BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= XP_031327207.1 uncharacterized protein LOC116182841 [Photinus
pyralis]

Length=540
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q580B5_TRYB2  unnamed protein product                                 30.8    3.8  
GCK3_CAEEL  unnamed protein product                                   29.6    8.2  


>Q580B5_TRYB2 unnamed protein product
Length=4448

 Score = 30.8 bits (68),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 16/49 (33%), Positives = 24/49 (49%), Gaps = 1/49 (2%)

Query  39    DPDLQQFN-IVCNHKNNPKLQCGQVGRDDILKLREVFYKNPNKVIQDGI  86
             DP +Q  N I   HK+NP+ +C      D LK  E   +  N  + +G+
Sbjct  3391  DPQMQAVNWIKRQHKSNPRFECASFSDADFLKRLEFAIQYGNPFLFEGV  3439


>GCK3_CAEEL unnamed protein product
Length=596

 Score = 29.6 bits (65),  Expect = 8.2, Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 32/62 (52%), Gaps = 5/62 (8%)

Query  237  NIGFGSPATDVCSYCVRTQTKISMSQSSSEKQKISTELKVHKFRATQFHKLMKTEVPNTV  296
            +IG G+ AT   +YC+    K+++   + EK + S +   H+ +A     + +   PN V
Sbjct  113  SIGVGATATVFTAYCLPRNEKVAIKCINLEKCQTSVDELSHEIQA-----MSQCNHPNVV  167

Query  297  SY  298
            SY
Sbjct  168  SY  169



Lambda      K        H
   0.321    0.135    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6277420098


Query= XP_031327208.1 uncharacterized protein LOC116183038 [Photinus
pyralis]

Length=326
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q57TX9_TRYB2  unnamed protein product                                 28.5    9.7  


>Q57TX9_TRYB2 unnamed protein product
Length=584

 Score = 28.5 bits (62),  Expect = 9.7, Method: Compositional matrix adjust.
 Identities = 17/49 (35%), Positives = 22/49 (45%), Gaps = 3/49 (6%)

Query  80   HRSTNRNVDTADKEFFYCQLKSLNRFSGFCWLLSPEQKTLHTEVKSFSK  128
            HR       TA  +FFY  ++ LN    F  L SP    LH E++   K
Sbjct  502  HRDLGIMYGTAKNKFFYMYVQELNYLIRFFTLNSP---ILHGELEEMLK  547



Lambda      K        H
   0.321    0.135    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6277420098


Query= XP_031327209.1 holotricin-3-like [Photinus pyralis]

Length=128
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q584I6_TRYB2  unnamed protein product                                 36.6    0.003


>Q584I6_TRYB2 unnamed protein product
Length=641

 Score = 36.6 bits (83),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 37/85 (44%), Gaps = 2/85 (2%)

Query  18  YGHGSSGGY--DHHSGGGGYGQGGNYGQGGGHGVGGGHGVGGGHGVGGGHGVGGGHGVGG  75
           +G G+ GG+     S  GG+G G N    GG G G      GG G G      GG G G 
Sbjct  8   FGRGAPGGFGAPACSTAGGFGSGFNTATTGGFGAGANTATTGGFGAGANTATTGGFGAGA  67

Query  76  GHGLDSGYGQGGSHGQGGGYGQGGS  100
                 G+G G +    GG+G G +
Sbjct  68  NTVTTGGFGAGANTATTGGFGAGAN  92


 Score = 34.7 bits (78),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 24/73 (33%), Positives = 31/73 (42%), Gaps = 0/73 (0%)

Query  28   HHSGGGGYGQGGNYGQGGGHGVGGGHGVGGGHGVGGGHGVGGGHGVGGGHGLDSGYGQGG  87
            + +  GG+G G N    GG G G      GG G G      GG G G       G+G G 
Sbjct  104  NTATTGGFGAGANTATTGGFGAGANTATTGGFGAGANTATTGGFGAGANTATTGGFGAGA  163

Query  88   SHGQGGGYGQGGS  100
            +    GG+G G +
Sbjct  164  NTATTGGFGAGAN  176


 Score = 33.1 bits (74),  Expect = 0.041, Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 31/77 (40%), Gaps = 0/77 (0%)

Query  28   HHSGGGGYGQGGNYGQGGGHGVGGGHGVGGGHGVGGGHGVGGGHGVGGGHGLDSGYGQGG  87
            + +  GG+G G N    GG G G      GG G G      GG G G       G+G G 
Sbjct  80   NTATTGGFGAGANTVTTGGFGAGANTATTGGFGAGANTATTGGFGAGANTATTGGFGAGA  139

Query  88   SHGQGGGYGQGGSYGHD  104
            +    GG+G G +    
Sbjct  140  NTATTGGFGAGANTATT  156


 Score = 33.1 bits (74),  Expect = 0.047, Method: Compositional matrix adjust.
 Identities = 24/73 (33%), Positives = 31/73 (42%), Gaps = 0/73 (0%)

Query  28   HHSGGGGYGQGGNYGQGGGHGVGGGHGVGGGHGVGGGHGVGGGHGVGGGHGLDSGYGQGG  87
            + +  GG+G G N    GG G G      GG G G      GG G G       G+G G 
Sbjct  140  NTATTGGFGAGANTATTGGFGAGANTATTGGFGAGANTVTTGGFGAGANTATTGGFGAGA  199

Query  88   SHGQGGGYGQGGS  100
            +    GG+G G +
Sbjct  200  NTATTGGFGAGAN  212


 Score = 33.1 bits (74),  Expect = 0.047, Method: Compositional matrix adjust.
 Identities = 24/73 (33%), Positives = 31/73 (42%), Gaps = 0/73 (0%)

Query  28   HHSGGGGYGQGGNYGQGGGHGVGGGHGVGGGHGVGGGHGVGGGHGVGGGHGLDSGYGQGG  87
            + +  GG+G G N    GG G G      GG G G      GG G G       G+G G 
Sbjct  224  NTATTGGFGAGANTVTTGGFGAGANTATTGGFGAGANTATTGGFGAGANTATTGGFGAGA  283

Query  88   SHGQGGGYGQGGS  100
            +    GG+G G +
Sbjct  284  NTATTGGFGAGAN  296


 Score = 31.6 bits (70),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 31/77 (40%), Gaps = 0/77 (0%)

Query  28   HHSGGGGYGQGGNYGQGGGHGVGGGHGVGGGHGVGGGHGVGGGHGVGGGHGLDSGYGQGG  87
            + +  GG+G G N    GG G G      GG G G      GG G G       G+G G 
Sbjct  56   NTATTGGFGAGANTVTTGGFGAGANTATTGGFGAGANTVTTGGFGAGANTATTGGFGAGA  115

Query  88   SHGQGGGYGQGGSYGHD  104
            +    GG+G G +    
Sbjct  116  NTATTGGFGAGANTATT  132


 Score = 31.6 bits (70),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 31/77 (40%), Gaps = 0/77 (0%)

Query  28   HHSGGGGYGQGGNYGQGGGHGVGGGHGVGGGHGVGGGHGVGGGHGVGGGHGLDSGYGQGG  87
            + +  GG+G G N    GG G G      GG G G      GG G G       G+G G 
Sbjct  188  NTATTGGFGAGANTATTGGFGAGANTVTTGGFGAGANTATTGGFGAGANTVTTGGFGAGA  247

Query  88   SHGQGGGYGQGGSYGHD  104
            +    GG+G G +    
Sbjct  248  NTATTGGFGAGANTATT  264


 Score = 27.3 bits (59),  Expect = 3.7, Method: Compositional matrix adjust.
 Identities = 20/59 (34%), Positives = 24/59 (41%), Gaps = 0/59 (0%)

Query  28   HHSGGGGYGQGGNYGQGGGHGVGGGHGVGGGHGVGGGHGVGGGHGVGGGHGLDSGYGQG  86
            + +  GG+G G N    GG G G      GG G G      GG G G       G+G G
Sbjct  260  NTATTGGFGAGANTATTGGFGAGANTATTGGFGAGANTVTTGGFGAGANTATTGGFGSG  318


 Score = 27.3 bits (59),  Expect = 4.3, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 36/89 (40%), Gaps = 8/89 (9%)

Query  33   GGYGQGGNYGQGGGHGVGGGHGVGGGHGVGGGHGVGGGHGVGGGHGLDSGYGQGGSHGQG  92
            GG+G G N    GG G G      GG G G      GG G G       G+G G +    
Sbjct  217  GGFGAGANTATTGGFGAGANTVTTGGFGAGANTATTGGFGAGANTATTGGFGAGANTATT  276

Query  93   GGYGQGGSYGHDHHGSGYDHHGSGAGHHH  121
            GG+G G     +   +G    G GAG + 
Sbjct  277  GGFGAGA----NTATTG----GFGAGANT  297


 Score = 26.2 bits (56),  Expect = 9.9, Method: Compositional matrix adjust.
 Identities = 29/98 (30%), Positives = 37/98 (38%), Gaps = 8/98 (8%)

Query  28   HHSGGGGYGQGGNYGQGGGHGVGGGHGVGGGHGVGGGHGVGGGHGVGGGHGLDSGYGQGG  87
            + +  GG+G G N    GG G G      GG G G      GG G G       G+G G 
Sbjct  164  NTATTGGFGAGANTVTTGGFGAGANTATTGGFGAGANTATTGGFGAGANTVTTGGFGAGA  223

Query  88   SHGQGGGYGQGGSYGHDHHGSGYDHHGSGAGHHHGGGG  125
            +    GG+G G +             G GAG +    G
Sbjct  224  NTATTGGFGAGANT--------VTTGGFGAGANTATTG  253



Lambda      K        H
   0.321    0.135    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6277420098


Query= XP_031327210.1 uncharacterized protein LOC116158558 isoform X1
[Photinus pyralis]

Length=242
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SMG1_DROME  unnamed protein product                                   28.9    4.6  
Q389T9_TRYB2  unnamed protein product                                 28.1    7.6  


>SMG1_DROME unnamed protein product
Length=3218

 Score = 28.9 bits (63),  Expect = 4.6, Method: Composition-based stats.
 Identities = 14/32 (44%), Positives = 20/32 (63%), Gaps = 3/32 (9%)

Query  59    TFLFETQDDLHLGLKIVLLIGITG---ACRYD  87
             TFLF+  +DLHL  +I+  + I+    ACR D
Sbjct  1924  TFLFKGMEDLHLDERIMQFLSISNAIMACRSD  1955


>Q389T9_TRYB2 unnamed protein product
Length=520

 Score = 28.1 bits (61),  Expect = 7.6, Method: Compositional matrix adjust.
 Identities = 15/42 (36%), Positives = 24/42 (57%), Gaps = 1/42 (2%)

Query  87   DEMVKMKTTDIE-DMGNVVLIKIPDRKTRKVRSFTIIGENYI  127
            DE  ++ T D+E D+ +VV +  P R TR+   FT   E ++
Sbjct  154  DEADRLTTDDMEGDVSDVVELLQPPRPTRRTLLFTATLEQHL  195



Lambda      K        H
   0.321    0.135    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6277420098


Query= XP_031327211.1 uncharacterized protein LOC116158558 isoform X1
[Photinus pyralis]

Length=242
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SMG1_DROME  unnamed protein product                                   28.9    4.6  
Q389T9_TRYB2  unnamed protein product                                 28.1    7.6  


>SMG1_DROME unnamed protein product
Length=3218

 Score = 28.9 bits (63),  Expect = 4.6, Method: Composition-based stats.
 Identities = 14/32 (44%), Positives = 20/32 (63%), Gaps = 3/32 (9%)

Query  59    TFLFETQDDLHLGLKIVLLIGITG---ACRYD  87
             TFLF+  +DLHL  +I+  + I+    ACR D
Sbjct  1924  TFLFKGMEDLHLDERIMQFLSISNAIMACRSD  1955


>Q389T9_TRYB2 unnamed protein product
Length=520

 Score = 28.1 bits (61),  Expect = 7.6, Method: Compositional matrix adjust.
 Identities = 15/42 (36%), Positives = 24/42 (57%), Gaps = 1/42 (2%)

Query  87   DEMVKMKTTDIE-DMGNVVLIKIPDRKTRKVRSFTIIGENYI  127
            DE  ++ T D+E D+ +VV +  P R TR+   FT   E ++
Sbjct  154  DEADRLTTDDMEGDVSDVVELLQPPRPTRRTLLFTATLEQHL  195



Lambda      K        H
   0.321    0.135    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6277420098


Query= XP_031327212.1 uncharacterized protein LOC116158558 isoform X1
[Photinus pyralis]

Length=242
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SMG1_DROME  unnamed protein product                                   28.9    4.6  
Q389T9_TRYB2  unnamed protein product                                 28.1    7.6  


>SMG1_DROME unnamed protein product
Length=3218

 Score = 28.9 bits (63),  Expect = 4.6, Method: Composition-based stats.
 Identities = 14/32 (44%), Positives = 20/32 (63%), Gaps = 3/32 (9%)

Query  59    TFLFETQDDLHLGLKIVLLIGITG---ACRYD  87
             TFLF+  +DLHL  +I+  + I+    ACR D
Sbjct  1924  TFLFKGMEDLHLDERIMQFLSISNAIMACRSD  1955


>Q389T9_TRYB2 unnamed protein product
Length=520

 Score = 28.1 bits (61),  Expect = 7.6, Method: Compositional matrix adjust.
 Identities = 15/42 (36%), Positives = 24/42 (57%), Gaps = 1/42 (2%)

Query  87   DEMVKMKTTDIE-DMGNVVLIKIPDRKTRKVRSFTIIGENYI  127
            DE  ++ T D+E D+ +VV +  P R TR+   FT   E ++
Sbjct  154  DEADRLTTDDMEGDVSDVVELLQPPRPTRRTLLFTATLEQHL  195



Lambda      K        H
   0.321    0.135    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6277420098


Query= XP_031327213.1 uncharacterized protein LOC116158558 isoform X2
[Photinus pyralis]

Length=179
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SMG1_DROME  unnamed protein product                                   28.9    2.6  
Q389T9_TRYB2  unnamed protein product                                 28.1    5.4  
ADRO_DROME  unnamed protein product                                   27.3    7.1  


>SMG1_DROME unnamed protein product
Length=3218

 Score = 28.9 bits (63),  Expect = 2.6, Method: Composition-based stats.
 Identities = 14/32 (44%), Positives = 20/32 (63%), Gaps = 3/32 (9%)

Query  59    TFLFETQDDLHLGLKIVLLIGITG---ACRYD  87
             TFLF+  +DLHL  +I+  + I+    ACR D
Sbjct  1924  TFLFKGMEDLHLDERIMQFLSISNAIMACRSD  1955


>Q389T9_TRYB2 unnamed protein product
Length=520

 Score = 28.1 bits (61),  Expect = 5.4, Method: Compositional matrix adjust.
 Identities = 15/42 (36%), Positives = 24/42 (57%), Gaps = 1/42 (2%)

Query  87   DEMVKMKTTDIE-DMGNVVLIKIPDRKTRKVRSFTIIGENYI  127
            DE  ++ T D+E D+ +VV +  P R TR+   FT   E ++
Sbjct  154  DEADRLTTDDMEGDVSDVVELLQPPRPTRRTLLFTATLEQHL  195


>ADRO_DROME unnamed protein product
Length=466

 Score = 27.3 bits (59),  Expect = 7.1, Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 30/71 (42%), Gaps = 5/71 (7%)

Query  109  PDRKTRKVRSFTIIGENYIKIDRKYAALRPKDMLETRFFSKYQ-NGKCCRSVMGIHTISS  167
            PD   R V   TI+G+  + +D     L P D L+T   ++Y      C  V  +H +  
Sbjct  164  PDLSGRDV---TIVGQGNVAVDVARMLLSPLDALKTTDTTEYALEALSCSQVERVHLVGR  220

Query  168  VPGKTHFGYTI  178
              G     +TI
Sbjct  221  R-GPLQAAFTI  230



Lambda      K        H
   0.321    0.135    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6277420098


Query= XP_031327214.1 putative inorganic phosphate cotransporter [Photinus
pyralis]

Length=485
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8MRP7_DROME  unnamed protein product                                 269     1e-84
Q9VKC9_DROME  unnamed protein product                                 225     9e-68
Q9VPX2_DROME  unnamed protein product                                 220     1e-65


>Q8MRP7_DROME unnamed protein product
Length=497

 Score = 269 bits (688),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 160/484 (33%), Positives = 255/484 (53%), Gaps = 25/484 (5%)

Query  20   RKWYGTRHTQILLLFLISAIEFGTRIHLSVAIVAMTTANSS-ANPDVST-----------  67
             K++G RH Q +L F   A+ +  R++LSVA+VAMT  ++S A  + +T           
Sbjct  17   EKFFGVRHVQCILCFFCLAMSYAWRVNLSVALVAMTDNSTSLAQNNTNTGVAPSEPGFDF  76

Query  68   ------YNWSWTDHSVVLSSYYWGYVPPQLIAGHLVGRFGAKWFLLLSAFGGSLCAIIIP  121
                  YN++  +   + +S+++GY+  Q+  G++  R+GAK  L+      +L  ++ P
Sbjct  77   FNSERYYNFTQKEKGNLQASFFFGYIVTQVPGGYIAQRYGAKTMLMYGLGIAALITMLSP  136

Query  122  FLAAFGPWTVVVSRVVQGICHGFLCPCCHSMLAQWVPKFERARLTAFVYAGGPLGMVLSL  181
                FG   + V R V G+  G + P  H++LA+W P  ER  L    Y+G   G V+ L
Sbjct  137  MSLQFGWVALAVMRFVMGLAQGAVHPATHALLAKWSPADERGMLGTLCYSGAQFGTVVML  196

Query  182  ALSGWMCGCWLGWPLSFYAHGLVGLIWSILWIFVGRGSPAEHQGISREERIYIETSIDAG  241
            A SG++    LGWP  FY  G  G IW + W      +P EH+ IS  E  YI  S   G
Sbjct  197  ATSGFIADSVLGWPSIFYLGGACGFIWMVFWYLFSASTPEEHRLISPGELKYITDSRSDG  256

Query  242  D---KIRVTSTPWRSIFTSLPVWAILVGSCGEVWVLTTLMTNIPTFMANVLHFEIEENGL  298
                  ++  TPW++IF+SLP  ++LV  C  ++    L+  IPT+M  + H +I++  L
Sbjct  257  KMQSAEKLAPTPWKAIFSSLPFLSLLVVHCTHIFGYWLLLMQIPTYMKKIYHVDIKKGAL  316

Query  299  ISAGPFLVFWICSFGWGYLIDFIITRGIVSTSTARKIATGVALYTPGIGLFAMGLISGLN  358
            +S+ P++V  + SF + +L   +  +  +S S  RKI   +  + P + L A+G +    
Sbjct  317  LSSLPYMVMLLLSFFFVWLSKVLQKKEGMSLSFNRKIFNSIGHWIPMLSLIALGYVPA--  374

Query  359  FDVTAITLVILFVSVGIASGFLSGLQVNHIDLSPIHASTLIGLTNGTANILSVVAPLIVH  418
             D   + + +L ++VGI+     G QVNHIDLSP +A TL+G+TN  AN++S +AP+IV 
Sbjct  375  -DNAPLAVTLLTLTVGISGATYLGFQVNHIDLSPNYAGTLMGITNCAANVMSGIAPVIVG  433

Query  419  LIVVEATDPAQWGVLFYIASAICVTCTTFYVIFSSGETQTWNGTDTNSSSQKHQARSAPE  478
             IVV+ T   +W ++F +A+A        +VIF   E Q W+    N    +     AP 
Sbjct  434  QIVVDETSVTEWRLVFLLAAAFYFLGNLLFVIFGRTEVQWWDSPRDNKEDAEQGTPLAPN  493

Query  479  -QVR  481
             QV+
Sbjct  494  GQVK  497


>Q9VKC9_DROME unnamed protein product
Length=496

 Score = 225 bits (574),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 136/461 (30%), Positives = 237/461 (51%), Gaps = 26/461 (6%)

Query  34   FLISAIEFGTRIHLSVAIVAMTTANSSANPDVST----------------YNWSWTDHSV  77
            FL     +  R+ LS AI  +    +S + D                   + WS     +
Sbjct  28   FLAILNAYTMRVCLSQAITVLVVKKNSTDDDSEAICEPDDIDEGTSVGGDFEWSEELQGL  87

Query  78   VLSSYYWGYVPPQLIAGHLVGRFGAKWFLLLSAFGGSLCAIIIPFLAAFGPWT-VVVSRV  136
            +LSS+Y GY+   +  G L  +FG KW L L     ++  ++ P     G    ++V+RV
Sbjct  88   ILSSFYIGYIVTHIPGGLLAEKFGGKWTLGLGILSTAVFTMLTPLAINKGDSDWLIVTRV  147

Query  137  VQGICHGFLCPCCHSMLAQWVPKFERARLTAFVYAGGPLGMVLSLALSGWMCGCWLGWPL  196
            + G+  G   P    +LA WVP  ER +L A V  GG +G ++   LSG     + GW  
Sbjct  148  LMGLGEGTTFPALSVLLAAWVPANERGKLGALVLGGGQVGTIMGNLLSGVFIDAY-GWEF  206

Query  197  SFYAHGLVGLIWSILWIFVGRGSPAEHQGISREERIYIETSIDAGDKIR-VTSTPWRSIF  255
             FY  G +G++W  +++F+    P  H  I   ER Y+   I    +   +  TPW++I 
Sbjct  207  VFYFFGGLGVVWFAIFMFLCYSDPTSHPFIKPSEREYLVKEIGTISRNEDLPPTPWKAIL  266

Query  256  TSLPVWAILVGSCGEVWVLTTLMTNIPTFMANVLHFEIEENGLISAGPFLVFWICSFGWG  315
            T+LP++A++    G  W    ++T++P +MA+VL F I+ NGL S+ P+++ WI S G G
Sbjct  267  TNLPMFALVAAQIGHDWGFYIMVTDLPKYMADVLQFSIKANGLYSSLPYVMMWIVSVGSG  326

Query  316  YLIDFIITRGIVSTSTARKIATGVALYTPGIGLFAMGLISGLNFDVTAITLVILF-VSVG  374
            ++ D++I RG++ST+  RK+ TG+A + P     A+ ++         + +V+LF + +G
Sbjct  327  FVADWMIRRGVLSTTNTRKVMTGLAAFGP-----AIFMVGASYAGCDRVLVVVLFTICMG  381

Query  375  IASGFLSGLQVNHIDLSPIHASTLIGLTNGTANILSVVAPLIVHLIVVEATDPAQWGVLF  434
            +   + +G++++ +D+SP +A TL+ +TNG   I  V+ P +V ++   A+   +W ++F
Sbjct  382  LMGAYYAGMKLSPLDMSPNYAGTLMAITNGIGAITGVITPYLVGVMTPNAS-LLEWRLVF  440

Query  435  YIASAICVTCTTFYVIFSSGETQTWNGTDTNSSSQKHQARS  475
            ++A  +       Y I++SGE Q +N       S   +A+ 
Sbjct  441  WVAFGVLCFTAVIYCIWASGEVQPFNNAPIQPRSVDFEAQE  481


>Q9VPX2_DROME unnamed protein product
Length=512

 Score = 220 bits (561),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 143/515 (28%), Positives = 232/515 (45%), Gaps = 45/515 (9%)

Query  10   DTVAKDPPTLRKWYGTRHTQILLLFLISAIEFGTRIHLSVAIVAMTT-------------  56
            D V      L K    R+   LL  +  AI +G +++LSVA+VAM               
Sbjct  3    DEVPAKGSILGKLVPARYVLALLGSIGMAIVYGLKVNLSVAMVAMVNHTAIKAHGDGGGH  62

Query  57   --------------------------ANSSANPDVSTYNWSWTDHSVVLSSYYWGYVPPQ  90
                                      +N +A  +   ++WS      +LS Y+WGY+  Q
Sbjct  63   GGHGSVILSNASQVSLVEECNPPGGASNVTAKVEDGPFDWSEPLQGTLLSCYFWGYLVSQ  122

Query  91   LIAGHLVGRFGAKWFLLLSAFGGSLCAIIIPFLAAFGPWTVVVSRVVQGICHGFLCPCCH  150
            +   H+   F AKW +L S     +C ++ P         +++ RV++G+  G   P  H
Sbjct  123  IPLAHVAENFSAKWVMLFSVAINVVCTLLTPVFTELHYGGLILMRVLEGVGGGASFPAMH  182

Query  151  SMLAQWVPKFERARLTAFVYAGGPLGMVLSLALSGWMCGCWLGWPLSFYAHGLVGLIWSI  210
             M+A W P  ER  ++  +Y G   G  LS+ L+G +C    GW   FY  G +  IW +
Sbjct  183  VMIASWAPPTERMVMSTIIYVGTSAGTALSILLAG-VCSAQWGWESVFYVMGALSCIWML  241

Query  211  LWIFVGRGSPAEHQGISREERIYIETSIDAGDKIR-VTSTPWRSIFTSLPVWAILVGSCG  269
            LW+ + + +P + + IS EER  I +S+    K     + PW  +FTS+P WAIL+    
Sbjct  242  LWVILVQDNPNKQRFISLEERQMITSSLGTEQKTEHHPAVPWGKVFTSVPFWAILIAHTC  301

Query  270  EVWVLTTLMTNIPTFMANVLHFEIEENGLISAGPFLVFWICSFGWGYLIDFIITRGIVST  329
              +     +  IP +M  VL F +  N  +SA P+    I S   G L+D +  +G ++T
Sbjct  302  SNFGWYMFLIEIPFYMKQVLKFNVASNAALSALPYFPMIIFSICLGKLLDSLQAKGKITT  361

Query  330  STARKIATGVALYTPGIGLFAMGLISGLNFDVTAITLVILFVSVGIASGFLSGLQVNHID  389
            + ARK AT +    PG+ L  +  I   +++  ++  V +     + SGFLS    NHID
Sbjct  362  TVARKTATSICTLIPGVCLLVLCYIGCRHYEAVSVMSVGIVAMGSMFSGFLS----NHID  417

Query  390  LSPIHASTLIGLTNGTANILSVVAPLIVHLIVVEATDPAQWGVLFYIASAICVTCTTFYV  449
            ++P  A TL+ LTN  A +  +V PL V  +     +   W ++F +   +       +V
Sbjct  418  IAPNFAGTLVALTNTAATLPGIVVPLFVGFVTKGNQNIGAWRIIFGVTIVLFALEFLVFV  477

Query  450  IFSSGETQTWNGTDTNSSSQKHQARSAPEQVRLEP  484
               SG  Q WN   T    +    ++  +++  +P
Sbjct  478  FLGSGSEQPWNKAGTPKDPEAKDEKTPLKELPTKP  512



Lambda      K        H
   0.321    0.135    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6277420098


Query= XP_031327215.1 LOW QUALITY PROTEIN: cationic amino acid transporter
4 [Photinus pyralis]

Length=642
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VNP7_DROME  unnamed protein product                                 442     5e-148
Q54EJ9_DICDI  unnamed protein product                                 291     2e-90 
Q9VB75_DROME  unnamed protein product                                 82.4    3e-16 


>Q9VNP7_DROME unnamed protein product
Length=604

 Score = 442 bits (1136),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 244/601 (41%), Positives = 366/601 (61%), Gaps = 37/601 (6%)

Query  13   MSDLCSKMNRTKQLPRDVMETPLNRCLNTFDITLLGVGHMIGAGIYVLTGTVVRDIAGPG  72
            M++L   + R K    +  E+ L R LN FD+T LGVG  +G G+YVL G V  +IAGP 
Sbjct  1    MTNLWKALTRRKTEDVNEGESQLARVLNLFDLTALGVGSTLGLGVYVLAGQVAFNIAGPA  60

Query  73   IILSFLLAGLASLLSALCYAEFGTRVPKAGSAYIYTYVSIGEFWAFVIGWNIILEHMIGA  132
            + +SFL+A +AS  + +CYAEF  RVPKAGSAY+Y+YV+IGEF AF IGWN+ILE++IG 
Sbjct  61   VTISFLIAAIASAFAGICYAEFAARVPKAGSAYVYSYVTIGEFVAFTIGWNLILEYVIGT  120

Query  133  ASVARAWSGYVDSLFGGSISNATAKITGELHEELLGRYPDLLAFTVCVVYAILLGIGVKG  192
            ASVAR  SGY DSL   ++S A  + +  +  + LG YPD L+F + ++ A +L  G K 
Sbjct  121  ASVARGLSGYFDSLINNNMSKALNE-SMHIDVDFLGDYPDFLSFGMVLLLAAILAFGAKE  179

Query  193  SAMINSSLTVVNLAVMTLVTIVGFYYANANNWSSQN---------GGFLPYGFGGVLKGA  243
            S+ +N+  T VNL  + +V + G   AN +NW             GGF+P+G  GV+ GA
Sbjct  180  SSFLNNIFTTVNLVTIAIVLVAGAMNANVDNWRIPKKDVPEGFGTGGFMPFGIAGVMAGA  239

Query  244  ATCFYAFVGFDSIATSGEEARNPSFSIPIATVLSMCIVTVGYVLVCTALTLLVPYYMINP  303
            A CFY FVGFD IAT+GEEA NP  +IP++ V+S+ I+ + Y  V T LT+++PYY  + 
Sbjct  240  AKCFYGFVGFDCIATTGEEAINPKRNIPLSIVVSLIIIFLSYFGVSTVLTMMLPYYKQDK  299

Query  304  EAALPEAFANIGAQWVKYVVSLGAICGMTTTLFGSLFSLPRCMYAMASDGLLFGFLGNVN  363
            +A  P AF ++    +K++V++GA+  + T+L G++F LPR +YAM  DG+LF  L  VN
Sbjct  300  DAPFPHAFDSVEWYTIKWIVTIGAVFALCTSLLGAMFPLPRILYAMGKDGILFKRLSTVN  359

Query  364  SKIQIPLTNLIISGIASGLIALLFDLEKLVEFMSIGTLLAYTIVSASVIILRYRPPPMII  423
            S  + PL   I+SGI + ++A+LF+L++LV+ MSIGTLLAYTIV+  V++LRY+   M  
Sbjct  360  SYTKTPLLATIVSGIFASIMAMLFNLDQLVDMMSIGTLLAYTIVAICVLVLRYQDEEM--  417

Query  424  SRNNSSLVSETSATNSQATTPVSDIQMLVGTLKPQYNWLNPLFGQCEPGSVVTGAVFIFA  483
                + LVS           P    Q   G    + N +          S+    + +FA
Sbjct  418  ----TKLVS--------VKAPNVFRQFFNGNSFREPNSMT--------SSITKVGIVVFA  457

Query  484  CVSGALCALLQLYTKDLWNGIWWVILLILFFVLIMAGCMLVIIAHYQNIDAGLKFRVPMV  543
                  C+L +++  D   GI  + L+    +LI   C+++ +     I+  L F+VP+V
Sbjct  458  IFCLVWCSLQKVFDLDSTGGIVALSLVGAVLILI---CVVIGMQPVSTIE--LTFKVPLV  512

Query  544  PIIPALSIFCNLEXMAHLNILTWLRFLVWMIVGLLVYFLYGIHYSKEGESNSTYSMLMAS  603
            P +P LS+F NL  M  L++ TW+RFL+W+++G ++YF YG+  S +   + +++ + AS
Sbjct  513  PFVPCLSVFANLYLMFQLDLNTWIRFLIWIVIGYVIYFCYGMRNSTQISRSRSHAEVAAS  572

Query  604  S  604
            +
Sbjct  573  A  573


>Q54EJ9_DICDI unnamed protein product
Length=562

 Score = 291 bits (746),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 181/562 (32%), Positives = 286/562 (51%), Gaps = 66/562 (12%)

Query  32   ETPLNRCLNTFDITLLGVGHMIGAGIYVLTGTVVRDIAGPGIILSFLLAGLASLLSALCY  91
            E  LN+CL  FDI   G+G  +GAG++V  G  +   AGPG +LSFL + +A L+SA CY
Sbjct  52   EGNLNKCLTVFDIISYGIGSTVGAGVFVSIGIAISSYAGPGTLLSFLFSAIACLISAFCY  111

Query  92   AEFGTRVPKAGSAYIYTYVSIGEFWAFVIGWNIILEHMIGAASVARAWSGYVDSLFGGSI  151
            +EF  R+P +GSAY + YVS+GE+  + +GWN+ LE+ I A++VAR W GY   +F    
Sbjct  112  SEFSARIPASGSAYTFAYVSLGEYMGWFVGWNLTLEYAISASAVARGWVGYFSVIFSIFG  171

Query  152  SNATAKITGELHEELLGRYPDLLAFTVCVVYAILLGIGVKGSAMINSSLTVVNLAVMTLV  211
            +     I G    + +   P  +A  + V   I+L  G+K SA  N  +T +N+  +   
Sbjct  172  AKTPQFIQGYQINDWININP--IAPLIIVFCTIILVFGIKDSARFNMIITCINILTILFF  229

Query  212  TIVGFYYANANNWSSQNGGFLPYGFGGVLKGAATCFYAFVGFDSIATSGEEARNPSFSIP  271
             ++G  Y    NW+     FLP+GF GV    +  F+++VGFDS+ T   E +NP   +P
Sbjct  230  IVLGSIYVKVENWTP----FLPFGFDGVFNACSVVFFSYVGFDSVTTLAGEVKNPKRDLP  285

Query  272  IATVLSMCIVTVGYVLVCTALTLLVPYYMINPEAALPEAFANIG--AQWVKYVVSLGAIC  329
            I  + S+ I T  Y+ V   L+ +V +  ++  + L +AF + G   +W   +++ G + 
Sbjct  286  IGVIGSLVIATSLYIGVTLVLSGMVNFREVSQGSPLSDAFIHNGLDMKWAAMIIAFGTLT  345

Query  330  GMTTTLFGSLFSLPRCMYAMASDGLLFGFLGNVNSKIQIPLTNLIISGIASGLIALLFDL  389
             +T +    L   PR    MA DGL F   G +N K Q+P+  ++ +   + L+A++ DL
Sbjct  346  SLTASTLCCLIGQPRIYLQMAKDGLFFKKFGELNKK-QVPVFGILFTCGFASLLAIVLDL  404

Query  390  EKLVEFMSIGTLLAYTIVSASVIILRYRPPPMIISRNNSSLVSETSATNSQATTPVSDIQ  449
            + L   +SIGTLLA+T V A V+++RYR              +E  + N     P+    
Sbjct  405  DNLTNMISIGTLLAFTCVCAGVVVMRYR--------------NEDGSENG----PI----  442

Query  450  MLVGTLKPQYNWLNPLFGQCEPGSVVTGAVFIFACVSGALCALLQLYTKDLWNGIWWVIL  509
                                 P ++V   +F+ ACV GA            +NG  W I 
Sbjct  443  ---------------------PSTLVLFVLFVVACVFGAAS----------YNG--WKIW  469

Query  510  LILFFVLIMAGCMLVIIAHYQNIDAGL--KFRVPMVPIIPALSIFCNLEXMAHLNILTWL  567
            + +   +I    ++++    Q +D      F  P+VPIIP L I  N   + HL+  +++
Sbjct  470  IQIVLAVIQLALIILLCFKKQTLDKSTCNYFLCPLVPIIPCLGIIINTYFIMHLDSASFI  529

Query  568  RFLVWMIVGLLVYFLYGIHYSK  589
            R  +W +VG +VYF+Y I  SK
Sbjct  530  RMAIWTVVGTIVYFVYSIRNSK  551


>Q9VB75_DROME unnamed protein product
Length=517

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 98/412 (24%), Positives = 188/412 (46%), Gaps = 32/412 (8%)

Query  22   RTKQLPRDVMETPLNRCLNTFDITLLGVGHMIGAGIYVLTGTVVRDIAGPGI-ILSFLLA  80
            R      D     + + L   +   + +G + G+GI+V    V+R++   G  ++ ++L 
Sbjct  42   REGSAESDSSRVVIKKQLGLLEGVAIILGIIFGSGIFVSPKGVIREVESVGASLVIWVLC  101

Query  81   GLASLLSALCYAEFGTRVPKAGSAYIYTYVSIGEFWAFVIGWNIILEHM-IGAASVARAW  139
            GL S++ ALCYAE GT +PK+G  Y Y + + G   AF+  W+ ++  +    A +   +
Sbjct  102  GLLSMIGALCYAELGTAIPKSGGDYAYIFEAYGSLPAFLYLWDAMMIFVPTTNAIMGLTF  161

Query  140  SGYV-DSLFGGSISNATAKITGELHEELLGRYPDLLAFTVCVVYAILLGIGVKGSAMINS  198
            + YV +  FGG+      KI  +L          L A T+C +   L    +K +  + +
Sbjct  162  ASYVLEPFFGGACE--IPKIALQL----------LAAITICFL-TYLNSYYMKVTTKMQN  208

Query  199  SLTVVNLAVMTLVTIVGFYY---ANANNWSS--QNGGFLPYGFGGVLKGAATCFYAFVGF  253
             +    +A + L+ +VG  +    N  N++    N    P   G +     +  +++ G+
Sbjct  209  VIMFTKIAALVLIILVGLVWMMMGNVENFTRPFDNTETDP---GKMSVAFYSGIFSYAGW  265

Query  254  DSIATSGEEARNPSFSIPIATVLSMCIVTVGYVLVCTA-LTLLVPYYMINPEA---ALPE  309
            + +    EE R+P  ++P A  +S+ +VT  YVL   A L +L P  MI   A      +
Sbjct  266  NYLNFMTEELRDPYRNLPRAIYISLPLVTGIYVLANVAYLAVLSPSEMIASNAIAVTFGD  325

Query  310  AFANIGAQWVKYVVSLGAICGMTTTLFGSLFSLPRCMYAMASDGLLFGFLGNVNSKIQIP  369
                + +  +  +V++ A  G++  +  S     R  +  A +G +   L +++ K   P
Sbjct  326  KILGVFSLIIPLMVAISAFGGLSVHIMTS----SRICFVGARNGHMPAILSHISVKSYTP  381

Query  370  LTNLIISGIASGLIALLFDLEKLVEFMSIGTLLAYTIVSASVIILRYRPPPM  421
            L +L+     S ++ ++ D+  L+ + SI       +  ++V+  RY  P M
Sbjct  382  LPSLVFLCFLSIVMLVVSDVYVLITYASIVESFFIMLSVSAVLYFRYTRPCM  433



Lambda      K        H
   0.321    0.135    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6277420098


Query= XP_031327216.1 neprilysin-2-like isoform X1 [Photinus pyralis]

Length=681
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

NEP2_DROME  unnamed protein product                                   181     6e-48
NEP4_DROME  unnamed protein product                                   118     4e-27
NEPL2_CAEEL  unnamed protein product                                  117     4e-27


>NEP2_DROME unnamed protein product
Length=774

 Score = 181 bits (458),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 168/700 (24%), Positives = 292/700 (42%), Gaps = 87/700 (12%)

Query  58   CGTPECMQIAARVLEHLDKDVDPCEDFYRFACGKVANVTSTENYPK--------RLLKNK  109
            C T EC+  A+ VL  +  +V+PC++FY FACG        EN P          ++ +K
Sbjct  84   CLTQECIHTASTVLRKMKPEVEPCDNFYEFACG---TYLEEENIPDDKVSISTFSVISDK  140

Query  110  ISQRLQELLEEPIDETDSPIFNYEKDFYSACIADKKGAQSL--KTLKEIFNDLNGWPLVV  167
            + ++L++++     ET+   F      Y AC+ +K   ++L  + +  +   L GWPL+ 
Sbjct  141  LQEQLKDIITAERPETEPKHFRLPNLLYKACM-NKTLIETLGPEPITRVAERLGGWPLIK  199

Query  168  GSSWE-EQSFDWLEWVSKFRKYGLRHDQILGFDVMVDSINPMKQIVKLYPPPYM----GM  222
            G SW  + S+ W E V KFR  G   D I+ F + VD  N  K+++ L           +
Sbjct  200  GDSWNADDSWTWQEQVKKFRTAGFSMDYIIDFSIGVDLQNSTKRLIDLDQSSLALSREYL  259

Query  223  PKGVKE------------VAVMFGANDDVTLDREIGDMLDFMKKIQEIRVKHINYTHEPP  270
             KG  E            +AV+FGAN D+    E+   L+F     E+ + +I++ +E  
Sbjct  260  VKGFNETLVTAYYKYMVDIAVLFGANRDLA-KTELLLSLEF-----EMALANISWPNEKR  313

Query  271  --TRALAN-----EFQEKHKDLDWLHYINSLTEPEHTIRPDDYLEFMYTDCVKTALELVR  323
              +  L N     + Q  +  + W+ Y+N+L      +  D+ +        +   +L+ 
Sbjct  314  RNSSELYNLRTPAQLQAAYPYVQWVDYMNALLPEGLNVAEDEMINLSVPSFFEDLGKLLA  373

Query  324  ASPKRTVANYMFWR----AVDDL----------YSIIISESLDIYDMKRTRVDICK----  365
             +PKR +ANYMFWR    +V  L          Y+  +S   +     +  VDI      
Sbjct  374  KTPKRVIANYMFWRIHGFSVGFLSEEFRKRQLQYATALSGRQEQEARWKECVDIATSSMD  433

Query  366  EILRYNFSPWSSFVA--YGKKFLTNNSRERATVIFNHVKREFKRLFNINKWMTEGDKQKF  423
            E+   +F      V   Y  K    +S+  A  + N ++  F  + +   WM    K++ 
Sbjct  434  EVCEDDFDSLGISVGSLYVGKHFHKDSKANALEMVNEIRNVFNDILDEVNWMDAKTKKEA  493

Query  424  RYKFNTMTEIVGITNDTIIHSTYHDLFKDNLIPKDGFLKMYLNLKTTLNTLS-NNARFQQ  482
            + K ++M   +G  ++ + +      +    I  D + + +L +       S N  R   
Sbjct  494  KLKLHSMATHIGYPDEMLDNEKLAAYYAKLDIDPDKYFESFLGMNIFGTDYSFNKLRLPV  553

Query  483  HSQDWRYLQFLLDTDTIYFGTQNAIMLPIGALQDWYYDEYGPMYVNFAT----IGKNLAV  538
            +  DW         +  Y   +N+I  P G LQ  +++   P Y+NF      IG  +  
Sbjct  554  NKTDWVRHARPAIVNAFYSSLENSIQFPAGILQGHFFNAQRPKYMNFGAIGYVIGHEITH  613

Query  539  TFAKVITSIDVAFEEKIRWSEETLKNYEEETNC-VEQ-----KEVKSLMVQYYDYKILEL  592
             F       DV    +  W  +T K Y  +  C +EQ     +    L +   + +   +
Sbjct  614  GFDDQGRQFDVKGNLRDWWHPDTQKAYLAKAKCIIEQYGNYTERATGLNLNGINTQGENI  673

Query  593  GQIVGLKVAYNAYKKWVEENEEELPAKGTGYSTNQLFWIIALTDSCFE------------  640
                G+K +Y AY++W E++  E    G  Y+  Q+FW+ A    C +            
Sbjct  674  ADNGGVKESYIAYRRWAEKHGPEAKLPGLDYTPEQMFWVAAGQTWCAKYRKESLKMRITT  733

Query  641  DAYDFNFFVHNEPIQRNPNFASDFSCSTNAKMNPPKKCSL  680
              +  + F     +    +FA DF C   + MNP +KC +
Sbjct  734  GVHSPSEFRVLGSLSNMKDFAKDFHCPEGSPMNPVQKCEV  773


>NEP4_DROME unnamed protein product
Length=1040

 Score = 118 bits (295),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 142/637 (22%), Positives = 267/637 (42%), Gaps = 133/637 (21%)

Query  134   KDFYSACIAD----KKGAQSLKTLKEIFNDLNGWPLVVGSSWEEQSFDWLEWVSKFRKYG  189
             K+ Y +C+      K+G + L TL     +L GWP V+ S W E +F+W    +  R+Y 
Sbjct  446   KNLYRSCVNSAVLAKRGLEPLHTL---IRELGGWP-VLESQWSESNFNWQVLAATLRRYN  501

Query  190   LRHDQILGFDVMVDSINPMKQIVKLYPPPYMGMP------------------KGVKEVAV  231
               +D ++   V  D  N  + IV+ +    +G+P                  + + EV  
Sbjct  502   --NDILIVQWVGADIKNSEENIVQ-FDQTGLGLPTREYFLQPSNAKYLQAYQRYMAEVMH  558

Query  232   MFGANDDVTLDREIGDMLDFMKKIQEIRV---KHINYTHEPPTRALANEFQEKHKDLDWL  288
               GA+      R   +++ F  ++  I     + +N T +   R   ++ Q    ++ W 
Sbjct  559   KMGASK-ADAQRVASELVAFETQLAGITAPAEQRLNVT-KLYKRMTLDQLQAVVPEIKWR  616

Query  289   HYINSLTEPEHTIRPDDYLEFMYTDCVKTALELVRASPKRTVANYMFWR-------AVDD  341
              Y+ SL + E  +   + +     + +   + L+  +  RTV+NYM WR        VDD
Sbjct  617   AYLQSLQDRE--VLGTEEVVIYAVEYMSKLVTLLDETDPRTVSNYMMWRFVRHRINNVDD  674

Query  342   LYSIIISE---SLDIYDMKRTRVDICKEILRYNF--SPWSSFVAYGKKFLTNNSRERATV  396
              +  I      +L   +    R  +C   +  N   +  S FV+   ++  NNS+     
Sbjct  675   RFDDIKQSFYHALFGREESPQRWKVCIAQVNTNMGMAVGSMFVS---RYFDNNSKRDTLR  731

Query  397   IFNHVKREFKRLFNINKWMTEGDKQKFRYKFNTMTEIVG----ITNDTIIHSTYHDLFKD  452
             + + +++ F+ +     W+ +  KQ    K N M+  +G    I N + ++S Y  +   
Sbjct  732   MTHDLQQAFRDILKTTDWLDDTTKQLAEEKVNAMSLKIGYPDFILNPSELNSKYAGI---  788

Query  453   NLIPKDGFLKMYLNLKTTLNTLSNNARFQQ-------HSQDWRYLQFLLDTDTIYFGTQN  505
              + P+  F       + TLN L + A+ +Q       +  +W+    +++    Y   +N
Sbjct  789   EIYPEKYF-------ENTLNVLLHTAKTEQAKLHERVNKTNWQTAPAIVNA--YYSRNKN  839

Query  506   AIMLPIGALQDWYYDEYGPMYVNFATIGKNLAVTFAKVITSIDVAFEEKIR---------  556
              IM P G LQ  +Y  + P  +NF  IG    V     +T     F++K R         
Sbjct  840   QIMFPAGILQPPFYHRHFPKSLNFGGIG----VVIGHELTH---GFDDKGRLFDRNGNIH  892

Query  557   --WSEETLKNYEEETNCVEQKEVKSLMVQYYDYKILELGQIV--------------GLKV  600
               W++ +++ ++E   C+        + QY +Y + E+G ++              GL+ 
Sbjct  893   KWWTDSSIRGFDERARCI--------IAQYSNYTVEEVGIVLNGESTQGENIADNGGLRQ  944

Query  601   AYNAYKKWVEENEEELPAK---GTGYSTNQLF-------WIIALTDSCFEDAYDFNFFVH  650
             A++AY++W++E+  E+  +   G   +  QLF       W  A+      +    N  +H
Sbjct  945   AFHAYQRWLKEHPSEVSDEILPGLNMTGPQLFFLNFGQVWCGAMRPEAIRN--KLNTAIH  1002

Query  651   NE-------PIQRNPNFASDFSCSTNAKMNPPKKCSL  680
             +         +  + +FA +F+C   + MNP KKCS+
Sbjct  1003  SPGRFRVIGTLSNSVDFAREFNCPLGSPMNPQKKCSV  1039


 Score = 36.2 bits (82),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 23/34 (68%), Gaps = 2/34 (6%)

Query  59   GTPECMQI--AARVLEHLDKDVDPCEDFYRFACG  90
            GT E +++  A  +  ++D  VDPC DFY++ACG
Sbjct  253  GTREGIRMTQAKTMKRYMDNKVDPCVDFYKYACG  286


>NEPL2_CAEEL unnamed protein product
Length=736

 Score = 117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 152/708 (21%), Positives = 286/708 (40%), Gaps = 108/708 (15%)

Query  57   TCGTPECMQIAARVLEHLDKDVDPCEDFYRFACGK-VANVTSTENYPKRLLKNKISQRLQ  115
             C +P C++ A+ +L  ++  VDPC+DFY FACG+ +      ++ P       + Q L+
Sbjct  52   VCLSPGCIKTASVILSSMNSSVDPCDDFYEFACGQWIKGHPIPDDAPSVSNFENLGQDLE  111

Query  116  ELLEEPIDETDSPIFNYE-------KDFYSACIADKKGAQSLK-TLKEIFNDLNGWPLVV  167
              L+E +DE D P ++YE       K FY+ C+ + +   + + T  E+     GWP + 
Sbjct  112  FALKELLDENDEP-YDYETSAVGKAKYFYNLCLNESEILDNWRTTFDEVVKSFGGWPSLG  170

Query  168  GSSWEEQSFDWL--EWVSKFRKYGLRHDQILGFDVMVDSINPMKQIVKLYPPPY------  219
                 + S + L  + V+KF+      D +    V  D  N  + ++ +  P        
Sbjct  171  HQMKPDASIEMLYADMVAKFKA-----DSLFKATVQPDDKNSQRHVLLIDQPQLNLFARD  225

Query  220  ----------MGMPKGVKEVAVMFGAN-DDVTLDREIGDMLDFMKKIQEIRV--KHINYT  266
                      M   + +++V ++  A+    TLD +  +++DF   +  I +  +H +  
Sbjct  226  FYVAAENEERMAYLQLIRDVLILLDADRTRATLDAK--EIIDFETALANITMADEHRHDI  283

Query  267  HEPPTRALANEFQEKHKDLDWLHYINSLTEPEH-----TIRPDDYLEFMY--TDCVKTAL  319
             E  T+    E +      +W  + N + +  H      I  DD  E +    + ++   
Sbjct  284  AELYTKITLGEMRRSLPHFNWPLFFNRMFKDLHEKNGKRITFDDNTEVVVYGYEFLRRLD  343

Query  320  ELVRASPKRTVANYMFW--------RAVDDLYSIII---SESLDIYDMKRTRVDICKEIL  368
             L+     R + NY+ W        R + D +++ I    ++L+I ++++ R   C  + 
Sbjct  344  VLIPQYDNRLIVNYLEWCWFFKTMLRDLPDPFALTIFKFYKTLNIMNVQKVRWHGC--VT  401

Query  369  RYN-FSPWSSFVAYGKKFLTNNSRERATVIFNHVKREFKRLFNINKWMTEGDKQKFRYKF  427
            R N   P ++   Y K    + ++++   + + +   F  L     W+T+  KQ  + K 
Sbjct  402  RINSLMPMATSAIYVKNHFDHEAKQQVEEMISLIMESFVDLLLSEDWLTKETKQTAKQKV  461

Query  428  NTMTEIVGIT---NDTIIHSTYHDLFKDNLIPKDGF-LKMYLNLKTTLNTLSNNARFQQH  483
            N M   +G     ND    +  +  FK  + P   +  K     +   + L    R  + 
Sbjct  462  NEMKRKIGYPDYLNDPAAVNNEYKTFK--VYPGHYYQTKFSFYEQYQRDVLE---RITEA  516

Query  484  SQDWRYLQFLLDTDTIYFGTQNAIMLPIGALQDWYYDEYGPMYVNFATIGKNLAVTFAKV  543
                R++      +  Y    N I+ P G LQ  +Y +  P  +NF  IG    V     
Sbjct  517  VDRERWVAGAALVNAFYSPNTNEIIFPAGILQPVFYSKDFPSSMNFGGIG----VVIGHE  572

Query  544  ITSIDVAFEEKIR-----------WSEETLKNYEEETNCVEQK------EVKSLMVQYYD  586
            IT     F+++ R           W   T+  +E +  C+E++      +  ++ +    
Sbjct  573  ITH---GFDDRGRLYDNLGNIRQWWDNATISKFEHKAQCIEKQYSSYVLDQINMQINGKS  629

Query  587  YKILELGQIVGLKVAYNAYKKWVEENEEELPAKGTGYSTNQLF-------WIIALTDSCF  639
             K   +    GLK AY AYKK+ + +       G   + +QLF       W   + D   
Sbjct  630  TKGENIADNGGLKQAYRAYKKYEKRHSRPPRLPGVNLTHDQLFFLNYAQIWCGTMNDK--  687

Query  640  EDAYDFNFFVHNE-------PIQRNPNFASDFSCSTNAKMNPPKKCSL  680
            E         H+        P+  + +FA  ++C   ++MNP +KC +
Sbjct  688  EAIRKLRTSEHSPGPIRVKGPLSNSYDFAKAYNCEPGSQMNPREKCRV  735



Lambda      K        H
   0.321    0.135    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6277420098


Query= XP_031327217.1 neprilysin-2-like isoform X2 [Photinus pyralis]

Length=678
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

NEP2_DROME  unnamed protein product                                   181     5e-48
NEPL2_CAEEL  unnamed protein product                                  117     4e-27
NEP4_DROME  unnamed protein product                                   117     5e-27


>NEP2_DROME unnamed protein product
Length=774

 Score = 181 bits (459),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 166/700 (24%), Positives = 290/700 (41%), Gaps = 87/700 (12%)

Query  55   CGTPECMQIAARVLEHLDKDVDPCEDFYRFACGKVANVTSTENYPK--------RLLKNK  106
            C T EC+  A+ VL  +  +V+PC++FY FACG        EN P          ++ +K
Sbjct  84   CLTQECIHTASTVLRKMKPEVEPCDNFYEFACG---TYLEEENIPDDKVSISTFSVISDK  140

Query  107  ISQRLQELLEEPIDETDSPIFNYEKDFYSACIADKKGAQSL--KTLKEIFNDLNGWPLVV  164
            + ++L++++     ET+   F      Y AC+ +K   ++L  + +  +   L GWPL+ 
Sbjct  141  LQEQLKDIITAERPETEPKHFRLPNLLYKACM-NKTLIETLGPEPITRVAERLGGWPLIK  199

Query  165  GSSWE-EQSFDWLEWVSKFRKYGLRHDQILGFDVMVDSINPMKQIVKLYPPPYM----GM  219
            G SW  + S+ W E V KFR  G   D I+ F + VD  N  K+++ L           +
Sbjct  200  GDSWNADDSWTWQEQVKKFRTAGFSMDYIIDFSIGVDLQNSTKRLIDLDQSSLALSREYL  259

Query  220  PKGVKE------------VAVMFGANDDVTLDREIGDMLDFMKKIQEIRVKHINYTHEPP  267
             KG  E            +AV+FGAN D+    E+   L+F     E+ + +I++ +E  
Sbjct  260  VKGFNETLVTAYYKYMVDIAVLFGANRDLA-KTELLLSLEF-----EMALANISWPNEKR  313

Query  268  TRA-------LANEFQEKHKDLDWLHYINSLTEPEHTIRPDDYLEFMYTDCVKTALELVR  320
              +          + Q  +  + W+ Y+N+L      +  D+ +        +   +L+ 
Sbjct  314  RNSSELYNLRTPAQLQAAYPYVQWVDYMNALLPEGLNVAEDEMINLSVPSFFEDLGKLLA  373

Query  321  ASPKRTVANYMFWR----AVDDL----------YSIIISESLDIYDMKRTRVDICK----  362
             +PKR +ANYMFWR    +V  L          Y+  +S   +     +  VDI      
Sbjct  374  KTPKRVIANYMFWRIHGFSVGFLSEEFRKRQLQYATALSGRQEQEARWKECVDIATSSMD  433

Query  363  EILRYNFSPWSSFVA--YGKKFLTNNSRERATVIFNHVKREFKRLFNINKWMTEGDKQKF  420
            E+   +F      V   Y  K    +S+  A  + N ++  F  + +   WM    K++ 
Sbjct  434  EVCEDDFDSLGISVGSLYVGKHFHKDSKANALEMVNEIRNVFNDILDEVNWMDAKTKKEA  493

Query  421  RYKFNTMTEIVGITNDTIIHSTYHDLFKDNLIPKDGFLKMYLNLKTTLNTLS-NNARFQQ  479
            + K ++M   +G  ++ + +      +    I  D + + +L +       S N  R   
Sbjct  494  KLKLHSMATHIGYPDEMLDNEKLAAYYAKLDIDPDKYFESFLGMNIFGTDYSFNKLRLPV  553

Query  480  HSQDWRYLQFLLDTDTIYFGTQNAIMLPIGALQDWYYDEYGPMYVNFAT----IGKNLAV  535
            +  DW         +  Y   +N+I  P G LQ  +++   P Y+NF      IG  +  
Sbjct  554  NKTDWVRHARPAIVNAFYSSLENSIQFPAGILQGHFFNAQRPKYMNFGAIGYVIGHEITH  613

Query  536  TFAKVITSIDVAFEEKIRWSEETLKNYEEETNC-VEQ-----KEVKSLMVQYYDYKILEL  589
             F       DV    +  W  +T K Y  +  C +EQ     +    L +   + +   +
Sbjct  614  GFDDQGRQFDVKGNLRDWWHPDTQKAYLAKAKCIIEQYGNYTERATGLNLNGINTQGENI  673

Query  590  GQIVGLKVAYNAYKKWVEENEEELPAKGTGYSTNQLFWIIALTDSCFE------------  637
                G+K +Y AY++W E++  E    G  Y+  Q+FW+ A    C +            
Sbjct  674  ADNGGVKESYIAYRRWAEKHGPEAKLPGLDYTPEQMFWVAAGQTWCAKYRKESLKMRITT  733

Query  638  DAYDFNFFVHNEPIQRNPNFASDFSCSTNAKMNPPKKCSL  677
              +  + F     +    +FA DF C   + MNP +KC +
Sbjct  734  GVHSPSEFRVLGSLSNMKDFAKDFHCPEGSPMNPVQKCEV  773


>NEPL2_CAEEL unnamed protein product
Length=736

 Score = 117 bits (294),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 152/708 (21%), Positives = 286/708 (40%), Gaps = 108/708 (15%)

Query  54   TCGTPECMQIAARVLEHLDKDVDPCEDFYRFACGK-VANVTSTENYPKRLLKNKISQRLQ  112
             C +P C++ A+ +L  ++  VDPC+DFY FACG+ +      ++ P       + Q L+
Sbjct  52   VCLSPGCIKTASVILSSMNSSVDPCDDFYEFACGQWIKGHPIPDDAPSVSNFENLGQDLE  111

Query  113  ELLEEPIDETDSPIFNYE-------KDFYSACIADKKGAQSLK-TLKEIFNDLNGWPLVV  164
              L+E +DE D P ++YE       K FY+ C+ + +   + + T  E+     GWP + 
Sbjct  112  FALKELLDENDEP-YDYETSAVGKAKYFYNLCLNESEILDNWRTTFDEVVKSFGGWPSLG  170

Query  165  GSSWEEQSFDWL--EWVSKFRKYGLRHDQILGFDVMVDSINPMKQIVKLYPPPY------  216
                 + S + L  + V+KF+      D +    V  D  N  + ++ +  P        
Sbjct  171  HQMKPDASIEMLYADMVAKFKA-----DSLFKATVQPDDKNSQRHVLLIDQPQLNLFARD  225

Query  217  ----------MGMPKGVKEVAVMFGAN-DDVTLDREIGDMLDFMKKIQEIRV--KHINYT  263
                      M   + +++V ++  A+    TLD +  +++DF   +  I +  +H +  
Sbjct  226  FYVAAENEERMAYLQLIRDVLILLDADRTRATLDAK--EIIDFETALANITMADEHRHDI  283

Query  264  HEPPTRALANEFQEKHKDLDWLHYINSLTEPEH-----TIRPDDYLEFMY--TDCVKTAL  316
             E  T+    E +      +W  + N + +  H      I  DD  E +    + ++   
Sbjct  284  AELYTKITLGEMRRSLPHFNWPLFFNRMFKDLHEKNGKRITFDDNTEVVVYGYEFLRRLD  343

Query  317  ELVRASPKRTVANYMFW--------RAVDDLYSIII---SESLDIYDMKRTRVDICKEIL  365
             L+     R + NY+ W        R + D +++ I    ++L+I ++++ R   C  + 
Sbjct  344  VLIPQYDNRLIVNYLEWCWFFKTMLRDLPDPFALTIFKFYKTLNIMNVQKVRWHGC--VT  401

Query  366  RYN-FSPWSSFVAYGKKFLTNNSRERATVIFNHVKREFKRLFNINKWMTEGDKQKFRYKF  424
            R N   P ++   Y K    + ++++   + + +   F  L     W+T+  KQ  + K 
Sbjct  402  RINSLMPMATSAIYVKNHFDHEAKQQVEEMISLIMESFVDLLLSEDWLTKETKQTAKQKV  461

Query  425  NTMTEIVGIT---NDTIIHSTYHDLFKDNLIPKDGF-LKMYLNLKTTLNTLSNNARFQQH  480
            N M   +G     ND    +  +  FK  + P   +  K     +   + L    R  + 
Sbjct  462  NEMKRKIGYPDYLNDPAAVNNEYKTFK--VYPGHYYQTKFSFYEQYQRDVLE---RITEA  516

Query  481  SQDWRYLQFLLDTDTIYFGTQNAIMLPIGALQDWYYDEYGPMYVNFATIGKNLAVTFAKV  540
                R++      +  Y    N I+ P G LQ  +Y +  P  +NF  IG    V     
Sbjct  517  VDRERWVAGAALVNAFYSPNTNEIIFPAGILQPVFYSKDFPSSMNFGGIG----VVIGHE  572

Query  541  ITSIDVAFEEKIR-----------WSEETLKNYEEETNCVEQK------EVKSLMVQYYD  583
            IT     F+++ R           W   T+  +E +  C+E++      +  ++ +    
Sbjct  573  ITH---GFDDRGRLYDNLGNIRQWWDNATISKFEHKAQCIEKQYSSYVLDQINMQINGKS  629

Query  584  YKILELGQIVGLKVAYNAYKKWVEENEEELPAKGTGYSTNQLF-------WIIALTDSCF  636
             K   +    GLK AY AYKK+ + +       G   + +QLF       W   + D   
Sbjct  630  TKGENIADNGGLKQAYRAYKKYEKRHSRPPRLPGVNLTHDQLFFLNYAQIWCGTMNDK--  687

Query  637  EDAYDFNFFVHNE-------PIQRNPNFASDFSCSTNAKMNPPKKCSL  677
            E         H+        P+  + +FA  ++C   ++MNP +KC +
Sbjct  688  EAIRKLRTSEHSPGPIRVKGPLSNSYDFAKAYNCEPGSQMNPREKCRV  735


>NEP4_DROME unnamed protein product
Length=1040

 Score = 117 bits (294),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 142/637 (22%), Positives = 267/637 (42%), Gaps = 133/637 (21%)

Query  131   KDFYSACIAD----KKGAQSLKTLKEIFNDLNGWPLVVGSSWEEQSFDWLEWVSKFRKYG  186
             K+ Y +C+      K+G + L TL     +L GWP V+ S W E +F+W    +  R+Y 
Sbjct  446   KNLYRSCVNSAVLAKRGLEPLHTL---IRELGGWP-VLESQWSESNFNWQVLAATLRRYN  501

Query  187   LRHDQILGFDVMVDSINPMKQIVKLYPPPYMGMP------------------KGVKEVAV  228
               +D ++   V  D  N  + IV+ +    +G+P                  + + EV  
Sbjct  502   --NDILIVQWVGADIKNSEENIVQ-FDQTGLGLPTREYFLQPSNAKYLQAYQRYMAEVMH  558

Query  229   MFGANDDVTLDREIGDMLDFMKKIQEIRV---KHINYTHEPPTRALANEFQEKHKDLDWL  285
               GA+      R   +++ F  ++  I     + +N T +   R   ++ Q    ++ W 
Sbjct  559   KMGASK-ADAQRVASELVAFETQLAGITAPAEQRLNVT-KLYKRMTLDQLQAVVPEIKWR  616

Query  286   HYINSLTEPEHTIRPDDYLEFMYTDCVKTALELVRASPKRTVANYMFWR-------AVDD  338
              Y+ SL + E  +   + +     + +   + L+  +  RTV+NYM WR        VDD
Sbjct  617   AYLQSLQDRE--VLGTEEVVIYAVEYMSKLVTLLDETDPRTVSNYMMWRFVRHRINNVDD  674

Query  339   LYSIIIS---ESLDIYDMKRTRVDICKEILRYNF--SPWSSFVAYGKKFLTNNSRERATV  393
              +  I      +L   +    R  +C   +  N   +  S FV+   ++  NNS+     
Sbjct  675   RFDDIKQSFYHALFGREESPQRWKVCIAQVNTNMGMAVGSMFVS---RYFDNNSKRDTLR  731

Query  394   IFNHVKREFKRLFNINKWMTEGDKQKFRYKFNTMTEIVG----ITNDTIIHSTYHDLFKD  449
             + + +++ F+ +     W+ +  KQ    K N M+  +G    I N + ++S Y  +   
Sbjct  732   MTHDLQQAFRDILKTTDWLDDTTKQLAEEKVNAMSLKIGYPDFILNPSELNSKYAGI---  788

Query  450   NLIPKDGFLKMYLNLKTTLNTLSNNARFQQ-------HSQDWRYLQFLLDTDTIYFGTQN  502
              + P+  F       + TLN L + A+ +Q       +  +W+    +++    Y   +N
Sbjct  789   EIYPEKYF-------ENTLNVLLHTAKTEQAKLHERVNKTNWQTAPAIVNA--YYSRNKN  839

Query  503   AIMLPIGALQDWYYDEYGPMYVNFATIGKNLAVTFAKVITSIDVAFEEKIR---------  553
              IM P G LQ  +Y  + P  +NF  IG    V     +T     F++K R         
Sbjct  840   QIMFPAGILQPPFYHRHFPKSLNFGGIG----VVIGHELTH---GFDDKGRLFDRNGNIH  892

Query  554   --WSEETLKNYEEETNCVEQKEVKSLMVQYYDYKILELGQIV--------------GLKV  597
               W++ +++ ++E   C+        + QY +Y + E+G ++              GL+ 
Sbjct  893   KWWTDSSIRGFDERARCI--------IAQYSNYTVEEVGIVLNGESTQGENIADNGGLRQ  944

Query  598   AYNAYKKWVEENEEELPAK---GTGYSTNQLF-------WIIALTDSCFEDAYDFNFFVH  647
             A++AY++W++E+  E+  +   G   +  QLF       W  A+      +    N  +H
Sbjct  945   AFHAYQRWLKEHPSEVSDEILPGLNMTGPQLFFLNFGQVWCGAMRPEAIRN--KLNTAIH  1002

Query  648   NE-------PIQRNPNFASDFSCSTNAKMNPPKKCSL  677
             +         +  + +FA +F+C   + MNP KKCS+
Sbjct  1003  SPGRFRVIGTLSNSVDFAREFNCPLGSPMNPQKKCSV  1039


 Score = 36.2 bits (82),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 23/34 (68%), Gaps = 2/34 (6%)

Query  56   GTPECMQI--AARVLEHLDKDVDPCEDFYRFACG  87
            GT E +++  A  +  ++D  VDPC DFY++ACG
Sbjct  253  GTREGIRMTQAKTMKRYMDNKVDPCVDFYKYACG  286



Lambda      K        H
   0.321    0.135    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6277420098


Query= XP_031327218.1 neprilysin-2-like isoform X3 [Photinus pyralis]

Length=618
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

NEP2_DROME  unnamed protein product                                   171     4e-45
NEP4_DROME  unnamed protein product                                   118     3e-27
NEPL2_CAEEL  unnamed protein product                                  109     1e-24


>NEP2_DROME unnamed protein product
Length=774

 Score = 171 bits (434),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 162/694 (23%), Positives = 286/694 (41%), Gaps = 87/694 (13%)

Query  1    MQIAARVLEHLDKDVDPCEDFYRFACGKVANVTSTENYPK--------RLLKNKISQRLQ  52
            +  A+ VL  +  +V+PC++FY FACG        EN P          ++ +K+ ++L+
Sbjct  90   IHTASTVLRKMKPEVEPCDNFYEFACG---TYLEEENIPDDKVSISTFSVISDKLQEQLK  146

Query  53   ELLEEPIDETDSPIFNYEKDFYSACIADKKGAQSL--KTLKEIFNDLNGWPLVVGSSWE-  109
            +++     ET+   F      Y AC+ +K   ++L  + +  +   L GWPL+ G SW  
Sbjct  147  DIITAERPETEPKHFRLPNLLYKACM-NKTLIETLGPEPITRVAERLGGWPLIKGDSWNA  205

Query  110  EQSFDWLEWVSKFRKYGLRHDQILGFDVMVDSINPMKQIVKLYPPPYMG----MPKGVKE  165
            + S+ W E V KFR  G   D I+ F + VD  N  K+++ L           + KG  E
Sbjct  206  DDSWTWQEQVKKFRTAGFSMDYIIDFSIGVDLQNSTKRLIDLDQSSLALSREYLVKGFNE  265

Query  166  ------------VAVMFGANDDVTLDREIGDMLDFMKKIQEIRVKHINYTHEPPTRA---  210
                        +AV+FGAN D+    E+   L+F     E+ + +I++ +E    +   
Sbjct  266  TLVTAYYKYMVDIAVLFGANRDLA-KTELLLSLEF-----EMALANISWPNEKRRNSSEL  319

Query  211  ----LANEFQEKHKDLDWLHYINSLTEPEHTIRPDDYLEFMYTDCVKTALELVRASPKRT  266
                   + Q  +  + W+ Y+N+L      +  D+ +        +   +L+  +PKR 
Sbjct  320  YNLRTPAQLQAAYPYVQWVDYMNALLPEGLNVAEDEMINLSVPSFFEDLGKLLAKTPKRV  379

Query  267  VANYMFWR----AVDDL----------YSIIISESLDIYDMKRTRVDICK----EILRYN  308
            +ANYMFWR    +V  L          Y+  +S   +     +  VDI      E+   +
Sbjct  380  IANYMFWRIHGFSVGFLSEEFRKRQLQYATALSGRQEQEARWKECVDIATSSMDEVCEDD  439

Query  309  FSPWSSFVA--YGKKFLTNNSRERATVIFNHVKREFKRLFNINKWMTEGDKQKFRYKFNT  366
            F      V   Y  K    +S+  A  + N ++  F  + +   WM    K++ + K ++
Sbjct  440  FDSLGISVGSLYVGKHFHKDSKANALEMVNEIRNVFNDILDEVNWMDAKTKKEAKLKLHS  499

Query  367  MTEIVGITNDTIIHSTYHDLFKDNLIPKDGFLKMYLNLKTTLNTLS-NNARFQQHSQDWR  425
            M   +G  ++ + +      +    I  D + + +L +       S N  R   +  DW 
Sbjct  500  MATHIGYPDEMLDNEKLAAYYAKLDIDPDKYFESFLGMNIFGTDYSFNKLRLPVNKTDWV  559

Query  426  YLQFLLDTDTIYFGTQNAIMLPIGALQDWYYDEYGPMYVNFAT----IGKNLAVTFAKVI  481
                    +  Y   +N+I  P G LQ  +++   P Y+NF      IG  +   F    
Sbjct  560  RHARPAIVNAFYSSLENSIQFPAGILQGHFFNAQRPKYMNFGAIGYVIGHEITHGFDDQG  619

Query  482  TSIDVAFEEKIRWSEETLKNYEEETNC-VEQ-----KEVKSLMVQYYDYKILELGQIVGL  535
               DV    +  W  +T K Y  +  C +EQ     +    L +   + +   +    G+
Sbjct  620  RQFDVKGNLRDWWHPDTQKAYLAKAKCIIEQYGNYTERATGLNLNGINTQGENIADNGGV  679

Query  536  KVAYNAYKKWVEENEEELPAKGTGYSTNQLFWIIALTDSCFE------------DAYDFN  583
            K +Y AY++W E++  E    G  Y+  Q+FW+ A    C +              +  +
Sbjct  680  KESYIAYRRWAEKHGPEAKLPGLDYTPEQMFWVAAGQTWCAKYRKESLKMRITTGVHSPS  739

Query  584  FFVHNEPIQRNPNFASDFSCSTNAKMNPPKKCSL  617
             F     +    +FA DF C   + MNP +KC +
Sbjct  740  EFRVLGSLSNMKDFAKDFHCPEGSPMNPVQKCEV  773


>NEP4_DROME unnamed protein product
Length=1040

 Score = 118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 143/639 (22%), Positives = 268/639 (42%), Gaps = 137/639 (21%)

Query  71    KDFYSACIAD----KKGAQSLKTLKEIFNDLNGWPLVVGSSWEEQSFDWLEWVSKFRKYG  126
             K+ Y +C+      K+G + L TL     +L GWP V+ S W E +F+W    +  R+Y 
Sbjct  446   KNLYRSCVNSAVLAKRGLEPLHTL---IRELGGWP-VLESQWSESNFNWQVLAATLRRYN  501

Query  127   LRHDQILGFDVMVDSINPMKQIVKLYPPPYMGMP------------------KGVKEVAV  168
               +D ++   V  D  N  + IV+ +    +G+P                  + + EV  
Sbjct  502   --NDILIVQWVGADIKNSEENIVQ-FDQTGLGLPTREYFLQPSNAKYLQAYQRYMAEVMH  558

Query  169   MFGANDDVTLDREIGDMLDFMKKIQEIRV---KHINYTHEPPTRALANEFQEKHKDLDWL  225
               GA+      R   +++ F  ++  I     + +N T +   R   ++ Q    ++ W 
Sbjct  559   KMGASK-ADAQRVASELVAFETQLAGITAPAEQRLNVT-KLYKRMTLDQLQAVVPEIKWR  616

Query  226   HYINSLTEPEHTIRPDDYLEFMYTDCVKTALELVRASPKRTVANYMFWR-------AVDD  278
              Y+ SL + E  +   + +     + +   + L+  +  RTV+NYM WR        VDD
Sbjct  617   AYLQSLQDRE--VLGTEEVVIYAVEYMSKLVTLLDETDPRTVSNYMMWRFVRHRINNVDD  674

Query  279   LYSIIIS---ESLDIYDMKRTRVDICKEILRYNFSPWSSFVAYGKKFLT---NNSRERAT  332
              +  I      +L   +    R  +C   +  N       +A G  F++   +N+ +R T
Sbjct  675   RFDDIKQSFYHALFGREESPQRWKVCIAQVNTNMG-----MAVGSMFVSRYFDNNSKRDT  729

Query  333   VIFNH-VKREFKRLFNINKWMTEGDKQKFRYKFNTMTEIVG----ITNDTIIHSTYHDLF  387
             +   H +++ F+ +     W+ +  KQ    K N M+  +G    I N + ++S Y  + 
Sbjct  730   LRMTHDLQQAFRDILKTTDWLDDTTKQLAEEKVNAMSLKIGYPDFILNPSELNSKYAGI-  788

Query  388   KDNLIPKDGFLKMYLNLKTTLNTLSNNARFQQ-------HSQDWRYLQFLLDTDTIYFGT  440
                + P+  F       + TLN L + A+ +Q       +  +W+    +++    Y   
Sbjct  789   --EIYPEKYF-------ENTLNVLLHTAKTEQAKLHERVNKTNWQTAPAIVNA--YYSRN  837

Query  441   QNAIMLPIGALQDWYYDEYGPMYVNFATIGKNLAVTFAKVITSIDVAFEEKIR-------  493
             +N IM P G LQ  +Y  + P  +NF  IG    V     +T     F++K R       
Sbjct  838   KNQIMFPAGILQPPFYHRHFPKSLNFGGIG----VVIGHELTH---GFDDKGRLFDRNGN  890

Query  494   ----WSEETLKNYEEETNCVEQKEVKSLMVQYYDYKILELGQIV--------------GL  535
                 W++ +++ ++E   C+        + QY +Y + E+G ++              GL
Sbjct  891   IHKWWTDSSIRGFDERARCI--------IAQYSNYTVEEVGIVLNGESTQGENIADNGGL  942

Query  536   KVAYNAYKKWVEENEEELPAK---GTGYSTNQLF-------WIIALTDSCFEDAYDFNFF  585
             + A++AY++W++E+  E+  +   G   +  QLF       W  A+      +    N  
Sbjct  943   RQAFHAYQRWLKEHPSEVSDEILPGLNMTGPQLFFLNFGQVWCGAMRPEAIRN--KLNTA  1000

Query  586   VHNE-------PIQRNPNFASDFSCSTNAKMNPPKKCSL  617
             +H+         +  + +FA +F+C   + MNP KKCS+
Sbjct  1001  IHSPGRFRVIGTLSNSVDFAREFNCPLGSPMNPQKKCSV  1039


 Score = 35.4 bits (80),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 18/27 (67%), Gaps = 0/27 (0%)

Query  1    MQIAARVLEHLDKDVDPCEDFYRFACG  27
            M  A  +  ++D  VDPC DFY++ACG
Sbjct  260  MTQAKTMKRYMDNKVDPCVDFYKYACG  286


>NEPL2_CAEEL unnamed protein product
Length=736

 Score = 109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 149/701 (21%), Positives = 282/701 (40%), Gaps = 108/701 (15%)

Query  1    MQIAARVLEHLDKDVDPCEDFYRFACGK-VANVTSTENYPKRLLKNKISQRLQELLEEPI  59
            ++ A+ +L  ++  VDPC+DFY FACG+ +      ++ P       + Q L+  L+E +
Sbjct  59   IKTASVILSSMNSSVDPCDDFYEFACGQWIKGHPIPDDAPSVSNFENLGQDLEFALKELL  118

Query  60   DETDSPIFNYE-------KDFYSACIADKKGAQSLK-TLKEIFNDLNGWPLVVGSSWEEQ  111
            DE D P ++YE       K FY+ C+ + +   + + T  E+     GWP +      + 
Sbjct  119  DENDEP-YDYETSAVGKAKYFYNLCLNESEILDNWRTTFDEVVKSFGGWPSLGHQMKPDA  177

Query  112  SFDWL--EWVSKFRKYGLRHDQILGFDVMVDSINPMKQIVKLYPPPY-------------  156
            S + L  + V+KF+      D +    V  D  N  + ++ +  P               
Sbjct  178  SIEMLYADMVAKFKA-----DSLFKATVQPDDKNSQRHVLLIDQPQLNLFARDFYVAAEN  232

Query  157  ---MGMPKGVKEVAVMFGAN-DDVTLDREIGDMLDFMKKIQEIRV--KHINYTHEPPTRA  210
               M   + +++V ++  A+    TLD +  +++DF   +  I +  +H +   E  T+ 
Sbjct  233  EERMAYLQLIRDVLILLDADRTRATLDAK--EIIDFETALANITMADEHRHDIAELYTKI  290

Query  211  LANEFQEKHKDLDWLHYINSLTEPEH-----TIRPDDYLEFMY--TDCVKTALELVRASP  263
               E +      +W  + N + +  H      I  DD  E +    + ++    L+    
Sbjct  291  TLGEMRRSLPHFNWPLFFNRMFKDLHEKNGKRITFDDNTEVVVYGYEFLRRLDVLIPQYD  350

Query  264  KRTVANYMFW--------RAVDDLYSIII---SESLDIYDMKRTRVDICKEILRYN-FSP  311
             R + NY+ W        R + D +++ I    ++L+I ++++ R   C  + R N   P
Sbjct  351  NRLIVNYLEWCWFFKTMLRDLPDPFALTIFKFYKTLNIMNVQKVRWHGC--VTRINSLMP  408

Query  312  WSSFVAYGKKFLTNNSRERATVIFNHVKREFKRLFNINKWMTEGDKQKFRYKFNTMTEIV  371
             ++   Y K    + ++++   + + +   F  L     W+T+  KQ  + K N M   +
Sbjct  409  MATSAIYVKNHFDHEAKQQVEEMISLIMESFVDLLLSEDWLTKETKQTAKQKVNEMKRKI  468

Query  372  GIT---NDTIIHSTYHDLFKDNLIPKDGF-LKMYLNLKTTLNTLSNNARFQQHSQDWRYL  427
            G     ND    +  +  FK  + P   +  K     +   + L    R  +     R++
Sbjct  469  GYPDYLNDPAAVNNEYKTFK--VYPGHYYQTKFSFYEQYQRDVLE---RITEAVDRERWV  523

Query  428  QFLLDTDTIYFGTQNAIMLPIGALQDWYYDEYGPMYVNFATIGKNLAVTFAKVITSIDVA  487
                  +  Y    N I+ P G LQ  +Y +  P  +NF  IG    V     IT     
Sbjct  524  AGAALVNAFYSPNTNEIIFPAGILQPVFYSKDFPSSMNFGGIG----VVIGHEITH---G  576

Query  488  FEEKIR-----------WSEETLKNYEEETNCVEQK------EVKSLMVQYYDYKILELG  530
            F+++ R           W   T+  +E +  C+E++      +  ++ +     K   + 
Sbjct  577  FDDRGRLYDNLGNIRQWWDNATISKFEHKAQCIEKQYSSYVLDQINMQINGKSTKGENIA  636

Query  531  QIVGLKVAYNAYKKWVEENEEELPAKGTGYSTNQLF-------WIIALTDSCFEDAYDFN  583
               GLK AY AYKK+ + +       G   + +QLF       W   + D   E      
Sbjct  637  DNGGLKQAYRAYKKYEKRHSRPPRLPGVNLTHDQLFFLNYAQIWCGTMNDK--EAIRKLR  694

Query  584  FFVHNE-------PIQRNPNFASDFSCSTNAKMNPPKKCSL  617
               H+        P+  + +FA  ++C   ++MNP +KC +
Sbjct  695  TSEHSPGPIRVKGPLSNSYDFAKAYNCEPGSQMNPREKCRV  735



Lambda      K        H
   0.321    0.135    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6277420098


Query= XP_031327219.1 oxytocin receptor-like isoform X1 [Photinus pyralis]

Length=412
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ANR_EISFE  unnamed protein product                                    247     5e-78
CTR2_OCTVU  unnamed protein product                                   239     7e-75
CTR1_OCTVU  unnamed protein product                                   232     3e-72


>ANR_EISFE unnamed protein product
Length=420

 Score = 247 bits (631),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 144/375 (38%), Positives = 200/375 (53%), Gaps = 56/375 (15%)

Query  11   NGTIENITRSGPTVDVENTTVDRDENLAKIEIATLAIIFLVTVLGNGTVLLALWTRRRYA  70
            N TI  +T S P          R+E LA +E+A  + I ++TV+GN  VL  + +  R+ 
Sbjct  22   NQTI--VTSSFPQTVSPGFLARRNEALAMVEVAVQSTILILTVVGNAAVLAMIVSLSRH-  78

Query  71   GRKKLSRMYFFILHLSVADLITAFLSVLPQLGWEVTYRFNGGVVLCKVVKFGQTLGPYLS  130
              K L RMY  I HLS ADL  A  ++LPQL W+VT+RF GG VLCK+VK+ Q +  Y S
Sbjct  79   --KDLGRMYTMIGHLSCADLFVAIFNLLPQLLWDVTHRFRGGRVLCKLVKYVQVVAMYAS  136

Query  131  AYILMATAIDRHQAICYPLTYCSWTSRRSKVMVWLAWAASLTFCIPQLTIFAYQEV--GP  188
            AY+LM+TA+DR+ AIC+P+   +WTS  +  +V  AW  +L F +PQL IF Y EV  G 
Sbjct  137  AYVLMSTAVDRYTAICHPMRSHTWTSTTAHYLVIGAWVLALVFAVPQLVIFDYVEVVPGS  196

Query  189  GVYDCWATFPQPWGAKAYVTWYGISVFIVPLLVLIVTYSCICREIWRSS-----------  237
            GVYDC   F   W    Y+TW+ ++V+++PL+VL   Y  IC  +W+S+           
Sbjct  197  GVYDCVDHFRPRWTLPVYITWFALAVYVIPLVVLATIYLRICVVVWKSANRKSTPMINVA  256

Query  238  ----------------------------------AGELGQRQRQNHQPKPLPGKKGPLIS  263
                                               G L +   Q    +        ++S
Sbjct  257  ARTSGATEQPSLDDASVSFNVADGGGVDLDPSGGGGSLSRHAAQLSHRQQQQQANNVVLS  316

Query  264  RAKINTVKQTVAVIVMHIVCSTPFISAQLWATWDPLASESPFLEGPAFTILTLLYSLNSC  323
            RAK  TVK T+ V++ ++VC  PF  + +W+ WDP    +PF EG    I  LL SLNSC
Sbjct  317  RAKTKTVKLTLTVVISYLVCWAPFFVSHIWSAWDP---HAPF-EGTEMVITLLLGSLNSC  372

Query  324  VNPWIYLAFNRELPR  338
            +NPWIYLAF+ +L R
Sbjct  373  INPWIYLAFSDQLRR  387


>CTR2_OCTVU unnamed protein product
Length=426

 Score = 239 bits (611),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 138/342 (40%), Positives = 194/342 (57%), Gaps = 30/342 (9%)

Query  22   PTVDVENTTVD----RDENLAKIEIATLAIIFLVTVLGNGTVLLALWTRRRYAGRKKLSR  77
            PT D  N T      RDE L KIEIA L   F + ++ N  VLL L  RR     KK+ R
Sbjct  26   PTTDFLNNTNSSHPIRDEKLVKIEIAVLGTCFTLAIINNLCVLLVLLWRR-----KKVRR  80

Query  78   MYFFILHLSVADLITAFLSVLPQLGWEVTYRFNGGVVLCKVVKFGQTLGPYLSAYILMAT  137
            M  FILHLS+ADLI AF ++LPQL W++T+RF  G  +C+ +K+ Q    YLS YIL+ T
Sbjct  81   MQMFILHLSIADLIVAFFNILPQLIWDITFRFMAGDAMCRFIKYAQMFSLYLSTYILIMT  140

Query  138  AIDRHQAICYPLTYCSWTSRRSKVMVWLAWAASLTFCIPQLTIFAYQEV--GPGVYDCWA  195
            A+DR++AIC+PL+  +WT       +++A+A +  F IPQ  +F  QEV  G G+YDCW 
Sbjct  141  AVDRYRAICHPLSNQTWTPCMVYCKIFIAYAIATIFSIPQAILFQMQEVNEGSGIYDCWV  200

Query  196  TFPQPWGAKAYVTWYGISVFIVPLLVLIVTYSCICREIWRSSAGELGQRQRQNHQPKPLP  255
             F   W   AY  +   +++++P+L+L  TY  IC  IW      +  ++  N +     
Sbjct  201  HFEPAWVLTAYALYIFFALYLIPILILFFTYGSICYTIWAKYRHAIKTKKDANTRYPQRR  260

Query  256  GKKGPLI--------SRAKINTVKQTVAVIVMHIVCSTPFISAQLWATWDPLASESPFLE  307
             KKG ++        S+AK+N+VK T AVIV +I+C +PF  +Q+W  +D        + 
Sbjct  261  KKKGVILRTHSVHGFSKAKLNSVKLTFAVIVTYIICWSPFFVSQIWWLFDETV-----VG  315

Query  308  GPAFTILTLLYSLNSCVNPWIYLAFNRE-----LP-RLLLRH  343
                 ++ L+  LNSC NPWIYL FNR      LP + L RH
Sbjct  316  NAGVVVILLMACLNSCTNPWIYLIFNRNYISNVLPCKCLRRH  357


>CTR1_OCTVU unnamed protein product
Length=397

 Score = 232 bits (591),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 129/330 (39%), Positives = 193/330 (58%), Gaps = 33/330 (10%)

Query  27   ENTTVDRDENLAKIEIATLAIIFLVTVLGNGTVLLALWTRRRYAGRKKLSRMYFFILHLS  86
            E   + R+++LA  E+ TLA++ ++TV+GN  VL+ L+ RR     KKL+RM+ FILHLS
Sbjct  34   ETQPIRRNQDLANAEVITLAVVIIITVIGNSIVLITLFQRR-----KKLTRMHLFILHLS  88

Query  87   VADLITAFLSVLPQLGWEVTYRFNGGVVLCKVVKFGQTLGPYLSAYILMATAIDRHQAIC  146
            V DL  AF + LPQ+ W++T+ F G  +LC++V + Q++  Y S+Y+L+ATAIDR+ AIC
Sbjct  89   VTDLFVAFFNNLPQMIWDITFLFLGTDLLCRLVTYLQSVAMYASSYVLVATAIDRYFAIC  148

Query  147  YPLTYCSWTSRRSKVMVWLAWAASLTFCIPQLTIFAYQEVGPGVYDCWATFPQPWGAKAY  206
            +PL+   WT+ R  VMV++AW  S  F  PQL I++ Q    G+  C ATF   W  K Y
Sbjct  149  HPLSSHKWTTARVHVMVFIAWMLSFLFSTPQLFIWSMQFSNIGL-TCQATFDPEWTLKFY  207

Query  207  VTWYGISVFIVPLLVLIVTYSCICREIWRSSAGELGQRQRQNHQ----------------  250
            +TW  ++++I+P + L + Y  +C  +W+     LG  + +N                  
Sbjct  208  ITWLTVAIWILPTIALTLFYGMMCFAVWKRGRSTLGSSRTRNRSFLTNRVSTRIGQSHLA  267

Query  251  ----PKPLPGKK---GPLISRAKINTVKQTVAVIVMHIVCSTPFISAQLWATWDPLASES  303
                 + + G+       ISRAK+ +V  T++V+    +C +PF   Q+WA WD  A  S
Sbjct  268  RGFSEEDMEGQSVNYNRGISRAKVRSVALTLSVVACCFICWSPFFVCQMWAAWDENAPYS  327

Query  304  PFLEGPAFTILTLLYSLNSCVNPWIYLAFN  333
                G  +TIL LL SLNSC NPWIY+ F+
Sbjct  328  ----GAIYTILLLLSSLNSCTNPWIYMIFS  353



Lambda      K        H
   0.321    0.135    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6277420098


Query= XP_031327220.1 oxytocin receptor-like isoform X2 [Photinus pyralis]

Length=405
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ANR_EISFE  unnamed protein product                                    247     7e-78
CTR2_OCTVU  unnamed protein product                                   240     3e-75
CTR1_OCTVU  unnamed protein product                                   233     1e-72


>ANR_EISFE unnamed protein product
Length=420

 Score = 247 bits (630),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 144/375 (38%), Positives = 200/375 (53%), Gaps = 56/375 (15%)

Query  11   NGTIENITRSGPTVDVENTTVDRDENLAKIEIATLAIIFLVTVLGNGTVLLALWTRRRYA  70
            N TI  +T S P          R+E LA +E+A  + I ++TV+GN  VL  + +  R+ 
Sbjct  22   NQTI--VTSSFPQTVSPGFLARRNEALAMVEVAVQSTILILTVVGNAAVLAMIVSLSRH-  78

Query  71   GRKKLSRMYFFILHLSVADLITAFLSVLPQLGWEVTYRFNGGVVLCKVVKFGQTLGPYLS  130
              K L RMY  I HLS ADL  A  ++LPQL W+VT+RF GG VLCK+VK+ Q +  Y S
Sbjct  79   --KDLGRMYTMIGHLSCADLFVAIFNLLPQLLWDVTHRFRGGRVLCKLVKYVQVVAMYAS  136

Query  131  AYILMATAIDRHQAICYPLTYCSWTSRRSKVMVWLAWAASLTFCIPQLTIFAYQEV--GP  188
            AY+LM+TA+DR+ AIC+P+   +WTS  +  +V  AW  +L F +PQL IF Y EV  G 
Sbjct  137  AYVLMSTAVDRYTAICHPMRSHTWTSTTAHYLVIGAWVLALVFAVPQLVIFDYVEVVPGS  196

Query  189  GVYDCWATFPQPWGAKAYVTWYGISVFIVPLLVLIVTYSCICREIWRSS-----------  237
            GVYDC   F   W    Y+TW+ ++V+++PL+VL   Y  IC  +W+S+           
Sbjct  197  GVYDCVDHFRPRWTLPVYITWFALAVYVIPLVVLATIYLRICVVVWKSANRKSTPMINVA  256

Query  238  ----------------------------------AGELGQRQRQNHQPKPLPGKKGPLIS  263
                                               G L +   Q    +        ++S
Sbjct  257  ARTSGATEQPSLDDASVSFNVADGGGVDLDPSGGGGSLSRHAAQLSHRQQQQQANNVVLS  316

Query  264  RAKINTVKQTVAVIVMHIVCSTPFISAQLWATWDPLASESPFLEGPAFTILTLLYSLNSC  323
            RAK  TVK T+ V++ ++VC  PF  + +W+ WDP    +PF EG    I  LL SLNSC
Sbjct  317  RAKTKTVKLTLTVVISYLVCWAPFFVSHIWSAWDP---HAPF-EGTEMVITLLLGSLNSC  372

Query  324  VNPWIYLAFNRELPR  338
            +NPWIYLAF+ +L R
Sbjct  373  INPWIYLAFSDQLRR  387


>CTR2_OCTVU unnamed protein product
Length=426

 Score = 240 bits (613),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 144/367 (39%), Positives = 203/367 (55%), Gaps = 31/367 (8%)

Query  22   PTVDVENTTVD----RDENLAKIEIATLAIIFLVTVLGNGTVLLALWTRRRYAGRKKLSR  77
            PT D  N T      RDE L KIEIA L   F + ++ N  VLL L  RR     KK+ R
Sbjct  26   PTTDFLNNTNSSHPIRDEKLVKIEIAVLGTCFTLAIINNLCVLLVLLWRR-----KKVRR  80

Query  78   MYFFILHLSVADLITAFLSVLPQLGWEVTYRFNGGVVLCKVVKFGQTLGPYLSAYILMAT  137
            M  FILHLS+ADLI AF ++LPQL W++T+RF  G  +C+ +K+ Q    YLS YIL+ T
Sbjct  81   MQMFILHLSIADLIVAFFNILPQLIWDITFRFMAGDAMCRFIKYAQMFSLYLSTYILIMT  140

Query  138  AIDRHQAICYPLTYCSWTSRRSKVMVWLAWAASLTFCIPQLTIFAYQEV--GPGVYDCWA  195
            A+DR++AIC+PL+  +WT       +++A+A +  F IPQ  +F  QEV  G G+YDCW 
Sbjct  141  AVDRYRAICHPLSNQTWTPCMVYCKIFIAYAIATIFSIPQAILFQMQEVNEGSGIYDCWV  200

Query  196  TFPQPWGAKAYVTWYGISVFIVPLLVLIVTYSCICREIWRSSAGELGQRQRQNHQPKPLP  255
             F   W   AY  +   +++++P+L+L  TY  IC  IW      +  ++  N +     
Sbjct  201  HFEPAWVLTAYALYIFFALYLIPILILFFTYGSICYTIWAKYRHAIKTKKDANTRYPQRR  260

Query  256  GKKGPLI--------SRAKINTVKQTVAVIVMHIVCSTPFISAQLWATWDPLASESPFLE  307
             KKG ++        S+AK+N+VK T AVIV +I+C +PF  +Q+W  +D        + 
Sbjct  261  KKKGVILRTHSVHGFSKAKLNSVKLTFAVIVTYIICWSPFFVSQIWWLFDETV-----VG  315

Query  308  GPAFTILTLLYSLNSCVNPWIYLAFNRE-----LPRLLLRHYTASNKNYRTTETGVVETT  362
                 ++ L+  LNSC NPWIYL FNR      LP   LR +        TTET  +   
Sbjct  316  NAGVVVILLMACLNSCTNPWIYLIFNRNYISNVLPCKCLRRHRVEVAA--TTETERLSLG  373

Query  363  SLRPFTR  369
            S+R  +R
Sbjct  374  SVRRDSR  380


>CTR1_OCTVU unnamed protein product
Length=397

 Score = 233 bits (593),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 136/366 (37%), Positives = 205/366 (56%), Gaps = 39/366 (11%)

Query  27   ENTTVDRDENLAKIEIATLAIIFLVTVLGNGTVLLALWTRRRYAGRKKLSRMYFFILHLS  86
            E   + R+++LA  E+ TLA++ ++TV+GN  VL+ L+ RR     KKL+RM+ FILHLS
Sbjct  34   ETQPIRRNQDLANAEVITLAVVIIITVIGNSIVLITLFQRR-----KKLTRMHLFILHLS  88

Query  87   VADLITAFLSVLPQLGWEVTYRFNGGVVLCKVVKFGQTLGPYLSAYILMATAIDRHQAIC  146
            V DL  AF + LPQ+ W++T+ F G  +LC++V + Q++  Y S+Y+L+ATAIDR+ AIC
Sbjct  89   VTDLFVAFFNNLPQMIWDITFLFLGTDLLCRLVTYLQSVAMYASSYVLVATAIDRYFAIC  148

Query  147  YPLTYCSWTSRRSKVMVWLAWAASLTFCIPQLTIFAYQEVGPGVYDCWATFPQPWGAKAY  206
            +PL+   WT+ R  VMV++AW  S  F  PQL I++ Q    G+  C ATF   W  K Y
Sbjct  149  HPLSSHKWTTARVHVMVFIAWMLSFLFSTPQLFIWSMQFSNIGL-TCQATFDPEWTLKFY  207

Query  207  VTWYGISVFIVPLLVLIVTYSCICREIWRSSAGELGQRQRQNHQ----------------  250
            +TW  ++++I+P + L + Y  +C  +W+     LG  + +N                  
Sbjct  208  ITWLTVAIWILPTIALTLFYGMMCFAVWKRGRSTLGSSRTRNRSFLTNRVSTRIGQSHLA  267

Query  251  ----PKPLPGKK---GPLISRAKINTVKQTVAVIVMHIVCSTPFISAQLWATWDPLASES  303
                 + + G+       ISRAK+ +V  T++V+    +C +PF   Q+WA WD  A  S
Sbjct  268  RGFSEEDMEGQSVNYNRGISRAKVRSVALTLSVVACCFICWSPFFVCQMWAAWDENAPYS  327

Query  304  PFLEGPAFTILTLLYSLNSCVNPWIYLAFNRELPRLLLRHYTASNKNYRTTETGVVETTS  363
                G  +TIL LL SLNSC NPWIY+ F+      + +H   +++     ET  V   S
Sbjct  328  ----GAIYTILLLLSSLNSCTNPWIYMIFS------VFQHRAKTSRFVNDEETTSVTVLS  377

Query  364  LRPFTR  369
             R   R
Sbjct  378  SRNDIR  383



Lambda      K        H
   0.321    0.135    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6277420098


Query= XP_031327221.1 U3 small nucleolar RNA-associated protein 6 homolog
[Photinus pyralis]

Length=574
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

E9AEW5_LEIMA  unnamed protein product                                 36.2    0.073
CRN_DROME  unnamed protein product                                    33.1    0.69 
STIP1_CAEEL  unnamed protein product                                  30.0    5.6  


>E9AEW5_LEIMA unnamed protein product
Length=631

 Score = 36.2 bits (82),  Expect = 0.073, Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 59/144 (41%), Gaps = 17/144 (12%)

Query  88   IKRIKTLYELALQRTNDVSLILAFFKFCKRVNYVHD-ASDAIARLVQLHADDPKVWQA--  144
            ++  +TLYE A++     S +         V +  D A++   + V LH DDPK+W    
Sbjct  459  MREARTLYEAAIEMNPSDSQLFTNLGVLHNVAHEFDEAAECFRKAVALHPDDPKMWNKLG  518

Query  145  ---ATNWH------AYDRK-DINAAL--AMFPKALEIHKDSQM-LYKERITLEIHSMVHN  191
               A   H      AY+R  DIN     AM+  A+     SQ  +   +I   I S    
Sbjct  519  ATLANGGHPDQALEAYNRALDINPGYVRAMYNMAVAYSNMSQYNMAARQIVKAIASQQGG  578

Query  192  IKSKDE-CITSIREVVDTIFTNIN  214
             K   E  I + R + D +   +N
Sbjct  579  TKPSGEGSIMATRNMWDLLRMTLN  602


>CRN_DROME unnamed protein product
Length=702

 Score = 33.1 bits (74),  Expect = 0.69, Method: Compositional matrix adjust.
 Identities = 86/410 (21%), Positives = 150/410 (37%), Gaps = 74/410 (18%)

Query  83   IEYKIIKRIKTLYELALQRTNDVSLILAFFKFCKRVNYVHDASDAIARLVQLHADDPKVW  142
            + YK I R + +YE  +    DV   + F +F +   ++H +     R V+   DD    
Sbjct  188  LRYKEIDRAREIYERFVYVHPDVKNWIKFARFEESHGFIHGSRRVFERAVEFFGDD----  243

Query  143  QAATNWHAYDRKDINAALAMFPKALEIHKDSQMLYKERI-------TLEIHSMV--HNIK  193
                    Y  + +  A A F +  + H  ++++YK  +       T E+      H  K
Sbjct  244  --------YIEERLFIAFARFEEGQKEHDRARIIYKYALDHLPKDRTQELFKAYTKHEKK  295

Query  194  SKD-----ECITSIREVVDTIFTNINDPNF-----YIELI-VQLEEHQFTLAIQDVIINK  242
              D     + I S R+         N  N+     Y+ LI  + +  Q     +  I N 
Sbjct  296  YGDRAGIEDVIVSKRKYQYEQEVAANPTNYDAWFDYLRLIEAEGDRDQIRETYERAISNV  355

Query  243  MTGDYYNNENIWHALAQRERRGIYQLVKLA-----NPEPATKSRTPKAKLEACFAKYLEG  297
                  N +N W       RR IY  +  A       E A ++R         +   LE 
Sbjct  356  PPA---NEKNFW-------RRYIYLWINYALYEELEAEDAERTRQ-------IYKTCLE-  397

Query  298  LSKVSQVTKPKLWALYLDFLIDLQQDTASANVLKQSTLKAALHSAYSEDCLLERHYIAW-  356
            L    Q T  KLW LY  F I  ++       L+++     L         L R YI   
Sbjct  398  LIPHKQFTFSKLWLLYAQFEIRCKE-------LQRARKALGLAIGMCPRDKLFRGYIDLE  450

Query  357  VTFAQDEDALEIAEKGTDAFPHSVELWELRLCKQILKGDTGKVNLVFKLSIINLKEKSLP  416
            +   + E    + EK  +  P +   W      + L GDT +   +F+L++   +   +P
Sbjct  451  IQLREFERCRMLYEKFLEFGPENCVTWMKFAELENLLGDTDRARAIFELAVQQPR-LDMP  509

Query  417  --LWQKIISYHLIMSHDDYIHLIYRDAVKQAKEISDDLKPKYIEWLALAK  464
              LW+  I + + +   +    +Y   +++ + +          W++ AK
Sbjct  510  ELLWKAYIDFEVALGETELARQLYERLLERTQHVK--------VWMSFAK  551


>STIP1_CAEEL unnamed protein product
Length=320

 Score = 30.0 bits (66),  Expect = 5.6, Method: Compositional matrix adjust.
 Identities = 34/162 (21%), Positives = 72/162 (44%), Gaps = 18/162 (11%)

Query  61   EKSLLKDIGLRRKKHKIFEKNNIEYKIIKRIKTLYELALQRTNDVSLILAFF--------  112
            EK   + +    K  ++  +   +YK+I +  +    A Q+ ND+SL + +F        
Sbjct  52   EKKFAECVQFCEKAVEVGRETRADYKLIAKAMSRAGNAFQKQNDLSLAVQWFHRSLSEFR  111

Query  113  --KFCKRVNYVHDASDAIARLVQLHADDPKVWQAATNWHA--YDRKDINAALAMFPKALE  168
              +  K+V  +     A  RL  ++   P++ Q   N     + + D   A+  + +A++
Sbjct  112  DPELVKKVKELEKQLKAAERLAYIN---PELAQEEKNKGNEYFKKGDYPTAMRHYNEAVK  168

Query  169  IHKDSQMLYKERITLEIHSMVHNIKSKDECITSIREVVDTIF  210
               ++ +LY  R    +  ++   ++ D+C T IR  +D+ F
Sbjct  169  RDPENAILYSNRAAC-LTKLMEFQRALDDCDTCIR--LDSKF  207



Lambda      K        H
   0.321    0.135    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6277420098


Query= XP_031327222.1 S-adenosylmethionine sensor upstream of mTORC1
[Photinus pyralis]

Length=302
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SAMTR_DROME  unnamed protein product                                  241     1e-78
STRM1_CAEEL  unnamed protein product                                  32.3    0.38 
Q9VCB8_DROME  unnamed protein product                                 32.0    0.80 


>SAMTR_DROME unnamed protein product
Length=302

 Score = 241 bits (615),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 125/301 (42%), Positives = 180/301 (60%), Gaps = 17/301 (6%)

Query  1    MANTQHLELSHFIKKVHENLRNDSKKYGIDKAWKEHCSKRD--MLDQYAAAMHELASKIW  58
            MA  +H  L+  +K  HE+LR  +K+YG   AW+EH S R+   L +YA AM +LA+ IW
Sbjct  1    MATEEHQRLASIVKSCHESLRQLTKEYGATAAWQEHTSPRNAKQLAEYAKAMKQLAA-IW  59

Query  59   ENNYAKENTAAFSRINWIFNYCNFYFYGEEI-LRQRLREKEI-------GLKINLTLDLP  110
            E N  K    A SRI W  +Y   YF+ E I L++R RE+ +       G    +   L 
Sbjct  60   ETNDGKVELQARSRIKWAIDYITKYFFTEGIYLQKRQREQRLLESYRAEGKLGEVQCRLM  119

Query  111  MAKRGKIRLLDVGSCYNPFKVFECFDVTAIDIAPATADVALCDFLNVDIATECLQTRFQ-  169
                 ++ +LDVGSC+NPF      +VTA+D+ PAT DV   DFL V++     +   + 
Sbjct  120  EEPPDRLHVLDVGSCFNPFSSAPHLEVTALDLCPATEDVLQADFLKVEVVPGIREPELEE  179

Query  170  -----LQEALFDVVVFSLFLEYLPTPEQRLMCCQKAYNLLTVEGILLIVTPDSKHVGANA  224
                 L  + ++ V+FSL LEY+P+ EQRL CC +AY+LL  EGIL+++TPDS+HVG NA
Sbjct  180  GSVRRLPASHYECVIFSLLLEYMPSAEQRLQCCLQAYDLLLPEGILVLITPDSQHVGKNA  239

Query  225  KIMKSWRFLLAGLGFSRIKYEKLSHIHCMAFRKSLSLSVASRWADLQDSVQFFAKMYIPQ  284
             +MK+WR+ LA +G  R+++EKL HI CM FRK++S  ++  WA +        ++ IPQ
Sbjct  240  HLMKNWRYSLARIGLLRVRFEKLPHISCMVFRKAISRELSQHWASIHREEGMCEEIRIPQ  299

Query  285  D  285
            D
Sbjct  300  D  300


>STRM1_CAEEL unnamed protein product
Length=334

 Score = 32.3 bits (72),  Expect = 0.38, Method: Compositional matrix adjust.
 Identities = 29/128 (23%), Positives = 57/128 (45%), Gaps = 12/128 (9%)

Query  81   NFYFYGEEILRQRLREKEIGLKINLTLDLPMAKRGKIRLLDVGSCYNPFKVFECFD----  136
            NF+F   +   Q+L E    L  ++   L +++   +  LD+G C     + +  D    
Sbjct  63   NFHFVPPKFEGQKLEEALKSLHCHIAEKLELSEN--VHCLDIG-CGIGGVMLDIADFGAK  119

Query  137  VTAIDIAPATADVALCDFLNVDIATECLQT-----RFQLQEALFDVVVFSLFLEYLPTPE  191
            +T + IAP  A++    F N+ I+  C        +   +++ FDV      L+Y+P  +
Sbjct  120  LTGVTIAPNEAEIGNEKFANMGISDRCKIVAADCQKMPFEDSTFDVAYAIYSLKYIPNLD  179

Query  192  QRLMCCQK  199
            + +   Q+
Sbjct  180  KVMKEIQR  187


>Q9VCB8_DROME unnamed protein product
Length=1122

 Score = 32.0 bits (71),  Expect = 0.80, Method: Compositional matrix adjust.
 Identities = 20/72 (28%), Positives = 32/72 (44%), Gaps = 8/72 (11%)

Query  119  LLDVGSCYNPFKVFECFDVTAIDIAPATADVALCDFLNVDIATECLQTRFQLQEALFDVV  178
            L+D  SC +P  +    D+  I+    T    + +FL  D           +   L  V+
Sbjct  636  LIDEISCDDPVVMNYLIDILRIETVLVTESKEIAEFLTSDTEN--------VPPNLTRVL  687

Query  179  VFSLFLEYLPTP  190
            V +L LEY+P+P
Sbjct  688  VPNLGLEYIPSP  699



Lambda      K        H
   0.321    0.135    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6277420098


Query= XP_031327223.1 uncharacterized protein LOC116158565 [Photinus
pyralis]

Length=141
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

UBP7_DROME  unnamed protein product                                   30.0    0.78 
Q09409_CAEEL  unnamed protein product                                 26.9    7.2  


>UBP7_DROME unnamed protein product
Length=1129

 Score = 30.0 bits (66),  Expect = 0.78, Method: Composition-based stats.
 Identities = 25/109 (23%), Positives = 50/109 (46%), Gaps = 16/109 (15%)

Query  20   YAMALNAEDICAEETKISMAKVWASYREESISEEDEEYGKYFHCVWLMKKLMDVNGSIDK  79
            Y      +D+ +   + S  +++  Y+  S+S  + +  K F CVW+   L D       
Sbjct  877  YTFKGTIKDLVSYTKQSSTKRIF--YQRLSLSIHELDNKKQFKCVWVSSDLKD-------  927

Query  80   TEVQNFLEKEISQDFTLNASLKQTLKEAAERCSKLDSASVQRKSVKLKN  128
                   EKE+      N ++K  L+EAA++ S  +++  + + +K+ N
Sbjct  928  -------EKELVLYPNKNDTVKGLLEEAAKKISFAENSRRKLRLLKISN  969


>Q09409_CAEEL unnamed protein product
Length=1425

 Score = 26.9 bits (58),  Expect = 7.2, Method: Compositional matrix adjust.
 Identities = 21/81 (26%), Positives = 39/81 (48%), Gaps = 4/81 (5%)

Query  36    ISMAKVWASYREESISEEDEEYGKYFH-CVWLMKKLMDVNGSIDKTEVQNFLEKEISQDF  94
             I   K + +   E + + D+   KY+H  +   ++L  ++  ID  E+Q+FL K   +D 
Sbjct  992   IPPIKKYQARTPEDLKDIDDMIDKYYHENILDERRLKMLDHKID--ELQSFLRKNYREDV  1049

Query  95    TLNASLKQTLKEAAERCSKLD  115
             TL  +    +   +  CS +D
Sbjct  1050  TL-TTFGSVMTGLSVNCSDID  1069



Lambda      K        H
   0.321    0.135    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6277420098


Query= XP_031327224.1 rho guanine nucleotide exchange factor 18 isoform X1
[Photinus pyralis]

Length=1367
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O44113_DROME  unnamed protein product                                 114     3e-25
O44381_DROME  unnamed protein product                                 112     1e-24
Q8T9E3_DROME  unnamed protein product                                 112     2e-24


>O44113_DROME unnamed protein product
Length=2559

 Score = 114 bits (286),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 102/367 (28%), Positives = 180/367 (49%), Gaps = 27/367 (7%)

Query  451   EVEPDSWTPHVGKEISRKLKEKEVKRQEHIYEFILTEKHHCMTLLMMQKIFVDGLQK--Y  508
             +V    W+  V  E+S  L + E KRQE I E   TE++H  TL ++ ++F   L +   
Sbjct  1514  DVNEADWSSMVAAEVSAALTDAEKKRQEIINEIYQTERNHVRTLKLLDRLFFLPLYESGL  1573

Query  509   FSLGPNLDRMFPRLVDLTELHLGFLLRLRQRQREAP-VVSSIADILLEEFSTSRAVKLKS  567
              S    L    P L+ L E+H  F   L+QR+ E   VV++I D+L + F     V L  
Sbjct  1574  LSQDHLLLLFPPALLSLREIHGAFEQSLKQRRIEHNHVVNTIGDLLADMFDGQSGVVLCE  1633

Query  568   AYGEFCSRHRDAVEIYKTYLSNDDRFGQFIRHCQNNPLLKKKGIPECILFVTQRLTKYPL  627
                +FC+R + A+E  K   + D+   + ++  +++   ++  + + +  V QRLTKYPL
Sbjct  1634  FAAQFCARQQIALEALKEKRNKDEMLQKLLKKSESHKACRRLELKDLLPTVLQRLTKYPL  1693

Query  628   LIEPLIKTS----KENQYEQEQLQRALALVKEILIEVDSQVAEKEKEDRKLEIYHRIDAK  683
             L E L K +     EN  E E +QRA+   K IL+EV+  V   E   +   I  ++D  
Sbjct  1694  LFENLYKVTVRLLPENTTEAEAIQRAVESSKRILVEVNQAVRTAEDAHKLQNIQRKLDRS  1753

Query  684   SYTTHRGYKFKKSDILQ------GNRSLRFEGVAMLMQGRGKMQVVMVIVLSDVLFFLQE  737
             SY      +FKK D+ Q      GN +++ +  ++ + G     +++++   D  ++L+ 
Sbjct  1754  SYDKE---EFKKLDLTQHHLIHDGNLTIK-KNPSVQLHGLLFENMIVLLTKQDDKYYLK-  1808

Query  738   SSHNKYTFFTPDNK--AGVISLQ-KLLVREKAGQESRGIYLISSNPADPEMFELKVHKPK  794
                N +T  +  NK  + ++S+    L+R++A  +    +LI    +  +M EL+     
Sbjct  1809  ---NLHTPLSITNKPVSPIMSIDADTLIRQEAA-DKNSFFLIKMKTS--QMLELRAPSSS  1862

Query  795   DKQVWIQ  801
             + + W +
Sbjct  1863  ECKTWFK  1869


>O44381_DROME unnamed protein product
Length=2559

 Score = 112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 101/367 (28%), Positives = 179/367 (49%), Gaps = 27/367 (7%)

Query  451   EVEPDSWTPHVGKEISRKLKEKEVKRQEHIYEFILTEKHHCMTLLMMQKIFVDGLQK--Y  508
             +V    W+  V  E+   L + E KRQE I E   TE++H  TL ++ ++F   L +   
Sbjct  1514  DVNEADWSSMVAAEVLAALTDAEKKRQEIINEIYQTERNHVRTLKLLDRLFFLPLYESGL  1573

Query  509   FSLGPNLDRMFPRLVDLTELHLGFLLRLRQRQREAP-VVSSIADILLEEFSTSRAVKLKS  567
              S    L    P L+ L E+H  F   L+QR+ E   VV++I D+L + F     V L  
Sbjct  1574  LSQDHLLLLFPPALLSLREIHGAFEQSLKQRRIEHNHVVNTIGDLLADMFDGQSGVVLCE  1633

Query  568   AYGEFCSRHRDAVEIYKTYLSNDDRFGQFIRHCQNNPLLKKKGIPECILFVTQRLTKYPL  627
                +FC+R + A+E  K   + D+   + ++  +++   ++  + + +  V QRLTKYPL
Sbjct  1634  FAAQFCARQQIALEALKEKRNKDEMLQKLLKKSESHKACRRLELKDLLPTVLQRLTKYPL  1693

Query  628   LIEPLIKTS----KENQYEQEQLQRALALVKEILIEVDSQVAEKEKEDRKLEIYHRIDAK  683
             L E L K +     EN  E E +QRA+   K IL+EV+  V   E   +   I  ++D  
Sbjct  1694  LFENLYKVTVRLLPENTTEAEAIQRAVESSKRILVEVNQAVKTAEDAHKLQNIQRKLDRS  1753

Query  684   SYTTHRGYKFKKSDILQ------GNRSLRFEGVAMLMQGRGKMQVVMVIVLSDVLFFLQE  737
             SY      +FKK D+ Q      GN +++ +  ++ + G     +++++   D  ++L+ 
Sbjct  1754  SYDKE---EFKKLDLTQHHLIHDGNLTIK-KNPSVQLHGLLFENMIVLLTKQDDKYYLK-  1808

Query  738   SSHNKYTFFTPDNK--AGVISLQ-KLLVREKAGQESRGIYLISSNPADPEMFELKVHKPK  794
                N +T  +  NK  + ++S+    L+R++A  +    +LI    +  +M EL+     
Sbjct  1809  ---NLHTPLSITNKPVSPIMSIDADTLIRQEAA-DKNSFFLIKMKTS--QMLELRAPSSS  1862

Query  795   DKQVWIQ  801
             + + W +
Sbjct  1863  ECKTWFK  1869


>Q8T9E3_DROME unnamed protein product
Length=2555

 Score = 112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 101/367 (28%), Positives = 179/367 (49%), Gaps = 27/367 (7%)

Query  451   EVEPDSWTPHVGKEISRKLKEKEVKRQEHIYEFILTEKHHCMTLLMMQKIFVDGLQK--Y  508
             +V    W+  V  E+   L + E KRQE I E   TE++H  TL ++ ++F   L +   
Sbjct  1510  DVNEADWSSMVAAEVLAALTDAEKKRQEIINEIYQTERNHVRTLKLLDRLFFLPLYESGL  1569

Query  509   FSLGPNLDRMFPRLVDLTELHLGFLLRLRQRQREAP-VVSSIADILLEEFSTSRAVKLKS  567
              S    L    P L+ L E+H  F   L+QR+ E   VV++I D+L + F     V L  
Sbjct  1570  LSQDHLLLLFPPALLSLREIHGAFEQSLKQRRIEHNHVVNTIGDLLADMFDGQSGVVLCE  1629

Query  568   AYGEFCSRHRDAVEIYKTYLSNDDRFGQFIRHCQNNPLLKKKGIPECILFVTQRLTKYPL  627
                +FC+R + A+E  K   + D+   + ++  +++   ++  + + +  V QRLTKYPL
Sbjct  1630  FAAQFCARQQIALEALKEKRNKDEMLQKLLKKSESHKACRRLELKDLLPTVLQRLTKYPL  1689

Query  628   LIEPLIKTS----KENQYEQEQLQRALALVKEILIEVDSQVAEKEKEDRKLEIYHRIDAK  683
             L E L K +     EN  E E +QRA+   K IL+EV+  V   E   +   I  ++D  
Sbjct  1690  LFENLYKVTVRLLPENTTEAEAIQRAVESSKRILVEVNQAVKTAEDAHKLQNIQRKLDRS  1749

Query  684   SYTTHRGYKFKKSDILQ------GNRSLRFEGVAMLMQGRGKMQVVMVIVLSDVLFFLQE  737
             SY      +FKK D+ Q      GN +++ +  ++ + G     +++++   D  ++L+ 
Sbjct  1750  SYDKE---EFKKLDLTQHHLIHDGNLTIK-KNPSVQLHGLLFENMIVLLTKQDDKYYLK-  1804

Query  738   SSHNKYTFFTPDNK--AGVISLQ-KLLVREKAGQESRGIYLISSNPADPEMFELKVHKPK  794
                N +T  +  NK  + ++S+    L+R++A  +    +LI    +  +M EL+     
Sbjct  1805  ---NLHTPLSITNKPVSPIMSIDADTLIRQEAA-DKNSFFLIKMKTS--QMLELRAPSSS  1858

Query  795   DKQVWIQ  801
             + + W +
Sbjct  1859  ECKTWFK  1865



Lambda      K        H
   0.321    0.135    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6277420098


Query= XP_031327225.1 rho guanine nucleotide exchange factor 18 isoform X2
[Photinus pyralis]

Length=1364
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O44113_DROME  unnamed protein product                                 114     3e-25
O44381_DROME  unnamed protein product                                 112     2e-24
A0A0B4K7T7_DROME  unnamed protein product                             112     2e-24


>O44113_DROME unnamed protein product
Length=2559

 Score = 114 bits (286),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 102/367 (28%), Positives = 181/367 (49%), Gaps = 27/367 (7%)

Query  455   EVEPDSWTPHVGKEISRKLKEKEVKRQEHIYEFILTEKHHCMTLLMMQKIFVDGLQK--Y  512
             +V    W+  V  E+S  L + E KRQE I E   TE++H  TL ++ ++F   L +   
Sbjct  1514  DVNEADWSSMVAAEVSAALTDAEKKRQEIINEIYQTERNHVRTLKLLDRLFFLPLYESGL  1573

Query  513   FSLGPNLDRMFPRLVDLTELHLGFLLRLRQRQREAP-VVSSIADILLEEFSTSRAVKLKS  571
              S    L    P L+ L E+H  F   L+QR+ E   VV++I D+L + F     V L  
Sbjct  1574  LSQDHLLLLFPPALLSLREIHGAFEQSLKQRRIEHNHVVNTIGDLLADMFDGQSGVVLCE  1633

Query  572   AYGEFCSRHRDAVEIYKTYLSNDDRFGQFIRHCQNNPLLKKKGIPECILFVTQRLTKYPL  631
                +FC+R + A+E  K   + D+   + ++  +++   ++  + + +  V QRLTKYPL
Sbjct  1634  FAAQFCARQQIALEALKEKRNKDEMLQKLLKKSESHKACRRLELKDLLPTVLQRLTKYPL  1693

Query  632   LIEPLIKTS----KENQYEQEQLQRALALVKEILIEVDSQVAEKEKEDRKLEIYHRIDAK  687
             L E L K +     EN  E E +QRA+   K IL+EV+  V   E   +   I  ++D  
Sbjct  1694  LFENLYKVTVRLLPENTTEAEAIQRAVESSKRILVEVNQAVRTAEDAHKLQNIQRKLDRS  1753

Query  688   SYTTHRGYKFKKSDILQ------GNRSLRFEGVAMLMQGRGKMQVVMVIVLSDVLFFLQE  741
             SY      +FKK D+ Q      GN +++ +  ++ + G     +++++   D  ++L+ 
Sbjct  1754  SYDKE---EFKKLDLTQHHLIHDGNLTIK-KNPSVQLHGLLFENMIVLLTKQDDKYYLK-  1808

Query  742   SSHNKYTFFTPDNK--AGVISLQ-KLLVREKAGQESRGIYLISSNPADPEMFELKVHKPK  798
                N +T  +  NK  + ++S+    L+R++A  ++   +LI    +  +M EL+     
Sbjct  1809  ---NLHTPLSITNKPVSPIMSIDADTLIRQEAADKN-SFFLIKMKTS--QMLELRAPSSS  1862

Query  799   DKQVWIQ  805
             + + W +
Sbjct  1863  ECKTWFK  1869


>O44381_DROME unnamed protein product
Length=2559

 Score = 112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 101/367 (28%), Positives = 179/367 (49%), Gaps = 27/367 (7%)

Query  455   EVEPDSWTPHVGKEISRKLKEKEVKRQEHIYEFILTEKHHCMTLLMMQKIFVDGLQK--Y  512
             +V    W+  V  E+   L + E KRQE I E   TE++H  TL ++ ++F   L +   
Sbjct  1514  DVNEADWSSMVAAEVLAALTDAEKKRQEIINEIYQTERNHVRTLKLLDRLFFLPLYESGL  1573

Query  513   FSLGPNLDRMFPRLVDLTELHLGFLLRLRQRQREAP-VVSSIADILLEEFSTSRAVKLKS  571
              S    L    P L+ L E+H  F   L+QR+ E   VV++I D+L + F     V L  
Sbjct  1574  LSQDHLLLLFPPALLSLREIHGAFEQSLKQRRIEHNHVVNTIGDLLADMFDGQSGVVLCE  1633

Query  572   AYGEFCSRHRDAVEIYKTYLSNDDRFGQFIRHCQNNPLLKKKGIPECILFVTQRLTKYPL  631
                +FC+R + A+E  K   + D+   + ++  +++   ++  + + +  V QRLTKYPL
Sbjct  1634  FAAQFCARQQIALEALKEKRNKDEMLQKLLKKSESHKACRRLELKDLLPTVLQRLTKYPL  1693

Query  632   LIEPLIKTS----KENQYEQEQLQRALALVKEILIEVDSQVAEKEKEDRKLEIYHRIDAK  687
             L E L K +     EN  E E +QRA+   K IL+EV+  V   E   +   I  ++D  
Sbjct  1694  LFENLYKVTVRLLPENTTEAEAIQRAVESSKRILVEVNQAVKTAEDAHKLQNIQRKLDRS  1753

Query  688   SYTTHRGYKFKKSDILQ------GNRSLRFEGVAMLMQGRGKMQVVMVIVLSDVLFFLQE  741
             SY      +FKK D+ Q      GN +++ +  ++ + G     +++++   D  ++L+ 
Sbjct  1754  SYDKE---EFKKLDLTQHHLIHDGNLTIK-KNPSVQLHGLLFENMIVLLTKQDDKYYLK-  1808

Query  742   SSHNKYTFFTPDNK--AGVISLQ-KLLVREKAGQESRGIYLISSNPADPEMFELKVHKPK  798
                N +T  +  NK  + ++S+    L+R++A  +    +LI    +  +M EL+     
Sbjct  1809  ---NLHTPLSITNKPVSPIMSIDADTLIRQEAA-DKNSFFLIKMKTS--QMLELRAPSSS  1862

Query  799   DKQVWIQ  805
             + + W +
Sbjct  1863  ECKTWFK  1869


>A0A0B4K7T7_DROME unnamed protein product
Length=2557

 Score = 112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 101/367 (28%), Positives = 179/367 (49%), Gaps = 27/367 (7%)

Query  455   EVEPDSWTPHVGKEISRKLKEKEVKRQEHIYEFILTEKHHCMTLLMMQKIFVDGLQK--Y  512
             +V    W+  V  E+   L + E KRQE I E   TE++H  TL ++ ++F   L +   
Sbjct  1512  DVNEADWSSMVAAEVLAALTDAEKKRQEIINEIYQTERNHVRTLKLLDRLFFLPLYESGL  1571

Query  513   FSLGPNLDRMFPRLVDLTELHLGFLLRLRQRQREAP-VVSSIADILLEEFSTSRAVKLKS  571
              S    L    P L+ L E+H  F   L+QR+ E   VV++I D+L + F     V L  
Sbjct  1572  LSQDHLLLLFPPALLSLREIHGAFEQSLKQRRIEHNHVVNTIGDLLADMFDGQSGVVLCE  1631

Query  572   AYGEFCSRHRDAVEIYKTYLSNDDRFGQFIRHCQNNPLLKKKGIPECILFVTQRLTKYPL  631
                +FC+R + A+E  K   + D+   + ++  +++   ++  + + +  V QRLTKYPL
Sbjct  1632  FAAQFCARQQIALEALKEKRNKDEMLQKLLKKSESHKACRRLELKDLLPTVLQRLTKYPL  1691

Query  632   LIEPLIKTS----KENQYEQEQLQRALALVKEILIEVDSQVAEKEKEDRKLEIYHRIDAK  687
             L E L K +     EN  E E +QRA+   K IL+EV+  V   E   +   I  ++D  
Sbjct  1692  LFENLYKVTVRLLPENTTEAEAIQRAVESSKRILVEVNQAVKTAEDAHKLQNIQRKLDRS  1751

Query  688   SYTTHRGYKFKKSDILQ------GNRSLRFEGVAMLMQGRGKMQVVMVIVLSDVLFFLQE  741
             SY      +FKK D+ Q      GN +++ +  ++ + G     +++++   D  ++L+ 
Sbjct  1752  SYDKE---EFKKLDLTQHHLIHDGNLTIK-KNPSVQLHGLLFENMIVLLTKQDDKYYLK-  1806

Query  742   SSHNKYTFFTPDNK--AGVISLQ-KLLVREKAGQESRGIYLISSNPADPEMFELKVHKPK  798
                N +T  +  NK  + ++S+    L+R++A  +    +LI    +  +M EL+     
Sbjct  1807  ---NLHTPLSITNKPVSPIMSIDADTLIRQEAA-DKNSFFLIKMKTS--QMLELRAPSSS  1860

Query  799   DKQVWIQ  805
             + + W +
Sbjct  1861  ECKTWFK  1867



Lambda      K        H
   0.321    0.135    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6277420098


Query= XP_031327226.1 rho guanine nucleotide exchange factor 18 isoform X3
[Photinus pyralis]

Length=1352
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O44113_DROME  unnamed protein product                                 115     3e-25
O44381_DROME  unnamed protein product                                 112     1e-24
A1ZAN6_DROME  unnamed protein product                                 112     1e-24


>O44113_DROME unnamed protein product
Length=2559

 Score = 115 bits (287),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 102/367 (28%), Positives = 180/367 (49%), Gaps = 27/367 (7%)

Query  436   EVEPDSWTPHVGKEISRKLKEKEVKRQEHIYEFILTEKHHCMTLLMMQKIFVDGLQK--Y  493
             +V    W+  V  E+S  L + E KRQE I E   TE++H  TL ++ ++F   L +   
Sbjct  1514  DVNEADWSSMVAAEVSAALTDAEKKRQEIINEIYQTERNHVRTLKLLDRLFFLPLYESGL  1573

Query  494   FSLGPNLDRMFPRLVDLTELHLGFLLRLRQRQREAP-VVSSIADILLEEFSTSRAVKLKS  552
              S    L    P L+ L E+H  F   L+QR+ E   VV++I D+L + F     V L  
Sbjct  1574  LSQDHLLLLFPPALLSLREIHGAFEQSLKQRRIEHNHVVNTIGDLLADMFDGQSGVVLCE  1633

Query  553   AYGEFCSRHRDAVEIYKTYLSNDDRFGQFIRHCQNNPLLKKKGIPECILFVTQRLTKYPL  612
                +FC+R + A+E  K   + D+   + ++  +++   ++  + + +  V QRLTKYPL
Sbjct  1634  FAAQFCARQQIALEALKEKRNKDEMLQKLLKKSESHKACRRLELKDLLPTVLQRLTKYPL  1693

Query  613   LIEPLIKTS----KENQYEQEQLQRALALVKEILIEVDSQVAEKEKEDRKLEIYHRIDAK  668
             L E L K +     EN  E E +QRA+   K IL+EV+  V   E   +   I  ++D  
Sbjct  1694  LFENLYKVTVRLLPENTTEAEAIQRAVESSKRILVEVNQAVRTAEDAHKLQNIQRKLDRS  1753

Query  669   SYTTHRGYKFKKSDILQ------GNRSLRFEGVAMLMQGRGKMQVVMVIVLSDVLFFLQE  722
             SY      +FKK D+ Q      GN +++ +  ++ + G     +++++   D  ++L+ 
Sbjct  1754  SYDKE---EFKKLDLTQHHLIHDGNLTIK-KNPSVQLHGLLFENMIVLLTKQDDKYYLK-  1808

Query  723   SSHNKYTFFTPDNK--AGVISLQ-KLLVREKAGQESRGIYLISSNPADPEMFELKVHKPK  779
                N +T  +  NK  + ++S+    L+R++A  +    +LI    +  +M EL+     
Sbjct  1809  ---NLHTPLSITNKPVSPIMSIDADTLIRQEAA-DKNSFFLIKMKTS--QMLELRAPSSS  1862

Query  780   DKQVWIQ  786
             + + W +
Sbjct  1863  ECKTWFK  1869


>O44381_DROME unnamed protein product
Length=2559

 Score = 112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 101/367 (28%), Positives = 179/367 (49%), Gaps = 27/367 (7%)

Query  436   EVEPDSWTPHVGKEISRKLKEKEVKRQEHIYEFILTEKHHCMTLLMMQKIFVDGLQK--Y  493
             +V    W+  V  E+   L + E KRQE I E   TE++H  TL ++ ++F   L +   
Sbjct  1514  DVNEADWSSMVAAEVLAALTDAEKKRQEIINEIYQTERNHVRTLKLLDRLFFLPLYESGL  1573

Query  494   FSLGPNLDRMFPRLVDLTELHLGFLLRLRQRQREAP-VVSSIADILLEEFSTSRAVKLKS  552
              S    L    P L+ L E+H  F   L+QR+ E   VV++I D+L + F     V L  
Sbjct  1574  LSQDHLLLLFPPALLSLREIHGAFEQSLKQRRIEHNHVVNTIGDLLADMFDGQSGVVLCE  1633

Query  553   AYGEFCSRHRDAVEIYKTYLSNDDRFGQFIRHCQNNPLLKKKGIPECILFVTQRLTKYPL  612
                +FC+R + A+E  K   + D+   + ++  +++   ++  + + +  V QRLTKYPL
Sbjct  1634  FAAQFCARQQIALEALKEKRNKDEMLQKLLKKSESHKACRRLELKDLLPTVLQRLTKYPL  1693

Query  613   LIEPLIKTS----KENQYEQEQLQRALALVKEILIEVDSQVAEKEKEDRKLEIYHRIDAK  668
             L E L K +     EN  E E +QRA+   K IL+EV+  V   E   +   I  ++D  
Sbjct  1694  LFENLYKVTVRLLPENTTEAEAIQRAVESSKRILVEVNQAVKTAEDAHKLQNIQRKLDRS  1753

Query  669   SYTTHRGYKFKKSDILQ------GNRSLRFEGVAMLMQGRGKMQVVMVIVLSDVLFFLQE  722
             SY      +FKK D+ Q      GN +++ +  ++ + G     +++++   D  ++L+ 
Sbjct  1754  SYDKE---EFKKLDLTQHHLIHDGNLTIK-KNPSVQLHGLLFENMIVLLTKQDDKYYLK-  1808

Query  723   SSHNKYTFFTPDNK--AGVISLQ-KLLVREKAGQESRGIYLISSNPADPEMFELKVHKPK  779
                N +T  +  NK  + ++S+    L+R++A  +    +LI    +  +M EL+     
Sbjct  1809  ---NLHTPLSITNKPVSPIMSIDADTLIRQEAA-DKNSFFLIKMKTS--QMLELRAPSSS  1862

Query  780   DKQVWIQ  786
             + + W +
Sbjct  1863  ECKTWFK  1869


>A1ZAN6_DROME unnamed protein product
Length=2559

 Score = 112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 101/367 (28%), Positives = 180/367 (49%), Gaps = 27/367 (7%)

Query  436   EVEPDSWTPHVGKEISRKLKEKEVKRQEHIYEFILTEKHHCMTLLMMQKIFVDGLQK--Y  493
             +V    W+  V  E+   L + E KRQE I E   TE++H  TL ++ ++F   L +   
Sbjct  1514  DVNEADWSSMVAAEVLAALTDAEKKRQEIINEIYQTERNHVRTLKLLDRLFFLPLYESGL  1573

Query  494   FSLGPNLDRMFPRLVDLTELHLGFLLRLRQRQREAP-VVSSIADILLEEFSTSRAVKLKS  552
              S    L    P L+ L E+H  F   L+QR+ E   VV++I D+L + F     V L  
Sbjct  1574  LSQDHLLLLFPPALLSLREIHGAFEQSLKQRRIEHNHVVNTIGDLLADMFDGQSGVVLCE  1633

Query  553   AYGEFCSRHRDAVEIYKTYLSNDDRFGQFIRHCQNNPLLKKKGIPECILFVTQRLTKYPL  612
                +FC+R + A+E  K   + D+   + ++  +++   ++  + + +  V QRLTKYPL
Sbjct  1634  FAAQFCARQQIALEALKEKRNKDEMLQKLLKKSESHKACRRLELKDLLPTVLQRLTKYPL  1693

Query  613   LIEPLIKTS----KENQYEQEQLQRALALVKEILIEVDSQVAEKEKEDRKLEIYHRIDAK  668
             L E L K +     EN  E E +QRA+   K IL+EV+  V   E   +   I  ++D  
Sbjct  1694  LFENLYKVTVRLLPENTTEAEAIQRAVESSKRILVEVNQAVKTAEDAHKLQNIQRKLDRS  1753

Query  669   SYTTHRGYKFKKSDILQ------GNRSLRFEGVAMLMQGRGKMQVVMVIVLSDVLFFLQE  722
             SY      +FKK D+ Q      GN +++ +  ++ + G     +++++   D  ++L+ 
Sbjct  1754  SYDKE---EFKKLDLTQHHLIHDGNLTIK-KNPSVQLHGLLFENMIVLLTKQDDKYYLK-  1808

Query  723   SSHNKYTFFTPDNK--AGVISLQ-KLLVREKAGQESRGIYLISSNPADPEMFELKVHKPK  779
                N +T  +  NK  + ++S+    L+R++A  ++   +LI    +  +M EL+     
Sbjct  1809  ---NLHTPLSITNKPVSPIMSIDADTLIRQEAADKN-SFFLIKMKTS--QMLELRAPSSS  1862

Query  780   DKQVWIQ  786
             + + W +
Sbjct  1863  ECKTWFK  1869



Lambda      K        H
   0.321    0.135    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6277420098


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jan 28, 2021  9:24 PM
  Number of letters in database: 17,197,330
  Number of sequences in database:  25,232



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= XP_031327227.1 rho guanine nucleotide exchange factor 18 isoform X4
[Photinus pyralis]

Length=1335
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O44113_DROME  unnamed protein product                                 114     4e-25
A1ZAN6_DROME  unnamed protein product                                 112     2e-24
Q8T9E3_DROME  unnamed protein product                                 112     2e-24


>O44113_DROME unnamed protein product
Length=2559

 Score = 114 bits (285),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 102/367 (28%), Positives = 181/367 (49%), Gaps = 27/367 (7%)

Query  419   EVEPDSWTPHVGKEISRKLKEKEVKRQEHIYEFILTEKHHCMTLLMMQKIFVDGLQK--Y  476
             +V    W+  V  E+S  L + E KRQE I E   TE++H  TL ++ ++F   L +   
Sbjct  1514  DVNEADWSSMVAAEVSAALTDAEKKRQEIINEIYQTERNHVRTLKLLDRLFFLPLYESGL  1573

Query  477   FSLGPNLDRMFPRLVDLTELHLGFLLRLRQRQREAP-VVSSIADILLEEFSTSRAVKLKS  535
              S    L    P L+ L E+H  F   L+QR+ E   VV++I D+L + F     V L  
Sbjct  1574  LSQDHLLLLFPPALLSLREIHGAFEQSLKQRRIEHNHVVNTIGDLLADMFDGQSGVVLCE  1633

Query  536   AYGEFCSRHRDAVEIYKTYLSNDDRFGQFIRHCQNNPLLKKKGIPECILFVTQRLTKYPL  595
                +FC+R + A+E  K   + D+   + ++  +++   ++  + + +  V QRLTKYPL
Sbjct  1634  FAAQFCARQQIALEALKEKRNKDEMLQKLLKKSESHKACRRLELKDLLPTVLQRLTKYPL  1693

Query  596   LIEPLIKTS----KENQYEQEQLQRALALVKEILIEVDSQVAEKEKEDRKLEIYHRIDAK  651
             L E L K +     EN  E E +QRA+   K IL+EV+  V   E   +   I  ++D  
Sbjct  1694  LFENLYKVTVRLLPENTTEAEAIQRAVESSKRILVEVNQAVRTAEDAHKLQNIQRKLDRS  1753

Query  652   SYTTHRGYKFKKSDILQ------GNRSLRFEGVAMLMQGRGKMQVVMVIVLSDVLFFLQE  705
             SY      +FKK D+ Q      GN +++ +  ++ + G     +++++   D  ++L+ 
Sbjct  1754  SYDKE---EFKKLDLTQHHLIHDGNLTIK-KNPSVQLHGLLFENMIVLLTKQDDKYYLK-  1808

Query  706   SSHNKYTFFTPDNK--AGVISLQ-KLLVREKAGQESRGIYLISSNPADPEMFELKVHKPK  762
                N +T  +  NK  + ++S+    L+R++A  ++   +LI    +  +M EL+     
Sbjct  1809  ---NLHTPLSITNKPVSPIMSIDADTLIRQEAADKN-SFFLIKMKTS--QMLELRAPSSS  1862

Query  763   DKQVWIQ  769
             + + W +
Sbjct  1863  ECKTWFK  1869


>A1ZAN6_DROME unnamed protein product
Length=2559

 Score = 112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 101/367 (28%), Positives = 179/367 (49%), Gaps = 27/367 (7%)

Query  419   EVEPDSWTPHVGKEISRKLKEKEVKRQEHIYEFILTEKHHCMTLLMMQKIFVDGLQK--Y  476
             +V    W+  V  E+   L + E KRQE I E   TE++H  TL ++ ++F   L +   
Sbjct  1514  DVNEADWSSMVAAEVLAALTDAEKKRQEIINEIYQTERNHVRTLKLLDRLFFLPLYESGL  1573

Query  477   FSLGPNLDRMFPRLVDLTELHLGFLLRLRQRQREAP-VVSSIADILLEEFSTSRAVKLKS  535
              S    L    P L+ L E+H  F   L+QR+ E   VV++I D+L + F     V L  
Sbjct  1574  LSQDHLLLLFPPALLSLREIHGAFEQSLKQRRIEHNHVVNTIGDLLADMFDGQSGVVLCE  1633

Query  536   AYGEFCSRHRDAVEIYKTYLSNDDRFGQFIRHCQNNPLLKKKGIPECILFVTQRLTKYPL  595
                +FC+R + A+E  K   + D+   + ++  +++   ++  + + +  V QRLTKYPL
Sbjct  1634  FAAQFCARQQIALEALKEKRNKDEMLQKLLKKSESHKACRRLELKDLLPTVLQRLTKYPL  1693

Query  596   LIEPLIKTS----KENQYEQEQLQRALALVKEILIEVDSQVAEKEKEDRKLEIYHRIDAK  651
             L E L K +     EN  E E +QRA+   K IL+EV+  V   E   +   I  ++D  
Sbjct  1694  LFENLYKVTVRLLPENTTEAEAIQRAVESSKRILVEVNQAVKTAEDAHKLQNIQRKLDRS  1753

Query  652   SYTTHRGYKFKKSDILQ------GNRSLRFEGVAMLMQGRGKMQVVMVIVLSDVLFFLQE  705
             SY      +FKK D+ Q      GN +++ +  ++ + G     +++++   D  ++L+ 
Sbjct  1754  SYDKE---EFKKLDLTQHHLIHDGNLTIK-KNPSVQLHGLLFENMIVLLTKQDDKYYLK-  1808

Query  706   SSHNKYTFFTPDNK--AGVISLQ-KLLVREKAGQESRGIYLISSNPADPEMFELKVHKPK  762
                N +T  +  NK  + ++S+    L+R++A  +    +LI    +  +M EL+     
Sbjct  1809  ---NLHTPLSITNKPVSPIMSIDADTLIRQEAA-DKNSFFLIKMKTS--QMLELRAPSSS  1862

Query  763   DKQVWIQ  769
             + + W +
Sbjct  1863  ECKTWFK  1869


>Q8T9E3_DROME unnamed protein product
Length=2555

 Score = 112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 101/367 (28%), Positives = 179/367 (49%), Gaps = 27/367 (7%)

Query  419   EVEPDSWTPHVGKEISRKLKEKEVKRQEHIYEFILTEKHHCMTLLMMQKIFVDGLQK--Y  476
             +V    W+  V  E+   L + E KRQE I E   TE++H  TL ++ ++F   L +   
Sbjct  1510  DVNEADWSSMVAAEVLAALTDAEKKRQEIINEIYQTERNHVRTLKLLDRLFFLPLYESGL  1569

Query  477   FSLGPNLDRMFPRLVDLTELHLGFLLRLRQRQREAP-VVSSIADILLEEFSTSRAVKLKS  535
              S    L    P L+ L E+H  F   L+QR+ E   VV++I D+L + F     V L  
Sbjct  1570  LSQDHLLLLFPPALLSLREIHGAFEQSLKQRRIEHNHVVNTIGDLLADMFDGQSGVVLCE  1629

Query  536   AYGEFCSRHRDAVEIYKTYLSNDDRFGQFIRHCQNNPLLKKKGIPECILFVTQRLTKYPL  595
                +FC+R + A+E  K   + D+   + ++  +++   ++  + + +  V QRLTKYPL
Sbjct  1630  FAAQFCARQQIALEALKEKRNKDEMLQKLLKKSESHKACRRLELKDLLPTVLQRLTKYPL  1689

Query  596   LIEPLIKTS----KENQYEQEQLQRALALVKEILIEVDSQVAEKEKEDRKLEIYHRIDAK  651
             L E L K +     EN  E E +QRA+   K IL+EV+  V   E   +   I  ++D  
Sbjct  1690  LFENLYKVTVRLLPENTTEAEAIQRAVESSKRILVEVNQAVKTAEDAHKLQNIQRKLDRS  1749

Query  652   SYTTHRGYKFKKSDILQ------GNRSLRFEGVAMLMQGRGKMQVVMVIVLSDVLFFLQE  705
             SY      +FKK D+ Q      GN +++ +  ++ + G     +++++   D  ++L+ 
Sbjct  1750  SYDKE---EFKKLDLTQHHLIHDGNLTIK-KNPSVQLHGLLFENMIVLLTKQDDKYYLK-  1804

Query  706   SSHNKYTFFTPDNK--AGVISLQ-KLLVREKAGQESRGIYLISSNPADPEMFELKVHKPK  762
                N +T  +  NK  + ++S+    L+R++A  +    +LI    +  +M EL+     
Sbjct  1805  ---NLHTPLSITNKPVSPIMSIDADTLIRQEAA-DKNSFFLIKMKTS--QMLELRAPSSS  1858

Query  763   DKQVWIQ  769
             + + W +
Sbjct  1859  ECKTWFK  1865



Lambda      K        H
   0.313    0.129    0.370 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 17440693000


Query= XP_031327228.1 52 kDa repressor of the inhibitor of the protein
kinase-like [Photinus pyralis]

Length=620
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q25442_MUSDO  unnamed protein product                                 45.1    1e-04
Q38BM2_TRYB2  unnamed protein product                                 30.4    5.9  
Q57UT8_TRYB2  unnamed protein product                                 30.0    7.1  


>Q25442_MUSDO unnamed protein product
Length=612

 Score = 45.1 bits (105),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/79 (32%), Positives = 46/79 (58%), Gaps = 1/79 (1%)

Query  238  HCASHRL-NLVINDLCAVREIQNCCSSIKEIVKFFRESVLRRRLVANLPLLCETRWSAKY  296
            +C+SH L N++ N      E+     + K IVK+F+++ L+ RL ++L   C TRW++ Y
Sbjct  264  NCSSHLLSNVLENSFEETPELNVPILACKNIVKYFKKANLQHRLRSSLKSECPTRWNSTY  323

Query  297  KSIRIFYENFINIIHALED  315
              +R   +N+ ++I  L +
Sbjct  324  TMLRSILDNWESVIQILSE  342


>Q38BM2_TRYB2 unnamed protein product
Length=700

 Score = 30.4 bits (67),  Expect = 5.9, Method: Compositional matrix adjust.
 Identities = 13/41 (32%), Positives = 26/41 (63%), Gaps = 1/41 (2%)

Query  579  LCMLSVHREKVKVDIDQFCQSVLDIFAQTPRNLMFAFSDKY  619
              +L +HRE  + + ++ C+  LD++A+T R+ + A +D Y
Sbjct  534  FALLYLHREDTE-NCEKMCKCALDMYAKTARSNVLAQADVY  573


>Q57UT8_TRYB2 unnamed protein product
Length=406

 Score = 30.0 bits (66),  Expect = 7.1, Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 58/122 (48%), Gaps = 16/122 (13%)

Query  316  LATNAEYNAATRSKAHQLYLAACQSNFIVA----MVIIAKYSS-KLEPVVNTLQGININL  370
            L ++A+Y  ++ +KA  L +     N +V+      +  +YS   LE   N L     ++
Sbjct  290  LLSDADYTTSSEAKA--LLVRTLHWNLMVSNAERFCVKYRYSQISLEEAANRLSS---SV  344

Query  371  LDVKNHIGIIEETLKKHRSDHETYFANIYQEATEIGNKIGKQM--EMPRIVQRQKHRSNP  428
             DV+N I  +   L +H S + T+FAN+    T  GN+    +   + R  +R + R  P
Sbjct  345  SDVRNRI--LSAVLLRHNSVYNTHFANV--SMTLFGNRDAAMICFVVSREYERSRKRMLP  400

Query  429  AL  430
            ++
Sbjct  401  SI  402



Lambda      K        H
   0.313    0.129    0.370 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 17440693000


Query= XP_031327229.1 derlin-1 [Photinus pyralis]

Length=253
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DERL1_CAEEL  unnamed protein product                                  224     1e-73
DERL1_DROME  unnamed protein product                                  224     2e-73
Q9VEU2_DROME  unnamed protein product                                 109     1e-28


>DERL1_CAEEL unnamed protein product
Length=245

 Score = 224 bits (572),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 120/254 (47%), Positives = 155/254 (61%), Gaps = 13/254 (5%)

Query  3    DLGDWFRSVPFFTRYWLTLTVGFTLAGRIGIFRPHTMILLYE-PLTRFQIWRLFTCLFYY  61
            DL ++   +P  TRYW   +    L GR G      M L ++  + +FQ WR  T L YY
Sbjct  2    DLENFLLGIPIVTRYWFLASTIIPLLGRFGFINVQWMFLQWDLVVNKFQFWRPLTALIYY  61

Query  62   PLSPGSGFHFLINLYFLYNYSRRLETDQYSGKPADYFFMLIFNWICCVIVGLIAEIPLLL  121
            P++P +GFH+L+  YFLYNYS+ LE++ Y G+ ADY FMLIFNW  C  + +  +I  LL
Sbjct  62   PVTPQTGFHWLMMCYFLYNYSKALESETYRGRSADYLFMLIFNWFFCSGLCMALDIYFLL  121

Query  122  DPMVLSILYIWCQLNKDVIVNFWFGTRFKAMYLPWVLLAFNMVISGGGLYEIIGILIGHL  181
            +PMV+S+LY+WCQ+NKD IV+FWFG RF A YLPWVL  FN V+ GGG  E++GIL+GH 
Sbjct  122  EPMVISVLYVWCQVNKDTIVSFWFGMRFPARYLPWVLWGFNAVLRGGGTNELVGILVGHA  181

Query  182  YFFLMFKYPQELGGPVLLQTPSILKEWFPDNFGGVHGFGQPPQRAPRPPPATRGGLFRGG  241
            YFF+  KYP E G   L+ TP  L    PD  GG+HG     + A + P          G
Sbjct  182  YFFVALKYPDEYGVD-LISTPEFLHRLIPDEDGGIHGQDGNIRGARQQPR---------G  231

Query  242  HNW--GRGNVLGGN  253
            H W  G G  LGGN
Sbjct  232  HQWPGGVGARLGGN  245


>DERL1_DROME unnamed protein product
Length=245

 Score = 224 bits (571),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/252 (48%), Positives = 158/252 (63%), Gaps = 9/252 (4%)

Query  3    DLGDWFRSVPFFTRYWLTLTVGFTLAGRIGIFRPHTMILLYEPL-TRFQIWRLFTCLFYY  61
            D G W+RS+P FTRYWLT TV  ++  R  +   H + L    + ++ Q+WR  T LF +
Sbjct  2    DAGVWYRSLPRFTRYWLTATVVLSMLCRFDVIPLHWLHLDRSAVFSKLQLWRCMTSLFVF  61

Query  62   PLSPGSGFHFLINLYFLYNYSRRLETDQYSGKPADYFFMLIFNWICCVIVGLIAEIPLLL  121
            P+S  + FHFLIN +F+  YS +LE DQYS  PADY ++LI + +   I G+I  +  L+
Sbjct  62   PISSNTAFHFLINCFFIVQYSSKLEKDQYSRSPADYLYLLIVSAVLANIGGMIFNVYFLM  121

Query  122  DPMVLSILYIWCQLNKDVIVNFWFGTRFKAMYLPWVLLAFNMVISGGGLYEIIGILIGHL  181
            D +VL+I YIWCQLNKDV V+FWFGTRFKAMYLPWVL AF  +     L  ++GI +GH+
Sbjct  122  DTLVLAITYIWCQLNKDVTVSFWFGTRFKAMYLPWVLAAFEFIFH-FSLASLVGIFVGHV  180

Query  182  YFFLMFKYPQELGGPVLLQTPSILKEWFPDNFGGVHGFGQPPQRAPRPPPATRGGLFRGG  241
            Y+F  F+Y Q+LGG  LL+TP  LK   PD  GG  GFG PP+    P  AT        
Sbjct  181  YYFFKFQYSQDLGGTPLLETPQFLKRLVPDVSGGFGGFGLPPESRAPPRQATESP-----  235

Query  242  HNWGRGNVLGGN  253
              WGRG  LG N
Sbjct  236  --WGRGMTLGRN  245


>Q9VEU2_DROME unnamed protein product
Length=261

 Score = 109 bits (273),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 69/215 (32%), Positives = 110/215 (51%), Gaps = 8/215 (4%)

Query  1    MSDLGDWFRSVPFFTRYWLTLTVGFTLAGRIGIFRPHTMILLYEP---LTRFQIWRLFTC  57
            M+ L  ++  +P  TR + T+ V  TLA  + +  P  + L + P   + +FQIWRL T 
Sbjct  1    MNALRQFYLEIPVVTRAYTTVCVLTTLAVHLDLVSP--LQLYFNPTLIVRKFQIWRLATT  58

Query  58   LFYYPLSPGSGFHFLINLYFLYNYSRRLETDQYSGKPADYFFMLIFNWICCVIVGLIAEI  117
              Y+      G  F  N+ F Y Y R LE   + G+ +D+  M IF  +     G+   +
Sbjct  59   FLYFG---TIGISFFFNMVFTYRYCRMLEDGSFRGRSSDFVMMFIFGGVLMTFFGIFVNL  115

Query  118  PLLLDPMVLSILYIWCQLNKDVIVNFWFGTRFKAMYLPWVLLAFNMVISGGGLYEIIGIL  177
              L     L ++Y+W + N  V +NF+    F+A YLPWVLL  +M++      ++IG+ 
Sbjct  116  LFLGQAFTLMLVYVWSRRNPLVPMNFFGVLNFQAPYLPWVLLCCSMILGNTVWVDVIGMG  175

Query  178  IGHLYFFLMFKYPQELGGPVLLQTPSILKEWFPDN  212
            +GH+Y+ L   YP    G  L++TP  LK  F ++
Sbjct  176  VGHIYYVLEDVYPTLSNGYRLIKTPYFLKRLFNEH  210



Lambda      K        H
   0.313    0.129    0.370 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 17440693000


Query= XP_031327230.1 40S ribosomal protein S12 [Photinus pyralis]

Length=140
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RS12_DICDI  unnamed protein product                                   138     6e-43
RS12_TRYBB  unnamed protein product                                   103     6e-29
Q38AC1_TRYB2  unnamed protein product                                 99.0    3e-27


>RS12_DICDI unnamed protein product
Length=136

 Score = 138 bits (348),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 81/112 (72%), Gaps = 0/112 (0%)

Query  25   ALQEVLKIALIHDGVLRGLHEAAKALDKRQAVLCILAENCNEPMFKKLVSALCAEHQIPL  84
            ALQ+V+K +L   GV RGLHE  KALDKR A LC+LA NC+EP F +LV AL  EH IPL
Sbjct  22   ALQKVIKESLAVQGVARGLHETVKALDKRTARLCVLASNCDEPNFVRLVKALATEHNIPL  81

Query  85   IKVDNNKKLGEWAGLCKIDNTGKARKVVGCSCVVIKDFGEESPALDILQEYL  136
            I+V +NK LGEWAGLCK+D    ARKVV CS +VIK FG+ES     L EY+
Sbjct  82   IEVPDNKALGEWAGLCKLDKDLAARKVVACSTLVIKTFGKESDDYKFLMEYI  133


>RS12_TRYBB unnamed protein product
Length=144

 Score = 103 bits (256),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 78/117 (67%), Gaps = 4/117 (3%)

Query  25   ALQEVLKIALIH----DGVLRGLHEAAKALDKRQAVLCILAENCNEPMFKKLVSALCAEH  80
            +L++ L+I L+     +G++ GL E  +ALD+R A LC+LA++C +  +KKLV+AL  ++
Sbjct  28   SLEDALRIVLMKARETNGLICGLSEVTRALDRRTAHLCVLADDCEDEEYKKLVTALAKQN  87

Query  81   QIPLIKVDNNKKLGEWAGLCKIDNTGKARKVVGCSCVVIKDFGEESPALDILQEYLK  137
             I L+ +D  +KL +WAGL ++   G  RK + CSC+ ++DFGE + ALD L   L+
Sbjct  88   NIDLVSMDEREKLAQWAGLTRMAADGSVRKTLKCSCLAVRDFGERTKALDYLLSQLQ  144


>Q38AC1_TRYB2 unnamed protein product
Length=142

 Score = 99.0 bits (245),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 78/113 (69%), Gaps = 5/113 (4%)

Query  22   VNQALQEVLKIALIHDGVLRGLHEAAKALDKRQAVLCILAENCNEPMFKKLVSALCAEHQ  81
            +  A++ V++ AL  +G++RGL E A+ALD+R A +CILA +C++  +KKL+ AL  +  
Sbjct  27   LQDAIRIVIRKALEVNGLVRGLSEVARALDRRTAHMCILATDCDDEEYKKLIKALALQAS  86

Query  82   IPLIKVDNNKKLGEWAGLC--KIDNTGKARKVVGCSCVVIKDFGEESPALDIL  132
            I +I+VD+ ++L EWAGL   K D T K  K   CSCV I+DFGE + ALD+L
Sbjct  87   IDIIEVDSREELAEWAGLQRRKQDETVKTFK---CSCVAIRDFGERTKALDML  136



Lambda      K        H
   0.313    0.129    0.370 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 17440693000


Query= XP_031327231.1 uncharacterized protein LOC116158575 isoform X1
[Photinus pyralis]

Length=586
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q54TS2_DICDI  unnamed protein product                                 32.3    1.6  
Q9VW23_DROME  unnamed protein product                                 32.0    1.8  
A0A0B4K718_DROME  unnamed protein product                             31.6    2.5  


>Q54TS2_DICDI unnamed protein product
Length=1706

 Score = 32.3 bits (72),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 18/61 (30%), Positives = 29/61 (48%), Gaps = 7/61 (11%)

Query  14    PGAVLRHGVNIEDHSNLELQRW-------LECRALKKTGNKTDLVQRVVNCIEAGRSNSI  66
             P A+L   ++I   S ++ + W          R LKK  NK   ++ ++  IE+G  N I
Sbjct  1013  PSALLLDSIDIPKGSEIQNELWSADYGPDFALRELKKLKNKYSEIKNIIKSIESGNLNEI  1072

Query  67    S  67
             S
Sbjct  1073  S  1073


>Q9VW23_DROME unnamed protein product
Length=1174

 Score = 32.0 bits (71),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 24/87 (28%), Positives = 37/87 (43%), Gaps = 17/87 (20%)

Query  479   NSVLTGQQQSNFFAYEENNKVFLKANHPYNYQVATTMLIFEVPECDF-------VVWSSV  531
             N VLT     N+  +          +HP N   AT   +F+   CD        +   + 
Sbjct  1079  NRVLTMTPWGNYVVFR---------HHPTNRSAATWFYVFDGCTCDIDRFRHLDLSTGTA  1129

Query  532   GLLVFKVQLSDISRHVIDDITKKLKKM  558
             GL+ F+ Q S++  H+ID   +K  KM
Sbjct  1130  GLIAFRKQ-SEVVCHIIDSREEKALKM  1155


>A0A0B4K718_DROME unnamed protein product
Length=4100

 Score = 31.6 bits (70),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 27/43 (63%), Gaps = 1/43 (2%)

Query  535   VFKVQLSDISRHVIDDITKKLKKMYYNMYIPELFLMRIPRNLP  577
             +  V+L+D  +H +D++ ++L+K Y N+     FL RI R LP
Sbjct  968   LIGVRLND-RQHELDNLNEELRKQYENLKGLAQFLERIQRQLP  1009



Lambda      K        H
   0.313    0.129    0.370 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 17440693000


Query= XP_031327232.1 uncharacterized protein LOC116158575 isoform X2
[Photinus pyralis]

Length=586
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q54TS2_DICDI  unnamed protein product                                 32.3    1.6  
Q9VW23_DROME  unnamed protein product                                 32.0    1.8  
A0A0B4K718_DROME  unnamed protein product                             31.6    2.5  


>Q54TS2_DICDI unnamed protein product
Length=1706

 Score = 32.3 bits (72),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 18/61 (30%), Positives = 29/61 (48%), Gaps = 7/61 (11%)

Query  14    PGAVLRHGVNIEDHSNLELQRW-------LECRALKKTGNKTDLVQRVVNCIEAGRSNSI  66
             P A+L   ++I   S ++ + W          R LKK  NK   ++ ++  IE+G  N I
Sbjct  1013  PSALLLDSIDIPKGSEIQNELWSADYGPDFALRELKKLKNKYSEIKNIIKSIESGNLNEI  1072

Query  67    S  67
             S
Sbjct  1073  S  1073


>Q9VW23_DROME unnamed protein product
Length=1174

 Score = 32.0 bits (71),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 24/87 (28%), Positives = 37/87 (43%), Gaps = 17/87 (20%)

Query  479   NSVLTGQQQSNFFAYEENNKVFLKANHPYNYQVATTMLIFEVPECDF-------VVWSSV  531
             N VLT     N+  +          +HP N   AT   +F+   CD        +   + 
Sbjct  1079  NRVLTMTPWGNYVVFR---------HHPTNRSAATWFYVFDGCTCDIDRFRHLDLSTGTA  1129

Query  532   GLLVFKVQLSDISRHVIDDITKKLKKM  558
             GL+ F+ Q S++  H+ID   +K  KM
Sbjct  1130  GLIAFRKQ-SEVVCHIIDSREEKALKM  1155


>A0A0B4K718_DROME unnamed protein product
Length=4100

 Score = 31.6 bits (70),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 27/43 (63%), Gaps = 1/43 (2%)

Query  535   VFKVQLSDISRHVIDDITKKLKKMYYNMYIPELFLMRIPRNLP  577
             +  V+L+D  +H +D++ ++L+K Y N+     FL RI R LP
Sbjct  968   LIGVRLND-RQHELDNLNEELRKQYENLKGLAQFLERIQRQLP  1009



Lambda      K        H
   0.313    0.129    0.370 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 17440693000


Query= XP_031327233.1 uncharacterized protein LOC116158576 isoform X1
[Photinus pyralis]

Length=1161


***** No hits found *****



Lambda      K        H
   0.313    0.129    0.370 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 17440693000


Query= XP_031327234.1 uncharacterized protein LOC116158576 isoform X2
[Photinus pyralis]

Length=997
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q57W57_TRYB2  unnamed protein product                                 38.5    0.038


>Q57W57_TRYB2 unnamed protein product
Length=6062

 Score = 38.5 bits (88),  Expect = 0.038, Method: Composition-based stats.
 Identities = 39/141 (28%), Positives = 61/141 (43%), Gaps = 13/141 (9%)

Query  663  RNELCVQCLKELCQKRRKNKVKTLKSVVTDNEKEIKDELKVVEKLKDVLDKEGDLIGPAF  722
            RNE  ++   EL  KR+  ++K    V TD   E++  L+  E+     ++E + +  + 
Sbjct  414  RNERMMRENTEL--KRKNEELKKEIKVATDKITELQRNLQASERTNRYAEEECEHLRDSL  471

Query  723  KKIAKNNVNLIKKVIECVKPEANFAK--TETSATTALEDAVVRAVKEATDDNLNEFIKIS  780
             K+ K   NL KK+ E    E    K   E  AT   + A +RA+ E            +
Sbjct  472  LKVEKQKANLAKKLSESTGNEFQLQKQAVELHATLEEQAACIRALSEQI---------TA  522

Query  781  EQNDIRDFIGEAVSFAQVLSL  801
                +RD  GE  S A +L L
Sbjct  523  ADAYLRDAEGECGSLAGLLGL  543



Lambda      K        H
   0.313    0.129    0.370 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 17440693000


Query= XP_031327235.1 1,5-anhydro-D-fructose reductase-like [Photinus
pyralis]

Length=326
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8T492_DROME  unnamed protein product                                 216     3e-68
ALRA_DICDI  unnamed protein product                                   215     4e-68
Q9VTL0_DROME  unnamed protein product                                 215     1e-67


>Q8T492_DROME unnamed protein product
Length=322

 Score = 216 bits (550),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 118/315 (37%), Positives = 182/315 (58%), Gaps = 18/315 (6%)

Query  15   MPVLGYGTWQSKDSELENALELALEAGYRHIDTAYVYENEKVIGNVIHRWISADKLKRED  74
            MP+LG GTW+S    +  A++ A++ GYRH D A++Y NE  +G  +   +    + R++
Sbjct  14   MPMLGLGTWRSPPEVVTQAVKDAIDIGYRHFDCAHIYGNEAQVGAALREKMDEGVVTRDE  73

Query  75   LFLVTKLPPSGNRPEGVAKFLKRSLENLRVTYIDLYLIHLPMAFKDIEGDLHPTTPEGEM  134
            LF+ +KL  + ++P+ V    + S+ NL V Y++LYL+H PMA+K    +L+PT P+   
Sbjct  74   LFITSKLWNTHHKPDLVRPACETSIRNLGVKYLNLYLMHWPMAYKSGSDNLYPTCPDTNK  133

Query  135  DIDVTTNHVAIWKEMESQVDAGLVKAIGISNFNQNQIQRIIDHARIKPVNLQIELHAYFQ  194
                  ++V  W+ ME+ VD GL +AIG+SNFN+ Q+ R++  A++KPV LQIE H Y  
Sbjct  134  AAFEDIDYVDTWRAMENLVDEGLCQAIGVSNFNEQQMNRLLSVAKLKPVVLQIECHPYLS  193

Query  195  QKGMVNFCRANNISVTCYSPLGTPGLGKFMAAFGTHMEMPD---ILNNPMVTKIAAKWNK  251
            QK ++  C  N I+VT YS LG+           T  E P    +L +P +  IA K+ +
Sbjct  194  QKPLITLCYDNAIAVTAYSCLGSG---------HTPYEKPGAYPLLQHPTILAIAEKYER  244

Query  252  SGAQVLIRHCIQKGLIAIPKSVTASRIKENI-NIFDFNLDDHDMDVLNNLDQGAIARLLD  310
            + AQVL+R+  Q G+I IP+SV+   + +N   I+DF L   D+  +N LD     R + 
Sbjct  245  TAAQVLLRYQTQSGIIVIPRSVSKQHMLDNFKRIWDFELAVDDIQAINELDCN--GRFMT  302

Query  311  FSAFPGIKKHPEYPF  325
              A  G   HP +PF
Sbjct  303  MKAAYG---HPHHPF  314


>ALRA_DICDI unnamed protein product
Length=297

 Score = 215 bits (547),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 118/305 (39%), Positives = 181/305 (59%), Gaps = 24/305 (8%)

Query  14   KMPVLGYGTWQSKDSELENALELALEAGYRHIDTAYVYENEKVIGNVI-HRWISADKLKR  72
            K+P++G+GTW+++ + +  A+E+AL+AGYRHID A VY NEK +G     ++ +   +KR
Sbjct  12   KIPLVGFGTWKAETTLVGKAVEVALDAGYRHIDCAAVYLNEKEVGEAFTKKFTTEATVKR  71

Query  73   EDLFLVTKLPPSGNRPEGVAKFLKRSLENLRVTYIDLYLIHLPMAFKDIEGDLHPTTPEG  132
            ED+F+ +KL  + ++ E V   L+R+L +L + Y+DLYL+H P+AF+    D+  +    
Sbjct  72   EDVFITSKLWNTFHKKEHVRPALERTLSDLGLQYLDLYLVHWPVAFEYTSNDIQTSGSTQ  131

Query  133  EMDIDVTTNHVAIWKEMESQVDAGLVKAIGISNFNQNQIQRIIDHARIKPVNLQIELHAY  192
            E       +    W+EME  VDAGLVK+IG+SNFN   +  ++ +ARIKP   Q+ELH +
Sbjct  132  EF-----VSIRETWEEMEKLVDAGLVKSIGLSNFNVQGLMEVLSYARIKPAANQVELHPF  186

Query  193  FQQKGMVNFCRANNISVTCYSPLGTPGLGKFMAAFGTHMEMPDILNNPMVTKIAAKWNKS  252
              Q  +  FC  +NI +T YSPLG    G F             ++N  V  IA K+NK+
Sbjct  187  LSQPELKKFCDKHNIHLTAYSPLGN---GAF-------------VDNEEVGAIAKKYNKT  230

Query  253  GAQVLIRHCIQKGLIAIPKSVTASRIKENINIFDFNLDDHDMDVLNNLDQGAIARLLDFS  312
               VL +  IQK    IPKS T SR+ EN ++F+F +++ DM  L+ +D+    R  D +
Sbjct  231  IPNVLCKWAIQKNFSVIPKSSTPSRVAENFDLFNFEIEEADMLFLDKMDKN--LRTCDPA  288

Query  313  AFPGI  317
             F G+
Sbjct  289  KFWGV  293


>Q9VTL0_DROME unnamed protein product
Length=322

 Score = 215 bits (547),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 118/315 (37%), Positives = 181/315 (57%), Gaps = 18/315 (6%)

Query  15   MPVLGYGTWQSKDSELENALELALEAGYRHIDTAYVYENEKVIGNVIHRWISADKLKRED  74
            MP+LG GTW+S    +  A++ A++ GYRH D A++Y NE  +G  +   +    + R++
Sbjct  14   MPMLGLGTWRSPPEVVTQAVKDAIDIGYRHFDCAHIYGNEAQVGAALREKMDEGVVTRDE  73

Query  75   LFLVTKLPPSGNRPEGVAKFLKRSLENLRVTYIDLYLIHLPMAFKDIEGDLHPTTPEGEM  134
            LF+ +KL  + ++P+ V    + S+ NL V Y++LYL+H PMA+K    +L+PT P+   
Sbjct  74   LFITSKLWNTHHKPDLVRPACETSIRNLGVKYLNLYLMHWPMAYKSGSDNLYPTCPDTNK  133

Query  135  DIDVTTNHVAIWKEMESQVDAGLVKAIGISNFNQNQIQRIIDHARIKPVNLQIELHAYFQ  194
                  ++V  W+ ME+ VD GL +AIG+SNFN+ Q+ R++  A++KPV LQIE H Y  
Sbjct  134  AAFEDIDYVDTWRAMENLVDEGLCQAIGVSNFNEQQMNRLLSVAKLKPVVLQIECHPYLS  193

Query  195  QKGMVNFCRANNISVTCYSPLGTPGLGKFMAAFGTHMEMPD---ILNNPMVTKIAAKWNK  251
            QK ++  C  N I+VT YS LG+           T  E P    +L +P +  IA K+ +
Sbjct  194  QKPLITLCYDNAIAVTAYSCLGSG---------HTPYEKPGAYPLLQHPTILAIAEKYER  244

Query  252  SGAQVLIRHCIQKGLIAIPKSVTASRIKENI-NIFDFNLDDHDMDVLNNLDQGAIARLLD  310
            + AQVL+R   Q G+I IP+SV+   + +N   I+DF L   D+  +N LD     R + 
Sbjct  245  TAAQVLLRFQTQSGIIVIPRSVSKQHMLDNFKRIWDFELAVDDIQAINELDCN--GRFMT  302

Query  311  FSAFPGIKKHPEYPF  325
              A  G   HP +PF
Sbjct  303  MKAAYG---HPHHPF  314



Lambda      K        H
   0.313    0.129    0.370 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 17440693000


Query= XP_031327236.1 uncharacterized protein LOC116158578 isoform X1
[Photinus pyralis]

Length=300
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q57ZF8_TRYB2  unnamed protein product                                 29.6    3.9  
Q388Q8_TRYB2  unnamed protein product                                 28.9    6.7  
O17099_CAEEL  unnamed protein product                                 28.5    7.0  


>Q57ZF8_TRYB2 unnamed protein product
Length=662

 Score = 29.6 bits (65),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 26/49 (53%), Gaps = 6/49 (12%)

Query  236  TNTRMRRDFVSLGD---NIVQCEASIQEEINVFEGASGCNYPSYKTNIN  281
            T  RMRRDF+S  +   N++ C+ S QEEI      SG      K NI+
Sbjct  100  TRKRMRRDFISFKEEDRNLLPCKVS-QEEIGYSGRKSGSK--EIKNNID  145


>Q388Q8_TRYB2 unnamed protein product
Length=684

 Score = 28.9 bits (63),  Expect = 6.7, Method: Compositional matrix adjust.
 Identities = 35/122 (29%), Positives = 54/122 (44%), Gaps = 22/122 (18%)

Query  84   SIDNVSTAGESATPTIILL--PYGRMLVVD----RNVFRQLQADRTGIDFI-ELSANLIL  136
            S++     G S TP II L     R+ + D    R + ++L+    G+ F+ +LS    L
Sbjct  151  SVEPSEVPGASPTPIIIQLFRCEQRLNIADCMRTRLLQKELRRTEGGLQFLHQLSKGSNL  210

Query  137  QDQNGSHADTLESEDTSKGLSLVSLDFLPPPY-------------DDIFGLKNSDLPPSY  183
             DQN   A  LES+ +    S+ ++  +  PY             DDIF     +LP S 
Sbjct  211  MDQNMVAA--LESKPSLAAESVSTVSAVETPYSGHIVWEKDGWFFDDIFSSSEIELPASS  268

Query  184  SE  185
            S+
Sbjct  269  SD  270


>O17099_CAEEL unnamed protein product
Length=374

 Score = 28.5 bits (62),  Expect = 7.0, Method: Compositional matrix adjust.
 Identities = 26/94 (28%), Positives = 47/94 (50%), Gaps = 3/94 (3%)

Query  177  SDLPPSYSEISVMLQK-LNGKPLDSEQLHKSELSVIMVKPKECILRTSSDPFILTDKMYH  235
            + LP +++ +  + QK L   PL+  +L + +LS  + K +E + +T         +   
Sbjct  188  ASLPKNFALLQAIDQKTLRVPPLEIAKL-RQQLSCQLSKLEEQVSKTDKS-IKAVGRAQL  245

Query  236  TNTRMRRDFVSLGDNIVQCEASIQEEINVFEGAS  269
            +N +  R+F    D+IV   ASI+E IN  E  +
Sbjct  246  SNLKDGREFQERKDSIVSYYASIRETINALENEA  279



Lambda      K        H
   0.313    0.129    0.370 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 17440693000


Query= XP_031327237.1 uncharacterized protein LOC116158578 isoform X2
[Photinus pyralis]

Length=283
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q57ZF8_TRYB2  unnamed protein product                                 29.6    3.6  
Q388Q8_TRYB2  unnamed protein product                                 29.3    4.9  
O17099_CAEEL  unnamed protein product                                 28.9    5.5  


>Q57ZF8_TRYB2 unnamed protein product
Length=662

 Score = 29.6 bits (65),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 26/49 (53%), Gaps = 6/49 (12%)

Query  219  TNTRMRRDFVSLGD---NIVQCEASIQEEINVFEGASGCNYPSYKTNIN  264
            T  RMRRDF+S  +   N++ C+ S QEEI      SG      K NI+
Sbjct  100  TRKRMRRDFISFKEEDRNLLPCKVS-QEEIGYSGRKSGSK--EIKNNID  145


>Q388Q8_TRYB2 unnamed protein product
Length=684

 Score = 29.3 bits (64),  Expect = 4.9, Method: Compositional matrix adjust.
 Identities = 35/122 (29%), Positives = 54/122 (44%), Gaps = 22/122 (18%)

Query  67   SIDNVSTAGESATPTIILL--PYGRMLVVD----RNVFRQLQADRTGIDFI-ELSANLIL  119
            S++     G S TP II L     R+ + D    R + ++L+    G+ F+ +LS    L
Sbjct  151  SVEPSEVPGASPTPIIIQLFRCEQRLNIADCMRTRLLQKELRRTEGGLQFLHQLSKGSNL  210

Query  120  QDQNGSHADTLESEDTSKGLSLVSLDFLPPPY-------------DDIFGLKNSDLPPSY  166
             DQN   A  LES+ +    S+ ++  +  PY             DDIF     +LP S 
Sbjct  211  MDQNMVAA--LESKPSLAAESVSTVSAVETPYSGHIVWEKDGWFFDDIFSSSEIELPASS  268

Query  167  SE  168
            S+
Sbjct  269  SD  270


>O17099_CAEEL unnamed protein product
Length=374

 Score = 28.9 bits (63),  Expect = 5.5, Method: Compositional matrix adjust.
 Identities = 26/94 (28%), Positives = 47/94 (50%), Gaps = 3/94 (3%)

Query  160  SDLPPSYSEISVMLQK-LNGKPLDSEQLHKSELSVIMVKPKECILRTSSDPFILTDKMYH  218
            + LP +++ +  + QK L   PL+  +L + +LS  + K +E + +T         +   
Sbjct  188  ASLPKNFALLQAIDQKTLRVPPLEIAKL-RQQLSCQLSKLEEQVSKTDKS-IKAVGRAQL  245

Query  219  TNTRMRRDFVSLGDNIVQCEASIQEEINVFEGAS  252
            +N +  R+F    D+IV   ASI+E IN  E  +
Sbjct  246  SNLKDGREFQERKDSIVSYYASIRETINALENEA  279



Lambda      K        H
   0.313    0.129    0.370 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 17440693000


Query= XP_031327238.1 uncharacterized protein LOC116158578 isoform X3
[Photinus pyralis]

Length=121
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q2XYI2_DROME  unnamed protein product                                 29.3    0.63 
Q7KU87_DROME  unnamed protein product                                 29.6    0.71 
Q86NW6_DROME  unnamed protein product                                 29.3    0.87 


>Q2XYI2_DROME unnamed protein product
Length=169

 Score = 29.3 bits (64),  Expect = 0.63, Method: Compositional matrix adjust.
 Identities = 10/42 (24%), Positives = 25/42 (60%), Gaps = 0/42 (0%)

Query  19   NGDTYIVNTGSASGVYVPSVSQGLPTLIVMVVVLVIIVLFCF  60
            +G+ + +N GSA+G + P  +  +P+ ++M +    +V + +
Sbjct  117  HGNKFYINPGSATGAFNPLDTNVVPSFVLMDIQSTTVVTYVY  158


>Q7KU87_DROME unnamed protein product
Length=872

 Score = 29.6 bits (65),  Expect = 0.71, Method: Composition-based stats.
 Identities = 12/23 (52%), Positives = 16/23 (70%), Gaps = 0/23 (0%)

Query  73   RICCCCAMDEPSIDNVLEDEMSD  95
            RIC C +++E S D +LEDE  D
Sbjct  250  RICSCQSLNEKSHDELLEDECFD  272


>Q86NW6_DROME unnamed protein product
Length=1191

 Score = 29.3 bits (64),  Expect = 0.87, Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 16/23 (70%), Gaps = 0/23 (0%)

Query  73   RICCCCAMDEPSIDNVLEDEMSD  95
            RIC C +++E S D +LEDE  D
Sbjct  569  RICSCQSLNEKSHDELLEDECFD  591



Lambda      K        H
   0.313    0.129    0.370 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 17440693000


Query= XP_031327239.1 ras-related protein Rab-23 [Photinus pyralis]

Length=206
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VNG6_DROME  unnamed protein product                                 267     7e-91
Q38AB6_TRYB2  unnamed protein product                                 117     1e-32
Q7K6A8_PLAF7  unnamed protein product                                 116     2e-32


>Q9VNG6_DROME unnamed protein product
Length=268

 Score = 267 bits (683),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 139/224 (62%), Positives = 160/224 (71%), Gaps = 26/224 (12%)

Query  1    MIQRYCKGIFTKDYKKTIGVDFLERQIEVDGEEVRLMLWDTAGQEEFDAITKAYYRGAQA  60
            MIQRYCKGIFTKDYKKTIGVDFLERQIE+DGE+VR+MLWDTAGQEEFD ITKAYYRGAQA
Sbjct  53   MIQRYCKGIFTKDYKKTIGVDFLERQIEIDGEDVRIMLWDTAGQEEFDCITKAYYRGAQA  112

Query  61   CVLAFSTTDRDSFEAAHSWKLKVENECGEIPTVIVQNKIDLVDQTVVNPEEAELLARALG  120
             VL FSTTDR SF+A   WK KVENEC EIPTVIVQNKIDL++Q VV  +E E LA+ L 
Sbjct  113  SVLVFSTTDRASFDAIKDWKRKVENECNEIPTVIVQNKIDLIEQAVVTADEVETLAKLLN  172

Query  121  CRLLRTSVKEDINVASVFRHLAARCLAELRDCRDD------------YYSTPNGHQPVTI  168
            CRL+RTSVKEDINVASVFR+LA +C   +    D             Y STP      TI
Sbjct  173  CRLIRTSVKEDINVASVFRYLATKCHQLMTQSYDQVAGNQQNSSHPPYSSTP------TI  226

Query  169  NSFNPSQADKSQQNGTIVLRPNKH------KKKKNVIKNVCRIL  206
            ++F+P+    S  +GTIVLRP K        +K+ ++   C IL
Sbjct  227  SAFSPTFTKSS--SGTIVLRPAKKGHGSSVARKRKIVLKKCGIL  268


>Q38AB6_TRYB2 unnamed protein product
Length=226

 Score = 117 bits (293),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 83/150 (55%), Gaps = 2/150 (1%)

Query  1    MIQRYCKGIFTKDYKKTIGVDFLERQIEVD--GEEVRLMLWDTAGQEEFDAITKAYYRGA  58
            +++R+  G F+  Y +T+GV+++E+ + +      V L LWDTAGQE   ++   YY  A
Sbjct  25   LLRRFVTGTFSNQYNRTVGVEYMEKSVCLRQRSTTVNLFLWDTAGQETVSSVKDIYYLDA  84

Query  59   QACVLAFSTTDRDSFEAAHSWKLKVENECGEIPTVIVQNKIDLVDQTVVNPEEAELLARA  118
               +L FST   +SF     WK  VE  CG IP V+ Q K DL  Q  V  EE E LA  
Sbjct  85   AVAILVFSTDSSESFARIEMWKRCVERVCGSIPMVLCQTKFDLARQAAVVAEEVEKLAVK  144

Query  119  LGCRLLRTSVKEDINVASVFRHLAARCLAE  148
            L   L R S K+  NV  +F ++AA C++E
Sbjct  145  LQLPLFRVSTKDGFNVTQLFEYVAAMCVSE  174


>Q7K6A8_PLAF7 unnamed protein product
Length=200

 Score = 116 bits (290),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/197 (35%), Positives = 101/197 (51%), Gaps = 23/197 (12%)

Query  1    MIQRYCKGIFTKDYKKTIGVDFLERQIEVDGEEVRLMLWDTAGQEEFDAITKAYYRGAQA  60
            ++ R+    +T  Y  TIGVDF  + IE++ + ++L +WDTAGQE F  IT +YYRGAQ 
Sbjct  24   LLLRFADDTYTDSYISTIGVDFKIKTIEIEDKIIKLQIWDTAGQERFRTITSSYYRGAQG  83

Query  61   CVLAFSTTDRDSFEAAHSWKLKVENECGE-IPTVIVQNKIDLVDQTVVNPEEAELLARAL  119
             ++ +  TDRDSF    +W +++E    E +  +++ NKIDL +   V+ EE + LA + 
Sbjct  84   IIIVYDVTDRDSFNNVKNWIIEIEKYASEDVQKILIGNKIDLKNDRNVSYEEGKELADSC  143

Query  120  GCRLLRTSVKEDINVASVFRHLAARCLAELRDCRDDYYSTPNGHQPVTINSFNPSQADKS  179
              + L TS K   NV   F+ +A              Y   N  Q  TIN        K 
Sbjct  144  NIQFLETSAKIAHNVEQAFKTMA--------------YEIKNKSQHETIN--------KG  181

Query  180  QQNGTIVLRPNKHKKKK  196
            + N  +  RP K  KKK
Sbjct  182  KTNINLNARPIKDTKKK  198



Lambda      K        H
   0.313    0.129    0.370 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 17440693000


Query= XP_031327240.1 uncharacterized protein LOC116158580 [Photinus
pyralis]

Length=289
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

LIN59_CAEEL  unnamed protein product                                  29.3    5.5  


>LIN59_CAEEL unnamed protein product
Length=1312

 Score = 29.3 bits (64),  Expect = 5.5, Method: Compositional matrix adjust.
 Identities = 13/41 (32%), Positives = 24/41 (59%), Gaps = 1/41 (2%)

Query  110  ILARSMGRAAGGIVADYIGAFITRRR-NKRFANEKNPDLPA  149
            +L   + R AG  + +Y G  ITR +  ++FA +++P + A
Sbjct  651  VLKTKIARRAGEFLCEYAGEVITREQAQEKFAQDRDPRIIA  691



Lambda      K        H
   0.313    0.129    0.370 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 17440693000


Query= XP_031327241.1 uncharacterized protein LOC116158580 [Photinus
pyralis]

Length=289
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

LIN59_CAEEL  unnamed protein product                                  29.3    5.5  


>LIN59_CAEEL unnamed protein product
Length=1312

 Score = 29.3 bits (64),  Expect = 5.5, Method: Compositional matrix adjust.
 Identities = 13/41 (32%), Positives = 24/41 (59%), Gaps = 1/41 (2%)

Query  110  ILARSMGRAAGGIVADYIGAFITRRR-NKRFANEKNPDLPA  149
            +L   + R AG  + +Y G  ITR +  ++FA +++P + A
Sbjct  651  VLKTKIARRAGEFLCEYAGEVITREQAQEKFAQDRDPRIIA  691



Lambda      K        H
   0.313    0.129    0.370 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 17440693000


Query= XP_031327242.1 uncharacterized protein LOC116158581 isoform X1
[Photinus pyralis]

Length=1104


***** No hits found *****



Lambda      K        H
   0.313    0.129    0.370 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 17440693000


Query= XP_031327243.1 bromodomain-containing protein 4-like isoform X2
[Photinus pyralis]

Length=1080


***** No hits found *****



Lambda      K        H
   0.313    0.129    0.370 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 17440693000


Query= XP_031327244.1 bromodomain-containing protein 4-like isoform X3
[Photinus pyralis]

Length=1079


***** No hits found *****



Lambda      K        H
   0.313    0.129    0.370 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 17440693000


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jan 28, 2021  9:24 PM
  Number of letters in database: 17,197,330
  Number of sequences in database:  25,232



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= XP_031327245.1 uncharacterized protein LOC116158583 [Photinus
pyralis]

Length=142
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

OB99A_DROME  unnamed protein product                                  31.2    0.16 
OB56A_DROME  unnamed protein product                                  30.4    0.32 
Q17461_CAEEL  unnamed protein product                                 28.5    2.2  


>OB99A_DROME unnamed protein product
Length=142

 Score = 31.2 bits (69),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 32/135 (24%), Positives = 57/135 (42%), Gaps = 21/135 (16%)

Query  6    ILLLFCVMAVKGVAVIIYTAVNVQGALA---ECIQ-------LDPKLTILTNGTDSKDAQ  55
            + +  CV+   G+A   Y   N    LA   EC++       L  K        D+K  Q
Sbjct  3    VFVAICVLI--GLASADYVVKNRHDMLAYRDECVKELAVPVDLVEKYQKWEYPNDAK-TQ  59

Query  56   CFLDCMYKKAGLID-EAGHTNETVVDTFIGKESSYGWLKTVVHKCTSSVVNEDE----PC  110
            C++ C++ K GL D ++G   E +    +G  + +       H   ++ V+++E     C
Sbjct  60   CYIKCVFTKWGLFDVQSGFNVENIHQQLVGNHADHN---EAFHASLAACVDKNEQGSNAC  116

Query  111  KTAANLANCEVDEEI  125
            + A   A C + E +
Sbjct  117  EWAYRGATCLLKENL  131


>OB56A_DROME unnamed protein product
Length=139

 Score = 30.4 bits (67),  Expect = 0.32, Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 46/95 (48%), Gaps = 15/95 (16%)

Query  33   AECIQLDPKLTILTNGTD----SKDAQCFLDCMYKKAGLIDEAGHTNETVV----DTFIG  84
            AE ++L  +     N  D    +++ +CF +C ++K G + + G   E+VV       IG
Sbjct  40   AEEVKLTEEEKAKVNAKDFNNPTENIKCFANCFFEKVGTLKD-GELQESVVLEKLGALIG  98

Query  85   KESSYGWLKTVVHKCTSSVVNEDEPCKTAANLANC  119
            +E +    K  + KC +  +  +  C TA+ L +C
Sbjct  99   EEKT----KAALEKCRT--IKGENKCDTASKLYDC  127


>Q17461_CAEEL unnamed protein product
Length=774

 Score = 28.5 bits (62),  Expect = 2.2, Method: Composition-based stats.
 Identities = 12/38 (32%), Positives = 23/38 (61%), Gaps = 0/38 (0%)

Query  2    IRNLILLLFCVMAVKGVAVIIYTAVNVQGALAECIQLD  39
            I+N+IL+L   MA +G A+ +   ++   +   C+Q+D
Sbjct  146  IKNIILILLVTMAFEGPAMNVIGNIHQVASGVACVQID  183



Lambda      K        H
   0.318    0.132    0.386 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 743799300


Query= XP_031327246.1 putative nuclease HARBI1 [Photinus pyralis]

Length=213
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8MRA3_DROME  unnamed protein product                                 34.7    0.059
A1Z9X4_DROME  unnamed protein product                                 34.7    0.059
Q9V787_DROME  unnamed protein product                                 34.3    0.068


>Q8MRA3_DROME unnamed protein product
Length=1228

 Score = 34.7 bits (78),  Expect = 0.059, Method: Composition-based stats.
 Identities = 20/69 (29%), Positives = 33/69 (48%), Gaps = 0/69 (0%)

Query  68   SIGDRFNVSKSSIFHCLIRVCKILNSKGSVFIKWPKGNDAIKTIAGFKKIKSFPGVLGAI  127
            S G R N+S+ S     + +C+ LNS+G+  ++     +   TI    + +SF     A+
Sbjct  698  SDGPRLNISRLSRNDAGVYICEALNSQGTALLEIQVAVEYAPTITAVSEGRSFVAGEPAV  757

Query  128  DGCHINICP  136
              CHI   P
Sbjct  758  LACHIQARP  766


>A1Z9X4_DROME unnamed protein product
Length=1235

 Score = 34.7 bits (78),  Expect = 0.059, Method: Composition-based stats.
 Identities = 20/69 (29%), Positives = 33/69 (48%), Gaps = 0/69 (0%)

Query  68   SIGDRFNVSKSSIFHCLIRVCKILNSKGSVFIKWPKGNDAIKTIAGFKKIKSFPGVLGAI  127
            S G R N+S+ S     + +C+ LNS+G+  ++     +   TI    + +SF     A+
Sbjct  698  SDGPRLNISRLSRNDAGVYICEALNSQGTALLEIQVAVEYAPTITAVSEGRSFVAGEPAV  757

Query  128  DGCHINICP  136
              CHI   P
Sbjct  758  LACHIQARP  766


>Q9V787_DROME unnamed protein product
Length=1235

 Score = 34.3 bits (77),  Expect = 0.068, Method: Composition-based stats.
 Identities = 20/69 (29%), Positives = 33/69 (48%), Gaps = 0/69 (0%)

Query  68   SIGDRFNVSKSSIFHCLIRVCKILNSKGSVFIKWPKGNDAIKTIAGFKKIKSFPGVLGAI  127
            S G R N+S+ S     + +C+ LNS+G+  ++     +   TI    + +SF     A+
Sbjct  698  SDGPRLNISRLSRNDAGVYICEALNSQGTALLEIQVAVEYAPTITAVSEGRSFVAGEPAV  757

Query  128  DGCHINICP  136
              CHI   P
Sbjct  758  LACHIRARP  766



Lambda      K        H
   0.318    0.132    0.386 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 743799300


Query= XP_031327247.1 protein pinocchio-like [Photinus pyralis]

Length=146
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PINO_DROME  unnamed protein product                                   121     1e-34
Q7KWJ1_PLAF7  unnamed protein product                                 28.9    1.0  
LVA_DROME  unnamed protein product                                    27.3    5.9  


>PINO_DROME unnamed protein product
Length=249

 Score = 121 bits (303),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 72/102 (71%), Gaps = 7/102 (7%)

Query  12   HSNSGSLSSFSYSLDDITTCCSP-QFNSEHVLTIEELRLQMSSCFTCGVSWVEDHVSLDC  70
            H N G     S SL D+    SP + + ++VLTIEELR  M SCFTCGVSW +DHVSLDC
Sbjct  98   HHNLG----LSASLPDLVG--SPLEISMDNVLTIEELRQHMGSCFTCGVSWTDDHVSLDC  151

Query  71   SECGGYAMERPCPKCDGTCGSLWKRDLTKTHSSSKAQWEGEC  112
            SECGGY++ERPCP CDG CG  WKRD   +H+ S+A+W G C
Sbjct  152  SECGGYSLERPCPLCDGQCGVQWKRDFAMSHACSQARWVGVC  193


>Q7KWJ1_PLAF7 unnamed protein product
Length=137

 Score = 28.9 bits (63),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 6/38 (16%)

Query  19  SSFSYSLDDITTCCSPQFNSEHVLTIEELRLQMSSCFT  56
           SS   + DDI    S Q      L++EE ++QM+S FT
Sbjct  57  SSLKSTFDDIKKIISKQ------LSVEEDKIQMNSNFT  88


>LVA_DROME unnamed protein product
Length=2779

 Score = 27.3 bits (59),  Expect = 5.9, Method: Composition-based stats.
 Identities = 16/58 (28%), Positives = 29/58 (50%), Gaps = 2/58 (3%)

Query  84    KCDGTCGSLWKRDLTKTHSSSKAQWEGECKRAATKPQPPKSFVSSTAATHEVCAKLEK  141
             KC G   S+W+  L++  ++ KAQ E E  +   +  P     +   AT ++  K++K
Sbjct  2460  KC-GEVASIWQEHLSQREAAFKAQLE-EVTQQQQRELPQSQQSTQGEATSDIMQKMQK  2515



Lambda      K        H
   0.318    0.132    0.386 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 743799300


Query= XP_031327248.1 uncharacterized protein LOC116158585 isoform X1
[Photinus pyralis]

Length=380


***** No hits found *****



Lambda      K        H
   0.318    0.132    0.386 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 743799300


Query= XP_031327249.1 uncharacterized protein LOC116158585 isoform X1
[Photinus pyralis]

Length=380


***** No hits found *****



Lambda      K        H
   0.318    0.132    0.386 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 743799300


Query= XP_031327250.1 uncharacterized protein LOC116158585 isoform X1
[Photinus pyralis]

Length=380


***** No hits found *****



Lambda      K        H
   0.318    0.132    0.386 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 743799300


Query= XP_031327251.1 uncharacterized protein LOC116158585 isoform X2
[Photinus pyralis]

Length=376
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

VRK1_CAEEL  unnamed protein product                                   31.6    1.1  


>VRK1_CAEEL unnamed protein product
Length=610

 Score = 31.6 bits (70),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 24/86 (28%), Positives = 42/86 (49%), Gaps = 5/86 (6%)

Query  80   RKLLQDAIEKGDPPDKEV-WQQFQFLPLRNNIFEAERKSRKATITSDLDS----QMEDHP  134
            +KL+ DAI+K     K+   +Q +      N    +R +R+  +  + D+    ++E  P
Sbjct  310  KKLVTDAIQKTSSDGKKTPTRQKKLAEEDKNAVTPKRSTRRLAVKEESDNKDNDEVEVKP  369

Query  135  EHITSKRKRKIRKMSSSDNDSSGDDE  160
            E   + RKR  RK    +NDS  ++E
Sbjct  370  EKKATPRKRTTRKAVEVNNDSDDNEE  395



Lambda      K        H
   0.318    0.132    0.386 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 743799300


Query= XP_031327252.1 uncharacterized protein LOC116158585 isoform X3
[Photinus pyralis]

Length=340


***** No hits found *****



Lambda      K        H
   0.318    0.132    0.386 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 743799300


Query= XP_031327253.1 uncharacterized protein LOC116158586 [Photinus
pyralis]

Length=262
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VTT2_DROME  unnamed protein product                                 43.1    1e-04
Q95TM2_DROME  unnamed protein product                                 32.3    0.42 
Q9GSR1_DROME  unnamed protein product                                 32.3    0.45 


>Q9VTT2_DROME unnamed protein product
Length=391

 Score = 43.1 bits (100),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/132 (23%), Positives = 59/132 (45%), Gaps = 9/132 (7%)

Query  31   AQSLLFHAKVTGSSISTVASNQSRVENLEPASDNLEQYLENDRHSWSHDETLCLIKSMEV  90
            AQ ++    +  + IS +  N  + E  E      + Y + +RH W  D    L++    
Sbjct  115  AQKMVVEPAIRANGISPLPKNVGKEEKFE------DYYTKTERHVWKKDAEKMLLQLWAQ  168

Query  91   HIEDENHPKKRKFIFENVANDLISNGFQVNATVCHNKWKNLMRSYKTAKDNMLKTGRGPT  150
            H++D     K   I+  +A ++  + F  + T    K  NL R Y+   + + +TG  P+
Sbjct  169  HLKDFRGESKNVIIYRQMAREM--SQFGPSHTELKTKMDNLSRKYRIEAERVRETG-VPS  225

Query  151  RFLFFSEMDGVL  162
            ++  F ++  +L
Sbjct  226  KWEHFHKLQALL  237


>Q95TM2_DROME unnamed protein product
Length=1325

 Score = 32.3 bits (72),  Expect = 0.42, Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 21/40 (53%), Gaps = 1/40 (3%)

Query  78   HDETLCLIKSMEVHIEDENHPKKR-KFIFENVANDLISNG  116
            HDE  CL  ++E  + DE  P K   +I  N   DL+S G
Sbjct  516  HDEIRCLFYAIEHSLPDEKLPSKACGYIMVNTVQDLLSEG  555


>Q9GSR1_DROME unnamed protein product
Length=2130

 Score = 32.3 bits (72),  Expect = 0.45, Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 21/40 (53%), Gaps = 1/40 (3%)

Query  78    HDETLCLIKSMEVHIEDENHPKKR-KFIFENVANDLISNG  116
             HDE  CL  ++E  + DE  P K   +I  N   DL+S G
Sbjct  1321  HDEIRCLFYAIEHSLPDEKLPSKACGYIMVNTVQDLLSEG  1360



Lambda      K        H
   0.318    0.132    0.386 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 743799300


Query= XP_031327254.1 uncharacterized protein LOC116158588 [Photinus
pyralis]

Length=261
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8I5K3_PLAF7  unnamed protein product                                 30.0    2.7  
Q586H3_TRYB2  unnamed protein product                                 28.1    8.1  


>Q8I5K3_PLAF7 unnamed protein product
Length=2329

 Score = 30.0 bits (66),  Expect = 2.7, Method: Composition-based stats.
 Identities = 14/50 (28%), Positives = 26/50 (52%), Gaps = 0/50 (0%)

Query  8     YDTGNQSYGTFNSHRSALSLILSTDLAGHPVVSRFLKGISKLRPQKPRYD  57
             Y+   Q+  ++++   +  + LS  + G P++  F KG+S L P  P  D
Sbjct  1739  YERECQNNNSYSNMYCSYMMKLSKKILGFPLIKDFSKGLSTLEPSLPLND  1788


>Q586H3_TRYB2 unnamed protein product
Length=384

 Score = 28.1 bits (61),  Expect = 8.1, Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 19/50 (38%), Gaps = 0/50 (0%)

Query  198  VNTKIFKAHSTRHAATSKAFQLGVPVETIRQTAGWTAKSKTFCNFYKRPF  247
            VN  +F   +   A TS   QLG P      TAGW   +        RP 
Sbjct  245  VNETMFTPQAQPVAMTSSPSQLGYPQNIGLSTAGWAGAAPHPTGVAMRPV  294



Lambda      K        H
   0.318    0.132    0.386 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 743799300


Query= XP_031327255.1 uncharacterized protein LOC116158589 isoform X1
[Photinus pyralis]

Length=491
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q961H2_DROME  unnamed protein product                                 152     1e-40
Q38CD5_TRYB2  unnamed protein product                                 34.3    0.22 
Q38CD7_TRYB2  unnamed protein product                                 33.5    0.39 


>Q961H2_DROME unnamed protein product
Length=507

 Score = 152 bits (385),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 116/433 (27%), Positives = 208/433 (48%), Gaps = 18/433 (4%)

Query  35   VEPLMFLFVFPSMLLTLSIVNLHMDKACRVNLQLNASVCDGL-SQRNSSMYTSEEENMVQ  93
            +EP +FL  F   L+     N  + + C    + NA+ C+ L      S    E E +VQ
Sbjct  54   LEPAVFLIFFARNLIGAVYQNQILYQTCITIEKFNATQCEPLLGIDRGSDADKEVEVIVQ  113

Query  94   RMVANMNMWKAVIQSVLPPCLLLMLGAWSDKHNRRKLLMGFPIVGEVITVTGFILCTYFF  153
               AN+ M  ++++S++P    L LG WSDK  RR +L+     G +      I+ TY  
Sbjct  114  TYSANIMMTTSLLESIIPAFASLFLGPWSDKFGRRPILLT-TFTGYLTGALILIVITYIT  172

Query  154  YELPMEVTG-VVESLPTSATGGWFVMFMAVYSYVGAVSTLESRTLR--IGALKICATGSI  210
                +     ++ S+P+  +GG   +   +Y Y+  V+    + LR  +    +CA   I
Sbjct  173  RSTNISPWWFLLSSVPSVVSGGTCALITGIYCYISDVAKERKKALRMVLNEASLCA--GI  230

Query  211  MVGTAMSGICYRLIGLYGIFSTALFLFVVGLIYTVLVIREVGTAAPQANKSTYTSYKDFF  270
            MVG   SG  Y       +FS A  L +  L+Y +L + E   +    +  T +  ++FF
Sbjct  231  MVGNVASGYIYAATNALVLFSIAGSLMMFALMYVLLFVPE---SLNPGDIHTGSRVREFF  287

Query  271  NYQHMKSTFYFAFKRRDGNRRARMFVSFVLLCLTFGPVQGETSVVYLFIRKRFQWSEVEF  330
             +  +       FKRR    R  ++++ + L +    ++GE++V Y+F++ +F W+  +F
Sbjct  288  RFDLVTDLIRTCFKRRPNFDRTIIWLTMIALTIAIFDMEGESTVNYMFVQDKFNWTIKDF  347

Query  331  SILFSIKIVLHLVGTVLPLLILSKYLKMDDTVIGMI----CYLGKFVSGFLCAFSTSPLM  386
            S+  + +IV+ +VG+++ +L+L + LKM    + M+    C L   V      +    L 
Sbjct  348  SLFNASRIVIQIVGSIVGMLVLRRVLKMSIVTMAMLSLACCVLESTVRATAVYWQELYLG  407

Query  387  YCIGMVVEMFSPTTFITVRSIGTKLVSVEEQGRLNALNSIFEALIPLGFVSVYNFVYKKT  446
              +GM+  +  P      R+I + +    E G++ AL +  E++ PLG   +Y  VYK T
Sbjct  408  MTLGMMRGVMGP----MCRAILSHVAPATEVGKIFALTTSMESVSPLGAAPLYTTVYKAT  463

Query  447  IDFFPGTFYIVSS  459
            ++ +PG F  +S+
Sbjct  464  LENYPGAFNFISA  476


>Q38CD5_TRYB2 unnamed protein product
Length=466

 Score = 34.3 bits (77),  Expect = 0.22, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 38/84 (45%), Gaps = 16/84 (19%)

Query  233  ALFLFVVGLIYTV-----LVIREVGTA----APQANKSTYTSYKDFFNYQHMKSTFYFAF  283
            A  + VV L  TV     L +R  G+      P  N+  ++ Y D    Q  K  FY+AF
Sbjct  14   AACILVVVLANTVYRSLSLALRTTGSGWEPCDPGVNQ--WSGYFDIPGEQSDKHYFYWAF  71

Query  284  KRRDGNRRARMFVSFVLLCLTFGP  307
              RDGN  A      VLL +T GP
Sbjct  72   GPRDGNPNAP-----VLLWMTGGP  90


>Q38CD7_TRYB2 unnamed protein product
Length=464

 Score = 33.5 bits (75),  Expect = 0.39, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 24/47 (51%), Gaps = 5/47 (11%)

Query  261  STYTSYKDFFNYQHMKSTFYFAFKRRDGNRRARMFVSFVLLCLTFGP  307
            + ++ Y D    Q  K  FY+AF  RDGN  A      VLL +T GP
Sbjct  46   NQWSGYFDIPGEQSDKHYFYWAFGPRDGNPNAP-----VLLWMTGGP  87



Lambda      K        H
   0.318    0.132    0.386 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 743799300


Query= XP_031327256.1 uncharacterized protein LOC116158589 isoform X2
[Photinus pyralis]

Length=486
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q961H2_DROME  unnamed protein product                                 152     1e-40
Q38CD5_TRYB2  unnamed protein product                                 34.3    0.23 
Q38CD7_TRYB2  unnamed protein product                                 33.5    0.40 


>Q961H2_DROME unnamed protein product
Length=507

 Score = 152 bits (385),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 116/433 (27%), Positives = 208/433 (48%), Gaps = 18/433 (4%)

Query  30   VEPLMFLFVFPSMLLTLSIVNLHMDKACRVNLQLNASVCDGL-SQRNSSMYTSEEENMVQ  88
            +EP +FL  F   L+     N  + + C    + NA+ C+ L      S    E E +VQ
Sbjct  54   LEPAVFLIFFARNLIGAVYQNQILYQTCITIEKFNATQCEPLLGIDRGSDADKEVEVIVQ  113

Query  89   RMVANMNMWKAVIQSVLPPCLLLMLGAWSDKHNRRKLLMGFPIVGEVITVTGFILCTYFF  148
               AN+ M  ++++S++P    L LG WSDK  RR +L+     G +      I+ TY  
Sbjct  114  TYSANIMMTTSLLESIIPAFASLFLGPWSDKFGRRPILLT-TFTGYLTGALILIVITYIT  172

Query  149  YELPMEVTG-VVESLPTSATGGWFVMFMAVYSYVGAVSTLESRTLR--IGALKICATGSI  205
                +     ++ S+P+  +GG   +   +Y Y+  V+    + LR  +    +CA   I
Sbjct  173  RSTNISPWWFLLSSVPSVVSGGTCALITGIYCYISDVAKERKKALRMVLNEASLCA--GI  230

Query  206  MVGTAMSGICYRLIGLYGIFSTALFLFVVGLIYTVLVIREVGTAAPQANKSTYTSYKDFF  265
            MVG   SG  Y       +FS A  L +  L+Y +L + E   +    +  T +  ++FF
Sbjct  231  MVGNVASGYIYAATNALVLFSIAGSLMMFALMYVLLFVPE---SLNPGDIHTGSRVREFF  287

Query  266  NYQHMKSTFYFAFKRRDGNRRARMFVSFVLLCLTFGPVQGETSVVYLFIRKRFQWSEVEF  325
             +  +       FKRR    R  ++++ + L +    ++GE++V Y+F++ +F W+  +F
Sbjct  288  RFDLVTDLIRTCFKRRPNFDRTIIWLTMIALTIAIFDMEGESTVNYMFVQDKFNWTIKDF  347

Query  326  SILFSIKIVLHLVGTVLPLLILSKYLKMDDTVIGMI----CYLGKFVSGFLCAFSTSPLM  381
            S+  + +IV+ +VG+++ +L+L + LKM    + M+    C L   V      +    L 
Sbjct  348  SLFNASRIVIQIVGSIVGMLVLRRVLKMSIVTMAMLSLACCVLESTVRATAVYWQELYLG  407

Query  382  YCIGMVVEMFSPTTFITVRSIGTKLVSVEEQGRLNALNSIFEALIPLGFVSVYNFVYKKT  441
              +GM+  +  P      R+I + +    E G++ AL +  E++ PLG   +Y  VYK T
Sbjct  408  MTLGMMRGVMGP----MCRAILSHVAPATEVGKIFALTTSMESVSPLGAAPLYTTVYKAT  463

Query  442  IDFFPGTFYIVSS  454
            ++ +PG F  +S+
Sbjct  464  LENYPGAFNFISA  476


>Q38CD5_TRYB2 unnamed protein product
Length=466

 Score = 34.3 bits (77),  Expect = 0.23, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 38/84 (45%), Gaps = 16/84 (19%)

Query  228  ALFLFVVGLIYTV-----LVIREVGTA----APQANKSTYTSYKDFFNYQHMKSTFYFAF  278
            A  + VV L  TV     L +R  G+      P  N+  ++ Y D    Q  K  FY+AF
Sbjct  14   AACILVVVLANTVYRSLSLALRTTGSGWEPCDPGVNQ--WSGYFDIPGEQSDKHYFYWAF  71

Query  279  KRRDGNRRARMFVSFVLLCLTFGP  302
              RDGN  A      VLL +T GP
Sbjct  72   GPRDGNPNAP-----VLLWMTGGP  90


>Q38CD7_TRYB2 unnamed protein product
Length=464

 Score = 33.5 bits (75),  Expect = 0.40, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 24/47 (51%), Gaps = 5/47 (11%)

Query  256  STYTSYKDFFNYQHMKSTFYFAFKRRDGNRRARMFVSFVLLCLTFGP  302
            + ++ Y D    Q  K  FY+AF  RDGN  A      VLL +T GP
Sbjct  46   NQWSGYFDIPGEQSDKHYFYWAFGPRDGNPNAP-----VLLWMTGGP  87



Lambda      K        H
   0.318    0.132    0.386 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 743799300


Query= XP_031327257.1 uncharacterized protein LOC116158589 isoform X2
[Photinus pyralis]

Length=486
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q961H2_DROME  unnamed protein product                                 152     1e-40
Q38CD5_TRYB2  unnamed protein product                                 34.3    0.23 
Q38CD7_TRYB2  unnamed protein product                                 33.5    0.40 


>Q961H2_DROME unnamed protein product
Length=507

 Score = 152 bits (385),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 116/433 (27%), Positives = 208/433 (48%), Gaps = 18/433 (4%)

Query  30   VEPLMFLFVFPSMLLTLSIVNLHMDKACRVNLQLNASVCDGL-SQRNSSMYTSEEENMVQ  88
            +EP +FL  F   L+     N  + + C    + NA+ C+ L      S    E E +VQ
Sbjct  54   LEPAVFLIFFARNLIGAVYQNQILYQTCITIEKFNATQCEPLLGIDRGSDADKEVEVIVQ  113

Query  89   RMVANMNMWKAVIQSVLPPCLLLMLGAWSDKHNRRKLLMGFPIVGEVITVTGFILCTYFF  148
               AN+ M  ++++S++P    L LG WSDK  RR +L+     G +      I+ TY  
Sbjct  114  TYSANIMMTTSLLESIIPAFASLFLGPWSDKFGRRPILLT-TFTGYLTGALILIVITYIT  172

Query  149  YELPMEVTG-VVESLPTSATGGWFVMFMAVYSYVGAVSTLESRTLR--IGALKICATGSI  205
                +     ++ S+P+  +GG   +   +Y Y+  V+    + LR  +    +CA   I
Sbjct  173  RSTNISPWWFLLSSVPSVVSGGTCALITGIYCYISDVAKERKKALRMVLNEASLCA--GI  230

Query  206  MVGTAMSGICYRLIGLYGIFSTALFLFVVGLIYTVLVIREVGTAAPQANKSTYTSYKDFF  265
            MVG   SG  Y       +FS A  L +  L+Y +L + E   +    +  T +  ++FF
Sbjct  231  MVGNVASGYIYAATNALVLFSIAGSLMMFALMYVLLFVPE---SLNPGDIHTGSRVREFF  287

Query  266  NYQHMKSTFYFAFKRRDGNRRARMFVSFVLLCLTFGPVQGETSVVYLFIRKRFQWSEVEF  325
             +  +       FKRR    R  ++++ + L +    ++GE++V Y+F++ +F W+  +F
Sbjct  288  RFDLVTDLIRTCFKRRPNFDRTIIWLTMIALTIAIFDMEGESTVNYMFVQDKFNWTIKDF  347

Query  326  SILFSIKIVLHLVGTVLPLLILSKYLKMDDTVIGMI----CYLGKFVSGFLCAFSTSPLM  381
            S+  + +IV+ +VG+++ +L+L + LKM    + M+    C L   V      +    L 
Sbjct  348  SLFNASRIVIQIVGSIVGMLVLRRVLKMSIVTMAMLSLACCVLESTVRATAVYWQELYLG  407

Query  382  YCIGMVVEMFSPTTFITVRSIGTKLVSVEEQGRLNALNSIFEALIPLGFVSVYNFVYKKT  441
              +GM+  +  P      R+I + +    E G++ AL +  E++ PLG   +Y  VYK T
Sbjct  408  MTLGMMRGVMGP----MCRAILSHVAPATEVGKIFALTTSMESVSPLGAAPLYTTVYKAT  463

Query  442  IDFFPGTFYIVSS  454
            ++ +PG F  +S+
Sbjct  464  LENYPGAFNFISA  476


>Q38CD5_TRYB2 unnamed protein product
Length=466

 Score = 34.3 bits (77),  Expect = 0.23, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 38/84 (45%), Gaps = 16/84 (19%)

Query  228  ALFLFVVGLIYTV-----LVIREVGTA----APQANKSTYTSYKDFFNYQHMKSTFYFAF  278
            A  + VV L  TV     L +R  G+      P  N+  ++ Y D    Q  K  FY+AF
Sbjct  14   AACILVVVLANTVYRSLSLALRTTGSGWEPCDPGVNQ--WSGYFDIPGEQSDKHYFYWAF  71

Query  279  KRRDGNRRARMFVSFVLLCLTFGP  302
              RDGN  A      VLL +T GP
Sbjct  72   GPRDGNPNAP-----VLLWMTGGP  90


>Q38CD7_TRYB2 unnamed protein product
Length=464

 Score = 33.5 bits (75),  Expect = 0.40, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 24/47 (51%), Gaps = 5/47 (11%)

Query  256  STYTSYKDFFNYQHMKSTFYFAFKRRDGNRRARMFVSFVLLCLTFGP  302
            + ++ Y D    Q  K  FY+AF  RDGN  A      VLL +T GP
Sbjct  46   NQWSGYFDIPGEQSDKHYFYWAFGPRDGNPNAP-----VLLWMTGGP  87



Lambda      K        H
   0.318    0.132    0.386 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 743799300


Query= XP_031327258.1 uncharacterized protein LOC116158587 [Photinus
pyralis]

Length=523
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7JWH6_DROME  unnamed protein product                                 75.9    1e-14
RPB1_DROME  unnamed protein product                                   31.6    2.0  


>Q7JWH6_DROME unnamed protein product
Length=372

 Score = 75.9 bits (185),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 73/148 (49%), Gaps = 14/148 (9%)

Query  35   PVSVNNEGRESNYNLGSPDGETILDISGCEDQPIQDLTKLLKEWKQEFLLEHFVQQKVFV  94
            P      G   N NL S DG  +L+++G ED   ++L  LL+ W    LL H   + + V
Sbjct  9    PQMPRGSGSVENCNLES-DGLQLLEMAGKED--YEELRDLLQSWDVADLLPHLQDEAINV  65

Query  95   DVLKVIKSHHLERLLKDFEIGIQIVFEHNLEQWRQSMGAPLLYSGNTSTLTSPLSPTSSC  154
            D L++IK HHL  LL++F  G +I FEH+LE+WR+ +  PL  +            +S C
Sbjct  66   DELQMIKRHHLSELLRNFRFGTRIRFEHHLERWRRWLNVPLQGAQGQG--------SSHC  117

Query  155  SSSRASSPAHDSRV---TPYCKEQPDSQ  179
            S  R       S+    +P   EQP  Q
Sbjct  118  SGCRCPEILGQSQCQEQSPLHMEQPSEQ  145


 Score = 71.6 bits (174),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 59/97 (61%), Gaps = 1/97 (1%)

Query  176  PDSQPNIPLSTILNETTKGVMLTDFYNKFSKLQEEQRTILITLVAQFHEDKGIAMTLAGS  235
            PD + +I L  + +   K   L +   +   L   QR +LI LV  ++E+  + +TL  S
Sbjct  230  PDQEVSI-LGILRSSGMKAQSLLERIGQNDPLDAVQRLLLIQLVCSYYEENQMHLTLQRS  288

Query  236  YRLEREILERFPTERLEYYRSNKRGRIYNKFCNLKKS  272
            + LEREIL+ FP E+L YYR+ +RG+IY +F N+K+S
Sbjct  289  HLLEREILQLFPQEQLSYYRTERRGKIYVRFTNMKRS  325


>RPB1_DROME unnamed protein product
Length=1887

 Score = 31.6 bits (70),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 25/40 (63%), Gaps = 1/40 (3%)

Query  132   GAPLLYSGNTSTLTSPLSPTSSCSSSRA-SSPAHDSRVTP  170
              A  +  G+T ++T P++P ++C++ R  S P H S +TP
Sbjct  1490  AAMFIGGGSTPSMTPPMTPWANCNTPRYFSPPGHVSAMTP  1529



Lambda      K        H
   0.318    0.132    0.386 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 743799300


Query= XP_031327259.1 uncharacterized protein LOC116158589 isoform X3
[Photinus pyralis]

Length=418
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q961H2_DROME  unnamed protein product                                 123     1e-30
Q38CD5_TRYB2  unnamed protein product                                 34.7    0.16 
Q38CD7_TRYB2  unnamed protein product                                 33.9    0.26 


>Q961H2_DROME unnamed protein product
Length=507

 Score = 123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 90/344 (26%), Positives = 168/344 (49%), Gaps = 26/344 (8%)

Query  35   VEPLMFLFVFPSMLLTLSIVNLHMDKACRVNLQLNASVCDGL-SQRNSSMYTSEEENMVQ  93
            +EP +FL  F   L+     N  + + C    + NA+ C+ L      S    E E +VQ
Sbjct  54   LEPAVFLIFFARNLIGAVYQNQILYQTCITIEKFNATQCEPLLGIDRGSDADKEVEVIVQ  113

Query  94   RMVANMNMWKAVIQSVLPPCLLLMLGAWSDKHNRRKLLM----GFPIVGEVITVTGFI--  147
               AN+ M  ++++S++P    L LG WSDK  RR +L+    G+     ++ V  +I  
Sbjct  114  TYSANIMMTTSLLESIIPAFASLFLGPWSDKFGRRPILLTTFTGYLTGALILIVITYITR  173

Query  148  ---LCTYFFYELPMEVTGVVESLPTSATGGWFVMFMAVYSYVGAVSTLESRTLR--IGAL  202
               +  ++F         ++ S+P+  +GG   +   +Y Y+  V+    + LR  +   
Sbjct  174  STNISPWWF---------LLSSVPSVVSGGTCALITGIYCYISDVAKERKKALRMVLNEA  224

Query  203  KICATGSIMVGTAMSGICYRLIGLYGIFSTALFLFVVGLIYTVLVIREVGTAAPQANKST  262
             +CA   IMVG   SG  Y       +FS A  L +  L+Y +L + E   +    +  T
Sbjct  225  SLCA--GIMVGNVASGYIYAATNALVLFSIAGSLMMFALMYVLLFVPE---SLNPGDIHT  279

Query  263  YTSYKDFFNYQHMKSTFYFAFKRRDGNRRARMFVSFVLLCLTFGPVQGETSVVYLFIRKR  322
             +  ++FF +  +       FKRR    R  ++++ + L +    ++GE++V Y+F++ +
Sbjct  280  GSRVREFFRFDLVTDLIRTCFKRRPNFDRTIIWLTMIALTIAIFDMEGESTVNYMFVQDK  339

Query  323  FQWSEVEFSILFSIKIVLHLVGTVLPLLILSKYLKMDDTVIGMI  366
            F W+  +FS+  + +IV+ +VG+++ +L+L + LKM    + M+
Sbjct  340  FNWTIKDFSLFNASRIVIQIVGSIVGMLVLRRVLKMSIVTMAML  383


>Q38CD5_TRYB2 unnamed protein product
Length=466

 Score = 34.7 bits (78),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 31/66 (47%), Gaps = 11/66 (17%)

Query  246  LVIREVGTA----APQANKSTYTSYKDFFNYQHMKSTFYFAFKRRDGNRRARMFVSFVLL  301
            L +R  G+      P  N+  ++ Y D    Q  K  FY+AF  RDGN  A      VLL
Sbjct  32   LALRTTGSGWEPCDPGVNQ--WSGYFDIPGEQSDKHYFYWAFGPRDGNPNAP-----VLL  84

Query  302  CLTFGP  307
             +T GP
Sbjct  85   WMTGGP  90


>Q38CD7_TRYB2 unnamed protein product
Length=464

 Score = 33.9 bits (76),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 24/47 (51%), Gaps = 5/47 (11%)

Query  261  STYTSYKDFFNYQHMKSTFYFAFKRRDGNRRARMFVSFVLLCLTFGP  307
            + ++ Y D    Q  K  FY+AF  RDGN  A      VLL +T GP
Sbjct  46   NQWSGYFDIPGEQSDKHYFYWAFGPRDGNPNAP-----VLLWMTGGP  87



Lambda      K        H
   0.318    0.132    0.386 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 743799300


Query= XP_031327260.1 uncharacterized protein LOC116158590 isoform X1
[Photinus pyralis]

Length=991
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q95PA9_DROME  unnamed protein product                                 31.6    3.9  
Q8MLT4_DROME  unnamed protein product                                 30.8    6.9  
Q6AWQ3_DROME  unnamed protein product                                 30.8    7.2  


>Q95PA9_DROME unnamed protein product
Length=1051

 Score = 31.6 bits (70),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 25/105 (24%), Positives = 47/105 (45%), Gaps = 4/105 (4%)

Query  732  NPKAISSNNLRKQIATVTQILSLKPEEAKQFANFMGHTQKTHDEFYELPVDIYQTAKVSK  791
            NPKA S  +    I      L   PE+A +    +     +++   ELP DI+    +S 
Sbjct  381  NPKAFSHLSNVVYINLSQNSLKKLPEKAFEKVTLLEELDLSYNSLTELPRDIFNGTTLSI  440

Query  792  LLMMMEKGSMPIEYKGKSLEEINIDFN----LEYAEEDKIDGTIN  832
            L +     +  + +  K L+++++ FN    + ++  DK+ G  N
Sbjct  441  LHLKYNTSNGDLHFGTKDLQQLDLSFNSIVQVHHSMFDKMPGLTN  485


>Q8MLT4_DROME unnamed protein product
Length=1076

 Score = 30.8 bits (68),  Expect = 6.9, Method: Compositional matrix adjust.
 Identities = 25/105 (24%), Positives = 47/105 (45%), Gaps = 4/105 (4%)

Query  732  NPKAISSNNLRKQIATVTQILSLKPEEAKQFANFMGHTQKTHDEFYELPVDIYQTAKVSK  791
            NPKA S  +    I      L   PE+A +    +     +++   ELP DI+    +S 
Sbjct  406  NPKAFSHLSNVVYINLSQNSLKKLPEKAFEKVTLLEELDLSYNSLTELPRDIFNGTTLSI  465

Query  792  LLMMMEKGSMPIEYKGKSLEEINIDFN----LEYAEEDKIDGTIN  832
            L +     +  + +  K L+++++ FN    + ++  DK+ G  N
Sbjct  466  LHLKYNTFNGDLHFGTKDLQQLDLSFNSIVQVHHSMFDKMPGLTN  510


>Q6AWQ3_DROME unnamed protein product
Length=1076

 Score = 30.8 bits (68),  Expect = 7.2, Method: Compositional matrix adjust.
 Identities = 25/105 (24%), Positives = 47/105 (45%), Gaps = 4/105 (4%)

Query  732  NPKAISSNNLRKQIATVTQILSLKPEEAKQFANFMGHTQKTHDEFYELPVDIYQTAKVSK  791
            NPKA S  +    I      L   PE+A +    +     +++   ELP DI+    +S 
Sbjct  406  NPKAFSHLSNVVYINLSQNSLKKLPEKAFEKVTLLEELDLSYNSLTELPRDIFNGTTLSI  465

Query  792  LLMMMEKGSMPIEYKGKSLEEINIDFN----LEYAEEDKIDGTIN  832
            L +     +  + +  K L+++++ FN    + ++  DK+ G  N
Sbjct  466  LHLKYNTFNGDLHFGTKDLQQLDLSFNSIVQVHHSMFDKMPGLTN  510



Lambda      K        H
   0.318    0.132    0.386 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 743799300


Query= XP_031327261.1 uncharacterized protein LOC116158590 isoform X2
[Photinus pyralis]

Length=972
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q95PA9_DROME  unnamed protein product                                 31.6    3.9  
Q8MLT4_DROME  unnamed protein product                                 30.8    7.2  
Q6AWQ3_DROME  unnamed protein product                                 30.8    7.5  


>Q95PA9_DROME unnamed protein product
Length=1051

 Score = 31.6 bits (70),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 25/105 (24%), Positives = 47/105 (45%), Gaps = 4/105 (4%)

Query  713  NPKAISSNNLRKQIATVTQILSLKPEEAKQFANFMGHTQKTHDEFYELPVDIYQTAKVSK  772
            NPKA S  +    I      L   PE+A +    +     +++   ELP DI+    +S 
Sbjct  381  NPKAFSHLSNVVYINLSQNSLKKLPEKAFEKVTLLEELDLSYNSLTELPRDIFNGTTLSI  440

Query  773  LLMMMEKGSMPIEYKGKSLEEINIDFN----LEYAEEDKIDGTIN  813
            L +     +  + +  K L+++++ FN    + ++  DK+ G  N
Sbjct  441  LHLKYNTSNGDLHFGTKDLQQLDLSFNSIVQVHHSMFDKMPGLTN  485


>Q8MLT4_DROME unnamed protein product
Length=1076

 Score = 30.8 bits (68),  Expect = 7.2, Method: Compositional matrix adjust.
 Identities = 25/105 (24%), Positives = 47/105 (45%), Gaps = 4/105 (4%)

Query  713  NPKAISSNNLRKQIATVTQILSLKPEEAKQFANFMGHTQKTHDEFYELPVDIYQTAKVSK  772
            NPKA S  +    I      L   PE+A +    +     +++   ELP DI+    +S 
Sbjct  406  NPKAFSHLSNVVYINLSQNSLKKLPEKAFEKVTLLEELDLSYNSLTELPRDIFNGTTLSI  465

Query  773  LLMMMEKGSMPIEYKGKSLEEINIDFN----LEYAEEDKIDGTIN  813
            L +     +  + +  K L+++++ FN    + ++  DK+ G  N
Sbjct  466  LHLKYNTFNGDLHFGTKDLQQLDLSFNSIVQVHHSMFDKMPGLTN  510


>Q6AWQ3_DROME unnamed protein product
Length=1076

 Score = 30.8 bits (68),  Expect = 7.5, Method: Compositional matrix adjust.
 Identities = 25/105 (24%), Positives = 47/105 (45%), Gaps = 4/105 (4%)

Query  713  NPKAISSNNLRKQIATVTQILSLKPEEAKQFANFMGHTQKTHDEFYELPVDIYQTAKVSK  772
            NPKA S  +    I      L   PE+A +    +     +++   ELP DI+    +S 
Sbjct  406  NPKAFSHLSNVVYINLSQNSLKKLPEKAFEKVTLLEELDLSYNSLTELPRDIFNGTTLSI  465

Query  773  LLMMMEKGSMPIEYKGKSLEEINIDFN----LEYAEEDKIDGTIN  813
            L +     +  + +  K L+++++ FN    + ++  DK+ G  N
Sbjct  466  LHLKYNTFNGDLHFGTKDLQQLDLSFNSIVQVHHSMFDKMPGLTN  510



Lambda      K        H
   0.318    0.132    0.386 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 743799300


Query= XP_031327262.1 uncharacterized protein LOC116158592 [Photinus
pyralis]

Length=602
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MOE1_CAEEL  unnamed protein product                                   32.3    1.0  
ACH1_DROME  unnamed protein product                                   31.6    2.4  
Q9V475_DROME  unnamed protein product                                 31.2    3.0  


>MOE1_CAEEL unnamed protein product
Length=407

 Score = 32.3 bits (72),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 15/58 (26%), Positives = 31/58 (53%), Gaps = 1/58 (2%)

Query  230  QICDQYVNYVKHVYGQDCVIVFDGYNSDNFSTKDALQQIRSQHAL-EISVKLENTIVT  286
            ++CD+Y       YG+ C+ +   +  + +   D L ++  +HAL +I  ++E  I+T
Sbjct  158  KLCDKYTTTGLCPYGKRCLFIHPDHGPNAYIRADKLLEVSQRHALADIRDQMEQHIMT  215


>ACH1_DROME unnamed protein product
Length=567

 Score = 31.6 bits (70),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 17/76 (22%), Positives = 35/76 (46%), Gaps = 2/76 (3%)

Query  219  KVLWQKPATFNQICDQYVNYVKHVYGQDCVIVFDGYNSDNFSTK-DALQQIRSQHALEIS  277
            KV+W+ PA +   C+  V Y      Q C + F  +  D +      L+Q      +E+ 
Sbjct  136  KVVWKPPAIYKSFCEIDVEYFPFD-EQTCFMKFGSWTYDGYMVDLRHLKQTADSDNIEVG  194

Query  278  VKLENTIVTPQEEFLR  293
            + L++  ++ + + +R
Sbjct  195  IDLQDYYISVEWDIMR  210


>Q9V475_DROME unnamed protein product
Length=773

 Score = 31.2 bits (69),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 35/137 (26%), Positives = 63/137 (46%), Gaps = 34/137 (25%)

Query  169  SPYPLSLFKDGVLRKGTKSLLFKEFDALTTPTSGTEQNAMHIIDGGFLLHKVLWQKPATF  228
            SP  LSLF D  L+KG K +              +EQ    I+D   +L + L +K    
Sbjct  384  SPEYLSLFIDDKLKKGGKGM--------------SEQEIESILDKTMVLFRFLLEK----  425

Query  229  NQICDQYVNYVKHVYGQDCVIVFDGYNSDNFSTKDALQQIRSQHALEISVKLE-------  281
              + ++Y  Y  H+  +   ++ +   SD+F  K+ + +++++   + + KLE       
Sbjct  426  -DVFERY--YKTHLAKR---LLLNKSVSDDFE-KNMISKLKTECGCQFTSKLEGMFKDMS  478

Query  282  --NTIVTPQEEFLRNNN  296
              NTI+   + F+ NNN
Sbjct  479  VSNTIMDEFKNFVNNNN  495



Lambda      K        H
   0.318    0.132    0.386 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 743799300


Query= XP_031327263.1 uncharacterized protein LOC116158593 [Photinus
pyralis]

Length=114
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q580I9_TRYB2  unnamed protein product                                 31.6    0.085
EXOC2_DROME  unnamed protein product                                  30.0    0.34 
Q9VVA7_DROME  unnamed protein product                                 29.3    0.58 


>Q580I9_TRYB2 unnamed protein product
Length=255

 Score = 31.6 bits (70),  Expect = 0.085, Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 23/48 (48%), Gaps = 0/48 (0%)

Query  46  VYQRTQRPYTRQTSDATIRKILEEAEHRKHEFWKLIDEHSAVVENLKK  93
           V QR   P+   T +  IR++     H++H  W+L    + V E+L  
Sbjct  20  VQQRHAAPHALTTDNIHIRRLSSLRPHQQHHLWRLCQLVTGVTESLSG  67


>EXOC2_DROME unnamed protein product
Length=894

 Score = 30.0 bits (66),  Expect = 0.34, Method: Compositional matrix adjust.
 Identities = 28/105 (27%), Positives = 47/105 (45%), Gaps = 35/105 (33%)

Query  13   NSTDR---LSEFSIVIEDFDSAKNTSKDDCLTQEAPVYQRTQRPYTRQTSDATIRKILEE  69
            NS DR     E+ IV+ D+  AKN            ++ +T+ P          RK+LEE
Sbjct  282  NSVDRRAKAGEYDIVVNDYSRAKN------------LFGKTEIP--------IFRKVLEE  321

Query  70   AEHR-------KHE----FWKLIDEHSAVVENLKKMELENTG-PI  102
             +HR        HE      + +++   +++ L  +EL+ +G PI
Sbjct  322  VDHRILSIRKQLHEKVVKMPQSVEQQKKLIKALISLELQQSGTPI  366


>Q9VVA7_DROME unnamed protein product
Length=408

 Score = 29.3 bits (64),  Expect = 0.58, Method: Composition-based stats.
 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 2/48 (4%)

Query  16   DRLSEFSIVIEDFDSAKNTSKDDCLTQEAPVYQRTQRPYTRQ--TSDA  61
            D+  E    +ED +SA+  + D+ +T  AP+Y++    Y  +  T DA
Sbjct  314  DKEQELEKALEDLESAEAINPDEAVTTTAPLYRQLLNAYADEAATEDA  361



Lambda      K        H
   0.318    0.132    0.386 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 743799300


Query= XP_031327264.1 uncharacterized protein LOC116158595 [Photinus
pyralis]

Length=418
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MNK_CAEEL  unnamed protein product                                    29.6    5.1  
EAF3_DROME  unnamed protein product                                   29.6    5.3  


>MNK_CAEEL unnamed protein product
Length=707

 Score = 29.6 bits (65),  Expect = 5.1, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 32/64 (50%), Gaps = 15/64 (23%)

Query  224  SECLNFESSA--IQNVQE-----NIPADSFLQFVFDN--------ADVNTRTIDGHGTFH  268
            S  +N + SA  +Q + E     N  AD+ L   FDN        +D+ T TI G G+F 
Sbjct  506  SNLINRKDSARDVQQMSEHFNLMNRLADTRLSARFDNKMTMSECGSDLGTATIHGDGSFL  565

Query  269  SMGG  272
            SMGG
Sbjct  566  SMGG  569


>EAF3_DROME unnamed protein product
Length=424

 Score = 29.6 bits (65),  Expect = 5.3, Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 38/81 (47%), Gaps = 15/81 (19%)

Query  199  TLLHRKYGSKNLIDILSTIGVSISYSECLNFESSAIQNVQENIPADSFLQFVFDNADVNT  258
            T L   YGS +L+ +   +G  +SYS     +  ++QN+  ++    FL+F+  N+ +  
Sbjct  353  TPLSELYGSFHLLRLFVRLGSMLSYSA---LDQQSMQNLLTHV--QDFLKFLVKNSSI--  405

Query  259  RTIDGHGTFHSMGGIICITPE  279
                    F SM   I + PE
Sbjct  406  --------FFSMSNFINVDPE  418



Lambda      K        H
   0.318    0.132    0.386 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 743799300


Query= XP_031327265.1 WD repeat-containing protein 37 [Photinus pyralis]

Length=487
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q57W14_TRYB2  unnamed protein product                                 88.6    1e-18
SEL10_CAEEL  unnamed protein product                                  82.4    2e-16
Q9VPL0_DROME  unnamed protein product                                 77.4    3e-15


>Q57W14_TRYB2 unnamed protein product
Length=419

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/224 (25%), Positives = 108/224 (48%), Gaps = 12/224 (5%)

Query  174  IGTASADHSACIWSVDSGRCLLQYHGHNGSVNSVRFHPIKDMVLTSSGDCSAHIW-----  228
            + + S D++A +W+V++G+ L    GH   + S+ F+   D++LT S D +A +W     
Sbjct  195  LSSGSMDYTAKVWNVETGQELYTLLGHTAEIVSLNFNTNGDLILTGSFDTTAKLWDVRTG  254

Query  229  QAVVSWDLPKGHSSEEELELGEE-----CEDQRADAKAATLRTPVCELGGHTNAISAAEW  283
            + V +    +   S  +           C D+ +          V  L GHT+ I    +
Sbjct  255  KCVHTLSSHRAEISSTQFNFAGNLCVTGCIDRTSKLWDVGSGQCVSTLRGHTDEILDVAF  314

Query  284  LSGADQVITAGWDRLAVLHDVESGATITTLTGHDLELTHTATHPTQRLAVTSSRDSTFRL  343
             +   Q++TA  D  A ++D  +   + +L GH+ E++    +P     ++++ D T R+
Sbjct  315  STSGSQIVTASADATARVYDTATFNCVASLVGHEGEISKVQFNPQGTKIISAANDKTCRV  374

Query  344  WDFRESVQSVSVFQGHSESVTSAVFTHE-DKVVSGSDDRTVKVW  386
            W   E+ Q++    GH++ + S  F +E D +++GS D T  +W
Sbjct  375  WSV-ETGQNLQTLTGHNDEIFSCAFNYEGDTILTGSKDNTCGIW  417


 Score = 86.3 bits (212),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 75/303 (25%), Positives = 127/303 (42%), Gaps = 45/303 (15%)

Query  156  GHKDGIWEVSVARLGQPIIGTASADHSACIWSVDSGRCLLQYHGHNGSVNSVRFHPIKDM  215
            GH++ ++ VS        + T S D +  IW   + +C     GH   +  + F+P    
Sbjct  135  GHRNVVYSVSFNNPYGNRVATGSFDKTCKIWDARTAQCYCTLAGHMAEIVCMSFNPQSTH  194

Query  216  VLTSSGDCSAHIWQAVVSWDLPKGHSSEEELELGEECEDQRADAKAATLRTPVCELGGHT  275
            + + S D +A +W                 +E G+E                +  L GHT
Sbjct  195  LSSGSMDYTAKVWN----------------VETGQE----------------LYTLLGHT  222

Query  276  NAISAAEWLSGADQVITAGWDRLAVLHDVESGATITTLTGHDLELTHTATHPTQRLAVTS  335
              I +  + +  D ++T  +D  A L DV +G  + TL+ H  E++ T  +    L VT 
Sbjct  223  AEIVSLNFNTNGDLILTGSFDTTAKLWDVRTGKCVHTLSSHRAEISSTQFNFAGNLCVTG  282

Query  336  SRDSTFRLWDFRESVQSVSVFQGHSESVTSAVF-THEDKVVSGSDDRTVKVWDLRNMRSP  394
              D T +LWD   S Q VS  +GH++ +    F T   ++V+ S D T +V+D       
Sbjct  283  CIDRTSKLWDVG-SGQCVSTLRGHTDEILDVAFSTSGSQIVTASADATARVYDTATFNCV  341

Query  395  VATIRADSAINRLSVSSNGVIAIPHDN-RHIRLFDL-NGQRLARLPRSSRQGGQGHN-RM  451
             + +  +  I+++  +  G   I   N +  R++ +  GQ L  L         GHN  +
Sbjct  342  ASLVGHEGEISKVQFNPQGTKIISAANDKTCRVWSVETGQNLQTL--------TGHNDEI  393

Query  452  VSC  454
             SC
Sbjct  394  FSC  396


 Score = 55.1 bits (131),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 49/196 (25%), Positives = 96/196 (49%), Gaps = 15/196 (8%)

Query  268  VCELGGHTNAISAAEWLSG-ADQVITAGWDRLAVLHDVESGATITTLTGHDLELTHTATH  326
            +  L GH N + +  + +   ++V T  +D+   + D  +     TL GH  E+   + +
Sbjct  130  IVSLEGHRNVVYSVSFNNPYGNRVATGSFDKTCKIWDARTAQCYCTLAGHMAEIVCMSFN  189

Query  327  PTQRLAVTSSRDSTFRLWDFRESVQSVSVFQGHSESVTSAVF-THEDKVVSGSDDRTVKV  385
            P      + S D T ++W+  E+ Q +    GH+  + S  F T+ D +++GS D T K+
Sbjct  190  PQSTHLSSGSMDYTAKVWNV-ETGQELYTLLGHTAEIVSLNFNTNGDLILTGSFDTTAKL  248

Query  386  WDLRNMRS--PVATIRADSAINRLSVSSNGVIAIPHDNRHIRLFDL-NGQRLARLPRSSR  442
            WD+R  +    +++ RA+ +  + + + N  +    D R  +L+D+ +GQ ++ L     
Sbjct  249  WDVRTGKCVHTLSSHRAEISSTQFNFAGNLCVTGCID-RTSKLWDVGSGQCVSTL-----  302

Query  443  QGGQGHNRMVSCVAWS  458
               +GH   +  VA+S
Sbjct  303  ---RGHTDEILDVAFS  315


 Score = 54.7 bits (130),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 64/145 (44%), Gaps = 3/145 (2%)

Query  271  LGGHTNAISAAEWLSGADQVITAGWDRLAVLHDVESGATITTLTGH-DLELTHTATHPTQ  329
            L  H   ++   +  G D  IT  +DR   + D  +G  I +L GH ++  + +  +P  
Sbjct  91   LRAHMLPLTNCAFNKGGDSFITGSYDRTCKVWDTATGNEIVSLEGHRNVVYSVSFNNPYG  150

Query  330  RLAVTSSRDSTFRLWDFRESVQSVSVFQGHSESVTSAVFTHEDK-VVSGSDDRTVKVWDL  388
                T S D T ++WD R + Q      GH   +    F  +   + SGS D T KVW++
Sbjct  151  NRVATGSFDKTCKIWDAR-TAQCYCTLAGHMAEIVCMSFNPQSTHLSSGSMDYTAKVWNV  209

Query  389  RNMRSPVATIRADSAINRLSVSSNG  413
               +     +   + I  L+ ++NG
Sbjct  210  ETGQELYTLLGHTAEIVSLNFNTNG  234


 Score = 47.4 bits (111),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 46/90 (51%), Gaps = 3/90 (3%)

Query  141  FKAPHLNCSIIREYVGHKDGIWEVSVARLGQPIIGTASADHSACIWSVDSGRCLLQYHGH  200
            +     NC  +   VGH+  I +V     G  II +A+ D +  +WSV++G+ L    GH
Sbjct  333  YDTATFNC--VASLVGHEGEISKVQFNPQGTKII-SAANDKTCRVWSVETGQNLQTLTGH  389

Query  201  NGSVNSVRFHPIKDMVLTSSGDCSAHIWQA  230
            N  + S  F+   D +LT S D +  IW++
Sbjct  390  NDEIFSCAFNYEGDTILTGSKDNTCGIWKS  419


>SEL10_CAEEL unnamed protein product
Length=587

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 89/390 (23%), Positives = 169/390 (43%), Gaps = 32/390 (8%)

Query  105  DNNIAKVLS-KKLSNTSTQKLKTANKLKAQTSKIVSSFKA-PHLNCSIIREYVGHKDGIW  162
            D N+ + L  +K  +   +    +  L+A   KI  ++ A P +  +++R   GH+D + 
Sbjct  205  DLNVHRFLKLQKFGDIFERAADKSRYLRAD--KIEKNWNANPIMGSAVLR---GHEDHV-  258

Query  163  EVSVARLGQPIIGTASADHSACIWSVDSGRCLLQYHGHNGSVNSVRFHPIKDMVLTSSGD  222
             ++  ++   ++ T S D++  +W +D G  +    GH G V + +       +++ S D
Sbjct  259  -ITCMQIHDDVLVTGSDDNTLKVWCIDKGEVMYTLVGHTGGVWTSQISQCGRYIVSGSTD  317

Query  223  CSAHIWQAVVSWDL--PKGHSSEEELELGEECEDQRADAKAATLRTPVCELG-------G  273
             +  +W  V    L   +GH+S     +          ++  TLR    E G       G
Sbjct  318  RTVKVWSTVDGSLLHTLQGHTSTVRC-MAMAGSILVTGSRDTTLRVWDVESGRHLATLHG  376

Query  274  HTNAISAAEWLSGADQVITAGWDRLAVLHDVESGATITTLTGHDLELTHTATHPTQRLAV  333
            H  A+   ++      V++ G+D    + +  +G  I TLTGH+  +        + +  
Sbjct  377  HHAAVRCVQF--DGTTVVSGGYDFTVKIWNAHTGRCIRTLTGHNNRVYSLLFESERSIVC  434

Query  334  TSSRDSTFRLWDFR--ESVQSVSVFQGHSESVTSAVFTHEDKVVSGSDDRTVKVWDLRNM  391
            + S D++ R+WDF   E  + V++ QGH+ S+TS +    + +VS + D  V+VWD+   
Sbjct  435  SGSLDTSIRVWDFTRPEGQECVALLQGHT-SLTSGMQLRGNILVSCNADSHVRVWDIHEG  493

Query  392  RSPVATIRADSAINRLSVSSNGVIAIPHDNRHIRLFDLNGQRLARLPRSSRQGGQGH---  448
                      SAI  L      ++A   D+  ++L+D+    L R   +   GG G    
Sbjct  494  TCVHMLSGHRSAITSLQWFGRNMVATSSDDGTVKLWDIERGALIRDLVTLDSGGNGGCIW  553

Query  449  -----NRMVSCVAWSNDHLNHVNLFTCGFD  473
                 + M++C   S ++     +    FD
Sbjct  554  RLCSTSTMLACAVGSRNNTEETKVILLDFD  583


>Q9VPL0_DROME unnamed protein product
Length=347

 Score = 77.4 bits (189),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 65/254 (26%), Positives = 101/254 (40%), Gaps = 41/254 (16%)

Query  147  NCSIIREYVGHKDGIWEVSVARLGQPIIGTASADHSACIWSVDSGRCLLQYHGHNGSVNS  206
            +C  +    GH   + E      G  I  T S D +   W + +G+   ++ GH   VNS
Sbjct  87   DCENVMAMSGHSGAVMEAHFTPDGSHIF-TCSTDKTLAFWDIATGQRQRRFKGHGNFVNS  145

Query  207  VRFHPIKDMVLTSSGDCSAHIWQAVVSWDLPKGHSSEEELELGEECEDQRADAKAATLRT  266
            V+       +L     CS    + +  WD  K H+                   A TL +
Sbjct  146  VQGSRRGQQLL-----CSGSDDRTIKIWDARKKHA-------------------AHTLES  181

Query  267  PVCELGGHTNAISAAEWLSGADQVITAGWDRLAVLHDVESGATITTLTGHDLELTHTATH  326
            P          ++A  +    +QVI+ G D    + D+   A +  L GH   +T  +  
Sbjct  182  PF--------QVTAVCFGDTGEQVISGGIDNEVKIWDIRKQAVLHHLRGHSDTITGMSLS  233

Query  327  PTQRLAVTSSRDSTFRLWDFRESV---QSVSVFQGHSESVTSAVF-----THEDKVVSGS  378
            P     +T++ D+T R+WD R      + V VFQGH  +    +         DK+ SGS
Sbjct  234  PEGDFILTNAMDNTLRVWDVRPYAPGERCVKVFQGHQHNFEKNLLRCAWSPGSDKITSGS  293

Query  379  DDRTVKVWDLRNMR  392
             DR V +WD+   R
Sbjct  294  ADRHVYIWDVNTRR  307


 Score = 67.8 bits (164),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 77/310 (25%), Positives = 132/310 (43%), Gaps = 64/310 (21%)

Query  194  LLQYHGHNGSVNSVRFHPIKDMVLTSSGDCSAHIWQAVVSWDLPKGHSSEEELELGEECE  253
            ++Q  GH G + +  FHP  +++L+S  D   +IWQ                    E+CE
Sbjct  48   IMQLEGHEGEIFTAEFHPEGELLLSSGFDRQIYIWQVY------------------EDCE  89

Query  254  DQRADAKAATLRTPVCELGGHTNAISAAEWLSGADQVITAGWDRLAVLHDVESGATITTL  313
            +             V  + GH+ A+  A +      + T   D+     D+ +G      
Sbjct  90   N-------------VMAMSGHSGAVMEAHFTPDGSHIFTCSTDKTLAFWDIATGQRQRRF  136

Query  314  TGH-DLELTHTATHPTQRLAVTSSRDSTFRLWDFRESVQS---VSVFQGHSESVTSAVFT  369
             GH +   +   +   Q+L  + S D T ++WD R+   +    S FQ     VT+  F 
Sbjct  137  KGHGNFVNSVQGSRRGQQLLCSGSDDRTIKIWDARKKHAAHTLESPFQ-----VTAVCFG  191

Query  370  HE-DKVVSGSDDRTVKVWDLRNMRSPVATIRADS-AINRLSVSSNG--VIAIPHDNRHIR  425
               ++V+SG  D  VK+WD+R  ++ +  +R  S  I  +S+S  G  ++    DN  +R
Sbjct  192  DTGEQVISGGIDNEVKIWDIRK-QAVLHHLRGHSDTITGMSLSPEGDFILTNAMDNT-LR  249

Query  426  LFDLN----GQRLARLPRSSRQGGQGHN---RMVSCVAWSNDHLNHVNLFTCG-FDRRVL  477
            ++D+     G+R  ++ +     G  HN    ++ C AWS       +  T G  DR V 
Sbjct  250  VWDVRPYAPGERCVKVFQ-----GHQHNFEKNLLRC-AWSPGS----DKITSGSADRHVY  299

Query  478  GWSVQSLKDL  487
             W V + + L
Sbjct  300  IWDVNTRRIL  309


 Score = 63.2 bits (152),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 82/178 (46%), Gaps = 8/178 (4%)

Query  260  KAATLRTPVCELGGHTNAISAAEWLSGADQVITAGWDRLAVLHDV-ESGATITTLTGHDL  318
            + + L+ P+ +L GH   I  AE+    + ++++G+DR   +  V E    +  ++GH  
Sbjct  40   RTSNLQAPIMQLEGHEGEIFTAEFHPEGELLLSSGFDRQIYIWQVYEDCENVMAMSGHSG  99

Query  319  ELTHTATHPTQRLAVTSSRDSTFRLWDFRESVQSVSVFQGHSESVTSAVFTHEDK--VVS  376
             +      P      T S D T   WD   + Q    F+GH   V S   +   +  + S
Sbjct  100  AVMEAHFTPDGSHIFTCSTDKTLAFWDI-ATGQRQRRFKGHGNFVNSVQGSRRGQQLLCS  158

Query  377  GSDDRTVKVWDLRNMRSPVATIRADSAINRLSVSSNG--VIAIPHDNRHIRLFDLNGQ  432
            GSDDRT+K+WD R  +    T+ +   +  +     G  VI+   DN  ++++D+  Q
Sbjct  159  GSDDRTIKIWDARK-KHAAHTLESPFQVTAVCFGDTGEQVISGGIDNE-VKIWDIRKQ  214


 Score = 48.5 bits (114),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/89 (34%), Positives = 49/89 (55%), Gaps = 7/89 (8%)

Query  143  APHLNCSIIREYVGHKDGIWEVSVARL----GQPIIGTASADHSACIWSVDSGRCLLQYH  198
            AP   C  ++ + GH+   +E ++ R     G   I + SAD    IW V++ R L +  
Sbjct  257  APGERC--VKVFQGHQHN-FEKNLLRCAWSPGSDKITSGSADRHVYIWDVNTRRILYKLP  313

Query  199  GHNGSVNSVRFHPIKDMVLTSSGDCSAHI  227
            GHNGSVN+V F P + ++L+ S D + ++
Sbjct  314  GHNGSVNAVDFSPKEPLILSGSSDKTLYL  342


 Score = 42.4 bits (98),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 38/189 (20%), Positives = 66/189 (35%), Gaps = 33/189 (17%)

Query  164  VSVARLGQPIIGTASADHSACIWSVDSGRCLLQYHGHNGSVNSVRFHPIKDMVLTSSGDC  223
            V     G+ +I +   D+   IW +     L    GH+ ++  +   P  D +LT++ D 
Sbjct  188  VCFGDTGEQVI-SGGIDNEVKIWDIRKQAVLHHLRGHSDTITGMSLSPEGDFILTNAMDN  246

Query  224  SAHIWQAVVSWDLPKGHSSEEELELGEECEDQRADAKAATLRTPVCELGGHTNAISA---  280
            +  +W                    GE C               V    GH +       
Sbjct  247  TLRVWDV-------------RPYAPGERC---------------VKVFQGHQHNFEKNLL  278

Query  281  -AEWLSGADQVITAGWDRLAVLHDVESGATITTLTGHDLELTHTATHPTQRLAVTSSRDS  339
               W  G+D++ +   DR   + DV +   +  L GH+  +      P + L ++ S D 
Sbjct  279  RCAWSPGSDKITSGSADRHVYIWDVNTRRILYKLPGHNGSVNAVDFSPKEPLILSGSSDK  338

Query  340  TFRLWDFRE  348
            T  L +  E
Sbjct  339  TLYLGEIDE  347



Lambda      K        H
   0.318    0.132    0.386 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 743799300


Query= XP_031327266.1 DNA excision repair protein ERCC-6-like [Photinus
pyralis]

Length=1013
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q57UN8_TRYB2  unnamed protein product                                 429     1e-132
Q93781_CAEEL  unnamed protein product                                 399     3e-123
BRM_DROME  unnamed protein product                                    312     2e-88 


>Q57UN8_TRYB2 unnamed protein product
Length=1126

 Score = 429 bits (1102),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 233/575 (41%), Positives = 325/575 (57%), Gaps = 69/575 (12%)

Query  216  DYVQISASFKVPYKMWNDLYSYQQKGVKWLWNIHQQSTGGLLGDEMGLGKTVQVIVFLAA  275
            D +++     +   ++  L+ +Q+ G++WL N+H+Q  GG+LGD+MGLGKT+Q+   L A
Sbjct  390  DSIEVLRGISLASSIYQKLFDHQRDGLRWLLNLHRQRVGGILGDDMGLGKTIQIAAMLNA  449

Query  276  LQYSRVVSSHGRYTGLGATLIVVPATVIHQWVKHFHDWAPEFRVAVLHQSGSFTGNKSQL  335
            L +S  +         G +LIV P TV+ QWV   H WAP  R  V+H S + T ++ +L
Sbjct  450  LNHSNQLR--------GPSLIVTPVTVLRQWVAEMHRWAPYVRTCVMHASSASTISREKL  501

Query  336  MKEINKSKGILITTYSGVLKYKGYLSELPWHYLILDEGHKIRNHNAKVSIAIKQLTTPHR  395
            +  +  +  +L+TTY+ V ++   L    + Y+ILDEGHKI N  A V+IA K   TPHR
Sbjct  502  IDSVRGTPAVLLTTYAAVREHCRLLHNACFQYVILDEGHKISNPEATVTIAAKSFPTPHR  561

Query  396  IMLTGSPMQNNLQELWSLFDFIVPGMLGNLTTFMEHVATPIMQGGYTNATPMQEATALSV  455
            ++L+G+P+QN L+ELW LFDF+ PG+LG L  F E    PI       A+P+  ATA   
Sbjct  562  LILSGTPVQNTLKELWCLFDFVKPGLLGTLRRFEEEFEVPINASKNIRASPLALATAAET  621

Query  456  ATALKDLISPHLLRRSKKEVQKYIHLPNKSEQVLFCSLTDEQRDLYKNYLMGDQV-----  510
            A  L + ISP LLRR KK+V     LP K E+V+ C L+D Q + Y + L   +V     
Sbjct  622  ARVLHESISPFLLRRLKKQVMSD-SLPEKYERVIRCPLSDSQLEAYVDLLSSSRVQRLMS  680

Query  511  ----------GMILKGR---------GKNW----FAENH--VRANVLVAITMLRKICNHP  545
                      G+   GR         GK +      EN   VR  +   +  LR+ICNH 
Sbjct  681  NTLSYTQLMGGLDRDGRDASGCLHIAGKRFQLMRDKENKGVVRHELFCVMHELRQICNHV  740

Query  546  DLYLG--------DDDSWNNSELSV----------------------EDKPGYYKRSGKM  575
            D++           DD  NN  L V                       ++P  Y+ S K+
Sbjct  741  DIFHMRQAKDFNYTDDMENNFFLDVVNAPTATARKAGGKGTTHFSMRSNRPVNYEGSSKL  800

Query  576  VVVSALLKIWKKQKHRVLLFTQARTMIAIFEEFLNQQGYKYLKMDGGTSISSRQPLINKF  635
              +  LLK+W++   R L+F+Q R M+ I E    Q+   Y++MDG T+   RQ L+++F
Sbjct  801  QTLRQLLKLWQRGGQRALVFSQTRAMLDIIENMCEQESLTYIRMDGTTNSLRRQELMDRF  860

Query  636  NEDSTYDVFLLTTRVGGLGVNLTGANRVIIFDPDWNPATDTQARERAWRIGQEKQVTVYR  695
            NED    V LLTTRVGG+GVNL GA+RV+IFDPDWNP TD QARERAWRIGQ + V VYR
Sbjct  861  NEDDRIVVALLTTRVGGVGVNLIGADRVVIFDPDWNPVTDEQARERAWRIGQTRDVGVYR  920

Query  696  LISAGTIEEKMYQRQVWKQLLSNKVLLDPKTQKFF  730
            LIS+GT+EE + +RQ+ K  ++ KVL DPK Q+FF
Sbjct  921  LISSGTVEEAVLRRQLAKTYVTEKVLHDPKLQRFF  955


>Q93781_CAEEL unnamed protein product
Length=957

 Score = 399 bits (1026),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 247/671 (37%), Positives = 351/671 (52%), Gaps = 69/671 (10%)

Query  185  DDGCIKFFKSRLD----EYYKELEKTQREQSEETPDYVQISASFKVPYKMWNDLYSYQQK  240
            DD   K FK+R+D    E   EL  T+   SEE   Y + S  +KV   +WN L+ +QQ+
Sbjct  144  DDNDSKNFKARIDKLKPEATSELVDTRMVTSEE---YGKSSKPWKVNAGVWNKLHKFQQE  200

Query  241  GVKWLWNIHQQSTGGLLGDEMGLGKTVQVIVFLAALQYSRVVSSHGRYTGLGATLIVVPA  300
            GV+WL       +GG+L DEMGLGKT+Q +VFL ++Q      +H + TGL   LIV   
Sbjct  201  GVEWLQKKTDHRSGGILADEMGLGKTIQSVVFLRSIQ--ETARTHYKTTGLDTALIVCHV  258

Query  301  TVIHQWVKHFHDWAPEFRVAVLHQSGSFTGNKSQLMKEINK----------SKGILITTY  350
            ++I QW+K  + W P+ RV +LH   S TG +   +  I +             I++TTY
Sbjct  259  SIIAQWIKELNQWFPKARVFLLHSHCS-TGRQEDYVGSIFRKLQRRRKEYPDGAIILTTY  317

Query  351  SGVLKYKGYLSELPWHYLILDEGHKIRNHNAKVSIAIKQLTTPHRIMLTGSPMQNNLQEL  410
            S   K K  + +  W  +ILDEGH IRN N K SIA+++L T  R +LTG+P QN L E 
Sbjct  318  SLFTKLKKPIVKHLWQVVILDEGHYIRNENTKCSIAMRKLMTTQRFILTGTPFQNRLSEF  377

Query  411  WSLFDFIVPGMLGNLTTFMEHVATPIMQGGYTNATPMQEATALSVATALKDLISPHLLRR  470
            W L DF+ PG L +  TF  +    I  G   N +P   A A     AL   + P +LRR
Sbjct  378  WKLVDFVHPGRLSDSATFHRNFTHIINAGANLNCSPEAAAKAYECLVALHIAVKPLILRR  437

Query  471  SKKEVQKYIHLPNKSEQVLFCSLTDEQRDLYKNYLMGDQVGMILKGRGKNWFAENHVRAN  530
             +++ ++ + LP K E VL C L+  QR LY  Y    QV  I++ R K +   NH    
Sbjct  438  LQEDHKEVLQLPEKQEIVLSCELSKRQRRLYMEYGNSHQVNEIIERRLKAFVGINH----  493

Query  531  VLVAITMLRKICNHPDLYLGDDDSWNNSELSVEDKPGYYKRSGKMVVVSALLKIW-KKQK  589
                   L  ICNHP +Y         S      K G  K SGK+ +   L   W K   
Sbjct  494  -------LTNICNHPGIY--------RSLSPASPKFGSIKDSGKVEMTFKLFDDWFKSPT  538

Query  590  HRVLLFTQARTMIAIFEEFLNQQGYKYLKMDGGTSISSRQPLINKFNEDSTYDVFLLTTR  649
            +RV+LFTQ RT+I + E FL ++G K + + G  S ++R  +I KF +D +  VFL+TTR
Sbjct  539  NRVILFTQRRTVITMMEYFLAEKGIKCVSLTGADSAAARPKIIKKFEDDVSIKVFLMTTR  598

Query  650  VGGLGVNLTGANRVIIFDPDWNPATDTQARERAWRIGQEKQVTVYRLISAGTIEEKMYQR  709
             GGLG+NLT AN+VIIFDPDWNP  D QA+ R +R+GQ   V +YRL+S GTIE+  + +
Sbjct  599  AGGLGLNLTCANKVIIFDPDWNPQADNQAKNRIYRMGQTNDVAIYRLVSNGTIEDLKFFK  658

Query  710  QVWKQLLSNKVLLDPKTQKFFKTNNLYDLFSFTEPADGSNPETTNIFHNSRVSLQEKMKE  769
            QV K+ L+ ++L + +  +F   N L DLF       G       ++ +  ++ +   K+
Sbjct  659  QVQKENLAARLLHNAEIDQFVPNNTLADLFRLK--PKGLEGSEIGVYLDGEIAREGSKKQ  716

Query  770  KKNEGESSVQ--------------------FSDAKIEAMRSLAQQIAKSISNKNTES-NV  808
            K+++ E                        F D K+ AMR        SIS +N+ S N 
Sbjct  717  KRDKVEKKAAKKRMKNKLAGFEDKKLLLSLFDDDKLVAMRE------HSISLQNSSSMNR  770

Query  809  IQKTSQQKELE  819
            I+K   +K ++
Sbjct  771  IEKMKMRKSID  781


>BRM_DROME unnamed protein product
Length=1638

 Score = 312 bits (799),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 175/493 (35%), Positives = 275/493 (56%), Gaps = 23/493 (5%)

Query  234   LYSYQQKGVKWLWNIHQQSTGGLLGDEMGLGKTVQVIVFLAALQYSRVVSSHGRYTGLGA  293
             L  YQ KG++WL +++  +  G+L DEMGLGKT+Q I  +  L   + V        +G 
Sbjct  773   LKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTISLVTYLMDRKKV--------MGP  824

Query  294   TLIVVPATVIHQWVKHFHDWAPEFRVAVLHQSGSFTGNKSQLMKEINKSK-GILITTYSG  352
              LI+VP + +  WV  F  WAP   V V+   GS  G +  L  ++  +K  +L+TTY  
Sbjct  825   YLIIVPLSTLPNWVLEFEKWAPA--VGVVSYKGSPQGRRL-LQNQMRATKFNVLLTTYEY  881

Query  353   VLKYKGYLSELPWHYLILDEGHKIRNHNAKVSIAIK-QLTTPHRIMLTGSPMQNNLQELW  411
             V+K K  L+++ W Y+I+DEGH+++NH+ K++  +      P+R++LTG+P+QN L ELW
Sbjct  882   VIKDKAVLAKIQWKYMIIDEGHRMKNHHCKLTQVLNTHYIAPYRLLLTGTPLQNKLPELW  941

Query  412   SLFDFIVPGMLGNLTTFMEHVATPIMQGGYTNATPMQEATALSVATALKDLISPHLLRRS  471
             +L +F++P +  + +TF +    P    G      + E   + +   L  ++ P LLRR 
Sbjct  942   ALLNFLLPSIFKSCSTFEQWFNAPFATTG--EKVELNEEETILIIRRLHKVLRPFLLRRL  999

Query  472   KKEVQKYIHLPNKSEQVLFCSLTDEQRDLYKNYLMGDQVGMILKGRGKNWFAENHVRANV  531
             KKEV+    LP+K E ++ C ++  QR LYK+       G++L    +           +
Sbjct  1000  KKEVEH--QLPDKVEYIIKCDMSALQRVLYKHM---QSKGVLLTDGSEKGKHGKGGAKAL  1054

Query  532   LVAITMLRKICNHPDLYLGDDDSW--NNSELSVEDKPGYYKRSGKMVVVSALLKIWKKQK  589
             +  I  LRK+CNHP ++   ++ +  +     V   P  Y+ SGK  ++  +L   K   
Sbjct  1055  MNTIVQLRKLCNHPFMFQHIEEKYCDHTGGHGVVSGPDLYRVSGKFELLDRILPKLKATN  1114

Query  590   HRVLLFTQARTMIAIFEEFLNQQGYKYLKMDGGTSISSRQPLINKFN-EDSTYDVFLLTT  648
             HRVLLF Q    + I E++L  + + YL++DG T    R  L+ KFN + S   VFLL+T
Sbjct  1115  HRVLLFCQMTQCMTIIEDYLGWRQFGYLRLDGTTKAEDRGELLRKFNAKGSDVFVFLLST  1174

Query  649   RVGGLGVNLTGANRVIIFDPDWNPATDTQARERAWRIGQEKQVTVYRLISAGTIEEKMYQ  708
             R GGLG+NL  A+ V+IFD DWNP  D QA++RA RIGQ  +V V RL++  ++EE++  
Sbjct  1175  RAGGLGLNLQTADTVVIFDSDWNPHQDLQAQDRAHRIGQRNEVRVLRLMTVNSVEERILA  1234

Query  709   RQVWKQLLSNKVL  721
                +K  +  KV+
Sbjct  1235  AARYKLNMDEKVI  1247



Lambda      K        H
   0.318    0.132    0.386 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 743799300


Query= XP_031327267.1 uncharacterized protein LOC116158594 [Photinus
pyralis]

Length=194
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

BICC_DROME  unnamed protein product                                   38.1    0.003
SARM1_DROME  unnamed protein product                                  35.0    0.035
ADT_DICDI  unnamed protein product                                    31.6    0.31 


>BICC_DROME unnamed protein product
Length=905

 Score = 38.1 bits (87),  Expect = 0.003, Method: Composition-based stats.
 Identities = 23/62 (37%), Positives = 31/62 (50%), Gaps = 1/62 (2%)

Query  5    VKTKLLEWGFTDLVESFHEQQVDRDVFLCLNLENLKEL-IPTFGIRIKFWNKYQTFLINE  63
            ++T L   G    ++ F   ++D +VF  L  ENL EL I  FG R K      T L NE
Sbjct  810  IQTLLTSLGLEHYIKIFVLNEIDLEVFTTLTEENLMELGIAAFGARKKLLTAIHTLLANE  869

Query  64   AS  65
            A+
Sbjct  870  AA  871


>SARM1_DROME unnamed protein product
Length=1360

 Score = 35.0 bits (79),  Expect = 0.035, Method: Composition-based stats.
 Identities = 16/34 (47%), Positives = 22/34 (65%), Gaps = 4/34 (12%)

Query  11   EW----GFTDLVESFHEQQVDRDVFLCLNLENLK  40
            EW    GF D ++ F+E QVD D+ L LN +NL+
Sbjct  697  EWVKQIGFNDYIDKFNESQVDGDLLLKLNQDNLR  730


>ADT_DICDI unnamed protein product
Length=309

 Score = 31.6 bits (70),  Expect = 0.31, Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 1/50 (2%)

Query  35   NLENLKELIPTFGIRIKFWNKYQTFLINEASKENEL-IYVDSLESPGGGG  83
            NL N+    PT  +   F +KY+ F +   +KEN    ++ +L S G  G
Sbjct  78   NLANVIRYFPTQALNFAFKDKYKKFFVRHTAKENPTKFFIGNLLSGGAAG  127



Lambda      K        H
   0.318    0.132    0.386 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 743799300


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jan 28, 2021  9:24 PM
  Number of letters in database: 17,197,330
  Number of sequences in database:  25,232



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= XP_031327268.1 protein ANTAGONIST OF LIKE HETEROCHROMATIN PROTEIN
1-like isoform X1 [Photinus pyralis]

Length=402
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9BKT9_CAEEL  unnamed protein product                                 35.4    0.077


>Q9BKT9_CAEEL unnamed protein product
Length=787

 Score = 35.4 bits (80),  Expect = 0.077, Method: Compositional matrix adjust.
 Identities = 17/57 (30%), Positives = 33/57 (58%), Gaps = 2/57 (4%)

Query  101  YRGGFEIIPLEKEILITLWYLAKGETLVSISDRFNVSVSKAFYITMKIIKVICSLMP  157
            Y   FE++ + + +    W+L KG T  + SD F ++VS++ Y+T +  +++  L P
Sbjct  507  YTKSFELVDVPRSL--DYWFLLKGITTPTGSDVFEMAVSRSVYLTGQTDEILGKLTP  561



Lambda      K        H
   0.327    0.140    0.447 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4320747090


Query= XP_031327269.1 protein ANTAGONIST OF LIKE HETEROCHROMATIN PROTEIN
1-like isoform X2 [Photinus pyralis]

Length=385
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9BKT9_CAEEL  unnamed protein product                                 35.4    0.077
CLH_DROME  unnamed protein product                                    29.3    7.0  
E9BC06_LEIDB  unnamed protein product                                 28.9    9.2  


>Q9BKT9_CAEEL unnamed protein product
Length=787

 Score = 35.4 bits (80),  Expect = 0.077, Method: Compositional matrix adjust.
 Identities = 17/57 (30%), Positives = 33/57 (58%), Gaps = 2/57 (4%)

Query  101  YRGGFEIIPLEKEILITLWYLAKGETLVSISDRFNVSVSKAFYITMKIIKVICSLMP  157
            Y   FE++ + + +    W+L KG T  + SD F ++VS++ Y+T +  +++  L P
Sbjct  507  YTKSFELVDVPRSL--DYWFLLKGITTPTGSDVFEMAVSRSVYLTGQTDEILGKLTP  561


>CLH_DROME unnamed protein product
Length=1678

 Score = 29.3 bits (64),  Expect = 7.0, Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 18/34 (53%), Gaps = 0/34 (0%)

Query  172   ANDFQQRCNYPDVIGAIDGCHITCKIPKEQHDSY  205
             AN+F +RCN P V   +    +   + KE  DSY
Sbjct  1096  ANEFAERCNEPAVWSQLAKAQLQQGLVKEAIDSY  1129


>E9BC06_LEIDB unnamed protein product
Length=429

 Score = 28.9 bits (63),  Expect = 9.2, Method: Compositional matrix adjust.
 Identities = 13/55 (24%), Positives = 26/55 (47%), Gaps = 2/55 (4%)

Query  256  CFNLFYGRYHLVGDSAYPLRSWLITPYRNTGIMPLQRKHNYAHSVTRVVIENTFG  310
            CFN+  G  H    +  P + ++I P + T      R  +  +   +V+I++ +G
Sbjct  147  CFNVINGGKH--AGNVLPFQEFMIAPTKATSFREALRMGSEVYHALKVIIKSKYG  199



Lambda      K        H
   0.327    0.140    0.447 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4320747090


Query= XP_031327270.1 uncharacterized protein LOC116158599 [Photinus
pyralis]

Length=162
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q38FP7_TRYB2  unnamed protein product                                 28.5    3.5  
Q384U0_TRYB2  unnamed protein product                                 27.3    6.4  


>Q38FP7_TRYB2 unnamed protein product
Length=1378

 Score = 28.5 bits (62),  Expect = 3.5, Method: Composition-based stats.
 Identities = 33/118 (28%), Positives = 47/118 (40%), Gaps = 22/118 (19%)

Query  47   SRAIEEGFLEQFGVCKGTSIADIDISRISDETPETIETAVAAAETDQEIWSSRGKPTDLD  106
            SR     F+E  G  +G  +   D S   D + ET E +VA            G P D  
Sbjct  333  SRETPPFFVE--GSMRGPGVGQEDCSDALDRSVET-EKSVA------------GPPGD--  375

Query  107  RRATEYMLELRNSAKFQTLFADKKTVKMSIWGKIAELL--GSAGFPLNPKEGGKKCYQ  162
               + Y+ E RNS    +    ++  +     K   L   G  G PL+P + GK+C Q
Sbjct  376  ---SRYLNERRNSHGKNSNDGSRENNRTFGGTKHCSLDEGGHRGLPLHPNDAGKRCNQ  430


>Q384U0_TRYB2 unnamed protein product
Length=496

 Score = 27.3 bits (59),  Expect = 6.4, Method: Composition-based stats.
 Identities = 12/19 (63%), Positives = 13/19 (68%), Gaps = 0/19 (0%)

Query  75  SDETPETIETAVAAAETDQ  93
           S ETPE I  A+AA E DQ
Sbjct  26  STETPEAIRDAIAADERDQ  44



Lambda      K        H
   0.327    0.140    0.447 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4320747090


Query= XP_031327271.1 uncharacterized protein LOC116158599 [Photinus
pyralis]

Length=162
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q38FP7_TRYB2  unnamed protein product                                 28.5    3.5  
Q384U0_TRYB2  unnamed protein product                                 27.3    6.4  


>Q38FP7_TRYB2 unnamed protein product
Length=1378

 Score = 28.5 bits (62),  Expect = 3.5, Method: Composition-based stats.
 Identities = 33/118 (28%), Positives = 47/118 (40%), Gaps = 22/118 (19%)

Query  47   SRAIEEGFLEQFGVCKGTSIADIDISRISDETPETIETAVAAAETDQEIWSSRGKPTDLD  106
            SR     F+E  G  +G  +   D S   D + ET E +VA            G P D  
Sbjct  333  SRETPPFFVE--GSMRGPGVGQEDCSDALDRSVET-EKSVA------------GPPGD--  375

Query  107  RRATEYMLELRNSAKFQTLFADKKTVKMSIWGKIAELL--GSAGFPLNPKEGGKKCYQ  162
               + Y+ E RNS    +    ++  +     K   L   G  G PL+P + GK+C Q
Sbjct  376  ---SRYLNERRNSHGKNSNDGSRENNRTFGGTKHCSLDEGGHRGLPLHPNDAGKRCNQ  430


>Q384U0_TRYB2 unnamed protein product
Length=496

 Score = 27.3 bits (59),  Expect = 6.4, Method: Composition-based stats.
 Identities = 12/19 (63%), Positives = 13/19 (68%), Gaps = 0/19 (0%)

Query  75  SDETPETIETAVAAAETDQ  93
           S ETPE I  A+AA E DQ
Sbjct  26  STETPEAIRDAIAADERDQ  44



Lambda      K        H
   0.327    0.140    0.447 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4320747090


Query= XP_031327272.1 uncharacterized protein LOC116158601 isoform X1
[Photinus pyralis]

Length=385
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q580T1_TRYB2  unnamed protein product                                 32.0    1.1  
TAF1_DROME  unnamed protein product                                   31.2    1.9  
AGO2_DROME  unnamed protein product                                   29.6    4.9  


>Q580T1_TRYB2 unnamed protein product
Length=1497

 Score = 32.0 bits (71),  Expect = 1.1, Method: Composition-based stats.
 Identities = 12/27 (44%), Positives = 15/27 (56%), Gaps = 0/27 (0%)

Query  210   DNYQCKKCGKTHAIRACPAYGLKCNQC  236
             D YQC++C      R  P Y LKC +C
Sbjct  1052  DVYQCQRCNDGLMERMLPEYVLKCGRC  1078


>TAF1_DROME unnamed protein product
Length=2129

 Score = 31.2 bits (69),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 50/120 (42%), Gaps = 23/120 (19%)

Query  125   EKQEESLVRDKIILGIRDRGLQEALLREADINLEKASNLCRAAEVSKQQVKLMREGKGNE  184
             E+Q+E + R+K       R +QE L R     +++     R A++++ Q KL   G    
Sbjct  1263  EQQKEEMKREK-------RRIQEQLRR-----IKRNQERERLAQLAQNQ-KLQPGGMPTS  1309

Query  185   LNINKLKIGHSKKGTNSGSSENGHNDNYQCKKCGKTHAIRACPAYGLKCNQCGRFNHFKV  244
             L   K   GHS K  +SG  E             K   ++  P   LKC  CG+  H + 
Sbjct  1310  LGDPKSSGGHSHKERDSGYKE--------VSPSRKKFKLK--PDLKLKCGACGQVGHMRT  1359


>AGO2_DROME unnamed protein product
Length=1214

 Score = 29.6 bits (65),  Expect = 4.9, Method: Compositional matrix adjust.
 Identities = 23/100 (23%), Positives = 44/100 (44%), Gaps = 5/100 (5%)

Query  290  SIKSGALSKSWTHAI-MLDNRLSVDFKIDTGADINVLP---YNYYKTYFSRFSLKETNSV  345
            SIK G + K     I  LD  LS    +    D+ ++P     +Y+  F +F + +    
Sbjct  404  SIKRGTIGKPGQVGINYLDLDLSKMPSVAYHYDVKIMPERPKKFYRQAFEQFRVDQLGGA  463

Query  346  LIAYGGTKIETFGIVKIPCKVWVSCLLITKFASRRMQFLL  385
            ++AY G K   + + K+P       + +T    R +++ +
Sbjct  464  VLAYDG-KASCYSVDKLPLNSQNPEVTVTDRNGRTLRYTI  502



Lambda      K        H
   0.327    0.140    0.447 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4320747090


Query= XP_031327273.1 uncharacterized protein LOC116158601 isoform X2
[Photinus pyralis]

Length=193


***** No hits found *****



Lambda      K        H
   0.327    0.140    0.447 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4320747090


Query= XP_031327274.1 uncharacterized protein LOC116158606 [Photinus
pyralis]

Length=302
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8MLR4_DROME  unnamed protein product                                 34.3    0.13 
O17430_DROME  unnamed protein product                                 34.3    0.13 
O44203_DROME  unnamed protein product                                 33.9    0.14 


>Q8MLR4_DROME unnamed protein product
Length=469

 Score = 34.3 bits (77),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 20/65 (31%), Positives = 32/65 (49%), Gaps = 0/65 (0%)

Query  20   FKEQEVQLLMTLVNKYKVIIENKKTDAITWKQKQTTWEEITNEFNANNDVYRSCKNIKGK  79
            +  QE + L+ L  K   IIENK+ DA     K   W+ I  +F+      R+C  +K +
Sbjct  45   WNHQEKKYLLDLCRKDMRIIENKRLDAGLTAVKNKAWKIIHQKFSNQFGTDRTCNRLKEQ  104

Query  80   YENLK  84
            +  +K
Sbjct  105  WRRMK  109


>O17430_DROME unnamed protein product
Length=490

 Score = 34.3 bits (77),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 20/65 (31%), Positives = 32/65 (49%), Gaps = 0/65 (0%)

Query  20   FKEQEVQLLMTLVNKYKVIIENKKTDAITWKQKQTTWEEITNEFNANNDVYRSCKNIKGK  79
            +  QE + L+ L  K   IIENK+ DA     K   W+ I  +F+      R+C  +K +
Sbjct  65   WNHQEKKYLLDLCRKDMRIIENKRLDAGLTAVKNKAWKIIHQKFSNQFGTDRTCNRLKEQ  124

Query  80   YENLK  84
            +  +K
Sbjct  125  WRRMK  129


>O44203_DROME unnamed protein product
Length=484

 Score = 33.9 bits (76),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 20/65 (31%), Positives = 32/65 (49%), Gaps = 0/65 (0%)

Query  20   FKEQEVQLLMTLVNKYKVIIENKKTDAITWKQKQTTWEEITNEFNANNDVYRSCKNIKGK  79
            +  QE + L+ L  K   IIENK+ DA     K   W+ I  +F+      R+C  +K +
Sbjct  59   WNHQEKKYLLDLCRKDMRIIENKRLDAGLTAVKNKAWKIIHQKFSNQFGTDRTCNRLKEQ  118

Query  80   YENLK  84
            +  +K
Sbjct  119  WRRMK  123



Lambda      K        H
   0.327    0.140    0.447 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4320747090


Query= XP_031327275.1 uncharacterized protein LOC116158607 isoform X1
[Photinus pyralis]

Length=372
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PGPLC_DROME  unnamed protein product                                  30.8    2.1  
Q7KIQ2_DROME  unnamed protein product                                 30.8    2.6  
A8DYV6_DROME  unnamed protein product                                 30.8    2.6  


>PGPLC_DROME unnamed protein product
Length=520

 Score = 30.8 bits (68),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 31/51 (61%), Gaps = 6/51 (12%)

Query  171  DSTVNTANITTNTMLFYIPRQKWIESKPPH----DLSIFI-YVILIETNSE  216
            +ST++  NI    +L ++ RQ+W+ ++PP     DL + +  VI + TNSE
Sbjct  339  NSTIDLDNIGGGLILRFVERQQWL-AQPPQKEIPDLELPVGLVIALPTNSE  388


>Q7KIQ2_DROME unnamed protein product
Length=1619

 Score = 30.8 bits (68),  Expect = 2.6, Method: Composition-based stats.
 Identities = 28/105 (27%), Positives = 44/105 (42%), Gaps = 14/105 (13%)

Query  12    IIIGLGA-INILSYH-WVPVRCQSDDGDENNSRVLCIT----DTNSNNSAAALSIDAT--  63
             I++G GA IN    + W P+ C +  G     ++LC       + +N   AA+   A+  
Sbjct  1062  ILLGQGAEINATDRNGWTPLHCAAKAGHLEVVKLLCEAGASPKSETNYGCAAIWFAASEG  1121

Query  64    ------YLQENEHGWINAVWDKRDQLYLKWTYNNTFDEPIAHFII  102
                   YL   EH     + DKR    L     N  ++PI  F++
Sbjct  1122  HNEVLRYLMNKEHDTYGLMEDKRFVYNLMVVSKNHNNKPIQEFVL  1166


>A8DYV6_DROME unnamed protein product
Length=1726

 Score = 30.8 bits (68),  Expect = 2.6, Method: Composition-based stats.
 Identities = 28/105 (27%), Positives = 44/105 (42%), Gaps = 14/105 (13%)

Query  12    IIIGLGA-INILSYH-WVPVRCQSDDGDENNSRVLCIT----DTNSNNSAAALSIDAT--  63
             I++G GA IN    + W P+ C +  G     ++LC       + +N   AA+   A+  
Sbjct  1062  ILLGQGAEINATDRNGWTPLHCAAKAGHLEVVKLLCEAGASPKSETNYGCAAIWFAASEG  1121

Query  64    ------YLQENEHGWINAVWDKRDQLYLKWTYNNTFDEPIAHFII  102
                   YL   EH     + DKR    L     N  ++PI  F++
Sbjct  1122  HNEVLRYLMNKEHDTYGLMEDKRFVYNLMVVSKNHNNKPIQEFVL  1166



Lambda      K        H
   0.327    0.140    0.447 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4320747090


Query= XP_031327276.1 uncharacterized protein LOC116158607 isoform X2
[Photinus pyralis]

Length=369
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PGPLC_DROME  unnamed protein product                                  30.8    2.1  
Q7KIQ2_DROME  unnamed protein product                                 30.8    2.6  
A8DYV6_DROME  unnamed protein product                                 30.8    2.6  


>PGPLC_DROME unnamed protein product
Length=520

 Score = 30.8 bits (68),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 31/51 (61%), Gaps = 6/51 (12%)

Query  168  DSTVNTANITTNTMLFYIPRQKWIESKPPH----DLSIFI-YVILIETNSE  213
            +ST++  NI    +L ++ RQ+W+ ++PP     DL + +  VI + TNSE
Sbjct  339  NSTIDLDNIGGGLILRFVERQQWL-AQPPQKEIPDLELPVGLVIALPTNSE  388


>Q7KIQ2_DROME unnamed protein product
Length=1619

 Score = 30.8 bits (68),  Expect = 2.6, Method: Composition-based stats.
 Identities = 28/105 (27%), Positives = 44/105 (42%), Gaps = 14/105 (13%)

Query  9     IIIGLGA-INILSYH-WVPVRCQSDDGDENNSRVLCIT----DTNSNNSAAALSIDAT--  60
             I++G GA IN    + W P+ C +  G     ++LC       + +N   AA+   A+  
Sbjct  1062  ILLGQGAEINATDRNGWTPLHCAAKAGHLEVVKLLCEAGASPKSETNYGCAAIWFAASEG  1121

Query  61    ------YLQENEHGWINAVWDKRDQLYLKWTYNNTFDEPIAHFII  99
                   YL   EH     + DKR    L     N  ++PI  F++
Sbjct  1122  HNEVLRYLMNKEHDTYGLMEDKRFVYNLMVVSKNHNNKPIQEFVL  1166


>A8DYV6_DROME unnamed protein product
Length=1726

 Score = 30.8 bits (68),  Expect = 2.6, Method: Composition-based stats.
 Identities = 28/105 (27%), Positives = 44/105 (42%), Gaps = 14/105 (13%)

Query  9     IIIGLGA-INILSYH-WVPVRCQSDDGDENNSRVLCIT----DTNSNNSAAALSIDAT--  60
             I++G GA IN    + W P+ C +  G     ++LC       + +N   AA+   A+  
Sbjct  1062  ILLGQGAEINATDRNGWTPLHCAAKAGHLEVVKLLCEAGASPKSETNYGCAAIWFAASEG  1121

Query  61    ------YLQENEHGWINAVWDKRDQLYLKWTYNNTFDEPIAHFII  99
                   YL   EH     + DKR    L     N  ++PI  F++
Sbjct  1122  HNEVLRYLMNKEHDTYGLMEDKRFVYNLMVVSKNHNNKPIQEFVL  1166



Lambda      K        H
   0.327    0.140    0.447 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4320747090


Query= XP_031327277.1 tigger transposable element-derived protein 2-like
[Photinus pyralis]

Length=614
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

KDM5_DROME  unnamed protein product                                   34.3    0.34 
INT12_DROME  unnamed protein product                                  32.3    1.1  
LMNB1_DICDI  unnamed protein product                                  31.2    3.3  


>KDM5_DROME unnamed protein product
Length=1838

 Score = 34.3 bits (77),  Expect = 0.34, Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 21/43 (49%), Gaps = 10/43 (23%)

Query  577   TKSKVDWIQCD-KCSGWLHETCTS---------NKNICNKCTK  609
             T  +VDW+QCD  C+ W H  C           +  IC +CTK
Sbjct  1765  TGREVDWVQCDGGCNEWFHMYCVGLNRSQIKPDDDYICIRCTK  1807


>INT12_DROME unnamed protein product
Length=328

 Score = 32.3 bits (72),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 45/104 (43%), Gaps = 24/104 (23%)

Query  516  NVSQRRTQTVSNKKKRVVKPRRQ---------LSSSSDSSLENRV--LSSTDDEVS----  560
            N++ R  +  +N   R   P +Q         L++S D    + V  ++ +DD +S    
Sbjct  58   NMTPRMLEDEANFSGRAATPPQQPINADEIINLTNSPDKEPSDSVDTIADSDDGLSAVGI  117

Query  561  -------DEGEDFCIECGDYYYTTKSKVDWIQCDKCSGWLHETC  597
                   D G+  C  CG+  +T  +++  I+C KC    H+ C
Sbjct  118  VNTGDTGDFGDLNCCVCGEMVFTATNRL--IECSKCGAMYHQEC  159


>LMNB1_DICDI unnamed protein product
Length=716

 Score = 31.2 bits (69),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 26/87 (30%), Positives = 48/87 (55%), Gaps = 5/87 (6%)

Query  456  TP-SKYLREIQPL--PLIPHRVSKRKQSAVELTSPENRVKRRVFSEKKEANASKKAEKNK  512
            TP SKY+  +  +  PL P+R ++R +   EL+   NR+K  +  +K E+  ++  +KN+
Sbjct  105  TPISKYIPSLSQIGTPLSPNRAAQRLREKDELSLIHNRLKSAL--KKLESAETELEKKNQ  162

Query  513  PCTNVSQRRTQTVSNKKKRVVKPRRQL  539
                + Q+ T T+   K+R  +  +QL
Sbjct  163  EYEELDQKHTATIKQLKQRSDQVEKQL  189



Lambda      K        H
   0.327    0.140    0.447 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4320747090


Query= XP_031327278.1 1-acylglycerol-3-phosphate O-acyltransferase
ABHD5-like isoform X1 [Photinus pyralis]

Length=393
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q5U191_DROME  unnamed protein product                                 469     8e-165
Q7JQU9_DROME  unnamed protein product                                 462     1e-162
LID1_CAEEL  unnamed protein product                                   240     3e-76 


>Q5U191_DROME unnamed protein product
Length=454

 Score = 469 bits (1208),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 213/356 (60%), Positives = 281/356 (79%), Gaps = 6/356 (2%)

Query  32   CSWNKFSESMLRAVEKKILSYLKTAYRGWYVDIGPTIGAADKIWTISLNADNQNTPIVLL  91
            C+W   S +MLRAVEKKILSY+K  YRG++VDIGP +G ADKIWTIS+N +++  P+VLL
Sbjct  59   CNWTSSSPTMLRAVEKKILSYVKLPYRGFFVDIGPAVGEADKIWTISMNTESKEVPLVLL  118

Query  92   HGLGAGVALWCLNLDAFAATRPVYAIDMIGFGRSSRPAFSTNAMEAEQQFVRSIEEWRHE  151
            HGLGAG+ALW +NLDAFA  RPVYA+D++GFGRSSRP F+ +A+  E+QFV+S+EEWR E
Sbjct  119  HGLGAGIALWVMNLDAFAKGRPVYAMDILGFGRSSRPLFAKDALVCEKQFVKSVEEWRRE  178

Query  152  MNLDKFILLGHSMGGFLAASYSLSHPQRVQHLILADPWGFPEKPPDSER-RPLPVWVRAV  210
            MN++  ILLGHSMGGF+A+SY+LSHP+RV+HLILADPWGFPEKP DS   + +P+WVRA+
Sbjct  179  MNINDMILLGHSMGGFIASSYALSHPERVKHLILADPWGFPEKPSDSTNGKTIPLWVRAI  238

Query  211  AYMMSPFNPLAAIRAAGPWGEWIIDKARPDIAKKFTPVVEE-CGLITQYLYQCNSQTPSG  269
            A +++P NPL A+RAAGP+G+W++ K RPDI +KF   +EE   L+ QY++QCN+Q PSG
Sbjct  239  ARVLTPLNPLWALRAAGPFGQWVVQKTRPDIMRKFQSTIEEDINLLPQYIHQCNAQNPSG  298

Query  270  ESAFHSMTSGFGWAKNPMVQRIDKLDKNIPITLLYGARSWVDNSAGEIIKSKRVGSYVQL  329
            ESAFH+M   FGWAK+PM+ RI  +  +IPIT +YG+RSW+D+S+GE IKS+R  + V +
Sbjct  299  ESAFHTMMQSFGWAKHPMIHRIKDVRSDIPITFIYGSRSWIDSSSGEKIKSQRGSNMVDI  358

Query  330  QIISSAGHHVYADKPDVFNKYVIEACKYADRVGNKYEYLKPSNV--DKTESDIEED  383
            +I++ AGHHVYADKPDVFN+YV E C      G K   + P  +  + TESD E +
Sbjct  359  KIVTGAGHHVYADKPDVFNRYVNETCDMYKVAGGK--LITPLQLIRESTESDEERE  412


>Q7JQU9_DROME unnamed protein product
Length=387

 Score = 462 bits (1188),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 210/347 (61%), Positives = 276/347 (80%), Gaps = 6/347 (2%)

Query  41   MLRAVEKKILSYLKTAYRGWYVDIGPTIGAADKIWTISLNADNQNTPIVLLHGLGAGVAL  100
            MLRAVEKKILSY+K  YRG++VDIGP +G ADKIWTIS+N +++  P+VLLHGLGAG+AL
Sbjct  1    MLRAVEKKILSYVKLPYRGFFVDIGPAVGEADKIWTISMNTESKEVPLVLLHGLGAGIAL  60

Query  101  WCLNLDAFAATRPVYAIDMIGFGRSSRPAFSTNAMEAEQQFVRSIEEWRHEMNLDKFILL  160
            W +NLDAFA  RPVYA+D++GFGRSSRP F+ +A+  E+QFV+S+EEWR EMN++  ILL
Sbjct  61   WVMNLDAFAKGRPVYAMDILGFGRSSRPLFAKDALVCEKQFVKSVEEWRREMNINDMILL  120

Query  161  GHSMGGFLAASYSLSHPQRVQHLILADPWGFPEKPPDSER-RPLPVWVRAVAYMMSPFNP  219
            GHSMGGF+A+SY+LSHP+RV+HLILADPWGFPEKP DS   + +P+WVRA+A +++P NP
Sbjct  121  GHSMGGFIASSYALSHPERVKHLILADPWGFPEKPSDSTNGKTIPLWVRAIARVLTPLNP  180

Query  220  LAAIRAAGPWGEWIIDKARPDIAKKFTPVVEE-CGLITQYLYQCNSQTPSGESAFHSMTS  278
            L A+RAAGP+G+W++ K RPDI +KF   +EE   L+ QY++QCN+Q PSGESAFH+M  
Sbjct  181  LWALRAAGPFGQWVVQKTRPDIMRKFQSTIEEDINLLPQYIHQCNAQNPSGESAFHTMMQ  240

Query  279  GFGWAKNPMVQRIDKLDKNIPITLLYGARSWVDNSAGEIIKSKRVGSYVQLQIISSAGHH  338
             FGWAK+PM+ RI  +  +IPIT +YG+RSW+D+S+GE IKS+R  + V ++I++ AGHH
Sbjct  241  SFGWAKHPMIHRIKDVRSDIPITFIYGSRSWIDSSSGEKIKSQRGSNMVDIKIVTGAGHH  300

Query  339  VYADKPDVFNKYVIEACKYADRVGNKYEYLKPSNV--DKTESDIEED  383
            VYADKPDVFN+YV E C      G K   + P  +  + TESD E +
Sbjct  301  VYADKPDVFNRYVNETCDMYKVAGGK--LITPLQLIRESTESDEERE  345


>LID1_CAEEL unnamed protein product
Length=360

 Score = 240 bits (613),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 124/326 (38%), Positives = 193/326 (59%), Gaps = 4/326 (1%)

Query  28   IPSWCSWNKFSESMLRAVEKKILSYLKTAYRGWYVDIGPTIGAADKIWTISLNADNQN-T  86
            I +W ++   S+  L+ VE ++    + +Y   YV +    G    +      A+N N  
Sbjct  13   IMNWMTFTDDSKEQLKIVEGRLFQSCEVSYEAKYVPVRFKRGEVYTVTVRPREAENLNGE  72

Query  87   PIVLLHGLGAGVALWCLNLDAFAATRPVYAIDMIGFGRSSRPAFSTNAMEAEQQFVRSIE  146
             IV + GLGAGVA++  N ++ A    V++ D +GFGRSSR  FS +   AE + V  +E
Sbjct  73   AIVFIPGLGAGVAMFTANFNSCAKNHAVHSFDPLGFGRSSRSRFSDDNAIAELEMVEVME  132

Query  147  EWRHEMNLDKFILLGHSMGGFLAASYSLSHPQRVQHLILADPWGFPEKPPDSERRPLP-V  205
            +WR  M ++K  ++GH+ GG+LA++Y+L +P RV HLIL DPWGF EK   +E+   P  
Sbjct  133  DWRKAMGIEKMYIIGHAFGGYLASAYALENPSRVAHLILVDPWGFAEKVETTEKLIKPYA  192

Query  206  WVRAVAYMMSPFNPLAAIRAAGPWGEWIIDKARPDIAKKFTPVVEECGLITQYLYQCNSQ  265
            W+  +  +   FNP + +R  GP+   I+ K RPD+  +F P + +   I +Y+Y  N  
Sbjct  193  WMSFLGGVAGYFNPFSPMRWMGPYAPAIVKKLRPDLLLRF-PGLHDYD-IYKYVYYLNLP  250

Query  266  TPSGESAFHSMTSGFGWAKNPMVQRIDKLDKNIPITLLYGARSWVDNSAGEIIKSKRVGS  325
             P+GE+AF +MT   GWAK PM++R + +DKN+ ++ +YG++SW+D      I+S R  +
Sbjct  251  NPTGETAFMNMTLPVGWAKRPMIKRFNGIDKNVGVSFIYGSKSWIDPGPAIDIQSTRENA  310

Query  326  YVQLQIISSAGHHVYADKPDVFNKYV  351
            YV ++I+  AG HVYAD P  FN+ V
Sbjct  311  YVDIKIVRGAGTHVYADDPAAFNEIV  336



Lambda      K        H
   0.327    0.140    0.447 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4320747090


Query= XP_031327279.1 1-acylglycerol-3-phosphate O-acyltransferase
ABHD5-like isoform X2 [Photinus pyralis]

Length=381
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q5U191_DROME  unnamed protein product                                 471     1e-165
Q7JQU9_DROME  unnamed protein product                                 462     3e-163
LID1_CAEEL  unnamed protein product                                   241     9e-77 


>Q5U191_DROME unnamed protein product
Length=454

 Score = 471 bits (1213),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 216/375 (58%), Positives = 289/375 (77%), Gaps = 7/375 (2%)

Query  2    STTSVIDEKKTSWIIPSW-CSWNKFSESMLRAVEKKILSYLKTAYRGWYVDIGPTIGAAD  60
            S+  + D +   + +  W C+W   S +MLRAVEKKILSY+K  YRG++VDIGP +G AD
Sbjct  40   SSMDLEDPRNNRFFLWKWLCNWTSSSPTMLRAVEKKILSYVKLPYRGFFVDIGPAVGEAD  99

Query  61   KIWTISLNADNQNTPIVLLHGLGAGVALWCLNLDAFAATRPVYAIDMIGFGRSSRPAFST  120
            KIWTIS+N +++  P+VLLHGLGAG+ALW +NLDAFA  RPVYA+D++GFGRSSRP F+ 
Sbjct  100  KIWTISMNTESKEVPLVLLHGLGAGIALWVMNLDAFAKGRPVYAMDILGFGRSSRPLFAK  159

Query  121  NAMEAEQQFVRSIEEWRHEMNLDKFILLGHSMGGFLAASYSLSHPQRVQHLILADPWGFP  180
            +A+  E+QFV+S+EEWR EMN++  ILLGHSMGGF+A+SY+LSHP+RV+HLILADPWGFP
Sbjct  160  DALVCEKQFVKSVEEWRREMNINDMILLGHSMGGFIASSYALSHPERVKHLILADPWGFP  219

Query  181  EKPPDSER-RPLPVWVRAVAYMMSPFNPLAAIRAAGPWGEWIIDKARPDIAKKFTPVVEE  239
            EKP DS   + +P+WVRA+A +++P NPL A+RAAGP+G+W++ K RPDI +KF   +EE
Sbjct  220  EKPSDSTNGKTIPLWVRAIARVLTPLNPLWALRAAGPFGQWVVQKTRPDIMRKFQSTIEE  279

Query  240  -CGLITQYLYQCNSQTPSGESAFHSMTSGFGWAKNPMVQRIDKLDKNIPITLLYGARSWV  298
               L+ QY++QCN+Q PSGESAFH+M   FGWAK+PM+ RI  +  +IPIT +YG+RSW+
Sbjct  280  DINLLPQYIHQCNAQNPSGESAFHTMMQSFGWAKHPMIHRIKDVRSDIPITFIYGSRSWI  339

Query  299  DNSAGEIIKSKRVGSYVQLQIISSAGHHVYADKPDVFNKYVIEACKYADRVGNKYEYLKP  358
            D+S+GE IKS+R  + V ++I++ AGHHVYADKPDVFN+YV E C      G K   + P
Sbjct  340  DSSSGEKIKSQRGSNMVDIKIVTGAGHHVYADKPDVFNRYVNETCDMYKVAGGK--LITP  397

Query  359  SNV--DKTESDIEED  371
              +  + TESD E +
Sbjct  398  LQLIRESTESDEERE  412


>Q7JQU9_DROME unnamed protein product
Length=387

 Score = 462 bits (1190),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 210/347 (61%), Positives = 276/347 (80%), Gaps = 6/347 (2%)

Query  29   MLRAVEKKILSYLKTAYRGWYVDIGPTIGAADKIWTISLNADNQNTPIVLLHGLGAGVAL  88
            MLRAVEKKILSY+K  YRG++VDIGP +G ADKIWTIS+N +++  P+VLLHGLGAG+AL
Sbjct  1    MLRAVEKKILSYVKLPYRGFFVDIGPAVGEADKIWTISMNTESKEVPLVLLHGLGAGIAL  60

Query  89   WCLNLDAFAATRPVYAIDMIGFGRSSRPAFSTNAMEAEQQFVRSIEEWRHEMNLDKFILL  148
            W +NLDAFA  RPVYA+D++GFGRSSRP F+ +A+  E+QFV+S+EEWR EMN++  ILL
Sbjct  61   WVMNLDAFAKGRPVYAMDILGFGRSSRPLFAKDALVCEKQFVKSVEEWRREMNINDMILL  120

Query  149  GHSMGGFLAASYSLSHPQRVQHLILADPWGFPEKPPDSER-RPLPVWVRAVAYMMSPFNP  207
            GHSMGGF+A+SY+LSHP+RV+HLILADPWGFPEKP DS   + +P+WVRA+A +++P NP
Sbjct  121  GHSMGGFIASSYALSHPERVKHLILADPWGFPEKPSDSTNGKTIPLWVRAIARVLTPLNP  180

Query  208  LAAIRAAGPWGEWIIDKARPDIAKKFTPVVEE-CGLITQYLYQCNSQTPSGESAFHSMTS  266
            L A+RAAGP+G+W++ K RPDI +KF   +EE   L+ QY++QCN+Q PSGESAFH+M  
Sbjct  181  LWALRAAGPFGQWVVQKTRPDIMRKFQSTIEEDINLLPQYIHQCNAQNPSGESAFHTMMQ  240

Query  267  GFGWAKNPMVQRIDKLDKNIPITLLYGARSWVDNSAGEIIKSKRVGSYVQLQIISSAGHH  326
             FGWAK+PM+ RI  +  +IPIT +YG+RSW+D+S+GE IKS+R  + V ++I++ AGHH
Sbjct  241  SFGWAKHPMIHRIKDVRSDIPITFIYGSRSWIDSSSGEKIKSQRGSNMVDIKIVTGAGHH  300

Query  327  VYADKPDVFNKYVIEACKYADRVGNKYEYLKPSNV--DKTESDIEED  371
            VYADKPDVFN+YV E C      G K   + P  +  + TESD E +
Sbjct  301  VYADKPDVFNRYVNETCDMYKVAGGK--LITPLQLIRESTESDEERE  345


>LID1_CAEEL unnamed protein product
Length=360

 Score = 241 bits (615),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 124/326 (38%), Positives = 193/326 (59%), Gaps = 4/326 (1%)

Query  16   IPSWCSWNKFSESMLRAVEKKILSYLKTAYRGWYVDIGPTIGAADKIWTISLNADNQN-T  74
            I +W ++   S+  L+ VE ++    + +Y   YV +    G    +      A+N N  
Sbjct  13   IMNWMTFTDDSKEQLKIVEGRLFQSCEVSYEAKYVPVRFKRGEVYTVTVRPREAENLNGE  72

Query  75   PIVLLHGLGAGVALWCLNLDAFAATRPVYAIDMIGFGRSSRPAFSTNAMEAEQQFVRSIE  134
             IV + GLGAGVA++  N ++ A    V++ D +GFGRSSR  FS +   AE + V  +E
Sbjct  73   AIVFIPGLGAGVAMFTANFNSCAKNHAVHSFDPLGFGRSSRSRFSDDNAIAELEMVEVME  132

Query  135  EWRHEMNLDKFILLGHSMGGFLAASYSLSHPQRVQHLILADPWGFPEKPPDSERRPLP-V  193
            +WR  M ++K  ++GH+ GG+LA++Y+L +P RV HLIL DPWGF EK   +E+   P  
Sbjct  133  DWRKAMGIEKMYIIGHAFGGYLASAYALENPSRVAHLILVDPWGFAEKVETTEKLIKPYA  192

Query  194  WVRAVAYMMSPFNPLAAIRAAGPWGEWIIDKARPDIAKKFTPVVEECGLITQYLYQCNSQ  253
            W+  +  +   FNP + +R  GP+   I+ K RPD+  +F P + +   I +Y+Y  N  
Sbjct  193  WMSFLGGVAGYFNPFSPMRWMGPYAPAIVKKLRPDLLLRF-PGLHDYD-IYKYVYYLNLP  250

Query  254  TPSGESAFHSMTSGFGWAKNPMVQRIDKLDKNIPITLLYGARSWVDNSAGEIIKSKRVGS  313
             P+GE+AF +MT   GWAK PM++R + +DKN+ ++ +YG++SW+D      I+S R  +
Sbjct  251  NPTGETAFMNMTLPVGWAKRPMIKRFNGIDKNVGVSFIYGSKSWIDPGPAIDIQSTRENA  310

Query  314  YVQLQIISSAGHHVYADKPDVFNKYV  339
            YV ++I+  AG HVYAD P  FN+ V
Sbjct  311  YVDIKIVRGAGTHVYADDPAAFNEIV  336



Lambda      K        H
   0.327    0.140    0.447 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4320747090


Query= XP_031327280.1 1-acylglycerol-3-phosphate O-acyltransferase
ABHD5-like isoform X3 [Photinus pyralis]

Length=367
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q5U191_DROME  unnamed protein product                                 466     1e-163
Q7JQU9_DROME  unnamed protein product                                 457     2e-161
LID1_CAEEL  unnamed protein product                                   240     2e-76 


>Q5U191_DROME unnamed protein product
Length=454

 Score = 466 bits (1198),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 205/326 (63%), Positives = 269/326 (83%), Gaps = 2/326 (1%)

Query  32   CSWNKFSESMLRAVEKKILSYLKTAYRGWYVDIGPTIGAADKIWTISLNADNQNTPIVLL  91
            C+W   S +MLRAVEKKILSY+K  YRG++VDIGP +G ADKIWTIS+N +++  P+VLL
Sbjct  59   CNWTSSSPTMLRAVEKKILSYVKLPYRGFFVDIGPAVGEADKIWTISMNTESKEVPLVLL  118

Query  92   HGLGAGVALWCLNLDAFAATRPVYAIDMIGFGRSSRPAFSTNAMEAEQQFVRSIEEWRHE  151
            HGLGAG+ALW +NLDAFA  RPVYA+D++GFGRSSRP F+ +A+  E+QFV+S+EEWR E
Sbjct  119  HGLGAGIALWVMNLDAFAKGRPVYAMDILGFGRSSRPLFAKDALVCEKQFVKSVEEWRRE  178

Query  152  MNLDKFILLGHSMGGFLAASYSLSHPQRVQHLILADPWGFPEKPPDSER-RPLPVWVRAV  210
            MN++  ILLGHSMGGF+A+SY+LSHP+RV+HLILADPWGFPEKP DS   + +P+WVRA+
Sbjct  179  MNINDMILLGHSMGGFIASSYALSHPERVKHLILADPWGFPEKPSDSTNGKTIPLWVRAI  238

Query  211  AYMMSPFNPLAAIRAAGPWGEWIIDKARPDIAKKFTPVVEE-CGLITQYLYQCNSQTPSG  269
            A +++P NPL A+RAAGP+G+W++ K RPDI +KF   +EE   L+ QY++QCN+Q PSG
Sbjct  239  ARVLTPLNPLWALRAAGPFGQWVVQKTRPDIMRKFQSTIEEDINLLPQYIHQCNAQNPSG  298

Query  270  ESAFHSMTSGFGWAKNPMVQRIDKLDKNIPITLLYGARSWVDNSAGEIIKSKRVGSYVQL  329
            ESAFH+M   FGWAK+PM+ RI  +  +IPIT +YG+RSW+D+S+GE IKS+R  + V +
Sbjct  299  ESAFHTMMQSFGWAKHPMIHRIKDVRSDIPITFIYGSRSWIDSSSGEKIKSQRGSNMVDI  358

Query  330  QIISSAGHHVYADKPDVFNKYVIEAC  355
            +I++ AGHHVYADKPDVFN+YV E C
Sbjct  359  KIVTGAGHHVYADKPDVFNRYVNETC  384


>Q7JQU9_DROME unnamed protein product
Length=387

 Score = 457 bits (1177),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 202/317 (64%), Positives = 264/317 (83%), Gaps = 2/317 (1%)

Query  41   MLRAVEKKILSYLKTAYRGWYVDIGPTIGAADKIWTISLNADNQNTPIVLLHGLGAGVAL  100
            MLRAVEKKILSY+K  YRG++VDIGP +G ADKIWTIS+N +++  P+VLLHGLGAG+AL
Sbjct  1    MLRAVEKKILSYVKLPYRGFFVDIGPAVGEADKIWTISMNTESKEVPLVLLHGLGAGIAL  60

Query  101  WCLNLDAFAATRPVYAIDMIGFGRSSRPAFSTNAMEAEQQFVRSIEEWRHEMNLDKFILL  160
            W +NLDAFA  RPVYA+D++GFGRSSRP F+ +A+  E+QFV+S+EEWR EMN++  ILL
Sbjct  61   WVMNLDAFAKGRPVYAMDILGFGRSSRPLFAKDALVCEKQFVKSVEEWRREMNINDMILL  120

Query  161  GHSMGGFLAASYSLSHPQRVQHLILADPWGFPEKPPDSER-RPLPVWVRAVAYMMSPFNP  219
            GHSMGGF+A+SY+LSHP+RV+HLILADPWGFPEKP DS   + +P+WVRA+A +++P NP
Sbjct  121  GHSMGGFIASSYALSHPERVKHLILADPWGFPEKPSDSTNGKTIPLWVRAIARVLTPLNP  180

Query  220  LAAIRAAGPWGEWIIDKARPDIAKKFTPVVEE-CGLITQYLYQCNSQTPSGESAFHSMTS  278
            L A+RAAGP+G+W++ K RPDI +KF   +EE   L+ QY++QCN+Q PSGESAFH+M  
Sbjct  181  LWALRAAGPFGQWVVQKTRPDIMRKFQSTIEEDINLLPQYIHQCNAQNPSGESAFHTMMQ  240

Query  279  GFGWAKNPMVQRIDKLDKNIPITLLYGARSWVDNSAGEIIKSKRVGSYVQLQIISSAGHH  338
             FGWAK+PM+ RI  +  +IPIT +YG+RSW+D+S+GE IKS+R  + V ++I++ AGHH
Sbjct  241  SFGWAKHPMIHRIKDVRSDIPITFIYGSRSWIDSSSGEKIKSQRGSNMVDIKIVTGAGHH  300

Query  339  VYADKPDVFNKYVIEAC  355
            VYADKPDVFN+YV E C
Sbjct  301  VYADKPDVFNRYVNETC  317


>LID1_CAEEL unnamed protein product
Length=360

 Score = 240 bits (612),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 124/331 (37%), Positives = 195/331 (59%), Gaps = 4/331 (1%)

Query  28   IPSWCSWNKFSESMLRAVEKKILSYLKTAYRGWYVDIGPTIGAADKIWTISLNADNQN-T  86
            I +W ++   S+  L+ VE ++    + +Y   YV +    G    +      A+N N  
Sbjct  13   IMNWMTFTDDSKEQLKIVEGRLFQSCEVSYEAKYVPVRFKRGEVYTVTVRPREAENLNGE  72

Query  87   PIVLLHGLGAGVALWCLNLDAFAATRPVYAIDMIGFGRSSRPAFSTNAMEAEQQFVRSIE  146
             IV + GLGAGVA++  N ++ A    V++ D +GFGRSSR  FS +   AE + V  +E
Sbjct  73   AIVFIPGLGAGVAMFTANFNSCAKNHAVHSFDPLGFGRSSRSRFSDDNAIAELEMVEVME  132

Query  147  EWRHEMNLDKFILLGHSMGGFLAASYSLSHPQRVQHLILADPWGFPEKPPDSERRPLP-V  205
            +WR  M ++K  ++GH+ GG+LA++Y+L +P RV HLIL DPWGF EK   +E+   P  
Sbjct  133  DWRKAMGIEKMYIIGHAFGGYLASAYALENPSRVAHLILVDPWGFAEKVETTEKLIKPYA  192

Query  206  WVRAVAYMMSPFNPLAAIRAAGPWGEWIIDKARPDIAKKFTPVVEECGLITQYLYQCNSQ  265
            W+  +  +   FNP + +R  GP+   I+ K RPD+  +F P + +   I +Y+Y  N  
Sbjct  193  WMSFLGGVAGYFNPFSPMRWMGPYAPAIVKKLRPDLLLRF-PGLHDYD-IYKYVYYLNLP  250

Query  266  TPSGESAFHSMTSGFGWAKNPMVQRIDKLDKNIPITLLYGARSWVDNSAGEIIKSKRVGS  325
             P+GE+AF +MT   GWAK PM++R + +DKN+ ++ +YG++SW+D      I+S R  +
Sbjct  251  NPTGETAFMNMTLPVGWAKRPMIKRFNGIDKNVGVSFIYGSKSWIDPGPAIDIQSTRENA  310

Query  326  YVQLQIISSAGHHVYADKPDVFNKYVIEACK  356
            YV ++I+  AG HVYAD P  FN+ V +  +
Sbjct  311  YVDIKIVRGAGTHVYADDPAAFNEIVSDVVE  341



Lambda      K        H
   0.327    0.140    0.447 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4320747090


Query= XP_031327281.1 protein phosphatase 1G-like [Photinus pyralis]

Length=166
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9W3G9_DROME  unnamed protein product                                 27.7    4.1  


>Q9W3G9_DROME unnamed protein product
Length=213

 Score = 27.7 bits (60),  Expect = 4.1, Method: Compositional matrix adjust.
 Identities = 19/48 (40%), Positives = 28/48 (58%), Gaps = 4/48 (8%)

Query  115  ITENRNDCEMEESVISVVAKI---RPREDDDNEEPKKKRKLNVDMYSK  159
            I  +R +C + E     + +I   R +EDDD +EP KKR+  VD+ SK
Sbjct  145  IPVHRQNCFLREQSQQQLDEISIPRLQEDDDQKEPPKKRQ-RVDVCSK  191



Lambda      K        H
   0.327    0.140    0.447 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4320747090


Query= XP_031327282.1 dual specificity protein phosphatase 23-like
[Photinus pyralis]

Length=160
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CDC14_CAEEL  unnamed protein product                                  59.7    6e-11
Q382E9_TRYB2  unnamed protein product                                 48.5    5e-07
Q382T8_TRYB2  unnamed protein product                                 42.0    9e-05


>CDC14_CAEEL unnamed protein product
Length=709

 Score = 59.7 bits (143),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/141 (25%), Positives = 66/141 (47%), Gaps = 19/141 (13%)

Query  12   NFSWIVPGELAGMACPKTK--------------HMNYLESVGIKHLITLSPEILPPSEGK  57
            +F+WI+PG++     P  +              + +Y     +  ++ L+ +    S+  
Sbjct  196  DFNWIIPGKILSFCGPHNESREENGYPYHAPDVYFDYFRENKVSTIVRLNAKNYDASKFT  255

Query  58   TIKWSQI--FIEEFEAPSLEQILKFVDICNTCRILHEAVGIHCRMGRGRTGVMGACYLVR  115
               +  +  F  +   PS E +LKF+ + +  +     V +HC+ G GRTG + AC++++
Sbjct  256  KAGFDHVDLFFIDGSTPSDEIMLKFIKVVDNTK---GGVAVHCKAGLGRTGTLIACWMMK  312

Query  116  FCGLAPERALINLRLLRPGSV  136
              GL     +  LR+ RPGSV
Sbjct  313  EYGLTAGECMGWLRVCRPGSV  333


>Q382E9_TRYB2 unnamed protein product
Length=494

 Score = 48.5 bits (114),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 47/85 (55%), Gaps = 5/85 (6%)

Query  68   EFEAPSLEQILKFVDICNTCRILHEAVGIHCRMGRGRTGVMGACYLVRFCGLAPERALIN  127
            +  AP  + +L+ V + ++       V +HC  G GRTG+M ACYL+ +    P   +I 
Sbjct  165  DMTAPKQDIVLRSVQVMDSHVKKSGKVLVHCHAGLGRTGLMIACYLL-YAQKMPSADVIE  223

Query  128  L-RLLRPGSVETREQERAVLQYHDY  151
            L R +RPG+++T  Q + +   HD+
Sbjct  224  LVRQMRPGAIQTSRQVKFI---HDF  245


>Q382T8_TRYB2 unnamed protein product
Length=818

 Score = 42.0 bits (97),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 25/44 (57%), Gaps = 0/44 (0%)

Query  93   AVGIHCRMGRGRTGVMGACYLVRFCGLAPERALINLRLLRPGSV  136
            AV +HC  G GRTG +   Y++R  G     A+   RL RPGSV
Sbjct  451  AVAVHCHAGLGRTGTIACTYIIRRYGFTARGAVGWTRLCRPGSV  494



Lambda      K        H
   0.327    0.140    0.447 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4320747090


Query= XP_031327283.1 N(6)-adenine-specific DNA methyltransferase
METTL4-like [Photinus pyralis]

Length=353
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DAMT1_CAEEL  unnamed protein product                                  103     7e-25
MET14_DROME  unnamed protein product                                  32.3    0.54 
ZW10_CAEEL  unnamed protein product                                   30.8    2.0  


>DAMT1_CAEEL unnamed protein product
Length=365

 Score = 103 bits (258),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 79/262 (30%), Positives = 129/262 (49%), Gaps = 22/262 (8%)

Query  96   KVKEFSKSANIEALETSATVYAESGRPNIANITGGNYDQAKLVEINDSC-FLFPNNCRFF  154
            ++ EF KS ++  L ++           I N    + D+  ++E +D   F  P    F 
Sbjct  117  QIIEFQKSESLSNLMSNGM---------INNWVRCSGDKPGIIENSDGTKFYIPPKSTFH  167

Query  155  CKDVAEINDH--LIDEQFDLIVLDPPWWNKYVRRKKAKTNDGYQMMFNDNIKE-LPVERL  211
              DV +I  +    D  FDLI+ DPPW++K V+RK+      YQM  ++ + + L +  +
Sbjct  168  VGDVKDIEQYSRAHDLLFDLIIADPPWFSKSVKRKRT-----YQM--DEEVLDCLDIPVI  220

Query  212  LGESGTVVVWCTNSNQHLEAVQNEFFPKWKVKFVARLFWLKVTQTGETVCKFSEPPGKQP  271
            L     +  W TN    +E    E F KW ++ VA    LK+T  G+ V  F     K P
Sbjct  221  LTHDALIAFWITN-RIGIEEEMIERFDKWGMEVVATWKLLKITTQGDPVYDFDNQKHKVP  279

Query  272  FEQIIIGSR-DEGPDWQFFNDKLIVSIPSALHSHKPPLIEILKTHLPEDPKCLEIFARYL  330
            FE +++  + D    ++   + +  S+P ++HSHKPPL+++L+    E  + LE+FAR L
Sbjct  280  FESLMLAKKKDSMRKFELPENFVFASVPMSVHSHKPPLLDLLRHFGIEFTEPLELFARSL  339

Query  331  LPNWTSWGLEAIRFQHLSVYEK  352
            LP+  S G E    Q   V+ +
Sbjct  340  LPSTHSVGYEPFLLQSEHVFTR  361


>MET14_DROME unnamed protein product
Length=397

 Score = 32.3 bits (72),  Expect = 0.54, Method: Compositional matrix adjust.
 Identities = 45/205 (22%), Positives = 80/205 (39%), Gaps = 22/205 (11%)

Query  153  FFCKDVAEINDHLIDEQFDLIVLDPPWWNKYVRRKK--AKTNDGYQMMFN-DNIKELPVE  209
            +   D+  ++   +  +FD+I+++PP   +Y R     A      ++ +N D+I  L V 
Sbjct  141  YLKADLKSLDVKTLGAKFDVILIEPP-LEEYARAAPSVATVGGAPRVFWNWDDILNLDVG  199

Query  210  RLLGESGTVVVWCTNSNQHLEAVQNEFFPKWKVKFVARLFWLKVTQTGETVCKFSEPPGK  269
             +      V +WC  S++ L+  +N    KW  +    + W++         K  EP  K
Sbjct  200  EIAAHRSFVFLWC-GSSEGLDMGRN-CLKKWGFRRCEDICWIRTNINKPGHSKQLEP--K  255

Query  270  QPFEQI-------IIGSRDEGPDWQFFN-----DKLIVSIPSALHSHKPPLIEILKTHLP  317
              F++        I G+     D  F +     D +I          KP  I  +  H  
Sbjct  256  AVFQRTKEHCLMGIKGTVRRSTDGDFIHANVDIDLIISEEEEFGSFEKPIEIFHIIEHFC  315

Query  318  EDPKCLEIFAR--YLLPNWTSWGLE  340
               + L +F R   + P W + G E
Sbjct  316  LGRRRLHLFGRDSSIRPGWLTVGPE  340


>ZW10_CAEEL unnamed protein product
Length=778

 Score = 30.8 bits (68),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 29/104 (28%), Positives = 49/104 (47%), Gaps = 17/104 (16%)

Query  8    NNGWFISHCELINNFYINVDKGESHKTFKLNPNLFKIVSPFQDLT-----KKSTRKRKNE  62
            NN  +ISHC +  +F  +   G++ KT  L P L   V   + +      K  TR R+  
Sbjct  529  NNCHYISHCIMTMSFEAS---GDNQKTL-LEPLLLDSVIRLRTVAADCMEKTLTRCRREM  584

Query  63   SHSLDHHNLHQCIEHVQKSYQQFVVELSRFLLPKVKEFSKSANI  106
            +  L+ H++    EH+  SY+      ++      +E S+SA+I
Sbjct  585  TAYLEDHSI---FEHLPASYKT-----TKNTFAAAEEMSESADI  620



Lambda      K        H
   0.327    0.140    0.447 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4320747090


Query= XP_031327284.1 uncharacterized protein LOC116158612 [Photinus
pyralis]

Length=178
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DYC1_CAEEL  unnamed protein product                                   35.0    0.024
PRSN_PIEBR  unnamed protein product                                   28.1    4.4  
Q54GM7_DICDI  unnamed protein product                                 27.3    8.0  


>DYC1_CAEEL unnamed protein product
Length=887

 Score = 35.0 bits (79),  Expect = 0.024, Method: Composition-based stats.
 Identities = 25/98 (26%), Positives = 44/98 (45%), Gaps = 17/98 (17%)

Query  52   VTVEVSTGGLKILQHSPKSKSKSLPINS----------FKVDTISYGVQDLVYTRVFCMI  101
            V + VS  G+K++    K K K L  +           +++  +S+  QDL   ++F  I
Sbjct  76   VDITVSVDGVKVVLQRKKQKEKGLSWDESKLLVMFHPIYRIFYVSHDSQDL---QIFSYI  132

Query  102  IVDDTNQKGALPFHCHAFVCDSRAQARRLTYALAAAFQ  139
              D  +      F C+ F C  ++QA R+   +  AF+
Sbjct  133  ARDGASNT----FKCNVFKCSKKSQAMRVVRTIGQAFE  166


>PRSN_PIEBR unnamed protein product
Length=850

 Score = 28.1 bits (61),  Expect = 4.4, Method: Composition-based stats.
 Identities = 29/93 (31%), Positives = 42/93 (45%), Gaps = 7/93 (8%)

Query  44   SENGPLPLVTVEVSTGGLKILQHSPKSKSKSLPINSFKVDTISYG-VQD---LVYTRVFC  99
            + N  L L  V  S GGL ++     + + +L  + + +  I Y  V D    ++   F 
Sbjct  522  NSNMILGLTNVSTSYGGLNLMVQDDSNGNSNLH-SDWDIKPIIYQYVPDGDYNIFNDNFP  580

Query  100  MIIVDDTNQKGALPFHCHAFVCDSRAQARRLTY  132
             I VD TNQ+GAL  H H F C +  Q     Y
Sbjct  581  NIAVDYTNQEGAL-VHGHNF-CSNNNQKWSFVY  611


>Q54GM7_DICDI unnamed protein product
Length=1399

 Score = 27.3 bits (59),  Expect = 8.0, Method: Composition-based stats.
 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 4/47 (9%)

Query  4     YKNFELIPKS----VLGEQPAKGLWGIKHTRKPVDILVAAAKNVSEN  46
             Y++  L P S    V+ E  A  + GIK T KP DI  + +  ++ N
Sbjct  964   YRDGTLAPHSFPPLVVYESSAIKISGIKSTNKPFDITFSTSDTLTSN  1010



Lambda      K        H
   0.327    0.140    0.447 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4320747090


Query= XP_031327285.1 putative nuclease HARBI1 [Photinus pyralis]

Length=272
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q19228_CAEEL  unnamed protein product                                 29.6    1.7  


>Q19228_CAEEL unnamed protein product
Length=147

 Score = 29.6 bits (65),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 13/50 (26%), Positives = 28/50 (56%), Gaps = 0/50 (0%)

Query  173  LDGKHVSIQAPYHSGSEYFSYKKSFSLVLMAACDSYYKFIYVDIAAPGSL  222
            L+G+ +SIQ  +   +E+ + +KSFS +++   D     +  +++  G L
Sbjct  70   LEGRQLSIQGEHDVENEHGASRKSFSRMILLPEDVDITSVATNLSNDGKL  119



Lambda      K        H
   0.327    0.140    0.447 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4320747090


Query= XP_031327286.1 trypsin beta-like [Photinus pyralis]

Length=247
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TRYDT_DROME  unnamed protein product                                  207     1e-66
Q9VQ97_DROME  unnamed protein product                                 152     3e-45
Q9W2C8_DROME  unnamed protein product                                 151     1e-43


>TRYDT_DROME unnamed protein product
Length=253

 Score = 207 bits (526),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 120/253 (47%), Positives = 155/253 (61%), Gaps = 8/253 (3%)

Query  1    MFRLVLLLTVVTLAAGARLPP---PRLDGKIVGGKPVKIEEYPYQVSLQSYGSHICGGSI  57
            M + V+LL+ V  A G  +P    P+LDG+IVGG    I  +P+Q+SLQ  GSH CGGSI
Sbjct  1    MLKFVILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSI  60

Query  58   LGPNKILTAAHCTSGSSASSLSIRHSSTYRGSEGVVIKVASIAQNPAYNPFTTSDDVSVL  117
               N I+TAAHC    SAS L IR  S+Y  S GV   V+S   +  YN  T  +D++++
Sbjct  61   YSSNVIVTAAHCLQSVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAII  120

Query  118  TLAESIKDSDIGKPIAMVEATAAEGGRAAVCTGWGTLSSGGSS-PLQLQAVDVEEVDRKE  176
             +  ++  S   K I +  +  A G  A+V +GWGTLS G SS P QLQ V+V  V + +
Sbjct  121  KINGALTFSSTIKAIGLASSNPANGAAASV-SGWGTLSYGSSSIPSQLQYVNVNIVSQSQ  179

Query  177  CNKS---YDGRITDTMICFASPGKDSCQGDSGGPLVVGDKQVGIVSWGRGCARPDYPGVY  233
            C  S   Y  +I  TMIC A+ GKD+CQGDSGGPLV G   VG+VSWG GCA  +YPGVY
Sbjct  180  CASSTYGYGSQIRSTMICAAASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVY  239

Query  234  AHVAPLRKFIDKN  246
            A VA LR ++  N
Sbjct  240  ADVAALRSWVISN  252


>Q9VQ97_DROME unnamed protein product
Length=245

 Score = 152 bits (383),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 96/244 (39%), Positives = 138/244 (57%), Gaps = 9/244 (4%)

Query  1    MFRLVLLLTVVTLAAGARLPPPRLDGKIVGGKPVKIEEYPYQVSLQSYGSHICGGSILGP  60
            +  LVL+ +V  ++AG+   P R    IVGG PV I E P+Q +L     +ICG  I   
Sbjct  3    LHWLVLVASVTLISAGSS--PER----IVGGHPVLISEVPWQAALMYSEKYICGAVIYSD  56

Query  61   NKILTAAHCTSGSSASSLSIRHSSTYRGSEGVVIKVASIAQNPAYNPFTT-SDDVSVLTL  119
              I+TAAHC      +  S+R  S ++   G   +VA I ++  Y   T   +D++V+ L
Sbjct  57   KIIITAAHCVERPFDTLYSVRVGSVWKNLGGQHARVAVIRKHEDYVSSTILFNDIAVIRL  116

Query  120  AESIKDSDIGKPIAMVEATAAEGGRAAVCTGWGTLSSGGSSPLQLQAVDVEEVDRKECNK  179
             +++  +   +PI + ++  A G  A+V +GWG +      P  L    V+ +D   C +
Sbjct  117  VDTLIFNAEVRPIQLADSAPAAGTEASV-SGWGEIGILWLQPTSLLKTSVKILDPNVCKR  175

Query  180  SYDGRITDTMICFASPGKDSCQGDSGGPLVVGDKQVGIVSWGRGCARPDYPGVYAHVAPL  239
            SY   IT TMIC A+  KDSC GDSGGPLV G + VGIVS+G GCA P +PGVYA+VA L
Sbjct  176  SYQ-YITKTMICAAALLKDSCHGDSGGPLVSGGQLVGIVSYGIGCANPFFPGVYANVAEL  234

Query  240  RKFI  243
            + +I
Sbjct  235  KPWI  238


>Q9W2C8_DROME unnamed protein product
Length=372

 Score = 151 bits (381),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/252 (36%), Positives = 131/252 (52%), Gaps = 24/252 (10%)

Query  19   LPPPR-----------LDGKIVGGKPVKIEEYPYQVSLQSYGSHICGGSILGPNKILTAA  67
            L PPR           +  +IVGG+  ++ +YP+   L   G   C  S+L    +LTA+
Sbjct  107  LNPPRNCSDCVCGIANIQKRIVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTAS  166

Query  68   HCTSGSSASSLSIR---HSSTYRGSEGVVIKVASIAQNPAYNPFTTSDDVSVLTLAESIK  124
            HC  G     +S+R   H       + +  KVA +  +P YN     +D++++ L E ++
Sbjct  167  HCVYGFRKERISVRLLEHDRKMSHMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVE  226

Query  125  DSDIGKPIAMVEATAAEGGRAAVCTGWGTLSSGGSSPLQLQAVDVEEVDRKECNKS-YDG  183
             +++  P+ M     +  G   + TGWG L  GG +   LQ V V  + + EC KS Y  
Sbjct  227  FNEVLHPVCMPTPGRSFKGENGIVTGWGALKVGGPTSDTLQEVQVPILSQDECRKSRYGN  286

Query  184  RITDTMIC--FASPGKDSCQGDSGGPLVV---GDKQ---VGIVSWGRGCARPDYPGVYAH  235
            +ITD M+C  +   GKDSCQGDSGGPL +   G ++    G+VSWG GCA+  YPGVYA 
Sbjct  287  KITDNMLCGGYDEGGKDSCQGDSGGPLHIVASGTREHQIAGVVSWGEGCAKAGYPGVYAR  346

Query  236  VAPLRKFIDKNL  247
            V     +I KNL
Sbjct  347  VNRYGTWI-KNL  357



Lambda      K        H
   0.327    0.140    0.447 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4320747090


Query= XP_031327287.1 trypsin beta-like [Photinus pyralis]

Length=250
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TRYDT_DROME  unnamed protein product                                  210     6e-68
Q9VQ97_DROME  unnamed protein product                                 153     1e-45
Q9W2C8_DROME  unnamed protein product                                 156     1e-45


>TRYDT_DROME unnamed protein product
Length=253

 Score = 210 bits (535),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 118/253 (47%), Positives = 157/253 (62%), Gaps = 5/253 (2%)

Query  1    MFRLVLLLTAVTLAAGAKLQSATPPRLDGKIVGGKPVKIEDYPYQVSLQYYGSHICGGSI  60
            M + V+LL+AV  A G  +     P+LDG+IVGG    I  +P+Q+SLQ  GSH CGGSI
Sbjct  1    MLKFVILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSI  60

Query  61   IGPNKVLTAAHCTSGSSASSLSIRHSSTYKGSEGVVIKVASIAQNPAYNPSTISDDVTVL  120
               N ++TAAHC    SAS L IR  S+Y  S GV   V+S   +  YN +T+ +D+ ++
Sbjct  61   YSSNVIVTAAHCLQSVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAII  120

Query  121  TLAEPIKDSDIGKPIAMVEANATEGDREAVCTGWGSLSSGGSS-PRQLQAVDVKEVDRKE  179
             +   +  S   K I +  +N   G   +V +GWG+LS G SS P QLQ V+V  V + +
Sbjct  121  KINGALTFSSTIKAIGLASSNPANGAAASV-SGWGTLSYGSSSIPSQLQYVNVNIVSQSQ  179

Query  180  CNTS---YGGGITDTMICFGSPGKDSCQGDSGGPLVVGEKQVGIVSWGYGCAHPEYPGVY  236
            C +S   YG  I  TMIC  + GKD+CQGDSGGPLV G   VG+VSWGYGCA+  YPGVY
Sbjct  180  CASSTYGYGSQIRSTMICAAASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVY  239

Query  237  AHVASLRTFIDKN  249
            A VA+LR+++  N
Sbjct  240  ADVAALRSWVISN  252


>Q9VQ97_DROME unnamed protein product
Length=245

 Score = 153 bits (386),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 98/244 (40%), Positives = 134/244 (55%), Gaps = 9/244 (4%)

Query  6    LLLTAVTLAAGAKLQSA--TPPRLDGKIVGGKPVKIEDYPYQVSLQYYGSHICGGSIIGP  63
            +LL  + L A   L SA  +P R    IVGG PV I + P+Q +L Y   +ICG  I   
Sbjct  1    MLLHWLVLVASVTLISAGSSPER----IVGGHPVLISEVPWQAALMYSEKYICGAVIYSD  56

Query  64   NKVLTAAHCTSGSSASSLSIRHSSTYKGSEGVVIKVASIAQNPAYNPSTI-SDDVTVLTL  122
              ++TAAHC      +  S+R  S +K   G   +VA I ++  Y  STI  +D+ V+ L
Sbjct  57   KIIITAAHCVERPFDTLYSVRVGSVWKNLGGQHARVAVIRKHEDYVSSTILFNDIAVIRL  116

Query  123  AEPIKDSDIGKPIAMVEANATEGDREAVCTGWGSLSSGGSSPRQLQAVDVKEVDRKECNT  182
             + +  +   +PI + ++    G  EA  +GWG +      P  L    VK +D   C  
Sbjct  117  VDTLIFNAEVRPIQLADSAPAAGT-EASVSGWGEIGILWLQPTSLLKTSVKILDPNVCKR  175

Query  183  SYGGGITDTMICFGSPGKDSCQGDSGGPLVVGEKQVGIVSWGYGCAHPEYPGVYAHVASL  242
            SY   IT TMIC  +  KDSC GDSGGPLV G + VGIVS+G GCA+P +PGVYA+VA L
Sbjct  176  SYQY-ITKTMICAAALLKDSCHGDSGGPLVSGGQLVGIVSYGIGCANPFFPGVYANVAEL  234

Query  243  RTFI  246
            + +I
Sbjct  235  KPWI  238


>Q9W2C8_DROME unnamed protein product
Length=372

 Score = 156 bits (395),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 88/236 (37%), Positives = 126/236 (53%), Gaps = 13/236 (6%)

Query  27   LDGKIVGGKPVKIEDYPYQVSLQYYGSHICGGSIIGPNKVLTAAHCTSGSSASSLSIR--  84
            +  +IVGG+  ++  YP+   L Y G   C  S++    +LTA+HC  G     +S+R  
Sbjct  123  IQKRIVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTASHCVYGFRKERISVRLL  182

Query  85   -HSSTYKGSEGVVIKVASIAQNPAYNPSTISDDVTVLTLAEPIKDSDIGKPIAMVEANAT  143
             H       + +  KVA +  +P YN     +D+ ++ L EP++ +++  P+ M     +
Sbjct  183  EHDRKMSHMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCMPTPGRS  242

Query  144  EGDREAVCTGWGSLSSGGSSPRQLQAVDVKEVDRKECNTS-YGGGITDTMIC--FGSPGK  200
                  + TGWG+L  GG +   LQ V V  + + EC  S YG  ITD M+C  +   GK
Sbjct  243  FKGENGIVTGWGALKVGGPTSDTLQEVQVPILSQDECRKSRYGNKITDNMLCGGYDEGGK  302

Query  201  DSCQGDSGGPLVV-----GEKQV-GIVSWGYGCAHPEYPGVYAHVASLRTFIDKNL  250
            DSCQGDSGGPL +      E Q+ G+VSWG GCA   YPGVYA V    T+I KNL
Sbjct  303  DSCQGDSGGPLHIVASGTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTWI-KNL  357



Lambda      K        H
   0.327    0.140    0.447 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4320747090


Query= XP_031327288.1 DNA polymerase epsilon catalytic subunit A [Photinus
pyralis]

Length=2209
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VCN1_DROME  unnamed protein product                                 2576    0.0  
Q9GV40_DROME  unnamed protein product                                 2533    0.0  
Q38DX2_TRYB2  unnamed protein product                                 628     0.0  


>Q9VCN1_DROME unnamed protein product
Length=2236

 Score = 2576 bits (6677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1247/2243 (56%), Positives = 1615/2243 (72%), Gaps = 101/2243 (5%)

Query  28    SELRLRQAQENDAIDTKYGFVRITEYQERTGFLLNIHTNEILNDDKRLISAVDYYFMEED  87
             +E   RQ++END ID+KYGF R+ + QERTG+L+N+H+NE+L++D+RLI+A+D +F++ D
Sbjct  29    NEAGYRQSRENDKIDSKYGFDRVKDSQERTGYLINMHSNEVLDEDRRLIAALDLFFIQMD  88

Query  88    GTRFKVSYPFKPYFYILTQRELLHEVSMYLLKKYAGTIDSIEEVVKEDLDLPNHLIGLKQ  147
             G+RFK +  ++PY  I  +  +  EV+ +L +KY+G I  +E + KEDLDLPNHL GL+Q
Sbjct  89    GSRFKCTVAYQPYLLIRPEDNMHLEVARFLGRKYSGQISGLEHITKEDLDLPNHLSGLQQ  148

Query  148   RYLKLSFVSQNDCIKVRKDILTVVRKNRKRKEQNCHYAALVVENIAKNTTESSHTSLN--  205
             +Y+KLSF++Q    KVR+++++ V++N++R++ N +Y  ++  ++A+++  S   +L   
Sbjct  149   QYIKLSFLNQTAMTKVRRELMSAVKRNQERQKSNTYYMQMLATSLAQSSAGSEDATLGKR  208

Query  206   -TDHLENILDIREYDVPYHVRVSIDLRIFCGSWYTVKCKAGGNHPPLFTPRPDIIERPEP  264
               D+++ I+DIRE+DVPYHVRVSIDLRIFCG WY ++C++G   P + T RPDI++RPEP
Sbjct  209   QQDYMDCIVDIREHDVPYHVRVSIDLRIFCGQWYNIRCRSGVELPTI-TCRPDILDRPEP  267

Query  265   IVLAFDIETTKLPLKFPDANTDQIMMISYMIDGQGFLITNREILSADIEDFEYTPKPELE  324
             +VLAFDIETTKLPLKFPDA TDQ+MMISYMIDGQG+LITNREI+S++++DFEYTPKPE E
Sbjct  268   VVLAFDIETTKLPLKFPDAQTDQVMMISYMIDGQGYLITNREIISSNVDDFEYTPKPEFE  327

Query  325   GKFTIFNEPNEFSLIQRFFYHIMDVRPHIFVTYNGDFFDWPFVEARAAFYELDMKQEIGF  384
             G F +FNE NE  L+QRFF HIM+VRPHI VTYNGDFFDWPFVE RAA Y+LDMKQEIGF
Sbjct  328   GNFIVFNEENEMQLLQRFFDHIMEVRPHIIVTYNGDFFDWPFVETRAAVYDLDMKQEIGF  387

Query  385   SKSKDGIYSCRAATHMDCLCWVKRDSYLPVGSQGLKAVAKAKLRYDPVELDPEEMCPLAA  444
             SK +DG Y  R A HMDCLCWVKRDSYLPVGSQGLKAVAKAKLRYDPVELDPE+MC +A 
Sbjct  388   SKLRDGNYLSRPAIHMDCLCWVKRDSYLPVGSQGLKAVAKAKLRYDPVELDPEDMCRMAV  447

Query  445   SQPQVLSNYSVSDAVATYYLYMQYVHPFIFALCTIIPCEPDEVLRKGSGTLCEALLMVEA  504
              QPQVL+NYSVSDAVATYYLYM+YVHPFIFAL TIIP EPDE+LRKGSGTLCE LLMVEA
Sbjct  448   EQPQVLANYSVSDAVATYYLYMKYVHPFIFALNTIIPMEPDEILRKGSGTLCETLLMVEA  507

Query  505   FQVNVIFPNKQETILNKLTDDGHLLHQETYVGGHVEALESGIFRADIPCRFRLDIEMLDT  564
             +   +++PNK ++ LNKL+++GH+L  ETYVGGHVEALESG+FRADIPCRFRLD  M+  
Sbjct  508   YHAQIVYPNKHQSELNKLSNEGHVLDSETYVGGHVEALESGVFRADIPCRFRLDPAMVKQ  567

Query  565   LISQISKTLTHAIEVEEGIPLDCVTNLQNVTDEIKTKLEALKEQPMRLEKPLIYHLDVGA  624
             L  Q+   L HAIEVEEGIPL+ V NL  V  EI   L+ L + P RLE+P+IYHLDVGA
Sbjct  568   LQEQVDAVLRHAIEVEEGIPLEKVLNLDEVRQEIVQGLQGLHDIPNRLEQPVIYHLDVGA  627

Query  625   MYPNVILTNRLQPYAMVDETVCAACDFNKPGATCQRGMAWMWRAEYMPASRSEYHRIQQQ  684
             MYPN+ILTNRLQP AMV +  CAACDFNKPG  C+R M W+WR E +PASR+E+ RIQQQ
Sbjct  628   MYPNIILTNRLQPSAMVSDLDCAACDFNKPGVRCKRSMDWLWRGEMLPASRNEFQRIQQQ  687

Query  685   LETEKFPPLFPNGPQRAFHELKLEEQAELEKKRMGIYCRKVYKKQKVTKMEERTSTVCQK  744
             LETEKFPPLFP GPQRAFHEL  E+QA  EKKR+  YCRK YKK K+TK+E RTST+CQK
Sbjct  688   LETEKFPPLFPGGPQRAFHELSKEDQAAYEKKRLTDYCRKAYKKTKLTKLETRTSTICQK  747

Query  745   ENSFYVDTVRAFRDRRYEYKSLSKKAKQQVVVAVIGGNAAEIKSAKNREILYDSLQLAHK  804
             ENSFYVDTVRAFRDRRYEYK L+K AK  V  AV  G+AAEIK+AK RE+LYDSLQLAHK
Sbjct  748   ENSFYVDTVRAFRDRRYEYKGLTKVAKASVNAAVASGDAAEIKAAKGREVLYDSLQLAHK  807

Query  805   CILNSFYGYVMRRGARWHSMEMGGIVCYTGANIIMKTREIVERVGRPLELDTDGIWCILP  864
             CILNSFYGYVMRRGARWHSM M GIVC TG+NII K REI+ERVGRPLELDTDGIWCILP
Sbjct  808   CILNSFYGYVMRRGARWHSMPMAGIVCLTGSNIITKAREIIERVGRPLELDTDGIWCILP  867

Query  865   ASFPDNVTVTTSDEKKKKLNISYPNAVLNAMVKANFTNDQYHELTDPYSLS---YVQKSE  921
              SFP   T+ TS EKKKK+NISYPNAVLN MVK +FTNDQYHEL      +   Y  + E
Sbjct  868   GSFPQEFTIHTSHEKKKKINISYPNAVLNTMVKDHFTNDQYHELRKDKENNLPKYDIRDE  927

Query  922   NSIFFEVDGPYRAMVLPASKEEGKKLKKRYAVFNFDGSLAELKGFEVKRRGELQLIKIFQ  981
             NSIFFEVDGPY AMVLPA+KEEGKKLKKRYAVFNFDG+LAELKGFEVKRRGELQLIK FQ
Sbjct  928   NSIFFEVDGPYLAMVLPAAKEEGKKLKKRYAVFNFDGTLAELKGFEVKRRGELQLIKNFQ  987

Query  982   SSVFEAFLKGDSLESCYAAVAQIADYWLDVLYSQGRHMPDSELFDLISENRSMSRKLEDY  1041
             SSVFEAFL G +LE CYA+VA++ADYWLDVLYS+G ++PDSELF+LISEN+SMS+KLE+Y
Sbjct  988   SSVFEAFLAGSTLEECYASVAKVADYWLDVLYSRGSNLPDSELFELISENKSMSKKLEEY  1047

Query  1042  GAQKSTSISTAKRLAEFLGDQMVKDAGLACKYVISKKPEGAPVTERAIPLAIFQAEEAVQ  1101
             GAQKSTSISTAKRLAEFLG+QMVKDAGLACKY+ISKKPEGAPVTERAIPLAIFQ+E +V+
Sbjct  1048  GAQKSTSISTAKRLAEFLGEQMVKDAGLACKYIISKKPEGAPVTERAIPLAIFQSEPSVR  1107

Query  1102  KYYLRKWLKDSSLNDFDIRDLLDWSYYIERLGGAIQKIITIPAAMQGVSNPVPRVRHPDW  1161
             +++LR+WLKD+++ D DIRD+LDW+YYIERLGG IQKIITIPAA+QG++NPVPRV+HPDW
Sbjct  1108  RHHLRRWLKDNTMGDADIRDVLDWNYYIERLGGTIQKIITIPAALQGLANPVPRVQHPDW  1167

Query  1162  LHKKMLEKDDNFKQRRITDMFSACAKNAANTLPTSKVKDIEDCGVTKKSPLKKPIANVNK  1221
             LHKKMLEK+D  KQRRI +MF++  K         K+ D+ED               V K
Sbjct  1168  LHKKMLEKNDVLKQRRINEMFTSRPKPKPLATEEDKLADMEDLAGKDGGEGAAGCPIVTK  1227

Query  1222  RKR---QQENEFEGFDLTLSWREALGTPPLLGETKADFDAWLAFQKKKWKYQMLQRLEGQ  1278
             RKR   ++ ++ E      +WR+ALG PP +GET+     W+ FQKKKWK+Q  QR   +
Sbjct  1228  RKRIQLEEHDDEEAQPQATTWRQALGAPPPIGETRKTIVEWVRFQKKKWKWQQDQRQRNR  1287

Query  1279  QKVKRLKG-STAVVR-SAAPGTLQGFLLKAQRALLANPWQILQIVKTNTPGEFLVWVLVE  1336
             Q  KR +G    VVR + +  TL GFL +AQR LL  PWQI+Q+V  +  G F VW L+ 
Sbjct  1288  QASKRTRGEDPPVVRATGSTATLGGFLRRAQRTLLDQPWQIVQLVPVDDLGHFTVWALIG  1347

Query  1337  SEIHIVKLIVPRMFYANLRTPKCADEGALFKKCNRTLPRSKQVNCLYLYTVQESLFEE--  1394
              E+H +KL VPR+FY N R+    +EG L++K NR LPRS+ V  LY Y+V E LF +  
Sbjct  1348  EELHKIKLTVPRIFYVNQRSAAPPEEGQLWRKVNRVLPRSRPVFNLYRYSVPEQLFRDNS  1407

Query  1395  YGKELQLNNSNVEGVYETQVPLIFRAFVQLGCVC-------RVTSKSPNMDSDTFSLSDL  1447
              G    L   ++EG+YETQ+ L FRA + +GC+C       R  ++    D +TFS+  L
Sbjct  1408  LGMLADLATPDIEGIYETQMTLEFRALMDMGCICGVQREEARRLAQLATKDLETFSIEQL  1467

Query  1448  EMTSISKQPYLPK--DSLKHLFLYQHRSNSDKRQFFGLFLTPIKKAIIIVVETVRHNEMP  1505
             E    ++  YL    + L+ ++LYQH + + K++ + L L P KKA +  ++TVR N+MP
Sbjct  1468  EQRPQTQVKYLASANNRLRKIYLYQHNTPTAKKEIWSLILMPSKKAFVFALDTVRANQMP  1527

Query  1506  NLKTIYQAERIA--------EQERNPDIELPPEDLQIMVRIETDVKEVHKLLQKHLQAYR  1557
             N++ +Y AER+A        EQ++     +P ED    V IE DVK++++ +Q+ L  Y+
Sbjct  1528  NMRQLYTAERLALLKNLTAEEQDK-----IPVEDYTFEVLIEVDVKQIYRHIQRALTTYK  1582

Query  1558  DEKKGPTLLAIQTLDDTLQLQHGVPVLTEFPQAHIHVKDVDDLYNSIDWRRIGAKALIRH  1617
              E +GPT+L +QT     +L   +P+L EFPQA IH+ D   L + +DW+R G++A+IRH
Sbjct  1583  QEHQGPTILCLQTALSARKLSLAMPILLEFPQAEIHISDDASLLSGLDWQRQGSRAVIRH  1642

Query  1618  YLNSERVLEFITEQCRYYHLPIGNLPTDPTLFASDLFFARHLIKQNHVLWCSNSDRPDLG  1677
             +LN   VL+ + +QCRY+H+PIGN+P D  LF +DLFFAR L + N VLW S S RPDLG
Sbjct  1643  FLNLNNVLDLMLDQCRYFHVPIGNMPPDTVLFGADLFFARLLQRHNFVLWWSASTRPDLG  1702

Query  1678  GSEESDARLLAESQEESSELCNKPGWYSSICIELDIDSLAINTLLQAHHITDIEGTSSAT  1737
             G E  D+RLLAE +E  S + NK G+Y  +C+EL +DSLA++ LLQ+  I ++EG SSA 
Sbjct  1703  GREADDSRLLAEFEESISVVQNKAGFYPDVCVELALDSLAVSALLQSTRIQEMEGASSAI  1762

Query  1738  AFDAAVPPSLDELISGNMNCG----YDETARCGEAFRILRTMATIWMRDISLYRNRFADF  1793
              FD     SL+E+I G +       YDETA C  AFR++R+M   W+R++S+ RN F+DF
Sbjct  1763  TFDVMPQVSLEEMI-GTVPAATLPSYDETALCSAAFRVMRSMVNGWLREVSINRNIFSDF  1821

Query  1794  QVIHFYRWLRSQKSLLYDPALLRNLQNLMKKLFMMLVAEFKRLGCTIIYANFNKIILCSK  1853
             Q++HFYRW+RS  +LLYDPAL R+L NLM+K+F+ ++AEFKRLG TIIYA+FN+IIL S 
Sbjct  1822  QIVHFYRWVRSSNALLYDPALRRSLNNLMRKMFLRIIAEFKRLGATIIYADFNRIILSSG  1881

Query  1854  KRLVEDALANAEFVITSIRNKELFHSLQITYSKCWEQLIWLDSTNFAGIQGKLPAGLEGE  1913
             K+ V DAL   ++++ S+RNKE+FHS+Q+++ +CW  ++W+D  NF+GI+GKLP G++  
Sbjct  1882  KKTVSDALGYVDYIVQSLRNKEMFHSIQLSFEQCWNFMLWMDQANFSGIRGKLPKGIDET  1941

Query  1914  AGEVQER-------------------------IETTNRDVVNEDEPVIVMNWNLAEQLPE  1948
                +                            +E+   +   EDE  + +NW + E LP+
Sbjct  1942  VSSIVSTTMIRDSERNQDDDEDEEEDSENRDPVESNEAEQDQEDELSLELNWTIGEHLPD  2001

Query  1949  AGGCRHNFNAIIAGYINAIYMKLRETDCNDSIVVGLSQPSLGLGANEVVTSYAKELIEGE  2008
                CR  F +++  ++ +    L E    +  +  +S       A + +    K   +G+
Sbjct  2002  ENECREKFESLLTLFMQS----LAEKKTTEQAIKDISH-----CAFDFILKLHKNYGKGK  2052

Query  2009  VSQNLFRIVERIFNRLPAKIDDCSPALEFVNAICHVLDLDPAVHDEVYNLKCNLLKLIGV  2068
                                    SP LE +  +   L +D  + +++  L+ N+L+L+G+
Sbjct  2053  P----------------------SPGLELIRTLIKALSVDKTLAEQINELRRNMLRLVGI  2090

Query  2069  GEFSEKAVWIDRTVSFVVPQIICKACNHCRDLDLGRDPHRSD----VAWLCPLCNTDYDN  2124
             GEFS+ A W D   S ++ ++ICKACNHCRDLDL +D HR+       WLC  C   YDN
Sbjct  2091  GEFSDLAEWEDPCDSHIINEVICKACNHCRDLDLCKDKHRAMKDGVPVWLCAQCYVAYDN  2150

Query  2125  NEIEGLILEIINKKFLAYNLQDMQCKKCGQIKMENLMMRCQCASEFMGLLPKADFVKLLE  2184
              EIE  +L+ + +K ++Y LQD++C +C +IK ENL   C CA  F+ L+   D   LL 
Sbjct  2151  EEIEMRMLDALQRKMMSYVLQDLRCSRCSEIKRENLAEFCTCAGNFVPLISGKDIQTLLG  2210

Query  2185  KFYKLAKTFNMKIVKEFIENVLA  2207
              F K+A    M+++++ +   L 
Sbjct  2211  TFNKVAANHKMQLLQQTVHQALT  2233


>Q9GV40_DROME unnamed protein product
Length=2220

 Score = 2533 bits (6564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1235/2241 (55%), Positives = 1599/2241 (71%), Gaps = 113/2241 (5%)

Query  28    SELRLRQAQENDAIDTKYGFVRITEYQERTGFLLNIHTNEILNDDKRLISAVDYYFMEED  87
             +E   RQ++END ID+KYGF R+ + QERTG+L+N+H+NE+L++D+RLI+A+D +F++ D
Sbjct  29    NEAGYRQSRENDKIDSKYGFDRVKDSQERTGYLINMHSNEVLDEDRRLIAALDLFFIQMD  88

Query  88    GTRFKVSYPFKPYFYILTQRELLHEVSMYLLKKYAGTIDSIEEVVKEDLDLPNHLIGLKQ  147
             G+RFK +  ++PY  I  +  +  EV+ +L +KY+G I  +E + KEDLDLPNHL GL+Q
Sbjct  89    GSRFKCTVAYQPYLLIRPEDNMHLEVARFLGRKYSGQISGLEHITKEDLDLPNHLSGLQQ  148

Query  148   RYLKLSFVSQNDCIKVRKDILTVVRKNRKRKEQNCHYAALVVENIAKNTTESSHTSLNT-  206
             +Y+KLSF++Q    KVR+++++ V++N++R++ N +Y  ++  ++A+++  S   +L   
Sbjct  149   QYIKLSFLNQTAMTKVRRELMSAVKRNQERQKSNTYYMQMLATSLAQSSAGSEDATLGKR  208

Query  207   --DHLENILDIREYDVPYHVRVSIDLRIFCGSWYTVKCKAGGNHPPLFTPRPDIIERPEP  264
               D+++ I+DIRE+DVPYHVRVSIDLRIFCG WY ++C++G   P + T RPDI++RPEP
Sbjct  209   QQDYMDCIVDIREHDVPYHVRVSIDLRIFCGQWYNIRCRSGVELPTI-TCRPDILDRPEP  267

Query  265   IVLAFDIETTKLPLKFPDANTDQIMMISYMIDGQGFLITNREILSADIEDFEYTPKPELE  324
             +VLAFDIETTKLPLKFPDA TDQ+MMISYMIDGQG+LITNREI+S++++DFEYTPKPE E
Sbjct  268   VVLAFDIETTKLPLKFPDAQTDQVMMISYMIDGQGYLITNREIISSNVDDFEYTPKPEFE  327

Query  325   GKFTIFNEPNEFSLIQRFFYHIMDVRPHIFVTYNGDFFDWPFVEARAAFYELDMKQEIGF  384
             G F +FNE NE  L+QRFF HIM+VRPHI VTYNGDFFDWPFVE RAA Y+LDMKQEIGF
Sbjct  328   GNFIVFNEENEMQLLQRFFDHIMEVRPHIIVTYNGDFFDWPFVETRAAVYDLDMKQEIGF  387

Query  385   SKSKDGIYSCRAATHMDCLCWVKRDSYLPVGSQGLKAVAKAKLRYDPVELDPEEMCPLAA  444
             SK +DG Y  R A HMDCLCWVKRDSYLPVGSQGLKAVAKAKLRYDPVELDPE+MC +A 
Sbjct  388   SKLRDGNYLSRPAIHMDCLCWVKRDSYLPVGSQGLKAVAKAKLRYDPVELDPEDMCRMAV  447

Query  445   SQPQVLSNYSVSDAVATYYLYMQYVHPFIFALCTIIPCEPDEVLRKGSGTLCEALLMVEA  504
              QPQVL+NYSVSDAVATYYLYM+YVHPFIFAL TIIP EPDE+LRKGSGTLCE LLMVEA
Sbjct  448   EQPQVLANYSVSDAVATYYLYMKYVHPFIFALNTIIPMEPDEILRKGSGTLCETLLMVEA  507

Query  505   FQVNVIFPNKQETILNKLTDDGHLLHQETYVGGHVEALESGIFRADIPCRFRLDIEMLDT  564
             +   +++PNK ++ LNKL+++GH+L  ETYVGGHVEALESG+FRADIPCRFRLD  M+  
Sbjct  508   YHAQIVYPNKHQSELNKLSNEGHVLDSETYVGGHVEALESGVFRADIPCRFRLDPAMVKQ  567

Query  565   LISQISKTLTHAIEVEEGIPLDCVTNLQNVTDEIKTKLEALKEQPMRLEKPLIYHLDVGA  624
             L  Q+   L HAIEVEEGIPL+ V NL  V  EI   L+ L + P RLE+P+IYHLDVGA
Sbjct  568   LQEQVDAVLRHAIEVEEGIPLEKVLNLDEVRQEIVQGLQGLHDIPNRLEQPVIYHLDVGA  627

Query  625   MYPNVILTNRLQPYAMVDETVCAACDFNKPGATCQRGMAWMWRAEYMPASRSEYHRIQQQ  684
             MYPN+ILTNRLQP AMV +  CAACDFNKPG  C+R M W+WR E +PASR+E+ RIQQQ
Sbjct  628   MYPNIILTNRLQPSAMVSDLDCAACDFNKPGVRCKRSMDWLWRGEMLPASRNEFQRIQQQ  687

Query  685   LETEKFPPLFPNGPQRAFHELKLEEQAELEKKRMGIYCRKVYKKQKVTKMEERTSTVCQK  744
             LETEKFPPLFP GPQRAFHEL  E+QA  EKKR+  YCRK YKK K+TK+E RTST+CQK
Sbjct  688   LETEKFPPLFPGGPQRAFHELSKEDQAAYEKKRLTDYCRKAYKKTKLTKLETRTSTICQK  747

Query  745   ENSFYVDTVRAFRDRRYEYKSLSKKAKQQVVVAVIGGNAAEIKSAKNREILYDSLQLAHK  804
             ENSFYVDTVRAFRDRRYEYK L+K AK  V  AV  G+AAEIK+AK RE+LYDSLQLAHK
Sbjct  748   ENSFYVDTVRAFRDRRYEYKGLTKVAKASVNAAVASGDAAEIKAAKGREVLYDSLQLAHK  807

Query  805   CILNSFYGYVMRRGARWHSMEMGGIVCYTGANIIMKTREIVERVGRPLELDTDGIWCILP  864
             CILNSFYGYVMRRGARWHSM M GIVC TG+NII K REI+ERVGRPLELDTDGIWCILP
Sbjct  808   CILNSFYGYVMRRGARWHSMPMAGIVCLTGSNIITKAREIIERVGRPLELDTDGIWCILP  867

Query  865   ASFPDNVTVTTSDEKKKKLNISYPNAVLNAMVKANFTNDQYHELTDPYSLS---YVQKSE  921
              SFP   T+ TS EKKKK+NISYPNAVLN MVK +FTNDQYHEL      +   Y  + E
Sbjct  868   GSFPQEFTIHTSHEKKKKINISYPNAVLNTMVKDHFTNDQYHELRKDKENNLPKYDIRDE  927

Query  922   NSIFFEVDGPYRAMVLPASKEEGKKLKKRYAVFNFDGSLAELKGFEVKRRGELQLIKIFQ  981
             NSIFFEVDGPY AMVLPA+KEEGKKLKKRYAVFNFDG+LAELKGFEVKRRGELQLIK FQ
Sbjct  928   NSIFFEVDGPYLAMVLPAAKEEGKKLKKRYAVFNFDGTLAELKGFEVKRRGELQLIKNFQ  987

Query  982   SSVFEAFLKGDSLESCYAAVAQIADYWLDVLYSQGRHMPDSELFDLISENRSMSRKLEDY  1041
             SSVFEAFL G +LE CYA+VA++ADYWLDVLYS+G ++PDSELF+LISEN+SMS+KLE+Y
Sbjct  988   SSVFEAFLAGSTLEECYASVAKVADYWLDVLYSRGSNLPDSELFELISENKSMSKKLEEY  1047

Query  1042  GAQKSTSISTAKRLAEFLGDQMVKDAGLACKYVISKKPEGAPVTERAIPLAIFQAEEAVQ  1101
             GAQKSTSISTAKRLAEFLG+QMVKDAGLACKY+ISKKPEGAPVTERAIPLAIFQ+E +V+
Sbjct  1048  GAQKSTSISTAKRLAEFLGEQMVKDAGLACKYIISKKPEGAPVTERAIPLAIFQSEPSVR  1107

Query  1102  KYYLRKWLKDSSLNDFDIRDLLDWSYYIERLGGAIQKIITIPAAMQGVSNPVPRVRHPDW  1161
             +++LR+WLKD+++ D DIRD+LDW+YYIERLGG IQKIITIPAA+QG++NPVPRV+HPDW
Sbjct  1108  RHHLRRWLKDNTMGDADIRDVLDWNYYIERLGGTIQKIITIPAALQGLANPVPRVQHPDW  1167

Query  1162  LHKKMLEKDDNFKQRRITDMFSACAKNAANTLPTSKVKDIEDCGVTKKSPLKKPIANVNK  1221
             LHKKMLEK+D  KQRRI +MF++  K         K+ D+ED               V K
Sbjct  1168  LHKKMLEKNDVLKQRRINEMFTSRPKPKPLATEEDKLADMEDLAGKDGGEGAAGCPIVTK  1227

Query  1222  RKR---QQENEFEGFDLTLSWREALGTPPLLGETKADFDAWLAFQKKKWKYQMLQRLEGQ  1278
             RKR   ++ +E E      +WR+ALG PP +GET+     W+ FQKKKWK+Q  QR   +
Sbjct  1228  RKRIQLEEHDEEEAQPQATTWRQALGAPPPIGETRKTIVEWVRFQKKKWKWQQDQRQRNR  1287

Query  1279  QKVKRLKGSTAVVRSAAPGTLQGFLLKAQRALLANPWQILQIVKTNTPGEFLVWVLVESE  1338
             Q  KR +G         P     FL +AQR LL  PWQI+Q+V  +  G F VW L+  E
Sbjct  1288  QASKRTRGED-------PRYTGRFLRRAQRTLLDQPWQIVQLVPVDDLGHFTVWALIGEE  1340

Query  1339  IHIVKLIVPRMFYANLRTPKCADEGALFKKCNRTLPRSKQVNCLYLYTVQESLFEE--YG  1396
             +H +KL VPR+FY N R+    +EG L++K NR LPRS+ V  LY Y+V E LF +   G
Sbjct  1341  LHKIKLTVPRIFYVNQRSAAPPEEGQLWRKVNRVLPRSRPVFNLYRYSVPEQLFRDNSLG  1400

Query  1397  KELQLNNSNVEGVYETQVPLIFRAFVQLGCVC-------RVTSKSPNMDSDTFSLSDLEM  1449
                 L   ++EG+YETQ+ L FRA + +GC+C       R  ++    D +TFS+  LE 
Sbjct  1401  MLADLATPDIEGIYETQMTLEFRALMDMGCICGVQREEARRLAQLATKDLETFSIEQLEQ  1460

Query  1450  -----TSISKQPYLPKDSLKHLFLYQHRSNSDKRQFFGLFLTPIKKAIIIVVETVRHNEM  1504
                  ++I   P +       + +   R    +R+   L   P KKA +  ++TVR N+M
Sbjct  1461  GPRLRSNIWLAPTIDCAKSTCISITHRRP---RRRSVSLIPMPSKKAFVFALDTVRANQM  1517

Query  1505  PNLKTIYQAERIA--------EQERNPDIELPPEDLQIMVRIETDVKEVHKLLQKHLQAY  1556
             PN++ +Y AER+A        EQ++     +P ED    V IE DVK++++ +Q+ L  Y
Sbjct  1518  PNMRQLYTAERLALLKNLTAEEQDK-----IPVEDYTFEVLIEVDVKQIYRHIQRALTTY  1572

Query  1557  RDEKKG-PTLLAIQTLDDTLQLQHGVPVLTEFPQAHIHVKDVDDLYNSIDWRRIGAKALI  1615
             + E +G PT+L +QT     +L   +P+L EFPQA IH+ D   L + +DW+R G++A+I
Sbjct  1573  KQEHQGPPTILCLQTALSARKLSLAMPILLEFPQAQIHISDDASLLSGLDWQRQGSRAVI  1632

Query  1616  RHYLNSERVLEFITEQCRYYHLPIGNLPTDPTLFASDLFFARHLIKQNHVLWCSNSDRPD  1675
             RH+LN   VL+ + +QCRY+H+PIGN+P D  LF +DLFFAR L + N VLW S S RPD
Sbjct  1633  RHFLNLNNVLDLMLDQCRYFHVPIGNMPPDTVLFGADLFFARLLQRHNFVLWWSASTRPD  1692

Query  1676  LGGSEESDARLLAESQEESSELCNKPGWYSSICIELDIDSLAINTLLQAHHITDIEGTSS  1735
             LGG E  D+RLLAE +E  S + NK G+Y  +C+EL +DSLA++ LLQ+  I ++EG SS
Sbjct  1693  LGGREADDSRLLAEFEESISVVQNKAGFYPDVCVELALDSLAVSALLQSTRIQEMEGASS  1752

Query  1736  ATAFDAAVPPSLDELISGNMNCG----YDETARCGEAFRILRTMATIWMRDISLYRNRFA  1791
             A  FD     SL+E+I G +       YDETA C  AFR++R+M   W+R++S+ RN F+
Sbjct  1753  AITFDVMPQVSLEEMI-GTVPAATLPSYDETALCSAAFRVMRSMVNGWLREVSINRNIFS  1811

Query  1792  DFQVIHFYRWLRSQKSLLYDPALLRNLQNLMKKLFMMLVAEFKRLGCTIIYANFNKIILC  1851
             DFQ++HFYRW+RS  +LLYDPAL R+L NLM+K+F+ ++AEFKRLG TIIYA+FN+IIL 
Sbjct  1812  DFQIVHFYRWVRSSNALLYDPALRRSLNNLMRKMFLRIIAEFKRLGATIIYADFNRIILS  1871

Query  1852  SKKRLVEDALANAEFVITSIRNKELFHSLQITYSKCWEQLIWLDSTNFAGIQGKLPAGLE  1911
             S K+ V DAL   ++++ S+RNKE+FHS+Q+++ +CW  ++W+D  NF+GI+GKLP G++
Sbjct  1872  SGKKTVSDALGYVDYIVQSLRNKEMFHSIQLSFEQCWNFMLWMDQANFSGIRGKLPKGID  1931

Query  1912  GEAGEV-------------------------QERIETTNRDVVNEDEPVIVMNWNLAEQL  1946
                  +                         ++ +E+   +   EDE  + +NW + E L
Sbjct  1932  ETVSSIVSTTMIRDSERNQDDDEDEEEDSENRDPVESNEAEQDQEDELSLELNWTIGEHL  1991

Query  1947  PEAGGCRHNFNAIIAGYINAIYMKLRETDCNDSIVVGLSQPSLGLGANEVVTSYAKELIE  2006
             P+   CR  F +++  ++ +    L E    +  +  +S       A + +    K   +
Sbjct  1992  PDENECREKFESLLTLFMQS----LAEKKTTEQAIKDISH-----CAFDFILKLHKNYGK  2042

Query  2007  GEVSQNLFRIVERIFNRLPAKIDDCSPALEFVNAICHVLDLDPAVHDEVYNLKCNLLKLI  2066
             G+                       SP LE +  +   L +D  + +++  L+ N+L+L+
Sbjct  2043  GKP----------------------SPGLELIRTLIKALSVDKTLAEQINELRRNMLRLV  2080

Query  2067  GVGEFSEKAVWIDRTVSFVVPQIICKACNHCRDLDLGRDPHRSDVAWLCPLCNTDYDNNE  2126
             G+GEFS+ A W D   S ++ ++ICKACNHCRDLDL +D HR+    +   C   YDN E
Sbjct  2081  GIGEFSDLAEWEDPCDSHIINEVICKACNHCRDLDLCKDKHRA----MKDGCYVAYDNEE  2136

Query  2127  IEGLILEIINKKFLAYNLQDMQCKKCGQIKMENLMMRCQCASEFMGLLPKADFVKLLEKF  2186
             IE  +L+ + +K ++Y LQD++C +C +IK ENL   C CA  F+ L+   D   LL  F
Sbjct  2137  IEMRMLDALQRKMMSYVLQDLRCSRCSEIKRENLAEFCTCAGNFVPLISGKDIQTLLGTF  2196

Query  2187  YKLAKTFNMKIVKEFIENVLA  2207
              K+A    M+++++ +   L 
Sbjct  2197  NKVAANHKMQLLQQTVHQALT  2217


>Q38DX2_TRYB2 unnamed protein product
Length=2246

 Score = 628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 491/1557 (32%), Positives = 747/1557 (48%), Gaps = 194/1557 (12%)

Query  697   GPQRAFHELKLEEQAELEKKRMGIYCRKVYKKQKVTKMEERTSTVCQKENSFYVDTVRAF  756
             G  +A+++L+   +  + KKR+  Y RK Y K   ++   R+  VCQ+ENSFYVDTVR F
Sbjct  754   GGPKAYYKLQESTKFNMLKKRLAEYSRKAYGKIHESREIMRSDVVCQRENSFYVDTVRLF  813

Query  757   RDRRYEYKSLSKKAKQQVVVAVIGGNAAEIKSAKNREILYDSLQLAHKCILNSFYGYVMR  816
             RDRRYEYK+  K  K+++  A    +  EIK  K+R +  +SLQLAHKCILNSFYGYVMR
Sbjct  814   RDRRYEYKAALKTWKKRLDNA---KDTEEIKLCKSRCVQMESLQLAHKCILNSFYGYVMR  870

Query  817   RGARWHSMEMGGIVCYTGANIIMKTREIVERVGRPLELDTDGIWCILPASFPDNVTVTTS  876
             +G+RW+SMEM GIV Y GA +I   R +V+++G  LELDTDGIWC LP +FP+N T TT+
Sbjct  871   KGSRWYSMEMAGIVTYLGATLIQMARALVQQIGVTLELDTDGIWCCLPNTFPENFTFTTT  930

Query  877   DEKKKKLNISYPNAVLNAMVKANFTNDQYHELTDPYSLSYVQKSENSIFFEVDGPYRAMV  936
             +    K+ ISYP  VLN MV   +TN QY     P    Y ++SE SI+FEVDGPY AM+
Sbjct  931   NPSTPKVTISYPCIVLNKMVHDGYTNHQYQTCVGPG--LYERRSECSIYFEVDGPYLAMM  988

Query  937   LPASKEEGKKLKKRYAVFNFDGSLAELKGFEVKRRGELQLIKIFQSSVFEAFLKGDSLES  996
             LPAS+EEGK +KKRYAVF+ DG LA+LKGFE+KRRGEL LIK FQS VF  FL G +L  
Sbjct  989   LPASREEGKGIKKRYAVFDPDGRLADLKGFELKRRGELMLIKDFQSQVFRRFLDGTTLVE  1048

Query  997   CYAAVAQIADYWLDVLYSQGRHMPDSELFDLISENRSMSRKLEDY-GAQKSTSISTAKRL  1055
              YA+ A  A+  LD+LYS+G      E+ + +SE+ +M+R+L +Y  +QKS +++TA+R+
Sbjct  1049  SYASAAVAANVALDMLYSKGEGYDPEEILEKLSESSNMTRRLSEYPDSQKSLALTTARRI  1108

Query  1056  AEFLGDQMVKDAGLACKYVISKKPEGAPVTERAIPLAIFQAEEAVQKYYLRKWLKDSSLN  1115
              +FLG QMVKD GLAC++VIS+ P G PVTERAIPL IF+A+ A++ ++LRKW  D+S++
Sbjct  1109  GDFLGPQMVKDKGLACQFVISRLPSGRPVTERAIPLTIFRADPAIRTHFLRKWTGDNSIS  1168

Query  1116  -DFDIRDLLDWSYYIERLGGAIQKIITIPAAMQGVSNPVPRVRHPDWLHKKMLEKDDNFK  1174
              + D++ LLDW YYI R    +QKIITIPAA+Q V NPVPRV +PDWL K++ + +  FK
Sbjct  1169  ANVDLQHLLDWDYYIARYNACVQKIITIPAALQQVPNPVPRVPYPDWLQKRVQQLNSRFK  1228

Query  1175  QRRITDMFSACAKNAANTLPTSKVKDIEDC----GVTKKSPLKKPIANVNKRKRQ-----  1225
             Q  +T+MF   AK     +P     D+ED     GV   S  +K +    +RK+      
Sbjct  1229  QTTLTNMFVK-AKPGDGGVP-----DVEDLVTGDGVAPSSGGEKDV----RRKKNGSAGV  1278

Query  1226  --------QENEF--------------EGFDLTLSWREAL------------------GT  1245
                     QE+E               EG+ L    REA                     
Sbjct  1279  VNGDVYYLQESEGTDSDVASIVNVSDDEGYRLV---REAELHEIEDVEMLKSKYFAPNSN  1335

Query  1246  PPLLGETKAD--FDAWLAFQKKKWKYQMLQRLEGQQKVKRLKGSTAVVRSAAPGTLQGFL  1303
              P+     AD    AWL  QK+ W  +   R +       +K S  +     P +     
Sbjct  1336  HPMDAAFFADARVGAWLKLQKQAWTRRATLRRQ------MMKESELLTADGQPTS--SHF  1387

Query  1304  LKAQRALLANPWQILQI-VKTNTPGEFLVWVLVESEIHIVKLIVPRMFYANLRTPKCADE  1362
             +  +   L+  W I++I       G   V   ++  ++  + IVPR    +      AD 
Sbjct  1388  IDVKTKALSTTWHIMEIRTDKADDGTVAVIAALDKTLYTFRCIVPRRIVVD------ADH  1441

Query  1363  GALFKKCN-----RTLPRSK-QVNCLYLYTVQESLFEEYGKELQLNNSNVEGVYETQVPL  1416
              A             LPRS+   N L++        E     L     +V  VYE  +  
Sbjct  1442  NAFLPSAKPVTNALVLPRSRSSTNLLHVDLPPGREGERMLNGLLTGREDVHMVYEDHITR  1501

Query  1417  IFRAFVQLGCVCRV-------TSKSPNMDSDTFSLSDLEMTSISKQPYLPKDSLKHLFLY  1469
                   ++GC   V        ++       TFS+   E+TS+    YL   S + +FL+
Sbjct  1502  AEVMIEKIGCCANVLVDDYLRNARQRPYARGTFSVD--ELTSVPTGNYLQNSSNRFVFLF  1559

Query  1470  QHRSNSDKRQFFGLFLTPIKKAIIIVVETVRH-NEMPNLKTIYQAERIAEQERNPDIELP  1528
                  SD R   GL       A + +++         N +T++     A Q  N   E+P
Sbjct  1560  H--VASDTRGIIGLVNHFDHTAFVAIIQPASAPAPTINWRTLFFE---AAQSLN-STEVP  1613

Query  1529  PEDLQIMVRIETDVKEVHKLLQKHLQAYRDEKKGPTLLAIQTLDDTLQL--QHGVPVLTE  1586
                L +   +  D +   +L+ + L    +    P    +++   T QL  Q  +P    
Sbjct  1614  ---LDVTWEVVADTENAWRLVYRSLNGVMEGGGSPLFAVLESSITTTQLIEQRCLPSSLP  1670

Query  1587  FPQAHIHVKDVDDLYNSIDWRRIGAKALIRHYLNSERVLEFITEQCRYYHLPIGNLPTDP  1646
             + +     +D   L +   W R+ A+ L++ Y  S   +E      R   +P+ NL  D 
Sbjct  1671  YLRILGAAEDERLLSDPFRWTRLLARRLLQRYCASLLWVEERISFSRLSRIPLCNLMQDT  1730

Query  1647  TLFASDLFFARHLIKQNHVLWCSNSDRPDLGGSEESDARLLAESQEESSELCNKPGWYSS  1706
             ++ A D+ F R L  + HVLW S             D  +  +S EE       PG Y S
Sbjct  1731  SVHAWDVLFTRALHARAHVLWNSR------------DVSIAFDSIEERPRQVVMPGGYLS  1778

Query  1707  ICIELDIDSLAINTLLQAHHITDIEGTSSATAFDAAVPPSLDELISGNMNCGYDETARCG  1766
               +E  +  L +  +L +  I + +  ++    +  V                       
Sbjct  1779  WGVEFSLARLDVVAVLFSQLIQEGDDPNAHALCNQGVTTH--------------------  1818

Query  1767  EAFRILRTMATIWMRDISLYRNRFADFQVIHFYRWLRSQKSLLYDPALLRNLQNLMKKLF  1826
               F ILR + +  +  +    N  AD  +  F RW+R   S  Y+P LL  +  L  +  
Sbjct  1819  --FNILRDLVSDLLGQVRT--NAVADVLLASFSRWIRDPVSSCYEPRLLELVSTLAHRAL  1874

Query  1827  MMLVAEFKRLGCTIIYANFNKIILCSKKRLVEDALANAEFVITSIRNKELFHSLQITYSK  1886
               ++    +LG   +  + + I++ + K  ++D ++ A F++ S++++ +   L +   +
Sbjct  1875  TTVLFSLAKLGGRTVKVDGDSIVVLTPKHTIQDTVSFARFMVDSLKDQPMLLLLSLKPIR  1934

Query  1887  CWEQLIWLDSTNFAGIQGKLPAGLEGEAGEVQERIETTNRDVVNEDEPVIVMNWNLAEQL  1946
              W   + LD  ++      L    EG    ++E      +D V  DE ++  ++ +  +L
Sbjct  1935  YWCPFVILDKRDYVF----LYVTSEG-CKSLKE------KDQVVLDEMLVEYSFTIWSKL  1983

Query  1947  PEAGGCRHNFNAIIAGYINAIYMKLRETDCNDSIVVGLSQ-PSLGLGA------NEVVTS  1999
             P+    R      I G + AI +        +S++V + + P++ L          +V  
Sbjct  1984  PKK--VRDILLVRIEGTLRAIAL------ARESVLVEVQEDPTVVLATKNEQILTRIVGV  2035

Query  2000  YAKELIEGEVSQNLFRIVERIFNR-------LPA---KIDDCSPALEFVNAICHVLDLDP  2049
             Y K+L+EG++   L   V  +  R        PA    +   + ALE+   +C +L+L P
Sbjct  2036  Y-KKLVEGKLHTELIEEVHDLTERKDLHEKGFPAGETTLTGAAVALEYTKVVCRLLELFP  2094

Query  2050  AVHDEVYN-LKCNLLKLIGVGEFSEKA-VWIDRTVSFVVPQIICKACNHCRDLDLGRDPH  2107
               +D V   ++ N L+L GV  FS  A +  D           C  CN    LDL     
Sbjct  2095  --NDGVLGKVRNNCLRLCGVSPFSPLAQITADADTDCHQLMFQCSFCNADVLLDLSIREK  2152

Query  2108  RSDVAWLCPLCNTDYDNNEIEGLILEIINKKFLAYNLQDMQCKKCGQIKMENLMMRC  2164
             R      C  C+     + +E  ++  +N   ++Y  QD  C KC ++   ++   C
Sbjct  2153  RMR----CNGCSAPIFASAVESYLVRKVNTLVMSYTKQDFVCGKCHEVTANSINQTC  2205


 Score = 606 bits (1562),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 306/657 (47%), Positives = 420/657 (64%), Gaps = 19/657 (3%)

Query  50   ITEYQERTGFLLNIHTNEIL--------NDDKRLISAVDYYFMEEDGTRFKVSYPFKPYF  101
            I E   RTG+L N H   +         +    + +A+   F + +   F+V+  + PY 
Sbjct  16   IMESGTRTGWLFNYHPTSVAAPESAFDRHGGSGVRAALVLLFTDHEREVFQVNLFYNPYI  75

Query  102  YILTQRELLHEVSMYLLKKYAGT-IDSIEEVVKEDLDLPNHLIGLKQRYLKLSFVSQNDC  160
            ++       HEV + ++  +    I  IE V KEDLDL NHL G K+ YLK+SF +  D 
Sbjct  76   FVSAVEGHEHEVELGMMSLFGPQLICHIEIVEKEDLDLINHLSGRKRLYLKVSFSNVQDL  135

Query  161  IKVRKDILTVVRKNRKRKEQNCHYAAL--VVENIAKNTTES---SHTSLNTDHLENILDI  215
              VR  +  +V++N      N     L   + ++   T E    + T+ +    + + +I
Sbjct  136  TTVRGRLEKIVKRNASMGASNTLLNPLDRSIGDVMAKTFEDDPVNSTTASERWFDWVHEI  195

Query  216  REYDVPYHVRVSIDLRIFCGSWYTVKCKAGGNHPPLFTPRPDIIERPEPIVLAFDIETTK  275
            REYDV Y +RV IDL +F G WY VK   G     L     +      P V AFDIETTK
Sbjct  196  REYDVKYSMRVGIDLGVFVGLWYDVKVHEGETQ--LIRCDLNAYAPAMPRVCAFDIETTK  253

Query  276  LPLKFPDANTDQIMMISYMIDGQGFLITNREILSADIEDFEYTPKPELEGKFTIFNEPNE  335
             PLKFP    DQI MISY++DG+G+LI NREI++ DI  FEYTPKPE EG F  FNEP+E
Sbjct  254  APLKFPQPEVDQIYMISYVLDGRGYLIVNREIVATDIHQFEYTPKPEYEGIFDTFNEPDE  313

Query  336  FSLIQRFFYHIMDVRPHIFVTYNGDFFDWPFVEARAAFYELDMKQEIGFSKSKDGIYSCR  395
             +L+QRF+  +   +P ++VTYNGD+FD+PF+ AR+ F+ L M++E+GFS++ +G +   
Sbjct  314  KALLQRFYSEMRLYQPTVYVTYNGDYFDFPFIHARSLFHHLSMREELGFSQNSEGAFVAN  373

Query  396  AATHMDCLCWVKRDSYLPVGSQGLKAVAKAKLRYDPVELDPEEMCPLAASQPQVLSNYSV  455
               H+DC  WVKRDSYLP GSQGLKAV K KL Y+P+E+DPE+M PLA S PQ +++YSV
Sbjct  374  KLVHLDCFYWVKRDSYLPQGSQGLKAVTKYKLGYEPIEVDPEDMLPLAQSNPQQMASYSV  433

Query  456  SDAVATYYLYMQYVHPFIFALCTIIPCEPDEVLRKGSGTLCEALLMVEAFQVNVIFPNKQ  515
            SDA++T++LY +YVHPFI++L TIIP  PD+VLRKGSG LCE+LLMV+A+  NVIFPNK+
Sbjct  434  SDALSTWFLYQKYVHPFIYSLSTIIPMAPDDVLRKGSGGLCESLLMVQAYANNVIFPNKK  493

Query  516  ETILNKLTDDGHLLHQETYVGGHVEALESGIFRADIPCRFRLDIEMLDTLISQISKTLTH  575
            E  L +   +GHL+  ETY+GG VEAL SG++R+DIP  F++  +M   LI  +   L  
Sbjct  494  EIKLERFF-NGHLIDSETYIGGRVEALRSGVYRSDIPIHFQMSADMYQKLIDDLDDALRF  552

Query  576  AIEVEEGIPLDCVTNLQNVTDEIKTKLEALKEQPMRLEKPLIYHLDVGAMYPNVILTNRL  635
            ++EVE  + ++ VTN + + D IK +LE L+++P +   P+IYHLDVGAMYPN+ILTNRL
Sbjct  553  SLEVENSVKMNEVTNYEEIRDSIKARLEVLRDRPSQYATPIIYHLDVGAMYPNIILTNRL  612

Query  636  QPYAMVDETVCAACDFNKPGAT--CQRGMAWMWRAEYMPASRSEYHRIQQQLETEKF  690
            QPYA+    VCA C FN P     C+R MAW W+ E++ A R EY R++ QLE E F
Sbjct  613  QPYAIPKAEVCAGCCFNSPTNEHFCKRTMAWKWKGEFLTAGRHEYQRVKAQLENESF  669



Lambda      K        H
   0.327    0.140    0.447 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4320747090


Query= XP_031327289.1 uncharacterized protein LOC116158614 [Photinus
pyralis]

Length=284
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TSTA_DICDI  unnamed protein product                                   32.3    0.47 
C6A20_DROME  unnamed protein product                                  30.4    2.0  
DOME_DROME  unnamed protein product                                   28.9    6.9  


>TSTA_DICDI unnamed protein product
Length=1408

 Score = 32.3 bits (72),  Expect = 0.47, Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 49/110 (45%), Gaps = 4/110 (4%)

Query  48   ADVNDQITTLF--LPVPSSSIDDALDTSNPQFGHINPQGDADVNTDLRQLLEKERVRGKE  105
            +D N+ + ++   LP  SS   + L   N  FG +   G+  V       L       K 
Sbjct  85   SDDNEVVISILKTLPHISSIFTELLMMGNADFGPLVRHGNPSVRKTALDTLTSLLFYRKS  144

Query  106  ILQSYKLFKTFNRSTLADIIIENQLKDDPNARIN--SATFTEISQKIAQT  153
            ILQSYK F +     + D I+E  +     +  +  S+ F+EIS+ ++ +
Sbjct  145  ILQSYKSFVSTGWELIVDRILEEPIPMVYQSSFSAISSLFSEISRSVSHS  194


>C6A20_DROME unnamed protein product
Length=501

 Score = 30.4 bits (67),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 26/51 (51%), Gaps = 3/51 (6%)

Query  110  YKLFKTFNRSTLADIIIENQLKDDPNARINSATFTEISQKIAQTFPGELAG  160
            Y++     R    D++IE +LK D   + N  TF EI+   AQ F   LAG
Sbjct  259  YRVKNNVKRHDFVDMLIEMKLKFDNGDKENGLTFNEIA---AQAFIFFLAG  306


>DOME_DROME unnamed protein product
Length=1282

 Score = 28.9 bits (63),  Expect = 6.9, Method: Compositional matrix adjust.
 Identities = 14/52 (27%), Positives = 24/52 (46%), Gaps = 0/52 (0%)

Query  138  INSATFTEISQKIAQTFPGELAGSYYIPYCKSSDGRVSTAKGILWDKYVNKR  189
            I+ AT T ++   ++     +   Y + YC+ S GR      +  D+Y NK 
Sbjct  543  IDVATSTSLTVSWSERVCAVILAGYNLTYCQRSAGRPDNCTTVTIDRYTNKH  594



Lambda      K        H
   0.327    0.140    0.447 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4320747090


Query= XP_031327290.1 helicase SKI2W [Photinus pyralis]

Length=1211
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VCH8_DROME  unnamed protein product                                 1035    0.0   
Q9BI21_DROME  unnamed protein product                                 1034    0.0   
Q9Y134_DROME  unnamed protein product                                 526     4e-168


>Q9VCH8_DROME unnamed protein product
Length=1197

 Score = 1035 bits (2675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 585/1223 (48%), Positives = 783/1223 (64%), Gaps = 70/1223 (6%)

Query  17    EELLEYLTKPERLPIHDYERNQEFWPRKPDPTKLFHYDFSPLSTTLKVQRDMNTGEIIEF  76
             E L  Y+ +PE L +H+     +  PRK DP +L H    P ST L  +RD  +G I+EF
Sbjct  11    ERLRNYILRPE-LSLHN--PLPDVLPRKFDPMRLLHAPRCPGSTKLAPRRD-QSGHILEF  66

Query  77    REVPIQNVGSTSRNSTLLTRQPAPPSEALWGGISNVPFWPAGLSDPTEGLP-LKKEALTK  135
              E+ ++ VG+ + NS  + R+P    +A  G  SN PFWP G  +  + +  L       
Sbjct  67    VELDLEAVGANANNSMSMQREPGLLEDATRGSHSNFPFWPGGFDEQRQQIAALDVSNFQF  126

Query  136   ND-LLVIPPGFKFGLLFEDDGCRVKEKIDKSVELQ--VKQGNVVNLLDILNEQHFSGLWE  192
              D LL +PPGF  G  F            +SV L   V   + V+LL+ L +      W 
Sbjct  127   GDKLLTVPPGFSSGYDFFQS---------QSVTLPPVVADPSNVDLLENLEQDLDVQEWM  177

Query  193   TVEKSPETDHS--------QDVQLQTSELPEEKDVLSQAVTKDVPLLKISEFEKKKVRNL  244
              + +S ET  +         +VQL + E  +  D + +A  K  P+L IS   K      
Sbjct  178   KLTRSEETSSTGTPKSPKQSNVQLPSEEFRDVDDHIMKADLK--PVLNISTTTKN--FKS  233

Query  245   EWAVNLDTSKPVKDFRERIPQMALEYEFELDTFQKLAILQLEQHNHVFVAAHTSAGKTVV  304
             +WA  +D S+P+ +F+E+IP  A+++ FELD FQK AIL+LEQ  +VFVAAHTSAGKTVV
Sbjct  234   DWAEMVDISQPINNFKEQIPCPAMDFPFELDVFQKQAILKLEQRQYVFVAAHTSAGKTVV  293

Query  305   AEYAIALSQRHMTRTIYTSPIKALSNQKYRDFKKKFNDVGLVTGDFQINMKGSCLIMTTE  364
             AEYAIALS+R +TRTIYTSPIKALSNQKYRDF+K F DVGL+TGD QI    SCLIMTTE
Sbjct  294   AEYAIALSKRDLTRTIYTSPIKALSNQKYRDFRKTFKDVGLITGDLQIEPTASCLIMTTE  353

Query  365   ILRSMLYAGSDVTRDLEYVIFDEVHYVNDKERGHVWEQVLIMLPAHVCVVMLSATVPNTM  424
             ILRSMLY GSDVTRDLE+VIFDEVHY+N+ ERGHVWE+V+I+LP HV ++MLSATVPNT+
Sbjct  354   ILRSMLYCGSDVTRDLEWVIFDEVHYINNPERGHVWEEVIILLPEHVNIIMLSATVPNTL  413

Query  425   EFADWLGQIYQRKVYVIKTAKRPVPLQHYLYTGCGGASRNNRYLLLDHNEVFRIAGYNEA  484
             E ADW+G   +RKVYVI T KRPVPL H+LYTG GG SR++ +LL+D    +    Y +A
Sbjct  414   ELADWVGSTKKRKVYVISTLKRPVPLTHFLYTGAGGKSRDDIFLLVDAQGKYLQGNYEKA  473

Query  485   KASLAKPKEHK-----ASGPPQRNYNPKQEQYMWNGLVDHLSRNKLLPVVAFTFSRNKCD  539
                + + KE +       G P+ + N KQEQY W GL+D L R+ ++PVVAFT SRN+CD
Sbjct  474   ---VERKKEMQGKAKGGGGGPRNHLNAKQEQYTWIGLIDFLRRSNMMPVVAFTLSRNRCD  530

Query  540   QNARSLRHLDLTTAHEKHYINSFFNRCIASLKPPDRDIPQILDMKEILSRGVGVHHSGIL  599
              N  +L+ +DL T  EK  +  FF +C+A LKPPDR IPQ+L +K+ L RG+GVHHSGIL
Sbjct  531   SNLAALQSVDLNTEKEKGAVQKFFLQCLAKLKPPDRTIPQVLVLKDALERGIGVHHSGIL  590

Query  600   PIIKEMIEMLFQGQYIKLLFATETFAMGVNMPARTVVFDSIKKHDGQSLRPLLPAEYIQM  659
             PI+KE++EMLFQ   +KLLFATETFAMGVNMPARTVVFDS KK DG  +R L P EYIQM
Sbjct  591   PILKEIVEMLFQNGLVKLLFATETFAMGVNMPARTVVFDSCKKFDGLEMRNLKPGEYIQM  650

Query  660   AGRAGRRGLDETGTVIILCKVNLHPVEDLKRMMMGKPNQLESQFRITYGMVLTLLRVESL  719
             AGRAGRRG DETGT II+CK ++ P  +L+ M++G P +L+SQF + Y ++LT LR+ES+
Sbjct  651   AGRAGRRGHDETGTAIIMCKGSVPPSMELRPMILGLPEKLQSQFILRYAVILTCLRIESI  710

Query  720   SVEGMMSRSFREADHQKKMSQIRTKLETVSKNLEI-ENRHE----LNEHMQPLVKFYLTV  774
              VE +M  SF+E +       ++ +L T  K L + E++      L EH+QPLV FY   
Sbjct  711   KVEDIMKFSFKEFN-------LKLQLPTQQKQLRLAEDKFAMLPTLGEHLQPLVNFYDKA  763

Query  775   RTFLDYHQDLMEQIVITPTMQKQLTTGRVILITHKSHVNKLALILTT---PSKSSDLYRV  831
               +      +M+ +V  P +QK+L  GRVI+IT   H NKLA++L T   P K + +Y+V
Sbjct  764   VEYWKEKHRIMKFVVTQPKIQKELKAGRVIVITQGKHYNKLAILLNTKSVPGKDT-IYKV  822

Query  832   LVLT---DTGSSESDEKSDNYYKMLGLA-SDRVYYPENSCSHEVLKIKPEDIFEITSAMI  887
             LVL        S S ++ + YYK+L L   +  + P     H VL IK  DI  IT + +
Sbjct  823   LVLDHQFKAKDSNSLQQGELYYKILSLTPRNMTFQPVGIGGHTVLDIKAIDIISITKSTL  882

Query  888   NVEYSFVISDWDKRQIPRFKDDPPSERCKFAVQELLKLTMNVSDKSNANRLTYLDM---V  944
              V+   +I +W++RQ+ RFKD PPS     AV EL +L  N S   N + + Y+++   +
Sbjct  883   KVDADAIIRNWEQRQLERFKDSPPSGSVVKAVTELNQL--NESYIDNPDNIKYVNLSKEI  940

Query  945   VKDLDLHKCLLEY-KKLKEGLIDCISSTQIPNFEEQFHIVFKKKSLEDEEDDLKFQLSYE  1003
             + + D    +L Y   L   + + +  T I  FE++F  V++++ LE   ++L+F+ S  
Sbjct  941   IVNADSEVAMLNYVDHLLRKVGEFLPHTNIAGFEQEFAKVYERRMLEIHIEELRFKNSAR  1000

Query  1004  SMSLYPEYERRIALLKELNYINSSNRVELKGKVACEIGMNELLITELVLRNVFTDLQPAE  1063
             +++LYP+Y  ++ +L+ L YI+  + V LKGKVACE+G NELLITEL+L N+F DL+PAE
Sbjct  1001  NLTLYPDYCNKLKVLRALKYIDELDEVTLKGKVACEMGQNELLITELILCNMFNDLEPAE  1060

Query  1064  VAALLSALVYQVKSKQDDNELNENLTKPLVEGKRIIKEVHKEIQDLEMKFEIDKVSEPSR  1123
             +AALLS LV+Q K  QD   + E L + +   ++I   +  E Q  +   E D       
Sbjct  1061  IAALLSGLVFQAKM-QDKPVIPEALKECVAAFEQINDTILAEEQRFQAAIETDN------  1113

Query  1124  DLNFELVEVVYEWANGHPFATLMNLTEVQEGIIVRCIQQLNETICDVRDVARLTGDPKLY  1183
              LNF L+EVVYEWA   PFA +M LT VQEGIIVRCIQQLNET+ DV+  A   G+P L 
Sbjct  1114  RLNFGLLEVVYEWARNKPFAEIMKLTTVQEGIIVRCIQQLNETLRDVKTAAIRIGNPGLQ  1173

Query  1184  TKMEEASASIKRDIVFAASLYTQ  1206
             +KMEEASA+IKRDIVF ASLYT+
Sbjct  1174  SKMEEASAAIKRDIVFTASLYTE  1196


>Q9BI21_DROME unnamed protein product
Length=1197

 Score = 1034 bits (2674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 585/1223 (48%), Positives = 783/1223 (64%), Gaps = 70/1223 (6%)

Query  17    EELLEYLTKPERLPIHDYERNQEFWPRKPDPTKLFHYDFSPLSTTLKVQRDMNTGEIIEF  76
             E L  Y+ +PE L +H+     +  PRK DP +L H    P ST L  +RD  +G I+EF
Sbjct  11    ERLRNYILRPE-LSLHN--PLPDVLPRKFDPMRLLHAPRCPGSTKLAPRRD-QSGHILEF  66

Query  77    REVPIQNVGSTSRNSTLLTRQPAPPSEALWGGISNVPFWPAGLSDPTEGLP-LKKEALTK  135
              E+ ++ VG+ + NS  + R+P    +A  G  SN PFWP G  +  + +  L       
Sbjct  67    VELDLEAVGANANNSMSMQREPGLLEDATRGSHSNFPFWPGGFDEQRQQIAALDVSNFQF  126

Query  136   ND-LLVIPPGFKFGLLFEDDGCRVKEKIDKSVELQ--VKQGNVVNLLDILNEQHFSGLWE  192
              D LL +PPGF  G  F            +SV L   V   + V+LL+ L +      W 
Sbjct  127   GDKLLTVPPGFSSGYDFFQS---------QSVTLPPVVADPSNVDLLENLEQDLDVQEWM  177

Query  193   TVEKSPETDHS--------QDVQLQTSELPEEKDVLSQAVTKDVPLLKISEFEKKKVRNL  244
              + +S ET  +         +VQL + E  +  D + +A  K  P+L IS   K      
Sbjct  178   KLTRSEETSSTGTPKSPKQSNVQLPSEEFRDVDDHIMKADLK--PVLNISTTTKN--FKS  233

Query  245   EWAVNLDTSKPVKDFRERIPQMALEYEFELDTFQKLAILQLEQHNHVFVAAHTSAGKTVV  304
             +WA  +D S+P+ +F+E+IP  A+++ FELD FQK AIL+LEQ  +VFVAAHTSAGKTVV
Sbjct  234   DWAEMVDISQPINNFKEQIPCPAMDFPFELDVFQKQAILKLEQRQYVFVAAHTSAGKTVV  293

Query  305   AEYAIALSQRHMTRTIYTSPIKALSNQKYRDFKKKFNDVGLVTGDFQINMKGSCLIMTTE  364
             AEYAIALS+R +TRTIYTSPIKALSNQKYRDF+K F DVGL+TGD QI    SCLIMTTE
Sbjct  294   AEYAIALSKRDLTRTIYTSPIKALSNQKYRDFRKTFKDVGLITGDLQIEPTASCLIMTTE  353

Query  365   ILRSMLYAGSDVTRDLEYVIFDEVHYVNDKERGHVWEQVLIMLPAHVCVVMLSATVPNTM  424
             ILRSMLY GSDVTRDLE+VIFDEVHY+N+ ERGHVWE+V+I+LP HV ++MLSATVPNT+
Sbjct  354   ILRSMLYCGSDVTRDLEWVIFDEVHYINNPERGHVWEEVIILLPEHVNIIMLSATVPNTL  413

Query  425   EFADWLGQIYQRKVYVIKTAKRPVPLQHYLYTGCGGASRNNRYLLLDHNEVFRIAGYNEA  484
             E ADW+G   +RKVYVI T KRPVPL H+LYTG GG SR++ +LL+D    +    Y +A
Sbjct  414   ELADWVGSTKKRKVYVISTLKRPVPLTHFLYTGAGGKSRDDIFLLVDAQGKYLQGNYEKA  473

Query  485   KASLAKPKEHK-----ASGPPQRNYNPKQEQYMWNGLVDHLSRNKLLPVVAFTFSRNKCD  539
                + + KE +       G P+ + N KQEQY W GL+D L R+ ++PVVAFT SRN+CD
Sbjct  474   ---VERKKEMQGKAKGGGGGPRNHLNAKQEQYTWIGLIDFLRRSNMMPVVAFTLSRNRCD  530

Query  540   QNARSLRHLDLTTAHEKHYINSFFNRCIASLKPPDRDIPQILDMKEILSRGVGVHHSGIL  599
              N  +L+ +DL T  EK  +  FF +C+A LKPPDR IPQ+L +K+ L RG+GVHHSGIL
Sbjct  531   SNLAALQSVDLNTEKEKGAVQKFFLQCLAKLKPPDRTIPQVLVLKDALERGIGVHHSGIL  590

Query  600   PIIKEMIEMLFQGQYIKLLFATETFAMGVNMPARTVVFDSIKKHDGQSLRPLLPAEYIQM  659
             PI+KE++EMLFQ   +KLLFATETFAMGVNMPARTVVFDS KK DG  +R L P EYIQM
Sbjct  591   PILKEIVEMLFQNGLVKLLFATETFAMGVNMPARTVVFDSCKKFDGLEMRNLKPGEYIQM  650

Query  660   AGRAGRRGLDETGTVIILCKVNLHPVEDLKRMMMGKPNQLESQFRITYGMVLTLLRVESL  719
             AGRAGRRG DETGT II+CK ++ P  +L+ M++G P +L+SQF + Y ++LT LR+ES+
Sbjct  651   AGRAGRRGHDETGTAIIMCKGSVPPSMELRPMILGLPEKLQSQFILRYAVILTCLRIESI  710

Query  720   SVEGMMSRSFREADHQKKMSQIRTKLETVSKNLEI-ENRHE----LNEHMQPLVKFYLTV  774
              VE +M  SF+E +       ++ +L T  K L + E++      L EH+QPLV FY   
Sbjct  711   KVEDIMKFSFKEFN-------LKLQLPTQQKQLRLAEDKFAMLPTLGEHLQPLVNFYDKA  763

Query  775   RTFLDYHQDLMEQIVITPTMQKQLTTGRVILITHKSHVNKLALILTT---PSKSSDLYRV  831
               +      +M+ +V  P +QK+L  GRVI+IT   H NKLA++L T   P K + +Y+V
Sbjct  764   VEYWKEKHRIMKFVVTQPKIQKELKAGRVIVITQGKHYNKLAILLNTKSVPGKDT-IYKV  822

Query  832   LVLT---DTGSSESDEKSDNYYKMLGLA-SDRVYYPENSCSHEVLKIKPEDIFEITSAMI  887
             LVL        S S ++ + YYK+L L   +  + P     H VL IK  DI  IT + +
Sbjct  823   LVLDHQFKAKDSNSLQQGELYYKILSLTPRNMTFQPVGIGGHTVLDIKAIDIISITKSTL  882

Query  888   NVEYSFVISDWDKRQIPRFKDDPPSERCKFAVQELLKLTMNVSDKSNANRLTYLDM---V  944
              V+   +I +W++RQ+ RFKD PPS     AV EL +L  N S   N + + Y+++   +
Sbjct  883   KVDADAIIRNWEQRQLERFKDSPPSGSVVKAVTELNQL--NESYIDNPDNIKYVNLSKEI  940

Query  945   VKDLDLHKCLLEY-KKLKEGLIDCISSTQIPNFEEQFHIVFKKKSLEDEEDDLKFQLSYE  1003
             + + D    +L Y   L   + + +  T I  FE++F  V++++ LE   ++L+F+ S  
Sbjct  941   IVNADSEVAMLNYVDHLLRKVGEFLPHTNIAGFEQEFAKVYERRMLEIHIEELRFKNSAR  1000

Query  1004  SMSLYPEYERRIALLKELNYINSSNRVELKGKVACEIGMNELLITELVLRNVFTDLQPAE  1063
             +++LYP+Y  ++ +L+ L YI+  + V LKGKVACE+G NELLITEL+L N+F DL+PAE
Sbjct  1001  NLTLYPDYCNKLKVLRALKYIDELDEVTLKGKVACEMGQNELLITELILCNMFNDLEPAE  1060

Query  1064  VAALLSALVYQVKSKQDDNELNENLTKPLVEGKRIIKEVHKEIQDLEMKFEIDKVSEPSR  1123
             +AALLS LV+Q K  QD   + E L + +   ++I   +  E Q  +   E D       
Sbjct  1061  IAALLSGLVFQAKM-QDKPVIPEALKECVAAFEQINDTILAEEQRFQAAIETDN------  1113

Query  1124  DLNFELVEVVYEWANGHPFATLMNLTEVQEGIIVRCIQQLNETICDVRDVARLTGDPKLY  1183
              LNF L+EVVYEWA   PFA +M LT VQEGIIVRCIQQLNET+ DV+  A   G+P L 
Sbjct  1114  RLNFGLLEVVYEWARNKPFAEIMKLTTVQEGIIVRCIQQLNETVRDVKTAAIRIGNPGLQ  1173

Query  1184  TKMEEASASIKRDIVFAASLYTQ  1206
             +KMEEASA+IKRDIVF ASLYT+
Sbjct  1174  SKMEEASAAIKRDIVFTASLYTE  1196


>Q9Y134_DROME unnamed protein product
Length=1055

 Score = 526 bits (1356),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 346/974 (36%), Positives = 509/974 (52%), Gaps = 79/974 (8%)

Query  255   PVKDFRERIPQMALEYEFELDTFQKLAILQLEQHNHVFVAAHTSAGKTVVAEYAIALSQR  314
             P+K F   +P  A EY F LD FQ+ AIL ++    V V+AHTSAGKTVVAEYAIA S  
Sbjct  136   PLKPF-SGVP--AKEYPFVLDPFQRQAILCIDNSQSVLVSAHTSAGKTVVAEYAIAKSLA  192

Query  315   HMTRTIYTSPIKALSNQKYRDFKKKFNDVGLVTGDFQINMKGSCLIMTTEILRSMLYAGS  374
                R IYT+PIKALSNQK+R+F  +F DVGLVTGD  IN   SCLIMTTEILR+MLY GS
Sbjct  193   AKQRVIYTTPIKALSNQKFREFTDEFKDVGLVTGDVTINPSASCLIMTTEILRNMLYRGS  252

Query  375   DVTRDLEYVIFDEVHYVNDKERGHVWEQVLIMLPAHVCVVMLSATVPNTMEFADWLGQIY  434
             ++ R++ +V+FDE+HY+ DKERG VWE+ LI+LP +V  V LSAT+PN  +FA+W+  ++
Sbjct  253   EIMREVGWVVFDEIHYMRDKERGVVWEETLILLPDNVRYVFLSATIPNARQFAEWVCHLH  312

Query  435   QRKVYVIKTAKRPVPLQHYLYTGCGGASRNNRYLLLDHNEVFRIAGYNEAKASLAKPKEH  494
             ++  +V+ T  RP PLQHY++   G    +  +L++D    F+   +  A A LA   E 
Sbjct  313   KQPCHVVYTDYRPTPLQHYIFPAGG----DGIHLIVDEKGQFKEDNFTTAMAVLANAGEA  368

Query  495   KASGPPQRNYNPK---QEQYMWNGLVDHLSRNKLLPVVAFTFSRNKCDQNARSLRHLDLT  551
                    R+   K     Q     +V  +      PV+ F+FS+  C+  A  +  LD  
Sbjct  369   GKGDQKGRHGGIKGTNAGQTNIFKIVKMIMERNFAPVIIFSFSKKDCEIYAMQMAKLDFN  428

Query  552   TAHEKHYINSFFNRCIASLKPPDRDIPQILDMKEILSRGVGVHHSGILPIIKEMIEMLFQ  611
             T  EK  ++  FN  +  L   DR +PQ+ ++  +L RG+G+HH G+LPI+KE IE+LF 
Sbjct  429   TPDEKKLVDEVFNNAMDVLTEEDRRLPQVENVLPLLRRGIGIHHGGLLPILKETIEILFG  488

Query  612   GQYIKLLFATETFAMGVNMPARTVVFDSIKKHDGQSLRPLLPAEYIQMAGRAGRRGLDET  671
                IK LFATETFAMG+NMPARTV+F + +K DG+  R +   EYIQMAGRAGRRGLD+ 
Sbjct  489   EGLIKALFATETFAMGLNMPARTVLFTAPRKFDGKKFRWISSGEYIQMAGRAGRRGLDDK  548

Query  672   GTVIILCKVNLHPVEDLKRMMMGKPNQLESQFRITYGMVLTLLRVESLSVEGMMSRSFRE  731
             G VI++    + P    + ++ GK + + S F +TY MVL LLRVE ++ E M+ RSF +
Sbjct  549   GIVILMIDEKVSPAVG-RDIVQGKADPINSAFHLTYNMVLNLLRVEEINPEYMLERSFYQ  607

Query  732   ADHQKKMSQIRTKLETVSKNLEIENRHELNEHMQPLVKFYLTVRTFLDYHQDLMEQIVIT  791
               +Q  +  +  ++E   K LE+      +EH    +  Y  +R+ LD H     Q +  
Sbjct  608   FQNQAALPGLHDQVE--QKTLELNKLTIKDEHN---IASYHHIRSQLDQHGKQFRQWITK  662

Query  792   PT-MQKQLTTGRVILITHKSHVNKLALILT---------TPSKSSDLYRVLVLTDTGSSE  841
             P  +   L  GR++ +   S      ++L           P K+     + VL     SE
Sbjct  663   PQYLLPFLQPGRLVKVAAGSQEYDWGIVLNFKKQDQSRKNPLKAEPSVTIDVLLHV--SE  720

Query  842   SDEKSDNYYKMLGLASDRVYYPENSCSHEVLKIKPEDIFEITSAMINVEYSFVISDWDKR  901
             +  K+ +        ++     E  C  EV+ +    I +I+S  I V +   +   D R
Sbjct  721   AAAKTGD--------TEPCKPNERGC-MEVVPVAHTLITQISS--IRVYFPNDLRSADNR  769

Query  902   QI---------PRFKDDPPSERCKFAVQELLKLTMNVSDKSNANRLTYLDMVVKDLDLHK  952
             +           RF   PP               +N  D  N     + D+V       K
Sbjct  770   RAVLKTIQEAKKRFPLGPP--------------VLNPIDDMNIKDREFRDIVNTISQFEK  815

Query  953   CLLEYKKLKEGLIDCISSTQIPNFEEQFHIVFKKKSLEDEEDDLKFQL-SYESMSLYPEY  1011
              L E+   K            P  E        K +L+ +  DLK +L +  S+    E 
Sbjct  816   RLEEHPLHKS-----------PELERIHRRYQDKVTLQKQLQDLKAELKAARSLLQMDEL  864

Query  1012  ERRIALLKELNYINSSNRVELKGKVACEI-GMNELLITELVLRNVFTDLQPAEVAALLSA  1070
             + R  +L+ + Y    + +E KG+VACE+   +ELL+TE++   VF DL   +  ALLS 
Sbjct  865   KHRKRVLRRMGYCKPGDVIEFKGRVACELSSADELLMTEMIFNGVFNDLTAPQAVALLSC  924

Query  1071  LVYQVKSKQDDNELNENLTKPLVEGKRIIKEVHKEIQDLEMKFEIDKVSEPSRDLNFELV  1130
              V   KS +      E L+ PL   + + + + K   + ++  + D   +  +     L+
Sbjct  925   FVCDEKSSESVKSATE-LSGPLRSMQDLARRIAKVSTECKLDLDADTYVDKFKPF---LM  980

Query  1131  EVVYEWANGHPFATLMNLTEVQEGIIVRCIQQLNETICDVRDVARLTGDPKLYTKMEEAS  1190
             +VV  W  G  F  +  +T++ EG I+RC+++L E +  +   ++  G+  L  K  E  
Sbjct  981   DVVLAWCKGSSFLAVCKMTDIFEGSIIRCMRRLEELLRQMCQASKTIGNTDLENKFSEGI  1040

Query  1191  ASIKRDIVFAASLY  1204
               +KRDIVFAASLY
Sbjct  1041  RLLKRDIVFAASLY  1054



Lambda      K        H
   0.327    0.140    0.447 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4320747090


Query= XP_031327291.1 lysosomal acid glucosylceramidase-like isoform X1
[Photinus pyralis]

Length=517
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VCJ4_DROME  unnamed protein product                                 311     2e-99
Q8IMY3_DROME  unnamed protein product                                 280     1e-87
Q9VLT3_DROME  unnamed protein product                                 30.4    4.4  


>Q9VCJ4_DROME unnamed protein product
Length=561

 Score = 311 bits (796),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 181/526 (34%), Positives = 279/526 (53%), Gaps = 56/526 (11%)

Query  43   VCVCNASYCDNFPPNTKPQDSSYFVYTTTEGGLRLLRQSYHF------------------  84
            VCVC A YCD         ++ +F+ ++++ GLR    S  F                  
Sbjct  40   VCVCTADYCDYLENPVLTDENEWFLISSSKQGLRFSTTSDKFGKEEKFTVQDYVEPTQET  99

Query  85   ---------------HAYERNSTDTIIT------IDSSKRHQTIIGWGGAFTDSTGININ  123
                            A+   S ++ IT      +D SK HQ ++G+GG++T +    + 
Sbjct  100  ANATILSRLLDKVVDSAFTLESRESSITRTVTLRLDRSKTHQKMVGFGGSYTGAVEYLVE  159

Query  124  SLSEPAAAT-LLRAYYSDNGLQYNMGRVPIGGTDFSTHGYSYNDGEEDPKLLRFN-LTAE  181
            +      A  L +++Y+++GL +N+ RV IGG DF    +SY + E D +L   + L A 
Sbjct  160  NFKHSELADHLYKSFYAEDGLGFNLMRVSIGGCDFDLEPWSYAEEEGDTELSDMDELNAH  219

Query  182  DFSYKIPLIKQAQALVKGELKLLASAWTAPKWMKRNGMYTGPDFLKDEMYQAWANYFVKF  241
            D +    + +  +      L +  +AW++P WMK N  +TG   LK   YQ WA+Y +++
Sbjct  220  DVTRVAQIKRLIEVSGVKNLLVKGAAWSSPPWMKTNNRWTGFGRLKRAYYQTWADYHLRW  279

Query  242  LRAYATEKINFWGLTTGNEPSTGLIPS---KINSVGWLPGSMGTFIAENLGPTIRKSEFA  298
            LR      I  W ++TGNEP  G+I     K  S+GW P +   ++ + LGPTIR SEF 
Sbjct  280  LRLMKDNGIPIWAISTGNEPLNGIIFMYFVKFMSLGWTPQTQAIWLNDYLGPTIRNSEFK  339

Query  299  SIKLLTIDDQLFMFPKMIEMIFKNE-KAKDYIDGFGLHYYWNWL-PRTWLKETHDQYPEK  356
             I L   DDQ + FP   +M+ +    + DY+DG  LH+YW+ +   +++++T +  P+K
Sbjct  340  DITLFGNDDQRYSFPHWFKMMNRTRPNSIDYLDGLSLHWYWDEIFGNSFIEQTKEYAPDK  399

Query  357  FILATESCEGVGIDQPHVK----LGDWKRAENYASDIIKDLNNWVTGWIDWNMALDLTGG  412
             ++ +ESC G   D+P       LG W+RAE YA D + ++     GWIDWN+ LD  GG
Sbjct  400  ILIVSESCIG---DKPWQAAAPLLGSWERAEKYARDYLLNIKLGFHGWIDWNICLDEIGG  456

Query  413  PTYIDNNVDAPIIVNSTA-GEFYKQPMYYALAHFSKFLPEGSQRISFTQTTNDILVTSFI  471
            P Y+DN VDAP+IVN+T   EFYKQPM+YA+ HFSK++PEGS RI    +  ++   +F+
Sbjct  457  PNYVDNTVDAPVIVNTTTFEEFYKQPMFYAIGHFSKWVPEGSVRIDAVPSNVNLDSVAFL  516

Query  472  RPDGAVVVTILNPNLHDAPIRIRPVDNKHAEVRANIPTKSIVTIVY  517
            RPD  +   + N    D  I +  VD+   +   N+P KSI T++Y
Sbjct  517  RPDNKITAVLFNSGRADLDITL--VDSIRGQFVVNVPAKSIHTLLY  560


>Q8IMY3_DROME unnamed protein product
Length=566

 Score = 280 bits (717),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 181/546 (33%), Positives = 271/546 (50%), Gaps = 69/546 (13%)

Query  32   CAPRSYGYSSVVCVCNASYCDNFPPNTKPQDSSYFVYTTTEGGLRLLRQSYHFHAY----  87
            C  R   + SV CVCN++YCD   P      S   V ++++ GLR  + +          
Sbjct  29   CDLRETSHGSV-CVCNSTYCDYLEPPQLTDISQIVVISSSKDGLRFKKTTGDLSKKKPIT  87

Query  88   --------ERNSTDTIIT----------------------------IDSSKRHQTIIGWG  111
                    E    D I+                             +   +  Q +  +G
Sbjct  88   IDDKQFTDENFKADAIVVDQERAWLQLANIPQSLFINASIKTYRIFVKREQSFQNVSIFG  147

Query  112  GAFTDSTGININSLSEPAAATLLRAYYSDNGLQYNMGRVPIGGTDFSTHGYSYNDGE-ED  170
            GAFT +    +  L       + R+Y+   G+ YN  R+ IGG+DF    ++YN+    D
Sbjct  148  GAFTGTVSYLLKELPVELQDHVYRSYFHPVGIAYNTIRMSIGGSDFDMEPWAYNELPLHD  207

Query  171  PKLLRF-NLTAEDFSYKIPLIKQAQALVKGE-LKLLASAWTAPKWMKRNGMYTGPDFLKD  228
            PKL  F  L   D   K+  +K+ + + K + LK++ +AW+AP WMK N  +TG   LK 
Sbjct  208  PKLSNFTELDPRDLQ-KVEQLKRLKIIGKVDSLKIMGAAWSAPTWMKSNNRWTGFGQLKS  266

Query  229  EMYQAWANYFVKFLRAYATEKINFWGLTTGNEPSTGLIP---SKINSVGWLPGSMGTFIA  285
            E YQ WA Y +KFL    ++ +  W ++TGNEP  G+I        S+GW P     ++ 
Sbjct  267  EYYQTWALYHLKFLELMRSKNMPIWAISTGNEPLNGVIGFFFVHFMSMGWTPWQQAIWLN  326

Query  286  ENLGPTIRKSEFASIKLLTIDDQLFMFPKMI-EMIFKNEKAKDYIDGFGLHYYWNWL--P  342
            +NLGPTIR S  + + +   DDQ + +P    +M      + +Y+DG  +H+YW+ L  P
Sbjct  327  DNLGPTIRNSAESKVLIFGNDDQRYTYPTWFRKMRSSRNNSLNYLDGLAVHWYWDELIGP  386

Query  343  RTWLKETHDQYPEKFILATESCEGVGIDQPH-VKLGDWKRAENYASDIIKDLNNWVTGWI  401
            +  + + H   P K +L TESC G    Q H  +LG W+R E+Y     +DL +   GW+
Sbjct  387  QL-IDQAHTDMPNKLLLNTESCIGDKPWQTHGPELGSWQRGESYMRAYTQDLTHNFNGWL  445

Query  402  DWNMALDLTGGPTYIDNNVDAPIIVNSTA-GEFYKQPMYYALAHFSKFLPEGSQRIS---  457
            DWN+ LD  GGP Y+ N VDAPIIVN+T+  E YKQP++YA+ HFSKFLP  S RI    
Sbjct  446  DWNLVLDEQGGPNYVKNFVDAPIIVNATSRSEIYKQPIFYAIGHFSKFLPPDSVRIETRI  505

Query  458  ------FTQTTNDILVTSFIRPDGAVVVTILNPNLHDAPIRIRPVDNKHAEVRANIPTKS  511
                  FTQ +    V  F RPDG+V + I N    + P+ +   D++   ++  +P +S
Sbjct  506  ENQSNPFTQLS----VVGFQRPDGSVALIIYNG--QNLPVDVTLDDSQRGAIQLRLPPRS  559

Query  512  IVTIVY  517
              T++Y
Sbjct  560  WHTVLY  565


>Q9VLT3_DROME unnamed protein product
Length=1760

 Score = 30.4 bits (67),  Expect = 4.4, Method: Compositional matrix adjust.
 Identities = 47/210 (22%), Positives = 97/210 (46%), Gaps = 34/210 (16%)

Query  136  AYYSDNGL--QYNMGRVPIGGTDFSTHGYSYNDGEEDPKLLRFNLTAE------DFSYKI  187
             Y+S+  L  +Y +GR P+  T+     + YN+  ++P+ +++N+  +      D S  I
Sbjct  375  GYFSNQVLNEKYRLGRSPLEQTNLYNERWRYNNPNQNPQ-VQYNVPGQLPQDGADLSQDI  433

Query  188  PLIKQAQALVKGELKLLASAWTAPKWMKRNGMYTGPDFLKDEMYQAWANYFVK---FLRA  244
              + + Q +V+   +     W  P W+++      P++ +D  Y+AW+  + K   +LR 
Sbjct  434  --LYRNQYVVERHYQ-FDEEW--PFWVRK------PEY-QDSSYEAWSGTYRKTLPYLR-  480

Query  245  YATEKINF-WGLTTGNEPSTGLIPSKINSVGWLPGSMGTFIAENL--GPTIRKSEFASIK  301
            Y     +F W L         L+P+  NS   +  ++G    + +  G ++ +   +S++
Sbjct  481  YFNGTFDFKWPL----RELELLVPNLANSEVLITATVGEKFYDEIISGYSVARVYNSSLR  536

Query  302  LLTIDDQLFMFPKMIEMIFKNEKAKDYIDG  331
            ++ + D   +F     M F    A +Y DG
Sbjct  537  VVFLGDSPQVFKPA--MPFTTYLAVEYHDG  564



Lambda      K        H
   0.327    0.140    0.447 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4320747090


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jan 28, 2021  9:24 PM
  Number of letters in database: 17,197,330
  Number of sequences in database:  25,232



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= XP_031327292.1 lysosomal acid glucosylceramidase-like isoform X2
[Photinus pyralis]

Length=505
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VCJ4_DROME  unnamed protein product                                 311     8e-100
Q8IMY3_DROME  unnamed protein product                                 280     8e-88 
Q9VLT3_DROME  unnamed protein product                                 30.8    3.9   


>Q9VCJ4_DROME unnamed protein product
Length=561

 Score = 311 bits (798),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 181/526 (34%), Positives = 279/526 (53%), Gaps = 56/526 (11%)

Query  31   VCVCNASYCDNFPPNTKPQDSSYFVYTTTEGGLRLLRQSYHFHAYER-------------  77
            VCVC A YCD         ++ +F+ ++++ GLR    S  F   E+             
Sbjct  40   VCVCTADYCDYLENPVLTDENEWFLISSSKQGLRFSTTSDKFGKEEKFTVQDYVEPTQET  99

Query  78   --------------------NSTDTIIT------IDSSKRHQTIIGWGGAFTDSTGININ  111
                                 S ++ IT      +D SK HQ ++G+GG++T +    + 
Sbjct  100  ANATILSRLLDKVVDSAFTLESRESSITRTVTLRLDRSKTHQKMVGFGGSYTGAVEYLVE  159

Query  112  SLSEPAAAT-LLRAYYSDNGLQYNMGRVPIGGTDFSTHGYSYNDGEEDPKLLRFN-LTAE  169
            +      A  L +++Y+++GL +N+ RV IGG DF    +SY + E D +L   + L A 
Sbjct  160  NFKHSELADHLYKSFYAEDGLGFNLMRVSIGGCDFDLEPWSYAEEEGDTELSDMDELNAH  219

Query  170  DFSYKIPLIKQAQALVKGELKLLASAWTAPKWMKRNGMYTGPDFLKDEMYQAWANYFVKF  229
            D +    + +  +      L +  +AW++P WMK N  +TG   LK   YQ WA+Y +++
Sbjct  220  DVTRVAQIKRLIEVSGVKNLLVKGAAWSSPPWMKTNNRWTGFGRLKRAYYQTWADYHLRW  279

Query  230  LRAYATEKINFWGLTTGNEPSTGLIPS---KINSVGWLPGSMGTFIAENLGPTIRKSEFA  286
            LR      I  W ++TGNEP  G+I     K  S+GW P +   ++ + LGPTIR SEF 
Sbjct  280  LRLMKDNGIPIWAISTGNEPLNGIIFMYFVKFMSLGWTPQTQAIWLNDYLGPTIRNSEFK  339

Query  287  SIKLLTIDDQLFMFPKMIEMIFKNE-KAKDYIDGFGLHYYWNWL-PRTWLKETHDQYPEK  344
             I L   DDQ + FP   +M+ +    + DY+DG  LH+YW+ +   +++++T +  P+K
Sbjct  340  DITLFGNDDQRYSFPHWFKMMNRTRPNSIDYLDGLSLHWYWDEIFGNSFIEQTKEYAPDK  399

Query  345  FILATESCEGVGIDQPHVK----LGDWKRAENYASDIIKDLNNWVTGWIDWNMALDLTGG  400
             ++ +ESC G   D+P       LG W+RAE YA D + ++     GWIDWN+ LD  GG
Sbjct  400  ILIVSESCIG---DKPWQAAAPLLGSWERAEKYARDYLLNIKLGFHGWIDWNICLDEIGG  456

Query  401  PTYIDNNVDAPIIVNSTA-GEFYKQPMYYALAHFSKFLPEGSQRISFTQTTNDILVTSFI  459
            P Y+DN VDAP+IVN+T   EFYKQPM+YA+ HFSK++PEGS RI    +  ++   +F+
Sbjct  457  PNYVDNTVDAPVIVNTTTFEEFYKQPMFYAIGHFSKWVPEGSVRIDAVPSNVNLDSVAFL  516

Query  460  RPDGAVVVTILNPNLHDAPIRIRPVDNKHAEVRANIPTKSIVTIVY  505
            RPD  +   + N    D  I +  VD+   +   N+P KSI T++Y
Sbjct  517  RPDNKITAVLFNSGRADLDITL--VDSIRGQFVVNVPAKSIHTLLY  560


>Q8IMY3_DROME unnamed protein product
Length=566

 Score = 280 bits (717),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 181/546 (33%), Positives = 271/546 (50%), Gaps = 69/546 (13%)

Query  20   CAPRSYGYSSVVCVCNASYCDNFPPNTKPQDSSYFVYTTTEGGLRLLRQSYHFHAY----  75
            C  R   + SV CVCN++YCD   P      S   V ++++ GLR  + +          
Sbjct  29   CDLRETSHGSV-CVCNSTYCDYLEPPQLTDISQIVVISSSKDGLRFKKTTGDLSKKKPIT  87

Query  76   --------ERNSTDTIIT----------------------------IDSSKRHQTIIGWG  99
                    E    D I+                             +   +  Q +  +G
Sbjct  88   IDDKQFTDENFKADAIVVDQERAWLQLANIPQSLFINASIKTYRIFVKREQSFQNVSIFG  147

Query  100  GAFTDSTGININSLSEPAAATLLRAYYSDNGLQYNMGRVPIGGTDFSTHGYSYNDGE-ED  158
            GAFT +    +  L       + R+Y+   G+ YN  R+ IGG+DF    ++YN+    D
Sbjct  148  GAFTGTVSYLLKELPVELQDHVYRSYFHPVGIAYNTIRMSIGGSDFDMEPWAYNELPLHD  207

Query  159  PKLLRF-NLTAEDFSYKIPLIKQAQALVKGE-LKLLASAWTAPKWMKRNGMYTGPDFLKD  216
            PKL  F  L   D   K+  +K+ + + K + LK++ +AW+AP WMK N  +TG   LK 
Sbjct  208  PKLSNFTELDPRDLQ-KVEQLKRLKIIGKVDSLKIMGAAWSAPTWMKSNNRWTGFGQLKS  266

Query  217  EMYQAWANYFVKFLRAYATEKINFWGLTTGNEPSTGLIP---SKINSVGWLPGSMGTFIA  273
            E YQ WA Y +KFL    ++ +  W ++TGNEP  G+I        S+GW P     ++ 
Sbjct  267  EYYQTWALYHLKFLELMRSKNMPIWAISTGNEPLNGVIGFFFVHFMSMGWTPWQQAIWLN  326

Query  274  ENLGPTIRKSEFASIKLLTIDDQLFMFPKMI-EMIFKNEKAKDYIDGFGLHYYWNWL--P  330
            +NLGPTIR S  + + +   DDQ + +P    +M      + +Y+DG  +H+YW+ L  P
Sbjct  327  DNLGPTIRNSAESKVLIFGNDDQRYTYPTWFRKMRSSRNNSLNYLDGLAVHWYWDELIGP  386

Query  331  RTWLKETHDQYPEKFILATESCEGVGIDQPH-VKLGDWKRAENYASDIIKDLNNWVTGWI  389
            +  + + H   P K +L TESC G    Q H  +LG W+R E+Y     +DL +   GW+
Sbjct  387  QL-IDQAHTDMPNKLLLNTESCIGDKPWQTHGPELGSWQRGESYMRAYTQDLTHNFNGWL  445

Query  390  DWNMALDLTGGPTYIDNNVDAPIIVNSTA-GEFYKQPMYYALAHFSKFLPEGSQRIS---  445
            DWN+ LD  GGP Y+ N VDAPIIVN+T+  E YKQP++YA+ HFSKFLP  S RI    
Sbjct  446  DWNLVLDEQGGPNYVKNFVDAPIIVNATSRSEIYKQPIFYAIGHFSKFLPPDSVRIETRI  505

Query  446  ------FTQTTNDILVTSFIRPDGAVVVTILNPNLHDAPIRIRPVDNKHAEVRANIPTKS  499
                  FTQ +    V  F RPDG+V + I N    + P+ +   D++   ++  +P +S
Sbjct  506  ENQSNPFTQLS----VVGFQRPDGSVALIIYNG--QNLPVDVTLDDSQRGAIQLRLPPRS  559

Query  500  IVTIVY  505
              T++Y
Sbjct  560  WHTVLY  565


>Q9VLT3_DROME unnamed protein product
Length=1760

 Score = 30.8 bits (68),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 47/210 (22%), Positives = 97/210 (46%), Gaps = 34/210 (16%)

Query  124  AYYSDNGL--QYNMGRVPIGGTDFSTHGYSYNDGEEDPKLLRFNLTAE------DFSYKI  175
             Y+S+  L  +Y +GR P+  T+     + YN+  ++P+ +++N+  +      D S  I
Sbjct  375  GYFSNQVLNEKYRLGRSPLEQTNLYNERWRYNNPNQNPQ-VQYNVPGQLPQDGADLSQDI  433

Query  176  PLIKQAQALVKGELKLLASAWTAPKWMKRNGMYTGPDFLKDEMYQAWANYFVK---FLRA  232
              + + Q +V+   +     W  P W+++      P++ +D  Y+AW+  + K   +LR 
Sbjct  434  --LYRNQYVVERHYQ-FDEEW--PFWVRK------PEY-QDSSYEAWSGTYRKTLPYLR-  480

Query  233  YATEKINF-WGLTTGNEPSTGLIPSKINSVGWLPGSMGTFIAENL--GPTIRKSEFASIK  289
            Y     +F W L         L+P+  NS   +  ++G    + +  G ++ +   +S++
Sbjct  481  YFNGTFDFKWPL----RELELLVPNLANSEVLITATVGEKFYDEIISGYSVARVYNSSLR  536

Query  290  LLTIDDQLFMFPKMIEMIFKNEKAKDYIDG  319
            ++ + D   +F     M F    A +Y DG
Sbjct  537  VVFLGDSPQVFKPA--MPFTTYLAVEYHDG  564



Lambda      K        H
   0.320    0.136    0.429 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5770007388


Query= XP_031327293.1 lysosomal acid glucosylceramidase-like isoform X3
[Photinus pyralis]

Length=503
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VCJ4_DROME  unnamed protein product                                 311     8e-100
Q8IMY3_DROME  unnamed protein product                                 281     5e-88 
Q9VLT3_DROME  unnamed protein product                                 30.4    4.2   


>Q9VCJ4_DROME unnamed protein product
Length=561

 Score = 311 bits (797),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 181/526 (34%), Positives = 279/526 (53%), Gaps = 56/526 (11%)

Query  29   VCVCNASYCDNFPPNTKPQDSSYFVYTTTEGGLRLLRQSYHF------------------  70
            VCVC A YCD         ++ +F+ ++++ GLR    S  F                  
Sbjct  40   VCVCTADYCDYLENPVLTDENEWFLISSSKQGLRFSTTSDKFGKEEKFTVQDYVEPTQET  99

Query  71   ---------------HAYERNSTDTIIT------IDSSKRHQTIIGWGGAFTDSTGININ  109
                            A+   S ++ IT      +D SK HQ ++G+GG++T +    + 
Sbjct  100  ANATILSRLLDKVVDSAFTLESRESSITRTVTLRLDRSKTHQKMVGFGGSYTGAVEYLVE  159

Query  110  SLSEPAAAT-LLRAYYSDNGLQYNMGRVPIGGTDFSTHGYSYNDGEEDPKLLRFN-LTAE  167
            +      A  L +++Y+++GL +N+ RV IGG DF    +SY + E D +L   + L A 
Sbjct  160  NFKHSELADHLYKSFYAEDGLGFNLMRVSIGGCDFDLEPWSYAEEEGDTELSDMDELNAH  219

Query  168  DFSYKIPLIKQAQALVKGELKLLASAWTAPKWMKRNGMYTGPDFLKDEMYQAWANYFVKF  227
            D +    + +  +      L +  +AW++P WMK N  +TG   LK   YQ WA+Y +++
Sbjct  220  DVTRVAQIKRLIEVSGVKNLLVKGAAWSSPPWMKTNNRWTGFGRLKRAYYQTWADYHLRW  279

Query  228  LRAYATEKINFWGLTTGNEPSTGLIPS---KINSVGWLPGSMGTFIAENLGPTIRKSEFA  284
            LR      I  W ++TGNEP  G+I     K  S+GW P +   ++ + LGPTIR SEF 
Sbjct  280  LRLMKDNGIPIWAISTGNEPLNGIIFMYFVKFMSLGWTPQTQAIWLNDYLGPTIRNSEFK  339

Query  285  SIKLLTIDDQLFMFPKMIEMIFKNE-KAKDYIDGFGLHYYWNWL-PRTWLKETHDQYPEK  342
             I L   DDQ + FP   +M+ +    + DY+DG  LH+YW+ +   +++++T +  P+K
Sbjct  340  DITLFGNDDQRYSFPHWFKMMNRTRPNSIDYLDGLSLHWYWDEIFGNSFIEQTKEYAPDK  399

Query  343  FILATESCEGVGIDQPHVK----LGDWKRAENYASDIIKDLNNWVTGWIDWNMALDLTGG  398
             ++ +ESC G   D+P       LG W+RAE YA D + ++     GWIDWN+ LD  GG
Sbjct  400  ILIVSESCIG---DKPWQAAAPLLGSWERAEKYARDYLLNIKLGFHGWIDWNICLDEIGG  456

Query  399  PTYIDNNVDAPIIVNSTA-GEFYKQPMYYALAHFSKFLPEGSQRISFTQTTNDILVTSFI  457
            P Y+DN VDAP+IVN+T   EFYKQPM+YA+ HFSK++PEGS RI    +  ++   +F+
Sbjct  457  PNYVDNTVDAPVIVNTTTFEEFYKQPMFYAIGHFSKWVPEGSVRIDAVPSNVNLDSVAFL  516

Query  458  RPDGAVVVTILNPNLHDAPIRIRPVDNKHAEVRANIPTKSIVTIVY  503
            RPD  +   + N    D  I +  VD+   +   N+P KSI T++Y
Sbjct  517  RPDNKITAVLFNSGRADLDITL--VDSIRGQFVVNVPAKSIHTLLY  560


>Q8IMY3_DROME unnamed protein product
Length=566

 Score = 281 bits (718),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 181/546 (33%), Positives = 271/546 (50%), Gaps = 69/546 (13%)

Query  18   CAPRSYGYSSVVCVCNASYCDNFPPNTKPQDSSYFVYTTTEGGLRLLRQSYHFHAY----  73
            C  R   + SV CVCN++YCD   P      S   V ++++ GLR  + +          
Sbjct  29   CDLRETSHGSV-CVCNSTYCDYLEPPQLTDISQIVVISSSKDGLRFKKTTGDLSKKKPIT  87

Query  74   --------ERNSTDTIIT----------------------------IDSSKRHQTIIGWG  97
                    E    D I+                             +   +  Q +  +G
Sbjct  88   IDDKQFTDENFKADAIVVDQERAWLQLANIPQSLFINASIKTYRIFVKREQSFQNVSIFG  147

Query  98   GAFTDSTGININSLSEPAAATLLRAYYSDNGLQYNMGRVPIGGTDFSTHGYSYNDGE-ED  156
            GAFT +    +  L       + R+Y+   G+ YN  R+ IGG+DF    ++YN+    D
Sbjct  148  GAFTGTVSYLLKELPVELQDHVYRSYFHPVGIAYNTIRMSIGGSDFDMEPWAYNELPLHD  207

Query  157  PKLLRF-NLTAEDFSYKIPLIKQAQALVKGE-LKLLASAWTAPKWMKRNGMYTGPDFLKD  214
            PKL  F  L   D   K+  +K+ + + K + LK++ +AW+AP WMK N  +TG   LK 
Sbjct  208  PKLSNFTELDPRDLQ-KVEQLKRLKIIGKVDSLKIMGAAWSAPTWMKSNNRWTGFGQLKS  266

Query  215  EMYQAWANYFVKFLRAYATEKINFWGLTTGNEPSTGLIP---SKINSVGWLPGSMGTFIA  271
            E YQ WA Y +KFL    ++ +  W ++TGNEP  G+I        S+GW P     ++ 
Sbjct  267  EYYQTWALYHLKFLELMRSKNMPIWAISTGNEPLNGVIGFFFVHFMSMGWTPWQQAIWLN  326

Query  272  ENLGPTIRKSEFASIKLLTIDDQLFMFPKMI-EMIFKNEKAKDYIDGFGLHYYWNWL--P  328
            +NLGPTIR S  + + +   DDQ + +P    +M      + +Y+DG  +H+YW+ L  P
Sbjct  327  DNLGPTIRNSAESKVLIFGNDDQRYTYPTWFRKMRSSRNNSLNYLDGLAVHWYWDELIGP  386

Query  329  RTWLKETHDQYPEKFILATESCEGVGIDQPH-VKLGDWKRAENYASDIIKDLNNWVTGWI  387
            +  + + H   P K +L TESC G    Q H  +LG W+R E+Y     +DL +   GW+
Sbjct  387  QL-IDQAHTDMPNKLLLNTESCIGDKPWQTHGPELGSWQRGESYMRAYTQDLTHNFNGWL  445

Query  388  DWNMALDLTGGPTYIDNNVDAPIIVNSTA-GEFYKQPMYYALAHFSKFLPEGSQRIS---  443
            DWN+ LD  GGP Y+ N VDAPIIVN+T+  E YKQP++YA+ HFSKFLP  S RI    
Sbjct  446  DWNLVLDEQGGPNYVKNFVDAPIIVNATSRSEIYKQPIFYAIGHFSKFLPPDSVRIETRI  505

Query  444  ------FTQTTNDILVTSFIRPDGAVVVTILNPNLHDAPIRIRPVDNKHAEVRANIPTKS  497
                  FTQ +    V  F RPDG+V + I N    + P+ +   D++   ++  +P +S
Sbjct  506  ENQSNPFTQLS----VVGFQRPDGSVALIIYNG--QNLPVDVTLDDSQRGAIQLRLPPRS  559

Query  498  IVTIVY  503
              T++Y
Sbjct  560  WHTVLY  565


>Q9VLT3_DROME unnamed protein product
Length=1760

 Score = 30.4 bits (67),  Expect = 4.2, Method: Compositional matrix adjust.
 Identities = 47/210 (22%), Positives = 97/210 (46%), Gaps = 34/210 (16%)

Query  122  AYYSDNGL--QYNMGRVPIGGTDFSTHGYSYNDGEEDPKLLRFNLTAE------DFSYKI  173
             Y+S+  L  +Y +GR P+  T+     + YN+  ++P+ +++N+  +      D S  I
Sbjct  375  GYFSNQVLNEKYRLGRSPLEQTNLYNERWRYNNPNQNPQ-VQYNVPGQLPQDGADLSQDI  433

Query  174  PLIKQAQALVKGELKLLASAWTAPKWMKRNGMYTGPDFLKDEMYQAWANYFVK---FLRA  230
              + + Q +V+   +     W  P W+++      P++ +D  Y+AW+  + K   +LR 
Sbjct  434  --LYRNQYVVERHYQ-FDEEW--PFWVRK------PEY-QDSSYEAWSGTYRKTLPYLR-  480

Query  231  YATEKINF-WGLTTGNEPSTGLIPSKINSVGWLPGSMGTFIAENL--GPTIRKSEFASIK  287
            Y     +F W L         L+P+  NS   +  ++G    + +  G ++ +   +S++
Sbjct  481  YFNGTFDFKWPL----RELELLVPNLANSEVLITATVGEKFYDEIISGYSVARVYNSSLR  536

Query  288  LLTIDDQLFMFPKMIEMIFKNEKAKDYIDG  317
            ++ + D   +F     M F    A +Y DG
Sbjct  537  VVFLGDSPQVFKPA--MPFTTYLAVEYHDG  564



Lambda      K        H
   0.320    0.136    0.429 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5770007388


Query= XP_031327294.1 ubiquinone biosynthesis O-methyltransferase,
mitochondrial-like [Photinus pyralis]

Length=274
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

E1JHN2_DROME  unnamed protein product                                 183     1e-56
Q5BIB9_DROME  unnamed protein product                                 183     2e-56
Q9VIF3_DROME  unnamed protein product                                 174     8e-53


>E1JHN2_DROME unnamed protein product
Length=289

 Score = 183 bits (464),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/266 (35%), Positives = 152/266 (57%), Gaps = 11/266 (4%)

Query  17   SFMRTISKAYSNKSTI---IESQVNHFSRLQEQWWDEAGAMKPLHSMNKLRVPFVQDGLV  73
            S  R  +++ S   ++    + +V H      +WW++ G M  LH++N++RVPF++DG+V
Sbjct  19   SIGRNSTRSSSTAKSLDAGTQKEVRHHENHASEWWNQNGTMGALHALNEIRVPFIRDGIV  78

Query  74   NSGLVHRDVILKQTPKPFANIKILDAGCGGGILAEALMKSGASVTGIDPAKDLIEIAKTH  133
            + G V    +   T K      IL+ GCGGG+L E L + GA V GID  + LIE A+ H
Sbjct  79   SRGTVKPGYV--NTTKVLLGQNILEVGCGGGLLTEHLARLGAQVAGIDLGEKLIEAAREH  136

Query  134  ------NVPRNINYWPVTIEEFSKENKNKFDAVITSQVVEHICELEVFLESCIRCLKPGG  187
                   +  N+ Y    +++ +K N   +DAVI S+V+EH+ +    LE+ +R LKPGG
Sbjct  137  LKCSSPELASNVVYKIEPVDQHAKANCECYDAVIVSEVLEHVKDKVSLLEASVRSLKPGG  196

Query  188  SLFVTTINQTLLAWLHNIVLAERVFRQIPLGTHQYRNLVPYQRLRTILENNKCRIGTVRG  247
            S+F+TT+N+T+ +W   ++L+E V   +P GTH +  ++    ++ IL+   C+   V G
Sbjct  197  SIFITTLNKTIPSWFGGVLLSEYVLNLVPRGTHHWDKMISPLDVQRILDTMNCQTVLVNG  256

Query  248  MVYNYLNNDWYWIKTTAIHYAVHAIK  273
              Y++ +N W WI    + YA+ A+K
Sbjct  257  STYDFWSNTWRWINNNQMCYALQAVK  282


>Q5BIB9_DROME unnamed protein product
Length=297

 Score = 183 bits (464),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/246 (36%), Positives = 144/246 (59%), Gaps = 8/246 (3%)

Query  34   ESQVNHFSRLQEQWWDEAGAMKPLHSMNKLRVPFVQDGLVNSGLVHRDVILKQTPKPFAN  93
            + +V H      +WW++ G M  LH++N++RVPF++DG+V+ G V    +   T K    
Sbjct  47   QKEVRHHENHASEWWNQNGTMGALHALNEIRVPFIRDGIVSRGTVKPGYV--NTTKVLLG  104

Query  94   IKILDAGCGGGILAEALMKSGASVTGIDPAKDLIEIAKTH------NVPRNINYWPVTIE  147
              IL+ GCGGG+L E L + GA V GID  + LIE A+ H       +  N+ Y    ++
Sbjct  105  QNILEVGCGGGLLTEHLARLGAQVAGIDLGEKLIEAAREHLKCSSPELASNVVYKIEPVD  164

Query  148  EFSKENKNKFDAVITSQVVEHICELEVFLESCIRCLKPGGSLFVTTINQTLLAWLHNIVL  207
            + +K N   +DAVI S+V+EH+ +    LE+ +R LKPGGS+F+TT+N+T+ +W   ++L
Sbjct  165  QHAKANCECYDAVIVSEVLEHVKDKVSLLEASVRSLKPGGSIFITTLNKTIPSWFGGVLL  224

Query  208  AERVFRQIPLGTHQYRNLVPYQRLRTILENNKCRIGTVRGMVYNYLNNDWYWIKTTAIHY  267
            +E V   +P GTH +  ++    ++ IL+   C+   V G  Y++ +N W WI    + Y
Sbjct  225  SEYVLNLVPRGTHHWDKMISPLDVQRILDTMNCQTVLVNGSTYDFWSNTWRWINNNQMCY  284

Query  268  AVHAIK  273
            A+ A+K
Sbjct  285  ALQAVK  290


>Q9VIF3_DROME unnamed protein product
Length=310

 Score = 174 bits (441),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 90/267 (34%), Positives = 146/267 (55%), Gaps = 29/267 (11%)

Query  34   ESQVNHFSRLQEQWWDEAGAMKPLHSMNKLRVPFVQDGLVNSGLVHRDVILKQTPKPFAN  93
            + +V H      +WW++ G M  LH++N++RVPF++DG+V+ G V    +   T K    
Sbjct  39   QKEVRHHENHASEWWNQNGTMGALHALNEIRVPFIRDGIVSRGTVKPGYV--NTTKVLLG  96

Query  94   IKILDAGCGGGILAEALMKSGASVTGIDPAKDLIEIAKTH------NVPRNINYWPVTIE  147
              IL+ GCGGG+L E L + GA V GID  + LIE A+ H       +  N+ Y    ++
Sbjct  97   QNILEVGCGGGLLTEHLARLGAQVAGIDLGEKLIEAAREHLKCSSPELASNVVYKIEPVD  156

Query  148  EFSKENKNKFDAVITSQVVEHICELEVFLESCIRCLKPGGSLFVTTINQTLLAWLHNIVL  207
            + +K N   +DAVI S+V+EH+ +    LE+ +R LKPGGS+F+TT+N+T+ +W   ++L
Sbjct  157  QHAKANCECYDAVIVSEVLEHVKDKVSLLEASVRSLKPGGSIFITTLNKTIPSWFGGVLL  216

Query  208  AERVFRQIPLGTHQYRNLVPYQRLRTILENNK---------------------CRIGTVR  246
            +E V   +P GTH +  ++    ++ IL+ +K                     C+   V 
Sbjct  217  SEYVLNLVPRGTHHWDKMISPLDVQRILDTSKFISGFIFRLGYSLFSRSSAVNCQTVLVN  276

Query  247  GMVYNYLNNDWYWIKTTAIHYAVHAIK  273
            G  Y++ +N W WI    + YA+ A+K
Sbjct  277  GSTYDFWSNTWRWINNNQMCYALQAVK  303



Lambda      K        H
   0.320    0.136    0.429 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5770007388


Query= XP_031327295.1 ubiquinone biosynthesis O-methyltransferase,
mitochondrial-like [Photinus pyralis]

Length=274
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

E1JHN2_DROME  unnamed protein product                                 183     1e-56
Q5BIB9_DROME  unnamed protein product                                 183     2e-56
Q9VIF3_DROME  unnamed protein product                                 174     8e-53


>E1JHN2_DROME unnamed protein product
Length=289

 Score = 183 bits (464),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/266 (35%), Positives = 152/266 (57%), Gaps = 11/266 (4%)

Query  17   SFMRTISKAYSNKSTI---IESQVNHFSRLQEQWWDEAGAMKPLHSMNKLRVPFVQDGLV  73
            S  R  +++ S   ++    + +V H      +WW++ G M  LH++N++RVPF++DG+V
Sbjct  19   SIGRNSTRSSSTAKSLDAGTQKEVRHHENHASEWWNQNGTMGALHALNEIRVPFIRDGIV  78

Query  74   NSGLVHRDVILKQTPKPFANIKILDAGCGGGILAEALMKSGASVTGIDPAKDLIEIAKTH  133
            + G V    +   T K      IL+ GCGGG+L E L + GA V GID  + LIE A+ H
Sbjct  79   SRGTVKPGYV--NTTKVLLGQNILEVGCGGGLLTEHLARLGAQVAGIDLGEKLIEAAREH  136

Query  134  ------NVPRNINYWPVTIEEFSKENKNKFDAVITSQVVEHICELEVFLESCIRCLKPGG  187
                   +  N+ Y    +++ +K N   +DAVI S+V+EH+ +    LE+ +R LKPGG
Sbjct  137  LKCSSPELASNVVYKIEPVDQHAKANCECYDAVIVSEVLEHVKDKVSLLEASVRSLKPGG  196

Query  188  SLFVTTINQTLLAWLHNIVLAERVFRQIPLGTHQYRNLVPYQRLRTILENNKCRIGTVRG  247
            S+F+TT+N+T+ +W   ++L+E V   +P GTH +  ++    ++ IL+   C+   V G
Sbjct  197  SIFITTLNKTIPSWFGGVLLSEYVLNLVPRGTHHWDKMISPLDVQRILDTMNCQTVLVNG  256

Query  248  MVYNYLNNDWYWIKTTAIHYAVHAIK  273
              Y++ +N W WI    + YA+ A+K
Sbjct  257  STYDFWSNTWRWINNNQMCYALQAVK  282


>Q5BIB9_DROME unnamed protein product
Length=297

 Score = 183 bits (464),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/246 (36%), Positives = 144/246 (59%), Gaps = 8/246 (3%)

Query  34   ESQVNHFSRLQEQWWDEAGAMKPLHSMNKLRVPFVQDGLVNSGLVHRDVILKQTPKPFAN  93
            + +V H      +WW++ G M  LH++N++RVPF++DG+V+ G V    +   T K    
Sbjct  47   QKEVRHHENHASEWWNQNGTMGALHALNEIRVPFIRDGIVSRGTVKPGYV--NTTKVLLG  104

Query  94   IKILDAGCGGGILAEALMKSGASVTGIDPAKDLIEIAKTH------NVPRNINYWPVTIE  147
              IL+ GCGGG+L E L + GA V GID  + LIE A+ H       +  N+ Y    ++
Sbjct  105  QNILEVGCGGGLLTEHLARLGAQVAGIDLGEKLIEAAREHLKCSSPELASNVVYKIEPVD  164

Query  148  EFSKENKNKFDAVITSQVVEHICELEVFLESCIRCLKPGGSLFVTTINQTLLAWLHNIVL  207
            + +K N   +DAVI S+V+EH+ +    LE+ +R LKPGGS+F+TT+N+T+ +W   ++L
Sbjct  165  QHAKANCECYDAVIVSEVLEHVKDKVSLLEASVRSLKPGGSIFITTLNKTIPSWFGGVLL  224

Query  208  AERVFRQIPLGTHQYRNLVPYQRLRTILENNKCRIGTVRGMVYNYLNNDWYWIKTTAIHY  267
            +E V   +P GTH +  ++    ++ IL+   C+   V G  Y++ +N W WI    + Y
Sbjct  225  SEYVLNLVPRGTHHWDKMISPLDVQRILDTMNCQTVLVNGSTYDFWSNTWRWINNNQMCY  284

Query  268  AVHAIK  273
            A+ A+K
Sbjct  285  ALQAVK  290


>Q9VIF3_DROME unnamed protein product
Length=310

 Score = 174 bits (441),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 90/267 (34%), Positives = 146/267 (55%), Gaps = 29/267 (11%)

Query  34   ESQVNHFSRLQEQWWDEAGAMKPLHSMNKLRVPFVQDGLVNSGLVHRDVILKQTPKPFAN  93
            + +V H      +WW++ G M  LH++N++RVPF++DG+V+ G V    +   T K    
Sbjct  39   QKEVRHHENHASEWWNQNGTMGALHALNEIRVPFIRDGIVSRGTVKPGYV--NTTKVLLG  96

Query  94   IKILDAGCGGGILAEALMKSGASVTGIDPAKDLIEIAKTH------NVPRNINYWPVTIE  147
              IL+ GCGGG+L E L + GA V GID  + LIE A+ H       +  N+ Y    ++
Sbjct  97   QNILEVGCGGGLLTEHLARLGAQVAGIDLGEKLIEAAREHLKCSSPELASNVVYKIEPVD  156

Query  148  EFSKENKNKFDAVITSQVVEHICELEVFLESCIRCLKPGGSLFVTTINQTLLAWLHNIVL  207
            + +K N   +DAVI S+V+EH+ +    LE+ +R LKPGGS+F+TT+N+T+ +W   ++L
Sbjct  157  QHAKANCECYDAVIVSEVLEHVKDKVSLLEASVRSLKPGGSIFITTLNKTIPSWFGGVLL  216

Query  208  AERVFRQIPLGTHQYRNLVPYQRLRTILENNK---------------------CRIGTVR  246
            +E V   +P GTH +  ++    ++ IL+ +K                     C+   V 
Sbjct  217  SEYVLNLVPRGTHHWDKMISPLDVQRILDTSKFISGFIFRLGYSLFSRSSAVNCQTVLVN  276

Query  247  GMVYNYLNNDWYWIKTTAIHYAVHAIK  273
            G  Y++ +N W WI    + YA+ A+K
Sbjct  277  GSTYDFWSNTWRWINNNQMCYALQAVK  303



Lambda      K        H
   0.320    0.136    0.429 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5770007388


Query= XP_031327296.1 ubiquinone biosynthesis O-methyltransferase,
mitochondrial-like [Photinus pyralis]

Length=274
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

E1JHN2_DROME  unnamed protein product                                 181     6e-56
Q5BIB9_DROME  unnamed protein product                                 182     6e-56
Q9VIF3_DROME  unnamed protein product                                 171     2e-51


>E1JHN2_DROME unnamed protein product
Length=289

 Score = 181 bits (460),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 95/266 (36%), Positives = 153/266 (58%), Gaps = 10/266 (4%)

Query  16   SVASSFTRAMYSKKSTIIESQ--VNHFKQLQEQWWDENGPIKPLHSLNKLRVPFVWDGLV  73
            S+  + TR+  + KS    +Q  V H +    +WW++NG +  LH+LN++RVPF+ DG+V
Sbjct  19   SIGRNSTRSSSTAKSLDAGTQKEVRHHENHASEWWNQNGTMGALHALNEIRVPFIRDGIV  78

Query  74   NTGVVHKDLLLNENPQPLANLEILDAGCGGGILAEALMRSGGTVTGIDPAKELLEIAKQH  133
            + G V    +     + L    IL+ GCGGG+L E L R G  V GID  ++L+E A++H
Sbjct  79   SRGTVKPGYV--NTTKVLLGQNILEVGCGGGLLTEHLARLGAQVAGIDLGEKLIEAAREH  136

Query  134  ------NISRNINYYSVTIEEFSKENENKLDAVITSEVIEHVCEVEVFLENCIRCLKPGG  187
                   ++ N+ Y    +++ +K N    DAVI SEV+EHV +    LE  +R LKPGG
Sbjct  137  LKCSSPELASNVVYKIEPVDQHAKANCECYDAVIVSEVLEHVKDKVSLLEASVRSLKPGG  196

Query  188  SLFVTTINQTLLAWLHIIVLAEILFRQIPLGTHQYRNLVPLQRLLTILENNNCRIGTVRG  247
            S+F+TT+N+T+ +W   ++L+E +   +P GTH +  ++    +  IL+  NC+   V G
Sbjct  197  SIFITTLNKTIPSWFGGVLLSEYVLNLVPRGTHHWDKMISPLDVQRILDTMNCQTVLVNG  256

Query  248  MVYNYLNNDWYWTKTTAINYAVHAIK  273
              Y++ +N W W     + YA+ A+K
Sbjct  257  STYDFWSNTWRWINNNQMCYALQAVK  282


>Q5BIB9_DROME unnamed protein product
Length=297

 Score = 182 bits (461),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 95/266 (36%), Positives = 153/266 (58%), Gaps = 10/266 (4%)

Query  16   SVASSFTRAMYSKKSTIIESQ--VNHFKQLQEQWWDENGPIKPLHSLNKLRVPFVWDGLV  73
            S+  + TR+  + KS    +Q  V H +    +WW++NG +  LH+LN++RVPF+ DG+V
Sbjct  27   SIGRNSTRSSSTAKSLDAGTQKEVRHHENHASEWWNQNGTMGALHALNEIRVPFIRDGIV  86

Query  74   NTGVVHKDLLLNENPQPLANLEILDAGCGGGILAEALMRSGGTVTGIDPAKELLEIAKQH  133
            + G V    +     + L    IL+ GCGGG+L E L R G  V GID  ++L+E A++H
Sbjct  87   SRGTVKPGYV--NTTKVLLGQNILEVGCGGGLLTEHLARLGAQVAGIDLGEKLIEAAREH  144

Query  134  ------NISRNINYYSVTIEEFSKENENKLDAVITSEVIEHVCEVEVFLENCIRCLKPGG  187
                   ++ N+ Y    +++ +K N    DAVI SEV+EHV +    LE  +R LKPGG
Sbjct  145  LKCSSPELASNVVYKIEPVDQHAKANCECYDAVIVSEVLEHVKDKVSLLEASVRSLKPGG  204

Query  188  SLFVTTINQTLLAWLHIIVLAEILFRQIPLGTHQYRNLVPLQRLLTILENNNCRIGTVRG  247
            S+F+TT+N+T+ +W   ++L+E +   +P GTH +  ++    +  IL+  NC+   V G
Sbjct  205  SIFITTLNKTIPSWFGGVLLSEYVLNLVPRGTHHWDKMISPLDVQRILDTMNCQTVLVNG  264

Query  248  MVYNYLNNDWYWTKTTAINYAVHAIK  273
              Y++ +N W W     + YA+ A+K
Sbjct  265  STYDFWSNTWRWINNNQMCYALQAVK  290


>Q9VIF3_DROME unnamed protein product
Length=310

 Score = 171 bits (432),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/287 (33%), Positives = 154/287 (54%), Gaps = 31/287 (11%)

Query  16   SVASSFTRAMYSKKSTIIESQ--VNHFKQLQEQWWDENGPIKPLHSLNKLRVPFVWDGLV  73
            S+  + TR+  + KS    +Q  V H +    +WW++NG +  LH+LN++RVPF+ DG+V
Sbjct  19   SIGRNSTRSSSTAKSLDAGTQKEVRHHENHASEWWNQNGTMGALHALNEIRVPFIRDGIV  78

Query  74   NTGVVHKDLLLNENPQPLANLEILDAGCGGGILAEALMRSGGTVTGIDPAKELLEIAKQH  133
            + G V    +     + L    IL+ GCGGG+L E L R G  V GID  ++L+E A++H
Sbjct  79   SRGTVKPGYV--NTTKVLLGQNILEVGCGGGLLTEHLARLGAQVAGIDLGEKLIEAAREH  136

Query  134  ------NISRNINYYSVTIEEFSKENENKLDAVITSEVIEHVCEVEVFLENCIRCLKPGG  187
                   ++ N+ Y    +++ +K N    DAVI SEV+EHV +    LE  +R LKPGG
Sbjct  137  LKCSSPELASNVVYKIEPVDQHAKANCECYDAVIVSEVLEHVKDKVSLLEASVRSLKPGG  196

Query  188  SLFVTTINQTLLAWLHIIVLAEILFRQIPLGTHQYRNLVPLQRLLTILENN---------  238
            S+F+TT+N+T+ +W   ++L+E +   +P GTH +  ++    +  IL+ +         
Sbjct  197  SIFITTLNKTIPSWFGGVLLSEYVLNLVPRGTHHWDKMISPLDVQRILDTSKFISGFIFR  256

Query  239  ------------NCRIGTVRGMVYNYLNNDWYWTKTTAINYAVHAIK  273
                        NC+   V G  Y++ +N W W     + YA+ A+K
Sbjct  257  LGYSLFSRSSAVNCQTVLVNGSTYDFWSNTWRWINNNQMCYALQAVK  303



Lambda      K        H
   0.320    0.136    0.429 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5770007388


Query= XP_031327297.1 ubiquinone biosynthesis O-methyltransferase,
mitochondrial-like [Photinus pyralis]

Length=273
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q5BIB9_DROME  unnamed protein product                                 178     2e-54
E1JHN2_DROME  unnamed protein product                                 177     2e-54
Q9VIF3_DROME  unnamed protein product                                 169     9e-51


>Q5BIB9_DROME unnamed protein product
Length=297

 Score = 178 bits (451),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/246 (37%), Positives = 140/246 (57%), Gaps = 8/246 (3%)

Query  33   ESQVNHFNQLQEQWWNKNGAAKPLHSLNKLRVPFVWDGLVNSGVVHKNLLLKQNPDLLAN  92
            + +V H      +WWN+NG    LH+LN++RVPF+ DG+V+ G V    +      +L  
Sbjct  47   QKEVRHHENHASEWWNQNGTMGALHALNEIRVPFIRDGIVSRGTVKPGYV--NTTKVLLG  104

Query  93   IEILDAGCGGGILAEALMRSGGTVTGIDPSKELIEIAKNH------NVSRNINYYSVTIE  146
              IL+ GCGGG+L E L R G  V GID  ++LIE A+ H       ++ N+ Y    ++
Sbjct  105  QNILEVGCGGGLLTEHLARLGAQVAGIDLGEKLIEAAREHLKCSSPELASNVVYKIEPVD  164

Query  147  EFSIENKGKFDAVITSEVIEHVCELEVFLESCISCLKPGGSLFITTINQTLLAWFHVIVL  206
            + +  N   +DAVI SEV+EHV +    LE+ +  LKPGGS+FITT+N+T+ +WF  ++L
Sbjct  165  QHAKANCECYDAVIVSEVLEHVKDKVSLLEASVRSLKPGGSIFITTLNKTIPSWFGGVLL  224

Query  207  SEILFRQIPLGTHQYRNIVPYQRLLTILENNKCRIGTGRGMVYNFLNNDWYWIKTTATHY  266
            SE +   +P GTH +  ++    +  IL+   C+     G  Y+F +N W WI      Y
Sbjct  225  SEYVLNLVPRGTHHWDKMISPLDVQRILDTMNCQTVLVNGSTYDFWSNTWRWINNNQMCY  284

Query  267  AVHAIK  272
            A+ A+K
Sbjct  285  ALQAVK  290


>E1JHN2_DROME unnamed protein product
Length=289

 Score = 177 bits (450),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/246 (37%), Positives = 140/246 (57%), Gaps = 8/246 (3%)

Query  33   ESQVNHFNQLQEQWWNKNGAAKPLHSLNKLRVPFVWDGLVNSGVVHKNLLLKQNPDLLAN  92
            + +V H      +WWN+NG    LH+LN++RVPF+ DG+V+ G V    +      +L  
Sbjct  39   QKEVRHHENHASEWWNQNGTMGALHALNEIRVPFIRDGIVSRGTVKPGYV--NTTKVLLG  96

Query  93   IEILDAGCGGGILAEALMRSGGTVTGIDPSKELIEIAKNH------NVSRNINYYSVTIE  146
              IL+ GCGGG+L E L R G  V GID  ++LIE A+ H       ++ N+ Y    ++
Sbjct  97   QNILEVGCGGGLLTEHLARLGAQVAGIDLGEKLIEAAREHLKCSSPELASNVVYKIEPVD  156

Query  147  EFSIENKGKFDAVITSEVIEHVCELEVFLESCISCLKPGGSLFITTINQTLLAWFHVIVL  206
            + +  N   +DAVI SEV+EHV +    LE+ +  LKPGGS+FITT+N+T+ +WF  ++L
Sbjct  157  QHAKANCECYDAVIVSEVLEHVKDKVSLLEASVRSLKPGGSIFITTLNKTIPSWFGGVLL  216

Query  207  SEILFRQIPLGTHQYRNIVPYQRLLTILENNKCRIGTGRGMVYNFLNNDWYWIKTTATHY  266
            SE +   +P GTH +  ++    +  IL+   C+     G  Y+F +N W WI      Y
Sbjct  217  SEYVLNLVPRGTHHWDKMISPLDVQRILDTMNCQTVLVNGSTYDFWSNTWRWINNNQMCY  276

Query  267  AVHAIK  272
            A+ A+K
Sbjct  277  ALQAVK  282


>Q9VIF3_DROME unnamed protein product
Length=310

 Score = 169 bits (427),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 93/267 (35%), Positives = 142/267 (53%), Gaps = 29/267 (11%)

Query  33   ESQVNHFNQLQEQWWNKNGAAKPLHSLNKLRVPFVWDGLVNSGVVHKNLLLKQNPDLLAN  92
            + +V H      +WWN+NG    LH+LN++RVPF+ DG+V+ G V    +      +L  
Sbjct  39   QKEVRHHENHASEWWNQNGTMGALHALNEIRVPFIRDGIVSRGTVKPGYV--NTTKVLLG  96

Query  93   IEILDAGCGGGILAEALMRSGGTVTGIDPSKELIEIAKNH------NVSRNINYYSVTIE  146
              IL+ GCGGG+L E L R G  V GID  ++LIE A+ H       ++ N+ Y    ++
Sbjct  97   QNILEVGCGGGLLTEHLARLGAQVAGIDLGEKLIEAAREHLKCSSPELASNVVYKIEPVD  156

Query  147  EFSIENKGKFDAVITSEVIEHVCELEVFLESCISCLKPGGSLFITTINQTLLAWFHVIVL  206
            + +  N   +DAVI SEV+EHV +    LE+ +  LKPGGS+FITT+N+T+ +WF  ++L
Sbjct  157  QHAKANCECYDAVIVSEVLEHVKDKVSLLEASVRSLKPGGSIFITTLNKTIPSWFGGVLL  216

Query  207  SEILFRQIPLGTHQYRNIVPYQRLLTILENNK---------------------CRIGTGR  245
            SE +   +P GTH +  ++    +  IL+ +K                     C+     
Sbjct  217  SEYVLNLVPRGTHHWDKMISPLDVQRILDTSKFISGFIFRLGYSLFSRSSAVNCQTVLVN  276

Query  246  GMVYNFLNNDWYWIKTTATHYAVHAIK  272
            G  Y+F +N W WI      YA+ A+K
Sbjct  277  GSTYDFWSNTWRWINNNQMCYALQAVK  303



Lambda      K        H
   0.320    0.136    0.429 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5770007388


Query= XP_031327298.1 glycine-rich cell wall structural protein-like
[Photinus pyralis]

Length=169


***** No hits found *****



Lambda      K        H
   0.320    0.136    0.429 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5770007388


Query= XP_031327299.1 leucine-rich repeat-containing protein 49 [Photinus
pyralis]

Length=888
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VQV7_DROME  unnamed protein product                                 77.8    2e-14
Q9VEK8_DROME  unnamed protein product                                 75.5    2e-14
Q9U3W5_DROME  unnamed protein product                                 74.7    4e-14


>Q9VQV7_DROME unnamed protein product
Length=806

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 68/235 (29%), Positives = 119/235 (51%), Gaps = 13/235 (6%)

Query  102  ISLDRRGLTVLPVLDDEVNLRLLSLQHNLLNSLDGFRHQRFNFLVFLDVYDNQLEKIHCL  161
            ++L ++ L  +P  DD  ++R L L  N L  +D      +  +  L +  NQL +++ +
Sbjct  13   LNLSKQKLKKVPKQDDAHSIRQLILDENELQKIDNI--DSYLKIETLSLARNQLLRMYGV  70

Query  162  DGLESLRVLLMGKNRIKQIEGLENLMKIEVLDLHGNQITHVNGLSPLSQLKVLNLAGNQI  221
              L  LR L +  N I  IEGL+  + + VL+L GN I  +  L+    L+ LNLA N I
Sbjct  71   CRLHCLRELNLSFNGILSIEGLKECIHLRVLNLEGNNIKTIEHLNTNVNLECLNLADNSI  130

Query  222  KNIGASDLKGLISLQEFNLRRNKLKKLLGFGET--ASLQKLFLSNNELHAVEDMCSLAKA  279
             +I  SD+  L +L+E  L  N+L  L    +    SL+ L L+ N ++ + ++C+L+  
Sbjct  131  GSI--SDMSYLRNLKELYLHGNRLTHLRQCDKCLPTSLETLTLAKNSINDLNEICTLSHL  188

Query  280  ISIREIAVDNNPI-----SLGG-DCVSFLVSYLPQLTILNGMQITDQVRKAAMAW  328
             ++  I++ +NP      SL G D   F++++   L  ++G  + D +      W
Sbjct  189  SNLLSISIADNPCVTMINSLDGFDYRPFVLNWCMSLKYIDGF-VVDPIESLKAEW  242


>Q9VEK8_DROME unnamed protein product
Length=326

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/170 (32%), Positives = 95/170 (56%), Gaps = 7/170 (4%)

Query  124  LSLQHNLLNSLDGFRHQRFNFLVFLDVYDNQLEKIHCLDGLESLRVLLMGKNRIKQIEGL  183
            L L+ NL+  ++         L+ L++YDNQ+ KI  LD L  L VL +  NR+ +IE L
Sbjct  66   LFLRWNLIKKIENL--SSLKTLIELELYDNQITKIENLDDLPHLEVLDISFNRLTKIENL  123

Query  184  ENLMKIEVLDLHGNQITHVNGLSPLSQLKVLNLAGNQIKNIGASDLKGLISLQEFNLRRN  243
            + L+K+E +    N+IT +  L  L+ L +L L  N++K I   +++ L++L++  L +N
Sbjct  124  DKLVKLEKVYFVSNRITQIENLDMLTNLTMLELGDNKLKKI--ENIEMLVNLRQLFLGKN  181

Query  244  KLKKLLGFGETASLQKLFLSNNELHAVEDMCSLAKAISIREIAVDNNPIS  293
            K+ K+       +L+ L L  N +  +E++  LA   ++RE+ V  N + 
Sbjct  182  KIAKIENLDTLVNLEILSLQANRIVKIENLEKLA---NLRELYVSENGVE  228


 Score = 64.7 bits (156),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 51/165 (31%), Positives = 95/165 (58%), Gaps = 2/165 (1%)

Query  145  LVFLDVYDNQLEKIHCLDGLESLRVLLMGKNRIKQIEGLENLMKIEVLDLHGNQITHVNG  204
            L  L++ DN+L+KI  ++ L +LR L +GKN+I +IE L+ L+ +E+L L  N+I  +  
Sbjct  151  LTMLELGDNKLKKIENIEMLVNLRQLFLGKNKIAKIENLDTLVNLEILSLQANRIVKIEN  210

Query  205  LSPLSQLKVLNLAGNQIKNIGASDLKGLISLQEFNLRRNKLKKLLGFGETASLQKLFLSN  264
            L  L+ L+ L ++ N ++ I   +L     L+  +L +N+LK +    +   L++L+L++
Sbjct  211  LEKLANLRELYVSENGVETI--ENLSENTKLETLDLAKNRLKGIANLEKLELLEELWLNH  268

Query  265  NELHAVEDMCSLAKAISIREIAVDNNPISLGGDCVSFLVSYLPQL  309
            N +   +D+  L    +++ I ++ NP++      S L   LPQL
Sbjct  269  NGVDDWKDIELLKVNKALQTIYLEYNPLAKDVRYRSKLRDILPQL  313


>Q9U3W5_DROME unnamed protein product
Length=326

 Score = 74.7 bits (182),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 54/170 (32%), Positives = 94/170 (55%), Gaps = 7/170 (4%)

Query  124  LSLQHNLLNSLDGFRHQRFNFLVFLDVYDNQLEKIHCLDGLESLRVLLMGKNRIKQIEGL  183
            L L+ NL+  ++         L+ L++YDNQ+ KI  LD L  L VL +  NR+ +IE L
Sbjct  66   LFLRWNLIKKIENL--SSLKTLIELELYDNQITKIENLDDLPHLEVLDISFNRLTKIENL  123

Query  184  ENLMKIEVLDLHGNQITHVNGLSPLSQLKVLNLAGNQIKNIGASDLKGLISLQEFNLRRN  243
            + L+K+E +    N+IT +  L  L+ L +L L  N++K I   +++ L++L++  L +N
Sbjct  124  DKLVKLEKVYFVSNRITQIENLDMLTNLTMLELGDNKLKKI--ENIEMLVNLRQLFLGKN  181

Query  244  KLKKLLGFGETASLQKLFLSNNELHAVEDMCSLAKAISIREIAVDNNPIS  293
            K+ K+       +L+ L L  N +  +E   +L K  ++RE+ V  N + 
Sbjct  182  KIAKIENLDTLVNLEILSLQANRIVKIE---TLEKLANLRELYVSENGVE  228


 Score = 64.3 bits (155),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/165 (31%), Positives = 95/165 (58%), Gaps = 2/165 (1%)

Query  145  LVFLDVYDNQLEKIHCLDGLESLRVLLMGKNRIKQIEGLENLMKIEVLDLHGNQITHVNG  204
            L  L++ DN+L+KI  ++ L +LR L +GKN+I +IE L+ L+ +E+L L  N+I  +  
Sbjct  151  LTMLELGDNKLKKIENIEMLVNLRQLFLGKNKIAKIENLDTLVNLEILSLQANRIVKIET  210

Query  205  LSPLSQLKVLNLAGNQIKNIGASDLKGLISLQEFNLRRNKLKKLLGFGETASLQKLFLSN  264
            L  L+ L+ L ++ N ++ I   +L     L+  +L +N+LK +    +   L++L+L++
Sbjct  211  LEKLANLRELYVSENGVETI--ENLSENTKLETLDLAKNRLKGIANLEKLELLEELWLNH  268

Query  265  NELHAVEDMCSLAKAISIREIAVDNNPISLGGDCVSFLVSYLPQL  309
            N +   +D+  L    +++ I ++ NP++      S L   LPQL
Sbjct  269  NGVDDWKDIELLKVNKALQTIYLEYNPLAKDVRYRSKLRDILPQL  313



Lambda      K        H
   0.320    0.136    0.429 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5770007388


Query= XP_031327300.1 uncharacterized protein LOC116158622 [Photinus
pyralis]

Length=431
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

BICC_DROME  unnamed protein product                                   39.3    0.007
EAK4_CAEEL  unnamed protein product                                   32.0    0.71 
LIPB_CAEEL  unnamed protein product                                   32.3    0.79 


>BICC_DROME unnamed protein product
Length=905

 Score = 39.3 bits (90),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 33/66 (50%), Gaps = 2/66 (3%)

Query  5    VTNLLTNWGFFQYIDVFAENRIDTTALTLLTEGDVANL-VPVLGDRVKLLAQL-TLWKAD  62
            +  LLT+ G   YI +F  N ID    T LTE ++  L +   G R KLL  + TL   +
Sbjct  810  IQTLLTSLGLEHYIKIFVLNEIDLEVFTTLTEENLMELGIAAFGARKKLLTAIHTLLANE  869

Query  63   NECSNI  68
              CS +
Sbjct  870  AACSTM  875


>EAK4_CAEEL unnamed protein product
Length=247

 Score = 32.0 bits (71),  Expect = 0.71, Method: Compositional matrix adjust.
 Identities = 23/70 (33%), Positives = 39/70 (56%), Gaps = 5/70 (7%)

Query  350  ILKGPSGYRLLALDYQRIFPDKDEALLRESLESVSTKILQKAATKC--TTTKDEFLKENI  407
            +++ P+G R + LD Q I+ D+ EA L + LE+  ++ L K         TKD+ L + +
Sbjct  79   LVECPAGRRAMQLDVQ-IYADRYEATLNKILET--SQELDKGLEDIFQAYTKDDPLADKV  135

Query  408  QTCLSSVDEV  417
              C  +VDE+
Sbjct  136  MNCRLTVDEM  145


>LIPB_CAEEL unnamed protein product
Length=920

 Score = 32.3 bits (72),  Expect = 0.79, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 32/70 (46%), Gaps = 2/70 (3%)

Query  9    LTNWGFFQYIDVFAENRIDTTALTLLTEGDVANLVPVLGDRVKLLAQLT--LWKADNECS  66
            L + G  QY DVFAEN +D   L  LT  D   +  V       LA+    L KAD   +
Sbjct  695  LDDIGLPQYKDVFAENVVDGPLLLSLTANDAVEMKVVNAHHYATLARSIQFLKKADFRFN  754

Query  67   NINRLSTEKI  76
             + +L  + I
Sbjct  755  AMEKLIDQNI  764



Lambda      K        H
   0.320    0.136    0.429 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5770007388


Query= XP_031327301.1 protein AATF [Photinus pyralis]

Length=448
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

AATF_DROME  unnamed protein product                                   148     3e-39
Q4GZ49_TRYB2  unnamed protein product                                 49.3    4e-06
Q38AI3_TRYB2  unnamed protein product                                 31.6    1.4  


>AATF_DROME unnamed protein product
Length=488

 Score = 148 bits (373),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 110/305 (36%), Positives = 168/305 (55%), Gaps = 38/305 (12%)

Query  141  KSTCVRQQLNTWESFLEMRIQLQKCLIVANKLPQGANFEQLKNDADFDVES--RKAVGTV  198
            K   V+ QL  WE  LE+RI  QK    AN+LP      +L +++D +++S   +A    
Sbjct  213  KGLAVQNQLRIWERLLELRINTQKFTSKANQLPAPETLTKLASESD-ELQSVLNEAQERS  271

Query  199  KNLLDKLLELQMLLLKNYPETKKLFLKPEVKNKSESDEEIPSDTDEEELSEVPCRKRMKT  258
              LL +LL LQ  L + Y E KK      VK K  +++  P+                  
Sbjct  272  SKLLQQLLSLQSALHQQYSEMKK-----SVKRKQPTEDSGPA-----------------V  309

Query  259  DEYSAELTNRSDLYYNYRNSVLQKWHDKTQI-----GV-NKSGNVVHSVTEQIKHILTSK  312
             ++ + L +       YRN VL KW D+T++     GV  KS    + + ++I   L ++
Sbjct  310  KKFGSVLQSNFQQMIGYRNEVLLKWDDRTKLLTPGAGVKRKSLQEDYDIIKKIGSALANR  369

Query  313  EKLIKATQLKRTDYDILGEHSDKIAESSVDVYNTNIFDDTDFYHHLLRELIEFKSSDLTD  372
            E L++ +Q   T  +   E  +      +     +I+DD+DFYH  LRELIE+K+S  ++
Sbjct  370  EALVEKSQ---TPKNSQAEQQENTPVQRL----KHIYDDSDFYHQQLRELIEYKASTSSN  422

Query  373  PVKLGRQWMQLQSLRSKMKKKVDTKATKGRKIRYVVHSKLVNFMAPVEDLTWQESAKNEL  432
              ++ +Q+++LQ LR KMKKKVDT+A+KGRK+RYVVH+KL+NFMAP E   W +++K+EL
Sbjct  423  MSEITKQFVELQKLRQKMKKKVDTRASKGRKLRYVVHNKLINFMAPNESSDWTDASKSEL  482

Query  433  YGSLF  437
            Y SLF
Sbjct  483  YKSLF  487


 Score = 33.1 bits (74),  Expect = 0.49, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 44/79 (56%), Gaps = 10/79 (13%)

Query  3   ESLSDKIATLLSAAPTSFDPED-DVNEETTARV----ESQYASDDDNNLSQNLSQFRKQN  57
           +++++K++ LL+    S   ED D +  T  R+    E +Y   D  +     + FRK+N
Sbjct  10  QTVAEKVSKLLAHPNESDSAEDSDFDVATGPRLVDFEEEEYDLPDARS-----TDFRKRN  64

Query  58  VELLEEVDKRYEGKRASRK  76
           V+LL E   RY+GK +SRK
Sbjct  65  VKLLSEQSDRYKGKISSRK  83


>Q4GZ49_TRYB2 unnamed protein product
Length=493

 Score = 49.3 bits (116),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 75/316 (24%), Positives = 122/316 (39%), Gaps = 69/316 (22%)

Query  144  CVRQQLNTWESFLEMRIQLQKCLIVANKLPQGANFEQLKNDADFDV--ESRKAVGTVKNL  201
             +   +  +   L MRI+LQ  +  A   PQ    +    + D  +  E++   G++K L
Sbjct  224  AIHHYVMVYSQLLRMRIKLQPVVARAVTFPQYYALKDFLQNGDETIKKETKVVTGSLKEL  283

Query  202  LDKLLELQMLLLKNYPETKKLFLKPEVKNKSESDEEIPSDTDEEELSEVPCRKRMKTDEY  261
            L   L L                      K   D   P+         VP  K       
Sbjct  284  LGTFLSL------------------AAGGKKGEDNGKPTTR-----GTVPSFK-------  313

Query  262  SAELTNRSDLYYNYRNSVLQKWHDK-TQIGVNKSGNVVHSVTEQIKHILTSKEKLIKATQ  320
              E+      +    ++ ++ W  K  Q    K   V   + +QI+ IL+S+  L    Q
Sbjct  314  --EVNVIHKRFIAGADACIEHWGAKFVQSNSAKLHTVSQPLIQQIRTILSSRAPLRARVQ  371

Query  321  LKRTDYDILG-----------EH----SDKIAESSVDVYNTNIFDDTDFYHHLLRELIEF  365
              R    ILG           EH    +  IA+  +D     I+DD +F    LRE++  
Sbjct  372  KNRAHVTILGHPEHYRATQSGEHKAARALHIADGDID---GEIYDDGEF----LREVVRR  424

Query  366  KSSDLTDPVKLGRQWMQLQS-LRS--KMKKKVDTKATKGRKIRYVVHSKLVNFMAPVEDL  422
              +     VKL +Q  ++Q  L+S  +  K+   + TKG+ + Y    KLV F+ PV   
Sbjct  425  GGA-----VKLQQQLQEIQRELQSSEEPAKRGFHRLTKGKAVNYEPRPKLVGFLLPV---  476

Query  423  TWQESAKNE-LYGSLF  437
             +  + ++E L+ SLF
Sbjct  477  PFAVNGQHEVLFKSLF  492


>Q38AI3_TRYB2 unnamed protein product
Length=712

 Score = 31.6 bits (70),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 39/173 (23%), Positives = 78/173 (45%), Gaps = 28/173 (16%)

Query  2    AESLSDKIATLLSAAPTSFDPEDDVNEETTARVESQYASDDDNNLSQNLSQFRKQNVELL  61
             E+  D +A  +  AP     ED+V++     VE+   +      +++  + RK+   LL
Sbjct  390  GETADDDLAAYI--APPDSSEEDEVDDN----VENSRVNGKKMKRAKDKVRIRKKYAALL  443

Query  62   EEVDKRYEGKRASRKKLTQYDEWESKSEDGKSSEETEDSGDEESAG-------EESDATE  114
            EE+    E             ++    EDG++ EE  D  D++S         E+S+ + 
Sbjct  444  EEIGGLPE-------------DYGGSGEDGEADEENSDESDDDSLNRFSDVEMEKSEGSC  490

Query  115  EYDDEVYGEDSGTANIFKNAETVSTNKSTCVRQQLNTWE--SFLEMRIQLQKC  165
            E   EV+GE   T ++   ++ V   +   ++QQ+ + +  S  E++ +L++ 
Sbjct  491  EGSPEVFGEVEATLDLDAESKAVKLQRDVRIKQQMTSSDLGSKAELKYKLRRS  543



Lambda      K        H
   0.320    0.136    0.429 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5770007388


Query= XP_031327302.1 39S ribosomal protein L54, mitochondrial [Photinus
pyralis]

Length=131
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9W274_DROME  unnamed protein product                                 28.9    1.5  
V6CJ54_CAEEL  unnamed protein product                                 27.7    3.0  
Q9XZC9_DROME  unnamed protein product                                 27.7    3.5  


>Q9W274_DROME unnamed protein product
Length=538

 Score = 28.9 bits (63),  Expect = 1.5, Method: Composition-based stats.
 Identities = 14/39 (36%), Positives = 21/39 (54%), Gaps = 3/39 (8%)

Query  90   DVRTGPPPPLEELDPNSKEYWRRVRKMAIKRNTQLARIN  128
            DV TG   P EE+DP   ++W ++    I +  QL + N
Sbjct  49   DVATGKYTPPEEMDP---QFWYKLADEEIAKRLQLPQPN  84


>V6CJ54_CAEEL unnamed protein product
Length=318

 Score = 27.7 bits (60),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 22/42 (52%), Gaps = 0/42 (0%)

Query  16   INSFSRMTYAKATVLGGALKKKKGGKGGPMTEKRVLPVETDP  57
            I+ +S+M Y+ A    G L  + G + GP    R+L + TD 
Sbjct  270  IDKYSKMDYSLAIQEIGELVAENGRRVGPSMAHRILTMLTDE  311


>Q9XZC9_DROME unnamed protein product
Length=3367

 Score = 27.7 bits (60),  Expect = 3.5, Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 51/122 (42%), Gaps = 21/122 (17%)

Query  5     KELIKGNR---FNLINSFSRMTYAKATVLGGALKKKKGG------KGGPMTEKRVLPVET  55
             ++++  NR   FN   +F+ +   +   L G+LK   GG      K  PM  K       
Sbjct  2929  RDVVFNNRTINFNDALTFANVQIGRNGPLMGSLK---GGLYDVLLKTEPMIGKSFTASPE  2985

Query  56    DPERLVNYACGTNIFKTGEDVKLLPDSEYPT---WL------WDVRTGPPPPLEELDPNS  106
               +R+ +Y+   N FK G+D+      + P    W       +D R+  P  +  L P S
Sbjct  2986  GCKRIGSYSYEPNAFKFGDDIYSYSQLKLPERHFWQRNFHLSFDFRSFYPNGMLYLSPGS  3045

Query  107   KE  108
             KE
Sbjct  3046  KE  3047



Lambda      K        H
   0.320    0.136    0.429 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5770007388


Query= XP_031327303.1 G2/M phase-specific E3 ubiquitin-protein ligase-like
[Photinus pyralis]

Length=487
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

NEDD4_DROME  unnamed protein product                                  46.6    4e-05
HECW1_CAEEL  unnamed protein product                                  46.2    6e-05
Q9GUP2_CAEEL  unnamed protein product                                 38.9    0.011


>NEDD4_DROME unnamed protein product
Length=1007

 Score = 46.6 bits (109),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 81/333 (24%), Positives = 127/333 (38%), Gaps = 78/333 (23%)

Query  174  IDGQSEGAVDMGGPTRELFRLLMNYLKNS--NLFMGPDKKYISLDALALD----------  221
            ++ + E  +D GG  RE F LL   + N    LF     +Y ++D   L           
Sbjct  682  VEFEGETGLDYGGLAREWFYLLSKEMFNPYYGLF-----EYSAMDNYTLQINNGSGLCNE  736

Query  222  --KRYYYDAGRMVALSIVHAGLGPHFFSNSLFVAVTKGVEFVKP--LKEFVECDILEKIN  277
                Y+   GR+  +++ H  L   FF    +  + +     KP  LK+    D  E  N
Sbjct  737  EHLSYFKFIGRIAGMAVYHGKLLDAFFIRPFYKMMLQ-----KPIDLKDMESVDT-EYYN  790

Query  278  KLSHINDETEMR----EYLLNESVFSI----------AGINIVNQLIARKDEIIDATVKF  323
             L  I  E + R     + L+E VF            A I++ N+    KDE I   +++
Sbjct  791  SLMWIK-ENDPRILELTFCLDEDVFGQKSQHELKPGGANIDVTNE---NKDEYIKLVIEW  846

Query  324  YHIYRTKPALDQLIDGLKTC---NVLEFLQNHPILFEDIVC-----DNKSKLNNTIIEEL  375
              + R K  +   +DG  +    N+++    H +  E ++C     D K    NT+ +  
Sbjct  847  RFVARVKEQMSSFLDGFGSIIPLNLIKIFDEHEL--ELLMCGIQNIDVKDWRENTLYK--  902

Query  376  PTVMLSEVGSNKRQTQNRILAFWRDYLLDCEEENSNCSLEELLVFVTGADTVPALGF---  432
                      +       I  FWR  L    E  S      LL FVTG   VP  GF   
Sbjct  903  ---------GDYHMNHIIIQWFWRAVLSFSNEMRS-----RLLQFVTGTSRVPMNGFKEL  948

Query  433  ----GTKIYIRFQHDDKMMYPKANTCGLELYLP  461
                G +++   +      +P+A+TC   L LP
Sbjct  949  YGSNGPQMFTIEKWGTPNNFPRAHTCFNRLDLP  981


>HECW1_CAEEL unnamed protein product
Length=1247

 Score = 46.2 bits (108),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 85/364 (23%), Positives = 149/364 (41%), Gaps = 70/364 (19%)

Query  162   DPF----AKIDVKFSDIDGQSEGAVDMGGPTRELFRLLMNYL---KNSNLFMGPDKKYIS  214
             DPF    +++ ++F     + E A+D GG +RE F LL   L   KN       +  ++ 
Sbjct  914   DPFVLKKSRLHIRF-----EGELALDYGGLSREFFILLSRELFHPKNGYFEYEGNDYHLQ  968

Query  215   LDALALD----KRYYYDAGRMVALSIVHAGLGPHFFSNSLFVAVTK-----------GVE  259
             L     +    K++    GR++AL+++H      FF+N  + ++ K             E
Sbjct  969   LRPRGCETEKEKKWLILCGRVLALAVIHRCYIDVFFTNVFYKSLQKRPVTLMDFKESDAE  1028

Query  260   FVKPLKEFVECDILEKINKLSHINDETEMREYLLNESVFSIAGINIVNQLI--ARKDEII  317
             F K +   +E D+++   ++S +   + M    L E      G    +Q++  A K E I
Sbjct  1029  FYKSMNWLLENDVVDL--EMSFVY--SSMVNGKLAEQELVPGG---ESQMVTEANKAEFI  1081

Query  318   DATVKFYHIYRTKPALDQLIDGLKTCNVLEFLQNHPILFEDIVCDNKSKLNNTIIEELPT  377
             D   +   I   +  L+ L+                  F  I+ DN   LN+    +L  
Sbjct  1082  DLMCQKKAIRGVEKPLEILLTS----------------FNQILNDNL--LNSLESSDLKR  1123

Query  378   VMLS--EVGSNKRQTQNRILAFWRD------YLLDCEEENSNCSLEELLVFVTGADTVPA  429
             ++    E+  N  +T       + D      +  +  E  +N    +LL+FVTG+ +VP 
Sbjct  1124  ILSGSLELDLNDWRTNTIYKGGYSDCHIVVEWFWEVIETMTNQERFDLLLFVTGSSSVPF  1183

Query  430   LGF----GTKIYIRF---QHDDKMMYPKANTCGLELYLPTCHTNFDDFKYHMDFGIGNSK  482
              GF    G +   +F   +  D   +P+A+TC   L LP+ +T     K  +   I N  
Sbjct  1184  EGFSALRGNEEISKFCIEKWGDATSFPRAHTCFNRLQLPSYNTK-QQLKSKLQQAIVNGM  1242

Query  483   DFGI  486
              + I
Sbjct  1243  SYSI  1246


>Q9GUP2_CAEEL unnamed protein product
Length=4177

 Score = 38.9 bits (89),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 76/354 (21%), Positives = 138/354 (39%), Gaps = 73/354 (21%)

Query  177   QSEGAVDMGGPTRELFRLLMNYLKNSN------------LFMGPDKKYISLDALALDKRY  224
             Q E   D GG  RE F ++   + N N             +M     YI+ + L     Y
Sbjct  3854  QGEEGQDAGGLLREWFSVITREIFNPNYALFITAPGDMVTYMINKASYINPEHLD----Y  3909

Query  225   YYDAGRMVALSIVHAGLGPHFFSNSLFVAV-----------TKGVEFVKPLKEFVECDIL  273
             +   GR++A S+        +F+ + +  +           ++   F K L   ++  I 
Sbjct  3910  FKFVGRLIAKSVFEHKYLDCYFTRAFYKHILNLPVRYQDLESEDPAFFKSLDFLLQNPID  3969

Query  274   EKINKLSHINDETEMREYLLNESVFSIAGINIVNQLI----ARKDEIIDATVKFYHIYRT  329
             +    L+     TE+ E+     V S+  +    + I    A KDE +    +       
Sbjct  3970  DLALDLTF---STEVEEF----GVRSVRDLKPNGRKIEVNDANKDEYVKLVCQMKMTGSI  4022

Query  330   KPALDQLIDGLKTCNVLEFLQNHPILFEDIVCDNKSKLNNTIIEELPTVMLSEVGSNK--  387
             +  LD  + G            + I+ +D++     +    +I  LPTV + ++ +N   
Sbjct  4023  RKQLDAFLTGF-----------YEIIPKDLISMFNEQELELLISGLPTVDIDDMAANTDY  4071

Query  388   ---RQTQNRILAFWRDYLLDCEEENSNCSLEELLVFVTGADTVPALGFGT----------  434
                ++T   I  FWR  L   E+E+      + L FVTG   VP  GF +          
Sbjct  4072  KGFQKTSTHIQWFWR-ALRSFEKEDK----AKFLQFVTGTSKVPLQGFASLEGMNGVQKF  4126

Query  435   KIYIRFQHDDKMMYPKANTCGLELYLPTCHTNFDDFKYHMDFGIGN-SKDFGIA  487
              I++  +  D++  P A+TC  +L LP  + +++  +  +   I   ++ FG A
Sbjct  4127  SIHMDSRGGDRL--PAAHTCFNQLDLPQ-YESYEKLRQSLLLAIRECTEGFGFA  4177



Lambda      K        H
   0.320    0.136    0.429 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5770007388


Query= XP_031327304.1 fanconi-associated nuclease 1-like [Photinus pyralis]

Length=960
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

FAN1_CAEEL  unnamed protein product                                   172     6e-44
Q38AL0_TRYB2  unnamed protein product                                 40.0    0.009
PP4R3_DROME  unnamed protein product                                  33.9    0.86 


>FAN1_CAEEL unnamed protein product
Length=865

 Score = 172 bits (436),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 183/682 (27%), Positives = 300/682 (44%), Gaps = 83/682 (12%)

Query  289  PISLNIILEIINFVVNHERLQK------LLVYKDTVMLHNFLQLNSKYI-FFCLKLYTRI  341
            P  + I ++I+  V++ E+           +  D +  + F++L S+      ++L+ R 
Sbjct  214  PYYIKITIKIMKRVISTEKFDGTFYADDFWLPSDIITFYRFVELLSEGAKCLLVRLFIRK  273

Query  342  KKWYNIFDLRTAIKSELSDPEV----MAMYDCLKGSLFVDTDYSTEPIHDLLHHLHVKIL  397
              WYN+  L      E   PE+     A+ +  KG  F+D D S + + + L    V  L
Sbjct  274  PAWYNLEKL------EQKYPEIPNIKEAVSELAKGH-FIDDDSSMKTLDEALQISDVVAL  326

Query  398  RELCVEFKIPFSKVKKTDLVDKLLNNCNNQTTL-TIKSSIRDLLMNSLKKKMGFCMKLNE  456
            + +  +FK+  +K  + +L+  L     +Q ++     ++   ++ SLK+++G C+++  
Sbjct  327  KNVTKKFKLDGTK-NRQELIQSLRKFAQSQQSIFGGTGNVEKSILKSLKQELGPCVRVRG  385

Query  457  YFFKLLNKVHLLYM-------------FTTNEYIQTSDLYLFMSRLMDGSIVLPSYLVDR  503
             F  L   +  +Y               TTN Y    DL   M  + +G++  P+     
Sbjct  386  GFVDLFKCLFTIYCPVTTNSANVIDNPSTTNVY---QDLLYLMLSVANGTVQFPA---PN  439

Query  504  NVDIFRSIEEFNSFHEAFQCYASVLIAADKKDSALIYQLACKIYEELKKIVERNVVDNRP  563
               I  S  +  +  + +    S+ IA   + S      A  +  + K+ +E+   D++ 
Sbjct  440  PCPIIASFYKNRNMLQDYMISKSLEIAIVSQMSNGNLDAALDLAIDAKEFIEQMSDDDKR  499

Query  564  SY----LH--RFTPGHKYTKALWHAIPFVIKPHK-ELACEWLKFLL----DQRLFCQYLR  612
             Y    +H  +FT    +T+   HA   + +  K  +A EW K LL    D + +C   R
Sbjct  500  YYESLEIHERKFTSIWVFTRCCGHASSILERQKKYGMAVEWQKDLLITNKDIQSYCIDSR  559

Query  613  GAWFIQLTIIQTKHLKKYDEVTKTLIDSLQDTSLRNIHRMELNKRAEKIKHNKTYKISQI  672
            G W+ ++ +    HLK+  E  K +  +LQD S+     + +  RA K+K          
Sbjct  560  GIWWDRMLLNLDSHLKEKKECAKMIQIALQDPSILEKELLMIQDRALKLKEMPA------  613

Query  673  DFGTISSVQPLPIKNLPYREIDAQAF-RSENSGQKRNYYIR---IDNGFELYSVEEVALN  728
            DF     V P+ I N   + I A    +S   G+   + IR    D+  E  SVEEV   
Sbjct  614  DF-----VTPINIGNPEKKTITANVITKSLGDGRINRFMIRDHETDDDVEC-SVEEVTRR  667

Query  729  YYEQNFGLN-GIHCENSLLITSFFLLFWDIIY--DHTIPSVFVSEIQHYPLDLYSTEFYT  785
            +Y +N G + G+H E S   T F L F+D+I+  D ++ S ++SE+Q  P DL +T  Y+
Sbjct  668  HYLENEGFSTGVHDEGSTWHTLFGLFFYDVIFATDESVESTWLSELQDCPSDLSNT-LYS  726

Query  786  SRRRKIGKRLSEVESEWTDKMMHQLICDVW-------NRNSQKKSFIHSSLVEDPERLFD  838
             R+ K   R   +E    + +    I  +W       NR    K F   +     E    
Sbjct  727  KRKEKFEDRFVWLEEAEQELIEEN-IRKIWDLKHNETNRECSWKQFPMGA-----EDCVS  780

Query  839  MLMCIGRPKLRKIFEHFLEDFGSYRSGLPDLFLWNLDEKRCKFVEVKGENDQLSAKQECW  898
               CI RP L  I     E++ + RSG PDL LWN + KR   VEVKG  D+LS KQ  W
Sbjct  781  FFQCIPRPALILILRRLAENYRNSRSGFPDLTLWNPETKRVAVVEVKGPGDRLSTKQRLW  840

Query  899  LDFLRSIGADVEVCYVHTTGSR  920
            L      G   EVC+V    SR
Sbjct  841  LAIFADSGIRAEVCHVAAQNSR  862


>Q38AL0_TRYB2 unnamed protein product
Length=982

 Score = 40.0 bits (92),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 59/128 (46%), Gaps = 17/128 (13%)

Query  818  NSQKK-----SFIHSSLVEDPER--LFDMLMCIGRPKL----RKIFEHFLED-FGSYRSG  865
            NSQ+K     SFI +  + DPE   LFD+L  + +  L    R ++    ED +  +   
Sbjct  833  NSQEKDGPTASFIPAEQLLDPEEFPLFDLLQAVPQGALCALLRCLYLPPPEDGYSVHFDS  892

Query  866  LPDLFLW-----NLDEKRCKFVEVKGENDQLSAKQECWLDFLRSIGADVEVCYVHTTGSR  920
             PDL LW       D    K VEV G N+ LS KQ   +D L     DV V +V      
Sbjct  893  FPDLVLWREVPSQPDGYEFKLVEVLGPNESLSEKQISTIDTLLRCKFDVTVAHVTDVDEG  952

Query  921  RRKLSSNK  928
            ++K + +K
Sbjct  953  KKKSNRSK  960


>PP4R3_DROME unnamed protein product
Length=980

 Score = 33.9 bits (76),  Expect = 0.86, Method: Compositional matrix adjust.
 Identities = 39/145 (27%), Positives = 63/145 (43%), Gaps = 33/145 (23%)

Query  283  NEETDNPISLNIILEIINFVVNHER-------LQKLLVYKDTVML---HNFLQLNSKYIF  332
            NE+      L I+L+I++F V H         LQK L+ +  V++   H FL L +    
Sbjct  486  NEDYQTAQLLGIVLDILSFCVEHHSYHIKNFLLQKDLLKRILVLMKSTHTFLVLGA----  541

Query  333  FCLKLYTRIKKWYNIFDLRTAIKSELSDPEVMAM------YDCLKGSLFVDTDYSTEPIH  386
              L+L  +I    + F  R  +K  L  P V A       Y+ L+ ++            
Sbjct  542  --LRLLRKIIALKDEFYNRHIVKCNLFAPVVDAFIRNNGRYNLLESAIL-----------  588

Query  387  DLLHHLHVKILRELCVEFKIPFSKV  411
            +L   + ++ +R LCV F   FSK+
Sbjct  589  ELFEFIKLEDIRTLCVYFVENFSKI  613



Lambda      K        H
   0.320    0.136    0.429 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5770007388


Query= XP_031327305.1 trypsin beta-like [Photinus pyralis]

Length=250
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TRYDT_DROME  unnamed protein product                                  209     2e-67
Q9W2C8_DROME  unnamed protein product                                 156     2e-45
Q9VQ97_DROME  unnamed protein product                                 151     6e-45


>TRYDT_DROME unnamed protein product
Length=253

 Score = 209 bits (532),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 117/253 (46%), Positives = 156/253 (62%), Gaps = 5/253 (2%)

Query  1    MFRLVLLLTAVTLATGAKLQNATPPRLDGKIVGGKPVKIEDYPYQVSLQYYGSHICGGSI  60
            M + V+LL+AV  A G  +     P+LDG+IVGG    I  +P+Q+SLQ  GSH CGGSI
Sbjct  1    MLKFVILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSI  60

Query  61   IGPNKVLTAAHCTSGSSASSLSIRHSSTYKGSEGVVIKVARIAQNPAYNPSTISDDVTVL  120
               N ++TAAHC    SAS L IR  S+Y  S GV   V+    +  YN +T+ +D+ ++
Sbjct  61   YSSNVIVTAAHCLQSVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAII  120

Query  121  TLAEPIKDSDIGKPIAMVEANATEGDREAVCTGWGSLSSGGSS-PRQLQAVDVKEVDRKE  179
             +   +  S   K I +  +N   G   +V +GWG+LS G SS P QLQ V+V  V + +
Sbjct  121  KINGALTFSSTIKAIGLASSNPANGAAASV-SGWGTLSYGSSSIPSQLQYVNVNIVSQSQ  179

Query  180  CNTS---YGGGITDTMICFGSPGKDSCQGDSGGPLVVGEKQVGIVSWGYGCAHPEYPGVY  236
            C +S   YG  I  TMIC  + GKD+CQGDSGGPLV G   VG+VSWGYGCA+  YPGVY
Sbjct  180  CASSTYGYGSQIRSTMICAAASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVY  239

Query  237  AHVASLRTFIDKN  249
            A VA+LR+++  N
Sbjct  240  ADVAALRSWVISN  252


>Q9W2C8_DROME unnamed protein product
Length=372

 Score = 156 bits (394),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 88/236 (37%), Positives = 126/236 (53%), Gaps = 13/236 (6%)

Query  27   LDGKIVGGKPVKIEDYPYQVSLQYYGSHICGGSIIGPNKVLTAAHCTSGSSASSLSIR--  84
            +  +IVGG+  ++  YP+   L Y G   C  S++    +LTA+HC  G     +S+R  
Sbjct  123  IQKRIVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTASHCVYGFRKERISVRLL  182

Query  85   -HSSTYKGSEGVVIKVARIAQNPAYNPSTISDDVTVLTLAEPIKDSDIGKPIAMVEANAT  143
             H       + +  KVA +  +P YN     +D+ ++ L EP++ +++  P+ M     +
Sbjct  183  EHDRKMSHMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCMPTPGRS  242

Query  144  EGDREAVCTGWGSLSSGGSSPRQLQAVDVKEVDRKECNTS-YGGGITDTMIC--FGSPGK  200
                  + TGWG+L  GG +   LQ V V  + + EC  S YG  ITD M+C  +   GK
Sbjct  243  FKGENGIVTGWGALKVGGPTSDTLQEVQVPILSQDECRKSRYGNKITDNMLCGGYDEGGK  302

Query  201  DSCQGDSGGPLVV-----GEKQV-GIVSWGYGCAHPEYPGVYAHVASLRTFIDKNL  250
            DSCQGDSGGPL +      E Q+ G+VSWG GCA   YPGVYA V    T+I KNL
Sbjct  303  DSCQGDSGGPLHIVASGTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTWI-KNL  357


>Q9VQ97_DROME unnamed protein product
Length=245

 Score = 151 bits (381),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 95/247 (38%), Positives = 136/247 (55%), Gaps = 11/247 (4%)

Query  1    MFRLVLLLTAVTLATGAKLQNATPPRLDGKIVGGKPVKIEDYPYQVSLQYYGSHICGGSI  60
            +   ++L+ +VTL +      ++P R    IVGG PV I + P+Q +L Y   +ICG  I
Sbjct  2    LLHWLVLVASVTLISA----GSSPER----IVGGHPVLISEVPWQAALMYSEKYICGAVI  53

Query  61   IGPNKVLTAAHCTSGSSASSLSIRHSSTYKGSEGVVIKVARIAQNPAYNPSTI-SDDVTV  119
                 ++TAAHC      +  S+R  S +K   G   +VA I ++  Y  STI  +D+ V
Sbjct  54   YSDKIIITAAHCVERPFDTLYSVRVGSVWKNLGGQHARVAVIRKHEDYVSSTILFNDIAV  113

Query  120  LTLAEPIKDSDIGKPIAMVEANATEGDREAVCTGWGSLSSGGSSPRQLQAVDVKEVDRKE  179
            + L + +  +   +PI + ++    G  EA  +GWG +      P  L    VK +D   
Sbjct  114  IRLVDTLIFNAEVRPIQLADSAPAAGT-EASVSGWGEIGILWLQPTSLLKTSVKILDPNV  172

Query  180  CNTSYGGGITDTMICFGSPGKDSCQGDSGGPLVVGEKQVGIVSWGYGCAHPEYPGVYAHV  239
            C  SY   IT TMIC  +  KDSC GDSGGPLV G + VGIVS+G GCA+P +PGVYA+V
Sbjct  173  CKRSYQY-ITKTMICAAALLKDSCHGDSGGPLVSGGQLVGIVSYGIGCANPFFPGVYANV  231

Query  240  ASLRTFI  246
            A L+ +I
Sbjct  232  AELKPWI  238



Lambda      K        H
   0.320    0.136    0.429 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5770007388


Query= XP_031327306.1 protein arginine N-methyltransferase 1 [Photinus
pyralis]

Length=378
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VGW7_DROME  unnamed protein product                                 570     0.0   
ANM1_CAEEL  unnamed protein product                                   469     2e-166
Q4GYA9_TRYB2  unnamed protein product                                 307     7e-103


>Q9VGW7_DROME unnamed protein product
Length=376

 Score = 570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/344 (74%), Positives = 305/344 (89%), Gaps = 1/344 (0%)

Query  35   PAAPKTGANDEDLTVDEMTSRDYYFDSYAHFGIHEEMLKDEVRTVTYRNSMYHNKHLFVG  94
            PA   TG N  +   DEMTSRDYYFDSYAHFGIHEEMLKDEVRTVTYRN+MYHNKHLF G
Sbjct  34   PAEGSTGDN-PNANADEMTSRDYYFDSYAHFGIHEEMLKDEVRTVTYRNAMYHNKHLFQG  92

Query  95   KTVMDIGCGTGILSMFAAKAGAKKVLAIECSNIVDYAKQIVEANKLDHIITVIKGKVEEV  154
            KTV+D+GCGTGILSMFAAKAGA +V+A++CSNI+++A+Q+V  N L  +ITV+KGK+EE+
Sbjct  93   KTVLDVGCGTGILSMFAAKAGAAQVIAVDCSNIIEFARQVVIDNNLQDVITVVKGKIEEI  152

Query  155  TLPDGIEQVDIIISEWMGYCLFYESMLSTVLYARDKWLKPEGLLFPDRCSLFVTAIEDRQ  214
             LP+GIE VDIIISEWMGYCLFYESML TVLYARDKWLK +G++FPDR +L++TAIEDRQ
Sbjct  153  ELPNGIEGVDIIISEWMGYCLFYESMLDTVLYARDKWLKKDGMMFPDRGTLYITAIEDRQ  212

Query  215  YKDEKINWWDDVYGFDMSLIRKVAISEPLVDIVDPKHVVTNACLIKEVDLYTVQKADLEF  274
            YKDEKINWWDDVYGFDMS IRKVA++EPLVD+VDPK VV+ +C++KEVDLYTVQKADL F
Sbjct  213  YKDEKINWWDDVYGFDMSCIRKVAVTEPLVDVVDPKQVVSTSCMVKEVDLYTVQKADLNF  272

Query  275  TSPFNLQVRRNDYVQAIVTFFNVEFTKCHKRIGFSTAPEAPYTHWKQTVFYFQDYMTVKK  334
            +S F+L ++RND+VQA+VT+FN+EFTKCHKR+GFST+P++ YTHWKQTVFY  D+MT KK
Sbjct  273  SSKFSLCIKRNDFVQALVTYFNIEFTKCHKRLGFSTSPDSTYTHWKQTVFYLDDHMTAKK  332

Query  335  NEEIYGTFSMKPNLRNTRDLDFIVELNFKGELGQVGEVNHYRMR  378
            NEEI GTF MKPN RN RDLDF++++NFKGEL Q+ E N YRMR
Sbjct  333  NEEITGTFQMKPNERNNRDLDFVIDINFKGELSQIQESNTYRMR  376


>ANM1_CAEEL unnamed protein product
Length=348

 Score = 469 bits (1207),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 221/329 (67%), Positives = 261/329 (79%), Gaps = 1/329 (0%)

Query  51   EMTSRDYYFDSYAHFGIHEEMLKDEVRTVTYRNSMYHNKHLFVGKTVMDIGCGTGILSMF  110
            E+TS+DYYFDSYAHFGIHEEMLKDEVRT TYRNS+YHN HLF  K VMD+G GTGILSMF
Sbjct  20   ELTSKDYYFDSYAHFGIHEEMLKDEVRTTTYRNSIYHNSHLFKDKVVMDVGSGTGILSMF  79

Query  111  AAKAGAKKVLAIECSNIVDYAKQIVEANKLDHIITVIKGKVEEV-TLPDGIEQVDIIISE  169
            AAKAGAKKV A+E SN+   +++I+  N LDHI+ VI+ KVE+V  LP GIE+VDIIISE
Sbjct  80   AAKAGAKKVFAMEFSNMALTSRKIIADNNLDHIVEVIQAKVEDVHELPGGIEKVDIIISE  139

Query  170  WMGYCLFYESMLSTVLYARDKWLKPEGLLFPDRCSLFVTAIEDRQYKDEKINWWDDVYGF  229
            WMGYCLFYESML+TVL ARD+WL P G+LFPD+  L+V AIEDRQYK++KI+WWD VYGF
Sbjct  140  WMGYCLFYESMLNTVLVARDRWLAPNGMLFPDKARLYVCAIEDRQYKEDKIHWWDSVYGF  199

Query  230  DMSLIRKVAISEPLVDIVDPKHVVTNACLIKEVDLYTVQKADLEFTSPFNLQVRRNDYVQ  289
            +MS I+ VAI EPLVDIVD   V TN CL+K+VDLYTV+  DL F S F L+  R+DY+Q
Sbjct  200  NMSAIKNVAIKEPLVDIVDNAQVNTNNCLLKDVDLYTVKIEDLTFKSDFKLRCTRSDYIQ  259

Query  290  AIVTFFNVEFTKCHKRIGFSTAPEAPYTHWKQTVFYFQDYMTVKKNEEIYGTFSMKPNLR  349
            A VTFF VEF+KCHK+ GFST P+  YTHWKQTVFY +D +TVKK EEI G+F M PN  
Sbjct  260  AFVTFFTVEFSKCHKKTGFSTGPDVQYTHWKQTVFYLKDALTVKKGEEITGSFEMAPNKN  319

Query  350  NTRDLDFIVELNFKGELGQVGEVNHYRMR  378
            N RDLD  +  +FKGE+  + E N Y M 
Sbjct  320  NERDLDINISFDFKGEVCDLNEQNTYTMH  348


>Q4GYA9_TRYB2 unnamed protein product
Length=345

 Score = 307 bits (787),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 158/332 (48%), Positives = 217/332 (65%), Gaps = 21/332 (6%)

Query  56   DYYFDSYAHFGIHEEMLKDEVRTVTYRNSMYHNKHLFVGKTVMDIGCGTGILSMFAAKAG  115
            DYYFDSY+H+GIH EMLKD  RT +YR++M+ N +LF  K V+D+GCGTGILSMFAAKAG
Sbjct  16   DYYFDSYSHYGIHMEMLKDCHRTTSYRDAMWRNAYLFKDKVVLDVGCGTGILSMFAAKAG  75

Query  116  AKKVLAIECSNIVDYAKQIVEANKLDHIITVIKGKVEEVTLPDGIEQVDIIISEWMGYCL  175
            A+KV+ ++CS +   A++IV  N  + +IT+I+GKVEE+ L    E+VDIIISEWMGY L
Sbjct  76   ARKVIGVDCSTVAVQAREIVRDNGFEDVITIIQGKVEEIQLD---EKVDIIISEWMGYFL  132

Query  176  FYESMLSTVLYARDKWLKPEGLLFPDRCSLFVTAIEDRQYKDEKINWWDDVYGFDMSLIR  235
             YESML+TVLYARD    P+  +FPD+ ++ V  I D QY  E+ N WD+V G D S  +
Sbjct  133  LYESMLNTVLYARDNLGTPDVKMFPDKANMHVCGITDEQYIQERFNIWDNVQGIDFSYFK  192

Query  236  KVAISEPLVDIVDPKHVVTNACLIKEVDLYTVQKADLEFTSPFNLQV-----RRND----  286
            +++  EPLVD V+   +VTN   +   D+ TV++ADL FTS F L+      +RN     
Sbjct  193  RLSFIEPLVDTVERSQIVTNVAPLVSFDINTVKEADLSFTSEFALEAQASRGKRNGGNSI  252

Query  287  -YVQAIVTFFNVEFTKCHKRIGFSTAPEAPYTHWKQTVFYFQDYMTVKKNEEIYGTFSMK  345
             YV A+   F+  FT  H+ +   T P +P THW+QTV Y  + + ++  E    TF MK
Sbjct  253  IYVHALSVHFDTPFTAGHEVVILDTTPYSPPTHWRQTVLYLFNPLRMRAGER--ATFRMK  310

Query  346  --PNLRNTRDLDFIVELNFKGELGQVGEVNHY  375
              PN  N RDLD  + ++F+G L    +++HY
Sbjct  311  CSPNALNGRDLDISLHVDFEGAL----QISHY  338



Lambda      K        H
   0.320    0.136    0.429 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5770007388


Query= XP_031327307.1 inositol hexakisphosphate and
diphosphoinositol-pentakisphosphate kinase isoform X1 [Photinus
pyralis]

Length=1292
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

VIP1_CAEEL  unnamed protein product                                   993     0.0  
Q9VU45_DROME  unnamed protein product                                 32.3    2.4  


>VIP1_CAEEL unnamed protein product
Length=1323

 Score = 993 bits (2566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 503/939 (54%), Positives = 650/939 (69%), Gaps = 81/939 (9%)

Query  49   QVVVGVCAMAKKSQSKPMKEILTRLQEF--EYLKVVVFPENEILEKPVEEWHACDCLISF  106
            ++ +G+CAM +K+ SKPM+ I+ ++ +F  +++   +FPE  I+ +PVE W  C CL+SF
Sbjct  16   KITIGICAMNRKATSKPMRAIMKKIIDFYGQWVDSFIFPEQVIINEPVENWPLCHCLVSF  75

Query  107  HSKGFPLDKAIQYAQLHNPYVINNLHMQYDIQDRRRVYAILESEGIEIPRYAVLDRDNPD  166
            HS  FPL+KAI Y +L NPYVINNL  QYD+ DRR V+ IL   GIE PR+  + R  P+
Sbjct  76   HSTEFPLEKAIAYVKLRNPYVINNLDRQYDLLDRRTVFKILSDNGIEHPRHGYVIRGRPN  135

Query  167  PKGHELVESEDHVEVNGIVFNKPFVEKPVSAEDHNIYIYYPTSAGGGSQRLFRKSDRCGY  226
                ELVE  DH+EVNG VFNKPFVEKP+S+EDHN+YIYYP+S GGGSQRLFRK      
Sbjct  136  EPDTELVEHPDHIEVNGEVFNKPFVEKPISSEDHNVYIYYPSSVGGGSQRLFRK------  189

Query  227  IKHTNLLFSSGKPIKIGSRSSVYSPESRVRKTGSFIYEDFMPTDGTDVKVYTVGPDYAHA  286
                           I +RSS YSP+S VRK GS+IYE+F+P DGTDVKVY VGP YAHA
Sbjct  190  ---------------INNRSSWYSPKSEVRKEGSYIYEEFIPADGTDVKVYAVGPFYAHA  234

Query  287  EARKSPALDGKVERDREGKEIRYPVILSNVEKMISRKVCLAFKQAVCGFDLLRANGKSFV  346
            EARK+P LDGKVERD +GKE+RYPVILSN EK I++K+ LAF Q VCGFDLLRANGKS+V
Sbjct  235  EARKAPGLDGKVERDSDGKEVRYPVILSNKEKQIAKKIVLAFGQTVCGFDLLRANGKSYV  294

Query  347  CDVNGFSFVKNSNKYYDDCAKILGNMILRELAPTLHIPWSVPFQL-----------DDPP  395
            CDVNGFSFVK S KYY+D AKILGN I+R  A + +  W VP  +           DDPP
Sbjct  295  CDVNGFSFVKTSTKYYEDTAKILGNQIVRHYAKSKN--WRVPSDMPQPPILDLGLGDDPP  352

Query  396  IVPTTFGKMMELRCVVAVIRHGDRTPKQKMKVEVRHPKFFEIFEKYEGYKNGYVKLKRPK  455
            ++ T  GK+ ELRCVVAVIRHGDRTPKQKMK+ V   +FF +FEKY+GYK   +K+K+P 
Sbjct  353  MITTPSGKLAELRCVVAVIRHGDRTPKQKMKLIVTDQRFFALFEKYDGYKKHEIKMKKPN  412

Query  456  QLQEILDTARSLL--------------------AEIQHHEADPET-EEKQGKLEQLKSVL  494
            QL E+L+ AR+L+                     EI   E D E  EE+  K EQ+++VL
Sbjct  413  QLMEVLELARALVIEKQRDRHQILEKLREGTGEEEIHKSEHDLEVCEEEMKKWEQMRTVL  472

Query  495  EMYGHFSGINRKVQMKYQPKGRPRGSSSDDGKTQLNPPAEPSLVLILKWGGELTPAGRIQ  554
            EMYGHFSGINRKVQMKY    + R + + D + +   PA   L+LILKWGGELT AG +Q
Sbjct  473  EMYGHFSGINRKVQMKYL---KERETKTSDEELRREGPA---LLLILKWGGELTTAGNMQ  526

Query  555  AEELGRIFRCMYPGGQGRHLAGEYAGAQGLGLLRLHSTFRHDLKIYASDEGRVQMTAAAF  614
            AE LGR+FR +YPG +           QGLG LRLHST+RHDLKIYASDEGRVQ TAAAF
Sbjct  527  AEALGRLFRTLYPGIRRTDGKSSPEDTQGLGFLRLHSTYRHDLKIYASDEGRVQTTAAAF  586

Query  615  AKGLLALEGELTPILVQMVKSANTNGLLDNDCDSSKYQNMCKSRLHELMQLNRDFSAEDI  674
            AKGLLALEGELTPIL+QMVKSANT+GLLD+DC +  YQ   K  LH+ +Q +RDF+ +D 
Sbjct  587  AKGLLALEGELTPILMQMVKSANTDGLLDDDCQARLYQTELKRYLHKALQADRDFTPQDY  646

Query  675  EKINPCNSSSISDALDFVKNPFRCCQHVHELIKSLLNIVRLKKEDSKAKDVVLYHGETWE  734
             ++NP    +I+ A++F+KNP + C  +   ++ +  ++ ++   ++     LY  E+ +
Sbjct  647  LELNPNGLRAITAAMEFIKNPRKMCHEIAGYVEKMCGVI-VEYSQTRPTGSTLYLQESMD  705

Query  735  LMGRRWGKIEKDFCTKNK----RFDISKIPDIYDCIKYDLQHN-----QHTLQFEQAEEL  785
            L  RRW K  ++F  KNK     FDISKIPDIYD IKYD++HN      + ++FE+   +
Sbjct  706  LAQRRWNKELREFRRKNKHGEVEFDISKIPDIYDNIKYDMEHNPDLCINNEVEFER---M  762

Query  786  YVYSKYLADIVIPQEYGLTAQEKLSIGQGICTPLLKKIRADLQRNIEELD-DETVNRLNP  844
            YV  K +ADIV+PQEYG+  + K+ I Q +CTPLL+KIR DL R +E  + +ET  RL+P
Sbjct  763  YVCVKNMADIVVPQEYGIKTENKMVIAQRVCTPLLRKIRNDLHRCLENKESEETQTRLDP  822

Query  845  IYSHGVSSPGRHVRTRLYFTSESHVHSLITCLRYGGLFNVVTDEQWRRAMEYVSMVSELN  904
              S G+++P RHVRTRLYFTSESH+H+L+  +RYG L + V D++W+RAM ++S V+E N
Sbjct  823  RASQGIATPFRHVRTRLYFTSESHIHTLMNLIRYGNLCS-VDDKKWQRAMNFLSGVTEFN  881

Query  905  YMSQVVIMLYEDPTK---DPSSDERFHVELHFSPGVNCC  940
            YM+QVV+M+YED  K   +  +  RFH+E+ FSPG+  C
Sbjct  882  YMTQVVLMVYEDSRKENDEADTGPRFHIEILFSPGLYPC  920


 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/156 (29%), Positives = 75/156 (48%), Gaps = 10/156 (6%)

Query  1078  EARSRSYDQYAMTARMQEVSSGSSCSKRHRHSIAGQMTYYKMLGTGYGPLTFKKVAGEN-  1136
             ++RSR Y  Y       ++ +G S    H   +  ++    +L   +G    KK + ++ 
Sbjct  1156  QSRSRRYFPYRFKHHTAQLLTGMSGGGVH---MQNRLISTDVLTGKFGDHDNKKNSRKDF  1212

Query  1137  --TNSLFSTAVISGSSSAPNLRDMIPSTASVSALEGIGGVPAIRPLETLHNALSLRQLDV  1194
                 ++ STAVI+ SSSAP L        SV  ++     P +R LETLH++++L Q D 
Sbjct  1213  GAGTAVLSTAVIARSSSAPRLMTYESEDFSVGEIKRFW--PPLRSLETLHDSINLSQFDG  1270

Query  1195  FLESMTLAPILKTPSSTPPKVPCTPSTTPTNTSRAP  1230
             FLE +    +  TP  +PPK P   + +    ++ P
Sbjct  1271  FLERLIKGAL--TPLPSPPKTPLPSALSCDAINKTP  1304


>Q9VU45_DROME unnamed protein product
Length=284

 Score = 32.3 bits (72),  Expect = 2.4, Method: Composition-based stats.
 Identities = 23/84 (27%), Positives = 45/84 (54%), Gaps = 8/84 (10%)

Query  406  ELRCVVAVIRHGDRTPKQKMKVEVRHPKFFEIFEKYEGYKNGYVKLKRPKQLQEILDTAR  465
            +L+ + AV+RHGDR  +QK+++E    +F  + EKY       ++ +    +++ L  A+
Sbjct  105  DLQRLQAVVRHGDR--QQKLQLEKLTREFHGVVEKYSN-----LQRRISSAMRQTLQQAQ  157

Query  466  SLLAEIQHHEADPETEEKQGKLEQ  489
                ++    A  E  ++Q +LEQ
Sbjct  158  QFADQVVETNARAELLQQQ-RLEQ  180



Lambda      K        H
   0.320    0.136    0.429 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5770007388


Query= XP_031327308.1 inositol hexakisphosphate and
diphosphoinositol-pentakisphosphate kinase isoform X2 [Photinus
pyralis]

Length=1275
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

VIP1_CAEEL  unnamed protein product                                   991     0.0  
Q9VU45_DROME  unnamed protein product                                 32.3    2.1  
M9PI58_DROME  unnamed protein product                                 31.2    8.0  


>VIP1_CAEEL unnamed protein product
Length=1323

 Score = 991 bits (2563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 503/939 (54%), Positives = 650/939 (69%), Gaps = 81/939 (9%)

Query  49   QVVVGVCAMAKKSQSKPMKEILTRLQEF--EYLKVVVFPENEILEKPVEEWHACDCLISF  106
            ++ +G+CAM +K+ SKPM+ I+ ++ +F  +++   +FPE  I+ +PVE W  C CL+SF
Sbjct  16   KITIGICAMNRKATSKPMRAIMKKIIDFYGQWVDSFIFPEQVIINEPVENWPLCHCLVSF  75

Query  107  HSKGFPLDKAIQYAQLHNPYVINNLHMQYDIQDRRRVYAILESEGIEIPRYAVLDRDNPD  166
            HS  FPL+KAI Y +L NPYVINNL  QYD+ DRR V+ IL   GIE PR+  + R  P+
Sbjct  76   HSTEFPLEKAIAYVKLRNPYVINNLDRQYDLLDRRTVFKILSDNGIEHPRHGYVIRGRPN  135

Query  167  PKGHELVESEDHVEVNGIVFNKPFVEKPVSAEDHNIYIYYPTSAGGGSQRLFRKSDRCGY  226
                ELVE  DH+EVNG VFNKPFVEKP+S+EDHN+YIYYP+S GGGSQRLFRK      
Sbjct  136  EPDTELVEHPDHIEVNGEVFNKPFVEKPISSEDHNVYIYYPSSVGGGSQRLFRK------  189

Query  227  IKHTNLLFSSGKPIKIGSRSSVYSPESRVRKTGSFIYEDFMPTDGTDVKVYTVGPDYAHA  286
                           I +RSS YSP+S VRK GS+IYE+F+P DGTDVKVY VGP YAHA
Sbjct  190  ---------------INNRSSWYSPKSEVRKEGSYIYEEFIPADGTDVKVYAVGPFYAHA  234

Query  287  EARKSPALDGKVERDREGKEIRYPVILSNVEKMISRKVCLAFKQAVCGFDLLRANGKSFV  346
            EARK+P LDGKVERD +GKE+RYPVILSN EK I++K+ LAF Q VCGFDLLRANGKS+V
Sbjct  235  EARKAPGLDGKVERDSDGKEVRYPVILSNKEKQIAKKIVLAFGQTVCGFDLLRANGKSYV  294

Query  347  CDVNGFSFVKNSNKYYDDCAKILGNMILRELAPTLHIPWSVPFQL-----------DDPP  395
            CDVNGFSFVK S KYY+D AKILGN I+R  A + +  W VP  +           DDPP
Sbjct  295  CDVNGFSFVKTSTKYYEDTAKILGNQIVRHYAKSKN--WRVPSDMPQPPILDLGLGDDPP  352

Query  396  IVPTTFGKMMELRCVVAVIRHGDRTPKQKMKVEVRHPKFFEIFEKYEGYKNGYVKLKRPK  455
            ++ T  GK+ ELRCVVAVIRHGDRTPKQKMK+ V   +FF +FEKY+GYK   +K+K+P 
Sbjct  353  MITTPSGKLAELRCVVAVIRHGDRTPKQKMKLIVTDQRFFALFEKYDGYKKHEIKMKKPN  412

Query  456  QLQEILDTARSLL--------------------AEIQHHEADPET-EEKQGKLEQLKSVL  494
            QL E+L+ AR+L+                     EI   E D E  EE+  K EQ+++VL
Sbjct  413  QLMEVLELARALVIEKQRDRHQILEKLREGTGEEEIHKSEHDLEVCEEEMKKWEQMRTVL  472

Query  495  EMYGHFSGINRKVQMKYQPKGRPRGSSSDDGKTQLNPPAEPSLVLILKWGGELTPAGRIQ  554
            EMYGHFSGINRKVQMKY    + R + + D + +   PA   L+LILKWGGELT AG +Q
Sbjct  473  EMYGHFSGINRKVQMKYL---KERETKTSDEELRREGPA---LLLILKWGGELTTAGNMQ  526

Query  555  AEELGRIFRCMYPGGQGRHLAGEYAGAQGLGLLRLHSTFRHDLKIYASDEGRVQMTAAAF  614
            AE LGR+FR +YPG +           QGLG LRLHST+RHDLKIYASDEGRVQ TAAAF
Sbjct  527  AEALGRLFRTLYPGIRRTDGKSSPEDTQGLGFLRLHSTYRHDLKIYASDEGRVQTTAAAF  586

Query  615  AKGLLALEGELTPILVQMVKSANTNGLLDNDCDSSKYQNMCKSRLHELMQLNRDFSAEDI  674
            AKGLLALEGELTPIL+QMVKSANT+GLLD+DC +  YQ   K  LH+ +Q +RDF+ +D 
Sbjct  587  AKGLLALEGELTPILMQMVKSANTDGLLDDDCQARLYQTELKRYLHKALQADRDFTPQDY  646

Query  675  EKINPCNSSSISDALDFVKNPFRCCQHVHELIKSLLNIVRLKKEDSKAKDVVLYHGETWE  734
             ++NP    +I+ A++F+KNP + C  +   ++ +  ++ ++   ++     LY  E+ +
Sbjct  647  LELNPNGLRAITAAMEFIKNPRKMCHEIAGYVEKMCGVI-VEYSQTRPTGSTLYLQESMD  705

Query  735  LMGRRWGKIEKDFCTKNK----RFDISKIPDIYDCIKYDLQHN-----QHTLQFEQAEEL  785
            L  RRW K  ++F  KNK     FDISKIPDIYD IKYD++HN      + ++FE+   +
Sbjct  706  LAQRRWNKELREFRRKNKHGEVEFDISKIPDIYDNIKYDMEHNPDLCINNEVEFER---M  762

Query  786  YVYSKYLADIVIPQEYGLTAQEKLSIGQGICTPLLKKIRADLQRNIEELD-DETVNRLNP  844
            YV  K +ADIV+PQEYG+  + K+ I Q +CTPLL+KIR DL R +E  + +ET  RL+P
Sbjct  763  YVCVKNMADIVVPQEYGIKTENKMVIAQRVCTPLLRKIRNDLHRCLENKESEETQTRLDP  822

Query  845  IYSHGVSSPGRHVRTRLYFTSESHVHSLITCLRYGGLFNVVTDEQWRRAMEYVSMVSELN  904
              S G+++P RHVRTRLYFTSESH+H+L+  +RYG L + V D++W+RAM ++S V+E N
Sbjct  823  RASQGIATPFRHVRTRLYFTSESHIHTLMNLIRYGNLCS-VDDKKWQRAMNFLSGVTEFN  881

Query  905  YMSQVVIMLYEDPTK---DPSSDERFHVELHFSPGVNCC  940
            YM+QVV+M+YED  K   +  +  RFH+E+ FSPG+  C
Sbjct  882  YMTQVVLMVYEDSRKENDEADTGPRFHIEILFSPGLYPC  920


 Score = 54.3 bits (129),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 63/124 (51%), Gaps = 7/124 (6%)

Query  1093  MQGQMTYYKMLGTGYGPLTFKKVAGEN---TNSLFSTAVISGSSSAPNLRDMIPSTASVS  1149
             MQ ++    +L   +G    KK + ++     ++ STAVI+ SSSAP L        SV 
Sbjct  1185  MQNRLISTDVLTGKFGDHDNKKNSRKDFGAGTAVLSTAVIARSSSAPRLMTYESEDFSVG  1244

Query  1150  ALEGIGGVPAIRPLETLHNALSLRQLDVFLESMTLAPILKTPSSTPPKVPCTPSTTPTNT  1209
              ++     P +R LETLH++++L Q D FLE +    +  TP  +PPK P   + +    
Sbjct  1245  EIKRFW--PPLRSLETLHDSINLSQFDGFLERLIKGAL--TPLPSPPKTPLPSALSCDAI  1300

Query  1210  SRAP  1213
             ++ P
Sbjct  1301  NKTP  1304


>Q9VU45_DROME unnamed protein product
Length=284

 Score = 32.3 bits (72),  Expect = 2.1, Method: Composition-based stats.
 Identities = 23/84 (27%), Positives = 45/84 (54%), Gaps = 8/84 (10%)

Query  406  ELRCVVAVIRHGDRTPKQKMKVEVRHPKFFEIFEKYEGYKNGYVKLKRPKQLQEILDTAR  465
            +L+ + AV+RHGDR  +QK+++E    +F  + EKY       ++ +    +++ L  A+
Sbjct  105  DLQRLQAVVRHGDR--QQKLQLEKLTREFHGVVEKYSN-----LQRRISSAMRQTLQQAQ  157

Query  466  SLLAEIQHHEADPETEEKQGKLEQ  489
                ++    A  E  ++Q +LEQ
Sbjct  158  QFADQVVETNARAELLQQQ-RLEQ  180


>M9PI58_DROME unnamed protein product
Length=999

 Score = 31.2 bits (69),  Expect = 8.0, Method: Compositional matrix adjust.
 Identities = 19/60 (32%), Positives = 29/60 (48%), Gaps = 1/60 (2%)

Query  1092  RMQGQMTYYKMLGTGYGPLTFKKVAGENTNSLFSTAVISGSSSAPNLRDMIPSTASVSAL  1151
             R QG +      G G GP T K  A EN  ++     + GSS+ PN ++    +A+ S +
Sbjct  763   RPQGSL-INSFFGQGNGPTTAKGAASENIRAMSRRYSVCGSSNPPNAQNASQGSANGSTI  821



Lambda      K        H
   0.320    0.136    0.429 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5770007388


Query= XP_031327309.1 uncharacterized protein LOC116158632 [Photinus
pyralis]

Length=621
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9W1H0_DROME  unnamed protein product                                 32.3    1.3  
A0A0B4LGG6_DROME  unnamed protein product                             32.3    1.4  
RIM2_DROME  unnamed protein product                                   31.6    1.9  


>Q9W1H0_DROME unnamed protein product
Length=1482

 Score = 32.3 bits (72),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 23/54 (43%), Gaps = 11/54 (20%)

Query  575  CLYCLKPYSNDKRGEEWIQCQSCKSWCHSDCR--------DEEDSFFFYCINCR  620
            C  C   YSN   GE  IQC+ C+ W H  C         D  D+  + C  CR
Sbjct  658  CPVCKVSYSN---GEMIIQCEHCELWAHFHCDSVNAQLTIDHYDNNVYKCFKCR  708


>A0A0B4LGG6_DROME unnamed protein product
Length=1478

 Score = 32.3 bits (72),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 23/54 (43%), Gaps = 11/54 (20%)

Query  575  CLYCLKPYSNDKRGEEWIQCQSCKSWCHSDCR--------DEEDSFFFYCINCR  620
            C  C   YSN   GE  IQC+ C+ W H  C         D  D+  + C  CR
Sbjct  658  CPVCKVSYSN---GEMIIQCEHCELWAHFHCDSVNAQLTIDHYDNNVYKCFKCR  708


>RIM2_DROME unnamed protein product
Length=365

 Score = 31.6 bits (70),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 21/43 (49%), Gaps = 0/43 (0%)

Query  129  YFGLTPTDVRSLVYEFAIRKSVTVPEQWHVTKMGSRDWFSNFM  171
            YFG+  T V  ++YEF   K +    Q H    GSRD+    M
Sbjct  231  YFGICETMVHFVIYEFIKSKLLEQRNQRHTDTKGSRDFLEFMM  273



Lambda      K        H
   0.320    0.136    0.429 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5770007388


Query= XP_031327310.1 inositol hexakisphosphate and
diphosphoinositol-pentakisphosphate kinase isoform X3 [Photinus
pyralis]

Length=1220
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

VIP1_CAEEL  unnamed protein product                                   991     0.0  
Q9VU45_DROME  unnamed protein product                                 32.3    2.2  


>VIP1_CAEEL unnamed protein product
Length=1323

 Score = 991 bits (2562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 503/939 (54%), Positives = 650/939 (69%), Gaps = 81/939 (9%)

Query  49   QVVVGVCAMAKKSQSKPMKEILTRLQEF--EYLKVVVFPENEILEKPVEEWHACDCLISF  106
            ++ +G+CAM +K+ SKPM+ I+ ++ +F  +++   +FPE  I+ +PVE W  C CL+SF
Sbjct  16   KITIGICAMNRKATSKPMRAIMKKIIDFYGQWVDSFIFPEQVIINEPVENWPLCHCLVSF  75

Query  107  HSKGFPLDKAIQYAQLHNPYVINNLHMQYDIQDRRRVYAILESEGIEIPRYAVLDRDNPD  166
            HS  FPL+KAI Y +L NPYVINNL  QYD+ DRR V+ IL   GIE PR+  + R  P+
Sbjct  76   HSTEFPLEKAIAYVKLRNPYVINNLDRQYDLLDRRTVFKILSDNGIEHPRHGYVIRGRPN  135

Query  167  PKGHELVESEDHVEVNGIVFNKPFVEKPVSAEDHNIYIYYPTSAGGGSQRLFRKSDRCGY  226
                ELVE  DH+EVNG VFNKPFVEKP+S+EDHN+YIYYP+S GGGSQRLFRK      
Sbjct  136  EPDTELVEHPDHIEVNGEVFNKPFVEKPISSEDHNVYIYYPSSVGGGSQRLFRK------  189

Query  227  IKHTNLLFSSGKPIKIGSRSSVYSPESRVRKTGSFIYEDFMPTDGTDVKVYTVGPDYAHA  286
                           I +RSS YSP+S VRK GS+IYE+F+P DGTDVKVY VGP YAHA
Sbjct  190  ---------------INNRSSWYSPKSEVRKEGSYIYEEFIPADGTDVKVYAVGPFYAHA  234

Query  287  EARKSPALDGKVERDREGKEIRYPVILSNVEKMISRKVCLAFKQAVCGFDLLRANGKSFV  346
            EARK+P LDGKVERD +GKE+RYPVILSN EK I++K+ LAF Q VCGFDLLRANGKS+V
Sbjct  235  EARKAPGLDGKVERDSDGKEVRYPVILSNKEKQIAKKIVLAFGQTVCGFDLLRANGKSYV  294

Query  347  CDVNGFSFVKNSNKYYDDCAKILGNMILRELAPTLHIPWSVPFQL-----------DDPP  395
            CDVNGFSFVK S KYY+D AKILGN I+R  A + +  W VP  +           DDPP
Sbjct  295  CDVNGFSFVKTSTKYYEDTAKILGNQIVRHYAKSKN--WRVPSDMPQPPILDLGLGDDPP  352

Query  396  IVPTTFGKMMELRCVVAVIRHGDRTPKQKMKVEVRHPKFFEIFEKYEGYKNGYVKLKRPK  455
            ++ T  GK+ ELRCVVAVIRHGDRTPKQKMK+ V   +FF +FEKY+GYK   +K+K+P 
Sbjct  353  MITTPSGKLAELRCVVAVIRHGDRTPKQKMKLIVTDQRFFALFEKYDGYKKHEIKMKKPN  412

Query  456  QLQEILDTARSLL--------------------AEIQHHEADPET-EEKQGKLEQLKSVL  494
            QL E+L+ AR+L+                     EI   E D E  EE+  K EQ+++VL
Sbjct  413  QLMEVLELARALVIEKQRDRHQILEKLREGTGEEEIHKSEHDLEVCEEEMKKWEQMRTVL  472

Query  495  EMYGHFSGINRKVQMKYQPKGRPRGSSSDDGKTQLNPPAEPSLVLILKWGGELTPAGRIQ  554
            EMYGHFSGINRKVQMKY    + R + + D + +   PA   L+LILKWGGELT AG +Q
Sbjct  473  EMYGHFSGINRKVQMKYL---KERETKTSDEELRREGPA---LLLILKWGGELTTAGNMQ  526

Query  555  AEELGRIFRCMYPGGQGRHLAGEYAGAQGLGLLRLHSTFRHDLKIYASDEGRVQMTAAAF  614
            AE LGR+FR +YPG +           QGLG LRLHST+RHDLKIYASDEGRVQ TAAAF
Sbjct  527  AEALGRLFRTLYPGIRRTDGKSSPEDTQGLGFLRLHSTYRHDLKIYASDEGRVQTTAAAF  586

Query  615  AKGLLALEGELTPILVQMVKSANTNGLLDNDCDSSKYQNMCKSRLHELMQLNRDFSAEDI  674
            AKGLLALEGELTPIL+QMVKSANT+GLLD+DC +  YQ   K  LH+ +Q +RDF+ +D 
Sbjct  587  AKGLLALEGELTPILMQMVKSANTDGLLDDDCQARLYQTELKRYLHKALQADRDFTPQDY  646

Query  675  EKINPCNSSSISDALDFVKNPFRCCQHVHELIKSLLNIVRLKKEDSKAKDVVLYHGETWE  734
             ++NP    +I+ A++F+KNP + C  +   ++ +  ++ ++   ++     LY  E+ +
Sbjct  647  LELNPNGLRAITAAMEFIKNPRKMCHEIAGYVEKMCGVI-VEYSQTRPTGSTLYLQESMD  705

Query  735  LMGRRWGKIEKDFCTKNK----RFDISKIPDIYDCIKYDLQHN-----QHTLQFEQAEEL  785
            L  RRW K  ++F  KNK     FDISKIPDIYD IKYD++HN      + ++FE+   +
Sbjct  706  LAQRRWNKELREFRRKNKHGEVEFDISKIPDIYDNIKYDMEHNPDLCINNEVEFER---M  762

Query  786  YVYSKYLADIVIPQEYGLTAQEKLSIGQGICTPLLKKIRADLQRNIEELD-DETVNRLNP  844
            YV  K +ADIV+PQEYG+  + K+ I Q +CTPLL+KIR DL R +E  + +ET  RL+P
Sbjct  763  YVCVKNMADIVVPQEYGIKTENKMVIAQRVCTPLLRKIRNDLHRCLENKESEETQTRLDP  822

Query  845  IYSHGVSSPGRHVRTRLYFTSESHVHSLITCLRYGGLFNVVTDEQWRRAMEYVSMVSELN  904
              S G+++P RHVRTRLYFTSESH+H+L+  +RYG L + V D++W+RAM ++S V+E N
Sbjct  823  RASQGIATPFRHVRTRLYFTSESHIHTLMNLIRYGNLCS-VDDKKWQRAMNFLSGVTEFN  881

Query  905  YMSQVVIMLYEDPTK---DPSSDERFHVELHFSPGVNCC  940
            YM+QVV+M+YED  K   +  +  RFH+E+ FSPG+  C
Sbjct  882  YMTQVVLMVYEDSRKENDEADTGPRFHIEILFSPGLYPC  920


 Score = 40.8 bits (94),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 32/56 (57%), Gaps = 2/56 (4%)

Query  1103  PAIRPLETLHNALSLRQLDVFLESMTLAPILKTPSSTPPKVPCTPSTTPTNTSRAP  1158
             P +R LETLH++++L Q D FLE +    +  TP  +PPK P   + +    ++ P
Sbjct  1251  PPLRSLETLHDSINLSQFDGFLERLIKGAL--TPLPSPPKTPLPSALSCDAINKTP  1304


>Q9VU45_DROME unnamed protein product
Length=284

 Score = 32.3 bits (72),  Expect = 2.2, Method: Composition-based stats.
 Identities = 23/84 (27%), Positives = 45/84 (54%), Gaps = 8/84 (10%)

Query  406  ELRCVVAVIRHGDRTPKQKMKVEVRHPKFFEIFEKYEGYKNGYVKLKRPKQLQEILDTAR  465
            +L+ + AV+RHGDR  +QK+++E    +F  + EKY       ++ +    +++ L  A+
Sbjct  105  DLQRLQAVVRHGDR--QQKLQLEKLTREFHGVVEKYSN-----LQRRISSAMRQTLQQAQ  157

Query  466  SLLAEIQHHEADPETEEKQGKLEQ  489
                ++    A  E  ++Q +LEQ
Sbjct  158  QFADQVVETNARAELLQQQ-RLEQ  180



Lambda      K        H
   0.320    0.136    0.429 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5770007388


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jan 28, 2021  9:24 PM
  Number of letters in database: 17,197,330
  Number of sequences in database:  25,232



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= XP_031327311.1 inositol hexakisphosphate and
diphosphoinositol-pentakisphosphate kinase isoform X4 [Photinus
pyralis]

Length=1100
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

VIP1_CAEEL  unnamed protein product                                   988     0.0  
Q9VU45_DROME  unnamed protein product                                 32.0    2.4  
A0A0B4KEE8_DROME  unnamed protein product                             31.2    6.9  


>VIP1_CAEEL unnamed protein product
Length=1323

 Score = 988 bits (2554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 503/939 (54%), Positives = 650/939 (69%), Gaps = 81/939 (9%)

Query  49   QVVVGVCAMAKKSQSKPMKEILTRLQEF--EYLKVVVFPENEILEKPVEEWHACDCLISF  106
            ++ +G+CAM +K+ SKPM+ I+ ++ +F  +++   +FPE  I+ +PVE W  C CL+SF
Sbjct  16   KITIGICAMNRKATSKPMRAIMKKIIDFYGQWVDSFIFPEQVIINEPVENWPLCHCLVSF  75

Query  107  HSKGFPLDKAIQYAQLHNPYVINNLHMQYDIQDRRRVYAILESEGIEIPRYAVLDRDNPD  166
            HS  FPL+KAI Y +L NPYVINNL  QYD+ DRR V+ IL   GIE PR+  + R  P+
Sbjct  76   HSTEFPLEKAIAYVKLRNPYVINNLDRQYDLLDRRTVFKILSDNGIEHPRHGYVIRGRPN  135

Query  167  PKGHELVESEDHVEVNGIVFNKPFVEKPVSAEDHNIYIYYPTSAGGGSQRLFRKSDRCGY  226
                ELVE  DH+EVNG VFNKPFVEKP+S+EDHN+YIYYP+S GGGSQRLFRK      
Sbjct  136  EPDTELVEHPDHIEVNGEVFNKPFVEKPISSEDHNVYIYYPSSVGGGSQRLFRK------  189

Query  227  IKHTNLLFSSGKPIKIGSRSSVYSPESRVRKTGSFIYEDFMPTDGTDVKVYTVGPDYAHA  286
                           I +RSS YSP+S VRK GS+IYE+F+P DGTDVKVY VGP YAHA
Sbjct  190  ---------------INNRSSWYSPKSEVRKEGSYIYEEFIPADGTDVKVYAVGPFYAHA  234

Query  287  EARKSPALDGKVERDREGKEIRYPVILSNVEKMISRKVCLAFKQAVCGFDLLRANGKSFV  346
            EARK+P LDGKVERD +GKE+RYPVILSN EK I++K+ LAF Q VCGFDLLRANGKS+V
Sbjct  235  EARKAPGLDGKVERDSDGKEVRYPVILSNKEKQIAKKIVLAFGQTVCGFDLLRANGKSYV  294

Query  347  CDVNGFSFVKNSNKYYDDCAKILGNMILRELAPTLHIPWSVPFQL-----------DDPP  395
            CDVNGFSFVK S KYY+D AKILGN I+R  A + +  W VP  +           DDPP
Sbjct  295  CDVNGFSFVKTSTKYYEDTAKILGNQIVRHYAKSKN--WRVPSDMPQPPILDLGLGDDPP  352

Query  396  IVPTTFGKMMELRCVVAVIRHGDRTPKQKMKVEVRHPKFFEIFEKYEGYKNGYVKLKRPK  455
            ++ T  GK+ ELRCVVAVIRHGDRTPKQKMK+ V   +FF +FEKY+GYK   +K+K+P 
Sbjct  353  MITTPSGKLAELRCVVAVIRHGDRTPKQKMKLIVTDQRFFALFEKYDGYKKHEIKMKKPN  412

Query  456  QLQEILDTARSLLA--------------------EIQHHEADPET-EEKQGKLEQLKSVL  494
            QL E+L+ AR+L+                     EI   E D E  EE+  K EQ+++VL
Sbjct  413  QLMEVLELARALVIEKQRDRHQILEKLREGTGEEEIHKSEHDLEVCEEEMKKWEQMRTVL  472

Query  495  EMYGHFSGINRKVQMKYQPKGRPRGSSSDDGKTQLNPPAEPSLVLILKWGGELTPAGRIQ  554
            EMYGHFSGINRKVQMKY    + R + + D + +   PA   L+LILKWGGELT AG +Q
Sbjct  473  EMYGHFSGINRKVQMKYL---KERETKTSDEELRREGPA---LLLILKWGGELTTAGNMQ  526

Query  555  AEELGRIFRCMYPGGQGRHLAGEYAGAQGLGLLRLHSTFRHDLKIYASDEGRVQMTAAAF  614
            AE LGR+FR +YPG +           QGLG LRLHST+RHDLKIYASDEGRVQ TAAAF
Sbjct  527  AEALGRLFRTLYPGIRRTDGKSSPEDTQGLGFLRLHSTYRHDLKIYASDEGRVQTTAAAF  586

Query  615  AKGLLALEGELTPILVQMVKSANTNGLLDNDCDSSKYQNMCKSRLHELMQLNRDFSAEDI  674
            AKGLLALEGELTPIL+QMVKSANT+GLLD+DC +  YQ   K  LH+ +Q +RDF+ +D 
Sbjct  587  AKGLLALEGELTPILMQMVKSANTDGLLDDDCQARLYQTELKRYLHKALQADRDFTPQDY  646

Query  675  EKINPCNSSSISDALDFVKNPFRCCQHVHELIKSLLNIVRLKKEDSKAKDVVLYHGETWE  734
             ++NP    +I+ A++F+KNP + C  +   ++ +  ++ ++   ++     LY  E+ +
Sbjct  647  LELNPNGLRAITAAMEFIKNPRKMCHEIAGYVEKMCGVI-VEYSQTRPTGSTLYLQESMD  705

Query  735  LMGRRWGKIEKDFCTKNK----RFDISKIPDIYDCIKYDLQHN-----QHTLQFEQAEEL  785
            L  RRW K  ++F  KNK     FDISKIPDIYD IKYD++HN      + ++FE+   +
Sbjct  706  LAQRRWNKELREFRRKNKHGEVEFDISKIPDIYDNIKYDMEHNPDLCINNEVEFER---M  762

Query  786  YVYSKYLADIVIPQEYGLTAQEKLSIGQGICTPLLKKIRADLQRNIEELD-DETVNRLNP  844
            YV  K +ADIV+PQEYG+  + K+ I Q +CTPLL+KIR DL R +E  + +ET  RL+P
Sbjct  763  YVCVKNMADIVVPQEYGIKTENKMVIAQRVCTPLLRKIRNDLHRCLENKESEETQTRLDP  822

Query  845  IYSHGVSSPGRHVRTRLYFTSESHVHSLITCLRYGGLFNVVTDEQWRRAMEYVSMVSELN  904
              S G+++P RHVRTRLYFTSESH+H+L+  +RYG L + V D++W+RAM ++S V+E N
Sbjct  823  RASQGIATPFRHVRTRLYFTSESHIHTLMNLIRYGNLCS-VDDKKWQRAMNFLSGVTEFN  881

Query  905  YMSQVVIMLYEDPTK---DPSSDERFHVELHFSPGVNCC  940
            YM+QVV+M+YED  K   +  +  RFH+E+ FSPG+  C
Sbjct  882  YMTQVVLMVYEDSRKENDEADTGPRFHIEILFSPGLYPC  920


>Q9VU45_DROME unnamed protein product
Length=284

 Score = 32.0 bits (71),  Expect = 2.4, Method: Composition-based stats.
 Identities = 23/84 (27%), Positives = 45/84 (54%), Gaps = 8/84 (10%)

Query  406  ELRCVVAVIRHGDRTPKQKMKVEVRHPKFFEIFEKYEGYKNGYVKLKRPKQLQEILDTAR  465
            +L+ + AV+RHGDR  +QK+++E    +F  + EKY       ++ +    +++ L  A+
Sbjct  105  DLQRLQAVVRHGDR--QQKLQLEKLTREFHGVVEKYSN-----LQRRISSAMRQTLQQAQ  157

Query  466  SLLAEIQHHEADPETEEKQGKLEQ  489
                ++    A  E  ++Q +LEQ
Sbjct  158  QFADQVVETNARAELLQQQ-RLEQ  180


>A0A0B4KEE8_DROME unnamed protein product
Length=1802

 Score = 31.2 bits (69),  Expect = 6.9, Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 0/40 (0%)

Query  382   HIPWSVPFQLDDPPIVPTTFGKMMELRCVVAVIRHGDRTP  421
             H+P   PF LD  P +P++  K+ E    +A +RH   +P
Sbjct  1188  HLPPPPPFMLDAMPQIPSSALKVSETVRALAAMRHQPASP  1227



Lambda      K        H
   0.318    0.135    0.402 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 14159614518


Query= XP_031327312.1 dynein beta chain, ciliary-like [Photinus pyralis]

Length=4499
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q5LJN5_DROME  unnamed protein product                                 5279    0.0  
Q9U3Y5_DROME  unnamed protein product                                 5256    0.0  
Q9VDG0_DROME  unnamed protein product                                 4906    0.0  


>Q5LJN5_DROME unnamed protein product
Length=4559

 Score = 5279 bits (13694),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 2625/4552 (58%), Positives = 3379/4552 (74%), Gaps = 70/4552 (2%)

Query  2     KTLKMKMEKWNKMWSTDEYARIILNFFNNPNVPRLIMITSAAGQLMPVTEFPNNLKTKSS  61
             KT+++K++KW KM +T+E+  +I+ F NNPN  R+I   ++ GQL P   FP   + K +
Sbjct  24    KTMRLKLDKWTKMITTNEFRDVIIEFLNNPNKKRIIFTINSGGQLYPSYSFPVRPRYKVA  83

Query  62    YFIRKKKEV-VTRDNIREVLLIGDMSPKPVEEIAVLVEEVFLPVLSNPANQTKWPAVIAA  120
             YFIR    + +T +N+   LLIGD+ P P+  +++L +EVF P+L+N  NQ  W  VIA 
Sbjct  84    YFIRYLTPLHLTDENMLNSLLIGDLLPNPLANLSILCDEVFFPLLNNTVNQVGWTNVIAN  143

Query  121   DITKHVYAFRNKVYQIKGALKSQTLLPMPTGVERIYEATLLLQQSHGKEVDLSLKTAIEG  180
             D+       RN + Q+KG + ++T+ P+P  ++ + +A   +       V+  +K ++E 
Sbjct  144   DMKTESQEMRNGIAQMKGLVINRTIFPLPICMDEVMQAAPAIAMGDISVVNPLMKHSLEF  203

Query  181   AVLQWASLCNDVLQ-QTSDAAFAHGQNPIPSAEINFWNSRLKNLESIFDQLRDPRVKRMV  239
              V++W     D++  +  +  ++    P+P A  +FW SRL+NLE++ +QL D R+K + 
Sbjct  204   MVVKWLDSVEDLVNIKAGEKIYSKENFPLPEAIFSFWESRLENLENLAEQLGDRRIKTIG  263

Query  240   LYLELAGSSYLSCFKCVFQDVVAGVIEAKNICLYLKPMKTHFEKFEDGEFLESEPYIRPM  299
               LE   S +   ++ + + V+  + EA++I   L P+K   +KFE  +  E+   IRP+
Sbjct  264   FVLEKIQSIFEHSYRRIVELVLESLAEARDITKCLSPLKRKMDKFETNDMDENRSDIRPL  323

Query  300   VHCLGLLWANSCYYCTNTKITTLLKEVANLFISAITAQLDPSTIFQGEPEDMVKKINTCL  359
             +  +GL+W +S Y+ T   +T       N  I  +   ++P +IFQG+ ++  KK++  +
Sbjct  324   MLTIGLVWGHSRYFHTLNNMTLFFNLFHNSLIDCVNRTVEPDSIFQGDVDEAYKKLDINM  383

Query  360   RLINIFRISFEEVRANLASYFKTPDIQPKPWTFHQRTVFQRLMDFVERLELVKSILLAAI  419
             + +  +++ + E R +L  +        + WT+HQ  +F RL  F+ RLE +K +     
Sbjct  384   QHLEYYKLIYNECRNSLKKFKIGTTFNSQDWTWHQDEIFGRLDKFLVRLEELKDLFNTVR  443

Query  420   EYQKLERIEIGGIKGRLLSKRCEDLLEEFNYAYANFVTIQYDLLDPLHMAIVAENEQFLI  479
             ++QKLE+I +GG+KGR ++   E +LEE+N  Y  +  IQY+ +DP     + + ++   
Sbjct  444   DFQKLEKIVMGGLKGRQITFALEKILEEYNSIYREWTNIQYNPIDPDAENSLFQRDRLSF  503

Query  480   KC-NDMDSRLASI-FEQVLDDCHNLESIFKFVNIANTLVERPIIYNAIKDKFYKIIEIFN  537
             K   D+  R+ S  FE+ L+D H+L         A +L+ RPII   ++   + I++ F 
Sbjct  504   KAKTDVMERMVSFQFEKGLEDTHDLLL-------AGSLLLRPIIKKHVEPLMHVIVDDFE  556

Query  538   RELDTVKE-------VYDEGKREGVPINNYFPPTAGVLCWLHKLRQRIVKQGEDFKMFQN  590
              E+  VK+       V+       +P ++ FP  +G + +L KLR RI+   ++ ++++ 
Sbjct  557   EEIMCVKKEFINFKNVFTALGLNELPTDDCFPKVSGAISFLKKLRHRIIGLHKEHELYEY  616

Query  591   KLVESPDALEAFSKWEEMQHILDAEEARVLSLWS----QSIPSQITASLSKMQLFKSGEQ  646
              L ++         +  M   +D     +L  W+    Q I   IT +L +        +
Sbjct  617   PLFDNERGGYVSDIFNIMVQEIDDFTKMLLDKWTVECWQGIQQDITLTLIEKD---EANE  673

Query  647   ISVNFDKELEAILREVKYMKLLGIENIPEVALALYERNEELFISMQHLNNISEWYNHLKN  706
             + VNF + L   L+++K ++LLG + +       + R +EL+ +   L  I+EWYN    
Sbjct  674   LRVNFTERLIFALKDIKVVRLLGCD-VSVNLTKFFCREDELWQARVKLMRIAEWYNDTFE  732

Query  707   KSLPVEYELIRSEVEELDLRLDELIYQLNWTTDNFELIKTIYDALKQLYDRVMEAQRNVN  766
             ++ P E  LI +E+  ++ ++  L+  + W   +   I  I+  +K L+DR++ AQ N+ 
Sbjct  733   RAHPTEKRLIAAEMILIEEQMKPLLDFIKWNAFSQRFIVMIFKMVKYLHDRLVAAQENLE  792

Query  767   NIIAEINLWGEEPLFERKDRNSHCLLYVEDRVERVHKRYSQITATSLSIEKVMELNYKLF  826
              I   I  WG+ PLF+RKD N   LL+ + R   +  R +    T   I+ +M +N KLF
Sbjct  793   AIKESIRSWGKVPLFQRKDLNPALLLHTDPREPILSIRAANAADTQRLIDLLMYVNLKLF  852

Query  827   FNIPD----PPPDPVEEPKVEEP--PP-------EPVKDKKEKDKGKKAADKGKKQKTEE  873
             F+IP     PP +  EE +  +   PP         VK KK+++   +  D  + ++ + 
Sbjct  853   FDIPRRYSLPPGEHGEEDEESDGIWPPIISLSVMTSVKFKKKREVIDEEDDLEEFEEEQS  912

Query  874   EEKPVEEPPVDE-QALRRLN-----LWEPYEAFIDELVSQSLRQAV-SVSLELLVKATES  926
             E +     P    + L+ L+     L+  YE ++DE+++++L  +V + S  L ++    
Sbjct  913   ESEEEIITPFHRYELLKGLSQEERALFREYEIYVDEIIAENLVDSVITSSTYLRMEVDNR  972

Query  927   NPNLYPLFELLLKLIDTNVVFIPSIDLEDTDNFLSFVESLIEDMRKMGIFMKRVKK----  982
               N  P+FE+ ++L + NVV+  ++D      F  F+E++++DM  M   +KRV +    
Sbjct  973   YENNTPIFEIFMELQEPNVVYFRNLDTSSKTGFAFFIETILDDMNNMMSLLKRVAQDPTE  1032

Query  983   --NADPDYFNDVCED-PEITSMMEIVVSRVTQAMELAMEYTTVFDDFSNLWLDNRQEFLR  1039
               N +P  F D  +D  E+      +++++  A++    +   F +FS+LW+ ++  +L 
Sbjct  1033  VTNMNPYSFYDELQDKSELDKQRVEIMNKIKLALQAVRVHGKGFMEFSSLWIWDKSTYLS  1092

Query  1040  QFLLYGRPLTAEELDIEQD-ETSGGLK----STPPIVSQFKEQIDFFEEMYKTVEQLETE  1094
             +   +GR LT +E D E D E S G+K      PP+ S +KEQ+D F E+   +   ET 
Sbjct  1093  EVKKFGRNLTLDERDAEADLEGSSGVKLLGLEYPPL-SVYKEQLDKFIELQDQIRTWETY  1151

Query  1095  KIILGWLRIDARPIRQAILNTVGKWGNMFKQHLYDHVINSISELENFIQEAIAGMQVQLT  1154
             +    +LR++    + A+L+ VG+W ++FK  L + V NS+ EL++F+ EA   ++++L 
Sbjct  1152  EDFFVFLRLNMTGFKVAVLSQVGQWISLFKLDLINRVKNSLKELQDFVDEANIVLKIELQ  1211

Query  1155  EDDYEGLLKVMAFLVKIRDMQAATDVMFGPLKDIIALLKDYGVEFSEETYVQLQELPDKW  1214
             +DD+EGL+K+++ L +I + Q   D MF PLK+II LL+ Y  EF +    Q+ ELPD W
Sbjct  1212  KDDFEGLVKILSVLNQINEKQCIYDSMFDPLKEIIDLLRQYNYEFKDTELAQINELPDAW  1271

Query  1215  LTCKKVAVQTKQAVGPLQTIQIAAIRRRIALFDVRQAMSRDAFRKMPFFLWGCQHVYALF  1274
             +  K++A  TKQ + P+Q+ Q+  I +RI L D      R  F    FF   C   Y L 
Sbjct  1272  MKVKRLAATTKQLIAPIQSYQVDLIEKRILLCDNMANTYRKKFLSKKFFFVPCLSCYELI  1331

Query  1275  DKVHKELSDFEVELKKLSEQSNLFDLQMSEYKSLKVTRKELKQIKQLWDFVNIVMSSINE  1334
             D+   EL   E   + L+E + LF+LQ  +   +++ R +LK +K +WDF   + S+IN+
Sbjct  1332  DESDLELVALEERQRSLAESAVLFELQGPDPVKIELCRFDLKLVKIMWDFAITIQSTIND  1391

Query  1335  WKTTPWKKIDVEGMEMELKKFGKETRLMDKEVRGWNVYIEMEATIKNMLTSLRAVTELQN  1394
             WK TPWKKID+E M+ E KKFG+E R +DK +R W  +I MEA++KN++TSLRAVTELQN
Sbjct  1392  WKKTPWKKIDIENMDQECKKFGRELRGLDKAMRTWEPFIFMEASLKNLMTSLRAVTELQN  1451

Query  1395  PAIRDRHWIQLMQATKVKFVLDDETTLSDLLDLNLHEYEEEVKTIVDKSVKEMAMEKSLK  1454
             PAIRDRHWI+LMQ TKVKF +DD TTL DL+DLNLHEYEEEVK IVDKSVKEMAMEK L+
Sbjct  1452  PAIRDRHWIELMQTTKVKFSMDDSTTLKDLIDLNLHEYEEEVKNIVDKSVKEMAMEKQLR  1511

Query  1455  EFNQNWNVLEFDTEIHDRSKIRLLKIAEETIEILEDNQVQLQNMMTSKFIQFFQKEVLEW  1514
             +    W  +EF T+IHDR+ I+LLK +EE IE LED+Q QLQNM +SK+I FF+ EV  W
Sbjct  1512  DIATAWGTMEFGTDIHDRTSIKLLKASEELIETLEDHQGQLQNMASSKYIAFFEHEVRLW  1571

Query  1515  QQKLSNADQVIQVFFEVQRKWCYLESIFIGSEDIRAQLPEDSKRFDKIDREFKEILNEMV  1574
             Q +LSNADQ+I  +FEVQRKW YLESIFIGSEDIR+QLPEDS+RFD ID+EFK +L +M 
Sbjct  1572  QNRLSNADQIIGSWFEVQRKWQYLESIFIGSEDIRSQLPEDSRRFDYIDKEFKALLAQMN  1631

Query  1575  RTLNIVRATSKPG--LATRLERILDDLLLCEKALNNYLETKRLAFPRFYFVSSADLLDIL  1632
                N+VR+T++ G  L   LE +L  LLLCEKALN+YLETKRL++PRFYFVSSADLLDIL
Sbjct  1632  ADRNVVRSTNRSGSKLYEHLEILLKMLLLCEKALNDYLETKRLSYPRFYFVSSADLLDIL  1691

Query  1633  STGNQPPLVARHLTKLFDSLAKLRFAMEGGKESKRSNAMGSKENDEWVPFLNHCDCSGKV  1692
             S GN P LVARHLTKL+DS+ KL   + G   SK +  M +KE +E+VPFL +CDCSGKV
Sbjct  1692  SNGNNPALVARHLTKLYDSMGKLNL-ISG---SKNAAGMVAKELEEYVPFLENCDCSGKV  1747

Query  1693  EVWLNRVIDIMRVTLHRSFSEAVTSYDEKPRELWIFDYPAQPALCGTQIWWTTEVNIAFA  1752
             EVWLNR+ D MR TL      ++T YD KPR +WIF++PAQPAL GTQI WTTE N AFA
Sbjct  1748  EVWLNRITDKMRDTLRDQLKRSLTFYDHKPRHVWIFEWPAQPALVGTQIMWTTETNDAFA  1807

Query  1753  RLEEGYENALKDYQKKQIAQLNALITLLLGDLTVGERQKIMTICTIDVHSRDVVAKMIQV  1812
             ++++ YENALKDY KKQI QLN LI LLLGDLT  ERQKIMTICTIDVHSRDVV  +I  
Sbjct  1808  KVQQRYENALKDYNKKQITQLNNLIILLLGDLTAAERQKIMTICTIDVHSRDVVGTIIAK  1867

Query  1813  KVENSQAFQWQSQLRHRWDTKVNNCFANICDAQFLYQYEYLGNSPRLVITPLTDRCYITL  1872
             KVE   AFQWQSQLRHRWD K+++CFANICDAQF Y YEYLGN+PRLVITPLTDRCYITL
Sbjct  1868  KVEVQTAFQWQSQLRHRWDPKIDDCFANICDAQFRYDYEYLGNTPRLVITPLTDRCYITL  1927

Query  1873  TQSLHLIMGGAPAGPAGTGKTETTKDLGKALGMMVYVFNCSEQMDYKSVGNIYKGLAQTG  1932
             TQSLHL+MGGAPAGPAGTGKTETTKDLG+ALGMMVYVFNCSEQMDYKS+G+I+KGLAQTG
Sbjct  1928  TQSLHLVMGGAPAGPAGTGKTETTKDLGRALGMMVYVFNCSEQMDYKSIGDIHKGLAQTG  1987

Query  1933  TWGCFDEFNRISVEVLSVVAVQVKTIQDAVKVKKARFNFLGEEISLIPTIGIFITMNPGY  1992
              WGCFDEFNRISVEVLSVVAVQVK IQDA+K KK  F+FLGE I+L  T+G+FITMNPGY
Sbjct  1988  AWGCFDEFNRISVEVLSVVAVQVKCIQDAIKSKKQTFSFLGEHIALRTTVGVFITMNPGY  2047

Query  1993  AGRTELPENLKALFRPCAMVVPDFALICEIMLVAEGFQEARLLARKFITLYTLCKELLSK  2052
             AGR ELPENLKAL+RPCAMVVPDFALI EIMLVAEGFQEARLLARKFITLYTLCKELLSK
Sbjct  2048  AGRAELPENLKALYRPCAMVVPDFALISEIMLVAEGFQEARLLARKFITLYTLCKELLSK  2107

Query  2053  QDHYDWGLRAIKSVLVVAGALRRGDRLRPEDQVLMRALRDFNIPKIVTDDVPVFMGLIGD  2112
             QDHYDWGLRAIKSVLVVAGALRR DR RPEDQVLMRALRDFNIPKIVTDDVPVFMGLIGD
Sbjct  2108  QDHYDWGLRAIKSVLVVAGALRRDDRQRPEDQVLMRALRDFNIPKIVTDDVPVFMGLIGD  2167

Query  2113  LFPALDVPRKRSLEFEKLAKASAVDLKLQPEDGFILKVVQLEELFAVRHSVFVLGFAGTG  2172
             LFPALDVPRKR+ EFE + K SA+DLKLQPEDGFILK+VQLEELFAVRHSVF++GFAGTG
Sbjct  2168  LFPALDVPRKRNPEFEAVIKRSALDLKLQPEDGFILKIVQLEELFAVRHSVFIIGFAGTG  2227

Query  2173  KTCVWKTLNRTYYNQKLKPYYNDLNPKAVTNDELFGIINPATREWKDGLFSVIMRDQANM  2232
             K+ VWKTLN+TY NQK KP+YNDLNPKAVTNDELFGI+NP+TREWKDGLFS++MRDQAN+
Sbjct  2228  KSEVWKTLNKTYQNQKRKPHYNDLNPKAVTNDELFGIVNPSTREWKDGLFSILMRDQANL  2287

Query  2233  SGDGPKWIVLDGDIDPMWIESLNTLMDDNKVLTLASNERIALTRAMRLLFEIANLRTATP  2292
              G GPKWIVLDGDIDPMWIESLNT+MDDNKVLTLASNERIALT+ MRLLFEIA+LRTATP
Sbjct  2288  GGTGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALTKEMRLLFEIASLRTATP  2347

Query  2293  ATVSRAGILYINPADLGWNPYIASWIDTR-NENEKANLMILFDKYIPPCLEMVKTKLKKI  2351
             ATVSRAGILYINP DLGW P+I SW+ TR N +E + L +LFDKY+PP L++ +T+L+ I
Sbjct  2348  ATVSRAGILYINPQDLGWTPFIQSWLGTRTNSSEVSMLNVLFDKYVPPLLDIFRTRLRSI  2407

Query  2352  TPIVDIAHIHMLCFLLDCFLTYQNVPPECPKEWYEIYFVFALIWAFGSALFQDQIIDWRN  2411
             TPI DIA + M C+LLD  LT QNVP +CPK+WYEIYFVF ++W FGS+LFQDQIIDW N
Sbjct  2408  TPISDIARLQMTCYLLDSMLTPQNVPNDCPKDWYEIYFVFCIVWGFGSSLFQDQIIDWSN  2467

Query  2412  EFSKWFTNEFKTVKFPTAGTVFHYYIDQETKKFMPWSDLTPSFELDPDIPLQATLVNTAE  2471
             EFSKWF NE+K VKFP +GT+F +YID ETKKF PW++L P FELD D+PLQ+ LVNTAE
Sbjct  2468  EFSKWFLNEYKAVKFPLSGTIFSFYIDHETKKFFPWTNLVPQFELDMDLPLQSNLVNTAE  2527

Query  2472  TVRVRYFMDKLIAHKHPVMLIGGAGSGKTVLVSDKLSSL-SEGYAVTNVPFNFYTTSEML  2530
             T R+R+FMD LI   HP+MLIG +GSGKT+L++ KLS+L S+ Y+VTNVPFNFYTTSEML
Sbjct  2528  TTRLRFFMDTLIEADHPLMLIGPSGSGKTILMNAKLSALPSDKYSVTNVPFNFYTTSEML  2587

Query  2531  QRVLENPLEKKAGRVYGPPGTKTMIYFIDDMNMPEVDKYFTVQPHTLLRQWMDYQHWYDR  2590
             QR+LE PLEKKAGR YGP G K MIYF+DDMNMPEVDKYFTVQPHTL+RQ+MDY HWYDR
Sbjct  2588  QRILEKPLEKKAGRNYGPIGNKRMIYFVDDMNMPEVDKYFTVQPHTLIRQFMDYHHWYDR  2647

Query  2591  QKLSLKDIHNIQFISCMNPTAGSFTIDPRLQRHFCVFAISFPTQDACYHIYSNIFSQHLT  2650
             QK++L+DIH    ++CMNP+AGSFTIDPRLQRHFC FA++ P+QDA +HI ++I SQH+ 
Sbjct  2648  QKMTLRDIHKCNIVACMNPSAGSFTIDPRLQRHFCSFAVNPPSQDALFHILNSILSQHMD  2707

Query  2651  NPLNKFPYSLHSLSVNVVTAALTLHSRVAQTFLPTAVKFHYVFNLRDLSNLFQGMLFANG  2710
             NP+ KF  ++  L  N+VT A+TLH +V  +FLPTA+KFHY FNLRD++N+F G+L++N 
Sbjct  2708  NPIQKFDKAVIKLCENMVTTAITLHLKVVSSFLPTAIKFHYNFNLRDIANIFTGVLYSNS  2767

Query  2711  DTAPNQSALIRLWMHESYRVYGDKLVERRDQDTFSKLVVEVLKKGFEELEEVEVMAKPLI  2770
             +T PN + +IRLW+HE YRVYGDKLV+  D ++F K+V ++++KG E + +  V A+PLI
Sbjct  2768  ETCPNSNQMIRLWIHECYRVYGDKLVDYTDINSFKKIVSDIVRKGIEGVNDDVVYAQPLI  2827

Query  2771  FCHFADGLGDPKYLPIQNYTVLTRLLNEALAGYNDLVSAMNLVLFEDAMNHICRINRIME  2830
             +CHFA GL D KY+PI  +  L  LL+EA   YND + AMNLVLF+DAM+H+CRI+RI+E
Sbjct  2828  YCHFAKGLTDIKYMPISGWDRLKSLLDEAQDRYNDYIGAMNLVLFDDAMSHVCRISRILE  2887

Query  2831  APRGNALLVGVGGSGKQSLTRLAAFISSLEVFQVQLKKGFNMSDLKANIAALYVKAGLKN  2890
             + RG ALL+GVGGSGKQSLTRLA+FISSL+VFQ+QL K +++SDLKANIA LY+KAG+K 
Sbjct  2888  SSRGYALLIGVGGSGKQSLTRLASFISSLDVFQIQLTKDYSVSDLKANIATLYMKAGVKT  2947

Query  2891  ISTVFLMTDAQVAEEAWLVVINDMLASGEIPDLLQDEEVENILNVVRGEVKASGVDDTKE  2950
              +  FLMTD++VA E +LV++ND+LASG+I +L  D+EVENI+N VR EVK  G+ D +E
Sbjct  2948  SACCFLMTDSEVAREQFLVLVNDLLASGDIHELFPDDEVENIVNAVRNEVKQLGIVDNRE  3007

Query  2951  NCWKFYIQRCRKLLKVVLCFSPVGSTLRIRGRKFPAVVSCTAIDWFHEWPKEALQSVSQK  3010
             NCWK++I++ R LLKVVLCFSPVG+TLR+R RKFPA+V+CT IDWFHEWP++AL+SVS +
Sbjct  3008  NCWKYFIEKVRSLLKVVLCFSPVGATLRVRSRKFPALVNCTTIDWFHEWPQQALESVSLR  3067

Query  3011  FLQDIEVLPKRIVDSVSNFMSYVHSVVNDMSVVYLQNEKRYNYTTPKTFLEQISLYSKLL  3070
             FL +I VLPK +   VSNFM++VH  VND+S +YL N KRYNYTTPK+FLE I+LYSKLL
Sbjct  3068  FLSEITVLPKELALPVSNFMAFVHKTVNDISKLYLANAKRYNYTTPKSFLELIALYSKLL  3127

Query  3071  TEKINFLEYSIIRLENGLLKLASTAEEVDGLKEVLAVQEVVLAEKNAAADKLIVVLGTEN  3130
              EK+       +RLENGL+KLAS  +EVD L++VL VQEV L  KN  AD LI+V+GTEN
Sbjct  3128  HEKVKANLDRRLRLENGLIKLASCTKEVDALQDVLKVQEVELKIKNQEADNLIIVVGTEN  3187

Query  3131  EKVETEKKIATEEEEKVKIIEEDVSVKAKICAADLAKAEPALLAAQEALNTLNKNNLTEL  3190
             EKV  E+  A++EE+ V+ IEEDV+ KAK+C  D  KA+PAL+AAQEALNTLNKNNLTEL
Sbjct  3188  EKVSKERAFASKEEKNVRQIEEDVTAKAKLCEEDFLKAQPALIAAQEALNTLNKNNLTEL  3247

Query  3191  KSFGTPPPAVVNVTAAVLVLF-SKGKIPKDRSWKECKMMMGKADQFLNDLIYYDKEHMSP  3249
             KSFG+PP AVV+V  AVLVLF SKGKIPKDRSWK C+  MG  D+FL++LI YDK+H+ P
Sbjct  3248  KSFGSPPDAVVSVCGAVLVLFSSKGKIPKDRSWKACRAFMGNVDKFLDNLINYDKKHIHP  3307

Query  3250  EVVKVTQEYLKDPEFLPEIILGKSAAAAGLCSWVINILKFYDVFVVVEPKRRALNKANQD  3309
             +V+K  Q Y+ D EF PE IL KS+AAAGLCSWVINI +FYDV++VVEPK RAL ++ ++
Sbjct  3308  DVIKALQPYILDAEFSPEKILAKSSAAAGLCSWVININRFYDVYLVVEPKERALLESEKE  3367

Query  3310  LEEARAKLVALNKKLDEFEQTLSVLRNDFEEATDAKLKCQAEADATALMIDLANRLVNGL  3369
             +++AR KL ALN +L E E+ L+ L+ +++EA   K KCQ EA  TA  ID+ANRL+ GL
Sbjct  3368  VKDARDKLTALNLRLTELEEQLNALQMEYDEALAKKQKCQDEASKTAFTIDIANRLIGGL  3427

Query  3370  ASEKVRWIASVANYKAAGVTMPGDVLLVTAFISYVGCFTRRYRLEMMNRYWLPFLQKLDV  3429
             A+EK+RW+ SV         +PGD+L+++ FISYVGCFTR YR E+  + W+P  +    
Sbjct  3428  ATEKIRWMESVKVLTFGIQQLPGDILIISCFISYVGCFTRAYRQELQEKLWMPAFKNSQP  3487

Query  3430  PIPMTEGLDPLSLLTDDARIAKWNNEGLPNDRMSSENATILENSARWPLMIDPQLQGIKW  3489
             PIP T+G+DP  ++ DDA+IA+WNN+GLP+DRMS+ENA IL  S R+PLMIDPQLQGIKW
Sbjct  3488  PIPSTDGVDPFEMICDDAQIAEWNNQGLPSDRMSAENAAILVQSERYPLMIDPQLQGIKW  3547

Query  3490  IKNKYGSQLTVIRLSMKNYLDTIERCISNGQVILLENVGETIDAVLDPILGRILIKKGKA  3549
             +K KYG+ L V+RLS +NYLD +ER +SNG V+L+EN+GE ID VL+P+LGR LIKKG  
Sbjct  3548  VKTKYGTGLVVLRLSQRNYLDQVERAVSNGSVLLIENIGENIDPVLNPLLGRQLIKKGTV  3607

Query  3550  IKIGDKDVDYDPRFRLIIHTKLANPHYKPEIQAQTTLINFTVTRDGLEEQLLAEVVKAER  3609
             +KIGD+++D++ RFRLI+HTKLANPHYKPE+QAQTTLINFTVTRDGLE+QLLAEVVK ER
Sbjct  3608  LKIGDREIDFNSRFRLILHTKLANPHYKPEMQAQTTLINFTVTRDGLEDQLLAEVVKVER  3667

Query  3610  PDLEHLKSNLTKQQNDFKITLKTCEDNLLERLSSATGNILGDVALVENLEKTKKTAADIQ  3669
             PDLE +++ LT+QQN FKITLK  ED+LL RLSSA  N+L DV LV NLEKTKKTA +I+
Sbjct  3668  PDLEAMRTRLTQQQNHFKITLKFLEDDLLARLSSAGDNVLEDVTLVMNLEKTKKTADEIE  3727

Query  3670  IKVAEAKVTSIKIDEAREQYRPAAIRGSLLYFILTDLNRINAIYQFSLKAFTVVFLNALV  3729
             +KVAEAK+T ++ID ARE YRPAA R S++YFIL DL +IN IYQFSLKAFTVVF NA++
Sbjct  3728  VKVAEAKITGVQIDSAREAYRPAAERASIIYFILNDLFKINPIYQFSLKAFTVVFNNAML  3787

Query  3730  RADPAEKLTQRVLNLLDSISFMVFMYTSRGLFECDKLIFLAQMTFQILLRENDILPSELD  3789
             +A  AEKL  RV NL+DSI+F  F+YTSRGLFE DKLIFL Q+  QIL+   ++ P+ELD
Sbjct  3788  KAMAAEKLKDRVENLIDSITFCSFVYTSRGLFEQDKLIFLTQLCIQILVNLGEVEPTELD  3847

Query  3790  FLLRFPALTVH-SPFDFLSNLCWGGIKALSGLDEFKNLDKDIEGSINRWRKFVESECPEK  3848
             FLLRFP +    S F +L+++ WGGI+AL+    FK L+KDIEGS  RW+KFV+SE PE 
Sbjct  3848  FLLRFPYMPNQTSNFTWLTHVGWGGIRALNNQAVFKGLEKDIEGSHKRWKKFVDSESPEN  3907

Query  3849  EKFPGEWKNKSALQRLCMMRALRPDRMTYAVSAFVDEKLGNKYIVARSVPFAKSYEETSS  3908
             EKFPGEWK KSA+QRLC+MR +RPDRM+YA+ +F++EKLG+KYI ARS+ F++++EE+S 
Sbjct  3908  EKFPGEWKGKSAIQRLCIMRCIRPDRMSYAMRSFIEEKLGSKYIDARSMEFSRTFEESSP  3967

Query  3909  ATPTFFILSPGVNPLKDVEALGKQLGFTFDNGNFHSVSLGQGQEIVAESAIDIATENGHW  3968
              T  FF+LSPGV+PLKDVE LGK LGF+FD+ NFHSVSLGQGQEIVAE+AI+IA++ GHW
Sbjct  3968  ETHIFFVLSPGVDPLKDVEKLGKSLGFSFDHENFHSVSLGQGQEIVAENAIEIASQYGHW  4027

Query  3969  VILQNIHLVARWLSSLEKKIEQTMDSSSPDYRLYLSAEPNSDPQICVIPQGILESSIKIT  4028
             VILQNIHLVARWL SLEKK+E ++ +    YRL+LSAEP  DP   ++PQGILES+IKIT
Sbjct  4028  VILQNIHLVARWLPSLEKKMESSLSNVHTSYRLFLSAEPAGDPAAHILPQGILESAIKIT  4087

Query  4029  NEPPTGMFANLHKALDNFNQETLEMCTKEAEFKAILFSLCYFHAVVAERRKFGPQGWNRN  4088
             NEPPTGM AN+HKALDNF+ ETLEMC+KE EFKAILFSLCYFHAVVAERRKFGPQGWNR+
Sbjct  4088  NEPPTGMMANIHKALDNFSDETLEMCSKETEFKAILFSLCYFHAVVAERRKFGPQGWNRS  4147

Query  4089  YPFNVGDLTISVNVLYNYLEGNTKVPWDDLRYLFGEIMYGGHITDDWDRRLCRTYLIEFM  4148
             YPFNVGDLTISV VLYNYLE NT+VPW+DLRYLFGEIMYGGHITDDWDRRLCRTYL EFM
Sbjct  4148  YPFNVGDLTISVYVLYNYLEANTRVPWEDLRYLFGEIMYGGHITDDWDRRLCRTYLEEFM  4207

Query  4149  QSELLDAELEFAPGFLAPPNTDYVGYHRYIDDRLPPESPYLYGLHPNAEIGFLTNLSDNL  4208
             Q EL+D ELE+  GF AP    Y GYH YIDD LP ESP LYGLH NAEIGFLT +S+ L
Sbjct  4208  QPELIDGELEYCQGFPAPGILKYTGYHNYIDDNLPSESPSLYGLHSNAEIGFLTTVSERL  4267

Query  4209  FKTIFELQPRDTGSSSGI-GISREDKVRCIIEDIIDKLPEEFRIVEMMAKVEDRTPFIIV  4267
             F+ +FELQPR TG SSG   +S+ED ++ IIEDI+DK P  F I+E+M +VEDR+P+IIV
Sbjct  4268  FRIVFELQPRMTGGSSGGETVSQEDIIKNIIEDILDKTPTPFNILELMGRVEDRSPYIIV  4327

Query  4268  AFQECERMNMLTKEMRRSLKELELGLKGELTITSVMEVLEESLFMDYVPESWAVKAYPSM  4327
             AFQECERMN L  E++RSL EL+LGLKGELTI+SVME L   L+MD VPE W   AYPSM
Sbjct  4328  AFQECERMNNLMTELKRSLNELDLGLKGELTISSVMEDLMVCLYMDQVPEQWTKLAYPSM  4387

Query  4328  LPLGQWVGDLSIRIKELEGWVGDFQMPPAVWLGGFFNPQSFLTAIMQQTARKNEWPLDKM  4387
             L L  W  DL +R++ELEGWV DF+MP ++WL GFFNPQS LTAIMQQTARKNEWPLD+M
Sbjct  4388  LGLQSWFSDLMLRLRELEGWVADFRMPSSIWLAGFFNPQSLLTAIMQQTARKNEWPLDRM  4447

Query  4388  CLLTDVTKKQREDLTTTPREGANVCGLYMEGARWDTASGSIADSKLKDLFPVVPVIYIKA  4447
             CL  DVTKK +E+LTT PREGA + GL+MEGARWD   G+IAD+ LK+LFP +PV+YIKA
Sbjct  4448  CLNCDVTKKWKEELTTAPREGAYINGLFMEGARWDMKMGTIADAFLKELFPAMPVLYIKA  4507

Query  4448  ITQDKQDLKNMYDCPVYKTRSRGPTFVWTFNLKTKEKATKWTLAGVALLLQV  4499
             +TQDKQD+KN+Y+CPVYK R RGPTFVWTFNLK++E+A+KWTLAGV LLLQ 
Sbjct  4508  VTQDKQDIKNVYECPVYKIRLRGPTFVWTFNLKSRERASKWTLAGVCLLLQT  4559


>Q9U3Y5_DROME unnamed protein product
Length=4559

 Score = 5256 bits (13635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 2618/4551 (58%), Positives = 3374/4551 (74%), Gaps = 68/4551 (1%)

Query  2     KTLKMKMEKWNKMWSTDEYARIILNFFNNPNVPRLIMITSAAGQLMPVTEFPNNLKTKSS  61
             KT+++K++KW KM +T+E+  +I+ F NNPN  R+I   ++ GQL P   FP   + K +
Sbjct  24    KTMRLKLDKWTKMITTNEFRDVIIEFLNNPNKKRIIFTINSGGQLYPSYSFPVRPRYKVA  83

Query  62    YFIRKKKEV-VTRDNIREVLLIGDMSPKPVEEIAVLVEEVFLPVLSNPANQTKWPAVIAA  120
             YFIR    + +T +N+   LLIGD+ P P+  +++L +EVF P+L+N  NQ  W  VIA 
Sbjct  84    YFIRYLTPLHLTDENMLNSLLIGDLLPNPLANLSILCDEVFFPLLNNTVNQVGWTNVIAN  143

Query  121   DITKHVYAFRNKVYQIKGALKSQTLLPMPTGVERIYEATLLLQQSHGKEVDLSLKTAIEG  180
             D+       RN + Q+KG + ++T+ P+P  ++ + +A   +       V+  +K ++E 
Sbjct  144   DMKTESQEMRNGIAQMKGLVINRTIFPLPICMDEVMQAAPAIAMGDISVVNPLMKHSLEF  203

Query  181   AVLQWASLCNDVLQ-QTSDAAFAHGQNPIPSAEINFWNSRLKNLESIFDQLRDPRVKRMV  239
              V++W     D++  +  +  ++    P+P A  +FW SRL+NLE++ +QL D R+K + 
Sbjct  204   MVVKWLDSVEDLVNIKAGEKIYSKENFPLPEAIFSFWESRLENLENLAEQLGDRRIKTIG  263

Query  240   LYLELAGSSYLSCFKCVFQDVVAGVIEAKNICLYLKPMKTHFEKFEDGEFLESEPYIRPM  299
               LE   S +   ++ + + V+  + EA++I   L P+K   +KFE  +  E+   IRP+
Sbjct  264   FVLEKIQSIFEHSYRRIVELVLESLAEARDITKCLSPLKRKMDKFETNDMDENRSDIRPL  323

Query  300   VHCLGLLWANSCYYCTNTKITTLLKEVANLFISAITAQLDPSTIFQGEPEDMVKKINTCL  359
             +  +GL+W +S Y+ T   IT       N  I  +   ++P +IFQG+ ++  KK++  +
Sbjct  324   MLTIGLVWGHSRYFHTLNNITLFFNLFHNSLIDCVNRTVEPDSIFQGDVDEAYKKLDINM  383

Query  360   RLINIFRISFEEVRANLASYFKTPDIQPKPWTFHQRTVFQRLMDFVERLELVKSILLAAI  419
             + +  +++ + E R +L  +        + WT+HQ  +F RL  F+ RLE +K +     
Sbjct  384   QHLEYYKLIYNECRNSLKKFKIGTTFNSQDWTWHQDEIFGRLDKFLVRLEELKDLFNTVR  443

Query  420   EYQKLERIEIGGIKGRLLSKRCEDLLEEFNYAYANFVTIQYDLLDPLHMAIVAENEQFLI  479
             ++QKLE+I +GG+KGR ++   E +LEE+N  Y  +  IQY+ +DP     + + ++   
Sbjct  444   DFQKLEKIVMGGLKGRQITFALEKILEEYNSIYREWTNIQYNPIDPDAENSLFQRDRLSF  503

Query  480   KCN-DMDSRLASI-FEQVLDDCHNLESIFKFVNIANTLVERPIIYNAIKDKFYKIIEIFN  537
             K N D+  R+ S  FE+ L+D H+L         A +L+ RPII   ++   + I++ F 
Sbjct  504   KANTDVMERMVSFQFEKGLEDTHDLLL-------AGSLLLRPIIKKHVEPLMHVIVDDFE  556

Query  538   RELDTVKE-------VYDEGKREGVPINNYFPPTAGVLCWLHKLRQRIVKQGEDFKMFQN  590
              E+  VK+       V+       +P ++ FP  +G + +L KLR RI+   ++ ++++ 
Sbjct  557   EEIMCVKKEFINFKNVFTALGLNELPTDDCFPKVSGAISFLKKLRHRIIGLHKEHELYEY  616

Query  591   KLVESPDALEAFSKWEEMQHILDAEEARVLSLWS----QSIPSQITASLSKMQLFKSGEQ  646
              L ++         +  M   +D     +L  W+    Q I   IT +L +        +
Sbjct  617   PLFDNERGGYVSDIFNIMVQEIDDFTKMLLDKWTVECWQGIQQDITLTLIEKD---EANE  673

Query  647   ISVNFDKELEAILREVKYMKLLGIENIPEVALALYERNEELFISMQHLNNISEWYNHLKN  706
             + VNF + L   L+++K ++LLG + +       + R +EL+ +   L  I+EWYN    
Sbjct  674   LRVNFTERLIFALKDIKVVRLLGCD-VSVNLTKFFCREDELWQARVKLMRIAEWYNDTFE  732

Query  707   KSLPVEYELIRSEVEELDLRLDELIYQLNWTTDNFELIKTIYDALKQLYDRVMEAQRNVN  766
             ++ P E  LI +E+  ++ ++  L+  + W   +   I  I+  +K L+DR++ AQ N+ 
Sbjct  733   RAHPTEKRLIAAEMILIEEQMKPLLDFIKWNAFSQRFIVMIFKMVKYLHDRLVAAQENLE  792

Query  767   NIIAEINLWGEEPLFERKDRNSHCLLYVEDRVERVHKRYSQITATSLSIEKVMELNYKLF  826
              I   I  WG+ PLF+RKD N   LL+ + R   +  R +    T   I+ +M +N KLF
Sbjct  793   AIKESIRSWGKVPLFQRKDLNPALLLHTDPREPILSIRAANAADTQRLIDLLMYVNLKLF  852

Query  827   FNIPD----PPPDPVEEPKVEEP--PP-------EPVKDKKEKDKGKKAADKGKKQKTEE  873
             F+IP     PP +  EE +  +   PP         VK KK+++   +  D  + ++ + 
Sbjct  853   FDIPRRYSLPPGEHGEEDEESDGIWPPIISLSVMTSVKFKKKREVIDEEDDLEEFEEEQS  912

Query  874   EEKPVEEPPVDE-QALRRLN-----LWEPYEAFIDELVSQSLRQAV-SVSLELLVKATES  926
             E +     P    + L+ L+     L+  YE ++DE+++++L  +V + S  L ++    
Sbjct  913   ESEEEIITPFHRYELLKGLSQEERALFREYEIYVDEIIAENLVDSVITSSTYLRMEVDNR  972

Query  927   NPNLYPLFELLLKLIDTNVVFIPSIDLEDTDNFLSFVESLIEDMRKMGIFMKRVKK----  982
               N  P+FE+ ++L + NVV+  ++D      F  F+E++++DM  M   +KRV +    
Sbjct  973   YENNTPIFEIFMELQEPNVVYFRNLDTSSKTGFAFFIETILDDMNNMMSLLKRVAQDPTE  1032

Query  983   --NADPDYFNDVCED-PEITSMMEIVVSRVTQAMELAMEYTTVFDDFSNLWLDNRQEFLR  1039
               N +P  F D  +D  E+      +++++ +A++    +   F +FS+LW+ ++  +L 
Sbjct  1033  VTNMNPYSFYDELQDKSELDKQRVEIMNKIKRALQAWRVHGKGFMEFSSLWIWDKSTYLS  1092

Query  1040  QFLLYGRPLTAEELDIEQD-ETSGGLKSTP---PIVSQFKEQIDFFEEMYKTVEQLETEK  1095
             +   +GR LT +E D E D E S G+K      P +S +KEQ+D F E+   +   ET +
Sbjct  1093  EVKKFGRNLTLDERDAEADLEGSSGVKLLGLEYPRLSVYKEQLDKFIELQDQIRTWETYE  1152

Query  1096  IILGWLRIDARPIRQAILNTVGKWGNMFKQHLYDHVINSISELENFIQEAIAGMQVQLTE  1155
                 +LR++    + A+L+ VG+W ++FK  L + V NS+ EL++F+ EA   ++++L +
Sbjct  1153  DFFVFLRLNMTGFKVAVLSQVGQWISLFKLDLINRVKNSLKELQDFVDEANIVLKIELQK  1212

Query  1156  DDYEGLLKVMAFLVKIRDMQAATDVMFGPLKDIIALLKDYGVEFSEETYVQLQELPDKWL  1215
             DD+EGL+K+++ L +I + Q   D MF PLK+II LL+ Y  EF +    Q+ ELPD W+
Sbjct  1213  DDFEGLVKILSVLNQINEKQCIYDSMFDPLKEIIDLLRQYNYEFKDTELAQINELPDAWM  1272

Query  1216  TCKKVAVQTKQAVGPLQTIQIAAIRRRIALFDVRQAMSRDAFRKMPFFLWGCQHVYALFD  1275
               K++A  TKQ + P+Q+ Q+  I +RI L D      R  F    FF   C   Y L D
Sbjct  1273  KVKRLAATTKQLIAPIQSYQVNLIEKRILLCDNMANTYRKKFLSKKFFFVPCLSCYELID  1332

Query  1276  KVHKELSDFEVELKKLSEQSNLFDLQMSEYKSLKVTRKELKQIKQLWDFVNIVMSSINEW  1335
             +   EL   E   + L+E + LF+LQ  +   +++ R +LK +K +WDF   + S+IN+W
Sbjct  1333  ESDLELVALEERQRSLAESAVLFELQGPDPVKIELCRFDLKLVKIMWDFAITIQSTINDW  1392

Query  1336  KTTPWKKIDVEGMEMELKKFGKETRLMDKEVRGWNVYIEMEATIKNMLTSLRAVTELQNP  1395
             K TPWKKID+E M+ E KKFG+E R +DK ++ W  +I MEA++KN++TSLRAVTELQNP
Sbjct  1393  KKTPWKKIDIENMDQECKKFGRELRGLDKAMQTWEPFIFMEASLKNLMTSLRAVTELQNP  1452

Query  1396  AIRDRHWIQLMQATKVKFVLDDETTLSDLLDLNLHEYEEEVKTIVDKSVKEMAMEKSLKE  1455
             AIRDRHWI+LMQ TKVKF +DD TTL DL+DLNLHEYEEEVK IVDKSVKEMAMEK L++
Sbjct  1453  AIRDRHWIELMQTTKVKFSMDDSTTLKDLIDLNLHEYEEEVKNIVDKSVKEMAMEKQLRD  1512

Query  1456  FNQNWNVLEFDTEIHDRSKIRLLKIAEETIEILEDNQVQLQNMMTSKFIQFFQKEVLEWQ  1515
                 W  +EF T+IHDR+ I+LLK +EE IE LED+Q QLQNM +SK+I FF+ EV  WQ
Sbjct  1513  IATAWGTMEFGTDIHDRTSIKLLKASEELIETLEDHQGQLQNMASSKYIAFFEHEVRLWQ  1572

Query  1516  QKLSNADQVIQVFFEVQRKWCYLESIFIGSEDIRAQLPEDSKRFDKIDREFKEILNEMVR  1575
              +LSNADQ+I  +FEVQRKW YLESIFIGSEDIR+QLPEDS+RFD ID+EFK +L +M  
Sbjct  1573  NRLSNADQIIGSWFEVQRKWQYLESIFIGSEDIRSQLPEDSRRFDYIDKEFKALLAQMNA  1632

Query  1576  TLNIVRATSKPG--LATRLERILDDLLLCEKALNNYLETKRLAFPRFYFVSSADLLDILS  1633
               N+VR+T++ G  L   LE +L  LLL +KALN+YLETKRL++PRFYFVSSADLLDILS
Sbjct  1633  DRNVVRSTNRSGSKLYEHLEILLKMLLLSQKALNDYLETKRLSYPRFYFVSSADLLDILS  1692

Query  1634  TGNQPPLVARHLTKLFDSLAKLRFAMEGGKESKRSNAMGSKENDEWVPFLNHCDCSGKVE  1693
              GN P LVARHLTKL+DS+ KL   + G   SK +  M +KE +E+VPFL +CDCSGKVE
Sbjct  1693  NGNNPALVARHLTKLYDSMGKLNL-ISG---SKNAAGMVAKELEEYVPFLENCDCSGKVE  1748

Query  1694  VWLNRVIDIMRVTLHRSFSEAVTSYDEKPRELWIFDYPAQPALCGTQIWWTTEVNIAFAR  1753
             VWLNR+ D MR TL      ++T YD KPR +WIF++PAQPAL GTQI WTTE N AFA+
Sbjct  1749  VWLNRITDKMRDTLRDQLKRSLTFYDHKPRHVWIFEWPAQPALVGTQIMWTTETNDAFAK  1808

Query  1754  LEEGYENALKDYQKKQIAQLNALITLLLGDLTVGERQKIMTICTIDVHSRDVVAKMIQVK  1813
             +++ YENALKDY KKQI QLN LI LLLGDLT  ERQKIMTICTIDVHSRDVV  +I  K
Sbjct  1809  VQQRYENALKDYNKKQITQLNNLIILLLGDLTAAERQKIMTICTIDVHSRDVVGTIIAKK  1868

Query  1814  VENSQAFQWQSQLRHRWDTKVNNCFANICDAQFLYQYEYLGNSPRLVITPLTDRCYITLT  1873
             VE   AFQWQSQLRHRWD K+++CFANICDAQF Y YEYLGN+PRLVITPLTDRCYITLT
Sbjct  1869  VEVQTAFQWQSQLRHRWDPKIDDCFANICDAQFRYDYEYLGNTPRLVITPLTDRCYITLT  1928

Query  1874  QSLHLIMGGAPAGPAGTGKTETTKDLGKALGMMVYVFNCSEQMDYKSVGNIYKGLAQTGT  1933
             QSLHL+MGGAPAGPAGTGKTETTKDLG+ALGMMVYVFNCSEQMDYKS+G+I+KGLAQTG 
Sbjct  1929  QSLHLVMGGAPAGPAGTGKTETTKDLGRALGMMVYVFNCSEQMDYKSIGDIHKGLAQTGA  1988

Query  1934  WGCFDEFNRISVEVLSVVAVQVKTIQDAVKVKKARFNFLGEEISLIPTIGIFITMNPGYA  1993
             WGCFDEFNRISVEV SVVAVQVK IQDA+K KK  F+FLGE I+L  T+G+FITMNPGYA
Sbjct  1989  WGCFDEFNRISVEVGSVVAVQVKCIQDAIKSKKQTFSFLGEHIALRTTVGVFITMNPGYA  2048

Query  1994  GRTELPENLKALFRPCAMVVPDFALICEIMLVAEGFQEARLLARKFITLYTLCKELLSKQ  2053
             GR ELPENLKAL+RPCAMVVPDFALI EIMLVAEGFQEARLLARKFITLYTLCKELLSKQ
Sbjct  2049  GRAELPENLKALYRPCAMVVPDFALISEIMLVAEGFQEARLLARKFITLYTLCKELLSKQ  2108

Query  2054  DHYDWGLRAIKSVLVVAGALRRGDRLRPEDQVLMRALRDFNIPKIVTDDVPVFMGLIGDL  2113
             DHYDWGLRAIKSVLVVAGALRR DR RPEDQVLMRALRDFNIPKIVTDDVPVFMGLIGDL
Sbjct  2109  DHYDWGLRAIKSVLVVAGALRRDDRQRPEDQVLMRALRDFNIPKIVTDDVPVFMGLIGDL  2168

Query  2114  FPALDVPRKRSLEFEKLAKASAVDLKLQPEDGFILKVVQLEELFAVRHSVFVLGFAGTGK  2173
             FPALDVPRKR+ EFE + K SA+DLKLQPEDGFILK+VQLEELFAVRHSVF++GFAGTGK
Sbjct  2169  FPALDVPRKRNPEFEAVIKRSALDLKLQPEDGFILKIVQLEELFAVRHSVFIIGFAGTGK  2228

Query  2174  TCVWKTLNRTYYNQKLKPYYNDLNPKAVTNDELFGIINPATREWKDGLFSVIMRDQANMS  2233
             + VWKTLN+TY NQK KP+YNDLNPKAVTNDELFGI+NP TRE KDGLFS++MRDQAN  
Sbjct  2229  SEVWKTLNKTYQNQKRKPHYNDLNPKAVTNDELFGIVNPLTREGKDGLFSILMRDQANHG  2288

Query  2234  GDGPKWIVLDGDIDPMWIESLNTLMDDNKVLTLASNERIALTRAMRLLFEIANLRTATPA  2293
             G GPKWIVLDGDIDPM IESLNT+MDDNKVLTLASNERIALT+ MRLLFEIA+LRTATPA
Sbjct  2289  GTGPKWIVLDGDIDPMCIESLNTVMDDNKVLTLASNERIALTKEMRLLFEIASLRTATPA  2348

Query  2294  TVSRAGILYINPADLGWNPYIASWIDTR-NENEKANLMILFDKYIPPCLEMVKTKLKKIT  2352
             TVSRAGILYINP DLGW P+I SW+ TR N +E + L +LFDKY+PP L++ +T+L+ IT
Sbjct  2349  TVSRAGILYINPQDLGWTPFIQSWLGTRTNSSEVSMLNVLFDKYVPPLLDIFRTRLRSIT  2408

Query  2353  PIVDIAHIHMLCFLLDCFLTYQNVPPECPKEWYEIYFVFALIWAFGSALFQDQIIDWRNE  2412
             PI DIA + M C+LLD  LT QNVP +CPK+WYEIYFVF ++W FGS+LFQDQIIDW NE
Sbjct  2409  PISDIARLQMTCYLLDSMLTPQNVPNDCPKDWYEIYFVFCIVWGFGSSLFQDQIIDWSNE  2468

Query  2413  FSKWFTNEFKTVKFPTAGTVFHYYIDQETKKFMPWSDLTPSFELDPDIPLQATLVNTAET  2472
             FSKWF NE+K VKFP +GT+F +YID ETKKF PW++L P FELD D+PLQ+ LVNTAET
Sbjct  2469  FSKWFLNEYKAVKFPLSGTIFSFYIDHETKKFFPWTNLVPQFELDMDLPLQSNLVNTAET  2528

Query  2473  VRVRYFMDKLIAHKHPVMLIGGAGSGKTVLVSDKLSSL-SEGYAVTNVPFNFYTTSEMLQ  2531
              R+R+FMD LI   HP+MLIG +GSGKT+L++ KLS+L S+ Y+VTNVPFNFYTTSEMLQ
Sbjct  2529  TRLRFFMDTLIEADHPLMLIGPSGSGKTILMNAKLSALPSDKYSVTNVPFNFYTTSEMLQ  2588

Query  2532  RVLENPLEKKAGRVYGPPGTKTMIYFIDDMNMPEVDKYFTVQPHTLLRQWMDYQHWYDRQ  2591
             R+LE PLEKKAGR YGP G K MIYF+DDMNMPEVDKYFTVQPHTL+RQ+MDY HWYDRQ
Sbjct  2589  RILEKPLEKKAGRNYGPIGNKRMIYFVDDMNMPEVDKYFTVQPHTLIRQFMDYHHWYDRQ  2648

Query  2592  KLSLKDIHNIQFISCMNPTAGSFTIDPRLQRHFCVFAISFPTQDACYHIYSNIFSQHLTN  2651
             K++L+DIH    ++CMNP+AGSFTIDPRLQRHFC FA++ P+QDA +HI ++I SQH+ N
Sbjct  2649  KMTLRDIHKCNIVACMNPSAGSFTIDPRLQRHFCSFAVNPPSQDALFHILNSILSQHMDN  2708

Query  2652  PLNKFPYSLHSLSVNVVTAALTLHSRVAQTFLPTAVKFHYVFNLRDLSNLFQGMLFANGD  2711
             P+ KF  ++  L  N+VT A+TLH +V  +FLPTA+KFHY FNLRD++N+F G+L++N +
Sbjct  2709  PIQKFDKAVIKLCENMVTTAITLHLKVVSSFLPTAIKFHYNFNLRDIANIFTGVLYSNSE  2768

Query  2712  TAPNQSALIRLWMHESYRVYGDKLVERRDQDTFSKLVVEVLKKGFEELEEVEVMAKPLIF  2771
             T PN + +IRLW+HE YRVYGDKLV+  D ++F K+V ++++KG E + +  V A+PLI+
Sbjct  2769  TCPNSNQMIRLWIHECYRVYGDKLVDYTDINSFKKIVSDIVRKGIEGVNDDVVYAQPLIY  2828

Query  2772  CHFADGLGDPKYLPIQNYTVLTRLLNEALAGYNDLVSAMNLVLFEDAMNHICRINRIMEA  2831
             CHFA GL D KY+PI  +  L  LL+EA   YND + AMNLVLF+DAM+H+CRI+RI+E+
Sbjct  2829  CHFAKGLTDIKYMPISGWDRLKSLLDEAQDRYNDYIGAMNLVLFDDAMSHVCRISRILES  2888

Query  2832  PRGNALLVGVGGSGKQSLTRLAAFISSLEVFQVQLKKGFNMSDLKANIAALYVKAGLKNI  2891
              RG ALL+GVGGSGKQSLTRLA+FISSL+VFQ+QL K +++SDLKANIA LY+KAG+K  
Sbjct  2889  SRGYALLIGVGGSGKQSLTRLASFISSLDVFQIQLTKDYSVSDLKANIATLYMKAGVKTS  2948

Query  2892  STVFLMTDAQVAEEAWLVVINDMLASGEIPDLLQDEEVENILNVVRGEVKASGVDDTKEN  2951
             +  FLMTD++VA E +LV++ND+LASG+I +L  D+EVENI+N VR EVK  G+ D +EN
Sbjct  2949  ACCFLMTDSEVAREQFLVLVNDLLASGDIHELFPDDEVENIVNAVRNEVKQLGIVDNREN  3008

Query  2952  CWKFYIQRCRKLLKVVLCFSPVGSTLRIRGRKFPAVVSCTAIDWFHEWPKEALQSVSQKF  3011
             CWK++I++ R LLKVVLCFSPVG+TLR+R RKFPA+V+CT IDWFHEWP++AL+SVS +F
Sbjct  3009  CWKYFIEKVRSLLKVVLCFSPVGATLRVRSRKFPALVNCTTIDWFHEWPQQALESVSLRF  3068

Query  3012  LQDIEVLPKRIVDSVSNFMSYVHSVVNDMSVVYLQNEKRYNYTTPKTFLEQISLYSKLLT  3071
             L +I VLPK +   VSNFM++VH  VND+S +YL N KRYNYTTPK+FLE I+LYSKLL 
Sbjct  3069  LSEITVLPKELALPVSNFMAFVHKTVNDISKLYLANAKRYNYTTPKSFLELIALYSKLLH  3128

Query  3072  EKINFLEYSIIRLENGLLKLASTAEEVDGLKEVLAVQEVVLAEKNAAADKLIVVLGTENE  3131
             EK+       +RLENGL+KLAS  +EVD L++VL VQEV L  KN  AD LI+V+GTENE
Sbjct  3129  EKVKANLDRRLRLENGLIKLASCTKEVDALQDVLKVQEVELKIKNQEADNLIIVVGTENE  3188

Query  3132  KVETEKKIATEEEEKVKIIEEDVSVKAKICAADLAKAEPALLAAQEALNTLNKNNLTELK  3191
             KV  E+  A++EE+ V+ IEEDV+ KAK+C  D  KA+PAL+AAQEALNTLNKNNLTELK
Sbjct  3189  KVSKERAFASKEEKNVRQIEEDVTAKAKLCEEDFLKAQPALIAAQEALNTLNKNNLTELK  3248

Query  3192  SFGTPPPAVVNVTAAVLVLF-SKGKIPKDRSWKECKMMMGKADQFLNDLIYYDKEHMSPE  3250
             SFG+PP AVV+V  AVLVLF SKGKIPKDRSWK C+  MG  D+FL++LI YDK+H+ P+
Sbjct  3249  SFGSPPDAVVSVCGAVLVLFSSKGKIPKDRSWKACRAFMGNVDKFLDNLINYDKKHIHPD  3308

Query  3251  VVKVTQEYLKDPEFLPEIILGKSAAAAGLCSWVINILKFYDVFVVVEPKRRALNKANQDL  3310
             V+K  Q Y+ D EF PE IL KS+AAAGLCSWVINI +FYDV++VVEPK RAL ++ +++
Sbjct  3309  VIKALQPYILDAEFSPEKILAKSSAAAGLCSWVININRFYDVYLVVEPKERALLESEKEV  3368

Query  3311  EEARAKLVALNKKLDEFEQTLSVLRNDFEEATDAKLKCQAEADATALMIDLANRLVNGLA  3370
             ++AR KL ALN +L E E+ L+ L+ +++EA   K KCQ EA  TA  ID+ANRL+ GLA
Sbjct  3369  KDARDKLTALNLRLTELEEQLNALQMEYDEALAKKQKCQDEASKTAFTIDIANRLIGGLA  3428

Query  3371  SEKVRWIASVANYKAAGVTMPGDVLLVTAFISYVGCFTRRYRLEMMNRYWLPFLQKLDVP  3430
             +EK+RW+ SV +       +PGD+L+++ FISYVGCFTR YR E+  + W+P  +    P
Sbjct  3429  TEKIRWMESVKSLTFGIQQLPGDILIISCFISYVGCFTRAYRQELQEKLWMPAFKNSQPP  3488

Query  3431  IPMTEGLDPLSLLTDDARIAKWNNEGLPNDRMSSENATILENSARWPLMIDPQLQGIKWI  3490
             IP T+G+DP  ++ DDA+IA+WNN+GLP+DRMS+ENA IL  S R+PLMIDPQLQGIKW+
Sbjct  3489  IPSTDGVDPFEMICDDAQIAEWNNQGLPSDRMSAENAAILVQSERYPLMIDPQLQGIKWV  3548

Query  3491  KNKYGSQLTVIRLSMKNYLDTIERCISNGQVILLENVGETIDAVLDPILGRILIKKGKAI  3550
             K KYG+ L V+RLS +NYLD +ER +SNG V+L+EN+GE ID VL+P+LGR LIKKG  +
Sbjct  3549  KTKYGTGLVVLRLSQRNYLDQVERAVSNGSVLLIENIGENIDPVLNPLLGRQLIKKGTVL  3608

Query  3551  KIGDKDVDYDPRFRLIIHTKLANPHYKPEIQAQTTLINFTVTRDGLEEQLLAEVVKAERP  3610
             KIGD+++D++ RFRLI+HTKLANPHYKPE+QAQTTLINFTVTRDGLE+QLLAEVVK ERP
Sbjct  3609  KIGDREIDFNSRFRLILHTKLANPHYKPEMQAQTTLINFTVTRDGLEDQLLAEVVKVERP  3668

Query  3611  DLEHLKSNLTKQQNDFKITLKTCEDNLLERLSSATGNILGDVALVENLEKTKKTAADIQI  3670
             DLE +++ LT+QQN FKITLK  ED+LL RLSSA  N+L DV LV NLEKTKKTA +I++
Sbjct  3669  DLEAMRTRLTQQQNHFKITLKFLEDDLLARLSSAGDNVLEDVTLVMNLEKTKKTADEIEV  3728

Query  3671  KVAEAKVTSIKIDEAREQYRPAAIRGSLLYFILTDLNRINAIYQFSLKAFTVVFLNALVR  3730
             KVAEAK+T ++ID ARE YRPAA R S++YFIL DL +IN IYQFSLKAFTVVF NA+++
Sbjct  3729  KVAEAKITGVQIDSAREAYRPAAERASIIYFILNDLFKINPIYQFSLKAFTVVFNNAMLK  3788

Query  3731  ADPAEKLTQRVLNLLDSISFMVFMYTSRGLFECDKLIFLAQMTFQILLRENDILPSELDF  3790
             A  AEKL  RV NL+DSI+F  F+YTSRGLFE DKLIFL Q+  QIL+   ++ P+ELDF
Sbjct  3789  AMAAEKLKDRVENLIDSITFCSFVYTSRGLFEQDKLIFLTQLCIQILVNLGEVEPTELDF  3848

Query  3791  LLRFPALTVH-SPFDFLSNLCWGGIKALSGLDEFKNLDKDIEGSINRWRKFVESECPEKE  3849
             LLRFP +    S F +L+++ WGGI+AL+    FK L+KDIEGS  RW+KFV+SE PE E
Sbjct  3849  LLRFPYMPNQTSNFTWLTHVGWGGIRALNNQAVFKGLEKDIEGSHKRWKKFVDSESPENE  3908

Query  3850  KFPGEWKNKSALQRLCMMRALRPDRMTYAVSAFVDEKLGNKYIVARSVPFAKSYEETSSA  3909
             KFPGEWK KSA+QRLC+MR++RPDRM+YA+ + ++EKLG+KYI ARS+ F++++EE+S  
Sbjct  3909  KFPGEWKGKSAIQRLCIMRSIRPDRMSYAMRSLIEEKLGSKYIDARSMEFSRTFEESSPE  3968

Query  3910  TPTFFILSPGVNPLKDVEALGKQLGFTFDNGNFHSVSLGQGQEIVAESAIDIATENGHWV  3969
             T  FF+LSPGV+PLKDVE LGK LGF+FD+ NFHSVSL QGQEIVAE+AI+IA++ GHWV
Sbjct  3969  THIFFVLSPGVDPLKDVEKLGKSLGFSFDHENFHSVSLCQGQEIVAENAIEIASQYGHWV  4028

Query  3970  ILQNIHLVARWLSSLEKKIEQTMDSSSPDYRLYLSAEPNSDPQICVIPQGILESSIKITN  4029
             ILQNIHLVARWL SLEKK+E ++ +    YRL+LSAEP  DP   ++PQGILES+IKITN
Sbjct  4029  ILQNIHLVARWLPSLEKKMESSLSNVHTSYRLFLSAEPAGDPAAHILPQGILESAIKITN  4088

Query  4030  EPPTGMFANLHKALDNFNQETLEMCTKEAEFKAILFSLCYFHAVVAERRKFGPQGWNRNY  4089
             EPPTGM AN+HKALDNF+ ETLEMC+KE EFKAILFSLCYFHAVVAERRKFGPQGWNR+Y
Sbjct  4089  EPPTGMMANIHKALDNFSDETLEMCSKETEFKAILFSLCYFHAVVAERRKFGPQGWNRSY  4148

Query  4090  PFNVGDLTISVNVLYNYLEGNTKVPWDDLRYLFGEIMYGGHITDDWDRRLCRTYLIEFMQ  4149
             PFNVGDLTISV VLYNYLE NT+VPW+DLRYLFGEIMYGGHITDDWDRRLCRTYL EFMQ
Sbjct  4149  PFNVGDLTISVYVLYNYLEANTRVPWEDLRYLFGEIMYGGHITDDWDRRLCRTYLEEFMQ  4208

Query  4150  SELLDAELEFAPGFLAPPNTDYVGYHRYIDDRLPPESPYLYGLHPNAEIGFLTNLSDNLF  4209
              EL+D ELE+  GF AP    Y GYH YIDD LP ESP LYGLH NAEIGFLT +S+ LF
Sbjct  4209  PELIDGELEYCQGFPAPGILKYTGYHNYIDDNLPSESPSLYGLHSNAEIGFLTTVSERLF  4268

Query  4210  KTIFELQPRDTGSSSGI-GISREDKVRCIIEDIIDKLPEEFRIVEMMAKVEDRTPFIIVA  4268
             + +FELQPR TG SSG   +S+ED ++ IIEDI+DK P  F I+E+M +VEDR+P+IIVA
Sbjct  4269  RIVFELQPRMTGGSSGGETVSQEDIIKNIIEDILDKTPTPFNILELMGRVEDRSPYIIVA  4328

Query  4269  FQECERMNMLTKEMRRSLKELELGLKGELTITSVMEVLEESLFMDYVPESWAVKAYPSML  4328
             FQECERMN L  E++RSL EL+LGLKGELTI+SVME L   L+MD VPE W   AYPSML
Sbjct  4329  FQECERMNNLMTELKRSLNELDLGLKGELTISSVMEDLMVCLYMDQVPEQWTKLAYPSML  4388

Query  4329  PLGQWVGDLSIRIKELEGWVGDFQMPPAVWLGGFFNPQSFLTAIMQQTARKNEWPLDKMC  4388
              L  W  DL +R++ELEGWV DF+MP ++WL GFFNPQS LTAIMQQTARKNEWPLD+MC
Sbjct  4389  GLQSWFSDLMLRLRELEGWVADFRMPSSIWLAGFFNPQSLLTAIMQQTARKNEWPLDRMC  4448

Query  4389  LLTDVTKKQREDLTTTPREGANVCGLYMEGARWDTASGSIADSKLKDLFPVVPVIYIKAI  4448
             L  DVTKK +E+LTT PREGA + GL+MEGARWD   G+IAD+ LK+LFP +PV+YIKA+
Sbjct  4449  LNCDVTKKWKEELTTAPREGAYINGLFMEGARWDMKMGTIADAFLKELFPAMPVLYIKAV  4508

Query  4449  TQDKQDLKNMYDCPVYKTRSRGPTFVWTFNLKTKEKATKWTLAGVALLLQV  4499
             TQDKQD+KN+Y+CPVYK R RGPTFVWTFNLK++E+A+KWTLAGV LLLQ 
Sbjct  4509  TQDKQDIKNVYECPVYKIRLRGPTFVWTFNLKSRERASKWTLAGVCLLLQT  4559


>Q9VDG0_DROME unnamed protein product
Length=4486

 Score = 4906 bits (12725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 2349/3613 (65%), Positives = 2882/3613 (80%), Gaps = 7/3613 (0%)

Query  893   LWEPYEAFIDELVSQSLRQAVSVSLELLVKATESNPNLYPLFELLLKLIDTNVVFIPSID  952
             +W  Y  F+D +V +++ + V VS+  L +  +   N  PLFE  L+L++ N+VF+PS+D
Sbjct  875   VWLSYVDFVDNIVYENILKTVGVSVGYLAENMDPENNYAPLFESRLELVEPNLVFVPSLD  934

Query  953   LEDTDNFLSFVESLIEDMRKMGIFMKRVKKNADPDYFNDVCEDPEITSMMEIVVSRVTQA  1012
              ED   F + +  L+ D+ KMG  +KR+K N   +Y   + E+ +I  M   +++ V   
Sbjct  935   PEDPMGFNNMLIELMRDIMKMGSLIKRLKPNEKRNYVEMIKENQDIIDMRREILNGVDLV  994

Query  1013  MELAMEYTTVFDDFSNLWLDNRQEFLRQFLLYGRPLTAEELDIE--QDETSGGLKSTPPI  1070
             ME A  +   F+ +S LWLD+R+E +  FL YGR L  +E+++    D      +   P 
Sbjct  995   MEEASRFCRQFERYSYLWLDDREECMEYFLEYGRMLDPDEIELILINDPNQPPPQPCQPT  1054

Query  1071  VSQFKEQIDFFEEMYKTVEQLETEKIILGWLRIDARPIRQAILNTVGKWGNMFKQHLYDH  1130
             +  F+EQID +E ++  +E +   ++   W ++D RP RQA+LNTV KWGNMFK+HL   
Sbjct  1055  IEAFREQIDNYESLFNEIEDIGPFQVFSSWFQVDVRPFRQALLNTVCKWGNMFKEHLVTT  1114

Query  1131  VINSISELENFIQEAIAGMQVQLTEDDYEGLLKVMAFLVKIRDMQAATDVMFGPLKDIIA  1190
             V +S+  L +FI++A  G+   + E DYEGL+ +MA+L+++++  A TD MF P+++ I 
Sbjct  1115  VTSSLMNLSHFIRKADEGLLQTVKEKDYEGLVSIMAYLMQVKERAAKTDEMFEPMQETIQ  1174

Query  1191  LLKDYGVEFSEETYVQLQELPDKWLTCKKVAVQTKQAVGPLQTIQIAAIRRRIALFDVRQ  1250
             LLK Y ++  EE  V LQELP++W   KK+A   KQ V PLQ  ++ +IR +IALF+   
Sbjct  1175  LLKYYDMDIPEEVNVLLQELPEQWANTKKIASTVKQQVSPLQATEVVSIRNKIALFESHI  1234

Query  1251  AMSRDAFRKMPFFLWGCQHVYALFDKVHKELSDFEVELKKLSEQSNLFDLQMSEYKSLKV  1310
              + R+ F+   FF + C   Y L D+++ ++   E E++ + E  +LF++ + E+K LK 
Sbjct  1235  QLFREVFKTYDFFRFDCYKPYLLMDRINDDMFLCESEMRDIQESGSLFEVNIPEFKVLKQ  1294

Query  1311  TRKELKQIKQLWDFVNIVMSSINEWKTTPWKKIDVEGMEMELKKFGKETRLMDKEVRGWN  1370
              RKEL+ +KQLWD+VNIV +SI++WKTTPW+K+DVE M++E KKF K+ RL+DKE+R W+
Sbjct  1295  CRKELRMLKQLWDYVNIVATSIDDWKTTPWRKVDVENMDIECKKFAKDIRLLDKEMRPWD  1354

Query  1371  VYIEMEATIKNMLTSLRAVTELQNPAIRDRHWIQLMQATKVKFVLDDETTLSDLLDLNLH  1430
              +I +E+T+KNMLTSLRAV ELQNPAIR+RHW QLM +TKVKF++D ETTL++LL LNLH
Sbjct  1355  TFINLESTVKNMLTSLRAVGELQNPAIRERHWNQLMNSTKVKFIMDHETTLAELLGLNLH  1414

Query  1431  EYEEEVKTIVDKSVKEMAMEKSLKEFNQNWNVLEFDTEIHDRSKIRLLKIAEETIEILED  1490
             E EEEVK IVDK+VKEM+MEK L++ N  W V+EFD E+H R+   LLK +EE IE LED
Sbjct  1415  ECEEEVKNIVDKAVKEMSMEKILRDLNTTWTVMEFDHELHPRTGCNLLKASEELIETLED  1474

Query  1491  NQVQLQNMMTSKFIQFFQKEVLEWQQKLSNADQVIQVFFEVQRKWCYLESIFIGSEDIRA  1550
             NQV LQN++TSK+I  F +EV  WQ KL  ADQVI V+FEVQR W +LESIF+ SEDIR 
Sbjct  1475  NQVCLQNLITSKYIAHFLEEVSTWQNKLMIADQVITVWFEVQRTWTHLESIFMSSEDIRK  1534

Query  1551  QLPEDSKRFDKIDREFKEILNEMVRTLNIVRATSKPGLATRLERILDDLLLCEKALNNYL  1610
             QLP DS RFD ID EF+ +++EM  + N+V +T++ GL  RLE +  +L LCEKAL  YL
Sbjct  1535  QLPVDSDRFDNIDAEFRVLMDEMSVSSNVVASTNRSGLIERLEHLQKELTLCEKALAEYL  1594

Query  1611  ETKRLAFPRFYFVSSADLLDILSTGNQPPLVARHLTKLFDSLAKLRFAMEGGKESKRSNA  1670
             ETKRLAFPRFYFVSSADLLD+LS G QP +V +HLTKLFDS+A+L+F  +   E   ++ 
Sbjct  1595  ETKRLAFPRFYFVSSADLLDVLSNGIQPEMVTKHLTKLFDSIARLKFNRDESNEINTASG  1654

Query  1671  MGSKENDEWVPFLNHCDCSGKVEVWLNRVIDIMRVTLHRSFSEAVTSYDEKPRELWIFDY  1730
             M +K+  E+V F       G VEVWLNR+   MR +L     EAV +Y+EK RE W+FDY
Sbjct  1655  MYAKDG-EYVEFNELASIRGPVEVWLNRIQAAMRASLRHYVMEAVIAYEEKQREQWLFDY  1713

Query  1731  PAQPALCGTQIWWTTEVNIAFARLEEGYENALKDYQKKQIAQLNALITLLLGDLTVGERQ  1790
             PAQ +LCG+QIWW+TEVNIAF+RLEEGY+NA+KDY KKQI+QL+ LITLLLG+L+ G+RQ
Sbjct  1714  PAQVSLCGSQIWWSTEVNIAFSRLEEGYDNAIKDYYKKQISQLSLLITLLLGELSKGDRQ  1773

Query  1791  KIMTICTIDVHSRDVVAKMIQVKVENSQAFQWQSQLRHRWDTKVNNCFANICDAQFLYQY  1850
             KIMTICTIDVHSRDVVAKMIQ K+++  AF WQSQLRHR+D    +CFANICDA+F Y +
Sbjct  1774  KIMTICTIDVHSRDVVAKMIQAKLDSGSAFMWQSQLRHRFDDVEKDCFANICDAEFQYCH  1833

Query  1851  EYLGNSPRLVITPLTDRCYITLTQSLHLIMGGAPAGPAGTGKTETTKDLGKALGMMVYVF  1910
             EYLGN+PRLVITPLTDRCYITLTQSLHL+MGGAPAGPAGTGKTETTKDLG+A+G+ VYVF
Sbjct  1834  EYLGNTPRLVITPLTDRCYITLTQSLHLVMGGAPAGPAGTGKTETTKDLGRAIGISVYVF  1893

Query  1911  NCSEQMDYKSVGNIYKGLAQTGTWGCFDEFNRISVEVLSVVAVQVKTIQDAVKVKKARFN  1970
             NCSEQMDY+S GNIYKGLAQTG WGCFDEFNRI+VEVLSVVAVQVK++QDA++ KK +FN
Sbjct  1894  NCSEQMDYQSCGNIYKGLAQTGAWGCFDEFNRITVEVLSVVAVQVKSVQDAIRDKKDKFN  1953

Query  1971  FLGEEISLIPTIGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFALICEIMLVAEGFQ  2030
             F+GE IS +PT+GIFITMNPGYAGRTELPENLKALFRPCAMVVPDF LICEIMLVAEGFQ
Sbjct  1954  FMGEMISCVPTVGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFQ  2013

Query  2031  EARLLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGALRRGDRLRPEDQVLMRAL  2090
             +AR+LARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAG+L+RGD  RPE++VLMRAL
Sbjct  2014  DARVLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRGDPGRPEEEVLMRAL  2073

Query  2091  RDFNIPKIVTDDVPVFMGLIGDLFPALDVPRKRSLEFEKLAKASAVDLKLQPEDGFILKV  2150
             RDFNIPKI+TDD+PVFMGLI DLFPALDVPRKR  +FE+  K +A DL LQPED FILKV
Sbjct  2074  RDFNIPKIITDDMPVFMGLISDLFPALDVPRKRDQDFERTVKQAASDLLLQPEDNFILKV  2133

Query  2151  VQLEELFAVRHSVFVLGFAGTGKTCVWKTLNRTYYNQKLKPYYNDLNPKAVTNDELFGII  2210
             VQLEEL  VRHSVF++G AGTGKT VWKTL RTY N K KP +NDLNPKAVTNDELFGII
Sbjct  2134  VQLEELLEVRHSVFIVGNAGTGKTQVWKTLLRTYQNIKRKPIFNDLNPKAVTNDELFGII  2193

Query  2211  NPATREWKDGLFSVIMRDQANMSGDGPKWIVLDGDIDPMWIESLNTLMDDNKVLTLASNE  2270
             NPATREWKDGLFSV+MRDQAN++GD PKWIVLDGDIDPMWIESLNT+MDDNKVLTLASNE
Sbjct  2194  NPATREWKDGLFSVLMRDQANITGDQPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNE  2253

Query  2271  RIALTRAMRLLFEIANLRTATPATVSRAGILYINPADLGWNPYIASWIDTRN-ENEKANL  2329
             RIALT +MRLLFEI+NLRTATPATVSRAGILYINP DLGWNPY+ SW++TR    EK+NL
Sbjct  2254  RIALTPSMRLLFEISNLRTATPATVSRAGILYINPQDLGWNPYVTSWVETRKIPAEKSNL  2313

Query  2330  MILFDKYIPPCLEMVKTKLKKITPIVDIAHIHMLCFLLDCFLTYQNVPPECPKEWYEIYF  2389
             ++LFDKYIPP LE ++ + KKITP+ ++AHI MLC LL+CFL   N P +CPKEW+E+YF
Sbjct  2314  VMLFDKYIPPSLETIRVRFKKITPVAEMAHIQMLCHLLNCFLIPANTPADCPKEWHELYF  2373

Query  2390  VFALIWAFGSALFQDQIIDWRNEFSKWFTNEFKTVKFPTAGTVFHYYIDQETKKFMPWSD  2449
             VFA IWAFGSA+FQDQ ID+R EFSKW+ NEFKTVKFP  GTVF Y++D ETK F+PW++
Sbjct  2374  VFACIWAFGSAMFQDQAIDYRVEFSKWWVNEFKTVKFPPGGTVFDYFLDSETKTFLPWTE  2433

Query  2450  LTPSFELDPDIPLQATLVNTAETVRVRYFMDKLIAHKHPVMLIGGAGSGKTVLVSDKLSS  2509
               P FELD D+PLQA +V+T+E++R+R+F+D L+  KHPVML+G AG GKTVLV++KL S
Sbjct  2434  KIPKFELDSDLPLQAVIVHTSESIRLRFFLDLLMDKKHPVMLVGNAGCGKTVLVNEKLQS  2493

Query  2510  LSEGYAVTNVPFNFYTTSEMLQRVLENPLEKKAGRVYGPPGTKTMIYFIDDMNMPEVDKY  2569
             LSE YAVT +PFN+YTTSEMLQ++LE PLEKKAGR YGPPG K + YF+DD+NMPEVD Y
Sbjct  2494  LSENYAVTTIPFNYYTTSEMLQKILEKPLEKKAGRNYGPPGNKLLCYFVDDINMPEVDAY  2553

Query  2570  FTVQPHTLLRQWMDYQHWYDRQKLSLKDIHNIQFISCMNPTAGSFTIDPRLQRHFCVFAI  2629
              TVQPHTL+RQ +DY HWYDR KL+LKDIHN Q+++CMNPT+GSFTI+PRLQRHFCV A+
Sbjct  2554  GTVQPHTLMRQHLDYGHWYDRNKLTLKDIHNCQYVACMNPTSGSFTINPRLQRHFCVLAV  2613

Query  2630  SFPTQDACYHIYSNIFSQHLTNPLNKFPYSLHSLSVNVVTAALTLHSRVAQTFLPTAVKF  2689
             SFP  ++   +YS+I +QH  N   KF   +  ++ N+V A + LH++  Q FLPTA+K 
Sbjct  2614  SFPGPESITVMYSSILAQHFANAEQKFTPIVTRMTPNIVAATIALHNKCLQVFLPTAIKS  2673

Query  2690  HYVFNLRDLSNLFQGMLFANGDTAPNQSALIRLWMHESYRVYGDKLVERRDQDTFSKLVV  2749
             HY+FNLRD+SN+FQG+LF++ +     + LIRLW HE+ RVY DKL + +D D+F+K+  
Sbjct  2674  HYIFNLRDISNVFQGLLFSSTECLTGSTDLIRLWQHETQRVYSDKLTDDKDIDSFTKMQH  2733

Query  2750  EVLKKGFEELEEVEVMAKPLIFCHFADGLGDPKYLPIQNYTVLTRLLNEALAGYNDLVSA  2809
             +++KK FEE++E  +  KP I+CHFA G+GDPKY+PI+ +  L +LL EA++ YNDLV+A
Sbjct  2734  DIVKKSFEEIDESVIFDKPNIYCHFAGGIGDPKYMPIKGWPELHKLLQEAMSSYNDLVAA  2793

Query  2810  MNLVLFEDAMNHICRINRIMEAPRGNALLVGVGGSGKQSLTRLAAFISSLEVFQVQLKKG  2869
             MNLVLFEDAM H+CRINRI+E+PRG+ALLVGVGGSGKQSL RLAAFISSLEV Q+QLKKG
Sbjct  2794  MNLVLFEDAMMHVCRINRILESPRGSALLVGVGGSGKQSLARLAAFISSLEVVQIQLKKG  2853

Query  2870  FNMSDLKANIAALYVKAGLKNISTVFLMTDAQVAEEAWLVVINDMLASGEIPDLLQDEEV  2929
             + ++DLK   + LY+KAGLKN+  +FLMTDAQ+  E +LV+INDMLA+GEIPDL  D+E+
Sbjct  2854  YGVNDLKNEFSGLYLKAGLKNVGIMFLMTDAQIPSEDFLVLINDMLATGEIPDLFPDDEI  2913

Query  2930  ENILNVVRGEVKASGVDDTKENCWKFYIQRCRKLLKVVLCFSPVGSTLRIRGRKFPAVVS  2989
             ENI+  VR EVK +G+ DT+ENCWKF+I R RK LK+VLCFSPVGSTLR+R RKFPA+++
Sbjct  2914  ENIIAGVRNEVKGAGLVDTRENCWKFFIDRVRKQLKIVLCFSPVGSTLRVRSRKFPAIIN  2973

Query  2990  CTAIDWFHEWPKEALQSVSQKFLQDIEVLPKRIVDSVSNFMSYVHSVVNDMSVVYLQNEK  3049
              T+I+WFHEWP+EAL SV+  FL   +VLP+   DSV+ FM+YVH+ VN  S VYLQNE+
Sbjct  2974  ATSINWFHEWPQEALISVAMNFLAQNKVLPENHRDSVAKFMAYVHTSVNTTSKVYLQNER  3033

Query  3050  RYNYTTPKTFLEQISLYSKLLTEKINFLEYSIIRLENGLLKLASTAEEVDGLKEVLAVQE  3109
             RYNYTTPK++LEQI+LY KLL  K   L+  I RLENGL KL STA +V  LK  LAVQE
Sbjct  3034  RYNYTTPKSYLEQINLYIKLLNHKNEDLQSKIERLENGLEKLRSTALQVADLKVKLAVQE  3093

Query  3110  VVLAEKNAAADKLIVVLGTENEKVETEKKIATEEEEKVKIIEEDVSVKAKICAADLAKAE  3169
             + L EKN AAD LI ++G E EKV+TEK +A EEE KV +I ++VS K + C  DL KAE
Sbjct  3094  IELKEKNEAADALIEIVGIETEKVQTEKAVADEEEMKVALIADEVSKKQRDCEEDLLKAE  3153

Query  3170  PALLAAQEALNTLNKNNLTELKSFGTPPPAVVNVTAAVLVLFSK-GKIPKDRSWKECKMM  3228
             PAL+AAQ+ALNTLNK NLTELKSFG+PP AV NVTAAV+VL S+ GK+PKDRSWK  K+ 
Sbjct  3154  PALMAAQDALNTLNKANLTELKSFGSPPGAVTNVTAAVMVLLSQGGKVPKDRSWKAAKIA  3213

Query  3229  MGKADQFLNDLIYYDKEHMSPEVVKVTQEYLKDPEFLPEIILGKSAAAAGLCSWVINILK  3288
             M K D FL+ LI YDKE++ PE+ K  Q YLKDPEF PE +  KS AAAGLC+WVINI+K
Sbjct  3214  MAKVDTFLDSLINYDKENIHPEITKAIQPYLKDPEFEPEFVRSKSGAAAGLCAWVINIIK  3273

Query  3289  FYDVFVVVEPKRRALNKANQDLEEARAKLVALNKKLDEFEQTLSVLRNDFEEATDAKLKC  3348
             FY+V+  VEPKR+AL  AN +L  A+ KL  + +K+   E+ L  L  DFE+AT  KL+C
Sbjct  3274  FYEVYCDVEPKRKALAAANAELAAAQDKLAGIKRKVMSLEEQLGKLTADFEKATADKLRC  3333

Query  3349  QAEADATALMIDLANRLVNGLASEKVRWIASVANYKAAGVTMPGDVLLVTAFISYVGCFT  3408
             Q EADAT   I LANRLV GLASE VRW  +V N+   G+T+PGD+LL+TAFISYVGCFT
Sbjct  3334  QQEADATQATIALANRLVGGLASENVRWAEAVNNFVKQGITLPGDILLITAFISYVGCFT  3393

Query  3409  RRYRLEMMNRYWLPFLQKLDVPIPMTEGLDPLSLLTDDARIAKWNNEGLPNDRMSSENAT  3468
             + +R++++ + W PFL+ +D PIP TE LDPLSLLTDD  IA W NEGLP+DRMS ENAT
Sbjct  3394  KGFRIDLLLKMWTPFLKSIDPPIPTTENLDPLSLLTDDTTIAIWTNEGLPSDRMSIENAT  3453

Query  3469  ILENSARWPLMIDPQLQGIKWIKNKYGSQLTVIRLSMKNYLDTIERCISNGQVILLENVG  3528
             IL NS RWPLMIDPQLQG+KWIK KYG  L VIRL  ++YLD IE+ I+ G  +L+EN+ 
Sbjct  3454  ILSNSDRWPLMIDPQLQGVKWIKQKYGEDLKVIRLGQRSYLDIIEKSINAGCNVLIENID  3513

Query  3529  ETIDAVLDPILGRILIKKGKAIKIGDKDVDYDPRFRLIIHTKLANPHYKPEIQAQTTLIN  3588
             E +D VLD +LGR LIKKGKAIKIGDK+++Y+  FRLI+HTKLANPHYKPE+QAQTTLIN
Sbjct  3514  ENLDPVLDSLLGRNLIKKGKAIKIGDKEIEYNSNFRLILHTKLANPHYKPEMQAQTTLIN  3573

Query  3589  FTVTRDGLEEQLLAEVVKAERPDLEHLKSNLTKQQNDFKITLKTCEDNLLERLSSATGNI  3648
             FTVTRDGLE+QLLAEVVKAERPDLE LK++LTKQQNDFKI LK  ED+LL RLSSA  NI
Sbjct  3574  FTVTRDGLEDQLLAEVVKAERPDLEELKADLTKQQNDFKIMLKKLEDDLLSRLSSAGENI  3633

Query  3649  LGDVALVENLEKTKKTAADIQIKVAEAKVTSIKIDEAREQYRPAAIRGSLLYFILTDLNR  3708
             LGD ALVENLE TK TA++I+ KVAEAK+TS +ID+ARE YRPAA R SLLYFIL +LN 
Sbjct  3634  LGDTALVENLETTKSTASEIEQKVAEAKITSKEIDKAREYYRPAAARASLLYFILNELNT  3693

Query  3709  INAIYQFSLKAFTVVFLNALVRADPAEKLTQRVLNLLDSISFMVFMYTSRGLFECDKLIF  3768
             IN IYQFSLKAF+VVF  A+ +A+P + L  RV NL+D I++ VF YTSRGLFECDKLIF
Sbjct  3694  INPIYQFSLKAFSVVFQKAIAKAEPGDTLDLRVSNLIDCITYSVFQYTSRGLFECDKLIF  3753

Query  3769  LAQMTFQILLRENDILPSELDFLLRFP-ALTVHSPFDFLSNLCWGGIKALSGLDEFKNLD  3827
              +QMTFQILL   ++  +ELDFLLRFP    V SP DFL+N  WGGI +L+  DEF+NLD
Sbjct  3754  ASQMTFQILLMNEEVTSAELDFLLRFPIKPHVTSPVDFLTNQSWGGICSLASKDEFRNLD  3813

Query  3828  KDIEGSINRWRKFVESECPEKEKFPGEWKNKSALQRLCMMRALRPDRMTYAVSAFVDEKL  3887
             +DIE S  RW+K VESE PEKEKFP EWKNK+ALQRLCM+RALRPDRMTYA++ F++EKL
Sbjct  3814  RDIETSSKRWKKLVESELPEKEKFPQEWKNKTALQRLCMIRALRPDRMTYALADFIEEKL  3873

Query  3888  GNKYIVARSVPFAKSYEETSSATPTFFILSPGVNPLKDVEALGKQLGFTFDNGNFHSVSL  3947
             G+KY+ +R++ FAKSYEE S +TP FFILSPGVNPLKDVEALGKQ+GF+ D GNFH+VSL
Sbjct  3874  GSKYVESRAMEFAKSYEEASPSTPIFFILSPGVNPLKDVEALGKQMGFSMDLGNFHNVSL  3933

Query  3948  GQGQEIVAESAIDIATENGHWVILQNIHLVARWLSSLEKKIEQTMDSSSPDYRLYLSAEP  4007
             GQGQE +AE+A+D A ++GHWV+LQNIHLV +WL  LEKK+E   + S PDYR++LSAEP
Sbjct  3934  GQGQEAIAEAAMDTAAKHGHWVVLQNIHLVRKWLPVLEKKLEYYAEDSHPDYRMFLSAEP  3993

Query  4008  NSDPQICVIPQGILESSIKITNEPPTGMFANLHKALDNFNQETLEMCTKEAEFKAILFSL  4067
              S P   +IPQGILESSIKITNEPPTGM ANLHKALDNF QETLEM  KEAEFKAILFSL
Sbjct  3994  ASTPSAHIIPQGILESSIKITNEPPTGMLANLHKALDNFTQETLEMSGKEAEFKAILFSL  4053

Query  4068  CYFHAVVAERRKFGPQGWNRNYPFNVGDLTISVNVLYNYLEGNTKVPWDDLRYLFGEIMY  4127
             CYFHAVVAERRKFGPQGWN+ YPFNVGDL ISV+VLYNYLE N KVPW+DLRYLFGEIMY
Sbjct  4054  CYFHAVVAERRKFGPQGWNKIYPFNVGDLNISVSVLYNYLEANAKVPWEDLRYLFGEIMY  4113

Query  4128  GGHITDDWDRRLCRTYLIEFMQSELLDAELEFAPGFLAPPNTDYVGYHRYIDDRLPPESP  4187
             GGHITDDWDRRLC TYL E+MQ +L+D EL  AP F APPNTDY GYH Y+D+ +P ESP
Sbjct  4114  GGHITDDWDRRLCITYLEEYMQPDLVDGELFLAPSFPAPPNTDYQGYHTYVDEMMPAESP  4173

Query  4188  YLYGLHPNAEIGFLTNLSDNLFKTIFELQPRDTGSSSGIGISREDKVRCIIEDIIDKLPE  4247
             YLYGLHPNAEIGFLT  ++N+F+T+FE+QPRD G+  G  ++REDKV+ I+++II+KLPE
Sbjct  4174  YLYGLHPNAEIGFLTTRAENIFRTVFEMQPRDAGAGGGATVTREDKVKQIVDEIIEKLPE  4233

Query  4248  EFRIVEMMAKVEDRTPFIIVAFQECERMNMLTKEMRRSLKELELGLKGELTITSVMEVLE  4307
             EF +VE+M KVE+RTP++IVAFQECERMN LT EM+RSLKEL+LGLKGELTITS MEVLE
Sbjct  4234  EFNMVEIMNKVEERTPYVIVAFQECERMNFLTSEMKRSLKELDLGLKGELTITSDMEVLE  4293

Query  4308  ESLFMDYVPESWAVKAYPSMLPLGQWVGDLSIRIKELEGWVGDFQMPPAVWLGGFFNPQS  4367
              SLF+D VP  W  +AYPS+L L  W  DL +R++ELE W  DF +P  VWL GFFNPQS
Sbjct  4294  NSLFLDQVPPIWTQRAYPSLLGLNNWFIDLCLRLRELETWSTDFVLPSCVWLAGFFNPQS  4353

Query  4368  FLTAIMQQTARKNEWPLDKMCLLTDVTKKQREDLTTTPREGANVCGLYMEGARWDTASGS  4427
              LTAIMQ TAR+N+ PLDKMCL  DVTKKQ+E+ TT PR+G  V G++MEGARWD   G 
Sbjct  4354  LLTAIMQSTARRNDLPLDKMCLQCDVTKKQKEEFTTAPRDGCCVHGIFMEGARWDIQQGI  4413

Query  4428  IADSKLKDLFPVVPVIYIKAITQDKQDLKNMYDCPVYKTRSRGP-TFVWTFNLKTKEKAT  4486
             I +S+LK+L+P +PVI I+AITQDKQDL+NMY+CPVYKTR+RGP T+V   NLKTK+K  
Sbjct  4414  IMESRLKELYPSMPVINIRAITQDKQDLRNMYECPVYKTRTRGPTTYVSNLNLKTKDKPG  4473

Query  4487  KWTLAGVALLLQV  4499
             KW LAGVALLLQ 
Sbjct  4474  KWILAGVALLLQT  4486


 Score = 568 bits (1465),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 293/836 (35%), Positives = 499/836 (60%), Gaps = 10/836 (1%)

Query  1    MKTLKMKMEKWNKMWSTDEYARIILNFFNNPNVPRLIMITSAAGQLMPVTEFP-NNLKTK  59
            +K+LK+K EKW ++ + +E+  II  F +      LI+I + A QL+P T FP + LK+K
Sbjct  30   IKSLKLKPEKWTRVVTVEEHKGIIKEFLDRNTPVVLIIILTPAAQLVPSTTFPLSQLKSK  89

Query  60   SSYFIRKKKEVVTRDNIREVLLIGDMSPKPVEEIAVLVEEVFLPVLSNPANQTKWPAVIA  119
              YFI++    + R++    ++ GD++ + +++++ LVEEV +P+LSN  N   WP ++A
Sbjct  90   GVYFIKRYALPIPREDCGNFIIYGDLATRTIDQLSALVEEVLVPLLSNEDNYRNWPIMVA  149

Query  120  ADITKHVYAFRNKVYQIKGALKSQTLLPMPTGVERIYEATLLLQQSHGKEVDLSLKTAIE  179
             D+ KHV++ ++ V+Q+KG +  +T+L MP GVE+I +A   L ++   + DL LK+AIE
Sbjct  150  QDVQKHVHSLKSTVHQVKGQVSGETILAMPVGVEKIVKAAKELVETEQCQFDLYLKSAIE  209

Query  180  GAVLQWASLCNDVLQQTSDAAFAHGQNPIPSAEINFWNSRLKNLESIFDQLRDPRVKRMV  239
            G V++WA+  ++V++++   AFA+GQNP P  E  FWN+RLKNL  I+DQLR+ R++ M 
Sbjct  210  GVVIKWATQIHEVIKESPSNAFANGQNPTPHTEFTFWNNRLKNLSFIYDQLRNERIRAMA  269

Query  240  LYLELAGSSYLSCFKCVFQDVVAGVIEAKNICLYLKPMKTHFEKFEDGEFLESEPYIRPM  299
            L LE + S+Y  CF+ +F++VV  + EAK+I LYL P+K   +  E+ +F E +P + P 
Sbjct  270  LILEYSMSAYHPCFQTLFKNVVTALAEAKDITLYLNPLKRPLQHLEEIDFAECKPLLIPF  329

Query  300  VHCLGLLWANSCYYCTNTKITTLLKEVANLFISAITAQLDPSTIFQGEPEDMVKKINTCL  359
            ++ +G+LW NS YYC + KIT LL+E+ NL I      LDPS+IF  + ++ ++++   +
Sbjct  330  MNTVGILWGNSRYYCQSAKITVLLQEICNLIIHQAKRYLDPSSIFHSDIDEAMQRLTLSI  389

Query  360  RLINIFRISFEEVRANLASYFKTPDIQPKP-WTFHQRTVFQRLMDFVERLELVKSILLAA  418
            +++  FR  F+  +  LA++F  P+ +P   WTFH  +VF+R   F+ERL  ++      
Sbjct  390  QILKFFRELFDYYKERLATFFTEPEERPPILWTFHPNSVFKRFNAFLERLTTIQWFFFTV  449

Query  419  IEYQKLERIEIGGIKGRLLSKRCEDLLEEFNYAYANFVTIQYDLLDPLHMAIVAENEQFL  478
            IE+ KLE++EIGG++GR LS R  D+  EFN  +  F +  YD+LDP       + + F 
Sbjct  450  IEFLKLEKVEIGGLRGRQLSTRITDVYVEFNQYFTAFASKSYDVLDPDDHEFDEDFKGFQ  509

Query  479  IKCNDMDSRLASIFEQVLDDCHNLESIFKFVNIANTLVERPIIYNAIKDKFYKIIEIFNR  538
             +  ++D +LA+I  Q  DDCHNLESIFK ++I  ++++RP I      ++ +I+ + + 
Sbjct  510  TRILELDMKLAAILCQAFDDCHNLESIFKLISIVGSVLDRPKIKEEFTQRYAEIVRMLDD  569

Query  539  ELDTVKEVYD---EGKREGVPI--NNYFPPTAGVLCWLHKLRQRIVKQGEDFKMFQNKLV  593
            E+   + +YD   E K+ G  +  N   PP A  + W H+L  RI    ++FK  Q+++ 
Sbjct  570  EMTICESIYDKQMELKKVGDNLYPNYNCPPVAAFIRWCHQLETRITAPVKNFKALQHEIT  629

Query  594  ESPDALEAFSKWEEMQHILDAEEARVLSLWSQSIPSQITASLSKMQLFKSGEQIS--VNF  651
            ++  + E   ++E +   L + + +    W+  +  QI  +L K  + +     S  +NF
Sbjct  630  KTEKSQEIVERYEILMVKLGSCKTQFFDDWAGQLDGQIEENLKKSLIARDRRHNSLILNF  689

Query  652  DKELEAILREVKYMKLLGIENIPEVALALYERNEELFISMQHLNNISEWYNHLKNKSLPV  711
               L +ILREV YM+ + IE IP++A+   E+++       +L    +WYN ++  S PV
Sbjct  690  SAALFSILREVHYMQQMKIEGIPQIAIDFAEKSDVFRSYTLNLEKTIDWYNSIQEGSSPV  749

Query  712  EYELIRSEVEELDLRLDELIYQLNW-TTDNFELIKTIYDALKQLYDRVMEAQRNVNNIIA  770
            E  LI  E++ +D  ++  + QL W ++D    +  +   +  L +R+   Q N+  I  
Sbjct  750  ELRLIEPEIKMIDDLVEIGVNQLVWNSSDILSYLDKLRKPVAALQNRMDHTQGNLRQIRK  809

Query  771  EINLWGEEPLFERKDRNSHCLLYVEDRVERVHKRYSQITATSLSIEKVMELNYKLF  826
             + +W ++PLFER+D     +L +++R +R  KRY++I A S+ I K+++ N   F
Sbjct  810  IMGVWAKQPLFERRDCKKDTVLSIDERPDRTSKRYAEIQAASIEIHKLLQDNMLQF  865



Lambda      K        H
   0.318    0.135    0.402 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 14159614518


Query= XP_031327313.1 homeobox protein orthopedia-like isoform X1 [Photinus
pyralis]

Length=302
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

OTP_DROME  unnamed protein product                                    200     2e-61
AL_DROME  unnamed protein product                                     110     2e-27
Q21836_CAEEL  unnamed protein product                                 108     5e-27


>OTP_DROME unnamed protein product
Length=409

 Score = 200 bits (509),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 131/219 (60%), Positives = 145/219 (66%), Gaps = 22/219 (10%)

Query  57   QKRHRTRFTPAQLNELERCFSKTHYPDIFMREEIAMRIGLTESRVQVWFQNRRAKWKKRK  116
            QKRHRTRFTPAQLNELERCFSKTHYPDIFMREEIAMRIGLTESRVQVWFQNRRAKWKKRK
Sbjct  109  QKRHRTRFTPAQLNELERCFSKTHYPDIFMREEIAMRIGLTESRVQVWFQNRRAKWKKRK  168

Query  117  KTTNVFRTPGALLPSHGLPPFG------AMGDGICGSGMFGSSDSRWGVASMATGLGQLS  170
            KTTNVFRTPGALLPSHGLPPFG      AMGDG+CG+GMFG      GV  M  G GQL+
Sbjct  169  KTTNVFRTPGALLPSHGLPPFGANITNIAMGDGLCGTGMFGGDRWSVGVNPMTAGFGQLN  228

Query  171  QGGVSMGGFGQSLGQ-LNQNSGLSAALPITTATASTVYQAHYGLNSLGDSMM---SYCNN  226
            Q           L   +N  S L A            YQ HYGLN+LGDSMM   S    
Sbjct  229  QSSPLSSSLNSGLNSGINMGSALGAG----------SYQ-HYGLNALGDSMMYQHSVGGV  277

Query  227  TSGGNGSGGGGSSPQNPCSAAATPPGASATTPNDPEDDI  265
            + G +GS    + P     ++ TPP  SA  PN  ++++
Sbjct  278  SCGPSGSPSATTPPNMNSCSSVTPPPLSA-QPNSSQNEL  315


 Score = 45.4 bits (106),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 36/50 (72%), Gaps = 6/50 (12%)

Query  254  SATTPNDPEDDIWRGHSIAALRRRASEINAAIPSYLQI---NYDTHNNAS  300
            S  +P+D  +D    HSIAALRRRASE+N AIPSYLQ+   NY+ +N+ S
Sbjct  359  SMQSPSDGANDTL--HSIAALRRRASELN-AIPSYLQMAPHNYEHYNSNS  405


>AL_DROME unnamed protein product
Length=408

 Score = 110 bits (275),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 56/63 (89%), Gaps = 0/63 (0%)

Query  56   KQKRHRTRFTPAQLNELERCFSKTHYPDIFMREEIAMRIGLTESRVQVWFQNRRAKWKKR  115
            KQ+R+RT FT  QL ELE+ FS+THYPD+F REE+AM+IGLTE+R+QVWFQNRRAKW+K+
Sbjct  84   KQRRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQNRRAKWRKQ  143

Query  116  KKT  118
            +K 
Sbjct  144  EKV  146


>Q21836_CAEEL unnamed protein product
Length=362

 Score = 108 bits (270),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 77/110 (70%), Gaps = 3/110 (3%)

Query  33   LSGLCDGLPPLGSSSSNDGDKPTKQKRHRTRFTPAQLNELERCFSKTHYPDIFMREEIAM  92
            L    +G P  G++S +D  K  KQ+R+RT F+  QL+ELE+ F++THYPD+F REE+A 
Sbjct  94   LDNRENGSPSDGTNSPDDNGK-RKQRRYRTTFSAFQLDELEKVFARTHYPDVFTREELAT  152

Query  93   RIGLTESRVQVWFQNRRAKWKK--RKKTTNVFRTPGALLPSHGLPPFGAM  140
            R+ LTE+RVQVWFQNRRAK++K  R  T + ++ P ++  S+G  P+  M
Sbjct  153  RVQLTEARVQVWFQNRRAKYRKQERSSTHHPYQAPMSIPNSNGDNPYQMM  202



Lambda      K        H
   0.318    0.135    0.402 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 14159614518


Query= XP_031327314.1 homeobox protein orthopedia-like isoform X2 [Photinus
pyralis]

Length=301
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

OTP_DROME  unnamed protein product                                    201     1e-61
AL_DROME  unnamed protein product                                     111     1e-27
Q21836_CAEEL  unnamed protein product                                 108     3e-27


>OTP_DROME unnamed protein product
Length=409

 Score = 201 bits (510),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 131/220 (60%), Positives = 145/220 (66%), Gaps = 22/220 (10%)

Query  55   KQKRHRTRFTPAQLNELERCFSKTHYPDIFMREEIAMRIGLTESRVQVWFQNRRAKWKKR  114
             QKRHRTRFTPAQLNELERCFSKTHYPDIFMREEIAMRIGLTESRVQVWFQNRRAKWKKR
Sbjct  108  DQKRHRTRFTPAQLNELERCFSKTHYPDIFMREEIAMRIGLTESRVQVWFQNRRAKWKKR  167

Query  115  KKTTNVFRTPGALLPSHGLPPFG------AMGDGICGSGMFGSSDSRWGVASMATGLGQL  168
            KKTTNVFRTPGALLPSHGLPPFG      AMGDG+CG+GMFG      GV  M  G GQL
Sbjct  168  KKTTNVFRTPGALLPSHGLPPFGANITNIAMGDGLCGTGMFGGDRWSVGVNPMTAGFGQL  227

Query  169  SQGGVSMGGFGQSLGQ-LNQNSGLSAALPITTATASTVYQAHYGLNSLGDSMM---SYCN  224
            +Q           L   +N  S L A            YQ HYGLN+LGDSMM   S   
Sbjct  228  NQSSPLSSSLNSGLNSGINMGSALGAG----------SYQ-HYGLNALGDSMMYQHSVGG  276

Query  225  NTSGGNGSGGGGSSPQNPCSAAATPPGASATTPNDPEDDI  264
             + G +GS    + P     ++ TPP  SA  PN  ++++
Sbjct  277  VSCGPSGSPSATTPPNMNSCSSVTPPPLSA-QPNSSQNEL  315


 Score = 45.4 bits (106),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 36/50 (72%), Gaps = 6/50 (12%)

Query  253  SATTPNDPEDDIWRGHSIAALRRRASEINAAIPSYLQI---NYDTHNNAS  299
            S  +P+D  +D    HSIAALRRRASE+N AIPSYLQ+   NY+ +N+ S
Sbjct  359  SMQSPSDGANDTL--HSIAALRRRASELN-AIPSYLQMAPHNYEHYNSNS  405


>AL_DROME unnamed protein product
Length=408

 Score = 111 bits (277),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 56/63 (89%), Gaps = 0/63 (0%)

Query  55   KQKRHRTRFTPAQLNELERCFSKTHYPDIFMREEIAMRIGLTESRVQVWFQNRRAKWKKR  114
            KQ+R+RT FT  QL ELE+ FS+THYPD+F REE+AM+IGLTE+R+QVWFQNRRAKW+K+
Sbjct  84   KQRRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQNRRAKWRKQ  143

Query  115  KKT  117
            +K 
Sbjct  144  EKV  146


>Q21836_CAEEL unnamed protein product
Length=362

 Score = 108 bits (271),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 77/110 (70%), Gaps = 3/110 (3%)

Query  32   LSGLCDGLPPLGSSSSNDGDKPTKQKRHRTRFTPAQLNELERCFSKTHYPDIFMREEIAM  91
            L    +G P  G++S +D  K  KQ+R+RT F+  QL+ELE+ F++THYPD+F REE+A 
Sbjct  94   LDNRENGSPSDGTNSPDDNGK-RKQRRYRTTFSAFQLDELEKVFARTHYPDVFTREELAT  152

Query  92   RIGLTESRVQVWFQNRRAKWKK--RKKTTNVFRTPGALLPSHGLPPFGAM  139
            R+ LTE+RVQVWFQNRRAK++K  R  T + ++ P ++  S+G  P+  M
Sbjct  153  RVQLTEARVQVWFQNRRAKYRKQERSSTHHPYQAPMSIPNSNGDNPYQMM  202



Lambda      K        H
   0.318    0.135    0.402 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 14159614518


Query= XP_031327315.1 homeobox protein orthopedia-like isoform X3 [Photinus
pyralis]

Length=289
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

OTP_DROME  unnamed protein product                                    200     1e-61
AL_DROME  unnamed protein product                                     110     1e-27
Q21836_CAEEL  unnamed protein product                                 108     3e-27


>OTP_DROME unnamed protein product
Length=409

 Score = 200 bits (509),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 131/219 (60%), Positives = 145/219 (66%), Gaps = 22/219 (10%)

Query  44   QKRHRTRFTPAQLNELERCFSKTHYPDIFMREEIAMRIGLTESRVQVWFQNRRAKWKKRK  103
            QKRHRTRFTPAQLNELERCFSKTHYPDIFMREEIAMRIGLTESRVQVWFQNRRAKWKKRK
Sbjct  109  QKRHRTRFTPAQLNELERCFSKTHYPDIFMREEIAMRIGLTESRVQVWFQNRRAKWKKRK  168

Query  104  KTTNVFRTPGALLPSHGLPPFG------AMGDGICGSGMFGSSDSRWGVASMATGLGQLS  157
            KTTNVFRTPGALLPSHGLPPFG      AMGDG+CG+GMFG      GV  M  G GQL+
Sbjct  169  KTTNVFRTPGALLPSHGLPPFGANITNIAMGDGLCGTGMFGGDRWSVGVNPMTAGFGQLN  228

Query  158  QGGVSMGGFGQSLGQ-LNQNSGLSAALPITTATASTVYQAHYGLNSLGDSMM---SYCNN  213
            Q           L   +N  S L A            YQ HYGLN+LGDSMM   S    
Sbjct  229  QSSPLSSSLNSGLNSGINMGSALGAG----------SYQ-HYGLNALGDSMMYQHSVGGV  277

Query  214  TSGGNGSGGGGSSPQNPCSAAATPPGASATTPNDPEDDI  252
            + G +GS    + P     ++ TPP  SA  PN  ++++
Sbjct  278  SCGPSGSPSATTPPNMNSCSSVTPPPLSA-QPNSSQNEL  315


 Score = 45.4 bits (106),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 36/50 (72%), Gaps = 6/50 (12%)

Query  241  SATTPNDPEDDIWRGHSIAALRRRASEINAAIPSYLQI---NYDTHNNAS  287
            S  +P+D  +D    HSIAALRRRASE+N AIPSYLQ+   NY+ +N+ S
Sbjct  359  SMQSPSDGANDTL--HSIAALRRRASELN-AIPSYLQMAPHNYEHYNSNS  405


>AL_DROME unnamed protein product
Length=408

 Score = 110 bits (276),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 56/63 (89%), Gaps = 0/63 (0%)

Query  43   KQKRHRTRFTPAQLNELERCFSKTHYPDIFMREEIAMRIGLTESRVQVWFQNRRAKWKKR  102
            KQ+R+RT FT  QL ELE+ FS+THYPD+F REE+AM+IGLTE+R+QVWFQNRRAKW+K+
Sbjct  84   KQRRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQNRRAKWRKQ  143

Query  103  KKT  105
            +K 
Sbjct  144  EKV  146


>Q21836_CAEEL unnamed protein product
Length=362

 Score = 108 bits (271),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 77/110 (70%), Gaps = 3/110 (3%)

Query  20   LSGLCDGLPPLGSSSSNDGDKPTKQKRHRTRFTPAQLNELERCFSKTHYPDIFMREEIAM  79
            L    +G P  G++S +D  K  KQ+R+RT F+  QL+ELE+ F++THYPD+F REE+A 
Sbjct  94   LDNRENGSPSDGTNSPDDNGK-RKQRRYRTTFSAFQLDELEKVFARTHYPDVFTREELAT  152

Query  80   RIGLTESRVQVWFQNRRAKWKK--RKKTTNVFRTPGALLPSHGLPPFGAM  127
            R+ LTE+RVQVWFQNRRAK++K  R  T + ++ P ++  S+G  P+  M
Sbjct  153  RVQLTEARVQVWFQNRRAKYRKQERSSTHHPYQAPMSIPNSNGDNPYQMM  202



Lambda      K        H
   0.318    0.135    0.402 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 14159614518


Query= XP_031327316.1 glutathione S-transferase C-terminal
domain-containing protein homolog [Photinus pyralis]

Length=564
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q93574_CAEEL  unnamed protein product                                 33.1    0.57 
Q8I4K4_CAEEL  unnamed protein product                                 32.7    0.83 
Q4GYR8_TRYB2  unnamed protein product                                 31.2    2.8  


>Q93574_CAEEL unnamed protein product
Length=478

 Score = 33.1 bits (74),  Expect = 0.57, Method: Compositional matrix adjust.
 Identities = 37/177 (21%), Positives = 74/177 (42%), Gaps = 33/177 (19%)

Query  339  SPESGALPESRAVRKCQQLENLAKATVKVTSLKK-----IETIVDFCSGSGHLGILVATL  393
            S  +G + +    +K  +++ + +   ++   +K     I+++VD  +G GHL  ++ ++
Sbjct  114  SSANGLVRKRIKAKKQHEIDRIVELISQIQIFQKDSADPIDSLVDIGAGIGHLSRMI-SI  172

Query  394  LPNCHVILVE-NKERSL-------------KRAQERISKMNLSNVSVVQSN---------  430
              N  V+ VE N++ +L              +   RI   N+ +  +  +N         
Sbjct  173  HNNISVMAVEGNQQFTLAANSLDEKLLLDSAKIGSRIENFNVKSTPIRYTNFVTEDLALK  232

Query  431  LDYFNARFDLGLALHACGVATDLVI---QACIRNKADFVCCPCCYGGIHNCHHLSYP  484
            +D F     + + LH CG  +  ++   Q   ++KA  V   CCY     C H   P
Sbjct  233  IDDFAVNSAILVGLHCCGDFSSTILKVFQKSEKSKA-LVLFGCCYHKEFQCFHFLRP  288


>Q8I4K4_CAEEL unnamed protein product
Length=440

 Score = 32.7 bits (73),  Expect = 0.83, Method: Compositional matrix adjust.
 Identities = 37/177 (21%), Positives = 74/177 (42%), Gaps = 33/177 (19%)

Query  339  SPESGALPESRAVRKCQQLENLAKATVKVTSLKK-----IETIVDFCSGSGHLGILVATL  393
            S  +G + +    +K  +++ + +   ++   +K     I+++VD  +G GHL  ++ ++
Sbjct  76   SSANGLVRKRIKAKKQHEIDRIVELISQIQIFQKDSADPIDSLVDIGAGIGHLSRMI-SI  134

Query  394  LPNCHVILVE-NKERSL-------------KRAQERISKMNLSNVSVVQSN---------  430
              N  V+ VE N++ +L              +   RI   N+ +  +  +N         
Sbjct  135  HNNISVMAVEGNQQFTLAANSLDEKLLLDSAKIGSRIENFNVKSTPIRYTNFVTEDLALK  194

Query  431  LDYFNARFDLGLALHACGVATDLVI---QACIRNKADFVCCPCCYGGIHNCHHLSYP  484
            +D F     + + LH CG  +  ++   Q   ++KA  V   CCY     C H   P
Sbjct  195  IDDFAVNSAILVGLHCCGDFSSTILKVFQKSEKSKA-LVLFGCCYHKEFQCFHFLRP  250


>Q4GYR8_TRYB2 unnamed protein product
Length=559

 Score = 31.2 bits (69),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 20/69 (29%), Positives = 36/69 (52%), Gaps = 2/69 (3%)

Query  357  LENLAKATVKVTSLKKIETIVDFCSGSGHLGILVATLLPNCHVILVENKERSLKRAQERI  416
            +E L + TV V  L    T++D C G+G +GI +A  +    VI +E  E +++ A+   
Sbjct  381  MELLLRETVAVAELTPETTLLDLCCGTGTIGIALAKHVKR--VIGIELVESAVRDARLNA  438

Query  417  SKMNLSNVS  425
             +  + N +
Sbjct  439  ERNGVRNAT  447



Lambda      K        H
   0.318    0.135    0.402 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 14159614518


Query= XP_031327317.1 protein JTB [Photinus pyralis]

Length=152
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GOB1_CAEEL  unnamed protein product                                   31.6    0.22 
O76189_9TRYP  unnamed protein product                                 28.5    2.0  
ITA2_DROME  unnamed protein product                                   28.9    2.2  


>GOB1_CAEEL unnamed protein product
Length=468

 Score = 31.6 bits (70),  Expect = 0.22, Method: Composition-based stats.
 Identities = 19/66 (29%), Positives = 30/66 (45%), Gaps = 14/66 (21%)

Query  17   LGALTIFVLIAESHWTQQTNNTRKRIFRVEQNSTCFEREKYEIISECQPCTDFEITSKSI  76
            LG  T+F  + E    +  +  R+RI RV+ NS      +Y ++  C P          I
Sbjct  319  LGVQTVFKQVPEDLSARYIDAVRERIHRVDPNS------QYLVLENCSPL--------EI  364

Query  77   GVCIHT  82
             VC+H+
Sbjct  365  EVCVHS  370


>O76189_9TRYP unnamed protein product
Length=203

 Score = 28.5 bits (62),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 12/43 (28%), Positives = 25/43 (58%), Gaps = 3/43 (7%)

Query  4   SCPRKR---MLLGITALGALTIFVLIAESHWTQQTNNTRKRIF  43
           + P K+   +LLG + +G  ++   +A++ W    N+T +R+F
Sbjct  7   AAPTKKYKIVLLGDSGVGKSSLVQRLAKNEWCDNQNSTGRRVF  49


>ITA2_DROME unnamed protein product
Length=1396

 Score = 28.9 bits (63),  Expect = 2.2, Method: Composition-based stats.
 Identities = 11/29 (38%), Positives = 14/29 (48%), Gaps = 0/29 (0%)

Query  38   TRKRIFRVEQNSTCFEREKYEIISECQPC  66
            T  R FR++   TCF    +E   E  PC
Sbjct  157  TPSRAFRIDPVGTCFTSHNFEEFYEVSPC  185



Lambda      K        H
   0.318    0.135    0.402 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 14159614518


Query= XP_031327318.1 uncharacterized protein LOC116158640 [Photinus
pyralis]

Length=311
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ODO1_CAEEL  unnamed protein product                                   38.1    0.009
Q38B01_TRYB2  unnamed protein product                                 29.3    6.3  


>ODO1_CAEEL unnamed protein product
Length=1029

 Score = 38.1 bits (87),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 28/114 (25%), Positives = 48/114 (42%), Gaps = 13/114 (11%)

Query  159  MVVILNGDKQRPTPNKAEEALKTNKWPDFETEGKLVYKPNDDLGHQNVDSSRYNWQSGGN  218
            M ++L+GD          E    +  P + T G +    N+ +G      S         
Sbjct  408  MAILLHGDAAFAGQGVVLETFNLDDLPSYTTHGAIHIVVNNQIGFTTDPRS---------  458

Query  219  SGSKSYPRNFAYHRVTGNPLYHSNLDKNPKAYIAVSVIAPKPLRPALQDDIILE  272
              S+S P      RV G P++H N+D +P+A + V  +A    R   + D+I++
Sbjct  459  --SRSSPYCTDVGRVVGCPIFHVNVD-DPEAVMHVCNVAAD-WRKTFKKDVIVD  508


>Q38B01_TRYB2 unnamed protein product
Length=1703

 Score = 29.3 bits (64),  Expect = 6.3, Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 22/33 (67%), Gaps = 0/33 (0%)

Query  76    RLLRKIDNDLITSKKLFDSIQNSIEDINNFSSV  108
             RL+    NDL   ++ F +++NS+E+ NNF SV
Sbjct  1477  RLINDALNDLYVEEENFVALRNSVENYNNFDSV  1509



Lambda      K        H
   0.318    0.135    0.402 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 14159614518


Query= XP_031327319.1 uncharacterized protein LOC116158639 [Photinus
pyralis]

Length=230
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7K740_PLAF7  unnamed protein product                                 30.4    1.2  
B7YZS4_DROME  unnamed protein product                                 28.1    7.5  
Q381S4_TRYB2  unnamed protein product                                 28.1    7.7  


>Q7K740_PLAF7 unnamed protein product
Length=397

 Score = 30.4 bits (67),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 18/52 (35%), Positives = 27/52 (52%), Gaps = 1/52 (2%)

Query  113  ITEELFVEWLKHFAQCVNASTENRVLVDLEYNKIEVTDIAELRHRNVFGEEE  164
            ++  LFVE L    QC  +S+  RVL +L Y+        EL   N +G++E
Sbjct  10   VSSFLFVEALFQEYQCYGSSSNTRVLNELNYDNAGTNLYNELE-MNYYGKQE  60


>B7YZS4_DROME unnamed protein product
Length=1842

 Score = 28.1 bits (61),  Expect = 7.5, Method: Compositional matrix adjust.
 Identities = 11/41 (27%), Positives = 22/41 (54%), Gaps = 0/41 (0%)

Query  171  EPNSVIRAETNELCEPPQETVSLDPRPGTSGDPDPSYVSSG  211
            +P  + + + + L +PP E + + P   +S  P P+  S+G
Sbjct  768  QPPPLAQVQPHSLAQPPVEAMCMSPEHRSSSQPTPATSSAG  808


>Q381S4_TRYB2 unnamed protein product
Length=595

 Score = 28.1 bits (61),  Expect = 7.7, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 21/41 (51%), Gaps = 2/41 (5%)

Query  184  CEPPQETVSLDPRPGTSG--DPDPSYVSSGSHDEVDVRQVT  222
            CEP  + + + PR GT G      S V+S +H     R+V+
Sbjct  80   CEPQSQRIVISPRDGTKGGYSSHASVVTSYNHSNKQKREVS  120



Lambda      K        H
   0.318    0.135    0.402 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 14159614518


Query= XP_031327320.1 uncharacterized protein LOC116158641 [Photinus
pyralis]

Length=480
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VJ27_DROME  unnamed protein product                                 47.4    2e-05
Q9VGA4_DROME  unnamed protein product                                 38.1    0.019
SCN60_DROME  unnamed protein product                                  30.0    6.0  


>Q9VJ27_DROME unnamed protein product
Length=762

 Score = 47.4 bits (111),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 52/112 (46%), Gaps = 16/112 (14%)

Query  4    TFCCVPGCNSLKRRTPDISFHKFPNVNDTVRIQTKLGVW-EIVNRRYIWKTKLRIGKNIS  62
              C V  C+        ISFH+FP      + +  L  W E   R   W          S
Sbjct  3    AHCAVINCSHKYVHAGSISFHRFP-----FKRKDLLQKWKEFTQRSAQWMP--------S  49

Query  63   EFMKVCSLHFTENDFFTIRQRRNLKKNVIPTMCLP--NPVHGSVQELAPSNR  112
            ++  +CS HF + DF     R+ LKKN +P++ +   + + G +++++PSNR
Sbjct  50   KWSALCSRHFGDEDFNCSNNRKTLKKNAVPSIRVSEDDSMSGHLEQVSPSNR  101


>Q9VGA4_DROME unnamed protein product
Length=1169

 Score = 38.1 bits (87),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 45/92 (49%), Gaps = 16/92 (17%)

Query  6   CCVPGCNSLKR--RTPDISFHKFPNVNDTVRIQTKLGVWEIVNRRYIWKTKLRIGKNISE  63
           CCV  C S  R      +++H FP ++  +R      +W       I  +++ + + I++
Sbjct  5   CCVANCPSTSRLLEHNGVTYHSFP-LDPIIR-----AIW-------IKNSRISLERQITK  51

Query  64  FMKVCSLHFTENDFFTIRQRRN-LKKNVIPTM  94
            + VCS HF   DF TIR  +  LK  V PT+
Sbjct  52  SVLVCSRHFRRLDFNTIRNGKYLLKPRVFPTV  83


>SCN60_DROME unnamed protein product
Length=2844

 Score = 30.0 bits (66),  Expect = 6.0, Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 40/83 (48%), Gaps = 16/83 (19%)

Query  230   LCVKDRVSLTFTKLKCDVSYTILGVLYGISSVLCRIYFIEMI-KLLS-----------TI  277
             L     ++L F  +  D + T+  VLY I+   C I+ +EMI K L+           TI
Sbjct  1760  LIFASSITLCFEDINLDKNKTLKRVLYWINFSFCLIFVVEMILKWLALGFSKYFTSFWTI  1819

Query  278   LKSVIVFPSK----IENSQNMPI  296
             L  +IVF S     IE ++N+ +
Sbjct  1820  LDFIIVFVSVFSLLIEENENLKV  1842



Lambda      K        H
   0.318    0.135    0.402 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 14159614518


Query= XP_031327321.1 uncharacterized protein LOC116158642 [Photinus
pyralis]

Length=180
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CBD1_CAEEL  unnamed protein product                                   31.6    0.33 
HDA2_CAEEL  unnamed protein product                                   28.5    4.0  
TORS_DROME  unnamed protein product                                   28.1    4.1  


>CBD1_CAEEL unnamed protein product
Length=1319

 Score = 31.6 bits (70),  Expect = 0.33, Method: Composition-based stats.
 Identities = 30/107 (28%), Positives = 46/107 (43%), Gaps = 9/107 (8%)

Query  55    LQTSALQSAPHKIEGTLVHDDEKWVVEKFACSCKAGQSGRCKHISAVLLQCSRT---SLD  111
             + T+   + P + EG   H D + V     CS K     RC + ++ L QCS     S D
Sbjct  1092  IATTPAPAQPKQFEGRCAHVDGEAVFSIGVCSSK---YLRCSYGASKLQQCSEDRVFSND  1148

Query  112   KLEAVSQTDIK-CTWSAQKGKTQDKYRAIPVKEMPCIKQSDGMKLDE  157
             KLE + +  +  CT    K  +  KY     +   C  + DG+  +E
Sbjct  1149  KLECIVRESVSACT--VPKNPSIKKYYTSNDQSAFCDGKEDGLYRNE  1193


>HDA2_CAEEL unnamed protein product
Length=507

 Score = 28.5 bits (62),  Expect = 4.0, Method: Compositional matrix adjust.
 Identities = 14/39 (36%), Positives = 21/39 (54%), Gaps = 0/39 (0%)

Query  129  KGKTQDKYRAIPVKEMPCIKQSDGMKLDEAILMGIHDNL  167
            KG    KY AI V  M  I+    +KL E+++ G+ +N 
Sbjct  235  KGVGPGKYFAINVPLMAAIRDEPYLKLFESVISGVEENF  273


>TORS_DROME unnamed protein product
Length=340

 Score = 28.1 bits (61),  Expect = 4.1, Method: Compositional matrix adjust.
 Identities = 23/108 (21%), Positives = 49/108 (45%), Gaps = 9/108 (8%)

Query  6    SICDYLLYIKGTDNSRVVY------EGEHVLNAGHIILCGVTNKEENRLTLYALCLQTSA  59
            S+ DY  ++ GTDN++ ++       G H+ +    ++     +E+ RL+ +   L+ +A
Sbjct  191  SLVDYNAFVDGTDNTKAIFIFLSNTAGSHIASHLGSVMKNGRLREDTRLSDFEPLLRKAA  250

Query  60   LQSAPHKIEGTLVHDDEKWVVEKFACSCKAGQSGRCKHISAVLLQCSR  107
                    + T++   E  V++ F       ++   K + A LL+  R
Sbjct  251  YNMDGGMKKTTMI---ESHVIDHFIPFLPMEKAHVIKCLEAELLRWRR  295



Lambda      K        H
   0.318    0.135    0.402 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 14159614518


Query= XP_031327322.1 uncharacterized protein LOC116158643 [Photinus
pyralis]

Length=263
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9W2K3_DROME  unnamed protein product                                 49.3    1e-06
Q9VW28_DROME  unnamed protein product                                 49.3    2e-06
M9PG36_DROME  unnamed protein product                                 49.3    2e-06


>Q9W2K3_DROME unnamed protein product
Length=315

 Score = 49.3 bits (116),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 46/95 (48%), Gaps = 2/95 (2%)

Query  7    SNIWLIDMEDATLIELVEQFEVLYNRRHKDFKNKLVRENAWKSIAAIFNDTPENVENRWN  66
            SN   +D  D  LI+ + +   LY+ +   F+    +E  W  +A + N +  +   RW 
Sbjct  3    SNHRPLDDSDILLIQTIRETPSLYDPQLPSFRLSQRKEEDWAKVADLLNISISDARRRWT  62

Query  67   SLRNRYAAELRKTKTIPSGSGAQTVWIHMSAMNFI  101
             LR+RY+ EL++ +  PSG      +     M+F+
Sbjct  63   CLRDRYSRELKQKRLHPSGEFGHNDF--FRKMDFL  95


 Score = 34.3 bits (77),  Expect = 0.086, Method: Compositional matrix adjust.
 Identities = 15/41 (37%), Positives = 31/41 (76%), Gaps = 1/41 (2%)

Query  223  TQKSEEELFCESLAKSLQQIQCPRKKMRAKIEIMQVVEQYL  263
            T ++E++ FC+S+A  L+Q+     K++AK+E+ Q++E+Y+
Sbjct  261  TCETEDDFFCKSIAAYLRQLSR-VHKIKAKVEMYQILEKYI  300


>Q9VW28_DROME unnamed protein product
Length=690

 Score = 49.3 bits (116),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 52/87 (60%), Gaps = 1/87 (1%)

Query  19   LIELVEQFEVLYNRRHKDFKNKLVRENAWKSIAAIFNDTPENVENRWNSLRNRYAAELRK  78
            LI L++Q +++YN  +++++N  ++   W+ IA     + +    +W +LR++YA E ++
Sbjct  319  LITLIQQEDMIYNYGNENYRNAKLKMEVWEEIARKLKKSVKQCRLKWKALRDQYAREHKR  378

Query  79   TKTIPSGSGAQTVWIHMSAMNFINAHI  105
             +T+     A + W H ++++F+  +I
Sbjct  379  LRTL-MHIDATSRWKHYNSLSFLQKYI  404


 Score = 43.9 bits (102),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/90 (22%), Positives = 45/90 (50%), Gaps = 4/90 (4%)

Query  19   LIELVEQFEVLYNRRHKDFKNKLVRENAWKSIAAIFNDTPENVENRWNSLRNRYAAELRK  78
            LI LV Q + LYN +H  +++  +++  W  I +    +    +++W ++R++Y  EL++
Sbjct  42   LISLVSQEQSLYNPKHPHYRSTKIKDEKWLEIGSNVGWSDVQCKSKWKAMRDQYCRELKR  101

Query  79   TKTIPSGSGAQTVWIHMSAMNFINAHIVPR  108
             K           W +   ++F+  + + R
Sbjct  102  AK----ACSKAVKWKYFKELDFLRPYALAR  127


>M9PG36_DROME unnamed protein product
Length=688

 Score = 49.3 bits (116),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 52/87 (60%), Gaps = 1/87 (1%)

Query  19   LIELVEQFEVLYNRRHKDFKNKLVRENAWKSIAAIFNDTPENVENRWNSLRNRYAAELRK  78
            LI L++Q +++YN  +++++N  ++   W+ IA     + +    +W +LR++YA E ++
Sbjct  317  LITLIQQEDMIYNYGNENYRNAKLKMEVWEEIARKLKKSVKQCRLKWKALRDQYAREHKR  376

Query  79   TKTIPSGSGAQTVWIHMSAMNFINAHI  105
             +T+     A + W H ++++F+  +I
Sbjct  377  LRTL-MHIDATSRWKHYNSLSFLQKYI  402


 Score = 47.0 bits (110),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 22/106 (21%), Positives = 50/106 (47%), Gaps = 4/106 (4%)

Query  19   LIELVEQFEVLYNRRHKDFKNKLVRENAWKSIAAIFNDTPENVENRWNSLRNRYAAELRK  78
            LI LV Q + LYN +H  +++  +++  W  I +    +    +++W ++R++Y  EL++
Sbjct  42   LISLVSQEQSLYNPKHPHYRSTKIKDEKWLEIGSNVGWSDVQCKSKWKAMRDQYCRELKR  101

Query  79   TKTIPSGSGAQTVWIHMSAMNFINAHIVPRRSTVSNVKATCSGTIS  124
             K           W +   ++F+  + + R+           GT++
Sbjct  102  AK----ACSKAVKWKYFKELDFLRPYALARKGRSGQTSNGAVGTVT  143



Lambda      K        H
   0.318    0.135    0.402 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 14159614518


Query= XP_031327323.1 uncharacterized protein LOC116158644 [Photinus
pyralis]

Length=425


***** No hits found *****



Lambda      K        H
   0.318    0.135    0.402 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 14159614518


Query= XP_031327324.1 putative nuclease HARBI1 isoform X1 [Photinus
pyralis]

Length=416
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

IDLDH_IPSPI  unnamed protein product                                  31.6    0.94 
Q9VRQ9_DROME  unnamed protein product                                 29.3    6.4  


>IDLDH_IPSPI unnamed protein product
Length=253

 Score = 31.6 bits (70),  Expect = 0.94, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 20/41 (49%), Gaps = 2/41 (5%)

Query  245  IHCFTGYPGAVHDQRVFQNSDLPEFFRNDTQFPDDVHILGD  285
            I  F    G +H   VFQN D  E F  DTQ P D  +L D
Sbjct  72   IQKFGKLDGVMHCAGVFQNGD--ELFNMDTQQPGDYTVLTD  110


>Q9VRQ9_DROME unnamed protein product
Length=340

 Score = 29.3 bits (64),  Expect = 6.4, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 34/79 (43%), Gaps = 5/79 (6%)

Query  216  YVNRKGYHSMQLQVGSYFLQA--VCNENGMFIHCFTGYPGAVHD-QRVFQNSDLPEFFRN  272
            Y N  G HS  +Q+      A  +   N MF+   +G  G V D  R F + ++P     
Sbjct  231  YENTDGLHSSLVQIEKSLRTAGQLEGNNNMFLSRVSG--GLVDDDHRPFLDENVPVLHLV  288

Query  273  DTQFPDDVHILGDAAYKLH  291
             T FPD  H   D A  LH
Sbjct  289  ATPFPDVWHTPRDNAANLH  307



Lambda      K        H
   0.318    0.135    0.402 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 14159614518


Query= XP_031327325.1 putative nuclease HARBI1 isoform X2 [Photinus
pyralis]

Length=409
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

IDLDH_IPSPI  unnamed protein product                                  31.6    0.90 


>IDLDH_IPSPI unnamed protein product
Length=253

 Score = 31.6 bits (70),  Expect = 0.90, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 20/41 (49%), Gaps = 2/41 (5%)

Query  238  IHCFTGYPGAVHDQRVFQNSDLPEFFRNDTQFPDDVHILGD  278
            I  F    G +H   VFQN D  E F  DTQ P D  +L D
Sbjct  72   IQKFGKLDGVMHCAGVFQNGD--ELFNMDTQQPGDYTVLTD  110



Lambda      K        H
   0.318    0.135    0.402 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 14159614518


Query= XP_031327326.1 uncharacterized protein LOC116158646 [Photinus
pyralis]

Length=285
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VTT3_DROME  unnamed protein product                                 49.3    1e-06
Q8T3K2_DROME  unnamed protein product                                 30.0    2.5  
Q0KHR5_DROME  unnamed protein product                                 30.0    2.7  


>Q9VTT3_DROME unnamed protein product
Length=368

 Score = 49.3 bits (116),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 56/120 (47%), Gaps = 4/120 (3%)

Query  95   WSFEGVTLLLNLYGEKQDVLVKGKVKQKAFWNSIAELMAKHGYTYTASQCKTKLATLKRQ  154
            WSF  V LLL L+      L   + + +  W    E M   G+T+T  + K K+  + +Q
Sbjct  121  WSFHAVELLLELWARHCVDLRDSRKRVQVIWKMTGE-MKSLGFTFT--EIKNKIDDMGQQ  177

Query  155  YKKVKDHNKVSGNDRKDWPYLEAMDEIFSSQPWLVPVSLASSSSASVNSAASSSSTSTSI  214
            Y++     K +G+ +  W Y E M  IFSS   ++       S ++ N+ +  +S  + +
Sbjct  178  YRRESHMEKTTGH-KSQWEYFETMKMIFSSDRNIIDNMPLDKSGSAPNTTSEHNSFGSQL  236


>Q8T3K2_DROME unnamed protein product
Length=1226

 Score = 30.0 bits (66),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 2/60 (3%)

Query  173  PYLEAMDEIFSSQPWLVPVSLASSSSASVNSAASSSSTSTSITPSTSATCAIANKNSPKT  232
            PYL  M E  S+     PV LAS+S    N      ++ + +TP+TS T      +SP T
Sbjct  386  PYLSRMPE--SANKASGPVDLASASRNRTNWFVPDKASCSDVTPNTSKTTPPIEGDSPPT  443


>Q0KHR5_DROME unnamed protein product
Length=1510

 Score = 30.0 bits (66),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 2/60 (3%)

Query  173  PYLEAMDEIFSSQPWLVPVSLASSSSASVNSAASSSSTSTSITPSTSATCAIANKNSPKT  232
            PYL  M E  S+     PV LAS+S    N      ++ + +TP+TS T      +SP T
Sbjct  670  PYLSRMPE--SANKASGPVDLASASRNRTNWFVPDKASCSDVTPNTSKTTPPIEGDSPPT  727



Lambda      K        H
   0.318    0.135    0.402 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 14159614518


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jan 28, 2021  9:24 PM
  Number of letters in database: 17,197,330
  Number of sequences in database:  25,232



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= XP_031327327.1 uncharacterized protein LOC116158647 isoform X1
[Photinus pyralis]

Length=683
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q388N7_TRYB2  unnamed protein product                                 66.2    5e-11
Q38BB2_TRYB2  unnamed protein product                                 62.4    3e-10
Q57XS3_TRYB2  unnamed protein product                                 63.5    4e-10


>Q388N7_TRYB2 unnamed protein product
Length=732

 Score = 66.2 bits (160),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 71/146 (49%), Gaps = 20/146 (14%)

Query  14   GELVPCEICGRTFLPAPLIKHKKVCERNATKQRKIFDSQKQRVEGTEFAPFNQSHVKKTV  73
            GE + C+ CGR F P  L +H++VC   + KQRK+F+ + QR+ GTE   F     KK  
Sbjct  588  GERLECQKCGRKFAPEALQRHERVCA--SQKQRKVFNMRAQRLAGTEAMSF----AKKID  641

Query  74   TGTPYAADAFKRAKWKEKHLELVKTIRAARGVGMTNKHSASSTSL--------SHDAPGT  125
            T    +A A  +  W+ +     ++++ AR V    K   +  +L        SH  P  
Sbjct  642  TTA--SAPAPPKKDWRAESEAFRRSLKEARMVDKVLKSGGNLRNLPPPTYSENSHYTP--  697

Query  126  ERCPSCDRQFGPRAYDRHVEWCKDHV  151
              CP C R+F P   +RH+  C + V
Sbjct  698  --CPHCGRKFAPDVAERHIPRCANTV  721


 Score = 32.7 bits (73),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 21/39 (54%), Gaps = 1/39 (3%)

Query  2    AETTMEEVIN-LEGELVPCEICGRTFLPAPLIKHKKVCE  39
            AE  M+E        LVPC+ CGR FLP  L  H + C+
Sbjct  72   AEKLMDEQFQEFTNNLVPCDRCGRKFLPDRLPVHLRGCK  110


>Q38BB2_TRYB2 unnamed protein product
Length=301

 Score = 62.4 bits (150),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 63/129 (49%), Gaps = 16/129 (12%)

Query  16   LVPCEICGRTFLPAPLIKHKKVCERNATKQRKIFDSQKQRV-----EGTEFAPFNQSHVK  70
            L PC  CGR FL   +  H+ VC+ N   +RK+FDS KQR       G  F   +    K
Sbjct  95   LHPCSRCGRKFLFDRIAYHESVCKGNV--KRKVFDSSKQRAIEGQYSGGCFGAPSAKGRK  152

Query  71   KTVTGTPYAADAFKRAKWKEKHLELVKTIRAARGVGMTNKHSASSTSLSHDAPGTERCPS  130
            K   G    A    R +W+E+H E ++ +RAAR      +   +S ++  +    E CP+
Sbjct  153  KAAPGASSPAPGVPRTRWREQHREFIEAMRAAR------QARQTSAAMWGEPCAKEPCPN  206

Query  131  CDRQFGPRA  139
             +RQ  PRA
Sbjct  207  -NRQ--PRA  212


>Q57XS3_TRYB2 unnamed protein product
Length=651

 Score = 63.5 bits (153),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 69/163 (42%), Gaps = 32/163 (20%)

Query  16   LVPCEICGRTFLPAPLIKHKKVCERNATKQRKIFDSQKQRVEGTE----FAPFNQSHVKK  71
            L+PC +CGRTF  + L +H+  C +   K+R++FD + QR+EG E     AP +     +
Sbjct  475  LLPCNLCGRTFRSSILARHEAACAK-VQKKRRVFDMKGQRLEGIEGIHDVAPSSHISHGR  533

Query  72   TVTGTPYA---------ADAFKRAKWKEKHLELVKTIRAARGV-------GMTNKHSASS  115
               GT  A             K  KWK +H +    +RA R V       G +   S  S
Sbjct  534  GDGGTFGAGKQNTTAQMGGQAKLPKWKIQHEQFQAAMRAMRQVTPEDAPGGKSGAQSTGS  593

Query  116  TS-----LSHDAPGTER------CPSCDRQFGPRAYDRHVEWC  147
             S     LS   P          CP C R+F     +RH+  C
Sbjct  594  KSTQQRQLSQPVPLPAEYDDRVPCPHCGRKFAQMTAERHIPKC  636



Lambda      K        H
   0.311    0.127    0.359 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8292602108


Query= XP_031327328.1 uncharacterized protein LOC116158647 isoform X2
[Photinus pyralis]

Length=559
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q381D9_TRYB2  unnamed protein product                                 38.9    0.013
Q381C5_TRYB2  unnamed protein product                                 36.2    0.083
HR3_DROME  unnamed protein product                                    33.1    0.57 


>Q381D9_TRYB2 unnamed protein product
Length=783

 Score = 38.9 bits (89),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 23/66 (35%), Positives = 32/66 (48%), Gaps = 12/66 (18%)

Query  495  SLSPLEYNRPQTSPIASPTSSSSDTTSMPLESQQRVSK----FCHECGTRYPIITAKFCV  550
            S+ PL  +RPQ + +        +T      +QQ+ +K    FC ECG R+     KFC 
Sbjct  723  SMRPLATDRPQATTL--------NTVRCVAPAQQQPTKQLVPFCTECGKRHLDDKVKFCA  774

Query  551  ECGVKR  556
             CG KR
Sbjct  775  FCGHKR  780


>Q381C5_TRYB2 unnamed protein product
Length=616

 Score = 36.2 bits (82),  Expect = 0.083, Method: Compositional matrix adjust.
 Identities = 16/52 (31%), Positives = 26/52 (50%), Gaps = 1/52 (2%)

Query  507  SPIASPTSSSSDTTSMPLESQQRVSKFCHECGTRYPIITAKFCVECGVKRLV  558
            S +  PT++         E   R+ ++C ECG + P  + +FC  CG K +V
Sbjct  564  SSLTHPTTAEGTHDVGSTEGAPRI-RYCFECGLKLPFESQRFCSGCGTKLVV  614


>HR3_DROME unnamed protein product
Length=487

 Score = 33.1 bits (74),  Expect = 0.57, Method: Compositional matrix adjust.
 Identities = 56/218 (26%), Positives = 90/218 (41%), Gaps = 37/218 (17%)

Query  236  YRLNLGESAIYSSRSEKATKRLSPRLLALINVITNA---PGDNSNRSATDQLLTISIGDC  292
            Y  NLG+  ++   +EK T+ +        N+I  A   PG     S  DQ+L +  G  
Sbjct  274  YYKNLGQEELWLDCAEKLTQMIQ-------NIIEFAKLIPG-FMRLSQDDQILLLKTGSF  325

Query  293  R-------RLLELDPNAVPVGDMLSKMNLTRSSASEEAELLKTKLPLISKVPVQKVSYDK  345
                    RLL+L  NAV  GD++       +S SEE  L+         +   K++  +
Sbjct  326  ELAIVRMSRLLDLSQNAVLYGDVMLPQEAFYTSDSEEMRLVSRIFQTAKSIAELKLTETE  385

Query  346  NVSSRSSIVSLPQ------------IVPKSKNAPTSEVR-KPAPFKKSLSVQEPPKPKS-  391
                +S ++  P+            +   S NA   E+    AP K  ++V +       
Sbjct  386  LALYQSLVLLWPERNGVRGNTEIQRLFNLSMNAIRQELETNHAPLKGDVTVLDTLLNNIP  445

Query  392  NFKD--DLQVEVLKKPRKSTELPSVDF-AKGDDLFDVD  426
            NF+D   L +E L K +   + P+V F A   +LF +D
Sbjct  446  NFRDISILHMESLSKFK--LQHPNVVFPALYKELFSID  481



Lambda      K        H
   0.311    0.127    0.359 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8292602108


Query= XP_031327329.1 zinc finger C2HC domain-containing protein 1A-like
isoform X3 [Photinus pyralis]

Length=461
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q388N7_TRYB2  unnamed protein product                                 66.6    2e-11
Q38BB2_TRYB2  unnamed protein product                                 61.2    3e-10
Q57XS3_TRYB2  unnamed protein product                                 62.4    4e-10


>Q388N7_TRYB2 unnamed protein product
Length=732

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 71/146 (49%), Gaps = 20/146 (14%)

Query  14   GELVPCEICGRTFLPAPLIKHKKVCERNATKQRKIFDSQKQRVEGTEFAPFNQSHVKKTV  73
            GE + C+ CGR F P  L +H++VC   + KQRK+F+ + QR+ GTE   F     KK  
Sbjct  588  GERLECQKCGRKFAPEALQRHERVCA--SQKQRKVFNMRAQRLAGTEAMSF----AKKID  641

Query  74   TGTPYAADAFKRAKWKEKHLELVKTIRAARGVGMTNKHSASSTSL--------SHDAPGT  125
            T    +A A  +  W+ +     ++++ AR V    K   +  +L        SH  P  
Sbjct  642  TTA--SAPAPPKKDWRAESEAFRRSLKEARMVDKVLKSGGNLRNLPPPTYSENSHYTP--  697

Query  126  ERCPSCDRQFGPRAYDRHVEWCKDHV  151
              CP C R+F P   +RH+  C + V
Sbjct  698  --CPHCGRKFAPDVAERHIPRCANTV  721


 Score = 32.7 bits (73),  Expect = 0.66, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 21/39 (54%), Gaps = 1/39 (3%)

Query  2    AETTMEEVIN-LEGELVPCEICGRTFLPAPLIKHKKVCE  39
            AE  M+E        LVPC+ CGR FLP  L  H + C+
Sbjct  72   AEKLMDEQFQEFTNNLVPCDRCGRKFLPDRLPVHLRGCK  110


>Q38BB2_TRYB2 unnamed protein product
Length=301

 Score = 61.2 bits (147),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 47/93 (51%), Gaps = 7/93 (8%)

Query  16   LVPCEICGRTFLPAPLIKHKKVCERNATKQRKIFDSQKQRV-----EGTEFAPFNQSHVK  70
            L PC  CGR FL   +  H+ VC+ N   +RK+FDS KQR       G  F   +    K
Sbjct  95   LHPCSRCGRKFLFDRIAYHESVCKGNV--KRKVFDSSKQRAIEGQYSGGCFGAPSAKGRK  152

Query  71   KTVTGTPYAADAFKRAKWKEKHLELVKTIRAAR  103
            K   G    A    R +W+E+H E ++ +RAAR
Sbjct  153  KAAPGASSPAPGVPRTRWREQHREFIEAMRAAR  185


>Q57XS3_TRYB2 unnamed protein product
Length=651

 Score = 62.4 bits (150),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 69/163 (42%), Gaps = 32/163 (20%)

Query  16   LVPCEICGRTFLPAPLIKHKKVCERNATKQRKIFDSQKQRVEGTE----FAPFNQSHVKK  71
            L+PC +CGRTF  + L +H+  C +   K+R++FD + QR+EG E     AP +     +
Sbjct  475  LLPCNLCGRTFRSSILARHEAACAK-VQKKRRVFDMKGQRLEGIEGIHDVAPSSHISHGR  533

Query  72   TVTGTPYA---------ADAFKRAKWKEKHLELVKTIRAARGV-------GMTNKHSASS  115
               GT  A             K  KWK +H +    +RA R V       G +   S  S
Sbjct  534  GDGGTFGAGKQNTTAQMGGQAKLPKWKIQHEQFQAAMRAMRQVTPEDAPGGKSGAQSTGS  593

Query  116  TS-----LSHDAPGTER------CPSCDRQFGPRAYDRHVEWC  147
             S     LS   P          CP C R+F     +RH+  C
Sbjct  594  KSTQQRQLSQPVPLPAEYDDRVPCPHCGRKFAQMTAERHIPKC  636



Lambda      K        H
   0.311    0.127    0.359 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8292602108


Query= XP_031327330.1 succinate dehydrogenase [ubiquinone] flavoprotein
subunit, mitochondrial isoform X1 [Photinus pyralis]

Length=656
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SDHA_DROME  unnamed protein product                                   1031    0.0  
SDHA_CAEEL  unnamed protein product                                   916     0.0  
SDHA_DICDI  unnamed protein product                                   810     0.0  


>SDHA_DROME unnamed protein product
Length=661

 Score = 1031 bits (2666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 506/661 (77%), Positives = 568/661 (86%), Gaps = 5/661 (1%)

Query  1    MSRLLKVNSLIAKSVFSKVDALQPI-TSRGLHISVNRGEAKVNT--NLSKVYPTVDHTYD  57
            MS +++V S++AK+  + +     +   R  HI+  R +A       +SK YP VDH YD
Sbjct  1    MSGIMRVPSILAKNAVASMQRAAAVGVQRSYHITHGRQQASAANPDKISKQYPVVDHAYD  60

Query  58   AVVVGAGGAGLRAAFGLVAEGFKTAVITKLFPTRSHTVAAQGGINAALGNMEEDDWKWHM  117
            A+VVGAGGAGLRAAFGLVAEGF+TAVITKLFPTRSHT+AAQGGINAALGNMEEDDWKWHM
Sbjct  61   AIVVGAGGAGLRAAFGLVAEGFRTAVITKLFPTRSHTIAAQGGINAALGNMEEDDWKWHM  120

Query  118  YDTVKGSDWLGDQDAIHYMTEEAPKAVIELENYGMPFSRTPEGKIYQRAFGGQSLKFGKG  177
            YDTVKGSDWLGDQDAIHYMT EAPKAVIELENYGMPFSRT +GKIYQRAFGGQSLKFGKG
Sbjct  121  YDTVKGSDWLGDQDAIHYMTREAPKAVIELENYGMPFSRTQDGKIYQRAFGGQSLKFGKG  180

Query  178  GQAHRCCCVADRTGHSLLHTLYGHSLKYDCNYFVEYFALDLIMEDGECRGITALCLDDGT  237
            GQAHRCC VADRTGHSLLHTLYG SL YDCNYFVEYFALDLI EDGECRG+ AL L+DGT
Sbjct  181  GQAHRCCAVADRTGHSLLHTLYGQSLSYDCNYFVEYFALDLIFEDGECRGVLALNLEDGT  240

Query  238  IHRFHAKHTVLATGGYGRAYFSCTSAHTCTGDGTAMVSRVGLPNQDLEFVQFHPTGIYGA  297
            +HRF AK+TV+ATGGYGRA+FSCTSAHTCTGDGTAMV+R GLP+QDLEFVQFHPTGIYGA
Sbjct  241  LHRFRAKNTVIATGGYGRAFFSCTSAHTCTGDGTAMVARQGLPSQDLEFVQFHPTGIYGA  300

Query  298  GCLITEGCRGEGGYLINSEGERFMERYAPVAKDLASRDVVSRAMTIEIREGRGVGPEKDH  357
            GCLITEGCRGEGGYLIN  GERFMERYAPVAKDLASRDVVSR+MTIEI EGRG GPEKDH
Sbjct  301  GCLITEGCRGEGGYLINGNGERFMERYAPVAKDLASRDVVSRSMTIEIMEGRGAGPEKDH  360

Query  358  VYLQLHHLPVEQLAARLPGISETAMIFAGVDVTREPIPVLPTVHYNMGGVPTNYKGQVLT  417
            VYLQLHHLP +QLA RLPGISETAMIFAGVDVTREPIPVLPTVHYNMGGVPTNY+GQV+T
Sbjct  361  VYLQLHHLPPKQLAERLPGISETAMIFAGVDVTREPIPVLPTVHYNMGGVPTNYRGQVIT  420

Query  418  T-VNGEDKIVRGLYACGESGSTSVHGANRLGANSLLDLVVFGRACAKTIAAEHKPGESIG  476
               +G+D IV GLYA GE+ S+SVHGANRLGANSLLDLVVFGRACAKTIA  +KPG    
Sbjct  421  IDKDGKDVIVPGLYAAGEAASSSVHGANRLGANSLLDLVVFGRACAKTIAELNKPGAPAP  480

Query  477  KLSANAGEASISNLDWIRYSDGPISTADLRLRMQKTMQKHAAVFRTAESLQEGIRLMEAL  536
             L  NAGEAS++NLD +R+++G I+TADLRL+MQKTMQ HAAVFR    LQ+G+  M+ +
Sbjct  481  TLKENAGEASVANLDKLRHANGQITTADLRLKMQKTMQHHAAVFRDGPILQDGVNKMKEI  540

Query  537  YADLKDIKVSDRGLVWNSDLVESLELQNLMINAMQTIVGAENRKESRGAHAREDFKTRSD  596
            Y   KDIKV DR L+WNSDLVE+LELQNL+ NA  TIV AE RKESRGAHAREDFK R D
Sbjct  541  YKQFKDIKVVDRSLIWNSDLVETLELQNLLANAQMTIVSAEARKESRGAHAREDFKVRED  600

Query  597  EYDYSKPIEGQQKRPESEHYRKHTLTTI-DDKGKVSIRYRPVIDHTLSKDVATVPPAIRS  655
            EYD+SKP++GQQK+P  +H+RKHTL+ + +D G +++ YR VID TL  +V+TVPPAIRS
Sbjct  601  EYDFSKPLDGQQKKPMDQHWRKHTLSWVCNDNGDITLDYRNVIDTTLDNEVSTVPPAIRS  660

Query  656  Y  656
            Y
Sbjct  661  Y  661


>SDHA_CAEEL unnamed protein product
Length=646

 Score = 916 bits (2368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/611 (74%), Positives = 516/611 (84%), Gaps = 3/611 (0%)

Query  49   YPTVDHTYDAVVVGAGGAGLRAAFGLVAEGFKTAVITKLFPTRSHTVAAQGGINAALGNM  108
            Y  VDH YDAVVVGAGGAGLRAA GL   G KTAVITKLFPTRSHTVAAQGGINAALGNM
Sbjct  36   YKVVDHAYDAVVVGAGGAGLRAAMGLAEGGLKTAVITKLFPTRSHTVAAQGGINAALGNM  95

Query  109  EEDDWKWHMYDTVKGSDWLGDQDAIHYMTEEAPKAVIELENYGMPFSRTPEGKIYQRAFG  168
              D+W+WH YDTVKGSDWLGDQDAIHYMT EA +AVIELENYGMPFSRT +GKIYQRAFG
Sbjct  96   NPDNWRWHFYDTVKGSDWLGDQDAIHYMTREAERAVIELENYGMPFSRTTDGKIYQRAFG  155

Query  169  GQSLKFGKGGQAHRCCCVADRTGHSLLHTLYGHSLKYDCNYFVEYFALDLIMEDGECRGI  228
            GQS  FG+GGQAHR CCVADRTGHSLLHTLYG SL+Y+CNYFVEYFALDLIME+G C G+
Sbjct  156  GQSNDFGRGGQAHRTCCVADRTGHSLLHTLYGASLQYNCNYFVEYFALDLIMENGVCVGV  215

Query  229  TALCLDDGTIHRFHAKHTVLATGGYGRAYFSCTSAHTCTGDGTAMVSRVGLPNQDLEFVQ  288
             A+ L+DGTIHRF +K+TVLATGGYGRA+FSCTSAHTCTGDGTA+ +R G+ N D+EFVQ
Sbjct  216  IAMDLEDGTIHRFRSKNTVLATGGYGRAFFSCTSAHTCTGDGTALTARAGINNSDMEFVQ  275

Query  289  FHPTGIYGAGCLITEGCRGEGGYLINSEGERFMERYAPVAKDLASRDVVSRAMTIEIREG  348
            FHPTGIYGAGCLITEG RGEGGYL+NS GERFMERYAP AKDLASRDVVSR+MT+EI EG
Sbjct  276  FHPTGIYGAGCLITEGSRGEGGYLVNSAGERFMERYAPNAKDLASRDVVSRSMTVEIMEG  335

Query  349  RGVGPEKDHVYLQLHHLPVEQLAARLPGISETAMIFAGVDVTREPIPVLPTVHYNMGGVP  408
            RGVGP+KDH+YLQLHHLP EQL  RLPGISETAMIFAGVDVT+EPIPV+PTVHYNMGGVP
Sbjct  336  RGVGPDKDHIYLQLHHLPAEQLQQRLPGISETAMIFAGVDVTKEPIPVIPTVHYNMGGVP  395

Query  409  TNYKGQVLT-TVNGEDKIVRGLYACGESGSTSVHGANRLGANSLLDLVVFGRACAKTIAA  467
            TNYKGQVL  T    D++V GLYA GE G+ SVHGANRLGANSLLDLV+FGRACA  I  
Sbjct  396  TNYKGQVLNYTPKKGDEVVPGLYAAGECGAHSVHGANRLGANSLLDLVIFGRACAIDILK  455

Query  468  EHKPGESIGKLSANAGEASISNLDWIRYSDGPISTADLRLRMQKTMQKHAAVFRTAESLQ  527
                G  + +L  NAGEAS++N+D +R++ G ISTA+LRL MQK+MQ HAAVFR  + L+
Sbjct  456  NTSAGVGVPELPKNAGEASVANIDKLRHNKGDISTAELRLTMQKSMQNHAAVFRRGDILK  515

Query  528  EGIRLMEALYADLKDIKVSDRGLVWNSDLVESLELQNLMINAMQTIVGAENRKESRGAHA  587
            EG++++  LY D   + V+D+GLVWNSDL+E+LELQNL+INA QTIV AENR+ESRGAHA
Sbjct  516  EGVKVLSKLYKDQAHLNVADKGLVWNSDLIETLELQNLLINATQTIVAAENREESRGAHA  575

Query  588  REDFKTRSDEYDYSKPIEGQQKRPESEHYRKHTLTTID-DKGKVSIRYRPVIDHTLSK-D  645
            R+DF  R DE DYSKP+EGQ K+   +H+RKH++   + + G+VS+ YRPVID TL K +
Sbjct  576  RDDFPDRLDELDYSKPLEGQTKKELKDHWRKHSIIRSNIETGEVSLDYRPVIDTTLDKSE  635

Query  646  VATVPPAIRSY  656
               VPP +RSY
Sbjct  636  TDWVPPKVRSY  646


>SDHA_DICDI unnamed protein product
Length=626

 Score = 810 bits (2093),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/620 (66%), Positives = 483/620 (78%), Gaps = 32/620 (5%)

Query  46   SKVYPTVDHTYDAVVVGAGGAGLRAAFGLVAEGFKTAVITKLFPTRSHTVAAQGGINAAL  105
            S+ Y  VDHTYDA+VVGAGGAGLRAA GL  +G+KTA ITKLFPTRSHTVAAQGGINAAL
Sbjct  30   SRDYAVVDHTYDAIVVGAGGAGLRAALGLTEKGYKTACITKLFPTRSHTVAAQGGINAAL  89

Query  106  GNMEEDDWKWHMYDTVKGSDWLGDQDAIHYMTEEAPKAVIELENYGMPFSRTPEGKIYQR  165
            GN ++DDW+WH YDTVKGSD+LGDQDAIHYM +EA   V+ELE YG+PFSR  +G+IYQR
Sbjct  90   GNADQDDWRWHAYDTVKGSDFLGDQDAIHYMCKEAVPTVLELEQYGVPFSRMDDGRIYQR  149

Query  166  AFGGQSLKFGKGGQAHRCCCVADRTGHSLLHTLYGHSLKYDCNYFVEYFALDLIMEDGEC  225
            AFGGQS  FGKGGQA RCC  ADRTGH+LLHTLYG ++K++  +F+EYF  DLIME+G+C
Sbjct  150  AFGGQSKNFGKGGQATRCCAAADRTGHALLHTLYGQAVKHNTKFFIEYFVTDLIMENGDC  209

Query  226  RGITALCLDDGTIHRFHAKHTVLATGGYGRAYFSCTSAHTCTGDGTAMVSRVGLPNQDLE  285
            RG+ A+ L+DGTIHRF +  TV+ATGGYGRAYFS TSAHTCTGDG AMV R GLP QDLE
Sbjct  210  RGVVAINLEDGTIHRFRSHATVIATGGYGRAYFSATSAHTCTGDGNAMVIRAGLPCQDLE  269

Query  286  FVQFHPTGIYGAGCLITEGCRGEGGYLINSEGERFMERYAPVAKDLASRDVVSRAMTIEI  345
            FVQFHPTGIYG+GCLITEG RGEGGYL+NS GERFM RYAP   DLASRDVVSR+ T+EI
Sbjct  270  FVQFHPTGIYGSGCLITEGARGEGGYLLNSSGERFMPRYAPSVADLASRDVVSRSETMEI  329

Query  346  REGRGVGPEKDHVYLQLHHLPVEQLAARLPGISETAMIFAGVDVTREPIPVLPTVHYNMG  405
            REGRGVGPEKDH  L L HL  E +  RLPGI ETAMIFAGVDVT+EPIPV+PTVHYNMG
Sbjct  330  REGRGVGPEKDHCLLNLTHLSPEIIDERLPGIRETAMIFAGVDVTKEPIPVIPTVHYNMG  389

Query  406  GVPTNYKGQVLTTVNGEDKIVRGLYACGESGSTSVHGANRLGANSLLDLVVFGRACAKTI  465
            G+PTNYKGQV+T V+G+DK+V+GLYA GES   SVHGANRLGANSLLD+VVFGRA A  I
Sbjct  390  GIPTNYKGQVITQVDGKDKLVKGLYAAGESACVSVHGANRLGANSLLDIVVFGRAVANEI  449

Query  466  A------AEHKPGESIGKLSANAGEASISNLDWIRYSDGPISTADLRLRMQKTMQKHAAV  519
                     HKP      L  NAGE SI+N+D IR+S+G  STA++RL MQK MQ++AAV
Sbjct  450  ENTLAKDTPHKP------LPPNAGEESIANIDAIRFSNGTRSTAEIRLEMQKIMQRNAAV  503

Query  520  FRTAESLQEGIRLMEALYADL-KDIKVSDRGLVWNSDLVESLELQNLMINAMQTIVGAEN  578
            FR  + L+EG+ L++     L  D+K +DR ++WN+DL+ESLELQNLM  A+ T+  AE 
Sbjct  504  FRDGQVLKEGVELIDKCARSLINDLKTTDRTMIWNTDLIESLELQNLMTQAVLTMHSAEA  563

Query  579  RKESRGAHAREDFKTRSDEYDYSKPIEGQQKRPESEHYRKHTLTTID-DKGKVSIRYRPV  637
            RKESRGAHARED+K R D                  ++ KHTL+ +D + GKV++ YRPV
Sbjct  564  RKESRGAHAREDYKERDD-----------------ANWMKHTLSYLDVNTGKVTLNYRPV  606

Query  638  IDHTLSK-DVATVPPAIRSY  656
            +  TL + ++ T+ P  R Y
Sbjct  607  VSETLDQSEMETIKPFKRVY  626



Lambda      K        H
   0.311    0.127    0.359 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8292602108


Query= XP_031327331.1 succinate dehydrogenase [ubiquinone] flavoprotein
subunit, mitochondrial isoform X2 [Photinus pyralis]

Length=549
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SDHA_DROME  unnamed protein product                                   930     0.0  
SDHA_CAEEL  unnamed protein product                                   848     0.0  
SDHA_DICDI  unnamed protein product                                   734     0.0  


>SDHA_DROME unnamed protein product
Length=661

 Score = 930 bits (2403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/551 (80%), Positives = 486/551 (88%), Gaps = 2/551 (0%)

Query  1    MEEDDWKWHMYDTVKGSDWLGDQDAIHYMTEEAPKAVIELENYGMPFSRTPEGKIYQRAF  60
            MEEDDWKWHMYDTVKGSDWLGDQDAIHYMT EAPKAVIELENYGMPFSRT +GKIYQRAF
Sbjct  111  MEEDDWKWHMYDTVKGSDWLGDQDAIHYMTREAPKAVIELENYGMPFSRTQDGKIYQRAF  170

Query  61   GGQSLKFGKGGQAHRCCCVADRTGHSLLHTLYGHSLKYDCNYFVEYFALDLIMEDGECRG  120
            GGQSLKFGKGGQAHRCC VADRTGHSLLHTLYG SL YDCNYFVEYFALDLI EDGECRG
Sbjct  171  GGQSLKFGKGGQAHRCCAVADRTGHSLLHTLYGQSLSYDCNYFVEYFALDLIFEDGECRG  230

Query  121  ITALCLDDGTIHRFHAKHTVLATGGYGRAYFSCTSAHTCTGDGTAMVSRVGLPNQDLEFV  180
            + AL L+DGT+HRF AK+TV+ATGGYGRA+FSCTSAHTCTGDGTAMV+R GLP+QDLEFV
Sbjct  231  VLALNLEDGTLHRFRAKNTVIATGGYGRAFFSCTSAHTCTGDGTAMVARQGLPSQDLEFV  290

Query  181  QFHPTGIYGAGCLITEGCRGEGGYLINSEGERFMERYAPVAKDLASRDVVSRAMTIEIRE  240
            QFHPTGIYGAGCLITEGCRGEGGYLIN  GERFMERYAPVAKDLASRDVVSR+MTIEI E
Sbjct  291  QFHPTGIYGAGCLITEGCRGEGGYLINGNGERFMERYAPVAKDLASRDVVSRSMTIEIME  350

Query  241  GRGVGPEKDHVYLQLHHLPVEQLAARLPGISETAMIFAGVDVTREPIPVLPTVHYNMGGV  300
            GRG GPEKDHVYLQLHHLP +QLA RLPGISETAMIFAGVDVTREPIPVLPTVHYNMGGV
Sbjct  351  GRGAGPEKDHVYLQLHHLPPKQLAERLPGISETAMIFAGVDVTREPIPVLPTVHYNMGGV  410

Query  301  PTNYKGQVLTT-VNGEDKIVRGLYACGESGSTSVHGANRLGANSLLDLVVFGRACAKTIA  359
            PTNY+GQV+T   +G+D IV GLYA GE+ S+SVHGANRLGANSLLDLVVFGRACAKTIA
Sbjct  411  PTNYRGQVITIDKDGKDVIVPGLYAAGEAASSSVHGANRLGANSLLDLVVFGRACAKTIA  470

Query  360  AEHKPGESIGKLSANAGEASISNLDWIRYSDGPISTADLRLRMQKTMQKHAAVFRTAESL  419
              +KPG     L  NAGEAS++NLD +R+++G I+TADLRL+MQKTMQ HAAVFR    L
Sbjct  471  ELNKPGAPAPTLKENAGEASVANLDKLRHANGQITTADLRLKMQKTMQHHAAVFRDGPIL  530

Query  420  QEGIRLMEALYADLKDIKVSDRGLVWNSDLVESLELQNLMINAMQTIVGAENRKESRGAH  479
            Q+G+  M+ +Y   KDIKV DR L+WNSDLVE+LELQNL+ NA  TIV AE RKESRGAH
Sbjct  531  QDGVNKMKEIYKQFKDIKVVDRSLIWNSDLVETLELQNLLANAQMTIVSAEARKESRGAH  590

Query  480  AREDFKTRSDEYDYSKPIEGQQKRPESEHYRKHTLTTI-DDKGKVSIRYRPVIDHTLSKD  538
            AREDFK R DEYD+SKP++GQQK+P  +H+RKHTL+ + +D G +++ YR VID TL  +
Sbjct  591  AREDFKVREDEYDFSKPLDGQQKKPMDQHWRKHTLSWVCNDNGDITLDYRNVIDTTLDNE  650

Query  539  VATVPPAIRSY  549
            V+TVPPAIRSY
Sbjct  651  VSTVPPAIRSY  661


>SDHA_CAEEL unnamed protein product
Length=646

 Score = 848 bits (2192),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/552 (72%), Positives = 465/552 (84%), Gaps = 3/552 (1%)

Query  1    MEEDDWKWHMYDTVKGSDWLGDQDAIHYMTEEAPKAVIELENYGMPFSRTPEGKIYQRAF  60
            M  D+W+WH YDTVKGSDWLGDQDAIHYMT EA +AVIELENYGMPFSRT +GKIYQRAF
Sbjct  95   MNPDNWRWHFYDTVKGSDWLGDQDAIHYMTREAERAVIELENYGMPFSRTTDGKIYQRAF  154

Query  61   GGQSLKFGKGGQAHRCCCVADRTGHSLLHTLYGHSLKYDCNYFVEYFALDLIMEDGECRG  120
            GGQS  FG+GGQAHR CCVADRTGHSLLHTLYG SL+Y+CNYFVEYFALDLIME+G C G
Sbjct  155  GGQSNDFGRGGQAHRTCCVADRTGHSLLHTLYGASLQYNCNYFVEYFALDLIMENGVCVG  214

Query  121  ITALCLDDGTIHRFHAKHTVLATGGYGRAYFSCTSAHTCTGDGTAMVSRVGLPNQDLEFV  180
            + A+ L+DGTIHRF +K+TVLATGGYGRA+FSCTSAHTCTGDGTA+ +R G+ N D+EFV
Sbjct  215  VIAMDLEDGTIHRFRSKNTVLATGGYGRAFFSCTSAHTCTGDGTALTARAGINNSDMEFV  274

Query  181  QFHPTGIYGAGCLITEGCRGEGGYLINSEGERFMERYAPVAKDLASRDVVSRAMTIEIRE  240
            QFHPTGIYGAGCLITEG RGEGGYL+NS GERFMERYAP AKDLASRDVVSR+MT+EI E
Sbjct  275  QFHPTGIYGAGCLITEGSRGEGGYLVNSAGERFMERYAPNAKDLASRDVVSRSMTVEIME  334

Query  241  GRGVGPEKDHVYLQLHHLPVEQLAARLPGISETAMIFAGVDVTREPIPVLPTVHYNMGGV  300
            GRGVGP+KDH+YLQLHHLP EQL  RLPGISETAMIFAGVDVT+EPIPV+PTVHYNMGGV
Sbjct  335  GRGVGPDKDHIYLQLHHLPAEQLQQRLPGISETAMIFAGVDVTKEPIPVIPTVHYNMGGV  394

Query  301  PTNYKGQVLT-TVNGEDKIVRGLYACGESGSTSVHGANRLGANSLLDLVVFGRACAKTIA  359
            PTNYKGQVL  T    D++V GLYA GE G+ SVHGANRLGANSLLDLV+FGRACA  I 
Sbjct  395  PTNYKGQVLNYTPKKGDEVVPGLYAAGECGAHSVHGANRLGANSLLDLVIFGRACAIDIL  454

Query  360  AEHKPGESIGKLSANAGEASISNLDWIRYSDGPISTADLRLRMQKTMQKHAAVFRTAESL  419
                 G  + +L  NAGEAS++N+D +R++ G ISTA+LRL MQK+MQ HAAVFR  + L
Sbjct  455  KNTSAGVGVPELPKNAGEASVANIDKLRHNKGDISTAELRLTMQKSMQNHAAVFRRGDIL  514

Query  420  QEGIRLMEALYADLKDIKVSDRGLVWNSDLVESLELQNLMINAMQTIVGAENRKESRGAH  479
            +EG++++  LY D   + V+D+GLVWNSDL+E+LELQNL+INA QTIV AENR+ESRGAH
Sbjct  515  KEGVKVLSKLYKDQAHLNVADKGLVWNSDLIETLELQNLLINATQTIVAAENREESRGAH  574

Query  480  AREDFKTRSDEYDYSKPIEGQQKRPESEHYRKHTLTTID-DKGKVSIRYRPVIDHTLSK-  537
            AR+DF  R DE DYSKP+EGQ K+   +H+RKH++   + + G+VS+ YRPVID TL K 
Sbjct  575  ARDDFPDRLDELDYSKPLEGQTKKELKDHWRKHSIIRSNIETGEVSLDYRPVIDTTLDKS  634

Query  538  DVATVPPAIRSY  549
            +   VPP +RSY
Sbjct  635  ETDWVPPKVRSY  646


>SDHA_DICDI unnamed protein product
Length=626

 Score = 734 bits (1894),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/557 (64%), Positives = 428/557 (77%), Gaps = 32/557 (6%)

Query  2    EEDDWKWHMYDTVKGSDWLGDQDAIHYMTEEAPKAVIELENYGMPFSRTPEGKIYQRAFG  61
            ++DDW+WH YDTVKGSD+LGDQDAIHYM +EA   V+ELE YG+PFSR  +G+IYQRAFG
Sbjct  93   DQDDWRWHAYDTVKGSDFLGDQDAIHYMCKEAVPTVLELEQYGVPFSRMDDGRIYQRAFG  152

Query  62   GQSLKFGKGGQAHRCCCVADRTGHSLLHTLYGHSLKYDCNYFVEYFALDLIMEDGECRGI  121
            GQS  FGKGGQA RCC  ADRTGH+LLHTLYG ++K++  +F+EYF  DLIME+G+CRG+
Sbjct  153  GQSKNFGKGGQATRCCAAADRTGHALLHTLYGQAVKHNTKFFIEYFVTDLIMENGDCRGV  212

Query  122  TALCLDDGTIHRFHAKHTVLATGGYGRAYFSCTSAHTCTGDGTAMVSRVGLPNQDLEFVQ  181
             A+ L+DGTIHRF +  TV+ATGGYGRAYFS TSAHTCTGDG AMV R GLP QDLEFVQ
Sbjct  213  VAINLEDGTIHRFRSHATVIATGGYGRAYFSATSAHTCTGDGNAMVIRAGLPCQDLEFVQ  272

Query  182  FHPTGIYGAGCLITEGCRGEGGYLINSEGERFMERYAPVAKDLASRDVVSRAMTIEIREG  241
            FHPTGIYG+GCLITEG RGEGGYL+NS GERFM RYAP   DLASRDVVSR+ T+EIREG
Sbjct  273  FHPTGIYGSGCLITEGARGEGGYLLNSSGERFMPRYAPSVADLASRDVVSRSETMEIREG  332

Query  242  RGVGPEKDHVYLQLHHLPVEQLAARLPGISETAMIFAGVDVTREPIPVLPTVHYNMGGVP  301
            RGVGPEKDH  L L HL  E +  RLPGI ETAMIFAGVDVT+EPIPV+PTVHYNMGG+P
Sbjct  333  RGVGPEKDHCLLNLTHLSPEIIDERLPGIRETAMIFAGVDVTKEPIPVIPTVHYNMGGIP  392

Query  302  TNYKGQVLTTVNGEDKIVRGLYACGESGSTSVHGANRLGANSLLDLVVFGRACAKTIA--  359
            TNYKGQV+T V+G+DK+V+GLYA GES   SVHGANRLGANSLLD+VVFGRA A  I   
Sbjct  393  TNYKGQVITQVDGKDKLVKGLYAAGESACVSVHGANRLGANSLLDIVVFGRAVANEIENT  452

Query  360  ----AEHKPGESIGKLSANAGEASISNLDWIRYSDGPISTADLRLRMQKTMQKHAAVFRT  415
                  HKP      L  NAGE SI+N+D IR+S+G  STA++RL MQK MQ++AAVFR 
Sbjct  453  LAKDTPHKP------LPPNAGEESIANIDAIRFSNGTRSTAEIRLEMQKIMQRNAAVFRD  506

Query  416  AESLQEGIRLMEALYADL-KDIKVSDRGLVWNSDLVESLELQNLMINAMQTIVGAENRKE  474
             + L+EG+ L++     L  D+K +DR ++WN+DL+ESLELQNLM  A+ T+  AE RKE
Sbjct  507  GQVLKEGVELIDKCARSLINDLKTTDRTMIWNTDLIESLELQNLMTQAVLTMHSAEARKE  566

Query  475  SRGAHAREDFKTRSDEYDYSKPIEGQQKRPESEHYRKHTLTTID-DKGKVSIRYRPVIDH  533
            SRGAHARED+K R D                  ++ KHTL+ +D + GKV++ YRPV+  
Sbjct  567  SRGAHAREDYKERDD-----------------ANWMKHTLSYLDVNTGKVTLNYRPVVSE  609

Query  534  TLSK-DVATVPPAIRSY  549
            TL + ++ T+ P  R Y
Sbjct  610  TLDQSEMETIKPFKRVY  626



Lambda      K        H
   0.311    0.127    0.359 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8292602108


Query= XP_031327332.1 zinc finger MYM-type protein 1-like [Photinus
pyralis]

Length=553
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q38EI8_TRYB2  unnamed protein product                                 32.0    0.81 
Q25442_MUSDO  unnamed protein product                                 31.2    2.8  
Q8ILW1_PLAF7  unnamed protein product                                 31.2    2.8  


>Q38EI8_TRYB2 unnamed protein product
Length=189

 Score = 32.0 bits (71),  Expect = 0.81, Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 1/50 (2%)

Query  202  DQISNAERELTELNRKKLYPIISTIIFCGTHDLPLRGTTKGNFEDLLDFR  251
            D++     ELT+L  + L    + ++FC   DLP R  T G   D L FR
Sbjct  97   DRVMEVRSELTKLLGEPLLSSATLLVFCNKQDLPNR-LTPGELVDKLGFR  145


>Q25442_MUSDO unnamed protein product
Length=612

 Score = 31.2 bits (69),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 18/77 (23%), Positives = 36/77 (47%), Gaps = 1/77 (1%)

Query  401  HCASHKL-NLVINDLNRIQDIQNTAATIKEIINFFRDSPLRRKYIPNLPLFSETRWSAKY  459
            +C+SH L N++ N      ++       K I+ +F+ + L+ +   +L     TRW++ Y
Sbjct  264  NCSSHLLSNVLENSFEETPELNVPILACKNIVKYFKKANLQHRLRSSLKSECPTRWNSTY  323

Query  460  KSIRVFAANFVEITNAL  476
              +R    N+  +   L
Sbjct  324  TMLRSILDNWESVIQIL  340


>Q8ILW1_PLAF7 unnamed protein product
Length=643

 Score = 31.2 bits (69),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 25/79 (32%), Positives = 38/79 (48%), Gaps = 5/79 (6%)

Query  309  ESADIAGKEQLSLGVRFVDKANN--IREEFLGFSELT--TLNANGISNTILNFCLEHNLN  364
            E    +GK++ +L   F+++ NN  I     G+  L    LN N I + +LN CL  + N
Sbjct  515  EKLIFSGKKKRALAQVFLERGNNNLIINNRDGYQYLQYQILNLNKIFSPLLNLCLHRHFN  574

Query  365  M-DKLVGLGFDGCSTMAGH  382
            +  K+ G G  G S    H
Sbjct  575  IVAKVEGGGLSGQSVAIFH  593



Lambda      K        H
   0.311    0.127    0.359 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8292602108


Query= XP_031327333.1 succinate dehydrogenase [ubiquinone] flavoprotein
subunit, mitochondrial isoform X2 [Photinus pyralis]

Length=549
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SDHA_DROME  unnamed protein product                                   930     0.0  
SDHA_CAEEL  unnamed protein product                                   848     0.0  
SDHA_DICDI  unnamed protein product                                   734     0.0  


>SDHA_DROME unnamed protein product
Length=661

 Score = 930 bits (2403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/551 (80%), Positives = 486/551 (88%), Gaps = 2/551 (0%)

Query  1    MEEDDWKWHMYDTVKGSDWLGDQDAIHYMTEEAPKAVIELENYGMPFSRTPEGKIYQRAF  60
            MEEDDWKWHMYDTVKGSDWLGDQDAIHYMT EAPKAVIELENYGMPFSRT +GKIYQRAF
Sbjct  111  MEEDDWKWHMYDTVKGSDWLGDQDAIHYMTREAPKAVIELENYGMPFSRTQDGKIYQRAF  170

Query  61   GGQSLKFGKGGQAHRCCCVADRTGHSLLHTLYGHSLKYDCNYFVEYFALDLIMEDGECRG  120
            GGQSLKFGKGGQAHRCC VADRTGHSLLHTLYG SL YDCNYFVEYFALDLI EDGECRG
Sbjct  171  GGQSLKFGKGGQAHRCCAVADRTGHSLLHTLYGQSLSYDCNYFVEYFALDLIFEDGECRG  230

Query  121  ITALCLDDGTIHRFHAKHTVLATGGYGRAYFSCTSAHTCTGDGTAMVSRVGLPNQDLEFV  180
            + AL L+DGT+HRF AK+TV+ATGGYGRA+FSCTSAHTCTGDGTAMV+R GLP+QDLEFV
Sbjct  231  VLALNLEDGTLHRFRAKNTVIATGGYGRAFFSCTSAHTCTGDGTAMVARQGLPSQDLEFV  290

Query  181  QFHPTGIYGAGCLITEGCRGEGGYLINSEGERFMERYAPVAKDLASRDVVSRAMTIEIRE  240
            QFHPTGIYGAGCLITEGCRGEGGYLIN  GERFMERYAPVAKDLASRDVVSR+MTIEI E
Sbjct  291  QFHPTGIYGAGCLITEGCRGEGGYLINGNGERFMERYAPVAKDLASRDVVSRSMTIEIME  350

Query  241  GRGVGPEKDHVYLQLHHLPVEQLAARLPGISETAMIFAGVDVTREPIPVLPTVHYNMGGV  300
            GRG GPEKDHVYLQLHHLP +QLA RLPGISETAMIFAGVDVTREPIPVLPTVHYNMGGV
Sbjct  351  GRGAGPEKDHVYLQLHHLPPKQLAERLPGISETAMIFAGVDVTREPIPVLPTVHYNMGGV  410

Query  301  PTNYKGQVLTT-VNGEDKIVRGLYACGESGSTSVHGANRLGANSLLDLVVFGRACAKTIA  359
            PTNY+GQV+T   +G+D IV GLYA GE+ S+SVHGANRLGANSLLDLVVFGRACAKTIA
Sbjct  411  PTNYRGQVITIDKDGKDVIVPGLYAAGEAASSSVHGANRLGANSLLDLVVFGRACAKTIA  470

Query  360  AEHKPGESIGKLSANAGEASISNLDWIRYSDGPISTADLRLRMQKTMQKHAAVFRTAESL  419
              +KPG     L  NAGEAS++NLD +R+++G I+TADLRL+MQKTMQ HAAVFR    L
Sbjct  471  ELNKPGAPAPTLKENAGEASVANLDKLRHANGQITTADLRLKMQKTMQHHAAVFRDGPIL  530

Query  420  QEGIRLMEALYADLKDIKVSDRGLVWNSDLVESLELQNLMINAMQTIVGAENRKESRGAH  479
            Q+G+  M+ +Y   KDIKV DR L+WNSDLVE+LELQNL+ NA  TIV AE RKESRGAH
Sbjct  531  QDGVNKMKEIYKQFKDIKVVDRSLIWNSDLVETLELQNLLANAQMTIVSAEARKESRGAH  590

Query  480  AREDFKTRSDEYDYSKPIEGQQKRPESEHYRKHTLTTI-DDKGKVSIRYRPVIDHTLSKD  538
            AREDFK R DEYD+SKP++GQQK+P  +H+RKHTL+ + +D G +++ YR VID TL  +
Sbjct  591  AREDFKVREDEYDFSKPLDGQQKKPMDQHWRKHTLSWVCNDNGDITLDYRNVIDTTLDNE  650

Query  539  VATVPPAIRSY  549
            V+TVPPAIRSY
Sbjct  651  VSTVPPAIRSY  661


>SDHA_CAEEL unnamed protein product
Length=646

 Score = 848 bits (2192),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/552 (72%), Positives = 465/552 (84%), Gaps = 3/552 (1%)

Query  1    MEEDDWKWHMYDTVKGSDWLGDQDAIHYMTEEAPKAVIELENYGMPFSRTPEGKIYQRAF  60
            M  D+W+WH YDTVKGSDWLGDQDAIHYMT EA +AVIELENYGMPFSRT +GKIYQRAF
Sbjct  95   MNPDNWRWHFYDTVKGSDWLGDQDAIHYMTREAERAVIELENYGMPFSRTTDGKIYQRAF  154

Query  61   GGQSLKFGKGGQAHRCCCVADRTGHSLLHTLYGHSLKYDCNYFVEYFALDLIMEDGECRG  120
            GGQS  FG+GGQAHR CCVADRTGHSLLHTLYG SL+Y+CNYFVEYFALDLIME+G C G
Sbjct  155  GGQSNDFGRGGQAHRTCCVADRTGHSLLHTLYGASLQYNCNYFVEYFALDLIMENGVCVG  214

Query  121  ITALCLDDGTIHRFHAKHTVLATGGYGRAYFSCTSAHTCTGDGTAMVSRVGLPNQDLEFV  180
            + A+ L+DGTIHRF +K+TVLATGGYGRA+FSCTSAHTCTGDGTA+ +R G+ N D+EFV
Sbjct  215  VIAMDLEDGTIHRFRSKNTVLATGGYGRAFFSCTSAHTCTGDGTALTARAGINNSDMEFV  274

Query  181  QFHPTGIYGAGCLITEGCRGEGGYLINSEGERFMERYAPVAKDLASRDVVSRAMTIEIRE  240
            QFHPTGIYGAGCLITEG RGEGGYL+NS GERFMERYAP AKDLASRDVVSR+MT+EI E
Sbjct  275  QFHPTGIYGAGCLITEGSRGEGGYLVNSAGERFMERYAPNAKDLASRDVVSRSMTVEIME  334

Query  241  GRGVGPEKDHVYLQLHHLPVEQLAARLPGISETAMIFAGVDVTREPIPVLPTVHYNMGGV  300
            GRGVGP+KDH+YLQLHHLP EQL  RLPGISETAMIFAGVDVT+EPIPV+PTVHYNMGGV
Sbjct  335  GRGVGPDKDHIYLQLHHLPAEQLQQRLPGISETAMIFAGVDVTKEPIPVIPTVHYNMGGV  394

Query  301  PTNYKGQVLT-TVNGEDKIVRGLYACGESGSTSVHGANRLGANSLLDLVVFGRACAKTIA  359
            PTNYKGQVL  T    D++V GLYA GE G+ SVHGANRLGANSLLDLV+FGRACA  I 
Sbjct  395  PTNYKGQVLNYTPKKGDEVVPGLYAAGECGAHSVHGANRLGANSLLDLVIFGRACAIDIL  454

Query  360  AEHKPGESIGKLSANAGEASISNLDWIRYSDGPISTADLRLRMQKTMQKHAAVFRTAESL  419
                 G  + +L  NAGEAS++N+D +R++ G ISTA+LRL MQK+MQ HAAVFR  + L
Sbjct  455  KNTSAGVGVPELPKNAGEASVANIDKLRHNKGDISTAELRLTMQKSMQNHAAVFRRGDIL  514

Query  420  QEGIRLMEALYADLKDIKVSDRGLVWNSDLVESLELQNLMINAMQTIVGAENRKESRGAH  479
            +EG++++  LY D   + V+D+GLVWNSDL+E+LELQNL+INA QTIV AENR+ESRGAH
Sbjct  515  KEGVKVLSKLYKDQAHLNVADKGLVWNSDLIETLELQNLLINATQTIVAAENREESRGAH  574

Query  480  AREDFKTRSDEYDYSKPIEGQQKRPESEHYRKHTLTTID-DKGKVSIRYRPVIDHTLSK-  537
            AR+DF  R DE DYSKP+EGQ K+   +H+RKH++   + + G+VS+ YRPVID TL K 
Sbjct  575  ARDDFPDRLDELDYSKPLEGQTKKELKDHWRKHSIIRSNIETGEVSLDYRPVIDTTLDKS  634

Query  538  DVATVPPAIRSY  549
            +   VPP +RSY
Sbjct  635  ETDWVPPKVRSY  646


>SDHA_DICDI unnamed protein product
Length=626

 Score = 734 bits (1894),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/557 (64%), Positives = 428/557 (77%), Gaps = 32/557 (6%)

Query  2    EEDDWKWHMYDTVKGSDWLGDQDAIHYMTEEAPKAVIELENYGMPFSRTPEGKIYQRAFG  61
            ++DDW+WH YDTVKGSD+LGDQDAIHYM +EA   V+ELE YG+PFSR  +G+IYQRAFG
Sbjct  93   DQDDWRWHAYDTVKGSDFLGDQDAIHYMCKEAVPTVLELEQYGVPFSRMDDGRIYQRAFG  152

Query  62   GQSLKFGKGGQAHRCCCVADRTGHSLLHTLYGHSLKYDCNYFVEYFALDLIMEDGECRGI  121
            GQS  FGKGGQA RCC  ADRTGH+LLHTLYG ++K++  +F+EYF  DLIME+G+CRG+
Sbjct  153  GQSKNFGKGGQATRCCAAADRTGHALLHTLYGQAVKHNTKFFIEYFVTDLIMENGDCRGV  212

Query  122  TALCLDDGTIHRFHAKHTVLATGGYGRAYFSCTSAHTCTGDGTAMVSRVGLPNQDLEFVQ  181
             A+ L+DGTIHRF +  TV+ATGGYGRAYFS TSAHTCTGDG AMV R GLP QDLEFVQ
Sbjct  213  VAINLEDGTIHRFRSHATVIATGGYGRAYFSATSAHTCTGDGNAMVIRAGLPCQDLEFVQ  272

Query  182  FHPTGIYGAGCLITEGCRGEGGYLINSEGERFMERYAPVAKDLASRDVVSRAMTIEIREG  241
            FHPTGIYG+GCLITEG RGEGGYL+NS GERFM RYAP   DLASRDVVSR+ T+EIREG
Sbjct  273  FHPTGIYGSGCLITEGARGEGGYLLNSSGERFMPRYAPSVADLASRDVVSRSETMEIREG  332

Query  242  RGVGPEKDHVYLQLHHLPVEQLAARLPGISETAMIFAGVDVTREPIPVLPTVHYNMGGVP  301
            RGVGPEKDH  L L HL  E +  RLPGI ETAMIFAGVDVT+EPIPV+PTVHYNMGG+P
Sbjct  333  RGVGPEKDHCLLNLTHLSPEIIDERLPGIRETAMIFAGVDVTKEPIPVIPTVHYNMGGIP  392

Query  302  TNYKGQVLTTVNGEDKIVRGLYACGESGSTSVHGANRLGANSLLDLVVFGRACAKTIA--  359
            TNYKGQV+T V+G+DK+V+GLYA GES   SVHGANRLGANSLLD+VVFGRA A  I   
Sbjct  393  TNYKGQVITQVDGKDKLVKGLYAAGESACVSVHGANRLGANSLLDIVVFGRAVANEIENT  452

Query  360  ----AEHKPGESIGKLSANAGEASISNLDWIRYSDGPISTADLRLRMQKTMQKHAAVFRT  415
                  HKP      L  NAGE SI+N+D IR+S+G  STA++RL MQK MQ++AAVFR 
Sbjct  453  LAKDTPHKP------LPPNAGEESIANIDAIRFSNGTRSTAEIRLEMQKIMQRNAAVFRD  506

Query  416  AESLQEGIRLMEALYADL-KDIKVSDRGLVWNSDLVESLELQNLMINAMQTIVGAENRKE  474
             + L+EG+ L++     L  D+K +DR ++WN+DL+ESLELQNLM  A+ T+  AE RKE
Sbjct  507  GQVLKEGVELIDKCARSLINDLKTTDRTMIWNTDLIESLELQNLMTQAVLTMHSAEARKE  566

Query  475  SRGAHAREDFKTRSDEYDYSKPIEGQQKRPESEHYRKHTLTTID-DKGKVSIRYRPVIDH  533
            SRGAHARED+K R D                  ++ KHTL+ +D + GKV++ YRPV+  
Sbjct  567  SRGAHAREDYKERDD-----------------ANWMKHTLSYLDVNTGKVTLNYRPVVSE  609

Query  534  TLSK-DVATVPPAIRSY  549
            TL + ++ T+ P  R Y
Sbjct  610  TLDQSEMETIKPFKRVY  626



Lambda      K        H
   0.311    0.127    0.359 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8292602108


Query= XP_031327334.1 succinate dehydrogenase [ubiquinone] flavoprotein
subunit, mitochondrial isoform X2 [Photinus pyralis]

Length=549
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SDHA_DROME  unnamed protein product                                   930     0.0  
SDHA_CAEEL  unnamed protein product                                   848     0.0  
SDHA_DICDI  unnamed protein product                                   734     0.0  


>SDHA_DROME unnamed protein product
Length=661

 Score = 930 bits (2403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/551 (80%), Positives = 486/551 (88%), Gaps = 2/551 (0%)

Query  1    MEEDDWKWHMYDTVKGSDWLGDQDAIHYMTEEAPKAVIELENYGMPFSRTPEGKIYQRAF  60
            MEEDDWKWHMYDTVKGSDWLGDQDAIHYMT EAPKAVIELENYGMPFSRT +GKIYQRAF
Sbjct  111  MEEDDWKWHMYDTVKGSDWLGDQDAIHYMTREAPKAVIELENYGMPFSRTQDGKIYQRAF  170

Query  61   GGQSLKFGKGGQAHRCCCVADRTGHSLLHTLYGHSLKYDCNYFVEYFALDLIMEDGECRG  120
            GGQSLKFGKGGQAHRCC VADRTGHSLLHTLYG SL YDCNYFVEYFALDLI EDGECRG
Sbjct  171  GGQSLKFGKGGQAHRCCAVADRTGHSLLHTLYGQSLSYDCNYFVEYFALDLIFEDGECRG  230

Query  121  ITALCLDDGTIHRFHAKHTVLATGGYGRAYFSCTSAHTCTGDGTAMVSRVGLPNQDLEFV  180
            + AL L+DGT+HRF AK+TV+ATGGYGRA+FSCTSAHTCTGDGTAMV+R GLP+QDLEFV
Sbjct  231  VLALNLEDGTLHRFRAKNTVIATGGYGRAFFSCTSAHTCTGDGTAMVARQGLPSQDLEFV  290

Query  181  QFHPTGIYGAGCLITEGCRGEGGYLINSEGERFMERYAPVAKDLASRDVVSRAMTIEIRE  240
            QFHPTGIYGAGCLITEGCRGEGGYLIN  GERFMERYAPVAKDLASRDVVSR+MTIEI E
Sbjct  291  QFHPTGIYGAGCLITEGCRGEGGYLINGNGERFMERYAPVAKDLASRDVVSRSMTIEIME  350

Query  241  GRGVGPEKDHVYLQLHHLPVEQLAARLPGISETAMIFAGVDVTREPIPVLPTVHYNMGGV  300
            GRG GPEKDHVYLQLHHLP +QLA RLPGISETAMIFAGVDVTREPIPVLPTVHYNMGGV
Sbjct  351  GRGAGPEKDHVYLQLHHLPPKQLAERLPGISETAMIFAGVDVTREPIPVLPTVHYNMGGV  410

Query  301  PTNYKGQVLTT-VNGEDKIVRGLYACGESGSTSVHGANRLGANSLLDLVVFGRACAKTIA  359
            PTNY+GQV+T   +G+D IV GLYA GE+ S+SVHGANRLGANSLLDLVVFGRACAKTIA
Sbjct  411  PTNYRGQVITIDKDGKDVIVPGLYAAGEAASSSVHGANRLGANSLLDLVVFGRACAKTIA  470

Query  360  AEHKPGESIGKLSANAGEASISNLDWIRYSDGPISTADLRLRMQKTMQKHAAVFRTAESL  419
              +KPG     L  NAGEAS++NLD +R+++G I+TADLRL+MQKTMQ HAAVFR    L
Sbjct  471  ELNKPGAPAPTLKENAGEASVANLDKLRHANGQITTADLRLKMQKTMQHHAAVFRDGPIL  530

Query  420  QEGIRLMEALYADLKDIKVSDRGLVWNSDLVESLELQNLMINAMQTIVGAENRKESRGAH  479
            Q+G+  M+ +Y   KDIKV DR L+WNSDLVE+LELQNL+ NA  TIV AE RKESRGAH
Sbjct  531  QDGVNKMKEIYKQFKDIKVVDRSLIWNSDLVETLELQNLLANAQMTIVSAEARKESRGAH  590

Query  480  AREDFKTRSDEYDYSKPIEGQQKRPESEHYRKHTLTTI-DDKGKVSIRYRPVIDHTLSKD  538
            AREDFK R DEYD+SKP++GQQK+P  +H+RKHTL+ + +D G +++ YR VID TL  +
Sbjct  591  AREDFKVREDEYDFSKPLDGQQKKPMDQHWRKHTLSWVCNDNGDITLDYRNVIDTTLDNE  650

Query  539  VATVPPAIRSY  549
            V+TVPPAIRSY
Sbjct  651  VSTVPPAIRSY  661


>SDHA_CAEEL unnamed protein product
Length=646

 Score = 848 bits (2192),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/552 (72%), Positives = 465/552 (84%), Gaps = 3/552 (1%)

Query  1    MEEDDWKWHMYDTVKGSDWLGDQDAIHYMTEEAPKAVIELENYGMPFSRTPEGKIYQRAF  60
            M  D+W+WH YDTVKGSDWLGDQDAIHYMT EA +AVIELENYGMPFSRT +GKIYQRAF
Sbjct  95   MNPDNWRWHFYDTVKGSDWLGDQDAIHYMTREAERAVIELENYGMPFSRTTDGKIYQRAF  154

Query  61   GGQSLKFGKGGQAHRCCCVADRTGHSLLHTLYGHSLKYDCNYFVEYFALDLIMEDGECRG  120
            GGQS  FG+GGQAHR CCVADRTGHSLLHTLYG SL+Y+CNYFVEYFALDLIME+G C G
Sbjct  155  GGQSNDFGRGGQAHRTCCVADRTGHSLLHTLYGASLQYNCNYFVEYFALDLIMENGVCVG  214

Query  121  ITALCLDDGTIHRFHAKHTVLATGGYGRAYFSCTSAHTCTGDGTAMVSRVGLPNQDLEFV  180
            + A+ L+DGTIHRF +K+TVLATGGYGRA+FSCTSAHTCTGDGTA+ +R G+ N D+EFV
Sbjct  215  VIAMDLEDGTIHRFRSKNTVLATGGYGRAFFSCTSAHTCTGDGTALTARAGINNSDMEFV  274

Query  181  QFHPTGIYGAGCLITEGCRGEGGYLINSEGERFMERYAPVAKDLASRDVVSRAMTIEIRE  240
            QFHPTGIYGAGCLITEG RGEGGYL+NS GERFMERYAP AKDLASRDVVSR+MT+EI E
Sbjct  275  QFHPTGIYGAGCLITEGSRGEGGYLVNSAGERFMERYAPNAKDLASRDVVSRSMTVEIME  334

Query  241  GRGVGPEKDHVYLQLHHLPVEQLAARLPGISETAMIFAGVDVTREPIPVLPTVHYNMGGV  300
            GRGVGP+KDH+YLQLHHLP EQL  RLPGISETAMIFAGVDVT+EPIPV+PTVHYNMGGV
Sbjct  335  GRGVGPDKDHIYLQLHHLPAEQLQQRLPGISETAMIFAGVDVTKEPIPVIPTVHYNMGGV  394

Query  301  PTNYKGQVLT-TVNGEDKIVRGLYACGESGSTSVHGANRLGANSLLDLVVFGRACAKTIA  359
            PTNYKGQVL  T    D++V GLYA GE G+ SVHGANRLGANSLLDLV+FGRACA  I 
Sbjct  395  PTNYKGQVLNYTPKKGDEVVPGLYAAGECGAHSVHGANRLGANSLLDLVIFGRACAIDIL  454

Query  360  AEHKPGESIGKLSANAGEASISNLDWIRYSDGPISTADLRLRMQKTMQKHAAVFRTAESL  419
                 G  + +L  NAGEAS++N+D +R++ G ISTA+LRL MQK+MQ HAAVFR  + L
Sbjct  455  KNTSAGVGVPELPKNAGEASVANIDKLRHNKGDISTAELRLTMQKSMQNHAAVFRRGDIL  514

Query  420  QEGIRLMEALYADLKDIKVSDRGLVWNSDLVESLELQNLMINAMQTIVGAENRKESRGAH  479
            +EG++++  LY D   + V+D+GLVWNSDL+E+LELQNL+INA QTIV AENR+ESRGAH
Sbjct  515  KEGVKVLSKLYKDQAHLNVADKGLVWNSDLIETLELQNLLINATQTIVAAENREESRGAH  574

Query  480  AREDFKTRSDEYDYSKPIEGQQKRPESEHYRKHTLTTID-DKGKVSIRYRPVIDHTLSK-  537
            AR+DF  R DE DYSKP+EGQ K+   +H+RKH++   + + G+VS+ YRPVID TL K 
Sbjct  575  ARDDFPDRLDELDYSKPLEGQTKKELKDHWRKHSIIRSNIETGEVSLDYRPVIDTTLDKS  634

Query  538  DVATVPPAIRSY  549
            +   VPP +RSY
Sbjct  635  ETDWVPPKVRSY  646


>SDHA_DICDI unnamed protein product
Length=626

 Score = 734 bits (1894),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/557 (64%), Positives = 428/557 (77%), Gaps = 32/557 (6%)

Query  2    EEDDWKWHMYDTVKGSDWLGDQDAIHYMTEEAPKAVIELENYGMPFSRTPEGKIYQRAFG  61
            ++DDW+WH YDTVKGSD+LGDQDAIHYM +EA   V+ELE YG+PFSR  +G+IYQRAFG
Sbjct  93   DQDDWRWHAYDTVKGSDFLGDQDAIHYMCKEAVPTVLELEQYGVPFSRMDDGRIYQRAFG  152

Query  62   GQSLKFGKGGQAHRCCCVADRTGHSLLHTLYGHSLKYDCNYFVEYFALDLIMEDGECRGI  121
            GQS  FGKGGQA RCC  ADRTGH+LLHTLYG ++K++  +F+EYF  DLIME+G+CRG+
Sbjct  153  GQSKNFGKGGQATRCCAAADRTGHALLHTLYGQAVKHNTKFFIEYFVTDLIMENGDCRGV  212

Query  122  TALCLDDGTIHRFHAKHTVLATGGYGRAYFSCTSAHTCTGDGTAMVSRVGLPNQDLEFVQ  181
             A+ L+DGTIHRF +  TV+ATGGYGRAYFS TSAHTCTGDG AMV R GLP QDLEFVQ
Sbjct  213  VAINLEDGTIHRFRSHATVIATGGYGRAYFSATSAHTCTGDGNAMVIRAGLPCQDLEFVQ  272

Query  182  FHPTGIYGAGCLITEGCRGEGGYLINSEGERFMERYAPVAKDLASRDVVSRAMTIEIREG  241
            FHPTGIYG+GCLITEG RGEGGYL+NS GERFM RYAP   DLASRDVVSR+ T+EIREG
Sbjct  273  FHPTGIYGSGCLITEGARGEGGYLLNSSGERFMPRYAPSVADLASRDVVSRSETMEIREG  332

Query  242  RGVGPEKDHVYLQLHHLPVEQLAARLPGISETAMIFAGVDVTREPIPVLPTVHYNMGGVP  301
            RGVGPEKDH  L L HL  E +  RLPGI ETAMIFAGVDVT+EPIPV+PTVHYNMGG+P
Sbjct  333  RGVGPEKDHCLLNLTHLSPEIIDERLPGIRETAMIFAGVDVTKEPIPVIPTVHYNMGGIP  392

Query  302  TNYKGQVLTTVNGEDKIVRGLYACGESGSTSVHGANRLGANSLLDLVVFGRACAKTIA--  359
            TNYKGQV+T V+G+DK+V+GLYA GES   SVHGANRLGANSLLD+VVFGRA A  I   
Sbjct  393  TNYKGQVITQVDGKDKLVKGLYAAGESACVSVHGANRLGANSLLDIVVFGRAVANEIENT  452

Query  360  ----AEHKPGESIGKLSANAGEASISNLDWIRYSDGPISTADLRLRMQKTMQKHAAVFRT  415
                  HKP      L  NAGE SI+N+D IR+S+G  STA++RL MQK MQ++AAVFR 
Sbjct  453  LAKDTPHKP------LPPNAGEESIANIDAIRFSNGTRSTAEIRLEMQKIMQRNAAVFRD  506

Query  416  AESLQEGIRLMEALYADL-KDIKVSDRGLVWNSDLVESLELQNLMINAMQTIVGAENRKE  474
             + L+EG+ L++     L  D+K +DR ++WN+DL+ESLELQNLM  A+ T+  AE RKE
Sbjct  507  GQVLKEGVELIDKCARSLINDLKTTDRTMIWNTDLIESLELQNLMTQAVLTMHSAEARKE  566

Query  475  SRGAHAREDFKTRSDEYDYSKPIEGQQKRPESEHYRKHTLTTID-DKGKVSIRYRPVIDH  533
            SRGAHARED+K R D                  ++ KHTL+ +D + GKV++ YRPV+  
Sbjct  567  SRGAHAREDYKERDD-----------------ANWMKHTLSYLDVNTGKVTLNYRPVVSE  609

Query  534  TLSK-DVATVPPAIRSY  549
            TL + ++ T+ P  R Y
Sbjct  610  TLDQSEMETIKPFKRVY  626



Lambda      K        H
   0.311    0.127    0.359 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8292602108


Query= XP_031327335.1 enoyl-CoA hydratase domain-containing protein 3,
mitochondrial-like [Photinus pyralis]

Length=287
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ECHM_CAEEL  unnamed protein product                                   89.4    1e-20
A1Z934_DROME  unnamed protein product                                 77.0    4e-16
Q7JR58_DROME  unnamed protein product                                 70.9    5e-14


>ECHM_CAEEL unnamed protein product
Length=288

 Score = 89.4 bits (220),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 66/257 (26%), Positives = 106/257 (41%), Gaps = 12/257 (5%)

Query  26   LTKVTFNNGIKTITLASPETRNTLSIPMERELLKHLSADWENNDLRVIVLDSEGPLFSAG  85
            + KV     +  I L  P+  N L   +  EL   L     +  +  IV+      F+AG
Sbjct  36   IEKVGEKQNVALIKLNRPKALNALCAQLMTELADALEVLDTDKSVGAIVITGSERAFAAG  95

Query  86   HNLNEMTTKNNLEVHNEIFHLASKVMF----AIIDCPVPVVGKVKAGAFAAGCQLVAQCD  141
             ++ EMT       +NE     S        A+ D   PV+  V   A   G +L   CD
Sbjct  96   ADIKEMT-------NNEFATTFSGSFLSNWTAVSDVKKPVIAAVNGFALGGGNELAMMCD  148

Query  142  IAVCTPNCKFATPGANVGIFCSTPGVA-IARCVHPMVTRHMLLTGLPLTANEAKDNGLVF  200
            I       +F  P  N+G      G    AR         + LTG  +TA EAK++G+V 
Sbjct  149  IIYAGEKARFGQPEINIGTIPGAGGTQRWARAAGKSFAMEVCLTGNHVTAQEAKEHGIVS  208

Query  201  KVCKEEDIDKEVDHICQSIMSKSRAIIMNGKRFYYRQVDLPIKEAFKLGEQEMIDTLSLR  260
            K+   + +  E   + + I  +S  I+   K    +  +L ++E      +    T + +
Sbjct  209  KIFPADQVVGEAVKLGEKIADQSPLIVQMAKEAVNKAYELTLQEGLHFERRLFHATFATK  268

Query  261  DTQEGIESFLQKKKPNW  277
            D +EG+ +F +K+KP W
Sbjct  269  DRKEGMTAFAEKRKPQW  285


>A1Z934_DROME unnamed protein product
Length=299

 Score = 77.0 bits (188),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 66/258 (26%), Positives = 106/258 (41%), Gaps = 19/258 (7%)

Query  32   NNGIKTITLASPETRNTLSIPMERELLKHLSADWENNDLRVIVLDSEGP-LFSAGHNLNE  90
              GI  I L  P  +N+ S  M       L    ++N  RV+VL S  P +F AG +L E
Sbjct  46   RQGISVIGLNRPAAKNSFSRGMVETFNDVLEDIKKDNGSRVVVLRSLSPGIFCAGADLKE  105

Query  91   ---MTTKNNLEVHNEIFHLASKVMFAIIDCPVPVVGKVKAGAFAAGCQLVAQCDIAVCTP  147
               MT +   E   E+  L    + AI   P+PV+  V   A   G ++   CDI     
Sbjct  106  RKGMTPEEATEFVKELRGL----LIAIEQLPMPVIAAVDGAALGGGLEMALACDIRTAAS  161

Query  148  NCKFATPGANVGIFCSTPGVA-IARCVHPMVTRHMLLTGLPLTANEAKDNGLVFKVCKEE  206
            + K       + I     G   + R + P + + ++ T       EAKD GLV  V K+ 
Sbjct  162  DTKMGLVETRLAIIPGAGGTQRLPRILSPALAKELIFTARVFNGAEAKDLGLVNHVVKQN  221

Query  207  DIDKEVDHICQSIMSKSRAIIMNG-------KRFYYRQVDLPIKEAFKLGEQEMIDTLSL  259
            +     D   Q  +  +  I+ NG       K    + + + +   + + E      +  
Sbjct  222  ETQ---DAAYQQALKLAEEILPNGPVGVRMAKLAIDKGMQVDLATGYSIEEICYSQVIPT  278

Query  260  RDTQEGIESFLQKKKPNW  277
            +D  EG+ +F +K+KP +
Sbjct  279  KDRLEGLAAFAEKRKPVY  296


>Q7JR58_DROME unnamed protein product
Length=295

 Score = 70.9 bits (172),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 59/241 (24%), Positives = 96/241 (40%), Gaps = 6/241 (2%)

Query  35   IKTITLASPETRNTLSIPMERELLKHLSADWENNDLRVIVLDSEGPLFSAGHNLNEMTTK  94
            +  ITL  P+  N L   + +EL   L    ++  +  IVL      F+AG ++ EM   
Sbjct  52   VGVITLNRPKALNALCNGLMKELSTALQQFSKDKTISAIVLTGSEKAFAAGADIKEMVGN  111

Query  95   NNLE-VHNEIFHLASKVMFAIIDCPVPVVGKVKAGAFAAGCQLVAQCDIAVCTPNCKFAT  153
               + +     +  ++V         P++  V   A   GC+L   CDI       KF  
Sbjct  112  TYSQCIQGNFLNDWTEVA----RTQKPIIAAVNGYALGGGCELAMMCDIIYAGDKAKFGQ  167

Query  154  PGANVGIFCSTPGVA-IARCVHPMVTRHMLLTGLPLTANEAKDNGLVFKVCKEEDIDKEV  212
            P   +G      G   + R V       M LTG  + A EA+  GL  KV   + +  E 
Sbjct  168  PEIALGTIPGAGGTQRLTRVVGKSKAMEMCLTGNMIGAQEAEKLGLASKVVPADQLLGEA  227

Query  213  DHICQSIMSKSRAIIMNGKRFYYRQVDLPIKEAFKLGEQEMIDTLSLRDTQEGIESFLQK  272
              + + I + S  I+   K       +  ++E  K   +    T S  D +EG+ +F +K
Sbjct  228  VKLGEKIGTHSNLIVQLCKEAVNTAYETTLQEGLKFERRTFHATFSTADRKEGMTAFAEK  287

Query  273  K  273
            +
Sbjct  288  R  288



Lambda      K        H
   0.311    0.127    0.359 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8292602108


Query= XP_031327336.1 uncharacterized protein LOC116158651 [Photinus
pyralis]

Length=131
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

OB99A_DROME  unnamed protein product                                  42.7    8e-06
OB76A_DROME  unnamed protein product                                  35.0    0.006
Q7K084_DROME  unnamed protein product                                 33.5    0.021


>OB99A_DROME unnamed protein product
Length=142

 Score = 42.7 bits (99),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 40/84 (48%), Gaps = 7/84 (8%)

Query  51   DRMKYLEFPKDQKFYCYMKCLYNEAGVIDAEGHVNVEELAKKFSFGNLE-------AAKK  103
            ++ +  E+P D K  CY+KC++ + G+ D +   NVE + ++    + +       +   
Sbjct  45   EKYQKWEYPNDAKTQCYIKCVFTKWGLFDVQSGFNVENIHQQLVGNHADHNEAFHASLAA  104

Query  104  CEDKVETEKRLCEQAYELLLCTVE  127
            C DK E     CE AY    C ++
Sbjct  105  CVDKNEQGSNACEWAYRGATCLLK  128


>OB76A_DROME unnamed protein product
Length=153

 Score = 35.0 bits (79),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 36/84 (43%), Gaps = 8/84 (10%)

Query  52   RMKYLEFPKDQKFYCYMKCLYNEAGVIDAEGHVN----VEELAKKFSFGNLEAAKK----  103
            R+    FP  Q   CY KC+   AG ++ +G  N    + +L        +E ++K    
Sbjct  61   RVGDFNFPPSQDLMCYTKCVSLMAGTVNKKGEFNAPKALAQLPHLVPPEMMEMSRKSVEA  120

Query  104  CEDKVETEKRLCEQAYELLLCTVE  127
            C D  +  K  CE+ Y+   C  E
Sbjct  121  CRDTHKQFKESCERVYQTAKCFSE  144


>Q7K084_DROME unnamed protein product
Length=143

 Score = 33.5 bits (75),  Expect = 0.021, Method: Compositional matrix adjust.
 Identities = 28/123 (23%), Positives = 51/123 (41%), Gaps = 7/123 (6%)

Query  8    TLLLVSMTAAINVSPEKIEKWENAIQPHVEKCKLESNVDPVYADRMKYLEFPKDQKFYCY  67
             +LL ++    + S  K+   E+ +Q   ++C   S V      + K  ++P D     Y
Sbjct  6    AILLCALLGLASASDYKLRTAED-LQSARKECAASSKVTEALIAKYKTFDYPDDDITRNY  64

Query  68   MKCLYNEAGVIDAEGHVNVEELAKKFSFGNLEAA------KKCEDKVETEKRLCEQAYEL  121
            ++C++ +  + D      VE L  +   G  + A      +KC DK E +    E A+  
Sbjct  65   IQCIFVKFDLFDEAKGFKVENLVAQLGQGKEDKAALKADIEKCADKNEQKSPANEWAFRG  124

Query  122  LLC  124
              C
Sbjct  125  FKC  127



Lambda      K        H
   0.311    0.127    0.359 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8292602108


Query= XP_031327337.1 uncharacterized protein LOC116158652 [Photinus
pyralis]

Length=309
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VEF0_DROME  unnamed protein product                                 31.6    0.74 
G5EGS5_CAEEL  unnamed protein product                                 31.2    1.6  
X2J8X8_DROME  unnamed protein product                                 30.0    2.4  


>Q9VEF0_DROME unnamed protein product
Length=430

 Score = 31.6 bits (70),  Expect = 0.74, Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 2/46 (4%)

Query  194  LNHTESHRRITNDDHLFLTCSKPFKPATKQTLSRWVKTTLYKAGVD  239
            L H E H+    D H+ LTC+K FK A  Q L R   T  ++  V+
Sbjct  308  LKHEEGHKSDQPDVHICLTCNKEFKEA--QFLHRHYSTKYHRKRVN  351


>G5EGS5_CAEEL unnamed protein product
Length=1975

 Score = 31.2 bits (69),  Expect = 1.6, Method: Composition-based stats.
 Identities = 12/25 (48%), Positives = 19/25 (76%), Gaps = 0/25 (0%)

Query  147   NITDERINIFIPDLIKTSKPNSYQP  171
             ++T ER+N F+P+LIK + PN  +P
Sbjct  1685  DVTVERLNKFMPELIKDTIPNPPRP  1709


>X2J8X8_DROME unnamed protein product
Length=396

 Score = 30.0 bits (66),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 32/160 (20%), Positives = 59/160 (37%), Gaps = 18/160 (11%)

Query  16   TYKLWWNFCRDRNICPFNVESEPVISFLQ--NILDSTNNLFGSVNSHRSALSLISMSNLG  73
            T ++ W   RD  +    + ++PV S+    N++  T  + G  + H    S I+     
Sbjct  141  TLQIKWAQKRDAGMYECQISTQPVRSYFVRLNVVVPTATILGGPDLHVDKGSTIN-----  195

Query  74   DDLSLKRFLKGVFKLRPPKPKYNYTWNPEKVIRYFDKSDDSSLTFLSHKLVALLTLVTGH  133
                    L    K  P  P Y + ++ E+VI Y       S+      +     L+   
Sbjct  196  --------LTCTVKFSPEPPAYIFWYHHEEVINYDSSRGGVSVITEKGDVTTSFLLIQNA  247

Query  134  RLQTIALIRC--SNINITDERINIF-IPDLIKTSKPNSYQ  170
             L       C  SN ++   R+++  +  +I    P + Q
Sbjct  248  DLADSGKYSCAPSNADVASVRVHVLNVRAIISGEHPEAMQ  287



Lambda      K        H
   0.311    0.127    0.359 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8292602108


Query= XP_031327338.1 uncharacterized protein LOC116158653 [Photinus
pyralis]

Length=137
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ABCA4_DICDI  unnamed protein product                                  29.6    0.76 
M9PCJ8_DROME  unnamed protein product                                 28.5    2.5  
M9NCR4_DROME  unnamed protein product                                 28.5    2.5  


>ABCA4_DICDI unnamed protein product
Length=1615

 Score = 29.6 bits (65),  Expect = 0.76, Method: Composition-based stats.
 Identities = 11/31 (35%), Positives = 20/31 (65%), Gaps = 0/31 (0%)

Query  79   LNNDGTSNIDNYRIFIASEHPEIVNPLIEKC  109
            LN+D  + +DN ++ ++ +HPE  N  I +C
Sbjct  80   LNSDQRNILDNLKLQVSIQHPEFSNDYINRC  110


>M9PCJ8_DROME unnamed protein product
Length=14825

 Score = 28.5 bits (62),  Expect = 2.5, Method: Composition-based stats.
 Identities = 11/23 (48%), Positives = 14/23 (61%), Gaps = 0/23 (0%)

Query  99     PEIVNPLIEKCKPSGVGGNVQER  121
              P + +P+IE C PS  G N Q R
Sbjct  11652  PVVEDPIIEACSPSPCGSNSQCR  11674


>M9NCR4_DROME unnamed protein product
Length=15105

 Score = 28.5 bits (62),  Expect = 2.5, Method: Composition-based stats.
 Identities = 11/23 (48%), Positives = 14/23 (61%), Gaps = 0/23 (0%)

Query  99     PEIVNPLIEKCKPSGVGGNVQER  121
              P + +P+IE C PS  G N Q R
Sbjct  11932  PVVEDPIIEACSPSPCGSNSQCR  11954



Lambda      K        H
   0.311    0.127    0.359 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8292602108


Query= XP_031327339.1 regulator of chromosome condensation-like [Photinus
pyralis]

Length=158
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RCC1_DROME  unnamed protein product                                   137     1e-38
C0H4M6_PLAF7  unnamed protein product                                 74.7    4e-16
E8NHA2_DROME  unnamed protein product                                 62.4    8e-12


>RCC1_DROME unnamed protein product
Length=547

 Score = 137 bits (346),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 75/155 (48%), Positives = 102/155 (66%), Gaps = 5/155 (3%)

Query  3    PKRR---RSNSVRESDTGAVKLPKKLKVVIEHDVPVGLQRSGVVLVTGAGDVGQLGMGSD  59
            P+R+    +N+  E++    K  K+ ++    ++P      G VLV G GDVGQLG+G D
Sbjct  2    PRRKALTNNNNAGEAEQQPPKA-KRARIAFHLELPKRRTVLGNVLVCGNGDVGQLGLGED  60

Query  60   ILEKSRFSLVNMEHEIVDVCAGGMHTVCLTKTGKVLTFGCNDEGALGRITADKEDSEFTA  119
            ILE+ R S V    + VD+ AGGMH + LTK+G + +FGCNDEGALGR T++ + SE   
Sbjct  61   ILERKRLSPVAGIPDAVDISAGGMHNLVLTKSGDIYSFGCNDEGALGRDTSE-DGSESKP  119

Query  120  DEVELPDKVVQVSAGDSHSAALLCDGRVFIWGTFR  154
            D ++LP K + +SAGDSHSA LL DGRVF WG+FR
Sbjct  120  DLIDLPGKALCISAGDSHSACLLEDGRVFAWGSFR  154


 Score = 37.7 bits (86),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 36/117 (31%), Positives = 58/117 (50%), Gaps = 7/117 (6%)

Query  39   RSGVVLVTGAGDVGQLGMGSDILEKSRFSLVNMEHEIVDV--CAGGMH-TVCLTKTGKVL  95
            ++ V+  TG  +  QL   +   E   F+L  ++ E+ D+   AGG H TV LT   K  
Sbjct  259  QTQVIWATGLNNFKQLAHETKGKE---FALTPIKTELKDIRHIAGGQHHTVILTTDLKCS  315

Query  96   TFGCNDEGALGRITADKEDSEFTADEVELPDKVVQVSAGDSHSAALLCDGRVFIWGT  152
              G  + G LG +   K+  E      +L +K+V V  G+  S A+  DG+++ WG+
Sbjct  316  VVGRPEYGRLG-LGDVKDVVEKPTIVKKLTEKIVSVGCGEVCSYAVTIDGKLYSWGS  371


 Score = 36.6 bits (83),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 33/107 (31%), Positives = 44/107 (41%), Gaps = 2/107 (2%)

Query  5    RRRSNSVRESDTGAVKLPKKLKVVIEHDVPVG-LQRSGVVLVTGAGDVGQLGMGSDILEK  63
            R  S    ES    + LP K   +   D     L   G V   G+       MG  I   
Sbjct  108  RDTSEDGSESKPDLIDLPGKALCISAGDSHSACLLEDGRVFAWGSFRDSHGNMGLTIDGN  167

Query  64   SRFSLVNMEHEIV-DVCAGGMHTVCLTKTGKVLTFGCNDEGALGRIT  109
             R  +  ME  +   + +G  H V LT  GKV T GC ++G LGR++
Sbjct  168  KRTPIDLMEGTVCCSIASGADHLVILTTAGKVFTVGCAEQGQLGRLS  214


>C0H4M6_PLAF7 unnamed protein product
Length=688

 Score = 74.7 bits (182),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 43/119 (36%), Positives = 69/119 (58%), Gaps = 8/119 (7%)

Query  43   VLVTGAGDVGQL--GMGSDILEKSRFSLVNMEHEIVDVCAGGMHTVCLTKTGKVLTFGCN  100
            + + G+G+ GQL     +D ++ +  ++ N+ ++I +V  G MHT+  T   K+ +FGCN
Sbjct  8    LFIFGSGECGQLPPEYCTDYVQVNPTAIPNLPNDIDEVICGSMHTIIKTTDDKLYSFGCN  67

Query  101  DEGALGRIT-----ADKEDSEFTADEVELPDKVVQVSAGDSHSAALLCDGRVFIWGTFR  154
            D G LGR T      D E S  T      P K+ +++ GD+H+A LL +G+V+I G FR
Sbjct  68   DMGVLGRKTYSSGIKDLEHSP-TLINFTFPSKIKKITCGDNHTAILLENGKVYITGGFR  125


 Score = 32.0 bits (71),  Expect = 0.19, Method: Composition-based stats.
 Identities = 32/124 (26%), Positives = 54/124 (44%), Gaps = 11/124 (9%)

Query  35   VGLQRSGVVLVTGAGDVGQLGMGS--DILEKSRFSLVNMEHEIVDVCAGGMHTVCLTKTG  92
            V L+ S  V   G    G  G+ S  +I++K        + +I  +C G   TVCL    
Sbjct  277  VQLENSLDVYGIGRNAYGSCGVSSKDNIIKKFEKIQELSQKKINQLCGGQSFTVCLLNNN  336

Query  93   KVLTFGCNDEGALGRITADKEDSEFTADEVELPDK----VVQVSAGDSHSAALLCDGRVF  148
             +  +G  +   LG    + +D  ++  E++   K    V  ++ G  H   L  +G++F
Sbjct  337  DLYIWG--NREILG---MEYDDDAYSPLELDFFKKNNYTVKNITCGTDHCLVLTDNGKLF  391

Query  149  IWGT  152
             WGT
Sbjct  392  GWGT  395


>E8NHA2_DROME unnamed protein product
Length=1062

 Score = 62.4 bits (150),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 46/134 (34%), Positives = 71/134 (53%), Gaps = 10/134 (7%)

Query  26   KVVIEHDVPVGLQRSGVVLVTGAGDVGQLGMGSDILEK----SRFSLVN--MEHEIVDVC  79
            +V   H   + L  +G V   G+ D  QLG   D+  K    S F L+    ++ I+ +C
Sbjct  44   QVACGHRHTLFLTATGKVYACGSNDYSQLG--HDLPTKRPRMSPFLLIPELQDYVIIQIC  101

Query  80   AGGMHTVCLTKTGKVLTFGCNDEGALGRITADKEDSEFTADEVELPDK-VVQVSAGDSHS  138
             G  H++ L+  G+VL++G ND G LG  T DKE  +      +L  K VVQ++ G++HS
Sbjct  102  CGSRHSLALSDWGQVLSWGDNDCGQLGHAT-DKEIVQLPKVVRQLVTKTVVQIACGNNHS  160

Query  139  AALLCDGRVFIWGT  152
             AL   G ++ WG+
Sbjct  161  LALTSCGELYSWGS  174


 Score = 44.7 bits (104),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 41/112 (37%), Positives = 50/112 (45%), Gaps = 9/112 (8%)

Query  47   GAGDVGQLGMG----SDILEKSRFSLVNMEHEIVDVCAGGMHTVCLTKTGKVLTFGCNDE  102
            G+   GQLG+G      IL  S+      +  +  V  G  HT+ LT TGKV   G ND 
Sbjct  11   GSTSHGQLGLGGIEDEQILTPSQIPWTP-DTAVQQVACGHRHTLFLTATGKVYACGSNDY  69

Query  103  GALGRITADKED--SEFTADEVELPDKV-VQVSAGDSHSAALLCDGRVFIWG  151
              LG     K    S F     EL D V +Q+  G  HS AL   G+V  WG
Sbjct  70   SQLGHDLPTKRPRMSPFLLIP-ELQDYVIIQICCGSRHSLALSDWGQVLSWG  120


 Score = 38.1 bits (87),  Expect = 0.001, Method: Composition-based stats.
 Identities = 28/74 (38%), Positives = 32/74 (43%), Gaps = 2/74 (3%)

Query  35   VGLQRSGVVLVTGAGDVGQLGMGSDILEK-SRFSLVNMEHEIVDVCAGGMHTVCLTKT-G  92
            V L   G V   GAG  GQLG G    E   R  +  M   I  V  G  HT+ L  + G
Sbjct  268  VFLTNEGGVFTCGAGAYGQLGHGFSSNEMLPRMVMELMGSTITQVACGNRHTLALVPSRG  327

Query  93   KVLTFGCNDEGALG  106
            +V  FG    G LG
Sbjct  328  RVYAFGLGSSGQLG  341


 Score = 34.7 bits (78),  Expect = 0.029, Method: Composition-based stats.
 Identities = 39/152 (26%), Positives = 66/152 (43%), Gaps = 16/152 (11%)

Query  14   SDTGAVKLPKKLKVVIEHDV---------PVGLQRSGVVLVTGAGDVGQLGMGS-DILEK  63
            +D   V+LPK ++ ++   V          + L   G +   G+   GQLG+ S + L  
Sbjct  131  TDKEIVQLPKVVRQLVTKTVVQIACGNNHSLALTSCGELYSWGSNIYGQLGVNSPNDLTH  190

Query  64   SRFSL---VNMEHEIVDVCAGGMHTVCLTKTGKVLTFGCNDEGALGRITADKEDSEFTAD  120
              + L     +   +  +  GG H+  ++K+G V  +G N+ G LG    D+ +  +   
Sbjct  191  CNYPLRLTTLLGIPLAAIACGGNHSFLISKSGAVFGWGRNNCGQLG--LNDETNRSYPTQ  248

Query  121  EVELPDKVVQ-VSAGDSHSAALLCDGRVFIWG  151
               L    V+ V+ GD  S  L  +G VF  G
Sbjct  249  LKTLRTLGVRFVACGDEFSVFLTNEGGVFTCG  280



Lambda      K        H
   0.311    0.127    0.359 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8292602108


Query= XP_031327340.1 facilitated trehalose transporter Tret1-like isoform
X1 [Photinus pyralis]

Length=453
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TRET1_BOMMO  unnamed protein product                                  204     5e-60
TRET1_POLVA  unnamed protein product                                  196     5e-57
TRE12_DROME  unnamed protein product                                  194     2e-56


>TRET1_BOMMO unnamed protein product
Length=505

 Score = 204 bits (519),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 139/449 (31%), Positives = 239/449 (53%), Gaps = 19/449 (4%)

Query  14   QYTAVFACSVATFSSGCQYGWSSPSLPLLLSEDSPIPMTNEQSSWVVVICLFGGLCGAIC  73
            Q  A FA SV + + G   G++SP++   L+ +  + +T E+ +WV  +     L G I 
Sbjct  51   QLLAAFAVSVGSMNVGFSSGYTSPAV---LTMNITLDITKEEITWVGGLMPLAALVGGIV  107

Query  74   AGITLDLIGRKMAILISSVTFIVSWLMMAFANSLAVLLAARLIAGYSDGLIYGVIPVYIA  133
             G  ++ +GRK  I+ ++V F + W+++A A ++ ++ A R+I G   G++    PVYI 
Sbjct  108  GGPLIEYLGRKKTIMGTAVPFTIGWMLIANAINVVMVFAGRVICGVCVGIVSLAFPVYIG  167

Query  134  EISDAGVRGLLGCTVTITFLIGSAFMNVIGTYLTIKWS--ALICAALPVIILVLLIWIPD  191
            E     VRG LG   T     G     ++G+YL   WS  A   AA+PV   +L+I  P+
Sbjct  168  ETIQPEVRGALGLLPTAFGNTGILLAFLVGSYL--DWSNLAFFGAAIPVPFFLLMILTPE  225

Query  192  SPNFYLIKNNHEKARVSLVAFKG------VEEADRTLEILAESVTKGN-LRCLFKKPSLK  244
            +P +Y+ K   ++AR SL   +G       E  D T+       T GN  + LF K  L 
Sbjct  226  TPRWYVSKARVQEARKSLRWLRGKNVNIEKEMRDLTISQTESDRTGGNAFKQLFSKRYLP  285

Query  245  NLLMIMGLRFGQQFSGVIAFTFYAQTLFQ-EGSDALSPLSGVLIWYAVQILFSTIGALYV  303
             +++ +GL   QQ +G+ A  FYA ++FQ  GS     L+ ++I   V  + + I  + +
Sbjct  286  AVMISLGLMLFQQLTGINAVIFYAASIFQMSGSSVDENLASIII-GVVNFISTFIATMLI  344

Query  304  DRIGRKPLMIASTIGSVISLL-LGGLFFLARDVLGLDTSGISALPTVMLITYIISYSSAL  362
            DR+GRK L+  S++  + +LL LG  F+L ++   +D +    LP   L+ Y++ +S   
Sbjct  345  DRLGRKVLLYISSVAMITTLLALGAYFYLKQN--HIDVTAYGWLPLACLVIYVLGFSIGF  402

Query  363  QLVPLFLGAEIFASNVKAYSVAISDGYYFIFAGLASKYFQFTMEEYGLYVPFLTFALCCS  422
              +P  +  EI  S ++  + +++ G+ +    + +K FQ  ++   ++     FA+ C 
Sbjct  403  GPIPWLMLGEILPSKIRGTAASLATGFNWTCTFIVTKTFQNIIDAIYMHGTLWLFAVICI  462

Query  423  FGLVMIIFFIPETKNKTLEEIQMEMNNKS  451
             GL+ +IFF+PETK K+LEEI+M++ + S
Sbjct  463  GGLLFVIFFVPETKGKSLEEIEMKLTSGS  491


>TRET1_POLVA unnamed protein product
Length=504

 Score = 196 bits (498),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 140/449 (31%), Positives = 235/449 (52%), Gaps = 16/449 (4%)

Query  14   QYTAVFACSVATFSSGCQYGWSSPSLPLLLSED-SPIPMTNEQSSWVVVICLFGGLCGAI  72
            Q  A  A S+ +   G    ++SP+L  + +   +   +T +++SWV  I    GL G I
Sbjct  43   QILAAIAVSMGSMVVGFASAYTSPALVSMQNTTITSFKVTEQEASWVGGIMPLAGLAGGI  102

Query  73   CAGITLDLIGRKMAILISSVTFIVSWLMMAFANSLAVLLAARLIAGYSDGLIYGVIPVYI  132
              G  ++ +GRK  IL ++V FIV+WL++AFANS+ ++LA R ++G+  G+    +PVY+
Sbjct  103  AGGPFIEYLGRKNTILATAVPFIVAWLLIAFANSIWMVLAGRALSGFCVGIASLSLPVYL  162

Query  133  AEISDAGVRGLLGCTVTITFLIGSAFMNVIGTYLTIKWS--ALICAALPVIILVLLIWIP  190
             E     VRG LG   T    IG     V G Y  + WS  A I + LP+  +VL + IP
Sbjct  163  GETVQPEVRGTLGLLPTAFGNIGILICFVAGKY--VNWSGLAFIGSILPIPFMVLTLLIP  220

Query  191  DSPNFYLIKNNHEKARVSLVAFKGVEEADRTLEILA---------ESVTKGNLRCLFKKP  241
            ++P +++ +   E+AR +L   +G ++AD   E+              ++  +  L K+ 
Sbjct  221  ETPRWFVTRGREERARKALQWLRG-KKADVEPELKGIVKSHCEAERHASQNAIFDLMKRS  279

Query  242  SLKNLLMIMGLRFGQQFSGVIAFTFYAQTLFQEGSDALSPLSGVLIWYAVQILFSTIGAL  301
            +LK LL+ +GL F QQ SG+ A  FY  ++F++    +      +I   V    +    +
Sbjct  280  NLKPLLIALGLMFFQQLSGINAVIFYTVSIFKDAGSTIDENLCTIIVGVVNFGATFFATV  339

Query  302  YVDRIGRKPLMIASTIGSVISLLLGGLFFLARDVLGLDTSGISALPTVMLITYIISYSSA  361
             +DR+GRK L+  S +  VI+LL  G FF  ++  G D S I  LP    + Y+I +SS 
Sbjct  340  LIDRLGRKILLYISEVAMVITLLTLGTFFYYKNS-GNDVSNIGWLPLASFVIYVIGFSSG  398

Query  362  LQLVPLFLGAEIFASNVKAYSVAISDGYYFIFAGLASKYFQFTMEEYGLYVPFLTFALCC  421
            +  +P  +  EI    ++  + +++ G+ +    + +K F   +   G +  F  F + C
Sbjct  399  VGPIPWLMLGEILPGKIRGSAASVATGFNWTCTFIVTKTFADIVAAIGNHGAFWFFGVIC  458

Query  422  SFGLVMIIFFIPETKNKTLEEIQMEMNNK  450
              GL  +IFF+PET+ K+LEEI+ +M  +
Sbjct  459  LIGLFFVIFFVPETQGKSLEEIERKMMGR  487


>TRE12_DROME unnamed protein product
Length=488

 Score = 194 bits (494),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 138/449 (31%), Positives = 232/449 (52%), Gaps = 16/449 (4%)

Query  14   QYTAVFACSVATFSSGCQYGWSSPSLPLLLSED-SPIPMTNEQSSWVVVICLFGGLCGAI  72
            Q  A  + S+ +   G    ++SP+L  +     +   +T +  SWV  I     L G I
Sbjct  28   QVLAALSVSLCSLVVGFVSAYTSPALVSMTDRTITSFEVTKDAGSWVGGIMPLAALAGGI  87

Query  73   CAGITLDLIGRKMAILISSVTFIVSWLMMAFANSLAVLLAARLIAGYSDGLIYGVIPVYI  132
              G  ++ +GR+  IL ++V FIVS L++A A ++ ++L  R + G+  G+    +PVY+
Sbjct  88   TGGPLIEYLGRRSTILATAVPFIVSSLLIACAVNVIMILCGRFLTGFCVGIASLSLPVYL  147

Query  133  AEISDAGVRGLLGCTVTITFLIGSAFMNVIGTYLTIKWSALICAALPVIILVLLIWIPDS  192
             E     VRG LG   T    IG     V G+++     A + AALPV  L+L+I IP++
Sbjct  148  GETLQPEVRGTLGLLPTALGNIGILVCYVAGSFMNWSMLAFLGAALPVPFLILMIIIPET  207

Query  193  PNFYLIKNNHEKARVSLVAFKGVE-EADRTLEILAESVTKGNLRC-------LFKKPSLK  244
            P +++ +   E+AR +L   +G E + +  L+ L +S    + +        LFK+ +LK
Sbjct  208  PRWFVNRGQEERARKALKWLRGKEADVEPELKELMQSQADADRQATQNTCLELFKRNNLK  267

Query  245  NLLMIMGLRFGQQFSGVIAFTFYAQTLFQE-GSDALSPLSGVLIWYAVQILFST-IGALY  302
             L + +GL F QQFSG+ A  FY   +F++ GS   S LS +++   V   F+T +G + 
Sbjct  268  PLSISLGLMFFQQFSGINAVIFYTVQIFKDAGSTIDSNLSTIIV--GVVNFFATFMGIIL  325

Query  303  VDRIGRKPLMIASTIGSVISL-LLGGLFFLARDVLGLDTSGISALPTVMLITYIISYSSA  361
            +DR+GRK L+  S I  +++L +LGG F+      G D S +  LP    + YI+ +S  
Sbjct  326  IDRLGRKILLYVSDIAMIVTLSILGGFFYCKAH--GPDVSHLGWLPLTCFVIYILGFSLG  383

Query  362  LQLVPLFLGAEIFASNVKAYSVAISDGYYFIFAGLASKYFQFTMEEYGLYVPFLTFALCC  421
               +P  +  EI  + ++  + ++   + +    + +K FQ      G +  F  F   C
Sbjct  384  FGPIPWLMMGEILPAKIRGPAASVVTAFNWFCTFVVTKTFQDLTVAMGAHGAFWLFGAIC  443

Query  422  SFGLVMIIFFIPETKNKTLEEIQMEMNNK  450
              GL  +I F+PET+ K+LEEI+ +M  +
Sbjct  444  IVGLFFVIIFVPETRGKSLEEIERKMMGR  472



Lambda      K        H
   0.311    0.127    0.359 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8292602108


Query= XP_031327341.1 facilitated trehalose transporter Tret1-like isoform
X2 [Photinus pyralis]

Length=411
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TRET1_BOMMO  unnamed protein product                                  167     2e-46
TRE12_DROME  unnamed protein product                                  162     4e-45
TRET1_POLVA  unnamed protein product                                  161     2e-44


>TRET1_BOMMO unnamed protein product
Length=505

 Score = 167 bits (422),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 118/398 (30%), Positives = 205/398 (52%), Gaps = 15/398 (4%)

Query  14   QYTAVFACSVATFSSGCQYGWSSPSLPLLLSEDSPIPMTNEQSSWVVVICLFGGLCGAIC  73
            Q  A FA SV + + G   G++SP++   L+ +  + +T E+ +WV  +     L G I 
Sbjct  51   QLLAAFAVSVGSMNVGFSSGYTSPAV---LTMNITLDITKEEITWVGGLMPLAALVGGIV  107

Query  74   AGITLDLIGRKMAILISSVTFIVSWLMMAFANSLAVLLAARLIAGYSDGLIYGVIPVYIA  133
             G  ++ +GRK  I+ ++V F + W+++A A ++ ++ A R+I G   G++    PVYI 
Sbjct  108  GGPLIEYLGRKKTIMGTAVPFTIGWMLIANAINVVMVFAGRVICGVCVGIVSLAFPVYIG  167

Query  134  EISDAGVRGLLGCTVTITFLIGSAFMNVIGTYLTIKWSALICAALPVIILVLLIWIPDSP  193
            E     VRG LG   T     G     ++G+YL     A   AA+PV   +L+I  P++P
Sbjct  168  ETIQPEVRGALGLLPTAFGNTGILLAFLVGSYLDWSNLAFFGAAIPVPFFLLMILTPETP  227

Query  194  NFYLIKNNHEKARVSLVAFKG------VEEADRTLEILAESVTKGN-LRCLFKKPSLKNL  246
             +Y+ K   ++AR SL   +G       E  D T+       T GN  + LF K  L  +
Sbjct  228  RWYVSKARVQEARKSLRWLRGKNVNIEKEMRDLTISQTESDRTGGNAFKQLFSKRYLPAV  287

Query  247  LMIMGLRFGQQFSGVIAFTFYAQTLFQ-EGSDALSPLSGVLIWYAVQILFSTIGALYVDR  305
            ++ +GL   QQ +G+ A  FYA ++FQ  GS     L+ ++I   V  + + I  + +DR
Sbjct  288  MISLGLMLFQQLTGINAVIFYAASIFQMSGSSVDENLASIII-GVVNFISTFIATMLIDR  346

Query  306  IGRKPLMIASTIGSVISLL-LGGLFFLARDVLGLDTSGISALPTVMLITYIISYSSALQL  364
            +GRK L+  S++  + +LL LG  F+L ++   +D +    LP   L+ Y++ +S     
Sbjct  347  LGRKVLLYISSVAMITTLLALGAYFYLKQN--HIDVTAYGWLPLACLVIYVLGFSIGFGP  404

Query  365  VPLFLGAEIFASNVKAYSVAISDGYYFIFAGLASKYFQ  402
            +P  +  EI  S ++  + +++ G+ +    + +K FQ
Sbjct  405  IPWLMLGEILPSKIRGTAASLATGFNWTCTFIVTKTFQ  442


>TRE12_DROME unnamed protein product
Length=488

 Score = 162 bits (411),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 121/401 (30%), Positives = 207/401 (52%), Gaps = 16/401 (4%)

Query  14   QYTAVFACSVATFSSGCQYGWSSPSLPLLLSED-SPIPMTNEQSSWVVVICLFGGLCGAI  72
            Q  A  + S+ +   G    ++SP+L  +     +   +T +  SWV  I     L G I
Sbjct  28   QVLAALSVSLCSLVVGFVSAYTSPALVSMTDRTITSFEVTKDAGSWVGGIMPLAALAGGI  87

Query  73   CAGITLDLIGRKMAILISSVTFIVSWLMMAFANSLAVLLAARLIAGYSDGLIYGVIPVYI  132
              G  ++ +GR+  IL ++V FIVS L++A A ++ ++L  R + G+  G+    +PVY+
Sbjct  88   TGGPLIEYLGRRSTILATAVPFIVSSLLIACAVNVIMILCGRFLTGFCVGIASLSLPVYL  147

Query  133  AEISDAGVRGLLGCTVTITFLIGSAFMNVIGTYLTIKWSALICAALPVIILVLLIWIPDS  192
             E     VRG LG   T    IG     V G+++     A + AALPV  L+L+I IP++
Sbjct  148  GETLQPEVRGTLGLLPTALGNIGILVCYVAGSFMNWSMLAFLGAALPVPFLILMIIIPET  207

Query  193  PNFYLIKNNHEKARVSLVAFKGVE-EADRTLEILAESVTKGNLRC-------LFKKPSLK  244
            P +++ +   E+AR +L   +G E + +  L+ L +S    + +        LFK+ +LK
Sbjct  208  PRWFVNRGQEERARKALKWLRGKEADVEPELKELMQSQADADRQATQNTCLELFKRNNLK  267

Query  245  NLLMIMGLRFGQQFSGVIAFTFYAQTLFQE-GSDALSPLSGVLIWYAVQILFST-IGALY  302
             L + +GL F QQFSG+ A  FY   +F++ GS   S LS +++   V   F+T +G + 
Sbjct  268  PLSISLGLMFFQQFSGINAVIFYTVQIFKDAGSTIDSNLSTIIV--GVVNFFATFMGIIL  325

Query  303  VDRIGRKPLMIASTIGSVISL-LLGGLFFLARDVLGLDTSGISALPTVMLITYIISYSSA  361
            +DR+GRK L+  S I  +++L +LGG F+      G D S +  LP    + YI+ +S  
Sbjct  326  IDRLGRKILLYVSDIAMIVTLSILGGFFYCKAH--GPDVSHLGWLPLTCFVIYILGFSLG  383

Query  362  LQLVPLFLGAEIFASNVKAYSVAISDGYYFIFAGLASKYFQ  402
               +P  +  EI  + ++  + ++   + +    + +K FQ
Sbjct  384  FGPIPWLMMGEILPAKIRGPAASVVTAFNWFCTFVVTKTFQ  424


>TRET1_POLVA unnamed protein product
Length=504

 Score = 161 bits (407),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 122/400 (31%), Positives = 207/400 (52%), Gaps = 16/400 (4%)

Query  14   QYTAVFACSVATFSSGCQYGWSSPSLPLLLSED-SPIPMTNEQSSWVVVICLFGGLCGAI  72
            Q  A  A S+ +   G    ++SP+L  + +   +   +T +++SWV  I    GL G I
Sbjct  43   QILAAIAVSMGSMVVGFASAYTSPALVSMQNTTITSFKVTEQEASWVGGIMPLAGLAGGI  102

Query  73   CAGITLDLIGRKMAILISSVTFIVSWLMMAFANSLAVLLAARLIAGYSDGLIYGVIPVYI  132
              G  ++ +GRK  IL ++V FIV+WL++AFANS+ ++LA R ++G+  G+    +PVY+
Sbjct  103  AGGPFIEYLGRKNTILATAVPFIVAWLLIAFANSIWMVLAGRALSGFCVGIASLSLPVYL  162

Query  133  AEISDAGVRGLLGCTVTITFLIGSAFMNVIGTYLTIKWS--ALICAALPVIILVLLIWIP  190
             E     VRG LG   T    IG     V G Y  + WS  A I + LP+  +VL + IP
Sbjct  163  GETVQPEVRGTLGLLPTAFGNIGILICFVAGKY--VNWSGLAFIGSILPIPFMVLTLLIP  220

Query  191  DSPNFYLIKNNHEKARVSLVAFKGVEEADRTLEILA---------ESVTKGNLRCLFKKP  241
            ++P +++ +   E+AR +L   +G ++AD   E+              ++  +  L K+ 
Sbjct  221  ETPRWFVTRGREERARKALQWLRG-KKADVEPELKGIVKSHCEAERHASQNAIFDLMKRS  279

Query  242  SLKNLLMIMGLRFGQQFSGVIAFTFYAQTLFQEGSDALSPLSGVLIWYAVQILFSTIGAL  301
            +LK LL+ +GL F QQ SG+ A  FY  ++F++    +      +I   V    +    +
Sbjct  280  NLKPLLIALGLMFFQQLSGINAVIFYTVSIFKDAGSTIDENLCTIIVGVVNFGATFFATV  339

Query  302  YVDRIGRKPLMIASTIGSVISLLLGGLFFLARDVLGLDTSGISALPTVMLITYIISYSSA  361
             +DR+GRK L+  S +  VI+LL  G FF  ++  G D S I  LP    + Y+I +SS 
Sbjct  340  LIDRLGRKILLYISEVAMVITLLTLGTFFYYKNS-GNDVSNIGWLPLASFVIYVIGFSSG  398

Query  362  LQLVPLFLGAEIFASNVKAYSVAISDGYYFIFAGLASKYF  401
            +  +P  +  EI    ++  + +++ G+ +    + +K F
Sbjct  399  VGPIPWLMLGEILPGKIRGSAASVATGFNWTCTFIVTKTF  438



Lambda      K        H
   0.311    0.127    0.359 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8292602108


Query= XP_031327342.1 peptidyl-alpha-hydroxyglycine alpha-amidating lyase
2-like [Photinus pyralis]

Length=389
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PAL2_DROME  unnamed protein product                                   357     4e-121
PAL1_DROME  unnamed protein product                                   229     5e-70 
A0A0B4LFP7_DROME  unnamed protein product                             39.7    0.004 


>PAL2_DROME unnamed protein product
Length=406

 Score = 357 bits (915),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 188/387 (49%), Positives = 243/387 (63%), Gaps = 30/387 (8%)

Query  20   SAVAFNSDPA-NINSDFYNDFRQLLK---------------LSASLRSKNENHKRNYMVE  63
            + +A +  P  N+N  F++  R L+K               L+  L   +    +N    
Sbjct  27   AGLAMDLGPGVNLNERFFDQVRALIKRRLQEKGLAKPEQPELAMPLTDDDAVALQNQRSY  86

Query  64   SQSPAPPASSELVPQEVENWPEVDLNLGQVSGVSVNVHQQPVIFHRADRVWDASTFDYNN  123
               P P AS    P  VENWP    + GQV+ V+V+    PV+FHRA+R WD +TF+ +N
Sbjct  87   DNVPLPAASVP-TPVLVENWPTEQHSFGQVTAVAVDPQGSPVVFHRAERYWDVNTFNESN  145

Query  124  NYRHQKLGPITSHTVLTLDPQTGRVLKKWGKDIFYMPHGLTIDHHNNMWITDVARHQAFK  183
             Y   + GPI  +T+  LD +TG +   WG ++FYMPHGLTID H N WITDVA HQAFK
Sbjct  146  IYYLIEYGPIKENTIYVLDAKTGAIKSGWGSNMFYMPHGLTIDLHGNYWITDVAMHQAFK  205

Query  184  FCPDMDEPQLIFGQNFEPGDDKDHLCKPTSVAVASTGEIFIADGYCNSRILKFTALGRLM  243
            F P  ++P L  G+ F PG    HLCKPTS+AVA+TGE FIADGYCNSRILKF A G+L+
Sbjct  206  FKPFSNKPLLTIGKRFRPGSSVKHLCKPTSIAVATTGEFFIADGYCNSRILKFNAAGKLL  265

Query  244  RTIPSGNECLSLSVPHHTALIESLDRICVADRENKRVVCPSAEL-SERSLTQP-LTIQTP  301
            RTIP   E LSL VPH   L+E LD +C+ADREN RVVCP A L S     +P  TIQ P
Sbjct  266  RTIPQPPEFLSLQVPHAITLLEHLDLLCIADRENMRVVCPKAGLISSHGEGEPAATIQEP  325

Query  302  DMGRIFGIAAVGEIIYAVNGPSLPFDMQLPVQGFIISAENETVIGDWGPFEKFQNPHAIA  361
            D+GR+FG+A+ G+I++AVNGP+      LPV+GF I   +ET+IG WG   +F+NPH++A
Sbjct  326  DLGRVFGVASFGDIVFAVNGPT----SMLPVRGFTIDPRSETIIGHWG---EFKNPHSMA  378

Query  362  ASPNTSSLYVVEIG----PNKVWKFNL  384
             S N S+LYV EIG     N+VWK+ L
Sbjct  379  VSVNGSALYVTEIGTNHQTNRVWKYVL  405


>PAL1_DROME unnamed protein product
Length=541

 Score = 229 bits (585),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 126/321 (39%), Positives = 177/321 (55%), Gaps = 27/321 (8%)

Query  83   WPEVDLNLGQVSGVSVNVHQQPVIFHRADRVWDASTFDYNNNYRHQKLGPITSHTVLTLD  142
            WP  ++ LG V+ VS +     VIFHR +RVW  +TFD  N Y+ +  GPI   T+L L+
Sbjct  101  WPANNVKLGAVTAVSFDKAGNVVIFHRVNRVWGQTTFDNRNQYQEKYRGPIRESTILALE  160

Query  143  PQTGRVLKKWGKDIFYMPHGLTIDHHNNMWITDVARHQAFKFCPDMDE--PQLIFGQNFE  200
            P TG+V   WGK+ FYMPHGLT+D  +N+W+TDVA HQ FKF P   +  P L  G  F+
Sbjct  161  PATGKVQYDWGKNFFYMPHGLTVDPEDNVWLTDVAMHQVFKFPPRGGDGKPALTLGDAFQ  220

Query  201  PGDDKDHLCKPTSVAVASTGEIFIADGYCNSRILKFTALGRLMRTIPSGNECLS------  254
            PG  +   CKPTSVAV   G+ F+ADGYCN+RILK++  G L+  +  G    S      
Sbjct  221  PGSGRK-FCKPTSVAVLDNGDFFVADGYCNARILKYSRKGELI--LFWGQNTFSGISYDV  277

Query  255  -----LSVPHHTALIESLDRICVADRENKRVVCPSAELSERSLTQPLTIQTPDMGRIFGI  309
                  ++PH   L+  L  +C ADREN RV C    LS                R+F +
Sbjct  278  APQNFFAIPHALTLVPELQLLCAADRENGRVQC---FLSSNGTFHSQYHNQLIGDRLFSM  334

Query  310  A---AVGEIIYAVNGPSLPFDMQ----LPVQGFIISAENETVIGDWGPFE-KFQNPHAIA  361
            A   A G  +  VNGP+    +       V GF++S  ++ ++  +GP   +FQNPH +A
Sbjct  335  AYTPAAGGQLVIVNGPTAELGIHPEHYNEVHGFVLSMRSKQLVSKFGPNNLQFQNPHDVA  394

Query  362  ASPNTSSLYVVEIGPNKVWKF  382
             + + + +YV E+ P ++ KF
Sbjct  395  VTADGNEIYVAELNPMRIHKF  415


>A0A0B4LFP7_DROME unnamed protein product
Length=1248

 Score = 39.7 bits (91),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 52/128 (41%), Gaps = 5/128 (4%)

Query  153   GKDIFYMPHGLTIDHHNNMWITDVARHQAFKFCPDMDEPQLIFGQNFEPGDDKDHLCKPT  212
             G+     PH + + + N + ++D   H+   F  +      + G+    G D      P 
Sbjct  1123  GEGQLEHPHYIAVSNTNRVIVSDSNNHRIQIFDVNGKVLSTVGGE----GSDDGQFKFPR  1178

Query  213   SVAVASTGEIFIADGYCNSRILKFTALGRLMRTIPSGNECLSLSVPHHTALIESLDRICV  272
              VAV   G IF+AD   N+RI  F   G  ++T  S     S         I S   I V
Sbjct  1179  GVAVDDQGYIFVADS-GNNRIQIFNPDGSFLKTFGSWGSGDSEFKGLEGVAIMSNGNILV  1237

Query  273   ADRENKRV  280
              DREN RV
Sbjct  1238  CDRENHRV  1245



Lambda      K        H
   0.311    0.127    0.359 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8292602108


Query= XP_031327343.1 uncharacterized protein LOC116158660 [Photinus
pyralis]

Length=382
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8SZF0_DROME  unnamed protein product                                 125     9e-32
Q7K9B7_DROME  unnamed protein product                                 112     7e-28
Q7JZR2_DROME  unnamed protein product                                 112     8e-28


>Q8SZF0_DROME unnamed protein product
Length=495

 Score = 125 bits (314),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 85/309 (28%), Positives = 149/309 (48%), Gaps = 18/309 (6%)

Query  51   IVAMIQSFGGGVLFATCFLHMMPEVSHFVVDLRKFGVL-QSNYPYSQLVISVGFFTIYFA  109
            +V  +  FGGGVL AT FLH++PEV   V +L++ G++ +  +P ++L++  GFF +YF 
Sbjct  95   VVKCLLYFGGGVLLATTFLHLLPEVQEVVEELQECGIIGELTFPLAELLMCCGFFLMYFI  154

Query  110  EELSNWMV--SRKSTKNADVSRPISSVSEQVEVLELRTPTLYNKMAFEMRPIETIEKNFA  167
            EE  +  V   +K    A   R  S     +    L  PT  N       P         
Sbjct  155  EEAMHTYVHHHQKDEAGAAFERGHS-----IRNSHLLKPTEGNATTPTAPPAPLAGTAEL  209

Query  168  NIEKHEKMYLDDFSCDLIVDTMDQGIQTENENPPDIDMEADLDLDTDVNAEIEELIEEGV  227
                 + +  +D           Q       +       + L +  D +A+  +++   +
Sbjct  210  GTLSVQNLLQNDLEQQKFATKPQQQANGHGHSHGHGHGHSHLSVIAD-DADAGDMLASSL  268

Query  228  KNQKQMFRCILVVMAISLHAFFEGLAIGLQRSNKNIWYLFTAVSIHSATVLFIIGSEVVI  287
            +        + +V A+SLH  FEG+AIGL+ S  ++W++F AVS H   + F +G E+++
Sbjct  269  RG-------LFIVSALSLHELFEGMAIGLESSASSVWFMFGAVSAHKLVLAFCVGVELIV  321

Query  288  SGTSTKSTLIHMLMLSSTSPFGVLLGVAITVTTDLETSGKSFAILLLEGLSAGTILYITF  347
            + T     ++++L  +  SP G+  G+ I +    ETSG S    +L+G + GT++Y+ F
Sbjct  322  ARTRMLLAVLYVLTFAVVSPLGI--GIGILINHGEETSGPSLVSAILQGFACGTLIYVVF  379

Query  348  FETLNREKK  356
            FE L++ + 
Sbjct  380  FEILSKNRS  388


>Q7K9B7_DROME unnamed protein product
Length=346

 Score = 112 bits (280),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 91/353 (26%), Positives = 163/353 (46%), Gaps = 63/353 (18%)

Query  3    LILTKLVVALLFGLIRYIFGILPI---KVHSWVTISRDGKVVESRRETMDGIVAMIQSFG  59
            L++ K+V  ++  +I  + G LP    +   W   S      E  R ++  +V  +  FG
Sbjct  14   LLVAKIVSMVVLVVITVLCGSLPYVLNRCFHWTKASP-----EETRSSL--VVRCLLFFG  66

Query  60   GGVLFATCFLHMMPEVSHFVVDLRKFGVL-QSNYPYSQLVISVGFFTIYFAEELSNWMVS  118
            GGVL  T FLHM+PEV   V  L++ G L ++ +  +++++  GFF +Y  +EL   +V 
Sbjct  67   GGVLICTTFLHMLPEVIEVVEALQECGSLVKTPFALAEMLLCTGFFLMYALDELMTSLVR  126

Query  119  RKSTKNADVSRPISSVSEQVEVLELRTPTLYNKMAFEMRPIETIEKNFANIEKHEKMYLD  178
                K   +SR  S  S                +AFE R          N +  E++ + 
Sbjct  127  HHQGK---LSRKESVAS----------------LAFE-RGRSIRHSVLLNPQAKEEVEVK  166

Query  179  DFSCDLIVDTMDQGIQTENENPPDIDMEADLDLDTDVNAEIEELIEEGVKNQKQMFRCIL  238
            D               TE +   D    + + +  D  +                 R + 
Sbjct  167  D---------------TEPQPHKDHHGHSHMPVPADDGSSA---------------RGLG  196

Query  239  VVMAISLHAFFEGLAIGLQRSNKNIWYLFTAVSIHSATVLFIIGSEVVISGTSTKSTLIH  298
            +++A+SLH  FEG+AIGL+ +   +W++F AVS H   + F +G E++++ T +   +++
Sbjct  197  IILALSLHELFEGMAIGLEGTVSTVWFMFGAVSAHKLVLAFCVGMELLVARTRSSLAILY  256

Query  299  MLMLSSTSPFGVLLGVAITVTTDLETSGKSFAILLLEGLSAGTILYITFFETL  351
            ++  S  +P G+  GV + ++  +     S    +L+G++ GT+LY+ FFE L
Sbjct  257  LVTFSIVTPIGI--GVGLGISQQVAAGQPSLPSGVLQGIACGTLLYVVFFEIL  307


>Q7JZR2_DROME unnamed protein product
Length=352

 Score = 112 bits (280),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 91/353 (26%), Positives = 163/353 (46%), Gaps = 63/353 (18%)

Query  3    LILTKLVVALLFGLIRYIFGILPI---KVHSWVTISRDGKVVESRRETMDGIVAMIQSFG  59
            L++ K+V  ++  +I  + G LP    +   W   S      E  R ++  +V  +  FG
Sbjct  20   LLVAKIVSMVVLVVITVLCGSLPYVLNRCFHWTKASP-----EETRSSL--VVRCLLFFG  72

Query  60   GGVLFATCFLHMMPEVSHFVVDLRKFGVL-QSNYPYSQLVISVGFFTIYFAEELSNWMVS  118
            GGVL  T FLHM+PEV   V  L++ G L ++ +  +++++  GFF +Y  +EL   +V 
Sbjct  73   GGVLICTTFLHMLPEVIEVVEALQECGSLVKTPFALAEMLLCTGFFLMYALDELMTSLVR  132

Query  119  RKSTKNADVSRPISSVSEQVEVLELRTPTLYNKMAFEMRPIETIEKNFANIEKHEKMYLD  178
                K   +SR  S  S                +AFE R          N +  E++ + 
Sbjct  133  HHQGK---LSRKESVAS----------------LAFE-RGRSIRHSVLLNPQAKEEVEVK  172

Query  179  DFSCDLIVDTMDQGIQTENENPPDIDMEADLDLDTDVNAEIEELIEEGVKNQKQMFRCIL  238
            D               TE +   D    + + +  D  +                 R + 
Sbjct  173  D---------------TEPQPHKDHHGHSHMPVPADDGSSA---------------RGLG  202

Query  239  VVMAISLHAFFEGLAIGLQRSNKNIWYLFTAVSIHSATVLFIIGSEVVISGTSTKSTLIH  298
            +++A+SLH  FEG+AIGL+ +   +W++F AVS H   + F +G E++++ T +   +++
Sbjct  203  IILALSLHELFEGMAIGLEGTVSTVWFMFGAVSAHKLVLAFCVGMELLVARTRSSLAILY  262

Query  299  MLMLSSTSPFGVLLGVAITVTTDLETSGKSFAILLLEGLSAGTILYITFFETL  351
            ++  S  +P G+  GV + ++  +     S    +L+G++ GT+LY+ FFE L
Sbjct  263  LVTFSIVTPIGI--GVGLGISQQVAAGQPSLPSGVLQGIACGTLLYVVFFEIL  313



Lambda      K        H
   0.311    0.127    0.359 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8292602108


Query= XP_031327344.1 CCAAT/enhancer-binding protein [Photinus pyralis]

Length=344
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CEBP_DROME  unnamed protein product                                   125     3e-32
Q8IG69_CAEEL  unnamed protein product                                 52.4    1e-08
Q8IQ99_DROME  unnamed protein product                                 46.2    3e-05


>CEBP_DROME unnamed protein product
Length=449

 Score = 125 bits (314),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 123/348 (35%), Positives = 168/348 (48%), Gaps = 92/348 (26%)

Query  51   LLKQHHMQQYQ-HGELSDLNTPEISLDLQNLIDDSQLMNE--GIFTDILQNQVPNKHLQN  107
            LL++  +QQY    +L +L T EI+LDLQ+LIDD     E  GIF+D++ +  P      
Sbjct  108  LLQKQMLQQYSTQTDLDELTTQEITLDLQHLIDDQFRDTETLGIFSDMVTS--PGGLSAT  165

Query  108  LHPRQVLNSLPSSNYPRT------------------TLAYMPQPVHSGATYAGNGNQTSS  149
            L P  ++++       +T                   LAYMPQPVH  ATY       +S
Sbjct  166  LPPSGMVSAAAKVLQQQTLRNQHGYGGRGGGGGAGGALAYMPQPVH--ATY------NNS  217

Query  150  SDSNSSGVSDSPLIKEEPIDPQDYRRSCN--------------VMPNSYMQG--------  187
            SD NSS  SDS  IKEEPIDP +YRR                  + N Y  G        
Sbjct  218  SDENSSVGSDSSTIKEEPIDP-EYRRHLQEAASQQAAFMGNGAGLYNGYGSGANGLTGGG  276

Query  188  ---------PSYPPNGGAPG------FAPLTPSSVLHHQQLNAMKNKAV---MLNQHA--  227
                     PS   + G+ G      F  LT ++VL H  L  +   A    +L QH+  
Sbjct  277  NPLNGGNTTPSSNGSNGSTGSSNGSQFTNLTTANVLAHHNLPHLAAAAGAHNLLKQHSKL  336

Query  228  --------------ARKHM-KPCDKNSDEYRRRRERNNIAVRKSREKAKVRTRETEEKVK  272
                           RKH  K  DK +DEYRRRRERNNIAVRKSREKAKVR+RE EE+VK
Sbjct  337  HAQQQHQQHQQQQQHRKHSNKHVDKGTDEYRRRRERNNIAVRKSREKAKVRSREVEERVK  396

Query  273  ILVKENERLQKRIELLSEELNVLRSLFSNVGVLPEHIHREINKHLDAF  320
             L+KE + L +++  ++ EL + + ++     L  H + E+++   +F
Sbjct  397  SLLKEKDALIRQLGEMTNELQLHKQIYMQ---LMNHANPEVSRVCRSF  441


>Q8IG69_CAEEL unnamed protein product
Length=100

 Score = 52.4 bits (124),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 45/66 (68%), Gaps = 0/66 (0%)

Query  234  PCDKNSDEYRRRRERNNIAVRKSREKAKVRTRETEEKVKILVKENERLQKRIELLSEELN  293
            P + + D+Y  +R+RNN AV ++R+K +    +T EKV  L KENE L++++E L +EL+
Sbjct  12   PREDDEDDYSTKRKRNNEAVNRTRQKKRQEENDTAEKVDELKKENETLERKVEQLQKELS  71

Query  294  VLRSLF  299
             L+ +F
Sbjct  72   FLKEMF  77


>Q8IQ99_DROME unnamed protein product
Length=633

 Score = 46.2 bits (108),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/73 (33%), Positives = 40/73 (55%), Gaps = 0/73 (0%)

Query  228  ARKHMKPCDKNSDEYRRRRERNNIAVRKSREKAKVRTRETEEKVKILVKENERLQKRIEL  287
            +RK   P +   D+Y  RR +NNIA ++SR+  + +  +   + + L KEN  L + +E 
Sbjct  556  SRKQFVPDELKDDKYWARRRKNNIAAKRSRDARRQKENQIAMRARYLEKENATLHQEVEQ  615

Query  288  LSEELNVLRSLFS  300
            L +E   LR+  S
Sbjct  616  LKQENMDLRARLS  628



Lambda      K        H
   0.311    0.127    0.359 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8292602108


Query= XP_031327345.1 DNA damage-binding protein 1 [Photinus pyralis]

Length=1148
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DDB1_DROME  unnamed protein product                                   1513    0.0  
DDB1_DICDI  unnamed protein product                                   804     0.0  
DDB1_CAEEL  unnamed protein product                                   723     0.0  


>DDB1_DROME unnamed protein product
Length=1140

 Score = 1513 bits (3916),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 736/1149 (64%), Positives = 906/1149 (79%), Gaps = 10/1149 (1%)

Query  1     MAFHYVVTAHKPTAVTSCVTGNFTSPNDLNLIVAKNSRLEIYLVTPEGLRPIKEVGLYGK  60
             M+ HYVVTA KPTAV +C+TGNFTSP DLNLI+A+N+++EI LVTPEGLRP+KE+ + G 
Sbjct  1     MSHHYVVTAQKPTAVVACLTGNFTSPTDLNLIIARNNQVEIDLVTPEGLRPLKEININGT  60

Query  61    VAVMKLYRPQQENKDYLFIVTMRYHAMILECVSDDDNLEIITKAHGNVADRIGKPSDTGI  120
             +AVM+ +RP   NKD LFI+T RY+ MILE    +D + ++TKA+GNV+D +G PS+ G+
Sbjct  61    IAVMRHFRPPDSNKDLLFILTRRYNVMILEARMVNDVITVVTKANGNVSDSVGIPSEGGV  120

Query  121   IAVIDPRARVIGLRLYDGLFKIIPLDKENSELKASSIRMDELQVTDVEFLHGCANPTIVL  180
             IA IDP+ARVIG+ LY GLF IIP+DK+ SELKA+++RMDEL V DVEFLHGC NPT+++
Sbjct  121   IAAIDPKARVIGMCLYQGLFTIIPMDKDASELKATNLRMDELNVYDVEFLHGCLNPTVIV  180

Query  181   IHQDVNGRHVKTHEISLRDKEFVKIPWRQDNVETEASMIIPVPSPLCGAIIVGQESILYH  240
             IH+D +GRHVK+HEI+LRDKEF+KI W+QDNVETEA+M+IPVPSP+ G I++G+ESI+YH
Sbjct  181   IHKDSDGRHVKSHEINLRDKEFMKIAWKQDNVETEATMLIPVPSPIGGVIVIGRESIVYH  240

Query  241   DGMTSVAVAPPIIKQSTIICYAKVDPSGLRYLLGDMAGHLFMLFLDVETKGDGSDVVKDL  300
             DG    AVAP   +QSTI CYA+V  +GLRYLLG+M G L+MLFL       G   VKD+
Sbjct  241   DGSNYHAVAPLTFRQSTINCYARVSSNGLRYLLGNMDGQLYMLFLGTAETSKGV-TVKDI  299

Query  301   KVELLGEISSPECITYLDNGVLYIGSRMGDSQLVKLNTKADDNGSYVTIMESFTNLAPIM  360
             KVE LGEIS PECITYLDNG LYIG+R GDSQLV+LN++A D GSYV  +E+FTNLAPI+
Sbjct  300   KVEQLGEISIPECITYLDNGFLYIGARHGDSQLVRLNSEAID-GSYVVPVENFTNLAPIL  358

Query  361   DMCVVDLERQGQGQLVTCSGAYKEGSLRIIRNGIGIQEHASIDLPGIKGMWALTVASD-G  419
             D+ VVDL+RQGQGQ++TCSG++K+GSLRIIR GIGIQEHA IDLPGIKGMW+L V  D  
Sbjct  359   DIAVVDLDRQGQGQIITCSGSFKDGSLRIIRIGIGIQEHACIDLPGIKGMWSLKVGVDES  418

Query  420   KHDNTLVLAFVGQTRVLSLNGEEVEETEIAGFTSDQQTFYCGNVRYEQIIQVTPVSARLV  479
              ++NTLVLAFVG TR+L+L+GEEVEETEI GF SD QTF C NV Y+Q+IQVT  S RLV
Sbjct  419   PYENTLVLAFVGHTRILTLSGEEVEETEIPGFASDLQTFLCSNVDYDQLIQVTSDSVRLV  478

Query  480   SAQNKTLVAEWKPPTEKNISVVASNSEQVVVSTGSDLYYIEIHQNELIMKGHTTLNVEIA  539
             S+  K LVAEW+P  ++ I VV+ N+ Q++V++  D++YI I    L  +   TL  E+A
Sbjct  479   SSATKALVAEWRPTGDRTIGVVSCNTTQILVASACDIFYIVIEDGSLREQSRRTLAYEVA  538

Query  540   CLDISPLGNNATSSQLVAVGLWTDISACILKLPDLAEVYKENLGGEIIPRSVLMTTFENH  599
             CLDI+PL      S LVAVGLWTDISA IL LPDL  +Y E L GEIIPRS+LMTTFE  
Sbjct  539   CLDITPLDETQKKSDLVAVGLWTDISAVILSLPDLETIYTEKLSGEIIPRSILMTTFEGI  598

Query  600   TYLLCALGDGSMFYFSLHRESGVLTDKKKVTLGTQPTALRTFKSLSTTNVFACSDRPTVI  659
              YLLCALGDGSM+YF + + +G LTDKKKVTLGTQPT LRTF+SLSTTNVFACSDRPTVI
Sbjct  599   HYLLCALGDGSMYYFIMDQTTGQLTDKKKVTLGTQPTTLRTFRSLSTTNVFACSDRPTVI  658

Query  660   YSSNHKLVFSNVNMKEVNHMCSLNAEAFPDSLALATDTSVTIGTIDEIQKLHIRTVALQE  719
             YSSNHKLVFSNVN+KEVNHMCSLNA+A+PDSLALA   +V +GTIDEIQKLHIRTV L E
Sbjct  659   YSSNHKLVFSNVNLKEVNHMCSLNAQAYPDSLALANKNAVILGTIDEIQKLHIRTVPLGE  718

Query  720   SPRRIAYQEQSQTFGVVSVRMDIQDSTGLNPARPSASTMTQSVTVSSSVGSLSLGKSSVS  779
              PRRIAYQE SQTF V ++R+D+    G  P R SAST  Q++T SS+      G +S  
Sbjct  719   GPRRIAYQESSQTFAVSTLRIDVHGRGGAKPLRNSASTQAQNITCSSNFLPKPGGGNS--  776

Query  780   GISGTNLTPEYGQEVEVHNLLIIDQHTFEVLHAHQLMQQEYAMSLISCQLGDDPNMYYII  839
                 T    E GQE++VHNLL+IDQ+TFEVLHAHQ +  E   SL+S +LGDDPN YY++
Sbjct  777   ----TAANAEVGQEIDVHNLLVIDQNTFEVLHAHQFVAPETISSLMSAKLGDDPNTYYVV  832

Query  840   GTAIVNPEESEPKQGRLLIFQWADNKLTPISEKEIKGACYSLAEFNGKLLASINSTVRLF  899
              T++V PEE EPK GR++IF + +NKLT ++E ++ G CY+L EFNGK+LA I S VRL+
Sbjct  833   ATSLVIPEEPEPKVGRIIIFHYHENKLTQVAETKVDGTCYALVEFNGKVLAGIGSFVRLY  892

Query  900   EWTAEKELRLECSHFNNIITLYLKTKGDFVLVGDLMRSMTLLQYKTMEGSFEEIARDYNP  959
             EWT EKELR+EC+  N I  L+LK KGDF+LVGDLMRS+TLLQ+K MEG F EIARD  P
Sbjct  893   EWTNEKELRMECNIQNMIAALFLKAKGDFILVGDLMRSITLLQHKQMEGIFVEIARDCEP  952

Query  960   NWMTGVEILDDDIFLGSENSFNIFVCQKDSAATADEERLQMQEVGQFHVGDMINVFRHGS  1019
              WM  VEILDDD FLGSE + N+FVCQKDSAAT DEER  + E+ +FH+GD +NVFRHGS
Sbjct  953   KWMRAVEILDDDTFLGSETNGNLFVCQKDSAATTDEERQLLPELARFHLGDTVNVFRHGS  1012

Query  1020  LVMQNLGETSTPTTGCVLFGTVGGAIGLVTQISSEFFDFLLEVQNRMSSIIKSVGKIEHA  1079
             LVMQN+GE +TP  GCVL+GT  GAIG+VTQI  +F+DFL  ++ R+  IIKSVGKIEH 
Sbjct  1013  LVMQNVGERTTPINGCVLYGTCNGAIGIVTQIPQDFYDFLHGLEERLKKIIKSVGKIEHT  1072

Query  1080  HWRSFHTDIKTEPCKGFIDGDLIESFLDLSTDKMKEVVDGLQMIGDGSMRQECTVDDLIK  1139
             ++R+F  + K EP +GFIDGDLIESFLDLS DKM++ V GL++  +G  R+   V+D+IK
Sbjct  1073  YYRNFQINSKVEPSEGFIDGDLIESFLDLSRDKMRDAVQGLELTLNGE-RKSADVEDVIK  1131

Query  1140  MVEDLTRIH  1148
             +VEDLTR+H
Sbjct  1132  IVEDLTRMH  1140


>DDB1_DICDI unnamed protein product
Length=1181

 Score = 804 bits (2077),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 473/1227 (39%), Positives = 707/1227 (58%), Gaps = 155/1227 (13%)

Query  3     FHYVVTAHKPTAVTSCVTGNFTSPNDLNLIVAKNSRLEIYLVTPEGLRPIKEVGLYGKVA  62
             +++V T  KPT+VT  VTGNFT PND NLI++K +++EI+L+  +GL+P+ +V +YG+++
Sbjct  2     YNFVSTVQKPTSVTHSVTGNFTGPNDKNLIISKCTKIEIFLMDQDGLKPMFDVNIYGRIS  61

Query  63    VMKLYRPQQENKDYLFIVTMRYHAMILECVSDDDNLEIITKAHGNVADRIGKPSDTGIIA  122
             V+KL+      +DYLFI T  +   IL    D +  EIITKA GN  D IG+P++ G + 
Sbjct  62    VLKLFSVAGSKQDYLFISTESFKFCIL--AYDYEKKEIITKASGNAEDTIGRPTEAGQLG  119

Query  123   VIDPRARVIGLRLYDGLFKIIPLDKENS--------------------------------  150
             +IDP  R++ L LY+GL K+I LD  N+                                
Sbjct  120   IIDPDGRIVALHLYEGLLKLITLDNNNTPNKINNNNNNNNNNNNNNNNNNNNNINNNNFN  179

Query  151   ----------ELKASSIRMDELQVTDVEFLHGCANPTIVLIHQDV-NGRHVKTHEISLRD  199
                       +   +++R++ELQV D+ FL+GC  PTI ++ +D  + +H+ T+EIS +D
Sbjct  180   INNNNNNSPIQKNVNNVRLEELQVLDMTFLYGCKVPTIAVLFKDTKDEKHISTYEISSKD  239

Query  200   KEFVKIPWRQDNVETEASMIIPVPSPLCGAIIVGQESILYHDGMTSVAVAPPIIKQSTII  259
              E V  PW Q NV   +S+++PVP  L G ++V    I Y +G  + +VA   +  +  +
Sbjct  240   TELVVGPWSQSNVGVYSSLLVPVP--LGGVLVVADNGITYLNGKVTRSVA---VSYTKFL  294

Query  260   CYAKVDPSGLRYLLGDMAGHLFMLFLDVETKGDGSDVVKDLKVELLGEISSPECITYLDN  319
              + +VD  G R+L GD  G L +L L  + +      V +LK E LG IS P  I+YLD+
Sbjct  295   AFTRVDKDGSRFLFGDHFGRLSVLVLIHQQQK-----VMELKFEQLGRISIPSSISYLDS  349

Query  320   GVLYIGSRMGDSQLVKLNTKADDN-GSYVTIMESFTNLAPIMDMCVVDLERQGQGQLVTC  378
             GV+YIGS  GDSQL++LNT+ D    SYVT +E+FTN+ P++D CVVD E+QGQ Q+VTC
Sbjct  350   GVVYIGSSSGDSQLIRLNTEKDQTTDSYVTYLEAFTNIGPVVDFCVVDAEKQGQAQIVTC  409

Query  379   SGAYKEGSLRIIRNGIGIQEHASIDLPGIKGMWALTVA------------------SDG-  419
             SG Y++GSLRIIRNGIGI E ASI+L GIKG++ +                     S+G 
Sbjct  410   SGTYRDGSLRIIRNGIGIAEQASIELEGIKGIFPINNNNNNNNNNNNNNNNNNNNNSNGI  469

Query  420   --KHDNTLVLAFVGQTRVLSLNGEEVEETEIAGFTSDQQTFYCGNV-RYEQIIQVTPVSA  476
                 D  L+ +F+  T+VLS  GEE+EETE  G  S+  T YCG + +   +IQ+T VS 
Sbjct  470   TDSKDRYLITSFIECTKVLSFQGEEIEETEFEGLESNCSTLYCGTIDKLNLLIQITNVSI  529

Query  477   RLVSAQNKTLVAEWKPPTEKNISVVASNSEQVVVSTGSDLYYIEIHQNE--LIMKGHTTL  534
              L+ +     V++W     + I++V++N +Q+V+S    L Y +I+ +   + +     L
Sbjct  530   NLIDSNTFKRVSQWNVEPSRRINLVSTNQDQIVLSIDKSLLYFQINSSNKSIQLVKEIEL  589

Query  535   NVEIACLDISPLGNNA-TSSQLVAVGLWTDISACILKLPDLAEVYKENLGGEIIPRSVLM  593
               EI+C+DISP  +   T SQLV+VGLW DI+  I KLP L E++KE LGGEI+PRS+LM
Sbjct  590   PHEISCIDISPFDSFMDTKSQLVSVGLWNDITLRIFKLPTLEEIWKEPLGGEILPRSILM  649

Query  594   TTFENHTYLLCALGDGSMFYFSLHRESGVLTDKKKVTLGTQPTALRTFKSLSTTNVFACS  653
              +F++  Y+ C+LGDG +F F     S  L DK+K+TLGTQP  L+ FK  +T N+FA S
Sbjct  650   ISFDSIDYIFCSLGDGHLFKFQFDFSSFKLFDKRKLTLGTQPIILKKFKLKNTINIFAIS  709

Query  654   DRPTVIYSSNHKLVFSNVNMKEVNHMCSLNAEAFPDSLALATDTSVTIGTIDEIQKLHIR  713
             DRPTVIYS N KL +S VN+K+V ++ S N++ FP+S+A+AT  S+TIGTIDEIQKLHI+
Sbjct  710   DRPTVIYSHNKKLFYSVVNLKDVTNVTSFNSDGFPNSMAIATTNSLTIGTIDEIQKLHIK  769

Query  714   TVAL-QESPRRIAYQEQSQTFGVVSVRMDIQDSTGLNPARPSASTMTQSVTVSSSVGSLS  772
             T+ L +E  RRI + E    + V++V+    ++ GL                        
Sbjct  770   TIPLNEEMGRRIVHLEDHSCYAVITVK----NNEGL------------------------  801

Query  773   LGKSSVSGISGTNLTPEYGQEVEVHNLLIIDQHTFEVLHAHQLMQQEYAMSLISCQL-GD  831
             LG          +L  E   + EV  + I +  TFE++ +++L   E   S+  C+  GD
Sbjct  802   LG-------GAQDLCEE---DEEVSYIRIYNDQTFELISSYKLDPYEMGWSITPCKFAGD  851

Query  832   DPNMYYIIGTAIVNPEESEPKQGRL-----------------------LIFQWADNKLTP  868
             D N Y  +GT+I  P +S    GR+                            A+ KLT 
Sbjct  852   DVNTYLAVGTSINTPIKS---SGRVLLFSLSSSSSSNDKDSLDNNNNNNNNSGANGKLTL  908

Query  869   ISEKEIKGACYSLAEFNGKLLASINSTVRLFEWTAEKE-----LRLECSHFNNIITLYLK  923
             + E + + + Y L  FNG+L+A+++  +    +T  KE     +  E  H  + + L L 
Sbjct  909   LEEIKFRSSVYFLLSFNGRLIAAVHKRLFSIRYTHSKEKNCKVISSESVHKGHTMILKLA  968

Query  924   TKGDFVLVGDLMRSMTLLQYKTMEGSFEEIARDYNPNWMTGVEILDDDIFLGSENSFNIF  983
             ++G F+LVGD+M+SM+LL  ++ +GS E+IAR+  P W+  V +++DD F+G+E S N  
Sbjct  969   SRGHFILVGDMMKSMSLLVEQS-DGSLEQIARNPQPIWIRSVAMINDDYFIGAEASNNFI  1027

Query  984   VCQKDSAATADEERLQMQEVGQFHVGDMINVFRHGSLVMQNLGETSTPTTGCVLFGTVGG  1043
             V +K++ +T + ER  +  VG +H+G+ IN  RHGSLV   L ++  P    +L+ +V G
Sbjct  1028  VVKKNNDSTNELERELLDSVGHYHIGESINSMRHGSLV--RLPDSDQPIIPTILYASVNG  1085

Query  1044  AIGLVTQISSEFFDFLLEVQNRMSSIIKSVGKIEHAHWRSFHTDIKTEPCKGFIDGDLIE  1103
             +IG+V  IS E F F  ++Q  ++ +++ VG   H  WR+F  D  T   K FIDGDLIE
Sbjct  1086  SIGVVASISEEDFIFFSKLQKGLNQVVRGVGGFSHETWRAFSNDHHTIDSKNFIDGDLIE  1145

Query  1104  SFLDLSTDKMKEVVDGLQMIGDGSMRQ  1130
             +FLDL  +   + V  L +  D + R+
Sbjct  1146  TFLDLKYESQLKAVADLGITPDDAFRR  1172


>DDB1_CAEEL unnamed protein product
Length=1134

 Score = 723 bits (1866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/1173 (34%), Positives = 700/1173 (60%), Gaps = 64/1173 (5%)

Query  1     MAFHYVVTAHKPTAVTSCVTGNFTSPNDLNLIVAKNSRLEIYLVTPEGLRPIKEVGLYGK  60
             M   Y V+A K + V   V GNFT   ++NLIVA+ +R+++ LV+PEGL+ + E+ +YG+
Sbjct  1     MPISYCVSAKKASVVVESVVGNFTGHENVNLIVARGNRIDVQLVSPEGLKNVCEIPIYGQ  60

Query  61    VAVMKLYRPQQENKDYLFIVTMRYHAMILECVSDDDNLEIITKAHGNVADRIGKPSDTGI  120
             V  + L + +++ +  L +VT ++H  IL       + +++T+A G +AD  G+ +D  +
Sbjct  61    VLTIALVKCKRDKRHSLIVVTEKWHMAILAY----RDGKVVTRAAGCIADPTGRATDN-L  115

Query  121   IAVIDPRARVIGLRLYDGLFKIIPLDKENSELKASSIRMDELQVTDVEFLHGCANPT--I  178
              ++   R  +I +R ++G  K+I  +   ++L+  ++R D   V+D +F+    +    +
Sbjct  116   FSLTIHRNGLIAIRAFEGSVKMIQWES-GTDLRHFNVRFDYPNVSDFKFVDTGEDDVYRV  174

Query  179   VLIHQDVNGRHVKTHEISLRDKEFVKIPWRQDNVETEASMIIPVPSPLCGAIIVGQESIL  238
               I+ D +G+H++  ++++ DKEF +   RQ ++  ++S++IPVP  + G I++G  S+L
Sbjct  175   AFIYDDDHGKHLQFSDLNMHDKEF-RTYSRQASIAADSSVLIPVPHAIGGVIVLGSNSVL  233

Query  239   YHDGMTSVAVAP---PIIKQSTIICYAKVDPSGLRYLLGDMAGHLFMLFLDVETKGDGSD  295
             Y        V P    +++ +T  C+  VD SG R+LL D  G L ML L+V T+     
Sbjct  234   YKPNDNLGEVVPYTCSLLENTTFTCHGIVDASGERFLLSDTDGRLLMLLLNV-TESQSGY  292

Query  296   VVKDLKVELLGEISSPECITYLDNGVLYIGSRMGDSQLVKLNTKADDNGSYVTIMESFTN  355
              VK+++++ LGE S  + I Y+DNGV+++GSR+GDSQL++L T+ +  GSY  I+E+++N
Sbjct  293   TVKEMRIDYLGETSIADSINYIDNGVVFVGSRLGDSQLIRLMTEPN-GGSYSVILETYSN  351

Query  356   LAPIMDMCVVDLERQGQGQLVTCSGAYKEGSLRIIRNGIGIQEHASIDLPGIKGMWALTV  415
             + PI DM +V  E  GQ QLVTC+GA K+GSLR+IRNGIGI E AS+DL G+ G++ + +
Sbjct  352   IGPIRDMVMV--ESDGQPQLVTCTGADKDGSLRVIRNGIGIDELASVDLAGVVGIFPIRL  409

Query  416   ASDGKHDNTLVLAFVGQTRVLSLNGEEVEETEIAGFTSDQQTFYCGNVRYEQ----IIQV  471
               D   DN ++++   +T VL + GEE+E+ ++    +D  T +   +        I+Q 
Sbjct  410   --DSNADNYVIVSLSDETHVLQITGEELEDVKLLEINTDLPTIFASTLFGPNDSGIILQA  467

Query  472   TPVSARLVSAQNKTLVAEWKPPTEKNISVVASNSE--QVVVSTGSDLYYI-----EIHQN  524
             T    RL+S+    L   W+P   + IS V+ N+   Q+V++    +Y +     E+   
Sbjct  468   TEKQIRLMSSSG--LSKFWEPTNGEIISKVSVNAANGQIVLAARDTVYLLTCIVDEMGAL  525

Query  525   ELIMKGHTTLNVEIACLDISPLGNNATS-SQLVAVGLWTDISACILKLPDLAEVYKENLG  583
             ++ +        EIACLD+S  G++  + +  + +  W+  +  +++LPDL  V   +L 
Sbjct  526   DIQLTAEKKFENEIACLDLSNEGDDPNNKATFLVLAFWSTFAMEVIQLPDLITVCHTDLP  585

Query  584   GEIIPRSVLMTTFENHTYLLCALGDGSMFYFSLHRESGVLTDKKKVTLGTQPTALRTFKS  643
              +IIPRS++ T  E   YLL A GDG++ Y+    ++G   + KK  +GT+P +L   ++
Sbjct  586   TKIIPRSIIATCIEEVHYLLVAFGDGALVYYVFDIKTGTHGEPKKSNVGTRPPSLHRVRN  645

Query  644   LSTTNVFACSDRPTVIYSSNHKLVFSNVNMKEVNHMCSLNAEAFPDSLALATDTSVTIGT  703
              +  ++F CSDRP +I+S++ KLVFSNVN+K V+ +CSL++ A+ D L ++   S+  GT
Sbjct  646   KNRQHLFVCSDRPVIIFSASKKLVFSNVNVKLVDTVCSLSSSAYRDCLVISDGNSMVFGT  705

Query  704   IDEIQKLHIRTVALQESPRRIAYQEQSQTFGVVSVRMDIQDSTGLNPARPSASTMTQSVT  763
             +D+IQK+H+R++ + ES  RIAYQ+ + T+GV S R                 T +++  
Sbjct  706   VDDIQKIHVRSIPMGESVLRIAYQKSTSTYGVCSNR-----------------TESKAER  748

Query  764   VSSSVGSLSLGKSSVSGISGTNLTPEYGQEVEVHNLLIIDQHTFEVLHAHQLMQQEYAMS  823
             V +S  +L   +S    ++ T    +        + +++DQ+TF+VLH+H+    E A+S
Sbjct  749   VFASKNALVTSQSR-PKVASTRADMDESPPNTTSSFMVLDQNTFQVLHSHEFGPWETALS  807

Query  824   LISCQLGDDPNMYYIIGTAIVNPEESEPKQGRLLIFQWAD---NKLTPISEKEIKGACYS  880
              IS Q  +D + YY++GT ++ P+E+E K GR+++F+  D   +KL  + E  ++G+  +
Sbjct  808   CISGQFTNDSSTYYVVGTGLIYPDETETKIGRIVVFEVDDVERSKLRRVHELVVRGSPLA  867

Query  881   LAEFNGKLLASINSTVRLFEWTAEKELRLECSHFNNIITLYLKTKGDFVLVGDLMRSMTL  940
             +   NGKL+A+INS++RLFEWT +KELRLECS FN++I L LK   + V V D+MRS++L
Sbjct  868   IRILNGKLVAAINSSIRLFEWTTDKELRLECSSFNHVIALDLKVMNEEVAVADVMRSVSL  927

Query  941   LQYKTMEGSFEEIARDYNPNWMTGVEILDDDIFLGSENSFNIFVCQKD-SAATADEERLQ  999
             L Y+ +EG+FEE+A+D+N  WM   E +  +  LG E   N+F  + D +    D+ R  
Sbjct  928   LSYRMLEGNFEEVAKDWNSQWMVTCEFITAESILGGEAHLNLFTVEVDKTRPITDDGRYV  987

Query  1000  MQEVGQFHVGDMINVFRHGSLVMQ---NLGETSTPTTGCVLFGTVGGAIGLVTQISSEFF  1056
             ++  G +++G++  V    +LV+Q   ++ + S P    ++FGT  G IG++ QI  ++ 
Sbjct  988   LEPTGYWYLGELPKVMTRSTLVIQPEDSIIQYSQP----IMFGTNQGTIGMIVQIDDKWK  1043

Query  1057  DFLLEVQNRMSSIIKSVGKIEHAHWRSFHTDIKTEPCKGFIDGDLIESFLDLSTDKMKEV  1116
              FL+ ++  ++  +K+   IEH+ +R+F    + EP  GF+DGDL+ES LD+      ++
Sbjct  1044  KFLIAIEKAIADSVKNCMHIEHSSYRTFVFQKRAEPPSGFVDGDLVESILDMDRSVAMDI  1103

Query  1117  VDGLQMIG-DGSMRQECTVDDLIKMVEDLTRIH  1148
             +  +   G D S+ ++    +++K++EDL R+H
Sbjct  1104  LSKVSDKGWDPSLPRDPV--EILKVIEDLARMH  1134



Lambda      K        H
   0.311    0.127    0.359 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8292602108


Query= XP_031327346.1 DNA repair protein complementing XP-C cells homolog
[Photinus pyralis]

Length=1000
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

XPC_DROME  unnamed protein product                                    474     3e-148
Q9N4C3_CAEEL  unnamed protein product                                 251     4e-69 
Q38DK1_TRYB2  unnamed protein product                                 125     3e-29 


>XPC_DROME unnamed protein product
Length=1293

 Score = 474 bits (1220),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 203/339 (60%), Positives = 262/339 (77%), Gaps = 0/339 (0%)

Query  627   TKGMDVWVEVYLEAEEKWISVDVGKNQVHCVNQLYSRASHPVSYVIAWNNNNSIKDITQR  686
             T   D+WVEV+ + EE+WI +D+ K ++HCV+ +   A+  ++YV A+ ++ S+KD+T R
Sbjct  955   TDASDMWVEVWSDVEEQWICIDLFKGKLHCVDTIRKNATPGLAYVFAFQDDQSLKDVTAR  1014

Query  687   YCTNWNTTTRLLRVDAKWWSATLKPYTGVKTARDKEEDEELAQLQLDKPLPSTISEYKNH  746
             YC +W+TT R  RV+  W   T+ PY G +T RD  ED++L ++  DKPLP +ISE+K+H
Sbjct  1015  YCASWSTTVRKARVEKAWLDETIAPYLGRRTKRDITEDDQLRRIHSDKPLPKSISEFKDH  1074

Query  747   PLYVLKRHLLKFEALYPPDLPPVGFIRNEPVYPRECVHVLHSREIWMKEAKQVKPAQQPY  806
             PLYVL+RHLLKF+ LYPPD P +GFIR E VY R+CVH+LHSREIW+K A+ VK  +QPY
Sbjct  1075  PLYVLERHLLKFQGLYPPDAPTLGFIRGEAVYSRDCVHLLHSREIWLKSARVVKLGEQPY  1134

Query  807   KIVKARPKYDKLSGKVITDLPLEVFGIWQVEDYIPPTAENGVVPRNAYGNVELFKPCMLP  866
             K+VKARPK+D+L+  VI D PLE+FG WQ ++Y PPTAENG+VPRNAYGNVELFK CMLP
Sbjct  1135  KVVKARPKWDRLTRTVIKDQPLEIFGYWQTQEYEPPTAENGIVPRNAYGNVELFKDCMLP  1194

Query  867   KGTVHLQLAGLNKVARKMGIDCVPAVVGFDFHSGWNHPTYDGFVVCEEQSEALVAAWFQD  926
             K TVHL+L GL ++ +K+ IDC  AVVGFDFH G  HP YDGF+VCEE  E + AAW +D
Sbjct  1195  KKTVHLRLPGLMRICKKLNIDCANAVVGFDFHQGACHPMYDGFIVCEEFREVVTAAWEED  1254

Query  927   QEEQEKKELEKIEKRVYGNWRKLIKGLLIRERLKKRYDY  965
             Q+ Q  KE EK E RVYGNW+KLIKGLLIRERLKK+Y++
Sbjct  1255  QQVQVLKEQEKYETRVYGNWKKLIKGLLIRERLKKKYNF  1293


 Score = 135 bits (340),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 130/472 (28%), Positives = 228/472 (48%), Gaps = 77/472 (16%)

Query  39   DSSSDSDIENYL-QPVDKLDLDSSFF---QIQKSPEIQSFESIEKDIFAGTNRLSDMDSD  94
            DSSS+S +E+YL  P D LDL S+FF   Q +KSP  Q       D  AG   LSD  S+
Sbjct  137  DSSSESSVEDYLVNPAD-LDLHSTFFAGGQKEKSPAPQF------DCNAGITNLSDSGSE  189

Query  95   ESDPEQEPTPTTSKLNFDQLHSYTNKLDQMKQAIQNYKTKQKVADAKAKPHSDNISDLLA  154
            +++         +  +F  L    N L++ + A+   K        +++  + +++ LLA
Sbjct  190  DNNESSFEDKAGNAFDFRGLLENANSLERTRDALS--KRNVTATPPRSQAATMDVNALLA  247

Query  155  LGEMQ----------------------------VDNPTDNHSLHSSDFH-----------  175
            LGE Q                            +D P+      S+              
Sbjct  248  LGENQNYQSVEVEEREGNQRKKAGRGAPAAPPTLDEPSRLSKTKSTRIKRHTKTRPVSTV  307

Query  176  --SCSEVEDNDWEEVEDKLTKP-----STSLVKDGIQITVSLPD---TMKKKKGVDLLAS  225
              +  + +D+D+EEV D           T  +   ++I V L     T ++K   +L  +
Sbjct  308  VANAGDTDDSDFEEVADADLSSDQDDGETPNISGDLEIRVGLEGLRPTKEQKTQHELEMA  367

Query  226  LKRRLNRIKKEHQVLIHKVHLLCWIAHGNYINKNLN-SETILGLALSLIPSQHCYPPDR-  283
            LKRRLNR  K+ Q+L+HKV L+C IA     N+ L+ S++++   L L+PS++ YP +R 
Sbjct  368  LKRRLNRDIKDRQILLHKVSLMCQIARSLKYNRLLSESDSLMQATLKLLPSRNAYPTERG  427

Query  284  TDLTYLEQILNWYNKVMDL-------SEKLVSKQWSLEKVLTLQLTRRQAYNKKMFTYIF  336
            T+L YL+  + W+   + L       ++   +K+  LE +L  Q+ R++A  K+   +IF
Sbjct  428  TELKYLQSFVTWFKTSIKLLSPNLYSAQSPATKEAILEALLE-QVKRKEARCKQDMIFIF  486

Query  337  ICILRALGIQCRLVLSFQVLPLRPLSNELHSLSTKANNKNE---VKTDHKTTSKISEKNE  393
            I + R +G+ CRL+++ Q +PLRP +++L  +  + ++KN+   V+++ ++  +  +K++
Sbjct  487  IALARGMGMHCRLIVNLQPMPLRPAASDLIPIKLRPDDKNKSQTVESERESEDEKPKKDK  546

Query  394  PKQDTTRKKNSKEQIEKKTTENKKAKSDKVEKVGSGNSTKQSTEKTSTSKLP  445
                   K++SK  I K+  +   AK  K E      ST + +E T +  +P
Sbjct  547  KAGKPAEKESSKSTISKEAEKKNNAK--KAEAKPLSKSTTKGSETTKSGTVP  596


>Q9N4C3_CAEEL unnamed protein product
Length=1119

 Score = 251 bits (641),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 144/385 (37%), Positives = 222/385 (58%), Gaps = 16/385 (4%)

Query  605   QDKVKVKKRIEVKRNQPESENATKGMDV-----WVEVYLEAEEKWISVDVGKNQVHCVNQ  659
             Q+K   K +   K+ Q   + A K + V     WVE +   E++WI VD     V     
Sbjct  693   QEKSGEKSQKPAKKGQKSEKKAAKKVVVEERNYWVEYWQPREKRWICVDPLHKSVDEPLS  752

Query  660   LYSRASHPVSYVIAWNNNNSIKDITQRYCTNW-NTTTRLLRVDAKW--WSATLKPYTGVK  716
             ++  ++ P+SYV A +N   I +++QRY  +      R  R + KW  W+  L P+    
Sbjct  753   IHEHSASPISYVFAIDNKQGICEVSQRYAMDCVKQDFRRRRTNPKWVAWTLFLPPFAA-N  811

Query  717   TARDKEEDEELAQLQLDKPLPSTISEYKNHPLYVLKRHLLKFEALYPPDLP--PVGFIRN  774
             + R K E  ++ +  + +PLP+ +SEYKNHPLY L++ LLKFEA+YPP     P+G IR 
Sbjct  812   SERKKWEMMQMREDLVKRPLPTVMSEYKNHPLYALEKDLLKFEAIYPPPATQKPLGQIRG  871

Query  775   EPVYPRECVHVLHSREIWMKEAKQVKPAQQPYKIVKARPKYDKLSGKVITDLPLEVFGIW  834
               VYPR  V  L     W+K A+ VK  ++PYKIVKARP   ++  +   D  L+V+G W
Sbjct  872   HNVYPRSTVFTLQGENNWLKLARSVKIGEKPYKIVKARPD-PRIPVEDREDKFLDVYGYW  930

Query  835   QVEDYIPPTAENGVVPRNAYGNVELFKPCMLPKGTVHLQLAGLNKVARKMGIDCVPAVVG  894
             Q E Y  P  +NG +P N YGNV +F   M P    +L+L+GL +++RK+G  C+PAVVG
Sbjct  931   QTEKYRRPPLKNGKIPHNEYGNVYMFNENMCPLDCTYLKLSGLVQISRKLGKQCIPAVVG  990

Query  895   FDFHSGWNHPTYDGFVVCEEQSEALVAAWFQ-DQEEQEKKELEKIEKRVYGNWRKLIKGL  953
             + F  G+ HP  DG +V E+ +   + AW + +    EK+E +++EK ++ NW+KLIKG+
Sbjct  991   WAFDGGFTHPVIDGAIVLEKDAIDFINAWEKLESGRAEKEEKQRVEK-IHENWKKLIKGM  1049

Query  954   LIRERLKKRYDYGEPSSQGDSKGKK  978
             L    ++K+  +G P+++  +K +K
Sbjct  1050  LRLAYVRKQ--FGHPAAEKPTKRQK  1072


 Score = 48.1 bits (113),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 55/219 (25%), Positives = 99/219 (45%), Gaps = 25/219 (11%)

Query  226  LKRRLNRIKKEHQVLIHKVHLLCWIAHGNYINK-NLNSETILGLALSLIPSQHCY----P  280
            L++ +NR  +E     HKVHLLC++AH  ++ K  L+   +  L +S +P+ +      P
Sbjct  508  LRQEINRKIREMWENTHKVHLLCFMAHLKFVVKIALDESLVPSLMMSQLPNGYLKFIGEP  567

Query  281  PDRTDLTYLEQILNWYNKVMDLSEKLVSKQWSLEKVLTLQL-------TRR--QAYNKKM  331
                D+  ++ ++ W+         +VS   S+E+   L+        TRR     + K 
Sbjct  568  VVPIDI--MKNLVKWFADAFRPLNGVVSVA-SIEQDSLLEGHEARYPETRRLTALVDAKC  624

Query  332  F------TYIFICILRALGIQCRLVLSFQVLPLRPLSNELHSLSTKANNKNEVKTDHKTT  385
            F        +  C+LR L +  RLV++ + +P R    +   L  + +   E+     TT
Sbjct  625  FETDLDRATLLFCLLRGLELTTRLVVNVRAIPRRWDKTQQKELQNELSKFRELSRSRSTT  684

Query  386  SKISEKNEPKQDTTRKKNSKEQIEKKTTENKKAKSDKVE  424
                EK+   Q+ + +K+ K   + + +E K AK   VE
Sbjct  685  P--GEKSLEIQEKSGEKSQKPAKKGQKSEKKAAKKVVVE  721


>Q38DK1_TRYB2 unnamed protein product
Length=768

 Score = 125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 101/373 (27%), Positives = 178/373 (48%), Gaps = 65/373 (17%)

Query  632  VWVEVYLEAEEKWISVDVGKNQVHCVNQLYSRASHPVSYVIAWNNNNSIKDITQRYCTNW  691
             W+EV+    + +ISV    N       L++    P ++ +     ++I D+T RY   +
Sbjct  414  FWLEVWCPQRQSYISV----NPCGGCATLFA---APYTFSV---GGDAIMDVTPRYSIKY  463

Query  692  NT--TTRLLRVD--------AKW-------------WSATLKPYTGVKTARDKEEDEELA  728
            ++  T RL R D         +W             +   +  YT  +  R+K++   L 
Sbjct  464  SSAFTHRLGRCDRYRHIWKDLQWNDNREASEVIVDLFRRDVGKYTEAQMQREKKQ---LH  520

Query  729  QLQLDKPLPSTISEYKNHPLYVLKRHLLKFEALYPPD-LPPVGFIRNEPVYPRECVHVLH  787
             L   + +P T++  + HPL++L+  L ++E +YP D    VG ++   V+ R  V  L 
Sbjct  521  SLTYAEEVPKTLTALQKHPLFILENGLSRYEGIYPKDSTTMVGSVKGHIVFKRSAVVSLR  580

Query  788  SREIWMKEAKQVKPAQQPYKIVKARPK--YDKLSGKVITDLPLEVFGIWQVEDYIP-PTA  844
            SR+ W++E + V   ++PYK++   P   + K S          +FG+WQ + + P P  
Sbjct  581  SRDGWLREGRTVSGEEEPYKVIPPPPSRPFSKSSA---------LFGVWQTKPFAPEPLG  631

Query  845  ENGVVPRNAYGNVELF----KPCMLPKGTVHLQLAGLNKVARKMGIDCVPAVVGFDFH--  898
            E+G +P+  +GN + +    KP   P G VH+Q   + +VAR+M ID    V G+     
Sbjct  632  EDGSIPK--HGNTQWYILLDKPA--PIGLVHMQQPNIIRVARRMNIDFGIVVTGYRRRRL  687

Query  899  -----SGWNHPTYDGFVVCEEQSEALVAAWFQDQEEQEKKELEKIEKRVYGNWRKLIKGL  953
                 SGW   T DG +V E  + +LV A+ + ++  E++E  K ++R Y  W   ++  
Sbjct  688  NEARSSGWEVVT-DGIIVKETNTGSLVKAYEEWKQLTEEQEAAKRKQRAYRWWMHFVQHR  746

Query  954  LIRERLKKRYDYG  966
            L   R++++Y  G
Sbjct  747  LAYLRIRQQYLEG  759



Lambda      K        H
   0.311    0.127    0.359 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8292602108


Query= XP_031327347.1 DNA repair protein complementing XP-C cells homolog
[Photinus pyralis]

Length=1000
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

XPC_DROME  unnamed protein product                                    474     3e-148
Q9N4C3_CAEEL  unnamed protein product                                 251     4e-69 
Q38DK1_TRYB2  unnamed protein product                                 125     3e-29 


>XPC_DROME unnamed protein product
Length=1293

 Score = 474 bits (1220),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 203/339 (60%), Positives = 262/339 (77%), Gaps = 0/339 (0%)

Query  627   TKGMDVWVEVYLEAEEKWISVDVGKNQVHCVNQLYSRASHPVSYVIAWNNNNSIKDITQR  686
             T   D+WVEV+ + EE+WI +D+ K ++HCV+ +   A+  ++YV A+ ++ S+KD+T R
Sbjct  955   TDASDMWVEVWSDVEEQWICIDLFKGKLHCVDTIRKNATPGLAYVFAFQDDQSLKDVTAR  1014

Query  687   YCTNWNTTTRLLRVDAKWWSATLKPYTGVKTARDKEEDEELAQLQLDKPLPSTISEYKNH  746
             YC +W+TT R  RV+  W   T+ PY G +T RD  ED++L ++  DKPLP +ISE+K+H
Sbjct  1015  YCASWSTTVRKARVEKAWLDETIAPYLGRRTKRDITEDDQLRRIHSDKPLPKSISEFKDH  1074

Query  747   PLYVLKRHLLKFEALYPPDLPPVGFIRNEPVYPRECVHVLHSREIWMKEAKQVKPAQQPY  806
             PLYVL+RHLLKF+ LYPPD P +GFIR E VY R+CVH+LHSREIW+K A+ VK  +QPY
Sbjct  1075  PLYVLERHLLKFQGLYPPDAPTLGFIRGEAVYSRDCVHLLHSREIWLKSARVVKLGEQPY  1134

Query  807   KIVKARPKYDKLSGKVITDLPLEVFGIWQVEDYIPPTAENGVVPRNAYGNVELFKPCMLP  866
             K+VKARPK+D+L+  VI D PLE+FG WQ ++Y PPTAENG+VPRNAYGNVELFK CMLP
Sbjct  1135  KVVKARPKWDRLTRTVIKDQPLEIFGYWQTQEYEPPTAENGIVPRNAYGNVELFKDCMLP  1194

Query  867   KGTVHLQLAGLNKVARKMGIDCVPAVVGFDFHSGWNHPTYDGFVVCEEQSEALVAAWFQD  926
             K TVHL+L GL ++ +K+ IDC  AVVGFDFH G  HP YDGF+VCEE  E + AAW +D
Sbjct  1195  KKTVHLRLPGLMRICKKLNIDCANAVVGFDFHQGACHPMYDGFIVCEEFREVVTAAWEED  1254

Query  927   QEEQEKKELEKIEKRVYGNWRKLIKGLLIRERLKKRYDY  965
             Q+ Q  KE EK E RVYGNW+KLIKGLLIRERLKK+Y++
Sbjct  1255  QQVQVLKEQEKYETRVYGNWKKLIKGLLIRERLKKKYNF  1293


 Score = 135 bits (340),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 130/472 (28%), Positives = 228/472 (48%), Gaps = 77/472 (16%)

Query  39   DSSSDSDIENYL-QPVDKLDLDSSFF---QIQKSPEIQSFESIEKDIFAGTNRLSDMDSD  94
            DSSS+S +E+YL  P D LDL S+FF   Q +KSP  Q       D  AG   LSD  S+
Sbjct  137  DSSSESSVEDYLVNPAD-LDLHSTFFAGGQKEKSPAPQF------DCNAGITNLSDSGSE  189

Query  95   ESDPEQEPTPTTSKLNFDQLHSYTNKLDQMKQAIQNYKTKQKVADAKAKPHSDNISDLLA  154
            +++         +  +F  L    N L++ + A+   K        +++  + +++ LLA
Sbjct  190  DNNESSFEDKAGNAFDFRGLLENANSLERTRDALS--KRNVTATPPRSQAATMDVNALLA  247

Query  155  LGEMQ----------------------------VDNPTDNHSLHSSDFH-----------  175
            LGE Q                            +D P+      S+              
Sbjct  248  LGENQNYQSVEVEEREGNQRKKAGRGAPAAPPTLDEPSRLSKTKSTRIKRHTKTRPVSTV  307

Query  176  --SCSEVEDNDWEEVEDKLTKP-----STSLVKDGIQITVSLPD---TMKKKKGVDLLAS  225
              +  + +D+D+EEV D           T  +   ++I V L     T ++K   +L  +
Sbjct  308  VANAGDTDDSDFEEVADADLSSDQDDGETPNISGDLEIRVGLEGLRPTKEQKTQHELEMA  367

Query  226  LKRRLNRIKKEHQVLIHKVHLLCWIAHGNYINKNLN-SETILGLALSLIPSQHCYPPDR-  283
            LKRRLNR  K+ Q+L+HKV L+C IA     N+ L+ S++++   L L+PS++ YP +R 
Sbjct  368  LKRRLNRDIKDRQILLHKVSLMCQIARSLKYNRLLSESDSLMQATLKLLPSRNAYPTERG  427

Query  284  TDLTYLEQILNWYNKVMDL-------SEKLVSKQWSLEKVLTLQLTRRQAYNKKMFTYIF  336
            T+L YL+  + W+   + L       ++   +K+  LE +L  Q+ R++A  K+   +IF
Sbjct  428  TELKYLQSFVTWFKTSIKLLSPNLYSAQSPATKEAILEALLE-QVKRKEARCKQDMIFIF  486

Query  337  ICILRALGIQCRLVLSFQVLPLRPLSNELHSLSTKANNKNE---VKTDHKTTSKISEKNE  393
            I + R +G+ CRL+++ Q +PLRP +++L  +  + ++KN+   V+++ ++  +  +K++
Sbjct  487  IALARGMGMHCRLIVNLQPMPLRPAASDLIPIKLRPDDKNKSQTVESERESEDEKPKKDK  546

Query  394  PKQDTTRKKNSKEQIEKKTTENKKAKSDKVEKVGSGNSTKQSTEKTSTSKLP  445
                   K++SK  I K+  +   AK  K E      ST + +E T +  +P
Sbjct  547  KAGKPAEKESSKSTISKEAEKKNNAK--KAEAKPLSKSTTKGSETTKSGTVP  596


>Q9N4C3_CAEEL unnamed protein product
Length=1119

 Score = 251 bits (641),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 144/385 (37%), Positives = 222/385 (58%), Gaps = 16/385 (4%)

Query  605   QDKVKVKKRIEVKRNQPESENATKGMDV-----WVEVYLEAEEKWISVDVGKNQVHCVNQ  659
             Q+K   K +   K+ Q   + A K + V     WVE +   E++WI VD     V     
Sbjct  693   QEKSGEKSQKPAKKGQKSEKKAAKKVVVEERNYWVEYWQPREKRWICVDPLHKSVDEPLS  752

Query  660   LYSRASHPVSYVIAWNNNNSIKDITQRYCTNW-NTTTRLLRVDAKW--WSATLKPYTGVK  716
             ++  ++ P+SYV A +N   I +++QRY  +      R  R + KW  W+  L P+    
Sbjct  753   IHEHSASPISYVFAIDNKQGICEVSQRYAMDCVKQDFRRRRTNPKWVAWTLFLPPFAA-N  811

Query  717   TARDKEEDEELAQLQLDKPLPSTISEYKNHPLYVLKRHLLKFEALYPPDLP--PVGFIRN  774
             + R K E  ++ +  + +PLP+ +SEYKNHPLY L++ LLKFEA+YPP     P+G IR 
Sbjct  812   SERKKWEMMQMREDLVKRPLPTVMSEYKNHPLYALEKDLLKFEAIYPPPATQKPLGQIRG  871

Query  775   EPVYPRECVHVLHSREIWMKEAKQVKPAQQPYKIVKARPKYDKLSGKVITDLPLEVFGIW  834
               VYPR  V  L     W+K A+ VK  ++PYKIVKARP   ++  +   D  L+V+G W
Sbjct  872   HNVYPRSTVFTLQGENNWLKLARSVKIGEKPYKIVKARPD-PRIPVEDREDKFLDVYGYW  930

Query  835   QVEDYIPPTAENGVVPRNAYGNVELFKPCMLPKGTVHLQLAGLNKVARKMGIDCVPAVVG  894
             Q E Y  P  +NG +P N YGNV +F   M P    +L+L+GL +++RK+G  C+PAVVG
Sbjct  931   QTEKYRRPPLKNGKIPHNEYGNVYMFNENMCPLDCTYLKLSGLVQISRKLGKQCIPAVVG  990

Query  895   FDFHSGWNHPTYDGFVVCEEQSEALVAAWFQ-DQEEQEKKELEKIEKRVYGNWRKLIKGL  953
             + F  G+ HP  DG +V E+ +   + AW + +    EK+E +++EK ++ NW+KLIKG+
Sbjct  991   WAFDGGFTHPVIDGAIVLEKDAIDFINAWEKLESGRAEKEEKQRVEK-IHENWKKLIKGM  1049

Query  954   LIRERLKKRYDYGEPSSQGDSKGKK  978
             L    ++K+  +G P+++  +K +K
Sbjct  1050  LRLAYVRKQ--FGHPAAEKPTKRQK  1072


 Score = 48.1 bits (113),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 55/219 (25%), Positives = 99/219 (45%), Gaps = 25/219 (11%)

Query  226  LKRRLNRIKKEHQVLIHKVHLLCWIAHGNYINK-NLNSETILGLALSLIPSQHCY----P  280
            L++ +NR  +E     HKVHLLC++AH  ++ K  L+   +  L +S +P+ +      P
Sbjct  508  LRQEINRKIREMWENTHKVHLLCFMAHLKFVVKIALDESLVPSLMMSQLPNGYLKFIGEP  567

Query  281  PDRTDLTYLEQILNWYNKVMDLSEKLVSKQWSLEKVLTLQL-------TRR--QAYNKKM  331
                D+  ++ ++ W+         +VS   S+E+   L+        TRR     + K 
Sbjct  568  VVPIDI--MKNLVKWFADAFRPLNGVVSVA-SIEQDSLLEGHEARYPETRRLTALVDAKC  624

Query  332  F------TYIFICILRALGIQCRLVLSFQVLPLRPLSNELHSLSTKANNKNEVKTDHKTT  385
            F        +  C+LR L +  RLV++ + +P R    +   L  + +   E+     TT
Sbjct  625  FETDLDRATLLFCLLRGLELTTRLVVNVRAIPRRWDKTQQKELQNELSKFRELSRSRSTT  684

Query  386  SKISEKNEPKQDTTRKKNSKEQIEKKTTENKKAKSDKVE  424
                EK+   Q+ + +K+ K   + + +E K AK   VE
Sbjct  685  P--GEKSLEIQEKSGEKSQKPAKKGQKSEKKAAKKVVVE  721


>Q38DK1_TRYB2 unnamed protein product
Length=768

 Score = 125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 101/373 (27%), Positives = 178/373 (48%), Gaps = 65/373 (17%)

Query  632  VWVEVYLEAEEKWISVDVGKNQVHCVNQLYSRASHPVSYVIAWNNNNSIKDITQRYCTNW  691
             W+EV+    + +ISV    N       L++    P ++ +     ++I D+T RY   +
Sbjct  414  FWLEVWCPQRQSYISV----NPCGGCATLFA---APYTFSV---GGDAIMDVTPRYSIKY  463

Query  692  NT--TTRLLRVD--------AKW-------------WSATLKPYTGVKTARDKEEDEELA  728
            ++  T RL R D         +W             +   +  YT  +  R+K++   L 
Sbjct  464  SSAFTHRLGRCDRYRHIWKDLQWNDNREASEVIVDLFRRDVGKYTEAQMQREKKQ---LH  520

Query  729  QLQLDKPLPSTISEYKNHPLYVLKRHLLKFEALYPPD-LPPVGFIRNEPVYPRECVHVLH  787
             L   + +P T++  + HPL++L+  L ++E +YP D    VG ++   V+ R  V  L 
Sbjct  521  SLTYAEEVPKTLTALQKHPLFILENGLSRYEGIYPKDSTTMVGSVKGHIVFKRSAVVSLR  580

Query  788  SREIWMKEAKQVKPAQQPYKIVKARPK--YDKLSGKVITDLPLEVFGIWQVEDYIP-PTA  844
            SR+ W++E + V   ++PYK++   P   + K S          +FG+WQ + + P P  
Sbjct  581  SRDGWLREGRTVSGEEEPYKVIPPPPSRPFSKSSA---------LFGVWQTKPFAPEPLG  631

Query  845  ENGVVPRNAYGNVELF----KPCMLPKGTVHLQLAGLNKVARKMGIDCVPAVVGFDFH--  898
            E+G +P+  +GN + +    KP   P G VH+Q   + +VAR+M ID    V G+     
Sbjct  632  EDGSIPK--HGNTQWYILLDKPA--PIGLVHMQQPNIIRVARRMNIDFGIVVTGYRRRRL  687

Query  899  -----SGWNHPTYDGFVVCEEQSEALVAAWFQDQEEQEKKELEKIEKRVYGNWRKLIKGL  953
                 SGW   T DG +V E  + +LV A+ + ++  E++E  K ++R Y  W   ++  
Sbjct  688  NEARSSGWEVVT-DGIIVKETNTGSLVKAYEEWKQLTEEQEAAKRKQRAYRWWMHFVQHR  746

Query  954  LIRERLKKRYDYG  966
            L   R++++Y  G
Sbjct  747  LAYLRIRQQYLEG  759



Lambda      K        H
   0.311    0.127    0.359 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8292602108


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jan 28, 2021  9:24 PM
  Number of letters in database: 17,197,330
  Number of sequences in database:  25,232



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= XP_031327348.1 eukaryotic initiation factor 4A-III [Photinus
pyralis]

Length=400
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

IF4A3_DROME  unnamed protein product                                  764     0.0  
IF4A_DROME  unnamed protein product                                   537     0.0  
Q8IKF0_PLAF7  unnamed protein product                                 523     0.0  


>IF4A3_DROME unnamed protein product
Length=399

 Score = 764 bits (1972),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/400 (92%), Positives = 384/400 (96%), Gaps = 1/400 (0%)

Query  1    MAKQRAGTLEDLSNVEFETSEGVDVIDKFKNMGLREELMRGIFAYGFEKPSAIQQRAIKP  60
            MA++ A   EDLSNVEFETSE V+VI  F  M L+EEL+RGI+AYGFEKPSAIQQR+I P
Sbjct  1    MARKNAQA-EDLSNVEFETSEDVEVIPTFNAMNLKEELLRGIYAYGFEKPSAIQQRSITP  59

Query  61   IMKGRDVIAQAQSGTGKTATFAISILQSLDLTMRETQVLCLSPTRELAVQIQKVILALGD  120
            I+KGRDVIAQAQSGTGKTATF+ISILQSLD T+RETQVLCLSPTRELAVQIQKVILALGD
Sbjct  60   IVKGRDVIAQAQSGTGKTATFSISILQSLDTTLRETQVLCLSPTRELAVQIQKVILALGD  119

Query  121  FMNVQCHACIGGTNLGEDIRKLDYGQHVVSGTPGRVYDMIRRRALRTRAVKMLVLDEADE  180
             MNVQCH CIGGTNLGEDIRKLDYGQH+VSGTPGRV+DMI+RR LRTRA+KMLVLDEADE
Sbjct  120  MMNVQCHVCIGGTNLGEDIRKLDYGQHIVSGTPGRVFDMIKRRVLRTRAIKMLVLDEADE  179

Query  181  MLNKGFKEQIYDVYRFLPPSTQVVLISATLPHEILEITSKFMTDPIRILVKRDELTLEGI  240
            MLNKGFKEQIYDVYR+LPP+TQVVLISATLPHEILE+TSKFMTDPIRILVKRDELTLEGI
Sbjct  180  MLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTSKFMTDPIRILVKRDELTLEGI  239

Query  241  KQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDM  300
            KQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDM
Sbjct  240  KQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDM  299

Query  301  PQKERDAIMKEFRSGQSRVLITTDVWARGIDVQQVSLVINYDLPNNRELYIHRIGRSGRF  360
            PQKERD IMKEFR+GQSRVLITTDVWARGIDVQQVSLVINYDLPNNRELYIHRIGRSGRF
Sbjct  300  PQKERDEIMKEFRAGQSRVLITTDVWARGIDVQQVSLVINYDLPNNRELYIHRIGRSGRF  359

Query  361  GRKGVAINFVKSDDIRILRDIEQYYSTQIDEMPMNVADLI  400
            GRKGVAINFVKSDDIRILRDIEQYYSTQIDEMPMNVADLI
Sbjct  360  GRKGVAINFVKSDDIRILRDIEQYYSTQIDEMPMNVADLI  399


>IF4A_DROME unnamed protein product
Length=403

 Score = 537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/377 (70%), Positives = 322/377 (85%), Gaps = 0/377 (0%)

Query  24   DVIDKFKNMGLREELMRGIFAYGFEKPSAIQQRAIKPIMKGRDVIAQAQSGTGKTATFAI  83
            +V D F +M LREEL+RGI+ YGFEKPSAIQQRAI P ++GRDVIAQAQSGTGKTATF+I
Sbjct  27   EVYDNFDDMNLREELLRGIYGYGFEKPSAIQQRAIIPCVRGRDVIAQAQSGTGKTATFSI  86

Query  84   SILQSLDLTMRETQVLCLSPTRELAVQIQKVILALGDFMNVQCHACIGGTNLGEDIRKLD  143
            +ILQ +D ++RE Q L L+PTRELA QIQ+V++ALG++M V  HACIGGTN+ ED R L+
Sbjct  87   AILQQIDTSIRECQALILAPTRELATQIQRVVMALGEYMKVHSHACIGGTNVREDARILE  146

Query  144  YGQHVVSGTPGRVYDMIRRRALRTRAVKMLVLDEADEMLNKGFKEQIYDVYRFLPPSTQV  203
             G HVV GTPGRVYDMI R+ LRT+ +K+ VLDEADEML++GFK+QI DV++ LPP  QV
Sbjct  147  SGCHVVVGTPGRVYDMINRKVLRTQYIKLFVLDEADEMLSRGFKDQIQDVFKMLPPDVQV  206

Query  204  VLISATLPHEILEITSKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDT  263
            +L+SAT+P ++LE++  FM DP+ ILVK++ELTLEGIKQF+V V++E WK  TLCDLYDT
Sbjct  207  ILLSATMPPDVLEVSRCFMRDPVSILVKKEELTLEGIKQFYVNVKQENWKLGTLCDLYDT  266

Query  264  LTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERDAIMKEFRSGQSRVLITT  323
            L+ITQ+VIFCNT+RKVD LT++M   NFTVS+MHGDM Q++R+ IMK+FRSG SRVLITT
Sbjct  267  LSITQSVIFCNTRRKVDQLTQEMSIHNFTVSAMHGDMEQRDREVIMKQFRSGSSRVLITT  326

Query  324  DVWARGIDVQQVSLVINYDLPNNRELYIHRIGRSGRFGRKGVAINFVKSDDIRILRDIEQ  383
            D+ ARGIDVQQVSLVINYDLP+NRE YIHRIGR GRFGRKGVAINF+  DD RIL+DIEQ
Sbjct  327  DLLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINFITDDDRRILKDIEQ  386

Query  384  YYSTQIDEMPMNVADLI  400
            +Y T I+EMP N+ADLI
Sbjct  387  FYHTTIEEMPANIADLI  403


>Q8IKF0_PLAF7 unnamed protein product
Length=398

 Score = 523 bits (1347),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/395 (64%), Positives = 314/395 (79%), Gaps = 5/395 (1%)

Query  8    TLEDLSNVEFETSEGVDVIDKFKNMGLREELMRGIFAYGFEKPSAIQQRAIKPIMKGRDV  67
            T  + +++E  T E   ++D F  +GL E+L+RGI++YGFEKPSAIQQR IKPI+ G D 
Sbjct  7    TFNNENDIEGNTEE---IVDTFDALGLNEKLLRGIYSYGFEKPSAIQQRGIKPILNGYDT  63

Query  68   IAQAQSGTGKTATFAISILQSLDLTMRETQVLCLSPTRELAVQIQKVILALGDFMNVQCH  127
            I QAQSGTGKTATF IS LQ ++      Q L L+PTRELA QIQKV+LALGD++ V+CH
Sbjct  64   IGQAQSGTGKTATFVISSLQLINYDYVACQALILAPTRELAQQIQKVVLALGDYLKVKCH  123

Query  128  ACIGGTNLGEDIRKLDYGQHVVSGTPGRVYDMIRRRALRTRAVKMLVLDEADEMLNKGFK  187
            AC+GGT + EDI KL  G H+V GTPGRVYDMI +R L    +K+ +LDEADEML++GFK
Sbjct  124  ACVGGTVVREDIDKLKQGVHMVVGTPGRVYDMIDKRHLGVDRLKLFILDEADEMLSRGFK  183

Query  188  EQIYDVYRFLPPSTQVVLISATLPHEILEITSKFMTDPIRILVKRDELTLEGIKQFFVAV  247
             QIY+V++ L P  QV L SAT+P EILE+T++FM DP  ILVK+DELTLEGI+QF+VAV
Sbjct  184  AQIYEVFKKLVPDIQVALFSATMPQEILELTTRFMRDPKTILVKKDELTLEGIRQFYVAV  243

Query  248  EREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERDA  307
            E+EEWK DTLCDLY+TLTITQ++I+CNT++KVD LT++M    FTVS MHGDM QK+RD 
Sbjct  244  EKEEWKLDTLCDLYETLTITQSIIYCNTRKKVDILTQEMHNRLFTVSCMHGDMDQKDRDL  303

Query  308  IMKEFRSGQSRVLITTDVWARGIDVQQVSLVINYDLPNNRELYIHRIGRSGRFGRKGVAI  367
            IM+EFRSG +RVL+TTD+ ARGIDVQQVSLVINYDLP + + YIHRIGRSGRFGRKGVAI
Sbjct  304  IMREFRSGSTRVLVTTDLLARGIDVQQVSLVINYDLPASPDTYIHRIGRSGRFGRKGVAI  363

Query  368  NFVKS--DDIRILRDIEQYYSTQIDEMPMNVADLI  400
            NFV +   +   L+ IE YYSTQI+EMP+ VAD +
Sbjct  364  NFVTNDDKEKDKLKKIESYYSTQIEEMPLEVADYL  398



Lambda      K        H
   0.322    0.138    0.393 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4291651150


Query= XP_031327349.1 probable cardiolipin synthase (CMP-forming) [Photinus
pyralis]

Length=323
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CRLS1_DROME  unnamed protein product                                  253     9e-83
CRLS1_CAEEL  unnamed protein product                                  170     2e-51
C0H5B7_PLAF7  unnamed protein product                                 55.5    7e-09


>CRLS1_DROME unnamed protein product
Length=322

 Score = 253 bits (646),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 123/251 (49%), Positives = 176/251 (70%), Gaps = 11/251 (4%)

Query  80   RQKQIKLKATEQRIKVCGETLRKDFV-----DTKNKVKEKVEEVI-----ERENIYTIPN  129
            +++ + L+  + R  + G   RK+F+     + ++KV+E+V E I     ERENI TIPN
Sbjct  71   KKQSLHLRTLQGRHLLQGVIERKNFLVDDIREARHKVQERVREKIDEIREERENIMTIPN  130

Query  130  FLCVSRILLSPYLGLLIVQAEFHFALALLGVAAVTDLLDGWIARTWASQSSIMGSFLDPM  189
             L +SR +LSPY+G +IVQ +F   ++LL  A +TDLLDG IAR W SQ+S  GSFLDPM
Sbjct  131  MLTISRAVLSPYIGYVIVQGDFTLGMSLLAFAGITDLLDGQIARRWPSQASKFGSFLDPM  190

Query  190  ADKVLIATLFLSLTYADLIPVSLTGLILLRDVLLVAAALALRYKSLSSPRTMGKLFDISH  249
            ADK+L+ +L +SL Y DL+P+ L G+++ RDV L+ A   +RY SL  P+T  + FD +H
Sbjct  191  ADKLLMGSLVISLCYTDLLPMWLMGIVVFRDVFLLGAGFVIRYISLPPPKTFSRYFDATH  250

Query  250  ATVQIKPTFISKINTGVQLALVGSTLAAPVFHYVGHPLLQSLWYITAATTIAGGLSYILS  309
             T Q++PT +SKINTGVQLA +G +L AP+++Y+ HP LQ LWY+T  TT A  LSY+++
Sbjct  251  VTAQLEPTLLSKINTGVQLATIGLSLGAPIWNYLDHPALQGLWYLTGLTTAATALSYVMN  310

Query  310  K-NTYKIIKKK  319
            + NT+KII+KK
Sbjct  311  RHNTFKIIQKK  321


>CRLS1_CAEEL unnamed protein product
Length=246

 Score = 170 bits (431),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/220 (40%), Positives = 136/220 (62%), Gaps = 6/220 (3%)

Query  102  KDFVDTKNKVKEKVEEVIEREN----IYTIPNFLCVSRILLSPYLGLLIVQAEFHFALAL  157
            ++F   + K   K+E +   E     + TIPN +C +RI  +P +G L+VQ  F  A  L
Sbjct  27   RNFSSLEQKQSPKIESLPPEERGKYKVATIPNAICTARIAATPLIGYLVVQHNFTPAFVL  86

Query  158  LGVAAVTDLLDGWIARTWASQSSIMGSFLDPMADKVLIATLFLSLTYADLIPVSLTGLIL  217
              VA  TDLLDG+IAR    Q S++GS LDP+ADK+LI+T+F+++TYA LIP+ LT +++
Sbjct  87   FTVAGATDLLDGFIARNVPGQKSLLGSVLDPVADKLLISTMFITMTYAGLIPLPLTSVVI  146

Query  218  LRDVLLVAAALALRYKSLSSPRTMGKLFDISHATVQIKPTFISKINTGVQLALVGSTLAA  277
            LRD+ L+      RY+ +S P ++ + F+   +++Q+ PT +SKINT +Q+ LV  +L++
Sbjct  147  LRDICLIGGGFYKRYQVMSPPYSLSRFFNPQVSSMQVVPTMMSKINTVLQITLVALSLSS  206

Query  278  PVFHYV--GHPLLQSLWYITAATTIAGGLSYILSKNTYKI  315
            PVF +    + ++  L  IT  TTI  GL Y   K   KI
Sbjct  207  PVFDFSTGANDVIVGLGCITGFTTIYSGLQYASGKAIKKI  246


>C0H5B7_PLAF7 unnamed protein product
Length=209

 Score = 55.5 bits (132),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 62/106 (58%), Gaps = 7/106 (7%)

Query  119  IERENIYT-IPNFLCVSRILLSPYLGLLIVQAEFHFALALLGVAAVTDLLDGWIARTWAS  177
            ++++N+Y  IPN +   R++L+  LG +I +      +    V+ V D LDGW AR + +
Sbjct  3    MKKKNVYLYIPNIIGYIRVILAL-LGFIISRKNLFLFVCFYSVSQVLDALDGWTARKF-N  60

Query  178  QSSIMGSFLDPMADKVLIATLFL--SLTYADLIPVSLTGLILLRDV  221
            Q+S+ G  LD + D++  + L+L  S  Y + I  +L GLI++ D+
Sbjct  61   QTSVFGQILDQITDRLSTSLLYLLNSSVYEEYI--TLIGLIMIADI  104



Lambda      K        H
   0.322    0.138    0.393 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4291651150


Query= XP_031327350.1 uncharacterized protein LOC116158665 [Photinus
pyralis]

Length=347
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

UNC4_CAEEL  unnamed protein product                                   31.2    1.1  
Q8MRR2_DROME  unnamed protein product                                 30.0    2.8  
Q7JNE1_DROME  unnamed protein product                                 29.6    4.0  


>UNC4_CAEEL unnamed protein product
Length=252

 Score = 31.2 bits (69),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 52/112 (46%), Gaps = 20/112 (18%)

Query  132  PDGNELLMNPNACEVVEEEFEEVETASKKKRKTTQAIKKTKTTPQQYEMYINFKKYKYDN  191
            PD + LLMN +    +E++ +  E+A+K++R  T                 NF  ++ + 
Sbjct  60   PDDDNLLMNEDDGIALEDDNDTGESAAKRRRTRT-----------------NFSGWQLEE  102

Query  192  EENAFKAL-CEELNGKKKLQRSVENWKRVFTVWESKVKAKARRNYLEQERTG  242
             E+AF+A    ++  ++ L   ++  +    VW    +AK R+   EQ R G
Sbjct  103  LESAFEASHYPDVFMREALAMRLDLLESRVQVWFQNRRAKWRKR--EQNRNG  152


>Q8MRR2_DROME unnamed protein product
Length=319

 Score = 30.0 bits (66),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 20/39 (51%), Gaps = 0/39 (0%)

Query  67   HIKSKIRASKQLNPTENRCAEVTGLFISCSGISGVQEMG  105
            HI+ K  +S QL P  N C+ VT   IS  G S    +G
Sbjct  157  HIRYKSLSSLQLTPDNNNCSSVTPPTISAHGKSSGAGVG  195


>Q7JNE1_DROME unnamed protein product
Length=346

 Score = 29.6 bits (65),  Expect = 4.0, Method: Compositional matrix adjust.
 Identities = 20/86 (23%), Positives = 38/86 (44%), Gaps = 14/86 (16%)

Query  169  KKTKTTPQQYEMYINF-------------KKYKYDNEENAFKALCEELNG-KKKLQRSVE  214
            +K +T+ +QY+MYI+              + Y  +     +K L + LN        + E
Sbjct  8    RKKRTSSEQYQMYIDMMESDPIFATGRVPRDYDLNYLTKKWKELSDRLNKCSSGPTLTPE  67

Query  215  NWKRVFTVWESKVKAKARRNYLEQER  240
             W++    W++  + K RR+ L  E+
Sbjct  68   EWRKRLNDWKNTTRCKYRRSLLSTEK  93



Lambda      K        H
   0.322    0.138    0.393 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4291651150


Query= XP_031327351.1 complex I intermediate-associated protein 30,
mitochondrial [Photinus pyralis]

Length=297
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CIA30_DROME  unnamed protein product                                  367     2e-128
CIA30_CAEEL  unnamed protein product                                  188     1e-57 
Q9N4P3_CAEEL  unnamed protein product                                 30.8    1.3   


>CIA30_DROME unnamed protein product
Length=296

 Score = 367 bits (942),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 174/300 (58%), Positives = 225/300 (75%), Gaps = 8/300 (3%)

Query  2    MNLILTKTLK--CCKLKLNNIQKLELNISAPLNAFWERDEKGGYADNRKLPPRTQMIRDG  59
            MN +L + L+  CC   L  +Q+ +++ +A    FWER++K GY      P + QMI DG
Sbjct  1    MNSLLRQGLRLGCC---LPAVQQ-QIHTTAVHRTFWEREKKSGYKTKLPEPSKKQMIMDG  56

Query  60   FKELKHEIALWSQEMKEKFECDPILDYRAGETDIVWNFESPNALQQWVITSDSDHNEGHS  119
             ++LK E+ LW QE+KE+FE DPIL +R GETD+V++F++P+ L +W +T+D+DH EG S
Sbjct  57   LRDLKEEMKLWRQEVKEQFESDPILVFRPGETDVVFDFKAPDVLDKWTVTTDADHGEGKS  116

Query  120  KCDLVVNKYGKGLFTGFLNTDVPDDGRIKRAGYCNMRTLRARKSFKRDSYLEWAPYNLLV  179
               L ++  G GLF G +N+D   DG IKR GY N+RT R RKSFKR++  +W  YN+LV
Sbjct  117  TATLELSAAGAGLFHGQVNSDHTKDGIIKRTGYANIRTKRVRKSFKRETTYDWTQYNMLV  176

Query  180  MKVRGDGRSYMLNITTKGRFDLTWNDTYHYVLYTRGGPYWQVSKIPFSKFFFTSKGRIQD  239
            MKVRGDGRSY++N+ T+G FDL WND YHYVLYTRGGP+WQ++KIPFSKFF +SKGR+QD
Sbjct  177  MKVRGDGRSYLINLHTEGYFDLMWNDIYHYVLYTRGGPHWQIAKIPFSKFFLSSKGRVQD  236

Query  240  RQYAIPLNRVTHFGISVGDK--IKGGFSLEIDYIGLEYNPNHTEEFAYEMYQTEKFIVAT  297
            RQ AIPLNRVTHFG SV  K  + G F LEIDY+GLEY+P+H EEFAYEMYQT K+IVAT
Sbjct  237  RQGAIPLNRVTHFGFSVAAKKGMDGPFGLEIDYVGLEYDPSHREEFAYEMYQTPKYIVAT  296


>CIA30_CAEEL unnamed protein product
Length=340

 Score = 188 bits (478),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/208 (46%), Positives = 130/208 (63%), Gaps = 2/208 (1%)

Query  87   RAGETDIVWNFESPNALQQWVITSDSDHNEGHSKCDLVVNKYGKGLFTGFLNTDVPDDGR  146
            R  E  + + F++   L  W I  DSD  EG S C LV +  G  +F+G ++T V  DGR
Sbjct  129  RHNEARVDYRFDTQEKLDLWKIGCDSDWKEGFSTCSLVNSDRGTAVFSGNISTKVLKDGR  188

Query  147  IKRAGYCNMRTLRARKSFKRDSYL-EWAPYNLLVMKVRGDGRSYMLNITTKGRFDLTWND  205
            ++RAG+ +M+ L  RK+F R  +L +W  ++ L++KVRGDGRSY + + +    D TW D
Sbjct  189  VERAGWASMK-LEDRKAFNRKKFLSKWRNFSHLLLKVRGDGRSYKIMLHSPLSMDFTWGD  247

Query  206  TYHYVLYTRGGPYWQVSKIPFSKFFFTSKGRIQDRQYAIPLNRVTHFGISVGDKIKGGFS  265
            ++ + L+T GGPYWQ  KIPFSKFF T  GRIQDRQY + L   +  GI + D+I G F 
Sbjct  248  SFSHPLHTHGGPYWQYEKIPFSKFFHTVAGRIQDRQYRVNLEDTSSIGIVLMDRIDGDFR  307

Query  266  LEIDYIGLEYNPNHTEEFAYEMYQTEKF  293
            LEIDYIG+  +  H E+FAYE Y    F
Sbjct  308  LEIDYIGVYNDTTHVEDFAYETYTLPVF  335


>Q9N4P3_CAEEL unnamed protein product
Length=558

 Score = 30.8 bits (68),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 53/121 (44%), Gaps = 19/121 (16%)

Query  113  DHNEGHSKCDLVVNKYGKGL-----FTGFLNTDVPDDGRIKRAGYCNMR-TLRARKSFKR  166
            DHN  + + D+VVNK  K       FT ++  D   + R+KR   C  R  L   +SF  
Sbjct  206  DHNVTNKQTDIVVNKSEKTKIPDDNFTDYIRHDNYVEDRLKRQNTCGSRKELHHMESFGD  265

Query  167  DSYLEWAP-----YNLLVMKVRGDGRSYMLNITTKGRFDLTWNDTYHYVLYTRGGPYWQV  221
             S  ++       ++LL+M+     R+   ++       +    + H+V   RG P  Q+
Sbjct  266  HSTSQYGSQASLNHDLLMMR-----RAQSFDVAAVTGPSVIQPQSPHHV---RGLPMRQL  317

Query  222  S  222
            S
Sbjct  318  S  318



Lambda      K        H
   0.322    0.138    0.393 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4291651150


Query= XP_031327352.1 ubiquinone biosynthesis O-methyltransferase,
mitochondrial-like [Photinus pyralis]

Length=256
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

E1JHN2_DROME  unnamed protein product                                 208     2e-66
Q5BIB9_DROME  unnamed protein product                                 207     2e-66
Q9VIF3_DROME  unnamed protein product                                 196     2e-61


>E1JHN2_DROME unnamed protein product
Length=289

 Score = 208 bits (529),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/232 (47%), Positives = 143/232 (62%), Gaps = 2/232 (1%)

Query  25   ERWNVTGRQILLHNLNNLRVPFIVGSLITTHKVKTTLINTTKVLEGTVILDVSCGGGILT  84
            E WN  G    LH LN +RVPFI   +++   VK   +NTTKVL G  IL+V CGGG+LT
Sbjct  51   EWWNQNGTMGALHALNEIRVPFIRDGIVSRGTVKPGYVNTTKVLLGQNILEVGCGGGLLT  110

Query  85   ESLAKLGGRVHGIDPSSDVISAAKRHAQLDKS--LSNLEYFTSTVEDYAEKNVEIYDAVI  142
            E LA+LG +V GID    +I AA+ H +       SN+ Y    V+ +A+ N E YDAVI
Sbjct  111  EHLARLGAQVAGIDLGEKLIEAAREHLKCSSPELASNVVYKIEPVDQHAKANCECYDAVI  170

Query  143  ASDVLECVVEKEAFLEACLRCLKPEGSLIITTFNKTWMSWIQNVIIGQGILNIIPRGTRK  202
             S+VLE V +K + LEA +R LKP GS+ ITT NKT  SW   V++ + +LN++PRGT  
Sbjct  171  VSEVLEHVKDKVSLLEASVRSLKPGGSIFITTLNKTIPSWFGGVLLSEYVLNLVPRGTHH  230

Query  203  WDQLIRPEDTQEILNKHNCRTVEIRGINLNWMKKKWSWTLNNNHIYALHAIK  254
            WD++I P D Q IL+  NC+TV + G   ++    W W  NN   YAL A+K
Sbjct  231  WDKMISPLDVQRILDTMNCQTVLVNGSTYDFWSNTWRWINNNQMCYALQAVK  282


>Q5BIB9_DROME unnamed protein product
Length=297

 Score = 207 bits (528),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/232 (47%), Positives = 143/232 (62%), Gaps = 2/232 (1%)

Query  25   ERWNVTGRQILLHNLNNLRVPFIVGSLITTHKVKTTLINTTKVLEGTVILDVSCGGGILT  84
            E WN  G    LH LN +RVPFI   +++   VK   +NTTKVL G  IL+V CGGG+LT
Sbjct  59   EWWNQNGTMGALHALNEIRVPFIRDGIVSRGTVKPGYVNTTKVLLGQNILEVGCGGGLLT  118

Query  85   ESLAKLGGRVHGIDPSSDVISAAKRHAQLDKS--LSNLEYFTSTVEDYAEKNVEIYDAVI  142
            E LA+LG +V GID    +I AA+ H +       SN+ Y    V+ +A+ N E YDAVI
Sbjct  119  EHLARLGAQVAGIDLGEKLIEAAREHLKCSSPELASNVVYKIEPVDQHAKANCECYDAVI  178

Query  143  ASDVLECVVEKEAFLEACLRCLKPEGSLIITTFNKTWMSWIQNVIIGQGILNIIPRGTRK  202
             S+VLE V +K + LEA +R LKP GS+ ITT NKT  SW   V++ + +LN++PRGT  
Sbjct  179  VSEVLEHVKDKVSLLEASVRSLKPGGSIFITTLNKTIPSWFGGVLLSEYVLNLVPRGTHH  238

Query  203  WDQLIRPEDTQEILNKHNCRTVEIRGINLNWMKKKWSWTLNNNHIYALHAIK  254
            WD++I P D Q IL+  NC+TV + G   ++    W W  NN   YAL A+K
Sbjct  239  WDKMISPLDVQRILDTMNCQTVLVNGSTYDFWSNTWRWINNNQMCYALQAVK  290


>Q9VIF3_DROME unnamed protein product
Length=310

 Score = 196 bits (497),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 108/253 (43%), Positives = 143/253 (57%), Gaps = 23/253 (9%)

Query  25   ERWNVTGRQILLHNLNNLRVPFIVGSLITTHKVKTTLINTTKVLEGTVILDVSCGGGILT  84
            E WN  G    LH LN +RVPFI   +++   VK   +NTTKVL G  IL+V CGGG+LT
Sbjct  51   EWWNQNGTMGALHALNEIRVPFIRDGIVSRGTVKPGYVNTTKVLLGQNILEVGCGGGLLT  110

Query  85   ESLAKLGGRVHGIDPSSDVISAAKRHAQLDKS--LSNLEYFTSTVEDYAEKNVEIYDAVI  142
            E LA+LG +V GID    +I AA+ H +       SN+ Y    V+ +A+ N E YDAVI
Sbjct  111  EHLARLGAQVAGIDLGEKLIEAAREHLKCSSPELASNVVYKIEPVDQHAKANCECYDAVI  170

Query  143  ASDVLECVVEKEAFLEACLRCLKPEGSLIITTFNKTWMSWIQNVIIGQGILNIIPRGTRK  202
             S+VLE V +K + LEA +R LKP GS+ ITT NKT  SW   V++ + +LN++PRGT  
Sbjct  171  VSEVLEHVKDKVSLLEASVRSLKPGGSIFITTLNKTIPSWFGGVLLSEYVLNLVPRGTHH  230

Query  203  WDQLIRPEDTQEILNKH---------------------NCRTVEIRGINLNWMKKKWSWT  241
            WD++I P D Q IL+                       NC+TV + G   ++    W W 
Sbjct  231  WDKMISPLDVQRILDTSKFISGFIFRLGYSLFSRSSAVNCQTVLVNGSTYDFWSNTWRWI  290

Query  242  LNNNHIYALHAIK  254
             NN   YAL A+K
Sbjct  291  NNNQMCYALQAVK  303



Lambda      K        H
   0.322    0.138    0.393 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4291651150


Query= XP_031327353.1 ubiquinone biosynthesis O-methyltransferase,
mitochondrial-like [Photinus pyralis]

Length=256
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

E1JHN2_DROME  unnamed protein product                                 208     2e-66
Q5BIB9_DROME  unnamed protein product                                 207     2e-66
Q9VIF3_DROME  unnamed protein product                                 196     2e-61


>E1JHN2_DROME unnamed protein product
Length=289

 Score = 208 bits (529),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/232 (47%), Positives = 143/232 (62%), Gaps = 2/232 (1%)

Query  25   ERWNVTGRQILLHNLNNLRVPFIVGSLITTHKVKTTLINTTKVLEGTVILDVSCGGGILT  84
            E WN  G    LH LN +RVPFI   +++   VK   +NTTKVL G  IL+V CGGG+LT
Sbjct  51   EWWNQNGTMGALHALNEIRVPFIRDGIVSRGTVKPGYVNTTKVLLGQNILEVGCGGGLLT  110

Query  85   ESLAKLGGRVHGIDPSSDVISAAKRHAQLDKS--LSNLEYFTSTVEDYAEKNVEIYDAVI  142
            E LA+LG +V GID    +I AA+ H +       SN+ Y    V+ +A+ N E YDAVI
Sbjct  111  EHLARLGAQVAGIDLGEKLIEAAREHLKCSSPELASNVVYKIEPVDQHAKANCECYDAVI  170

Query  143  ASDVLECVVEKEAFLEACLRCLKPEGSLIITTFNKTWMSWIQNVIIGQGILNIIPRGTRK  202
             S+VLE V +K + LEA +R LKP GS+ ITT NKT  SW   V++ + +LN++PRGT  
Sbjct  171  VSEVLEHVKDKVSLLEASVRSLKPGGSIFITTLNKTIPSWFGGVLLSEYVLNLVPRGTHH  230

Query  203  WDQLIRPEDTQEILNKHNCRTVEIRGINLNWMKKKWSWTLNNNHIYALHAIK  254
            WD++I P D Q IL+  NC+TV + G   ++    W W  NN   YAL A+K
Sbjct  231  WDKMISPLDVQRILDTMNCQTVLVNGSTYDFWSNTWRWINNNQMCYALQAVK  282


>Q5BIB9_DROME unnamed protein product
Length=297

 Score = 207 bits (528),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/232 (47%), Positives = 143/232 (62%), Gaps = 2/232 (1%)

Query  25   ERWNVTGRQILLHNLNNLRVPFIVGSLITTHKVKTTLINTTKVLEGTVILDVSCGGGILT  84
            E WN  G    LH LN +RVPFI   +++   VK   +NTTKVL G  IL+V CGGG+LT
Sbjct  59   EWWNQNGTMGALHALNEIRVPFIRDGIVSRGTVKPGYVNTTKVLLGQNILEVGCGGGLLT  118

Query  85   ESLAKLGGRVHGIDPSSDVISAAKRHAQLDKS--LSNLEYFTSTVEDYAEKNVEIYDAVI  142
            E LA+LG +V GID    +I AA+ H +       SN+ Y    V+ +A+ N E YDAVI
Sbjct  119  EHLARLGAQVAGIDLGEKLIEAAREHLKCSSPELASNVVYKIEPVDQHAKANCECYDAVI  178

Query  143  ASDVLECVVEKEAFLEACLRCLKPEGSLIITTFNKTWMSWIQNVIIGQGILNIIPRGTRK  202
             S+VLE V +K + LEA +R LKP GS+ ITT NKT  SW   V++ + +LN++PRGT  
Sbjct  179  VSEVLEHVKDKVSLLEASVRSLKPGGSIFITTLNKTIPSWFGGVLLSEYVLNLVPRGTHH  238

Query  203  WDQLIRPEDTQEILNKHNCRTVEIRGINLNWMKKKWSWTLNNNHIYALHAIK  254
            WD++I P D Q IL+  NC+TV + G   ++    W W  NN   YAL A+K
Sbjct  239  WDKMISPLDVQRILDTMNCQTVLVNGSTYDFWSNTWRWINNNQMCYALQAVK  290


>Q9VIF3_DROME unnamed protein product
Length=310

 Score = 196 bits (497),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 108/253 (43%), Positives = 143/253 (57%), Gaps = 23/253 (9%)

Query  25   ERWNVTGRQILLHNLNNLRVPFIVGSLITTHKVKTTLINTTKVLEGTVILDVSCGGGILT  84
            E WN  G    LH LN +RVPFI   +++   VK   +NTTKVL G  IL+V CGGG+LT
Sbjct  51   EWWNQNGTMGALHALNEIRVPFIRDGIVSRGTVKPGYVNTTKVLLGQNILEVGCGGGLLT  110

Query  85   ESLAKLGGRVHGIDPSSDVISAAKRHAQLDKS--LSNLEYFTSTVEDYAEKNVEIYDAVI  142
            E LA+LG +V GID    +I AA+ H +       SN+ Y    V+ +A+ N E YDAVI
Sbjct  111  EHLARLGAQVAGIDLGEKLIEAAREHLKCSSPELASNVVYKIEPVDQHAKANCECYDAVI  170

Query  143  ASDVLECVVEKEAFLEACLRCLKPEGSLIITTFNKTWMSWIQNVIIGQGILNIIPRGTRK  202
             S+VLE V +K + LEA +R LKP GS+ ITT NKT  SW   V++ + +LN++PRGT  
Sbjct  171  VSEVLEHVKDKVSLLEASVRSLKPGGSIFITTLNKTIPSWFGGVLLSEYVLNLVPRGTHH  230

Query  203  WDQLIRPEDTQEILNKH---------------------NCRTVEIRGINLNWMKKKWSWT  241
            WD++I P D Q IL+                       NC+TV + G   ++    W W 
Sbjct  231  WDKMISPLDVQRILDTSKFISGFIFRLGYSLFSRSSAVNCQTVLVNGSTYDFWSNTWRWI  290

Query  242  LNNNHIYALHAIK  254
             NN   YAL A+K
Sbjct  291  NNNQMCYALQAVK  303



Lambda      K        H
   0.322    0.138    0.393 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4291651150


Query= XP_031327354.1 uncharacterized protein LOC116158670 [Photinus
pyralis]

Length=111
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CED3_CAEEL  unnamed protein product                                   27.7    2.1  
A1Z7M3_DROME  unnamed protein product                                 26.9    3.7  
Q2EEN1_CAEEL  unnamed protein product                                 26.9    4.3  


>CED3_CAEEL unnamed protein product
Length=503

 Score = 27.7 bits (60),  Expect = 2.1, Method: Composition-based stats.
 Identities = 16/61 (26%), Positives = 27/61 (44%), Gaps = 13/61 (21%)

Query  28   YRCYATDKDPQATLNCRHF-------------DNITKSERCIGYCMFTYGSFTENGVLLG  74
            YR +++ +     +N  HF             DN+T   RC+GY +    + T  G+LL 
Sbjct  235  YRNFSSPRGMCLIINNEHFEQMPTRNGTKADKDNLTNLFRCMGYTVICKDNLTGRGMLLT  294

Query  75   V  75
            +
Sbjct  295  I  295


>A1Z7M3_DROME unnamed protein product
Length=1041

 Score = 26.9 bits (58),  Expect = 3.7, Method: Composition-based stats.
 Identities = 13/37 (35%), Positives = 16/37 (43%), Gaps = 0/37 (0%)

Query  38   QATLNCRHFDNITKSERCIGYCMFTYGSFTENGVLLG  74
            Q+  N RH   I +     G CMF      +NG  LG
Sbjct  76   QSGRNIRHLPCIVRKSGRSGICMFAIDCIKQNGTHLG  112


>Q2EEN1_CAEEL unnamed protein product
Length=1129

 Score = 26.9 bits (58),  Expect = 4.3, Method: Composition-based stats.
 Identities = 12/47 (26%), Positives = 21/47 (45%), Gaps = 0/47 (0%)

Query  43   CRHFDNITKSERCIGYCMFTYGSFTENGVLLGVAQRYCSVFNCEHHQ  89
            C+ +    +SE  +GYC   YG      V    + ++ S +  E H+
Sbjct  866  CQTYKGKRESENLVGYCRLVYGKVPREIVDGHFSDQFVSAYYFELHE  912



Lambda      K        H
   0.322    0.138    0.393 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4291651150


Query= XP_031327355.1 uncharacterized protein LOC116158671 [Photinus
pyralis]

Length=110
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

G5EGD8_CAEEL  unnamed protein product                                 28.9    1.0  
G5EE70_CAEEL  unnamed protein product                                 28.9    1.0  
Q8T307_TRYBB  unnamed protein product                                 27.7    2.3  


>G5EGD8_CAEEL unnamed protein product
Length=957

 Score = 28.9 bits (63),  Expect = 1.0, Method: Composition-based stats.
 Identities = 15/59 (25%), Positives = 28/59 (47%), Gaps = 2/59 (3%)

Query  20   VRSANDCYRCY--ANDKDPQATLNCRHFDNITKSERCVGYCMFTYGTFTENGVLLGVAQ  76
            +R+    Y  +   N K PQA+L    F+++T +E      +F+    T +G  +  +Q
Sbjct  70   LRAMQSMYNTFNNGNQKQPQASLTMSQFNSMTGNEPSTSSNVFSASIPTTSGTQINASQ  128


>G5EE70_CAEEL unnamed protein product
Length=972

 Score = 28.9 bits (63),  Expect = 1.0, Method: Composition-based stats.
 Identities = 15/59 (25%), Positives = 28/59 (47%), Gaps = 2/59 (3%)

Query  20   VRSANDCYRCY--ANDKDPQATLNCRHFDNITKSERCVGYCMFTYGTFTENGVLLGVAQ  76
            +R+    Y  +   N K PQA+L    F+++T +E      +F+    T +G  +  +Q
Sbjct  70   LRAMQSMYNTFNNGNQKQPQASLTMSQFNSMTGNEPSTSSNVFSASIPTTSGTQINASQ  128


>Q8T307_TRYBB unnamed protein product
Length=1596

 Score = 27.7 bits (60),  Expect = 2.3, Method: Composition-based stats.
 Identities = 16/38 (42%), Positives = 17/38 (45%), Gaps = 9/38 (24%)

Query  13   MCLAVTSVRSANDC---------YRCYANDKDPQATLN  41
            MCLA T VR A +          Y C  N  DP  TLN
Sbjct  777  MCLAETPVREAANTLEKLNQLLEYSCRNNGPDPLITLN  814



Lambda      K        H
   0.322    0.138    0.393 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4291651150


Query= XP_031327356.1 angiotensin-converting enzyme-like [Photinus pyralis]

Length=595
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ACE_DROME  unnamed protein product                                    321     1e-101
ACER_DROME  unnamed protein product                                   315     4e-99 
ACN1_CAEEL  unnamed protein product                                   182     1e-48 


>ACE_DROME unnamed protein product
Length=615

 Score = 321 bits (822),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 173/597 (29%), Positives = 308/597 (52%), Gaps = 28/597 (5%)

Query  9    WLREVNMDLSDFNSVAASLTWKLATAPDETTSNRAMELGVVRNKWKNKVCDSRVRKYWLA  68
            +L  +N +L+   +V     W   +   +    +  E+     K+  +V     +  W +
Sbjct  28   YLENLNKELAKRTNVETEAAWAYGSNITDENEKKKNEISAELAKFMKEVASDTTKFQWRS  87

Query  69   ---PNASRMMYLLCR--GPRFSEELSRSYMDIMGRLAQNYNS-EICFNRSDSEMLRALNI  122
                +  R    L +       E+     +D +  +  N+   ++C  +  ++   AL+ 
Sbjct  88   YQSEDLKRQFKALTKLGYAALPEDDYAELLDTLSAMESNFAKVKVCDYKDSTKCDLALD-  146

Query  123  SGQCVYGEPDLEWLIKRTDLSAEQLKWIWTTWHNFVGPKIGSLYPVAVKLQNMAAQGNGY  182
                    P++E +I ++    E+L + W  +++  G  + S +   V+L   AA+ N +
Sbjct  147  --------PEIEEVISKS-RDHEELAYYWREFYDKAGTAVRSQFERYVELNTKAAKLNNF  197

Query  183  NSMAEVWQEELEISNLESKVFKLYDQIKPLYMLLHAVVRHKLFQKYGSTIVDPKGPIPIH  242
             S AE W +E E    E ++  ++  I+PLY  +H  VR +L + YG  +V   GPIP+H
Sbjct  198  TSGAEAWLDEYEDDTFEQQLEDIFADIRPLYQQIHGYVRFRLRKHYGDAVVSETGPIPMH  257

Query  243  LLGNMWGQDWSQLINLFDFGTMK--VNLETNLMQKNWTVIDMVLRAEDMYTSLGLPKMTE  300
            LLGNMW Q WS++ ++      K  V++   + ++ +T + M    +D +TS+ L K+ +
Sbjct  258  LLGNMWAQQWSEIADIVSPFPEKPLVDVSAEMEKQGYTPLKMFQMGDDFFTSMNLTKLPQ  317

Query  301  KFWKYSKFQENSNMS--VCHGTAANLYERDDFRMLLCAKVTMEDFYIVDHEMGHIEYYMA  358
             FW  S  ++ ++    VCH +A + Y  DD R+  C +VT +  + V HE+GHI+Y++ 
Sbjct  318  DFWDKSIIEKPTDGRDLVCHASAWDFYLTDDVRIKQCTRVTQDQLFTVHHELGHIQYFLQ  377

Query  359  YQNQPAIFQDGSSSAFHESIGDAIMNGVMVPQHLYRLGLITDDQLFNTGLGDFLLLQQAL  418
            YQ+QP +++ G++  FHE++GD +   V  P+HL ++GL+ D    +    + L L  AL
Sbjct  378  YQHQPFVYRTGANPGFHEAVGDVLSLSVSTPKHLEKIGLLKDYVRDDEARINQLFL-TAL  436

Query  419  SKIPELPYSLIIDKYRWDIFKGRIVQENYNKEFWDLNYKIRGVSPPETRGEKYFDAGAKF  478
             KI  LP++  +DKYRW +F+G + + N+N  FW L  +  G+ PP  R EK FDA AK+
Sbjct  437  DKIVFLPFAFTMDKYRWSLFRGEVDKANWNCAFWKLRDEYSGIEPPVVRSEKDFDAPAKY  496

Query  479  HVPDNTPYIRYFLAGFLQVDMFNSLCKLAVCGKNGDGNMSNYCPYIPLHLCDIYGSKKSG  538
            H+  +  Y+RY ++  +Q   + S C  A  G+    N+      +PL  CDIYGS  +G
Sbjct  497  HISADVEYLRYLVSFIIQFQFYKSACIKA--GQYDPDNVE-----LPLDNCDIYGSAAAG  549

Query  539  KKLEEMMSFGSSQPWTETLQILTGKTYITADPLLQYYQPMYKWLNNYINLHKIPVGW  595
                 M+S G+S+PW + L+   G+  ++   + +Y++P+  WL      + + +GW
Sbjct  550  AAFHNMLSMGASKPWPDALEAFNGERIMSGKAIAEYFEPLRVWLEAENIKNNVHIGW  606


>ACER_DROME unnamed protein product
Length=630

 Score = 315 bits (806),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 169/498 (34%), Positives = 272/498 (55%), Gaps = 12/498 (2%)

Query  101  QNYNSEICFNRSDSEMLRALNISGQCVYGEPDLEWLIKRTDLSAEQLKWIWTTWHNFVGP  160
            QN  S +  N + + +    N S   +  EP ++  +  +   AE L W W  WH+  G 
Sbjct  126  QNAISSMQTNYATATVCSYTNRSDCSLTLEPHIQERLSHSRDPAE-LAWYWREWHDKSGT  184

Query  161  KIGSLYPVAVKLQNMAAQGNGYNSMAEVWQEELEISNLESKVFKLYDQIKPLYMLLHAVV  220
             +   +   V+L   A+Q NG+ S A+ W +  E  + E ++   + Q+ P Y  LH  V
Sbjct  185  PMRQNFAEYVRLTRKASQLNGHRSYADYWVQFYEDPDFERQLDATFKQLLPFYRQLHGYV  244

Query  221  RHKLFQKYGSTIVDPKGPIPIHLLGNMWGQDWSQLINLFDFGTMK--VNLETNLMQKNWT  278
            R +L Q YG  ++  +G IPI LLGNMWGQ W++L++LF     K  V+++  + ++ +T
Sbjct  245  RFRLRQHYGPDVMPAEGNIPISLLGNMWGQSWNELLDLFTPYPEKPFVDVKAEMEKQGYT  304

Query  279  VIDMVLRAEDMYTSLGLPKMTEKFWKYSKF-QENSNMSVCHGTAANLYERDDFRMLLCAK  337
            V  +    +  + SLG+  +   FW  S   + +    VCH +A + Y+  D R+ +C +
Sbjct  305  VQKLFELGDQFFQSLGMRALPPSFWNLSVLTRPDDRHVVCHASAWDFYQDSDVRIKMCTE  364

Query  338  VTMEDFYIVDHEMGHIEYYMAYQNQPAIFQDGSSSAFHESIGDAIMNGVMVPQHLYRLGL  397
            V    FY+V HE+GHI+YY+ Y+ QPA+++   +  FHE++GD I   VM  +HL  +GL
Sbjct  365  VDSHYFYVVHHELGHIQYYLQYEQQPAVYRGAPNPGFHEAVGDVIALSVMSAKHLKAIGL  424

Query  398  ITDDQLFNTGLGDFLLLQQALSKIPELPYSLIIDKYRWDIFKGRIVQENYNKEFWDLNYK  457
            I + +L      +  L +QALSKI  LP+   +DKYR+ +F+  + +  +N  FW +  +
Sbjct  425  IENGRLDEKSRIN-QLFKQALSKIVFLPFGYAVDKYRYAVFRNELDESQWNCGFWQMRSE  483

Query  458  IRGVSPPETRGEKYFDAGAKFHVPDNTPYIRYFLAGFLQVDMFNSLCKLAVCGKNGDGNM  517
              GV PP  R EK FD  AK+H+  +  Y+RYF A   Q     +LC+ A  G+    N 
Sbjct  484  FGGVEPPVFRTEKDFDPPAKYHIDADVEYLRYFAAHIFQFQFHKALCRKA--GQYAPNNS  541

Query  518  SNYCPYIPLHLCDIYGSKKSGKKLEEMMSFGSSQPWTETLQILTGKTYITADPLLQYYQP  577
                  + L  CDI+GSK +G+ L + +S G+S+ W E L+  TG+T +    LL+Y++P
Sbjct  542  R-----LTLDNCDIFGSKAAGRSLSQFLSKGNSRHWKEVLEEFTGETEMDPAALLEYFEP  596

Query  578  MYKWLNNYINLHKIPVGW  595
            +Y+WL    +   +P+GW
Sbjct  597  LYQWLKQENSRLGVPLGW  614


>ACN1_CAEEL unnamed protein product
Length=906

 Score = 182 bits (462),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 127/519 (24%), Positives = 239/519 (46%), Gaps = 43/519 (8%)

Query  98   RLAQNYNSEICFNR-SDSEMLRALNISGQCVYGEPDLEWLIKRTDLSAEQLKWIWTTWHN  156
            R A    ++   NR S    +   ++   C   + D++ +  R +  A +L+ +W ++  
Sbjct  268  RFADYSQAQAALNRDSKDSTICDKDVPPPCALQKIDMDSIF-RNEKDASRLQHLWVSYVT  326

Query  157  FVGPKIGSLYPVAVKLQNMAAQGNGYNSMAEVWQEELEIS--------NLESKVFKLYDQ  208
             +  K    Y   + + N  A+ NG+ +   +W+   ++S        +L  ++ K+Y  
Sbjct  327  AIA-KSKPSYNNIITISNEGAKLNGFANGGAMWRSAFDMSSKVHKAEFDLNKQIDKIYST  385

Query  209  IKPLYMLLHAVVRHKLFQKYGSTI-VDPKGPIPIHLLGNMWGQDWS----QLINLFDFGT  263
            I+P Y LLHA +R +L   Y + + +   GPIP HL G++ G DWS    Q     +   
Sbjct  386  IQPFYQLLHAYMRRQLAGIYSNPVGLSKDGPIPAHLFGSLDGGDWSAHYEQTKPFEEESE  445

Query  264  MKVNLETNLMQKNWTVIDMVLRAEDMYTSLGLPKMTEKFWKYSKFQEN-SNMSVCHGTAA  322
                + +    +N+T   M + A   + S G P + + +W  S F    S   +CH  AA
Sbjct  446  TPEAMLSAFNTQNYTTKKMFVTAYRYFKSAGFPHLPKSYWTSSIFARVWSKDMICHPAAA  505

Query  323  -NLYERDDFRMLLCAKVTMEDFYIVDHEMGHIEYYMAYQNQPAIFQDGSSSAFHESIGDA  381
             ++   +DFR+  CA++   DF      +    Y   Y++Q  +F++ +S    ++I +A
Sbjct  506  LDMRAPNDFRVKACAQLGEPDFEQAHSLLVQTYYQYLYKDQSLLFREQASPVITDAIANA  565

Query  382  IMNGVMVPQHLYRLGLITDDQLFNTGLGDFLLL----QQALSKIPELPYSLIIDKYRWDI  437
              +    P +LY   L+  + L    + D +++    +++L    +LP+++  D +R+++
Sbjct  566  FAHLSTNPHYLYSQKLVPSEHL---DIKDSVIINKLYKESLESFTKLPFTIAADNWRYEL  622

Query  438  FKGRIVQENYNKEFWDLNYKIRGVSPPETRGEKYFDAGAKFHVPD-NTPYIRYFLAGFLQ  496
            F G + +   N  +W++  K  GV  P+       DA     V   ++P  R  ++  L+
Sbjct  623  FDGTVPKNKLNDRWWEIRNKYEGVRSPQPYNTSNLDALIHNSVSQVHSPATRTLISYVLK  682

Query  497  VDMFNSLCKLAVCGKNGDGNMSNYCPYIPLHLCDIYGSKKSGKKLEEMMSFGSSQPWTET  556
              +  +LC        G               C +  S+ + +KL E M  GSS  W + 
Sbjct  683  FQILKALCPEGTILSEG---------------CIL--SEDTTEKLRETMKLGSSITWLKA  725

Query  557  LQILTGKTYITADPLLQYYQPMYKWLNNYINLHKIPVGW  595
            L++++GK  + A PLL+YY+P+  WL N   + ++ VGW
Sbjct  726  LEMISGKGELDAQPLLEYYEPLINWLRNTNEIDQVVVGW  764



Lambda      K        H
   0.322    0.138    0.393 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4291651150


Query= XP_031327357.1 putative nuclease HARBI1 isoform X1 [Photinus
pyralis]

Length=360
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

EXOC5_DICDI  unnamed protein product                                  30.4    2.6  
Q54LJ4_DICDI  unnamed protein product                                 30.4    3.0  
Q8I100_CAEEL  unnamed protein product                                 29.6    4.0  


>EXOC5_DICDI unnamed protein product
Length=978

 Score = 30.4 bits (67),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 18/48 (38%), Positives = 25/48 (52%), Gaps = 6/48 (13%)

Query  314  EP-PIENLIMEHELQQAIRDGDIP-----LAAEENDLGYDYRRHLVDI  355
            EP P   L +  +LQ +  + +I      LA E ND  YDY+R L D+
Sbjct  293  EPAPFNQLFLNTQLQLSQLESNIDRRLDDLAEECNDFSYDYKRKLQDL  340


>Q54LJ4_DICDI unnamed protein product
Length=2563

 Score = 30.4 bits (67),  Expect = 3.0, Method: Composition-based stats.
 Identities = 23/64 (36%), Positives = 35/64 (55%), Gaps = 5/64 (8%)

Query  58    EKIEHRLEYFHNRN-NSISPMNQLLLTLRAYASAGHFVAVGDF---VHADKSTVCKIVSK  113
             EK E  L+    R+ NS+SP N +LL L +  SA ++   GDF   +   K+T  K +S+
Sbjct  1529  EKFESTLKSALQRSENSLSPTNPILLQL-SLLSANYYKENGDFEKSIQISKNTFDKAISE  1587

Query  114   VSRL  117
             +  L
Sbjct  1588  LDTL  1591


>Q8I100_CAEEL unnamed protein product
Length=517

 Score = 29.6 bits (65),  Expect = 4.0, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 51/120 (43%), Gaps = 18/120 (15%)

Query  23   IPRQIHI--RRNLFNIYSNVEFFRRF----RLEKGTALYLLEKIEHRLEYFHNRNNSISP  76
            +P  I++  R N   I SNV+F  RF    RL  G A Y    +   LE+  N N+    
Sbjct  303  LPTLIYVLFRGNPPLIQSNVKFISRFAIPARLMSGEAAYFFTNLSCALEFARNMNHESLQ  362

Query  77   MNQLLLTLRAYASAGHFV--------AVGDFVHADKSTVCKIVSKVSRLIASIAREFIYM  128
            M +      AY S GH          A    ++  + T+ + ++ V++   S+A+    M
Sbjct  363  MEK--SEFEAYTS-GHLAPPLSVINSACNQAIYVLEGTI-ETITNVAKKAGSLAKNLTNM  418



Lambda      K        H
   0.322    0.138    0.393 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4291651150


Query= XP_031327358.1 putative nuclease HARBI1 isoform X2 [Photinus
pyralis]

Length=257
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

EXOC5_DICDI  unnamed protein product                                  30.4    1.7  


>EXOC5_DICDI unnamed protein product
Length=978

 Score = 30.4 bits (67),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 19/52 (37%), Positives = 26/52 (50%), Gaps = 6/52 (12%)

Query  206  LRGEPEPPIENLIMEHELQQAIRDGDIP-----LAAEENDLGYDYRRHLVDI  252
            L  EP  P   L +  +LQ +  + +I      LA E ND  YDY+R L D+
Sbjct  290  LHFEP-APFNQLFLNTQLQLSQLESNIDRRLDDLAEECNDFSYDYKRKLQDL  340



Lambda      K        H
   0.322    0.138    0.393 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4291651150


Query= XP_031327359.1 zinc finger protein 3 homolog isoform X1 [Photinus
pyralis]

Length=507
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TTKA_DROME  unnamed protein product                                   82.4    3e-16
TTKB_DROME  unnamed protein product                                   81.6    4e-16
BRC1_DROME  unnamed protein product                                   79.3    3e-15


>TTKA_DROME unnamed protein product
Length=813

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 80/131 (61%), Gaps = 8/131 (6%)

Query  54   MTDSSENYQLKWHSYSSHLHSCVASSLTTETFADVSLCTMDGHFIMAHRFVLSACSQYLH  113
            M  +S+ + L+W+++ S+L S     L  ETF DV+L  ++G  + AH+ VLSACS Y +
Sbjct  1    MKMASQRFCLRWNNHQSNLLSVFDQLLHAETFTDVTLA-VEGQHLKAHKMVLSACSPYFN  59

Query  114  QV-LKHQQKMTTTLPLVIILPPEISYRTIKTLINYMYSGETTVSKDILENVLKGGDILKV  172
             + + H +K     P+VI+   ++ Y  +K+L+++MY GE +V ++ L   L+  + L++
Sbjct  60   TLFVSHPEKH----PIVILK--DVPYSDMKSLLDFMYRGEVSVDQERLTAFLRVAESLRI  113

Query  173  KGLWRPKEDRP  183
            KGL    +D+P
Sbjct  114  KGLTEVNDDKP  124


>TTKB_DROME unnamed protein product
Length=643

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 80/131 (61%), Gaps = 8/131 (6%)

Query  54   MTDSSENYQLKWHSYSSHLHSCVASSLTTETFADVSLCTMDGHFIMAHRFVLSACSQYLH  113
            M  +S+ + L+W+++ S+L S     L  ETF DV+L  ++G  + AH+ VLSACS Y +
Sbjct  1    MKMASQRFCLRWNNHQSNLLSVFDQLLHAETFTDVTLA-VEGQHLKAHKMVLSACSPYFN  59

Query  114  QV-LKHQQKMTTTLPLVIILPPEISYRTIKTLINYMYSGETTVSKDILENVLKGGDILKV  172
             + + H +K     P+VI+   ++ Y  +K+L+++MY GE +V ++ L   L+  + L++
Sbjct  60   TLFVSHPEKH----PIVILK--DVPYSDMKSLLDFMYRGEVSVDQERLTAFLRVAESLRI  113

Query  173  KGLWRPKEDRP  183
            KGL    +D+P
Sbjct  114  KGLTEVNDDKP  124


>BRC1_DROME unnamed protein product
Length=727

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 49/160 (31%), Positives = 88/160 (55%), Gaps = 12/160 (8%)

Query  56   DSSENYQLKWHSYSSHLHSCVASSLTTETFADVSLCTMDGHFIMAHRFVLSACSQYLHQV  115
            D ++++ L+W++Y S + S   +    E F DV+L   +G  I AHR VLSACS Y  ++
Sbjct  2    DDTQHFCLRWNNYQSSITSAFENLRDDEAFVDVTLAC-EGRSIKAHRVVLSACSPYFREL  60

Query  116  LKHQQKMTTTLPLVIILPPEISYRTIKTLINYMYSGETTVSKDILENVLKGGDILKVKGL  175
            LK     +T     +IL  ++++  +  L+ ++Y GE  V +  L++ LK  ++L+V GL
Sbjct  61   LK-----STPCKHPVILLQDVNFMDLHALVEFIYHGEVNVHQKSLQSFLKTAEVLRVSGL  115

Query  176  WRPKEDRPNEKKLAKVQEQLNGTKSVSGNVTPTSTASETV  215
             + ++       LA++Q   N     SG  TP +T ++++
Sbjct  116  TQ-QQAEDTHSHLAQIQNLAN-----SGGRTPLNTHTQSL  149



Lambda      K        H
   0.322    0.138    0.393 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4291651150


Query= XP_031327360.1 zinc finger protein 3 homolog isoform X2 [Photinus
pyralis]

Length=454
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TTKA_DROME  unnamed protein product                                   83.2    9e-17
TTKB_DROME  unnamed protein product                                   82.0    2e-16
LOLA5_DROME  unnamed protein product                                  80.5    9e-16


>TTKA_DROME unnamed protein product
Length=813

 Score = 83.2 bits (204),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 80/131 (61%), Gaps = 8/131 (6%)

Query  1    MTDSSENYQLKWHSYSSHLHSCVASSLTTETFADVSLCTMDGHFIMAHRFVLSACSQYLH  60
            M  +S+ + L+W+++ S+L S     L  ETF DV+L  ++G  + AH+ VLSACS Y +
Sbjct  1    MKMASQRFCLRWNNHQSNLLSVFDQLLHAETFTDVTLA-VEGQHLKAHKMVLSACSPYFN  59

Query  61   QV-LKHQQKMTTTLPLVIILPPEISYRTIKTLINYMYSGETTVSKDILENVLKGGDILKV  119
             + + H +K     P+VI+   ++ Y  +K+L+++MY GE +V ++ L   L+  + L++
Sbjct  60   TLFVSHPEKH----PIVIL--KDVPYSDMKSLLDFMYRGEVSVDQERLTAFLRVAESLRI  113

Query  120  KGLWRPKEDRP  130
            KGL    +D+P
Sbjct  114  KGLTEVNDDKP  124


>TTKB_DROME unnamed protein product
Length=643

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 80/131 (61%), Gaps = 8/131 (6%)

Query  1    MTDSSENYQLKWHSYSSHLHSCVASSLTTETFADVSLCTMDGHFIMAHRFVLSACSQYLH  60
            M  +S+ + L+W+++ S+L S     L  ETF DV+L  ++G  + AH+ VLSACS Y +
Sbjct  1    MKMASQRFCLRWNNHQSNLLSVFDQLLHAETFTDVTLA-VEGQHLKAHKMVLSACSPYFN  59

Query  61   QV-LKHQQKMTTTLPLVIILPPEISYRTIKTLINYMYSGETTVSKDILENVLKGGDILKV  119
             + + H +K     P+VI+   ++ Y  +K+L+++MY GE +V ++ L   L+  + L++
Sbjct  60   TLFVSHPEKH----PIVIL--KDVPYSDMKSLLDFMYRGEVSVDQERLTAFLRVAESLRI  113

Query  120  KGLWRPKEDRP  130
            KGL    +D+P
Sbjct  114  KGLTEVNDDKP  124


>LOLA5_DROME unnamed protein product
Length=963

 Score = 80.5 bits (197),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 70/120 (58%), Gaps = 6/120 (5%)

Query  3    DSSENYQLKWHSYSSHLHSCVASSLTTETFADVSLCTMDGHFIMAHRFVLSACSQYLHQV  62
            D  + + L+W+++ S L S   + L  ET  D +L   +G F+ AH+ VLSACS Y   +
Sbjct  2    DDDQQFCLRWNNHQSTLISVFDTLLENETLVDCTLAA-EGKFLKAHKVVLSACSPYFATL  60

Query  63   LKHQQKMTTTLPLVIILPPEISYRTIKTLINYMYSGETTVSKDILENVLKGGDILKVKGL  122
            L+ Q       P+ I+   ++ Y+ ++ +++YMY GE  +S+D L  +LK  + L++KGL
Sbjct  61   LQEQYDKH---PIFIL--KDVKYQELRAMMDYMYRGEVNISQDQLAALLKAAESLQIKGL  115


 Score = 35.0 bits (79),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 2/51 (4%)

Query  381  ICTMCNKKFPSHASMLIHKRTHTGEKP-YMC-EHCQKGFNVKSNLLRHLRT  429
            +C  CN+ +    S+  H +   G  P Y C + C    NV SNL RHL T
Sbjct  850  VCRNCNRTYKWKNSLKCHLKNECGLPPRYFCSKMCGYATNVHSNLKRHLNT  900



Lambda      K        H
   0.322    0.138    0.393 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4291651150


Query= XP_031327361.1 uncharacterized protein LOC116158678 isoform X1
[Photinus pyralis]

Length=156
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9W1M6_DROME  unnamed protein product                                 30.4    0.69 
O17430_DROME  unnamed protein product                                 30.0    0.70 
Q8MLR4_DROME  unnamed protein product                                 30.0    0.70 


>Q9W1M6_DROME unnamed protein product
Length=489

 Score = 30.4 bits (67),  Expect = 0.69, Method: Composition-based stats.
 Identities = 21/62 (34%), Positives = 31/62 (50%), Gaps = 1/62 (2%)

Query  3    ESRLLVDEVCKRKKIIENKQTDAVTCKQKEDAWINLESAFNANSGSTFRSTKMLKIKYEG  62
            E + L+D   K  +IIENK+ DA     K  AW  +   F +N   T R+   LK ++  
Sbjct  69   EKKYLLDLCRKDMRIIENKRLDAGLTAVKNKAWKIIHQKF-SNQFGTDRTCNRLKEQWRR  127

Query  63   IK  64
            +K
Sbjct  128  MK  129


>O17430_DROME unnamed protein product
Length=490

 Score = 30.0 bits (66),  Expect = 0.70, Method: Composition-based stats.
 Identities = 21/62 (34%), Positives = 31/62 (50%), Gaps = 1/62 (2%)

Query  3    ESRLLVDEVCKRKKIIENKQTDAVTCKQKEDAWINLESAFNANSGSTFRSTKMLKIKYEG  62
            E + L+D   K  +IIENK+ DA     K  AW  +   F +N   T R+   LK ++  
Sbjct  69   EKKYLLDLCRKDMRIIENKRLDAGLTAVKNKAWKIIHQKF-SNQFGTDRTCNRLKEQWRR  127

Query  63   IK  64
            +K
Sbjct  128  MK  129


>Q8MLR4_DROME unnamed protein product
Length=469

 Score = 30.0 bits (66),  Expect = 0.70, Method: Composition-based stats.
 Identities = 21/62 (34%), Positives = 31/62 (50%), Gaps = 1/62 (2%)

Query  3    ESRLLVDEVCKRKKIIENKQTDAVTCKQKEDAWINLESAFNANSGSTFRSTKMLKIKYEG  62
            E + L+D   K  +IIENK+ DA     K  AW  +   F +N   T R+   LK ++  
Sbjct  49   EKKYLLDLCRKDMRIIENKRLDAGLTAVKNKAWKIIHQKF-SNQFGTDRTCNRLKEQWRR  107

Query  63   IK  64
            +K
Sbjct  108  MK  109



Lambda      K        H
   0.322    0.138    0.393 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4291651150


Query= XP_031327362.1 uncharacterized protein LOC116158678 isoform X2
[Photinus pyralis]

Length=154
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O44203_DROME  unnamed protein product                                 30.4    0.57 
O17430_DROME  unnamed protein product                                 30.0    0.75 
A0A0B4KGD0_DROME  unnamed protein product                             30.0    0.75 


>O44203_DROME unnamed protein product
Length=484

 Score = 30.4 bits (67),  Expect = 0.57, Method: Compositional matrix adjust.
 Identities = 21/62 (34%), Positives = 31/62 (50%), Gaps = 1/62 (2%)

Query  3    ESRLLVDEVCKRKKIIENKQTDAVTCKQKEDAWINLESAFNANSGSTFRSTKMLKIKYEG  62
            E + L+D   K  +IIENK+ DA     K  AW  +   F +N   T R+   LK ++  
Sbjct  63   EKKYLLDLCRKDMRIIENKRLDAGLTAVKNKAWKIIHQKF-SNQFGTDRTCNRLKEQWRR  121

Query  63   IK  64
            +K
Sbjct  122  MK  123


>O17430_DROME unnamed protein product
Length=490

 Score = 30.0 bits (66),  Expect = 0.75, Method: Composition-based stats.
 Identities = 21/62 (34%), Positives = 31/62 (50%), Gaps = 1/62 (2%)

Query  3    ESRLLVDEVCKRKKIIENKQTDAVTCKQKEDAWINLESAFNANSGSTFRSTKMLKIKYEG  62
            E + L+D   K  +IIENK+ DA     K  AW  +   F +N   T R+   LK ++  
Sbjct  69   EKKYLLDLCRKDMRIIENKRLDAGLTAVKNKAWKIIHQKF-SNQFGTDRTCNRLKEQWRR  127

Query  63   IK  64
            +K
Sbjct  128  MK  129


>A0A0B4KGD0_DROME unnamed protein product
Length=499

 Score = 30.0 bits (66),  Expect = 0.75, Method: Composition-based stats.
 Identities = 21/62 (34%), Positives = 31/62 (50%), Gaps = 1/62 (2%)

Query  3    ESRLLVDEVCKRKKIIENKQTDAVTCKQKEDAWINLESAFNANSGSTFRSTKMLKIKYEG  62
            E + L+D   K  +IIENK+ DA     K  AW  +   F +N   T R+   LK ++  
Sbjct  79   EKKYLLDLCRKDMRIIENKRLDAGLTAVKNKAWKIIHQKF-SNQFGTDRTCNRLKEQWRR  137

Query  63   IK  64
            +K
Sbjct  138  MK  139



Lambda      K        H
   0.322    0.138    0.393 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4291651150


Query= XP_031327363.1 phosphatidylinositide phosphatase SAC1-like isoform
X1 [Photinus pyralis]

Length=579
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SAC1_DROME  unnamed protein product                                   568     0.0  
Q54D97_DICDI  unnamed protein product                                 242     7e-69
Q5U0V7_DROME  unnamed protein product                                 183     8e-49


>SAC1_DROME unnamed protein product
Length=592

 Score = 568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/583 (50%), Positives = 382/583 (66%), Gaps = 20/583 (3%)

Query  6    VYDDFNLFITPDKFYICPKLSSKYLVVDRVSESLSLQSNVNDIPVAT--SSREFCGLLGS  63
            VYDD NL+I P  F I P    + LV+ R  +   +Q     + VA    +R  CG+LG+
Sbjct  9    VYDDMNLYIAPQSFIIEPNGGDELLVIGRHDKVTRVQPASGGL-VANLRPTRRICGVLGT  67

Query  64   VRLLAGQYLIIATKRTYVGSIAGHAVWCLVSSELIPYNRSTLHLNAEQLDDNNSYLSMIK  123
            + LL+  YL++AT R +VG + G  VW L   ++IPY       N+ Q  +N +YL +++
Sbjct  68   IHLLSCDYLLVATHRLFVGVLNGAVVWRLAGYDIIPYIP-----NSFQRKENENYLRLLR  122

Query  124  NVLDTPYLYFSYTYDLTHTMQRLHLMEPDFLNRS-LFERADHRFVWNSNLIKQIFRPEIH  182
              LDT + YFSY YDLT+++QR   +       S L +RA+ RFVWN  +++Q    ++ 
Sbjct  123  QTLDTKFFYFSYRYDLTNSLQRQREVAQSRPEVSGLLQRAEQRFVWNGYVLRQFNCDKME  182

Query  183  NFCLPLLHGFMAINDFSINGYNFTWTVISRRSINRPGTRLFRRGLDNVGNVANFVETEQI  242
             F LPL+ GF++IN   ING  F W++I+RRS+ R GTRLF RG D  G+VANFVETEQI
Sbjct  183  KFQLPLVLGFVSINQVQINGQTFFWSIITRRSVQRAGTRLFCRGSDEQGHVANFVETEQI  242

Query  243  VECQGDRASFVQIRGSIPLYWSQYPDLRYKPPPHLVDVAADEQQSACARHLDSLSVYYGR  302
            VE  G    FVQ RGS+P +W Q P+LRYKP P LV     +  +AC  H       YG 
Sbjct  243  VEFNGQLTGFVQTRGSMPFHWHQLPNLRYKPRPVLV--PGKDHLAACGLHFKEQIRLYGN  300

Query  303  QVLLDLVDQRGSEGKLQKAYADTVQALGFPFVRYEPFDFHSECRHMRWDRLSILLDRISL  362
             V ++LVD +G+EG+L+  YA  V+ +G P VRYE FDFHSECR MRWDRL+IL+DR++ 
Sbjct  301  NVAVNLVDHKGAEGELEATYARLVREMGNPQVRYESFDFHSECRKMRWDRLNILIDRLAH  360

Query  363  EQDDMGFFLLLRDGSIPLLQDGVFRTNCVDCLDRTNVVQSMIARRCLGNILHKLSIIKSE  422
            EQD  G + +  DG +   Q GVFRTNC+DCLDRTNVVQSM+ARR L  +L KL ++   
Sbjct  361  EQDQFGVYHVFDDGKLVSTQTGVFRTNCIDCLDRTNVVQSMLARRSLTAVLQKLGVLHVG  420

Query  423  ESIEEFPSL-ERVFKEVWADNADLISLQYSGTGALKTDFTRTGKRTHVGLMRDGLNSLTR  481
            + +E    + E +FK VWADNADL+SLQYSGT ALKTDFTRTGKRT  G M+DG NSL R
Sbjct  421  QKVEHASDIFESIFKGVWADNADLVSLQYSGTCALKTDFTRTGKRTKSGAMQDGKNSLMR  480

Query  482  YYKNNFSDGFRQDAIDLFHGI--------AEIKSPLRIERGWKYITFPSVLLVAIAMFVA  533
            YY NNF+DG RQD+IDLF G           + SPL  + GW++ TFPSVLLVA+AMF+ 
Sbjct  481  YYLNNFADGQRQDSIDLFLGKYLVNDNEGGAVPSPLESKHGWRFFTFPSVLLVAVAMFMI  540

Query  534  CAILPSEYSTDSLLFILFWGVMVTATLTTILNHGPEFVDQPRL  576
                P+E++T++LLF+LFWG M+  + T IL++G EFV  PRL
Sbjct  541  TMTYPAEFNTENLLFMLFWGAMIAVSATGILHYGVEFVQWPRL  583


>Q54D97_DICDI unnamed protein product
Length=1379

 Score = 242 bits (618),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 172/547 (31%), Positives = 279/547 (51%), Gaps = 59/547 (11%)

Query  10   FNLFITPDKFYIC-PKLSSKYLVVDRVSESLS--LQSNVNDIPVATSSREFCGLLGSVRL  66
            F +FIT   F I    L SK LV++R   S    +Q +  D  + +    +C +LG  RL
Sbjct  6    FRIFITTQSFIIKRDSLHSKALVINRRDPSKIDIIQPDQIDQSLRSERSVYC-VLGIFRL  64

Query  67   LAGQYLIIATKRTYVGSIA----GHAVWCLVSSELIPYN------------RSTLHLNAE  110
            +   YL++ T+     +       + +  +  ++ I +                   N E
Sbjct  65   VNECYLVVVTESDIAANFQFQGQPNVIRKIRCTDFISFQTGRGHISIGGGGGGGGSGNGE  124

Query  111  QLDDNNSYLSMIKNVLDTPYLYFS---YTYDLTHTMQRLHLMEPDFLNRSLFERADHRFV  167
              +D+  Y+ ++ N+L++ + Y++    ++D+T T Q    +EP   +  ++ER D RF 
Sbjct  125  SKEDDRPYVQVM-NLLNSGHFYWTPPNSSFDITRTYQS-QCLEPK-SDLPVWERVDKRFY  181

Query  168  WNSNLIKQIFRPEIHNFCLPLLHGFMAINDFS-INGYNFTWTVISRRSINRPGTRLFRRG  226
            WN  L K      ++++C P++ GF+  +    I G N  +T+ISRRS  R GTR   RG
Sbjct  182  WNKYLQKDFIAYRLYDWCFPIIQGFVVSDHLGHIQGKNVVYTLISRRSRFRAGTRFVTRG  241

Query  227  LDNVGNVANFVETEQI--VECQGDRASFVQIRGSIPLYWSQ----YPDLRYKPPPHLVDV  280
            +D+ GNVANF E+EQI  +E  G  A F+QIRGS+P++W+Q      DL+ K        
Sbjct  242  IDDDGNVANFCESEQILSIESYGVLA-FLQIRGSVPVFWNQSSPQMSDLKIKMSNLSKIG  300

Query  281  AADEQQSACAR-----------HLDSLSVYYGRQVLLDLVDQ-RGSEGKLQKAYADTVQA  328
               +++   AR           HL   +  YG  V+++L+ + +  E  L  AY + ++ 
Sbjct  301  KISKKKITIARNTQATTPAFQLHLKEQTKKYGNIVIVNLLSKLKSGECDLVNAYEEQIRI  360

Query  329  LGFPFVRYEPFDFHSECRHMRWDRLSILLDRIS-------------LEQDDMGFFLLLRD  375
            L  P V Y  FD + + +  R D L  L++ I              + +  +G+F    +
Sbjct  361  LRSPQVFYNHFDLNEQTKGNRMDPLDSLINYIDNQSISGGGGTTGGVSEKIVGYFFQNSN  420

Query  376  GSIPLLQDGVFRTNCVDCLDRTNVVQSMIARRCLGNILHKLSIIKSEESIEEFPSLERVF  435
            G I   Q+G+ RTNC DCLDRTN+VQS ++     + L KL + +  +SI  +P + +  
Sbjct  421  GQIISKQNGIIRTNCKDCLDRTNIVQSRVSWVLFESQLRKLGLFRGHDSIGSYPRVSQTL  480

Query  436  KEVWADNADLISLQYSGTGALKTDFTRTGKRTHVGLMRDGLNSLTRYYKNNFSDGFRQDA  495
            K  WADN D +S+QY+G+G+LK+  TR G    +G++ DG  ++TR+Y NNF D  RQD 
Sbjct  481  KTTWADNGDALSIQYAGSGSLKSTLTREGDYGIMGMLADGKKTMTRFYINNFKDPGRQDV  540

Query  496  IDLFHGI  502
            +DL  G+
Sbjct  541  LDLLLGL  547


>Q5U0V7_DROME unnamed protein product
Length=1218

 Score = 183 bits (464),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 136/467 (29%), Positives = 220/467 (47%), Gaps = 62/467 (13%)

Query  59   GLLGSVRLLAGQ----YLIIATKRTYVGSIAGHAVWCLVSSELIPYNRSTLHLNAEQLDD  114
            G LG+++L AG+    +L++ T    +G I    ++ +  +  +    +           
Sbjct  62   GCLGALQLNAGESTVLFLVLVTGCVSMGKIGDIEIFRITQTTFVSLQNAA---------P  112

Query  115  NNSYLSMIKNVLDTPYLYFSYT-------------YDLTHTMQRLHLMEPDFLNRSLFER  161
            N   +S ++ +L++   YF++T             +D+T   QR          R   + 
Sbjct  113  NEDKISEVRKLLNSGTFYFAHTNASASASGASSYRFDITLCAQR----------RQQTQE  162

Query  162  ADHRFVWNSNLIKQIFRPEI--HNFCLPLLHGFMAINDFSINGYNFTWTVISRRSINRPG  219
             D+RF WN  +   + R  I   ++ L  + G + +    I        +ISR S  R G
Sbjct  163  TDNRFFWNRMMHIHLMRFGIDCQSWLLQAMCGSVEVRTVYIGAKQARAAIISRLSCERAG  222

Query  220  TRLFRRGLDNVGNVANFVETEQIVECQGDRASFVQIRGSIPLYWSQYPDLRYKPPPHLVD  279
            TR   RG ++ G VANFVETEQ++   GD  S+VQ RGS+PL+W Q P ++     H V 
Sbjct  223  TRFNVRGTNDEGYVANFVETEQVIYVDGDVTSYVQTRGSVPLFWEQ-PGVQVG--SHKVK  279

Query  280  VAADEQQSACA--RHLDSLSVYYGRQVLLD-----LVDQRGSEGKLQKAYADTVQALGFP  332
            ++   + SA A  RH+  +   YG Q +++     LV  +  E  L   +          
Sbjct  280  LSRGFETSAAAFDRHMSMMRQRYGYQTVVNLLGSSLVGSKEGEAMLSNEFQRHHGMSAHK  339

Query  333  FVRYEPFDFHSECRHMRWDRLSILLDRISLEQDDMGFFLLLRDGSIPLLQDGVFRTNCVD  392
             V +  FD+H ECR   +  L+ L +RI     + G F    +G +   Q GV RTNC+D
Sbjct  340  DVPHVVFDYHQECRGGNFSALAKLKERIVACGANYGVF-HASNGQVLREQFGVVRTNCLD  398

Query  393  CLDRTNVVQSMIARRCLGNILHKLSIIKSEESIEEFPSLERVFKEVWADNADLISLQYSG  452
            CLDRTN VQ+ +    LG  L  L +   +++I  F   E +F+++W +N + +S  Y+G
Sbjct  399  CLDRTNCVQTYLGLDTLGIQLEALKMGGKQQNISRF---EEIFRQMWINNGNEVSKIYAG  455

Query  453  TGALKTDFTRTGKRTHVGLMRDGLNSLTRYYKNNFSDGFRQDAIDLF  499
            TGA++      G +     + DG  S  R  +NN  D  +Q+AID+ 
Sbjct  456  TGAIQ-----GGSK-----LMDGARSAARTIQNNLLDNSKQEAIDVL  492



Lambda      K        H
   0.322    0.138    0.393 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4291651150


Query= XP_031327364.1 phosphatidylinositide phosphatase SAC1-like isoform
X2 [Photinus pyralis]

Length=579
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SAC1_DROME  unnamed protein product                                   567     0.0  
Q54D97_DICDI  unnamed protein product                                 243     3e-69
Q5U0V7_DROME  unnamed protein product                                 184     3e-49


>SAC1_DROME unnamed protein product
Length=592

 Score = 567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/583 (50%), Positives = 382/583 (66%), Gaps = 20/583 (3%)

Query  6    VYDDFNLFITPDKFYICPKLSSKYLVVDRVSESLSLQSNVNDIPVAT--SSREFCGLLGS  63
            VYDD NL+I P  F I P    + LV+ R  +   +Q     + VA    +R  CG+LG+
Sbjct  9    VYDDMNLYIAPQSFIIEPNGGDELLVIGRHDKVTRVQPASGGL-VANLRPTRRICGVLGT  67

Query  64   VRLLAGQYLIIATKRTYVGSIAGHAVWCLVSSELIPYNRSTLHLNAEQLDDNNSYLSMIK  123
            + LL+  YL++AT R +VG + G  VW L   ++IPY       N+ Q  +N +YL +++
Sbjct  68   IHLLSCDYLLVATHRLFVGVLNGAVVWRLAGYDIIPYIP-----NSFQRKENENYLRLLR  122

Query  124  NVLDTPYLYFSYTYDLTHTMQRLHLMEPDFLNRS-LFERADHRFVWNSNLIKQIFRLEIH  182
              LDT + YFSY YDLT+++QR   +       S L +RA+ RFVWN  +++Q    ++ 
Sbjct  123  QTLDTKFFYFSYRYDLTNSLQRQREVAQSRPEVSGLLQRAEQRFVWNGYVLRQFNCDKME  182

Query  183  NFCLPLLHGFMAINDFSINGYNFTWTVISRRSINRPGTRLFRRGLDNVGNVANFVETEQI  242
             F LPL+ GF++IN   ING  F W++I+RRS+ R GTRLF RG D  G+VANFVETEQI
Sbjct  183  KFQLPLVLGFVSINQVQINGQTFFWSIITRRSVQRAGTRLFCRGSDEQGHVANFVETEQI  242

Query  243  VECQGDRASFVQIRGSIPLYWSQYPDLRYKPPPHLVDVAADEQQSACARHLDSLSVYYGR  302
            VE  G    FVQ RGS+P +W Q P+LRYKP P LV     +  +AC  H       YG 
Sbjct  243  VEFNGQLTGFVQTRGSMPFHWHQLPNLRYKPRPVLV--PGKDHLAACGLHFKEQIRLYGN  300

Query  303  QVLLDLVDQRGSEGKLQKAYADTVQALGFPFVRYEPFDFHSECRHMRWDRLSILLDRISL  362
             V ++LVD +G+EG+L+  YA  V+ +G P VRYE FDFHSECR MRWDRL+IL+DR++ 
Sbjct  301  NVAVNLVDHKGAEGELEATYARLVREMGNPQVRYESFDFHSECRKMRWDRLNILIDRLAH  360

Query  363  EQDDMGFFLLLRDGSIPLLQDGVFRTNCVDCLDRTNVVQSMIARRCLGNILHKLSIIKSE  422
            EQD  G + +  DG +   Q GVFRTNC+DCLDRTNVVQSM+ARR L  +L KL ++   
Sbjct  361  EQDQFGVYHVFDDGKLVSTQTGVFRTNCIDCLDRTNVVQSMLARRSLTAVLQKLGVLHVG  420

Query  423  ESIEEFPSL-ERVFKEVWADNADLISLQYSGTGALKTDFTRTGKRTHVGLMRDGLNSLTR  481
            + +E    + E +FK VWADNADL+SLQYSGT ALKTDFTRTGKRT  G M+DG NSL R
Sbjct  421  QKVEHASDIFESIFKGVWADNADLVSLQYSGTCALKTDFTRTGKRTKSGAMQDGKNSLMR  480

Query  482  YYKNNFSDGFRQDAIDLFHGI--------AEIKSPLRIERGWKYITFPSVLLVAIAMFVA  533
            YY NNF+DG RQD+IDLF G           + SPL  + GW++ TFPSVLLVA+AMF+ 
Sbjct  481  YYLNNFADGQRQDSIDLFLGKYLVNDNEGGAVPSPLESKHGWRFFTFPSVLLVAVAMFMI  540

Query  534  CAILPSEYSTDSLLFILFWGVMVTATLTTILNHGPEFVDQPRL  576
                P+E++T++LLF+LFWG M+  + T IL++G EFV  PRL
Sbjct  541  TMTYPAEFNTENLLFMLFWGAMIAVSATGILHYGVEFVQWPRL  583


>Q54D97_DICDI unnamed protein product
Length=1379

 Score = 243 bits (621),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 172/547 (31%), Positives = 279/547 (51%), Gaps = 59/547 (11%)

Query  10   FNLFITPDKFYIC-PKLSSKYLVVDRVSESLS--LQSNVNDIPVATSSREFCGLLGSVRL  66
            F +FIT   F I    L SK LV++R   S    +Q +  D  + +    +C +LG  RL
Sbjct  6    FRIFITTQSFIIKRDSLHSKALVINRRDPSKIDIIQPDQIDQSLRSERSVYC-VLGIFRL  64

Query  67   LAGQYLIIATKRTYVGSIA----GHAVWCLVSSELIPYN------------RSTLHLNAE  110
            +   YL++ T+     +       + +  +  ++ I +                   N E
Sbjct  65   VNECYLVVVTESDIAANFQFQGQPNVIRKIRCTDFISFQTGRGHISIGGGGGGGGSGNGE  124

Query  111  QLDDNNSYLSMIKNVLDTPYLYFS---YTYDLTHTMQRLHLMEPDFLNRSLFERADHRFV  167
              +D+  Y+ ++ N+L++ + Y++    ++D+T T Q    +EP   +  ++ER D RF 
Sbjct  125  SKEDDRPYVQVM-NLLNSGHFYWTPPNSSFDITRTYQS-QCLEPK-SDLPVWERVDKRFY  181

Query  168  WNSNLIKQIFRLEIHNFCLPLLHGFMAINDFS-INGYNFTWTVISRRSINRPGTRLFRRG  226
            WN  L K      ++++C P++ GF+  +    I G N  +T+ISRRS  R GTR   RG
Sbjct  182  WNKYLQKDFIAYRLYDWCFPIIQGFVVSDHLGHIQGKNVVYTLISRRSRFRAGTRFVTRG  241

Query  227  LDNVGNVANFVETEQI--VECQGDRASFVQIRGSIPLYWSQ----YPDLRYKPPPHLVDV  280
            +D+ GNVANF E+EQI  +E  G  A F+QIRGS+P++W+Q      DL+ K        
Sbjct  242  IDDDGNVANFCESEQILSIESYGVLA-FLQIRGSVPVFWNQSSPQMSDLKIKMSNLSKIG  300

Query  281  AADEQQSACAR-----------HLDSLSVYYGRQVLLDLVDQ-RGSEGKLQKAYADTVQA  328
               +++   AR           HL   +  YG  V+++L+ + +  E  L  AY + ++ 
Sbjct  301  KISKKKITIARNTQATTPAFQLHLKEQTKKYGNIVIVNLLSKLKSGECDLVNAYEEQIRI  360

Query  329  LGFPFVRYEPFDFHSECRHMRWDRLSILLDRIS-------------LEQDDMGFFLLLRD  375
            L  P V Y  FD + + +  R D L  L++ I              + +  +G+F    +
Sbjct  361  LRSPQVFYNHFDLNEQTKGNRMDPLDSLINYIDNQSISGGGGTTGGVSEKIVGYFFQNSN  420

Query  376  GSIPLLQDGVFRTNCVDCLDRTNVVQSMIARRCLGNILHKLSIIKSEESIEEFPSLERVF  435
            G I   Q+G+ RTNC DCLDRTN+VQS ++     + L KL + +  +SI  +P + +  
Sbjct  421  GQIISKQNGIIRTNCKDCLDRTNIVQSRVSWVLFESQLRKLGLFRGHDSIGSYPRVSQTL  480

Query  436  KEVWADNADLISLQYSGTGALKTDFTRTGKRTHVGLMRDGLNSLTRYYKNNFSDGFRQDA  495
            K  WADN D +S+QY+G+G+LK+  TR G    +G++ DG  ++TR+Y NNF D  RQD 
Sbjct  481  KTTWADNGDALSIQYAGSGSLKSTLTREGDYGIMGMLADGKKTMTRFYINNFKDPGRQDV  540

Query  496  IDLFHGI  502
            +DL  G+
Sbjct  541  LDLLLGL  547


>Q5U0V7_DROME unnamed protein product
Length=1218

 Score = 184 bits (468),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 136/467 (29%), Positives = 220/467 (47%), Gaps = 62/467 (13%)

Query  59   GLLGSVRLLAGQ----YLIIATKRTYVGSIAGHAVWCLVSSELIPYNRSTLHLNAEQLDD  114
            G LG+++L AG+    +L++ T    +G I    ++ +  +  +    +           
Sbjct  62   GCLGALQLNAGESTVLFLVLVTGCVSMGKIGDIEIFRITQTTFVSLQNAA---------P  112

Query  115  NNSYLSMIKNVLDTPYLYFSYT-------------YDLTHTMQRLHLMEPDFLNRSLFER  161
            N   +S ++ +L++   YF++T             +D+T   QR          R   + 
Sbjct  113  NEDKISEVRKLLNSGTFYFAHTNASASASGASSYRFDITLCAQR----------RQQTQE  162

Query  162  ADHRFVWNSNLIKQIFRLEI--HNFCLPLLHGFMAINDFSINGYNFTWTVISRRSINRPG  219
             D+RF WN  +   + R  I   ++ L  + G + +    I        +ISR S  R G
Sbjct  163  TDNRFFWNRMMHIHLMRFGIDCQSWLLQAMCGSVEVRTVYIGAKQARAAIISRLSCERAG  222

Query  220  TRLFRRGLDNVGNVANFVETEQIVECQGDRASFVQIRGSIPLYWSQYPDLRYKPPPHLVD  279
            TR   RG ++ G VANFVETEQ++   GD  S+VQ RGS+PL+W Q P ++     H V 
Sbjct  223  TRFNVRGTNDEGYVANFVETEQVIYVDGDVTSYVQTRGSVPLFWEQ-PGVQVG--SHKVK  279

Query  280  VAADEQQSACA--RHLDSLSVYYGRQVLLD-----LVDQRGSEGKLQKAYADTVQALGFP  332
            ++   + SA A  RH+  +   YG Q +++     LV  +  E  L   +          
Sbjct  280  LSRGFETSAAAFDRHMSMMRQRYGYQTVVNLLGSSLVGSKEGEAMLSNEFQRHHGMSAHK  339

Query  333  FVRYEPFDFHSECRHMRWDRLSILLDRISLEQDDMGFFLLLRDGSIPLLQDGVFRTNCVD  392
             V +  FD+H ECR   +  L+ L +RI     + G F    +G +   Q GV RTNC+D
Sbjct  340  DVPHVVFDYHQECRGGNFSALAKLKERIVACGANYGVF-HASNGQVLREQFGVVRTNCLD  398

Query  393  CLDRTNVVQSMIARRCLGNILHKLSIIKSEESIEEFPSLERVFKEVWADNADLISLQYSG  452
            CLDRTN VQ+ +    LG  L  L +   +++I  F   E +F+++W +N + +S  Y+G
Sbjct  399  CLDRTNCVQTYLGLDTLGIQLEALKMGGKQQNISRF---EEIFRQMWINNGNEVSKIYAG  455

Query  453  TGALKTDFTRTGKRTHVGLMRDGLNSLTRYYKNNFSDGFRQDAIDLF  499
            TGA++      G +     + DG  S  R  +NN  D  +Q+AID+ 
Sbjct  456  TGAIQ-----GGSK-----LMDGARSAARTIQNNLLDNSKQEAIDVL  492



Lambda      K        H
   0.322    0.138    0.393 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4291651150


Query= XP_031327365.1 putative nuclease HARBI1 [Photinus pyralis]

Length=349
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q381F5_TRYB2  unnamed protein product                                 34.7    0.14 
Q19058_CAEEL  unnamed protein product                                 32.0    0.76 
Q18496_CAEEL  unnamed protein product                                 32.0    0.88 


>Q381F5_TRYB2 unnamed protein product
Length=1059

 Score = 34.7 bits (78),  Expect = 0.14, Method: Composition-based stats.
 Identities = 20/71 (28%), Positives = 30/71 (42%), Gaps = 9/71 (13%)

Query  197  IVCRWPGASHDSHIFRNSTIRMKFENNEMENSILLGDSGYPL-------CHYLITPINNP  249
            + C  P  S   H+F N  +  + E+  +  +I L   GYP+       C Y    +  P
Sbjct  644  VRCIKPNMSASPHLFENVLVSNQLESTSLLQTIKLKRQGYPVRRSIHDFCRYFFLIM--P  701

Query  250  TNPAEHYFNEC  260
             +PAE Y   C
Sbjct  702  RSPAELYKRHC  712


>Q19058_CAEEL unnamed protein product
Length=298

 Score = 32.0 bits (71),  Expect = 0.76, Method: Compositional matrix adjust.
 Identities = 31/145 (21%), Positives = 66/145 (46%), Gaps = 28/145 (19%)

Query  91   SFQIVAGDFGGLHRTTSGQIIRRVSRAIAELSP-VYIKMPDTVEEMAIIKQGFYAIARFP  149
            +FQ  +G+FGG  RT+  +I    +  + + +P   I+   TV++ A+ + G        
Sbjct  136  TFQTGSGNFGG-DRTSPHEI---KAATVPDRAPDAVIEQKTTVDQAALYRLGS-------  184

Query  150  RVIGAIDCTHIRIQNPGGEHAENFRNRKGFFSINVQAVCDANYKIRNIVCRWPGASHDSH  209
               G ++  H+   +P       F    GF +  +  +C   +  R+++  W G  +DS 
Sbjct  185  ---GDMNPLHV---DP------EFAKMSGFKTPILHGLCSLGFATRHVIAAWAG--NDSD  230

Query  210  IFRNSTIRMKFENNEMENSILLGDS  234
             F+   I+++F +  +    L+ ++
Sbjct  231  KFK--AIKVRFSSPVLPGQTLVTET  253


>Q18496_CAEEL unnamed protein product
Length=680

 Score = 32.0 bits (71),  Expect = 0.88, Method: Compositional matrix adjust.
 Identities = 17/40 (43%), Positives = 25/40 (63%), Gaps = 0/40 (0%)

Query  101  GLHRTTSGQIIRRVSRAIAELSPVYIKMPDTVEEMAIIKQ  140
            GL +T SG++ RR+ R IAE S   I    T+ + ++IKQ
Sbjct  632  GLPKTRSGKVTRRILRKIAEGSESGIGDTTTLVDESVIKQ  671



Lambda      K        H
   0.322    0.138    0.393 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4291651150


Query= XP_031327366.1 uncharacterized protein LOC116158682 [Photinus
pyralis]

Length=531
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q57V79_TRYB2  unnamed protein product                                 50.8    2e-06
Q580M0_TRYB2  unnamed protein product                                 48.1    1e-05
SADA_DICDI  unnamed protein product                                   43.5    5e-04


>Q57V79_TRYB2 unnamed protein product
Length=873

 Score = 50.8 bits (120),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 36/62 (58%), Gaps = 1/62 (2%)

Query  363  DKQECWICYDLDKPEPLIQPCGCIGDMSSVHHECLRRWLMESSSGSTEALQ-CKVCKQAY  421
            D++ C IC D +  E LI  C CIG +  +H  CL RW +ES+  +   +  C++CK+ +
Sbjct  608  DERICRICRDDETDEKLISACECIGSVRWIHVSCLDRWRIESTKRNLHNVNCCEICKKPF  667

Query  422  QV  423
             V
Sbjct  668  HV  669


>Q580M0_TRYB2 unnamed protein product
Length=866

 Score = 48.1 bits (113),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 35/76 (46%), Gaps = 8/76 (11%)

Query  363  DKQECWICYDL-DKPEPLIQP--CGCIGDMSSVHHECLRRWLMESSSGSTEALQCKVCKQ  419
            D +ECWIC +  D PE  +    C C G +  VH  CL  W+      S   ++C  C  
Sbjct  86   DARECWICREASDTPENRLTSGLCRCRGSIGLVHTGCLNYWVF-----SQRRVRCPSCNA  140

Query  420  AYQVKETNKLDWEKGF  435
             Y V   +  D+ KGF
Sbjct  141  TYNVISVSSEDFPKGF  156


>SADA_DICDI unnamed protein product
Length=952

 Score = 43.5 bits (101),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%), Gaps = 0/28 (0%)

Query  13   CISDCSGRGECHNGTCVCEIRFSGDHCD  40
            C SDCSG GEC+ GTCVC+  + G  C+
Sbjct  376  CPSDCSGHGECNYGTCVCDHNYQGQGCE  403



Lambda      K        H
   0.322    0.138    0.393 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4291651150


Query= XP_031327367.1 uncharacterized protein LOC116158682 [Photinus
pyralis]

Length=531
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q57V79_TRYB2  unnamed protein product                                 50.8    2e-06
Q580M0_TRYB2  unnamed protein product                                 48.1    1e-05
SADA_DICDI  unnamed protein product                                   43.5    5e-04


>Q57V79_TRYB2 unnamed protein product
Length=873

 Score = 50.8 bits (120),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 36/62 (58%), Gaps = 1/62 (2%)

Query  363  DKQECWICYDLDKPEPLIQPCGCIGDMSSVHHECLRRWLMESSSGSTEALQ-CKVCKQAY  421
            D++ C IC D +  E LI  C CIG +  +H  CL RW +ES+  +   +  C++CK+ +
Sbjct  608  DERICRICRDDETDEKLISACECIGSVRWIHVSCLDRWRIESTKRNLHNVNCCEICKKPF  667

Query  422  QV  423
             V
Sbjct  668  HV  669


>Q580M0_TRYB2 unnamed protein product
Length=866

 Score = 48.1 bits (113),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 35/76 (46%), Gaps = 8/76 (11%)

Query  363  DKQECWICYDL-DKPEPLIQP--CGCIGDMSSVHHECLRRWLMESSSGSTEALQCKVCKQ  419
            D +ECWIC +  D PE  +    C C G +  VH  CL  W+      S   ++C  C  
Sbjct  86   DARECWICREASDTPENRLTSGLCRCRGSIGLVHTGCLNYWVF-----SQRRVRCPSCNA  140

Query  420  AYQVKETNKLDWEKGF  435
             Y V   +  D+ KGF
Sbjct  141  TYNVISVSSEDFPKGF  156


>SADA_DICDI unnamed protein product
Length=952

 Score = 43.5 bits (101),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%), Gaps = 0/28 (0%)

Query  13   CISDCSGRGECHNGTCVCEIRFSGDHCD  40
            C SDCSG GEC+ GTCVC+  + G  C+
Sbjct  376  CPSDCSGHGECNYGTCVCDHNYQGQGCE  403



Lambda      K        H
   0.322    0.138    0.393 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4291651150


Query= XP_031327368.1 uncharacterized protein LOC116158683 [Photinus
pyralis]

Length=531
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q57V79_TRYB2  unnamed protein product                                 50.8    2e-06
Q580M0_TRYB2  unnamed protein product                                 48.1    1e-05
SADA_DICDI  unnamed protein product                                   43.5    5e-04


>Q57V79_TRYB2 unnamed protein product
Length=873

 Score = 50.8 bits (120),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 36/62 (58%), Gaps = 1/62 (2%)

Query  363  DKQECWICYDLDKPEPLIQPCGCIGDMSSVHHECLRRWLMESSSGSTEALQ-CKVCKQAY  421
            D++ C IC D +  E LI  C CIG +  +H  CL RW +ES+  +   +  C++CK+ +
Sbjct  608  DERICRICRDDETDEKLISACECIGSVRWIHVSCLDRWRIESTKRNLHNVNCCEICKKPF  667

Query  422  QV  423
             V
Sbjct  668  HV  669


>Q580M0_TRYB2 unnamed protein product
Length=866

 Score = 48.1 bits (113),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 35/76 (46%), Gaps = 8/76 (11%)

Query  363  DKQECWICYDL-DKPEPLIQP--CGCIGDMSSVHHECLRRWLMESSSGSTEALQCKVCKQ  419
            D +ECWIC +  D PE  +    C C G +  VH  CL  W+      S   ++C  C  
Sbjct  86   DARECWICREASDTPENRLTSGLCRCRGSIGLVHTGCLNYWVF-----SQRRVRCPSCNA  140

Query  420  AYQVKETNKLDWEKGF  435
             Y V   +  D+ KGF
Sbjct  141  TYNVISVSSEDFPKGF  156


>SADA_DICDI unnamed protein product
Length=952

 Score = 43.5 bits (101),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%), Gaps = 0/28 (0%)

Query  13   CISDCSGRGECHNGTCVCEIRFSGDHCD  40
            C SDCSG GEC+ GTCVC+  + G  C+
Sbjct  376  CPSDCSGHGECNYGTCVCDHNYQGQGCE  403



Lambda      K        H
   0.322    0.138    0.393 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4291651150


Query= XP_031327369.1 uncharacterized protein LOC116158684 [Photinus
pyralis]

Length=276
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

NITO_DROME  unnamed protein product                                   30.0    2.5  


>NITO_DROME unnamed protein product
Length=793

 Score = 30.0 bits (66),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 25/47 (53%), Gaps = 7/47 (15%)

Query  41   PGRSHKRGVRYKGRRHLHSSAERSRSRSPVDIRPSSSRVPVSDSDAS  87
            PG S+ RG R   R       ERSRSRSP+      +R P SDSD S
Sbjct  572  PGESYDRGARSSSRE---PGVERSRSRSPL----KRARSPGSDSDTS  611



Lambda      K        H
   0.322    0.138    0.393 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4291651150


Query= XP_031327370.1 uncharacterized protein LOC116158685 [Photinus
pyralis]

Length=140
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VEC5_DROME  unnamed protein product                                 27.7    4.2  
RFA1_DROME  unnamed protein product                                   26.9    7.4  
Q54YR8_DICDI  unnamed protein product                                 26.6    7.9  


>Q9VEC5_DROME unnamed protein product
Length=971

 Score = 27.7 bits (60),  Expect = 4.2, Method: Compositional matrix adjust.
 Identities = 15/62 (24%), Positives = 28/62 (45%), Gaps = 2/62 (3%)

Query  57   RGPSIPDTKQFRNYITCIYRELGMISNDGHFQEMVIMKKADYLTYNLVKRCVGKANPEKE  116
            RG ++P++   RN I  +   +    N  H  E+V+      L   ++  CVG   P  +
Sbjct  836  RGMTLPESGAIRNSIQFLTHFVMQSRNHAHVTEVVLATGEQTLYTAMM--CVGYLTPRSQ  893

Query  117  LE  118
            ++
Sbjct  894  VD  895


>RFA1_DROME unnamed protein product
Length=603

 Score = 26.9 bits (58),  Expect = 7.4, Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 33/70 (47%), Gaps = 11/70 (16%)

Query  61   IPDTKQFRNYITCIYRELGMISNDGHFQEMVIMKKADYLTYNLVKRCVGK----------  110
            I D K F +Y   +  +L ++ ++G  +E  I++   Y+T  + K   GK          
Sbjct  46   ISDGKYFNSY-AMLASQLNVMQHNGELEEFTIVQLDKYVTSLVGKDGAGKRVLIISELTV  104

Query  111  ANPEKELESK  120
             NP  E++SK
Sbjct  105  VNPGAEVKSK  114


>Q54YR8_DICDI unnamed protein product
Length=270

 Score = 26.6 bits (57),  Expect = 7.9, Method: Compositional matrix adjust.
 Identities = 17/66 (26%), Positives = 28/66 (42%), Gaps = 5/66 (8%)

Query  80   MISNDGHFQEMVIMKKADYLTY-----NLVKRCVGKANPEKELESKSFKLCECVVKGLEH  134
            + S    +Q ++   KAD + +     NLV +     +    L+ K F     V+    H
Sbjct  185  LTSKKNQWQHLIFYSKADTIVHSDDIDNLVGKIKNNLSDVNHLDYKCFDDSPHVLHMRSH  244

Query  135  PKFYKD  140
            PK Y+D
Sbjct  245  PKIYED  250



Lambda      K        H
   0.322    0.138    0.393 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4291651150


Query= XP_031327371.1 growth arrest and DNA damage-inducible protein GADD45
alpha [Photinus pyralis]

Length=164
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A1Z6W5_DROME  unnamed protein product                                 93.2    2e-24
Q8MYS8_DROME  unnamed protein product                                 93.2    2e-24
RS12_TRYBB  unnamed protein product                                   33.1    0.050


>A1Z6W5_DROME unnamed protein product
Length=163

 Score = 93.2 bits (230),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/139 (37%), Positives = 80/139 (58%), Gaps = 10/139 (7%)

Query  23   VTGVLTRARVERRLICGLLPAITFLEDNPDGALLCMLSQTRPGDAATHIQTVLLQAFCYE  82
            +   L RA+ E R+I GL  AI  L  +P+G+L C+++Q + GD+ATH+  VLL+AFCYE
Sbjct  35   IKSALLRAQSEARVIVGLSAAINVLSKSPEGSLFCLMAQPKDGDSATHMHEVLLEAFCYE  94

Query  83   NFIPVIQVDSSEKLADLCGLSEGKGRNSECFCAIITTDTNNELNPDEDPPLSPSEQKLAD  142
            N I VI+VD + KL+ + G        S C    +  D      P+E   L+ +E +L D
Sbjct  95   NDIYVIKVDDATKLSRILG---QDSVESCCLVQKVWADA-----PEEQ--LTKAENQLVD  144

Query  143  FYECTLEEYPRPVIHLPSL  161
            + E   +   +P++ LP++
Sbjct  145  YCEAHWDAPQQPIVQLPAV  163


>Q8MYS8_DROME unnamed protein product
Length=163

 Score = 93.2 bits (230),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/139 (37%), Positives = 80/139 (58%), Gaps = 10/139 (7%)

Query  23   VTGVLTRARVERRLICGLLPAITFLEDNPDGALLCMLSQTRPGDAATHIQTVLLQAFCYE  82
            +   L RA+ E R+I GL  AI  L  +P+G+L C+++Q + GD+ATH+  VLL+AFCYE
Sbjct  35   IKSALLRAQSEARVIVGLSAAINVLSKSPEGSLFCLMAQPKDGDSATHMHEVLLEAFCYE  94

Query  83   NFIPVIQVDSSEKLADLCGLSEGKGRNSECFCAIITTDTNNELNPDEDPPLSPSEQKLAD  142
            N I VI+VD + KL+ + G        S C    +  D      P+E   L+ +E +L D
Sbjct  95   NDIYVIKVDDATKLSRILG---QDSVESCCLVQKVWADA-----PEEQ--LTKAENQLVD  144

Query  143  FYECTLEEYPRPVIHLPSL  161
            + E   +   +P++ LP++
Sbjct  145  YCEAHWDAPQQPIVQLPAV  163


>RS12_TRYBB unnamed protein product
Length=144

 Score = 33.1 bits (74),  Expect = 0.050, Method: Compositional matrix adjust.
 Identities = 30/94 (32%), Positives = 43/94 (46%), Gaps = 11/94 (12%)

Query  26   VLTRARVERRLICGLLPAITFLEDNPDGALLCMLSQTRPGDAATHIQTVLLQAFCYENFI  85
            VL +AR    LICGL      L+     A LC+L+     D        L+ A   +N I
Sbjct  36   VLMKARETNGLICGLSEVTRALDRRT--AHLCVLAD----DCEDEEYKKLVTALAKQNNI  89

Query  86   PVIQVDSSEKLADLCGL----SEGKGRNS-ECFC  114
             ++ +D  EKLA   GL    ++G  R + +C C
Sbjct  90   DLVSMDEREKLAQWAGLTRMAADGSVRKTLKCSC  123



Lambda      K        H
   0.322    0.138    0.393 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4291651150


Query= XP_031327372.1 uncharacterized protein LOC116158687 isoform X1
[Photinus pyralis]

Length=230
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A8JUS1_DROME  unnamed protein product                                 52.8    5e-08
A8WH76_DROME  unnamed protein product                                 38.9    3e-04
Q54QX7_DICDI  unnamed protein product                                 29.3    3.2  


>A8JUS1_DROME unnamed protein product
Length=353

 Score = 52.8 bits (125),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 31/38 (82%), Gaps = 2/38 (5%)

Query  48  RKQQS--KLVRCLTVLAYVLSVSLAAIILSVYYIFVWE  83
           + QQS  K++R LTV  YVL VSLAAI+LS+YYIF+W+
Sbjct  25  QPQQSNRKVIRILTVAVYVLCVSLAAIMLSLYYIFIWD  62


>A8WH76_DROME unnamed protein product
Length=81

 Score = 38.9 bits (89),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/49 (37%), Positives = 29/49 (59%), Gaps = 4/49 (8%)

Query  37  IAKPSKSTFYGRKQQSKLVRCLTVLAYVLSVSLAAIILSVYYIFVWEGK  85
           I  P  + F+    +SK  R LT+L Y+  VS   + L+VYY+F+W+ +
Sbjct  23  IPMPKSNDFF----ESKTFRLLTLLLYMGGVSGMGLTLAVYYLFIWDSR  67


>Q54QX7_DICDI unnamed protein product
Length=1290

 Score = 29.3 bits (64),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 10/16 (63%), Positives = 12/16 (75%), Gaps = 0/16 (0%)

Query  76    VYYIFVWEGKPSLSYN  91
             +YY F+WEGK S  YN
Sbjct  1113  IYYGFIWEGKNSFRYN  1128



Lambda      K        H
   0.322    0.138    0.393 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4291651150


Query= XP_031327373.1 uncharacterized protein LOC116158687 isoform X2
[Photinus pyralis]

Length=215
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A8JUS1_DROME  unnamed protein product                                 52.4    5e-08
A8WH76_DROME  unnamed protein product                                 38.9    3e-04
H2FLH3_CAEEL  unnamed protein product                                 29.6    2.6  


>A8JUS1_DROME unnamed protein product
Length=353

 Score = 52.4 bits (124),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 31/38 (82%), Gaps = 2/38 (5%)

Query  33  RKQQS--KLVRCLTVLAYVLSVSLAAIILSVYYIFVWE  68
           + QQS  K++R LTV  YVL VSLAAI+LS+YYIF+W+
Sbjct  25  QPQQSNRKVIRILTVAVYVLCVSLAAIMLSLYYIFIWD  62


>A8WH76_DROME unnamed protein product
Length=81

 Score = 38.9 bits (89),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/49 (37%), Positives = 29/49 (59%), Gaps = 4/49 (8%)

Query  22  IAKPSKSTFYGRKQQSKLVRCLTVLAYVLSVSLAAIILSVYYIFVWEGK  70
           I  P  + F+    +SK  R LT+L Y+  VS   + L+VYY+F+W+ +
Sbjct  23  IPMPKSNDFF----ESKTFRLLTLLLYMGGVSGMGLTLAVYYLFIWDSR  67


>H2FLH3_CAEEL unnamed protein product
Length=6848

 Score = 29.6 bits (65),  Expect = 2.6, Method: Composition-based stats.
 Identities = 20/68 (29%), Positives = 32/68 (47%), Gaps = 13/68 (19%)

Query  68    EGKPSLSY----NSYLRTGSHYAFDNKSYHRKIATKELQR--SRVF-------NGIDSAS  114
             E  P++++    N  +R G     DN  Y  K+  K+++R  S  F       NG D A+
Sbjct  2689  EPAPTVTWHWPDNREIRNGGRVKLDNPEYQSKLVVKQMERGDSGTFTIKAVNANGEDEAT  2748

Query  115   LVINTIQE  122
             + IN I +
Sbjct  2749  VKINVIDK  2756



Lambda      K        H
   0.322    0.138    0.393 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4291651150


Query= XP_031327374.1 uncharacterized protein LOC116158690 isoform X1
[Photinus pyralis]

Length=508
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

E1JIV5_DROME  unnamed protein product                                 31.2    1.8  
Q8T3K5_DROME  unnamed protein product                                 30.8    1.8  
A0A0B4JDB9_DROME  unnamed protein product                             31.2    1.9  


>E1JIV5_DROME unnamed protein product
Length=248

 Score = 31.2 bits (69),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 15/37 (41%), Positives = 22/37 (59%), Gaps = 2/37 (5%)

Query  458  SSQPWYPLFTSLLEGPPIIFKPNRDLLLFNRIPHPLW  494
            S Q W+ L++ L+   P   KP R+LLLF +   P+W
Sbjct  80   SVQQWWSLYSHLIR--PTALKPYRELLLFKQGIIPMW  114


>Q8T3K5_DROME unnamed protein product
Length=223

 Score = 30.8 bits (68),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 15/37 (41%), Positives = 22/37 (59%), Gaps = 2/37 (5%)

Query  458  SSQPWYPLFTSLLEGPPIIFKPNRDLLLFNRIPHPLW  494
            S Q W+ L++ L+   P   KP R+LLLF +   P+W
Sbjct  80   SVQQWWSLYSHLIR--PTALKPYRELLLFKQGIIPMW  114


>A0A0B4JDB9_DROME unnamed protein product
Length=242

 Score = 31.2 bits (69),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 15/37 (41%), Positives = 22/37 (59%), Gaps = 2/37 (5%)

Query  458  SSQPWYPLFTSLLEGPPIIFKPNRDLLLFNRIPHPLW  494
            S Q W+ L++ L+   P   KP R+LLLF +   P+W
Sbjct  80   SVQQWWSLYSHLIR--PTALKPYRELLLFKQGIIPMW  114



Lambda      K        H
   0.322    0.138    0.393 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4291651150


Query= XP_031327375.1 uncharacterized protein LOC116158690 isoform X2
[Photinus pyralis]

Length=391


***** No hits found *****



Lambda      K        H
   0.322    0.138    0.393 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4291651150


Query= XP_031327376.1 galectin-4-like isoform X1 [Photinus pyralis]

Length=332
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9NCX9_DROME  unnamed protein product                                 94.0    2e-21
E1JHP9_DROME  unnamed protein product                                 94.0    3e-21
E1JHQ0_DROME  unnamed protein product                                 94.0    3e-21


>M9NCX9_DROME unnamed protein product
Length=401

 Score = 94.0 bits (232),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 74/143 (52%), Gaps = 4/143 (3%)

Query  18   GGLDPGSMIRIQGAVPENADKFNVNLHCGRPPSDVALHISVRLLQGYIARNSLQDDDWGE  77
            G L  G    + G +  N ++F++NL       DVALHI+ RL Q YI RN+   D WG 
Sbjct  42   GKLSEGISFTVTGNLSVNCERFSINLVYNNDSRDVALHINPRLPQNYIVRNTKVQDIWGN  101

Query  78   EEGDGNL--TIGSGQSFEILILCDPSSYKIAVNGRHFCEFRHRIPFNGVSHLEIEGTVEL  135
            EE    L   +  G+ F I +L   + Y I+VNG+HF  + HRIP+  V  LE++G V  
Sbjct  102  EEVSSALPFLLSRGEEFSIQVLVTEACYMISVNGQHFAAYTHRIPYRDVRILEVKGDV--  159

Query  136  QLIAIESALPAPPPPRQPPPNAD  158
              + ++  L    P R P   A+
Sbjct  160  SNVEMKRTLVLKYPERLPQSEAN  182


 Score = 50.4 bits (119),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 70/144 (49%), Gaps = 17/144 (12%)

Query  15   PIKGGLDPGSMI-----RIQGAVPENADKFNVNLHCGR---PPSDVALHISVRLLQG---  63
            P  G L P S++     +I+G V      F +NL  G+   P   +A H++ R  +    
Sbjct  237  PYYGALPPNSLVDGRCLKIEGRVRLLPHSFYINLQQGQDIWPHPVIAFHLNPRFSKASSG  296

Query  64   -----YIARNSLQDDDWGEEE-GDGNLTIGSGQSFEILILCDPSSYKIAVNGRHFCEFRH  117
                  + RN+  +  W +EE  + +     G+SF + I+C  +S+++ VN +   +F++
Sbjct  297  AIGKAVVCRNAWLNGAWAQEERSEFDTNFRPGRSFCLAIVCTKTSFEVYVNRQFMTDFKY  356

Query  118  RIPFNGVSHLEIEGTVELQLIAIE  141
            ++    V  + I+G V+L  + +E
Sbjct  357  KVSPEVVDTVYIQGDVKLWNVTLE  380


>E1JHP9_DROME unnamed protein product
Length=419

 Score = 94.0 bits (232),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 74/143 (52%), Gaps = 4/143 (3%)

Query  18   GGLDPGSMIRIQGAVPENADKFNVNLHCGRPPSDVALHISVRLLQGYIARNSLQDDDWGE  77
            G L  G    + G +  N ++F++NL       DVALHI+ RL Q YI RN+   D WG 
Sbjct  60   GKLSEGISFTVTGNLSVNCERFSINLVYNNDSRDVALHINPRLPQNYIVRNTKVQDIWGN  119

Query  78   EEGDGNL--TIGSGQSFEILILCDPSSYKIAVNGRHFCEFRHRIPFNGVSHLEIEGTVEL  135
            EE    L   +  G+ F I +L   + Y I+VNG+HF  + HRIP+  V  LE++G V  
Sbjct  120  EEVSSALPFLLSRGEEFSIQVLVTEACYMISVNGQHFAAYTHRIPYRDVRILEVKGDV--  177

Query  136  QLIAIESALPAPPPPRQPPPNAD  158
              + ++  L    P R P   A+
Sbjct  178  SNVEMKRTLVLKYPERLPQSEAN  200


 Score = 50.1 bits (118),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 70/144 (49%), Gaps = 17/144 (12%)

Query  15   PIKGGLDPGSMI-----RIQGAVPENADKFNVNLHCGR---PPSDVALHISVRLLQG---  63
            P  G L P S++     +I+G V      F +NL  G+   P   +A H++ R  +    
Sbjct  255  PYYGALPPNSLVDGRCLKIEGRVRLLPHSFYINLQQGQDIWPHPVIAFHLNPRFSKASSG  314

Query  64   -----YIARNSLQDDDWGEEE-GDGNLTIGSGQSFEILILCDPSSYKIAVNGRHFCEFRH  117
                  + RN+  +  W +EE  + +     G+SF + I+C  +S+++ VN +   +F++
Sbjct  315  AIGKAVVCRNAWLNGAWAQEERSEFDTNFRPGRSFCLAIVCTKTSFEVYVNRQFMTDFKY  374

Query  118  RIPFNGVSHLEIEGTVELQLIAIE  141
            ++    V  + I+G V+L  + +E
Sbjct  375  KVSPEVVDTVYIQGDVKLWNVTLE  398


>E1JHQ0_DROME unnamed protein product
Length=402

 Score = 94.0 bits (232),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 74/143 (52%), Gaps = 4/143 (3%)

Query  18   GGLDPGSMIRIQGAVPENADKFNVNLHCGRPPSDVALHISVRLLQGYIARNSLQDDDWGE  77
            G L  G    + G +  N ++F++NL       DVALHI+ RL Q YI RN+   D WG 
Sbjct  43   GKLSEGISFTVTGNLSVNCERFSINLVYNNDSRDVALHINPRLPQNYIVRNTKVQDIWGN  102

Query  78   EEGDGNL--TIGSGQSFEILILCDPSSYKIAVNGRHFCEFRHRIPFNGVSHLEIEGTVEL  135
            EE    L   +  G+ F I +L   + Y I+VNG+HF  + HRIP+  V  LE++G V  
Sbjct  103  EEVSSALPFLLSRGEEFSIQVLVTEACYMISVNGQHFAAYTHRIPYRDVRILEVKGDV--  160

Query  136  QLIAIESALPAPPPPRQPPPNAD  158
              + ++  L    P R P   A+
Sbjct  161  SNVEMKRTLVLKYPERLPQSEAN  183


 Score = 50.1 bits (118),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/145 (25%), Positives = 70/145 (48%), Gaps = 17/145 (12%)

Query  15   PIKGGLDPGSMI-----RIQGAVPENADKFNVNLHCGR---PPSDVALHISVRLLQG---  63
            P  G L P S++     +I+G V      F +NL  G+   P   +A H++ R  +    
Sbjct  238  PYYGALPPNSLVDGRCLKIEGRVRLLPHSFYINLQQGQDIWPHPVIAFHLNPRFSKASSG  297

Query  64   -----YIARNSLQDDDWGEEE-GDGNLTIGSGQSFEILILCDPSSYKIAVNGRHFCEFRH  117
                  + RN+  +  W +EE  + +     G+SF + I+C  +S+++ VN +   +F++
Sbjct  298  AIGKAVVCRNAWLNGAWAQEERSEFDTNFRPGRSFCLAIVCTKTSFEVYVNRQFMTDFKY  357

Query  118  RIPFNGVSHLEIEGTVELQLIAIES  142
            ++    V  + I+G V+L  + +E 
Sbjct  358  KVSPEVVDTVYIQGDVKLWNVTLEK  382



Lambda      K        H
   0.322    0.138    0.393 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4291651150


Query= XP_031327377.1 galectin-4-like isoform X2 [Photinus pyralis]

Length=295
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8I4A5_CAEEL  unnamed protein product                                 91.7    8e-22
M9NCX9_DROME  unnamed protein product                                 94.0    1e-21
E1JHQ0_DROME  unnamed protein product                                 94.0    1e-21


>Q8I4A5_CAEEL unnamed protein product
Length=221

 Score = 91.7 bits (226),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 72/132 (55%), Gaps = 4/132 (3%)

Query  10   VPFVGPIKGGLDPGSMIRIQGAVPENADKFNVNLHCGRPP---SDVALHISVRLLQGYIA  66
            +P+   +   ++PG  + I+G   + + +FN+NLH   P    +DV LH+S+R  +G I 
Sbjct  13   IPYRSKLTERIEPGQTLIIRGKTIDESKRFNINLHKDSPDFSGNDVPLHLSIRFDEGKIV  72

Query  67   RNSLQDDDWGEEEGDGNLTIGSGQSFEILILCDPSSYKIAVNGRHFCEFRHRIPFNGVSH  126
             N+     WG+EE   N  I  G  F+I I    S +++++N +    F HRIP N VSH
Sbjct  73   YNAYTKGTWGKEERAKN-PIKKGDDFDIRIRAHDSKFQVSINHKEVKNFEHRIPLNSVSH  131

Query  127  LEIEGTVELQLI  138
            L I+G V L  +
Sbjct  132  LSIDGDVVLNHV  143


 Score = 30.4 bits (67),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 23/42 (55%), Gaps = 2/42 (5%)

Query  19   GLDPGSMIRIQGAVPENADKFNVNLHCGRPPSDVALHISVRL  60
            GL PG  + + G   + A KFN+NL   +   D+ALH + R 
Sbjct  162  GLVPGKTLVVYGTPEKKAKKFNINL--LKKNGDIALHFNPRF  201


>M9NCX9_DROME unnamed protein product
Length=401

 Score = 94.0 bits (232),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 74/143 (52%), Gaps = 4/143 (3%)

Query  18   GGLDPGSMIRIQGAVPENADKFNVNLHCGRPPSDVALHISVRLLQGYIARNSLQDDDWGE  77
            G L  G    + G +  N ++F++NL       DVALHI+ RL Q YI RN+   D WG 
Sbjct  42   GKLSEGISFTVTGNLSVNCERFSINLVYNNDSRDVALHINPRLPQNYIVRNTKVQDIWGN  101

Query  78   EEGDGNL--TIGSGQSFEILILCDPSSYKIAVNGRHFCEFRHRIPFNGVSHLEIEGTVEL  135
            EE    L   +  G+ F I +L   + Y I+VNG+HF  + HRIP+  V  LE++G V  
Sbjct  102  EEVSSALPFLLSRGEEFSIQVLVTEACYMISVNGQHFAAYTHRIPYRDVRILEVKGDV--  159

Query  136  QLIAIESALPAPPPPRQPPPNAD  158
              + ++  L    P R P   A+
Sbjct  160  SNVEMKRTLVLKYPERLPQSEAN  182


 Score = 50.8 bits (120),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 36/145 (25%), Positives = 70/145 (48%), Gaps = 17/145 (12%)

Query  15   PIKGGLDPGSMI-----RIQGAVPENADKFNVNLHCGR---PPSDVALHISVRLLQG---  63
            P  G L P S++     +I+G V      F +NL  G+   P   +A H++ R  +    
Sbjct  237  PYYGALPPNSLVDGRCLKIEGRVRLLPHSFYINLQQGQDIWPHPVIAFHLNPRFSKASSG  296

Query  64   -----YIARNSLQDDDWGEEE-GDGNLTIGSGQSFEILILCDPSSYKIAVNGRHFCEFRH  117
                  + RN+  +  W +EE  + +     G+SF + I+C  +S+++ VN +   +F++
Sbjct  297  AIGKAVVCRNAWLNGAWAQEERSEFDTNFRPGRSFCLAIVCTKTSFEVYVNRQFMTDFKY  356

Query  118  RIPFNGVSHLEIEGTVELQLIAIES  142
            ++    V  + I+G V+L  + +E 
Sbjct  357  KVSPEVVDTVYIQGDVKLWNVTLEK  381


>E1JHQ0_DROME unnamed protein product
Length=402

 Score = 94.0 bits (232),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 74/143 (52%), Gaps = 4/143 (3%)

Query  18   GGLDPGSMIRIQGAVPENADKFNVNLHCGRPPSDVALHISVRLLQGYIARNSLQDDDWGE  77
            G L  G    + G +  N ++F++NL       DVALHI+ RL Q YI RN+   D WG 
Sbjct  43   GKLSEGISFTVTGNLSVNCERFSINLVYNNDSRDVALHINPRLPQNYIVRNTKVQDIWGN  102

Query  78   EEGDGNL--TIGSGQSFEILILCDPSSYKIAVNGRHFCEFRHRIPFNGVSHLEIEGTVEL  135
            EE    L   +  G+ F I +L   + Y I+VNG+HF  + HRIP+  V  LE++G V  
Sbjct  103  EEVSSALPFLLSRGEEFSIQVLVTEACYMISVNGQHFAAYTHRIPYRDVRILEVKGDV--  160

Query  136  QLIAIESALPAPPPPRQPPPNAD  158
              + ++  L    P R P   A+
Sbjct  161  SNVEMKRTLVLKYPERLPQSEAN  183


 Score = 50.8 bits (120),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 36/145 (25%), Positives = 70/145 (48%), Gaps = 17/145 (12%)

Query  15   PIKGGLDPGSMI-----RIQGAVPENADKFNVNLHCGR---PPSDVALHISVRLLQG---  63
            P  G L P S++     +I+G V      F +NL  G+   P   +A H++ R  +    
Sbjct  238  PYYGALPPNSLVDGRCLKIEGRVRLLPHSFYINLQQGQDIWPHPVIAFHLNPRFSKASSG  297

Query  64   -----YIARNSLQDDDWGEEE-GDGNLTIGSGQSFEILILCDPSSYKIAVNGRHFCEFRH  117
                  + RN+  +  W +EE  + +     G+SF + I+C  +S+++ VN +   +F++
Sbjct  298  AIGKAVVCRNAWLNGAWAQEERSEFDTNFRPGRSFCLAIVCTKTSFEVYVNRQFMTDFKY  357

Query  118  RIPFNGVSHLEIEGTVELQLIAIES  142
            ++    V  + I+G V+L  + +E 
Sbjct  358  KVSPEVVDTVYIQGDVKLWNVTLEK  382



Lambda      K        H
   0.322    0.138    0.393 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4291651150


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jan 28, 2021  9:24 PM
  Number of letters in database: 17,197,330
  Number of sequences in database:  25,232



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= XP_031327378.1 uncharacterized protein LOC116158689 [Photinus
pyralis]

Length=373
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VSB8_DROME  unnamed protein product                                 75.1    8e-15
Q5BHZ5_DROME  unnamed protein product                                 68.9    7e-13
Q9VYJ6_DROME  unnamed protein product                                 68.9    7e-13


>Q9VSB8_DROME unnamed protein product
Length=348

 Score = 75.1 bits (183),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 60/102 (59%), Gaps = 4/102 (4%)

Query  7    FIKDFIELYQKHKCLWKIKDSSYANKALRAKAYQELLELYKTVDSEATVESVKNKINNMR  66
            +++ FI+ Y+    LW      Y N+  RA+AY  L+ +Y  +  +ATVE VK KIN +R
Sbjct  22   YLRAFIQTYRDLPVLWDTSLRDYTNREKRAEAYLRLVPIYHYLKRDATVEDVKKKINTLR  81

Query  67   SAFRKELKKVKMSKRSGSSADEIYTPSLWYYDLLLFTTDQEE  108
            + +RKELK V+ + RSGS    +++P  W +  L F  + E+
Sbjct  82   TNYRKELKVVESALRSGS----LHSPRCWTFQELDFLRNSEK  119


>Q5BHZ5_DROME unnamed protein product
Length=319

 Score = 68.9 bits (167),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 56/102 (55%), Gaps = 7/102 (7%)

Query  1    MANQPSFIKDFIELYQKHKCLWKIKDSSYANKALRAKAYQELLELYKTVDSEATVESVKN  60
            + ++P  +++FI  YQ    LW      Y +K  +   YQELL++ + V+S  +++ VK 
Sbjct  9    LYDEPEIMEEFISCYQYFTALWDSSSPDYLSKQKKEPGYQELLKILRRVNSNCSIQDVKR  68

Query  61   KINNMRSAFRKELKKVKMSKRSGSSADEIYTPSLWYYDLLLF  102
            KIN++R  +R+E KKV+ S          Y   LW++ L+ F
Sbjct  69   KINSLRCCYRREFKKVQESVNG-------YQTRLWWFHLMDF  103


 Score = 35.4 bits (80),  Expect = 0.053, Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 25/41 (61%), Gaps = 0/41 (0%)

Query  192  EFKTVGANVAWKLQRMEKNQRDIAEHLINTILHYGITNKLS  232
            E + +G  +A   +RM  +QR  AE +I+ +L YG  N+LS
Sbjct  269  ECELIGKRMASHFRRMRPDQRLFAERIISEVLVYGRMNRLS  309


>Q9VYJ6_DROME unnamed protein product
Length=339

 Score = 68.9 bits (167),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 57/97 (59%), Gaps = 7/97 (7%)

Query  21   LWKIKDSSYANKALRAKAYQELLELYKTVDSEATVESVKNKINNMRSAFRKELKKVKMSK  80
            LW ++   Y ++ L+ ++Y  LLEL +T DS A + ++K KINN R+++R+EL+KV    
Sbjct  4    LWLVRSKLYRDRQLKLESYSRLLELLRTTDSYANIHTLKRKINNFRTSYRRELRKV---L  60

Query  81   RSGSSADEIYTPSLWYYDLLLFTTDQEECRETLSSCV  117
             SG++    Y P+LWY+  L F  + E     L   V
Sbjct  61   DSGNT----YKPTLWYFKELDFLYELETGELQLEGIV  93


 Score = 34.7 bits (78),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 25/41 (61%), Gaps = 0/41 (0%)

Query  192  EFKTVGANVAWKLQRMEKNQRDIAEHLINTILHYGITNKLS  232
            E + +G  +A   +RM  +QR  AE +I+ +L YG  N+LS
Sbjct  289  ECELIGKRMASHFRRMRPDQRLFAERIISEVLVYGRMNRLS  329



Lambda      K        H
   0.310    0.123    0.348 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3920191338


Query= XP_031327379.1 pyrimidodiazepine synthase-like [Photinus pyralis]

Length=243
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VSL6_DROME  unnamed protein product                                 223     7e-73
SEPIA_DROME  unnamed protein product                                  209     5e-68
Q9VSL2_DROME  unnamed protein product                                 196     1e-62


>Q9VSL6_DROME unnamed protein product
Length=254

 Score = 223 bits (567),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 121/242 (50%), Positives = 160/242 (66%), Gaps = 7/242 (3%)

Query  4    KHLSKGSKLPP-PVRGKIRLYSNRFCAYAQRVHLVLDAKKIPYDVVYINLSSIPDWFYEK  62
            +HL+ GS  P  P  G ++LYS RFC YA RVHLVLDAKKIPY  +YINL   P+WF   
Sbjct  5    QHLTIGSPKPVFPDDGILKLYSMRFCPYAHRVHLVLDAKKIPYHAIYINLRDKPEWFSLV  64

Query  63   SPLGKVPALEV--ESGD-VIYESLIIADYLEDIWTTHPLYPRDPLQKAKDRILVDQFNKV  119
            S   KVPALE+  E G+ V+ ESLII DYL++ +   PLYP+D L+KA+++IL+++F + 
Sbjct  65   SSSTKVPALELVKEQGNPVLIESLIICDYLDEKYPEVPLYPKDLLKKAQEKILIERFGQF  124

Query  120  INAMFKLILNTNRSYIEDYRSIIVEGLASFENELKRREGPFFSGHKPGMLDYMIWPWCER  179
            INA + L+L+ N   + D  +    GL  +E ELKRR   FF G  PGMLDYM+WPWCER
Sbjct  125  INAFYYLLLHDNPEQLVD--TDHYAGLVVYEEELKRRCTKFFGGDSPGMLDYMMWPWCER  182

Query  180  ADLLK-LFGSHFTIKPDYYKKLMEWRTLMRDDPAVKKSYIDSATHIRYVQSYRAGVPDYD  238
             D LK  F   F + P+ +  L++WR LM  D AVK  Y+D  TH +Y+ S R+G  DY+
Sbjct  183  FDSLKYTFEQKFELSPERFPTLIKWRDLMIQDRAVKCFYLDGQTHAKYMNSRRSGQADYN  242

Query  239  MV  240
            M+
Sbjct  243  ML  244


>SEPIA_DROME unnamed protein product
Length=243

 Score = 209 bits (533),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 110/243 (45%), Positives = 159/243 (65%), Gaps = 12/243 (5%)

Query  4    KHLSKGSKLPP-PVRGKIRLYSNRFCAYAQRVHLVLDAKKIPYDVVYINLSSIPDWFYEK  62
            +HL+KGS +P  P  G +RLYS RFC +AQRVHLVLDAK+IPY  +YINL+  P+W  EK
Sbjct  5    RHLAKGSPMPDVPEDGILRLYSMRFCPFAQRVHLVLDAKQIPYHSIYINLTDKPEWLLEK  64

Query  63   SPLGKVPALEV--ESG-DVIYESLIIADYLEDIWTTHPLYPRDPLQKAKDRILVDQFNKV  119
            +P GKVPALE+  E G  V+ ESL+I +YL++ +   PLYPRDPL+K +D++L+++F  V
Sbjct  65   NPQGKVPALEIVREPGPPVLTESLLICEYLDEQYPLRPLYPRDPLKKVQDKLLIERFRAV  124

Query  120  INAMFKLILNTNRSYIEDYRSIIVEGLASFENELKRREGPFFSGHKPGMLDYMIWPWCER  179
            + A FK    ++   +E + S    GL  +E EL RR   FF G + G+LDYMIWPWCER
Sbjct  125  LGAFFK---ASDGGDLEPFWS----GLDIYERELARRGTEFFGGEQTGILDYMIWPWCER  177

Query  180  ADLLKL-FGSHFTIKPDYYKKLMEWRTLMRDDPAVKKSYIDSATHIRYVQSYRAGVPDYD  238
             +LLKL  G  +      + +L  W   M+ DPAV   Y+++     ++++   G P+Y+
Sbjct  178  LELLKLQRGEDYNYDQSRFPQLTLWLERMKRDPAVMAFYMEAEVQAEFLRTRSLGRPNYN  237

Query  239  MVI  241
            +++
Sbjct  238  LLV  240


>Q9VSL2_DROME unnamed protein product
Length=241

 Score = 196 bits (498),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/244 (43%), Positives = 156/244 (64%), Gaps = 11/244 (5%)

Query  2    SPKHLSKGSKLPP-PVRGKIRLYSNRFCAYAQRVHLVLDAKKIPYDVVYINLSSIPDWFY  60
            S KHL+KGS  P  P  G +RLYS RFC YAQR HLVL+AK +PY  VYINL+  P+W  
Sbjct  3    SGKHLAKGSPKPVLPDDGVLRLYSMRFCPYAQRAHLVLNAKNVPYHSVYINLTEKPEWLV  62

Query  61   EKSPLGKVPALEV--ESGD-VIYESLIIADYLEDIWTTHPLYPRDPLQKAKDRILVDQFN  117
            E SPL KVPAL++  E G+  + ESLIIA+YL+D +  +PL P+DPL++A+D+IL+++F+
Sbjct  63   EVSPLLKVPALQLVAEKGEPSLIESLIIAEYLDDKYPENPLLPKDPLKRAQDKILLERFS  122

Query  118  KVINAMFKLILNTNRSYIEDYRSIIVEGLASFENELKRREGPFFSGHKPGMLDYMIWPWC  177
             + +A   +++    + +EDY +     L  FE EL +R  P+F G+KPG +DYMIWPW 
Sbjct  123  SITSAFINILVQG--TGLEDYWT----ALDIFEEELTKRGTPYFGGNKPGFVDYMIWPWF  176

Query  178  ERADLLKL-FGSHFTIKPDYYKKLMEWRTLMRDDPAVKKSYIDSATHIRYVQSYRAGVPD  236
            ER  +++L     +      + K+ +W  L++ D  V+  Y     H  + ++ +AG  +
Sbjct  177  ERLSVIELKLQKEYNFNESRFPKITKWIALLKADSVVQSFYATPEQHNEFWRTRKAGNAN  236

Query  237  YDMV  240
            YD++
Sbjct  237  YDLL  240



Lambda      K        H
   0.310    0.123    0.348 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3920191338


Query= XP_031327380.1 uncharacterized protein LOC116158693 [Photinus
pyralis]

Length=783
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q583R3_TRYB2  unnamed protein product                                 36.6    0.086
MICAL_DROME  unnamed protein product                                  32.3    2.0  
VA0D2_DROME  unnamed protein product                                  32.0    2.1  


>Q583R3_TRYB2 unnamed protein product
Length=761

 Score = 36.6 bits (83),  Expect = 0.086, Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 58/144 (40%), Gaps = 30/144 (21%)

Query  338  KQSDKVIRTALRNANNSVVPVPDL--RCRKQP---HNKIDDEVIRNHIVSYNPTISHYRR  392
            K   +V+   L+     V PVP    R  ++P    + +   +  +H VSY P    +R 
Sbjct  94   KVHGRVLAQELKKLYEFVCPVPKCWRRGEQEPFCEQHHLHAHLKYDHEVSYCPICLQHRS  153

Query  393  EH-APQRLYLPSDLTFAALHQDFLTKHPDLKISYEKYRVVAKKMNISLANLGHEECESCE  451
               A Q +Y P  L    LH                  +V +  +   + LGH  C  C+
Sbjct  154  VFLAEQMVYSPEAL---CLH------------------MVGEYEHDPASFLGHPPCRFCK  192

Query  452  GFSLHDKSHTKDNLEE---TCDVC  472
            G  ++D+ H   ++ E   TCD+C
Sbjct  193  GMHMYDEDHLLKHMRERHFTCDIC  216


>MICAL_DROME unnamed protein product
Length=4723

 Score = 32.3 bits (72),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 24/90 (27%), Positives = 44/90 (49%), Gaps = 5/90 (6%)

Query  131   SFMTEVRNSELETVTELFESTRSFMTEV-RNSELETVTELFESITEAVEPPVQGEVVVAD  189
             S +   R+SE+    +L +   + + ++ +  E E V ELF+S+ E +E   Q   +V  
Sbjct  2166  SLIMSRRHSEISLNEKLNQDALAALNQIEKEREAEQVDELFQSMVEEMEQEPQPTAIVEP  2225

Query  190   PDDFVDIDGAGV----SNNASVVQYTKKGT  215
             P++ +D D        S +A  V   K+G+
Sbjct  2226  PEEDIDADSLCTTISKSPSAQPVTVVKRGS  2255


>VA0D2_DROME unnamed protein product
Length=350

 Score = 32.0 bits (71),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 16/60 (27%), Positives = 28/60 (47%), Gaps = 11/60 (18%)

Query  534  ESFVPIGKKKNSKTFAAVWHDALFKRSKDEIISAFYQFVLMKRDAVKITLWLDNCSAQNK  593
            + F+ +  KKN +TF   +H              FY F+ +K+  V+  +W+  C AQ +
Sbjct  289  DRFLMMEAKKNVQTFLQQYH-----------FGIFYSFIKLKQLEVRNIVWISECIAQRQ  337



Lambda      K        H
   0.310    0.123    0.348 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3920191338


Query= XP_031327381.1 uncharacterized protein LOC116158694 [Photinus
pyralis]

Length=480
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VJ27_DROME  unnamed protein product                                 47.4    2e-05
Q9VGA4_DROME  unnamed protein product                                 38.1    0.017
Q9W151_DROME  unnamed protein product                                 28.5    6.1  


>Q9VJ27_DROME unnamed protein product
Length=762

 Score = 47.4 bits (111),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 52/112 (46%), Gaps = 16/112 (14%)

Query  4    TFCCVPGCNSLKRRTPDISFHKFPNVNDTVRIQTKLGVW-EIVNRRYIWKTKLRIGKNIS  62
              C V  C+        ISFH+FP      + +  L  W E   R   W          S
Sbjct  3    AHCAVINCSHKYVHAGSISFHRFP-----FKRKDLLQKWKEFTQRSAQWMP--------S  49

Query  63   EFMKVCSLHFTENDFFTIRQRRNLKKNVIPTMCLP--NPVHGSVQELAPSNR  112
            ++  +CS HF + DF     R+ LKKN +P++ +   + + G +++++PSNR
Sbjct  50   KWSALCSRHFGDEDFNCSNNRKTLKKNAVPSIRVSEDDSMSGHLEQVSPSNR  101


>Q9VGA4_DROME unnamed protein product
Length=1169

 Score = 38.1 bits (87),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 45/92 (49%), Gaps = 16/92 (17%)

Query  6   CCVPGCNSLKR--RTPDISFHKFPNVNDTVRIQTKLGVWEIVNRRYIWKTKLRIGKNISE  63
           CCV  C S  R      +++H FP ++  +R      +W       I  +++ + + I++
Sbjct  5   CCVANCPSTSRLLEHNGVTYHSFP-LDPIIR-----AIW-------IKNSRISLERQITK  51

Query  64  FMKVCSLHFTENDFFTIRQRRN-LKKNVIPTM  94
            + VCS HF   DF TIR  +  LK  V PT+
Sbjct  52  SVLVCSRHFRRLDFNTIRNGKYLLKPRVFPTV  83


>Q9W151_DROME unnamed protein product
Length=119

 Score = 28.5 bits (62),  Expect = 6.1, Method: Compositional matrix adjust.
 Identities = 11/27 (41%), Positives = 16/27 (59%), Gaps = 0/27 (0%)

Query  208  FILLDEICASIAIIYKDVRIHKLCVKD  234
            F  LD IC     ++++  IH+LC KD
Sbjct  49   FFRLDRICEDCYQLFRETSIHRLCKKD  75



Lambda      K        H
   0.310    0.123    0.348 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3920191338


Query= XP_031327382.1 uncharacterized protein LOC116158695 [Photinus
pyralis]

Length=455
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CBD1_CAEEL  unnamed protein product                                   30.0    5.0  
MUP4_CAEEL  unnamed protein product                                   29.6    7.8  
Q57UM9_TRYB2  unnamed protein product                                 29.3    8.0  


>CBD1_CAEEL unnamed protein product
Length=1319

 Score = 30.0 bits (66),  Expect = 5.0, Method: Compositional matrix adjust.
 Identities = 36/139 (26%), Positives = 57/139 (41%), Gaps = 12/139 (9%)

Query  55    LQTSALQSAPHKIEGTLVHDDEKWVVEKFACSCKAGQSGRCKHISAVLLQCSRT---SLD  111
             + T+   + P + EG   H D + V     CS K     RC + ++ L QCS     S D
Sbjct  1092  IATTPAPAQPKQFEGRCAHVDGEAVFSIGVCSSKY---LRCSYGASKLQQCSEDRVFSND  1148

Query  112   KLEAVSQTDIKCTWSAQKGKTQDKYRAIPVKEMPCIKQSDGMKLDE----AILMGIHDNL  167
             KLE + +  +    +  K  +  KY     +   C  + DG+  +E    AIL      L
Sbjct  1149  KLECIVRESVS-ACTVPKNPSIKKYYTSNDQSAFCDGKEDGLYRNERDCSAILQCFGGEL  1207

Query  168   VSKLP-NSALALHKAGRRC  185
                    S+LA ++   +C
Sbjct  1208  FEHPSCQSSLAFNQLTGKC  1226


>MUP4_CAEEL unnamed protein product
Length=2104

 Score = 29.6 bits (65),  Expect = 7.8, Method: Composition-based stats.
 Identities = 34/143 (24%), Positives = 53/143 (37%), Gaps = 26/143 (18%)

Query  19    NSRVVYEG----EHVLNAGHIILCGVTNKEENRLTLYALCLQTSALQSAPHKIEGTLVHD  74
             N+R V +G    E V NAG I    +T++   +      C++      + H      + +
Sbjct  982   NARCVEKGANDYECVCNAGFIDKSPLTHRPGRK------CVEPICSDDSKHDCHSAAICE  1035

Query  75    DEKWVVEKFACSCK-----------AGQSGR-CKHISAVLLQCSRTSLDKLEAVSQTDIK  122
             +   V EK+ C C+            G+SGR CK +    L  S  S D        D  
Sbjct  1036  ENDSVPEKYTCKCRDGYLDVGAVMGGGKSGRECKELVNECLSASLNSCDAAATCIDLDDG  1095

Query  123   CTWSAQKGKTQDKYRAIPVKEMP  145
              T     G   +     PV ++P
Sbjct  1096  YTCKCPLGSKDES----PVPKLP  1114


>Q57UM9_TRYB2 unnamed protein product
Length=1649

 Score = 29.3 bits (64),  Expect = 8.0, Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 45/98 (46%), Gaps = 14/98 (14%)

Query  353   ELIEIKCPFAGA------TETIGSVVPKLKYLQLEDNIYELKKKHKYFAQVQL-------  399
             E+I I CP +        T  I  V+P +   +L   I +LK+K   +  ++        
Sbjct  1035  EVITIHCPSSDPNDELRHTVAIDDVLPVMSSPELV-TITQLKEKIAAYRPLRALQPLKKY  1093

Query  400   GMAMLNVFNCKFIIYCSFDKSMLILDVPYNYDFSKTLL  437
             G    ++ N   + +CSFDK+ +++D       ++T+L
Sbjct  1094  GRRSYDLRNLVILTHCSFDKTAVLVDTGIIQTIAETVL  1131



Lambda      K        H
   0.310    0.123    0.348 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3920191338


Query= XP_031327383.1 polyribonucleotide nucleotidyltransferase 1,
mitochondrial isoform X1 [Photinus pyralis]

Length=744
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9V9X7_DROME  unnamed protein product                                 994     0.0  
Q5U1D1_DROME  unnamed protein product                                 992     0.0  
Q95RX7_DROME  unnamed protein product                                 979     0.0  


>Q9V9X7_DROME unnamed protein product
Length=771

 Score = 994 bits (2570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 463/722 (64%), Positives = 594/722 (82%), Gaps = 2/722 (0%)

Query  24   SDSALANEMEVAFSNGRKLALSTGKLAKLADGCAVGTIGDTSVMVTAVSKSKPTSG-GFT  82
            S +  A  +EV FSNGR +  S+G+LA+ A+G AV  +GDT+VMVTAV+K+KP  G GF 
Sbjct  34   SSNGEAPSVEVNFSNGRNMTFSSGRLARFANGTAVCQMGDTAVMVTAVAKAKPNPGQGFM  93

Query  83   PLIVDYRQKSAAAGRIPTNFLRRELGPSEREILTSRLIDRSLRPLFPENFCYETQIVCNM  142
            PL+VDYR K+AA+GRIP NF+RRELGPSE+EIL++RLIDRSLRPLF +++  ETQ+VCNM
Sbjct  94   PLVVDYRLKNAASGRIPMNFMRRELGPSEKEILSARLIDRSLRPLFHKDYRTETQLVCNM  153

Query  143  LAVDSINNPDIVSINAASAALSLSDIPWNGPVGAVRVGCIDNEYIINPTRRELECSLLNL  202
            LA+D++++PD+++INAAS ALSLSDIPWNGP+GAVRVG  D E +INPTRREL+ S L+L
Sbjct  154  LAMDAVHSPDVLAINAASMALSLSDIPWNGPIGAVRVGLCDGEVLINPTRRELQTSQLDL  213

Query  203  VVSATKQNLVVMIEANADNMLQPEFLKAIKTGVKEAQFVVNGIEKLQKSSGKTKRTFEKQ  262
            VVSATKQNLVVM+E   + +LQ + LKAIK G +EAQF+++ IE+LQK+ G+ KR  E  
Sbjct  214  VVSATKQNLVVMLEGKGNVVLQQDLLKAIKQGTREAQFIIHEIERLQKAYGRQKREVEVA  273

Query  263  QELSEEVKVAIESLSQMRLKDIFKNHSLDKLSRDNEINYLRNDVADKIRLDFPTLDYNLV  322
             E+  E+  A+ S+ +MRL++IF++ + DK+SRDN +N +R++V DK+   FP  + +L+
Sbjct  274  AEVDPELGKAVRSMCEMRLREIFQDSTHDKMSRDNAVNEVRSNVIDKVWSSFPDTEPSLI  333

Query  323  VDCFGKITRRVFRDSIFEDERRCDGRDFDDLRNISCEVDLYKPLHGSAVFQRGQTQVFCT  382
             + F + +R +FR+ IFE   RCDGRD+D LRNISC+VD+YKPLHGSA+FQRGQTQVFCT
Sbjct  334  TEQFNQTSRTIFRELIFERGLRCDGRDYDQLRNISCQVDMYKPLHGSALFQRGQTQVFCT  393

Query  383  VTLDSHESALKLDPLSILTSG-LKEKNFFLHYEFPPFATKETGKIGPLGRREMGHGALAE  441
            V+LDS ESA+KLD L+ L SG LK KNF LHYEFPP+AT E G+IGP+GRREMGHGALAE
Sbjct  394  VSLDSQESAMKLDSLAALDSGGLKAKNFMLHYEFPPYATGEVGRIGPVGRREMGHGALAE  453

Query  442  KGLYPTVPHDFPFTIRLTSEVLESNGSSSMASVCGGSLALMDAGVPVTAPAAGVAIGLVT  501
            + L PT+P+D+PFT+RLTSEVLESNGSSSMASVCGGSLALMDAGVPV+APAAGVAIGLVT
Sbjct  454  RSLLPTLPNDYPFTVRLTSEVLESNGSSSMASVCGGSLALMDAGVPVSAPAAGVAIGLVT  513

Query  502  RCNENDTKHIDDYKLLTDILGIEDYMGDMDFKLAGTKKGITALQADIKLPGLPLKIIMEA  561
            +   +DTKH+ DY++LTDILGIEDYMGDMD K+AGT+KG TA+QAD+K+PG+PLK++ME+
Sbjct  514  KFENDDTKHLQDYRILTDILGIEDYMGDMDMKVAGTRKGFTAIQADLKIPGIPLKVVMES  573

Query  562  VVKATEAKSKILDIMQHCMSKPRIVKKENWPVVDKLEVEPHKRSRLFGIGGINLKKILYK  621
            + KAT+AKS ILDIM   + +PR   KE+WPV + L VEP +R++L G  G+++K+I  +
Sbjct  574  LQKATDAKSNILDIMSEAIREPRKYPKESWPVSETLTVEPQQRAQLIGPSGLHMKRIYLE  633

Query  622  TGAHISPIDDSSFSIFAPNQQAMDEAQETITQLLNTERIPELEFGGIYTATVVEVRDIGV  681
            TG  ++ +D++ F++FAP+Q AMDEA+E I   +  ER+P+LEFGGIYTA + E+RD GV
Sbjct  634  TGTSLTAVDETHFNVFAPSQAAMDEAKELIEGYMVKERVPDLEFGGIYTAKITELRDTGV  693

Query  682  MVTLYPDMPPALLHNSQLDQKKIMHPSALGVEVGQQMQVKYFGRDPVSGLMRLSRKVLQA  741
            MV LYP MPPALLHNSQLDQ+KI HPSAL +EVGQ++QVKYFGRDPVSG MRLSRKVLQ 
Sbjct  694  MVILYPSMPPALLHNSQLDQRKIAHPSALNLEVGQEIQVKYFGRDPVSGFMRLSRKVLQG  753

Query  742  SA  743
             A
Sbjct  754  PA  755


>Q5U1D1_DROME unnamed protein product
Length=771

 Score = 992 bits (2565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 462/722 (64%), Positives = 593/722 (82%), Gaps = 2/722 (0%)

Query  24   SDSALANEMEVAFSNGRKLALSTGKLAKLADGCAVGTIGDTSVMVTAVSKSKPTSG-GFT  82
            S +  A  +EV FSNGR +  S+G+LA+ A+G AV  +GDT+VMVTAV+K+KP  G GF 
Sbjct  34   SSNGEAPSVEVNFSNGRNMTFSSGRLARFANGTAVCQMGDTAVMVTAVAKAKPNPGQGFM  93

Query  83   PLIVDYRQKSAAAGRIPTNFLRRELGPSEREILTSRLIDRSLRPLFPENFCYETQIVCNM  142
            PL+VDYR K+AA+GRIP NF+RRELGPSE+EIL++RLIDRSLRPLF +++  ETQ+VCNM
Sbjct  94   PLVVDYRLKNAASGRIPMNFMRRELGPSEKEILSARLIDRSLRPLFHKDYRTETQLVCNM  153

Query  143  LAVDSINNPDIVSINAASAALSLSDIPWNGPVGAVRVGCIDNEYIINPTRRELECSLLNL  202
            LA+D++++PD+++INAAS ALSLSDIPWNGP+GAVRVG  D E +INPTRREL+ S L+L
Sbjct  154  LAMDAVHSPDVLAINAASMALSLSDIPWNGPIGAVRVGLCDGEVLINPTRRELQTSQLDL  213

Query  203  VVSATKQNLVVMIEANADNMLQPEFLKAIKTGVKEAQFVVNGIEKLQKSSGKTKRTFEKQ  262
            VVSATKQNLVVM+E   + +LQ + LKAIK G +EAQF+++ IE+LQK+ G+ KR  E  
Sbjct  214  VVSATKQNLVVMLEGKGNVVLQQDLLKAIKQGTREAQFIIHEIERLQKAYGRQKREVEVA  273

Query  263  QELSEEVKVAIESLSQMRLKDIFKNHSLDKLSRDNEINYLRNDVADKIRLDFPTLDYNLV  322
             E+  E+  A+ S+ +MRL++IF++ + DK+SRDN +N +R++V DK+   FP  + +L+
Sbjct  274  AEVDPELGKAVRSMCEMRLREIFQDSTHDKMSRDNAVNEVRSNVIDKVWSSFPDTEPSLI  333

Query  323  VDCFGKITRRVFRDSIFEDERRCDGRDFDDLRNISCEVDLYKPLHGSAVFQRGQTQVFCT  382
             + F + +R +FR+ IFE   RCDGRD+D LRNISC+VD+YKPLHGSA+FQRGQTQVFCT
Sbjct  334  TEQFNQTSRTIFRELIFERGLRCDGRDYDQLRNISCQVDMYKPLHGSALFQRGQTQVFCT  393

Query  383  VTLDSHESALKLDPLSILTSG-LKEKNFFLHYEFPPFATKETGKIGPLGRREMGHGALAE  441
            V+LDS ESA+KLD L+ L SG LK KNF LHYEFPP+AT E G+IGP+GRREMGHGALAE
Sbjct  394  VSLDSQESAMKLDSLAALDSGGLKAKNFMLHYEFPPYATGEVGRIGPVGRREMGHGALAE  453

Query  442  KGLYPTVPHDFPFTIRLTSEVLESNGSSSMASVCGGSLALMDAGVPVTAPAAGVAIGLVT  501
            + L PT+P+D+PFT+RLTSEVLESNGSSSMASVCGGSLALMDAGVPV+APAAGVAIGLVT
Sbjct  454  RSLLPTLPNDYPFTVRLTSEVLESNGSSSMASVCGGSLALMDAGVPVSAPAAGVAIGLVT  513

Query  502  RCNENDTKHIDDYKLLTDILGIEDYMGDMDFKLAGTKKGITALQADIKLPGLPLKIIMEA  561
            +   +DTKH+ DY++LTDILGIEDYMGDMD K+AGT+KG TA+QAD+K+PG+PLK++ME+
Sbjct  514  KFENDDTKHLQDYRILTDILGIEDYMGDMDMKVAGTRKGFTAIQADLKIPGIPLKVVMES  573

Query  562  VVKATEAKSKILDIMQHCMSKPRIVKKENWPVVDKLEVEPHKRSRLFGIGGINLKKILYK  621
            + KAT+AKS ILDIM   + +PR   KE+WPV + L VEP +R++L G  G+++K+I  +
Sbjct  574  LQKATDAKSNILDIMSEAIREPRKYPKESWPVSETLTVEPQQRAQLIGPSGLHMKRIYLE  633

Query  622  TGAHISPIDDSSFSIFAPNQQAMDEAQETITQLLNTERIPELEFGGIYTATVVEVRDIGV  681
            TG  ++ +D++ F++FAP+Q AMDEA+E I   +  ER+P+LEFGGIYTA + E+RD GV
Sbjct  634  TGTSLTAVDETHFNVFAPSQAAMDEAKELIEGYMVKERVPDLEFGGIYTAKITELRDTGV  693

Query  682  MVTLYPDMPPALLHNSQLDQKKIMHPSALGVEVGQQMQVKYFGRDPVSGLMRLSRKVLQA  741
            MV LYP MPPALLHNSQLDQ+KI HPS L +EVGQ++QVKYFGRDPVSG MRLSRKVLQ 
Sbjct  694  MVILYPSMPPALLHNSQLDQRKIAHPSTLNLEVGQEIQVKYFGRDPVSGFMRLSRKVLQG  753

Query  742  SA  743
             A
Sbjct  754  PA  755


>Q95RX7_DROME unnamed protein product
Length=720

 Score = 979 bits (2532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/704 (64%), Positives = 583/704 (83%), Gaps = 2/704 (0%)

Query  42   LALSTGKLAKLADGCAVGTIGDTSVMVTAVSKSKPTSG-GFTPLIVDYRQKSAAAGRIPT  100
            +  S+G+LA+ A+G AV  +GDT+VMVTAV+K+KP  G GF PL+VDYR K+AA+GRIP 
Sbjct  1    MTFSSGRLARFANGTAVCQMGDTAVMVTAVAKAKPNPGQGFMPLVVDYRLKNAASGRIPM  60

Query  101  NFLRRELGPSEREILTSRLIDRSLRPLFPENFCYETQIVCNMLAVDSINNPDIVSINAAS  160
            NF+RRELGPSE+EIL++RLIDRSLRPLF +++  ETQ+VCNMLA+D++++PD+++INAAS
Sbjct  61   NFMRRELGPSEKEILSARLIDRSLRPLFHKDYRTETQLVCNMLAMDAVHSPDVLAINAAS  120

Query  161  AALSLSDIPWNGPVGAVRVGCIDNEYIINPTRRELECSLLNLVVSATKQNLVVMIEANAD  220
             ALSLSDIPWNGP+GAVRVG  D E +INPTRREL+ S L+LVVSATKQNLVVM+E   +
Sbjct  121  MALSLSDIPWNGPIGAVRVGLCDGEVLINPTRRELQTSQLDLVVSATKQNLVVMLEGKGN  180

Query  221  NMLQPEFLKAIKTGVKEAQFVVNGIEKLQKSSGKTKRTFEKQQELSEEVKVAIESLSQMR  280
             +LQ + LKAIK G +EAQF+++ IE+LQK+ G+ KR  E   E+  E+  A+ S+ +MR
Sbjct  181  VVLQQDLLKAIKQGTREAQFIIHEIERLQKAYGRQKREVEVAAEVDPELGKAVRSMCEMR  240

Query  281  LKDIFKNHSLDKLSRDNEINYLRNDVADKIRLDFPTLDYNLVVDCFGKITRRVFRDSIFE  340
            L++IF++ + DK+SRDN +N +R++V DK+   FP  + +L+ + F + +R +FR+ IFE
Sbjct  241  LREIFQDSTHDKMSRDNAVNEVRSNVIDKVWSSFPDTEPSLITEQFNQTSRTIFRELIFE  300

Query  341  DERRCDGRDFDDLRNISCEVDLYKPLHGSAVFQRGQTQVFCTVTLDSHESALKLDPLSIL  400
               RCDGRD+D LRNISC+VD+YKPLHGSA+FQRGQTQVFCTV+LDS ESA+KLD L+ L
Sbjct  301  RGLRCDGRDYDQLRNISCQVDMYKPLHGSALFQRGQTQVFCTVSLDSQESAMKLDSLAAL  360

Query  401  TSG-LKEKNFFLHYEFPPFATKETGKIGPLGRREMGHGALAEKGLYPTVPHDFPFTIRLT  459
             SG LK KNF LHYEFPP+AT E G+IGP+GRREMGHGALAE+ L PT+P+D+PFT+RLT
Sbjct  361  DSGGLKAKNFMLHYEFPPYATGEVGRIGPVGRREMGHGALAERSLLPTLPNDYPFTVRLT  420

Query  460  SEVLESNGSSSMASVCGGSLALMDAGVPVTAPAAGVAIGLVTRCNENDTKHIDDYKLLTD  519
            SEVLESNGSSSMASVCGGSLALMDAGVPV+APAAGVAIGLVT+   +DTKH+ DY++LTD
Sbjct  421  SEVLESNGSSSMASVCGGSLALMDAGVPVSAPAAGVAIGLVTKFENDDTKHLQDYRILTD  480

Query  520  ILGIEDYMGDMDFKLAGTKKGITALQADIKLPGLPLKIIMEAVVKATEAKSKILDIMQHC  579
            ILGIEDYMGDMD K+AGT+KG TA+QAD+K+PG+PLK++ME++ KAT+AKS ILDIM   
Sbjct  481  ILGIEDYMGDMDMKVAGTRKGFTAIQADLKIPGIPLKVVMESLQKATDAKSNILDIMSEA  540

Query  580  MSKPRIVKKENWPVVDKLEVEPHKRSRLFGIGGINLKKILYKTGAHISPIDDSSFSIFAP  639
            + +PR   KE+WPV + L VEP +R++L G  G+++K+I  +TG  ++ +D++ F++FAP
Sbjct  541  IREPRKYPKESWPVSETLTVEPQQRAQLIGPSGLHMKRIYLETGTSLTAVDETHFNVFAP  600

Query  640  NQQAMDEAQETITQLLNTERIPELEFGGIYTATVVEVRDIGVMVTLYPDMPPALLHNSQL  699
            +Q AMDEA+E I   +  ER+P+LEFGGIYTA + E+RD GVMV LYP MPPALLHNSQL
Sbjct  601  SQAAMDEAKELIEGYMVKERVPDLEFGGIYTAKITELRDTGVMVILYPSMPPALLHNSQL  660

Query  700  DQKKIMHPSALGVEVGQQMQVKYFGRDPVSGLMRLSRKVLQASA  743
            DQ+KI HPSAL +EVGQ++QVKYFGRDPVSG MRLSRKVLQ  A
Sbjct  661  DQRKIAHPSALNLEVGQEIQVKYFGRDPVSGFMRLSRKVLQGPA  704



Lambda      K        H
   0.310    0.123    0.348 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3920191338


Query= XP_031327384.1 polyribonucleotide nucleotidyltransferase 1,
mitochondrial isoform X2 [Photinus pyralis]

Length=708
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9V9X7_DROME  unnamed protein product                                 981     0.0  
Q5U1D1_DROME  unnamed protein product                                 979     0.0  
Q95RX7_DROME  unnamed protein product                                 979     0.0  


>Q9V9X7_DROME unnamed protein product
Length=771

 Score = 981 bits (2536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 455/706 (64%), Positives = 584/706 (83%), Gaps = 2/706 (0%)

Query  4    RKLALSTGKLAKLADGCAVGTIGDTSVMVTAVSKSKPTSG-GFTPLIVDYRQKSAAAGRI  62
            R +  S+G+LA+ A+G AV  +GDT+VMVTAV+K+KP  G GF PL+VDYR K+AA+GRI
Sbjct  50   RNMTFSSGRLARFANGTAVCQMGDTAVMVTAVAKAKPNPGQGFMPLVVDYRLKNAASGRI  109

Query  63   PTNFLRRELGPSEREILTSRLIDRSLRPLFPENFCYETQIVCNMLAVDSINNPDIVSINA  122
            P NF+RRELGPSE+EIL++RLIDRSLRPLF +++  ETQ+VCNMLA+D++++PD+++INA
Sbjct  110  PMNFMRRELGPSEKEILSARLIDRSLRPLFHKDYRTETQLVCNMLAMDAVHSPDVLAINA  169

Query  123  ASAALSLSDIPWNGPVGAVRVGCIDNEYIINPTRRELECSLLNLVVSATKQNLVVMIEAN  182
            AS ALSLSDIPWNGP+GAVRVG  D E +INPTRREL+ S L+LVVSATKQNLVVM+E  
Sbjct  170  ASMALSLSDIPWNGPIGAVRVGLCDGEVLINPTRRELQTSQLDLVVSATKQNLVVMLEGK  229

Query  183  ADNMLQPEFLKAIKTGVKEAQFVVNGIEKLQKSSGKTKRTFEKQQELSEEVKVAIESLSQ  242
             + +LQ + LKAIK G +EAQF+++ IE+LQK+ G+ KR  E   E+  E+  A+ S+ +
Sbjct  230  GNVVLQQDLLKAIKQGTREAQFIIHEIERLQKAYGRQKREVEVAAEVDPELGKAVRSMCE  289

Query  243  MRLKDIFKNHSLDKLSRDNEINYLRNDVADKIRLDFPTLDYNLVVDCFGKITRRVFRDSI  302
            MRL++IF++ + DK+SRDN +N +R++V DK+   FP  + +L+ + F + +R +FR+ I
Sbjct  290  MRLREIFQDSTHDKMSRDNAVNEVRSNVIDKVWSSFPDTEPSLITEQFNQTSRTIFRELI  349

Query  303  FEDERRCDGRDFDDLRNISCEVDLYKPLHGSAVFQRGQTQVFCTVTLDSHESALKLDPLS  362
            FE   RCDGRD+D LRNISC+VD+YKPLHGSA+FQRGQTQVFCTV+LDS ESA+KLD L+
Sbjct  350  FERGLRCDGRDYDQLRNISCQVDMYKPLHGSALFQRGQTQVFCTVSLDSQESAMKLDSLA  409

Query  363  ILTSG-LKEKNFFLHYEFPPFATKETGKIGPLGRREMGHGALAEKGLYPTVPHDFPFTIR  421
             L SG LK KNF LHYEFPP+AT E G+IGP+GRREMGHGALAE+ L PT+P+D+PFT+R
Sbjct  410  ALDSGGLKAKNFMLHYEFPPYATGEVGRIGPVGRREMGHGALAERSLLPTLPNDYPFTVR  469

Query  422  LTSEVLESNGSSSMASVCGGSLALMDAGVPVTAPAAGVAIGLVTRCNENDTKHIDDYKLL  481
            LTSEVLESNGSSSMASVCGGSLALMDAGVPV+APAAGVAIGLVT+   +DTKH+ DY++L
Sbjct  470  LTSEVLESNGSSSMASVCGGSLALMDAGVPVSAPAAGVAIGLVTKFENDDTKHLQDYRIL  529

Query  482  TDILGIEDYMGDMDFKLAGTKKGITALQADIKLPGLPLKIIMEAVVKATEAKSKILDIMQ  541
            TDILGIEDYMGDMD K+AGT+KG TA+QAD+K+PG+PLK++ME++ KAT+AKS ILDIM 
Sbjct  530  TDILGIEDYMGDMDMKVAGTRKGFTAIQADLKIPGIPLKVVMESLQKATDAKSNILDIMS  589

Query  542  HCMSKPRIVKKENWPVVDKLEVEPHKRSRLFGIGGINLKKILYKTGAHISPIDDSSFSIF  601
              + +PR   KE+WPV + L VEP +R++L G  G+++K+I  +TG  ++ +D++ F++F
Sbjct  590  EAIREPRKYPKESWPVSETLTVEPQQRAQLIGPSGLHMKRIYLETGTSLTAVDETHFNVF  649

Query  602  APNQQAMDEAQETITQLLNTERIPELEFGGIYTATVVEVRDIGVMVTLYPDMPPALLHNS  661
            AP+Q AMDEA+E I   +  ER+P+LEFGGIYTA + E+RD GVMV LYP MPPALLHNS
Sbjct  650  APSQAAMDEAKELIEGYMVKERVPDLEFGGIYTAKITELRDTGVMVILYPSMPPALLHNS  709

Query  662  QLDQKKIMHPSALGVEVGQQMQVKYFGRDPVSGLMRLSRKVLQASA  707
            QLDQ+KI HPSAL +EVGQ++QVKYFGRDPVSG MRLSRKVLQ  A
Sbjct  710  QLDQRKIAHPSALNLEVGQEIQVKYFGRDPVSGFMRLSRKVLQGPA  755


>Q5U1D1_DROME unnamed protein product
Length=771

 Score = 979 bits (2532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/706 (64%), Positives = 583/706 (83%), Gaps = 2/706 (0%)

Query  4    RKLALSTGKLAKLADGCAVGTIGDTSVMVTAVSKSKPTSG-GFTPLIVDYRQKSAAAGRI  62
            R +  S+G+LA+ A+G AV  +GDT+VMVTAV+K+KP  G GF PL+VDYR K+AA+GRI
Sbjct  50   RNMTFSSGRLARFANGTAVCQMGDTAVMVTAVAKAKPNPGQGFMPLVVDYRLKNAASGRI  109

Query  63   PTNFLRRELGPSEREILTSRLIDRSLRPLFPENFCYETQIVCNMLAVDSINNPDIVSINA  122
            P NF+RRELGPSE+EIL++RLIDRSLRPLF +++  ETQ+VCNMLA+D++++PD+++INA
Sbjct  110  PMNFMRRELGPSEKEILSARLIDRSLRPLFHKDYRTETQLVCNMLAMDAVHSPDVLAINA  169

Query  123  ASAALSLSDIPWNGPVGAVRVGCIDNEYIINPTRRELECSLLNLVVSATKQNLVVMIEAN  182
            AS ALSLSDIPWNGP+GAVRVG  D E +INPTRREL+ S L+LVVSATKQNLVVM+E  
Sbjct  170  ASMALSLSDIPWNGPIGAVRVGLCDGEVLINPTRRELQTSQLDLVVSATKQNLVVMLEGK  229

Query  183  ADNMLQPEFLKAIKTGVKEAQFVVNGIEKLQKSSGKTKRTFEKQQELSEEVKVAIESLSQ  242
             + +LQ + LKAIK G +EAQF+++ IE+LQK+ G+ KR  E   E+  E+  A+ S+ +
Sbjct  230  GNVVLQQDLLKAIKQGTREAQFIIHEIERLQKAYGRQKREVEVAAEVDPELGKAVRSMCE  289

Query  243  MRLKDIFKNHSLDKLSRDNEINYLRNDVADKIRLDFPTLDYNLVVDCFGKITRRVFRDSI  302
            MRL++IF++ + DK+SRDN +N +R++V DK+   FP  + +L+ + F + +R +FR+ I
Sbjct  290  MRLREIFQDSTHDKMSRDNAVNEVRSNVIDKVWSSFPDTEPSLITEQFNQTSRTIFRELI  349

Query  303  FEDERRCDGRDFDDLRNISCEVDLYKPLHGSAVFQRGQTQVFCTVTLDSHESALKLDPLS  362
            FE   RCDGRD+D LRNISC+VD+YKPLHGSA+FQRGQTQVFCTV+LDS ESA+KLD L+
Sbjct  350  FERGLRCDGRDYDQLRNISCQVDMYKPLHGSALFQRGQTQVFCTVSLDSQESAMKLDSLA  409

Query  363  ILTSG-LKEKNFFLHYEFPPFATKETGKIGPLGRREMGHGALAEKGLYPTVPHDFPFTIR  421
             L SG LK KNF LHYEFPP+AT E G+IGP+GRREMGHGALAE+ L PT+P+D+PFT+R
Sbjct  410  ALDSGGLKAKNFMLHYEFPPYATGEVGRIGPVGRREMGHGALAERSLLPTLPNDYPFTVR  469

Query  422  LTSEVLESNGSSSMASVCGGSLALMDAGVPVTAPAAGVAIGLVTRCNENDTKHIDDYKLL  481
            LTSEVLESNGSSSMASVCGGSLALMDAGVPV+APAAGVAIGLVT+   +DTKH+ DY++L
Sbjct  470  LTSEVLESNGSSSMASVCGGSLALMDAGVPVSAPAAGVAIGLVTKFENDDTKHLQDYRIL  529

Query  482  TDILGIEDYMGDMDFKLAGTKKGITALQADIKLPGLPLKIIMEAVVKATEAKSKILDIMQ  541
            TDILGIEDYMGDMD K+AGT+KG TA+QAD+K+PG+PLK++ME++ KAT+AKS ILDIM 
Sbjct  530  TDILGIEDYMGDMDMKVAGTRKGFTAIQADLKIPGIPLKVVMESLQKATDAKSNILDIMS  589

Query  542  HCMSKPRIVKKENWPVVDKLEVEPHKRSRLFGIGGINLKKILYKTGAHISPIDDSSFSIF  601
              + +PR   KE+WPV + L VEP +R++L G  G+++K+I  +TG  ++ +D++ F++F
Sbjct  590  EAIREPRKYPKESWPVSETLTVEPQQRAQLIGPSGLHMKRIYLETGTSLTAVDETHFNVF  649

Query  602  APNQQAMDEAQETITQLLNTERIPELEFGGIYTATVVEVRDIGVMVTLYPDMPPALLHNS  661
            AP+Q AMDEA+E I   +  ER+P+LEFGGIYTA + E+RD GVMV LYP MPPALLHNS
Sbjct  650  APSQAAMDEAKELIEGYMVKERVPDLEFGGIYTAKITELRDTGVMVILYPSMPPALLHNS  709

Query  662  QLDQKKIMHPSALGVEVGQQMQVKYFGRDPVSGLMRLSRKVLQASA  707
            QLDQ+KI HPS L +EVGQ++QVKYFGRDPVSG MRLSRKVLQ  A
Sbjct  710  QLDQRKIAHPSTLNLEVGQEIQVKYFGRDPVSGFMRLSRKVLQGPA  755


>Q95RX7_DROME unnamed protein product
Length=720

 Score = 979 bits (2531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/704 (64%), Positives = 583/704 (83%), Gaps = 2/704 (0%)

Query  6    LALSTGKLAKLADGCAVGTIGDTSVMVTAVSKSKPTSG-GFTPLIVDYRQKSAAAGRIPT  64
            +  S+G+LA+ A+G AV  +GDT+VMVTAV+K+KP  G GF PL+VDYR K+AA+GRIP 
Sbjct  1    MTFSSGRLARFANGTAVCQMGDTAVMVTAVAKAKPNPGQGFMPLVVDYRLKNAASGRIPM  60

Query  65   NFLRRELGPSEREILTSRLIDRSLRPLFPENFCYETQIVCNMLAVDSINNPDIVSINAAS  124
            NF+RRELGPSE+EIL++RLIDRSLRPLF +++  ETQ+VCNMLA+D++++PD+++INAAS
Sbjct  61   NFMRRELGPSEKEILSARLIDRSLRPLFHKDYRTETQLVCNMLAMDAVHSPDVLAINAAS  120

Query  125  AALSLSDIPWNGPVGAVRVGCIDNEYIINPTRRELECSLLNLVVSATKQNLVVMIEANAD  184
             ALSLSDIPWNGP+GAVRVG  D E +INPTRREL+ S L+LVVSATKQNLVVM+E   +
Sbjct  121  MALSLSDIPWNGPIGAVRVGLCDGEVLINPTRRELQTSQLDLVVSATKQNLVVMLEGKGN  180

Query  185  NMLQPEFLKAIKTGVKEAQFVVNGIEKLQKSSGKTKRTFEKQQELSEEVKVAIESLSQMR  244
             +LQ + LKAIK G +EAQF+++ IE+LQK+ G+ KR  E   E+  E+  A+ S+ +MR
Sbjct  181  VVLQQDLLKAIKQGTREAQFIIHEIERLQKAYGRQKREVEVAAEVDPELGKAVRSMCEMR  240

Query  245  LKDIFKNHSLDKLSRDNEINYLRNDVADKIRLDFPTLDYNLVVDCFGKITRRVFRDSIFE  304
            L++IF++ + DK+SRDN +N +R++V DK+   FP  + +L+ + F + +R +FR+ IFE
Sbjct  241  LREIFQDSTHDKMSRDNAVNEVRSNVIDKVWSSFPDTEPSLITEQFNQTSRTIFRELIFE  300

Query  305  DERRCDGRDFDDLRNISCEVDLYKPLHGSAVFQRGQTQVFCTVTLDSHESALKLDPLSIL  364
               RCDGRD+D LRNISC+VD+YKPLHGSA+FQRGQTQVFCTV+LDS ESA+KLD L+ L
Sbjct  301  RGLRCDGRDYDQLRNISCQVDMYKPLHGSALFQRGQTQVFCTVSLDSQESAMKLDSLAAL  360

Query  365  TSG-LKEKNFFLHYEFPPFATKETGKIGPLGRREMGHGALAEKGLYPTVPHDFPFTIRLT  423
             SG LK KNF LHYEFPP+AT E G+IGP+GRREMGHGALAE+ L PT+P+D+PFT+RLT
Sbjct  361  DSGGLKAKNFMLHYEFPPYATGEVGRIGPVGRREMGHGALAERSLLPTLPNDYPFTVRLT  420

Query  424  SEVLESNGSSSMASVCGGSLALMDAGVPVTAPAAGVAIGLVTRCNENDTKHIDDYKLLTD  483
            SEVLESNGSSSMASVCGGSLALMDAGVPV+APAAGVAIGLVT+   +DTKH+ DY++LTD
Sbjct  421  SEVLESNGSSSMASVCGGSLALMDAGVPVSAPAAGVAIGLVTKFENDDTKHLQDYRILTD  480

Query  484  ILGIEDYMGDMDFKLAGTKKGITALQADIKLPGLPLKIIMEAVVKATEAKSKILDIMQHC  543
            ILGIEDYMGDMD K+AGT+KG TA+QAD+K+PG+PLK++ME++ KAT+AKS ILDIM   
Sbjct  481  ILGIEDYMGDMDMKVAGTRKGFTAIQADLKIPGIPLKVVMESLQKATDAKSNILDIMSEA  540

Query  544  MSKPRIVKKENWPVVDKLEVEPHKRSRLFGIGGINLKKILYKTGAHISPIDDSSFSIFAP  603
            + +PR   KE+WPV + L VEP +R++L G  G+++K+I  +TG  ++ +D++ F++FAP
Sbjct  541  IREPRKYPKESWPVSETLTVEPQQRAQLIGPSGLHMKRIYLETGTSLTAVDETHFNVFAP  600

Query  604  NQQAMDEAQETITQLLNTERIPELEFGGIYTATVVEVRDIGVMVTLYPDMPPALLHNSQL  663
            +Q AMDEA+E I   +  ER+P+LEFGGIYTA + E+RD GVMV LYP MPPALLHNSQL
Sbjct  601  SQAAMDEAKELIEGYMVKERVPDLEFGGIYTAKITELRDTGVMVILYPSMPPALLHNSQL  660

Query  664  DQKKIMHPSALGVEVGQQMQVKYFGRDPVSGLMRLSRKVLQASA  707
            DQ+KI HPSAL +EVGQ++QVKYFGRDPVSG MRLSRKVLQ  A
Sbjct  661  DQRKIAHPSALNLEVGQEIQVKYFGRDPVSGFMRLSRKVLQGPA  704



Lambda      K        H
   0.310    0.123    0.348 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3920191338


Query= XP_031327385.1 four and a half LIM domains protein 2-like [Photinus
pyralis]

Length=237
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VVB8_DROME  unnamed protein product                                 372     4e-132
Q9VVB7_DROME  unnamed protein product                                 315     4e-108
Q8MYZ5_DROME  unnamed protein product                                 315     4e-108


>Q9VVB8_DROME unnamed protein product
Length=245

 Score = 372 bits (955),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 177/240 (74%), Positives = 205/240 (85%), Gaps = 6/240 (3%)

Query  4    VLSDQLKS-LNLRTKTVGEDRIRRARERNEDVAILSMDLPG-----EKKTFACCLGDECL  57
            VLS ++KS L+L+TKT+G +RI++A++ NED+A+LSM LP      E + F C LGD C 
Sbjct  6    VLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAVEENRNFYCQLGDYCR  65

Query  58   MGDAKLLPLGTKKMEYKTRQWHEKCFCCNVCKTPIGTQSFIPREQEIYCAKCYEDKYATR  117
            +GD +    GTKKMEYKTRQWHE CFCC VCKT IGT+SFIPREQEIYCA CYE+K+ATR
Sbjct  66   LGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAIGTKSFIPREQEIYCAGCYEEKFATR  125

Query  118  CIKCNKVITSGGVTYKNEPWHRECFTCTNCNTSLAGARFTSRDDKPYCAECFGELFAKRC  177
            CIKCNKVITSGGVTYKNEPWHRECFTCT+CN +LAG RFTSRD+KPYCAECFGELFAKRC
Sbjct  126  CIKCNKVITSGGVTYKNEPWHRECFTCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRC  185

Query  178  TSCNKPITGIGGTKFISFEDRHWHNDCFYCANCRTSLVGRGFITDADDIICPDCAKKNFM  237
            T+C KPITGIGGT+FISFEDRHWH+DCF CA+C+ SLVGRGFITD  DI+CPDCAK+  M
Sbjct  186  TACVKPITGIGGTRFISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM  245


>Q9VVB7_DROME unnamed protein product
Length=339

 Score = 315 bits (806),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 146/179 (82%), Positives = 161/179 (90%), Gaps = 0/179 (0%)

Query  59   GDAKLLPLGTKKMEYKTRQWHEKCFCCNVCKTPIGTQSFIPREQEIYCAKCYEDKYATRC  118
            G  ++   GTKKMEYKTRQWHE CFCC VCKT IGT+SFIPREQEIYCA CYE+K+ATRC
Sbjct  161  GCGEVFRAGTKKMEYKTRQWHENCFCCCVCKTAIGTKSFIPREQEIYCAGCYEEKFATRC  220

Query  119  IKCNKVITSGGVTYKNEPWHRECFTCTNCNTSLAGARFTSRDDKPYCAECFGELFAKRCT  178
            IKCNKVITSGGVTYKNEPWHRECFTCT+CN +LAG RFTSRD+KPYCAECFGELFAKRCT
Sbjct  221  IKCNKVITSGGVTYKNEPWHRECFTCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCT  280

Query  179  SCNKPITGIGGTKFISFEDRHWHNDCFYCANCRTSLVGRGFITDADDIICPDCAKKNFM  237
            +C KPITGIGGT+FISFEDRHWH+DCF CA+C+ SLVGRGFITD  DI+CPDCAK+  M
Sbjct  281  ACVKPITGIGGTRFISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM  339


 Score = 124 bits (310),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/179 (35%), Positives = 95/179 (53%), Gaps = 4/179 (2%)

Query  60   DAKLLPLGTKKMEYKTRQWHEKCFCCNVCKTPIGTQSFIPREQEIYCAKCYEDKYATRCI  119
            DA +   G +  +   + WH   FCC  C   +  Q ++ R+   YC KCYE+ +A  C 
Sbjct  40   DATIEERGGEYTKAMDKDWHSGHFCCWQCDESLTGQRYVIRDDHPYCIKCYENVFANTCE  99

Query  120  KCNKV--ITSGGVTYKNEPWHRECFTCTNCNTSLAGARFTSRDDKPYCAECFGELFAKRC  177
            +CNK+  I S  ++YK++ WH  CF C  C+ SL   +F ++ DK YC  C+   FA RC
Sbjct  100  ECNKIIGIDSKDLSYKDKHWHEACFLCFKCHLSLVDKQFGAKADKIYCGNCYDAQFASRC  159

Query  178  TSCNKPITGIGGTKFISFEDRHWHNDCFYCANCRTSLVGRGFITDADDIICPDCAKKNF  236
              C +      GTK + ++ R WH +CF C  C+T++  + FI    +I C  C ++ F
Sbjct  160  DGCGEVFR--AGTKKMEYKTRQWHENCFCCCVCKTAIGTKSFIPREQEIYCAGCYEEKF  216


>Q8MYZ5_DROME unnamed protein product
Length=339

 Score = 315 bits (806),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 146/179 (82%), Positives = 161/179 (90%), Gaps = 0/179 (0%)

Query  59   GDAKLLPLGTKKMEYKTRQWHEKCFCCNVCKTPIGTQSFIPREQEIYCAKCYEDKYATRC  118
            G  ++   GTKKMEYKTRQWHE CFCC VCKT IGT+SFIPREQEIYCA CYE+K+ATRC
Sbjct  161  GCGEVFRAGTKKMEYKTRQWHENCFCCCVCKTAIGTKSFIPREQEIYCAGCYEEKFATRC  220

Query  119  IKCNKVITSGGVTYKNEPWHRECFTCTNCNTSLAGARFTSRDDKPYCAECFGELFAKRCT  178
            IKCNKVITSGGVTYKNEPWHRECFTCT+CN +LAG RFTSRD+KPYCAECFGELFAKRCT
Sbjct  221  IKCNKVITSGGVTYKNEPWHRECFTCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCT  280

Query  179  SCNKPITGIGGTKFISFEDRHWHNDCFYCANCRTSLVGRGFITDADDIICPDCAKKNFM  237
            +C KPITGIGGT+FISFEDRHWH+DCF CA+C+ SLVGRGFITD  DI+CPDCAK+  M
Sbjct  281  ACVKPITGIGGTRFISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM  339


 Score = 124 bits (310),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/179 (35%), Positives = 95/179 (53%), Gaps = 4/179 (2%)

Query  60   DAKLLPLGTKKMEYKTRQWHEKCFCCNVCKTPIGTQSFIPREQEIYCAKCYEDKYATRCI  119
            DA +   G +  +   + WH   FCC  C   +  Q ++ R+   YC KCYE+ +A  C 
Sbjct  40   DATIEERGGEYTKAMDKDWHSGHFCCWQCDESLTGQRYVIRDDHPYCIKCYENVFANTCE  99

Query  120  KCNKV--ITSGGVTYKNEPWHRECFTCTNCNTSLAGARFTSRDDKPYCAECFGELFAKRC  177
            +CNK+  I S  ++YK++ WH  CF C  C+ SL   +F ++ DK YC  C+   FA RC
Sbjct  100  ECNKIIGIDSKDLSYKDKHWHEACFLCFKCHLSLVDKQFGAKADKIYCGNCYDAQFASRC  159

Query  178  TSCNKPITGIGGTKFISFEDRHWHNDCFYCANCRTSLVGRGFITDADDIICPDCAKKNF  236
              C +      GTK + ++ R WH +CF C  C+T++  + FI    +I C  C ++ F
Sbjct  160  DGCGEVFR--AGTKKMEYKTRQWHENCFCCCVCKTAIGTKSFIPREQEIYCAGCYEEKF  216



Lambda      K        H
   0.310    0.123    0.348 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3920191338


Query= XP_031327386.1 protein ERGIC-53 [Photinus pyralis]

Length=514
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9V3A8_DROME  unnamed protein product                                 612     0.0  
Q9VCC2_DROME  unnamed protein product                                 155     5e-43
Q385Z7_TRYB2  unnamed protein product                                 115     4e-27


>Q9V3A8_DROME unnamed protein product
Length=512

 Score = 612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/518 (57%), Positives = 381/518 (74%), Gaps = 24/518 (5%)

Query  10   FVILVYLLVTLTNCINGTL------VHKKFEYKYSFKPPYLAQKDGSVPFWEYGGNAIAS  63
              IL +L    ++   G L      VH++FEYKYSFKPPYLAQKDG+VPFWEYGGNAIAS
Sbjct  6    LAILCFLAWNPSSEATGNLSPGAVGVHRRFEYKYSFKPPYLAQKDGTVPFWEYGGNAIAS  65

Query  64   AENVRLAPSLRSQKGAIWTKSPLNFDWWEVDIVFRVTGRGRIGADGLAFWYTQSKGSYEG  123
            +E+VR+APSLRSQKGAIWTKS  NFDWW+V+IVFRVTGRGRIGADGLAFWYT  KG Y G
Sbjct  66   SESVRVAPSLRSQKGAIWTKSQTNFDWWDVEIVFRVTGRGRIGADGLAFWYTTEKGDYNG  125

Query  124  DVYGSSDKWVGLGVFFDSFDNDNKHNNPYIMGMVNDGTRLFDHQNDGGTQVMAGCLRDFR  183
             V+GSSD+W GL + FDSFDNDNKHNNPYI  ++NDGT+L+DH  DG TQ+++GCLRDFR
Sbjct  126  PVFGSSDRWNGLAIMFDSFDNDNKHNNPYISAVLNDGTKLYDHAEDGTTQLLSGCLRDFR  185

Query  184  NKPFPTRARVEYYQNVLTVSFHNGITNNEGDYELCFRTENVILPKGGYFGLSAATGGLAD  243
            NKPFPTRAR+EYY NVLTV  HNG++NN  DYELC R + V LPK GYFG+SAATGGLAD
Sbjct  186  NKPFPTRARIEYYNNVLTVMIHNGMSNNNDDYELCLRADGVNLPKNGYFGISAATGGLAD  245

Query  244  DHDILHFLTSSLWPPGQHPTSGTQASSAEQQKLTQEYQEYQRKLDQQKEDYRKEHPDAKP  303
            DHD+ HFLT+SL   GQ      Q     Q+KLTQEY+EYQ KL++QK++Y+K+HPD   
Sbjct  246  DHDVFHFLTTSLHAAGQ---VQEQPKVENQEKLTQEYKEYQDKLEKQKQEYKKDHPDEHK  302

Query  304  KDPNAEDWFESDNQRELRQIFQGQSQMYEVMRDLNRKLDEIIGRQERTLSVVSMMQSGVA  363
             + + E+++ES+NQRELRQI+QGQSQ+ + +R+L+RK+DEIIGRQE TLS+VS   +G A
Sbjct  303  DEEDWEEFYESENQRELRQIWQGQSQIADHLRELSRKVDEIIGRQETTLSLVS-RNAGQA  361

Query  364  VPQGQAPPVGQVPPPSGAVPSLGEGIRKYEFDAMYNNVVQVMTSINQITQSLGDLHRKTE  423
            +P   A  V Q   P GAV        + + D +  N   +++SI +I Q +GD++ +T+
Sbjct  362  LPPPAAGGVPQQQLPVGAV-------SRSDVDLLLTNQNMLLSSIREIRQLVGDINVRTD  414

Query  424  TVMSNQAKQPTAQVQSVGYDMQSLVSEMRDGLNHVKQNVAQVSQKM-----GGSTTTCTS  478
             + +NQ   PTAQ+QS GYD+Q+L++EMRDG+N VKQ +  V Q++           C +
Sbjct  415  NIQTNQKHAPTAQIQSTGYDVQTLIAEMRDGMNQVKQGITHVGQRLAAPQGAAQVANCPT  474

Query  479  --CVSLTAVLVITAVQLAILLGYSIYRDSKENQAKKFY  514
              CV +T  L +T VQL ++  Y+++++  E QAKKFY
Sbjct  475  GNCVGVTLFLSVTVVQLLLVFIYNVFKNRSEAQAKKFY  512


>Q9VCC2_DROME unnamed protein product
Length=329

 Score = 155 bits (393),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 79/204 (39%), Positives = 119/204 (58%), Gaps = 8/204 (4%)

Query  51   VPFWEYGGNAIASAENVRLAPSLRSQKGAIWTKSPLNFDWWEVDIVFRVTGRG-RIGADG  109
            +P W++ GN + ++  +RL P L+S+ GA+W  SP+    WEV + F+V G+G  +  DG
Sbjct  52   LPHWDFLGNTMVTSNYIRLTPDLQSKSGALWNYSPVMTRNWEVHVGFKVHGKGTELFGDG  111

Query  110  LAFWYTQSKGSYEGDVYGSSDKWVGLGVFFDSFDNDN---KHNNPYIMGMVNDGTRLFDH  166
             A WYT+ +    G V+GS D + GL +  D++ N N    H +PY+  MVN+G+  +DH
Sbjct  112  FAIWYTKERMQ-TGPVFGSKDHFSGLAIILDTYSNHNGPHNHQHPYLSAMVNNGSWSYDH  170

Query  167  QNDGGTQVMAGCLRDFRNKPFPTRARVEYYQNVLTVSFHNGITNNEGDYELCFRTENVIL  226
              DG    +AGC   FRN  + T   + Y  ++L+VS       N  +++ CF   NV L
Sbjct  171  DRDGTHTQLAGCEVRFRNVEYETLVSIRYENDILSVS---TDLENRNEWKNCFVVANVEL  227

Query  227  PKGGYFGLSAATGGLADDHDILHF  250
            P G +FG+SA TG L+D+HDI  F
Sbjct  228  PTGYHFGMSATTGDLSDNHDIHSF  251


>Q385Z7_TRYB2 unnamed protein product
Length=545

 Score = 115 bits (287),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 80/237 (34%), Positives = 119/237 (50%), Gaps = 18/237 (8%)

Query  24   INGTLVHKKFEY---KYSFKPPYLAQKDGS--VPFWEYGGNAIASAENVRLAPSLRSQKG  78
            + G+ +H+  E     +SF PP L    G   +  W  GG A+ + ++VRL  + R Q+G
Sbjct  58   LTGSQMHRTIEKVIEHHSFTPPLLRNYYGGEGLEHWFVGGTAVVTDDHVRLTGNYRDQEG  117

Query  79   AIWTKSPLNFDWWEVDIVFRVTGRGRIGADGLAFWYTQSKGSYEGDVYGSSDKWVGLGVF  138
             +W +  L+   +E+ + F + G  R  ADG A W T S  +  G + G    + G+GV 
Sbjct  118  YMWNREALDMPSFEIIVGFHLHGTARYPADGFAIWLTSSPQNATGPLMGHPMDFQGVGVV  177

Query  139  FDSFDNDNKHNNPYIMGMVN-DGT--RLFDHQNDGGTQVMAGCLRDFR--NKPFPTRARV  193
            FD+FDND   NNP +  + N +G+  R +   ND   + +  C   FR  +  F T AR+
Sbjct  178  FDTFDNDGAGNNPAVYVLYNAEGSENREYTTSNDFKNEHVGSCEYAFRQTSAKFST-ARL  236

Query  194  EYYQNVLTVSFHNGITNNEGDYELCFRTENVIL---PKGGYFGLSAATGGLADDHDI  247
            +Y    L V   N     E D  LC    +V L    K  Y G++AATGG +D+HDI
Sbjct  237  QYKNETLRVYLSNSA---EEDETLCTSV-SVQLKTDSKDYYIGITAATGGYSDNHDI  289



Lambda      K        H
   0.310    0.123    0.348 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3920191338


Query= XP_031327387.1 protein ALP1-like [Photinus pyralis]

Length=397


***** No hits found *****



Lambda      K        H
   0.310    0.123    0.348 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3920191338


Query= XP_031327388.1 uncharacterized protein LOC116158701 [Photinus
pyralis]

Length=352
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

B3CJ34_CAEEL  unnamed protein product                                 30.8    2.2  
Q7JNM8_DROME  unnamed protein product                                 26.6    6.7  
Q581V4_TRYB2  unnamed protein product                                 28.9    7.5  


>B3CJ34_CAEEL unnamed protein product
Length=2651

 Score = 30.8 bits (68),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 19/33 (58%), Gaps = 6/33 (18%)

Query  299   FDATYEDFVAAREPP------LKRRRYDEADRR  325
             FD TY+D V  REP       L+R   DE+DRR
Sbjct  1191  FDETYKDLVLIREPIYDDVGRLQREAIDESDRR  1223


>Q7JNM8_DROME unnamed protein product
Length=60

 Score = 26.6 bits (57),  Expect = 6.7, Method: Composition-based stats.
 Identities = 15/32 (47%), Positives = 20/32 (63%), Gaps = 4/32 (13%)

Query  88   IFVVLARRGERYVFPVLFCLLPNKTTQTYRKL  119
            I+VVL +RGERY       LL +K +  Y+KL
Sbjct  1    IYVVLRKRGERY----RMALLASKNSFVYQKL  28


>Q581V4_TRYB2 unnamed protein product
Length=459

 Score = 28.9 bits (63),  Expect = 7.5, Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 37/80 (46%), Gaps = 7/80 (9%)

Query  190  ARMITSLAFVPEENLM--QALIDLENYVTDDLEPIVAWFTNTYVGRLRNNGTRAPPNFPY  247
            A ++  + F+ E +++  +    L   +   L P+V + TN    R+R    R+P   P 
Sbjct  295  AELVPGVLFIDEVHMLDIECFTFLNKALESTLAPVVIFATNRGSCRIRGTDVRSPHGIP-  353

Query  248  ATWSVLQRTLAGSDRTNNYA  267
                +L R L    RT+NY+
Sbjct  354  --TDLLDRLLI--VRTSNYS  369



Lambda      K        H
   0.310    0.123    0.348 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3920191338


Query= XP_031327389.1 paired box protein Pax-5 isoform X1 [Photinus
pyralis]

Length=303
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

POXN_DROME  unnamed protein product                                   243     6e-78
D1YSG9_DROME  unnamed protein product                                 196     7e-59
Q59DN7_DROME  unnamed protein product                                 198     1e-58


>POXN_DROME unnamed protein product
Length=425

 Score = 243 bits (621),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 121/137 (88%), Positives = 129/137 (94%), Gaps = 0/137 (0%)

Query  1    MPHTGQAGVNQLGGVFVNGRPLPDCVRRRIVELALLGVRPCDISRQLLVSHGCVSKILTR  60
            MPHTGQAGVNQLGGVFVNGRPLPDCVRRRIV+LAL GVRPCDISRQLLVSHGCVSKILTR
Sbjct  1    MPHTGQAGVNQLGGVFVNGRPLPDCVRRRIVDLALCGVRPCDISRQLLVSHGCVSKILTR  60

Query  61   FYETGSIRPGSIGGSKTKQVATPTVVKKILKFKQENPGMFAWEIREQLVAQRVCEPHSIP  120
            FYETGSIRPGSIGGSKTKQVATPTVVKKI++ K+EN GMFAWEIREQL  QRVC+P S+P
Sbjct  61   FYETGSIRPGSIGGSKTKQVATPTVVKKIIRLKEENSGMFAWEIREQLQQQRVCDPSSVP  120

Query  121  SVSSVNRILRNSGAWPD  137
            S+SS+NRILRNSG W D
Sbjct  121  SISSINRILRNSGLWTD  137


 Score = 37.4 bits (85),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 15/18 (83%), Positives = 18/18 (100%), Gaps = 0/18 (0%)

Query  246  KKRNPYSIEELLKKPDKK  263
            +KRNPYSIEELLKKP+K+
Sbjct  355  RKRNPYSIEELLKKPEKR  372


>D1YSG9_DROME unnamed protein product
Length=491

 Score = 196 bits (497),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 108/132 (82%), Gaps = 1/132 (1%)

Query  3    HTGQAGVNQLGGVFVNGRPLPDCVRRRIVELALLGVRPCDISRQLLVSHGCVSKILTRFY  62
            +T   GVNQLGGVFVNGRPLPD VR+RIVELA  GVRPCDISRQL VSHGCVSKIL+R+Y
Sbjct  17   YTCHGGVNQLGGVFVNGRPLPDVVRQRIVELAHNGVRPCDISRQLRVSHGCVSKILSRYY  76

Query  63   ETGSIRPGSIGGSKTKQVATPTVVKKILKFKQENPGMFAWEIREQLVAQRVCEPHSIPSV  122
            ETGS + G IGGSK K VATP VV  I  +K+ENP MFAWEIR++L+A+ +C   ++PSV
Sbjct  77   ETGSFKAGVIGGSKPK-VATPPVVDAIANYKRENPTMFAWEIRDRLLAEAICSQDNVPSV  135

Query  123  SSVNRILRNSGA  134
            SS+NRI+RN  A
Sbjct  136  SSINRIVRNKAA  147


>Q59DN7_DROME unnamed protein product
Length=628

 Score = 198 bits (503),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 107/130 (82%), Gaps = 1/130 (1%)

Query  5    GQAGVNQLGGVFVNGRPLPDCVRRRIVELALLGVRPCDISRQLLVSHGCVSKILTRFYET  64
            G  GVNQLGGVFVNGRPLPD VR+RIVELA  GVRPCDISRQL VSHGCVSKIL+R+YET
Sbjct  175  GHGGVNQLGGVFVNGRPLPDVVRQRIVELAHNGVRPCDISRQLRVSHGCVSKILSRYYET  234

Query  65   GSIRPGSIGGSKTKQVATPTVVKKILKFKQENPGMFAWEIREQLVAQRVCEPHSIPSVSS  124
            GS + G IGGSK K VATP VV  I  +K+ENP MFAWEIR++L+A+ +C   ++PSVSS
Sbjct  235  GSFKAGVIGGSKPK-VATPPVVDAIANYKRENPTMFAWEIRDRLLAEAICSQDNVPSVSS  293

Query  125  VNRILRNSGA  134
            +NRI+RN  A
Sbjct  294  INRIVRNKAA  303



Lambda      K        H
   0.310    0.123    0.348 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3920191338


Query= XP_031327390.1 paired box protein Pax-5 isoform X2 [Photinus
pyralis]

Length=288
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

POXN_DROME  unnamed protein product                                   210     3e-65
D1YSG9_DROME  unnamed protein product                                 176     2e-51
Q8IM96_DROME  unnamed protein product                                 178     2e-51


>POXN_DROME unnamed protein product
Length=425

 Score = 210 bits (534),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 115/137 (84%), Gaps = 15/137 (11%)

Query  1    MPHTGQAGVNQLGGVFVNGRPLPDCVRRRIVELALLGVRPCDISRQLLVSHGCVSKILTR  60
            MPHTGQAGVNQLGGVFVNGRPLPDCVRRRIV+LAL GVRPCDISRQLLVSHGCVSKILTR
Sbjct  1    MPHTGQAGVNQLGGVFVNGRPLPDCVRRRIVDLALCGVRPCDISRQLLVSHGCVSKILTR  60

Query  61   FYETGSIRPGSIGGSKTKQ---------------ENPGMFAWEIREQLVAQRVCEPHSIP  105
            FYETGSIRPGSIGGSKTKQ               EN GMFAWEIREQL  QRVC+P S+P
Sbjct  61   FYETGSIRPGSIGGSKTKQVATPTVVKKIIRLKEENSGMFAWEIREQLQQQRVCDPSSVP  120

Query  106  SVSSVNRILRNSGAWPD  122
            S+SS+NRILRNSG W D
Sbjct  121  SISSINRILRNSGLWTD  137


 Score = 37.0 bits (84),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 15/18 (83%), Positives = 18/18 (100%), Gaps = 0/18 (0%)

Query  231  KKRNPYSIEELLKKPDKK  248
            +KRNPYSIEELLKKP+K+
Sbjct  355  RKRNPYSIEELLKKPEKR  372


>D1YSG9_DROME unnamed protein product
Length=491

 Score = 176 bits (445),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 99/131 (76%), Gaps = 14/131 (11%)

Query  3    HTGQAGVNQLGGVFVNGRPLPDCVRRRIVELALLGVRPCDISRQLLVSHGCVSKILTRFY  62
            +T   GVNQLGGVFVNGRPLPD VR+RIVELA  GVRPCDISRQL VSHGCVSKIL+R+Y
Sbjct  17   YTCHGGVNQLGGVFVNGRPLPDVVRQRIVELAHNGVRPCDISRQLRVSHGCVSKILSRYY  76

Query  63   ETGSIRPGSIGGSK--------------TKQENPGMFAWEIREQLVAQRVCEPHSIPSVS  108
            ETGS + G IGGSK               K+ENP MFAWEIR++L+A+ +C   ++PSVS
Sbjct  77   ETGSFKAGVIGGSKPKVATPPVVDAIANYKRENPTMFAWEIRDRLLAEAICSQDNVPSVS  136

Query  109  SVNRILRNSGA  119
            S+NRI+RN  A
Sbjct  137  SINRIVRNKAA  147


>Q8IM96_DROME unnamed protein product
Length=647

 Score = 178 bits (452),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 98/129 (76%), Gaps = 14/129 (11%)

Query  5    GQAGVNQLGGVFVNGRPLPDCVRRRIVELALLGVRPCDISRQLLVSHGCVSKILTRFYET  64
            G  GVNQLGGVFVNGRPLPD VR+RIVELA  GVRPCDISRQL VSHGCVSKIL+R+YET
Sbjct  175  GHGGVNQLGGVFVNGRPLPDVVRQRIVELAHNGVRPCDISRQLRVSHGCVSKILSRYYET  234

Query  65   GSIRPGSIGGSK--------------TKQENPGMFAWEIREQLVAQRVCEPHSIPSVSSV  110
            GS + G IGGSK               K+ENP MFAWEIR++L+A+ +C   ++PSVSS+
Sbjct  235  GSFKAGVIGGSKPKVATPPVVDAIANYKRENPTMFAWEIRDRLLAEAICSQDNVPSVSSI  294

Query  111  NRILRNSGA  119
            NRI+RN  A
Sbjct  295  NRIVRNKAA  303



Lambda      K        H
   0.310    0.123    0.348 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3920191338


Query= XP_031327391.1 uncharacterized protein LOC116158703 [Photinus
pyralis]

Length=350
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

G5EF51_CAEEL  unnamed protein product                                 30.0    3.4  
Q38BB3_TRYB2  unnamed protein product                                 28.5    7.6  


>G5EF51_CAEEL unnamed protein product
Length=723

 Score = 30.0 bits (66),  Expect = 3.4, Method: Compositional matrix adjust.
 Identities = 9/25 (36%), Positives = 16/25 (64%), Gaps = 0/25 (0%)

Query  114  LKGLQKSKAYEEGFAFSNAKFNSNW  138
            +KG  KS  Y+ G++F + +F + W
Sbjct  369  IKGFSKSAGYQPGYSFDDHRFRNTW  393


>Q38BB3_TRYB2 unnamed protein product
Length=224

 Score = 28.5 bits (62),  Expect = 7.6, Method: Compositional matrix adjust.
 Identities = 14/37 (38%), Positives = 20/37 (54%), Gaps = 0/37 (0%)

Query  204  LRMGNSEVTPTTDDEYNDNNNNLDEFQEYPEDMHGAP  240
            L  GN+  TP  D  Y    +NL+EFQ+ P+    +P
Sbjct  17   LSGGNTGPTPYQDKPYPVQPHNLNEFQQPPDTWRKSP  53



Lambda      K        H
   0.310    0.123    0.348 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3920191338


Query= XP_031327392.1 uncharacterized protein LOC116158705 [Photinus
pyralis]

Length=185
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

OSKA_DROME  unnamed protein product                                   41.6    2e-04
Q583R5_TRYB2  unnamed protein product                                 30.0    1.3  
ICE2_DROME  unnamed protein product                                   29.6    1.6  


>OSKA_DROME unnamed protein product
Length=606

 Score = 41.6 bits (96),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/122 (30%), Positives = 65/122 (53%), Gaps = 15/122 (12%)

Query  35   LCIGGQTISQLRKRVERSRSDESEWFVPRNTPLVVLIGTNDILRSGRASVVFNNLKRLLI  94
            LC+ G TI+  R R++R +       +P  T ++V IG+ DI+R G+  V   +  RLLI
Sbjct  454  LCVSGLTINGARNRLKRVQ-------LPEGTQIIVNIGSVDIMR-GKPLVQIEHDFRLLI  505

Query  95   TLEKWSRITPITLCTLPPIKHASPD--VRHQLHKYNTSIRTLCSNRCDVFRLLDLYALLD  152
                  R+ PI L  L P+ +   D  +  +++++N  IR+ C +     +++D+++ L 
Sbjct  506  KEMHNMRLVPI-LTNLAPLGNYCHDKVLCDKIYRFNKFIRSECCH----LKVIDIHSCLI  560

Query  153  AE  154
             E
Sbjct  561  NE  562


>Q583R5_TRYB2 unnamed protein product
Length=639

 Score = 30.0 bits (66),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 42/110 (38%), Gaps = 11/110 (10%)

Query  59   WFVPRNTPLV------VLIGTNDILRSGRASVVFNNLKRLLITLEKWSRITPITL--CTL  110
            W    N+P V      V I    +    R +V  NNLK   ++ EK      I+   C  
Sbjct  79   WGTDVNSPAVGAPLPTVTINLCQVESPERRTVTMNNLKVSKVSFEKVGTYGIISCVECHE  138

Query  111  PPIKHASPDVRHQLHKYNTSIRTLCSNRCDVFRLLDLYALLDAENYEGHF  160
             PIK     VR+ L      + TLC N   V   ++    L  +  EG F
Sbjct  139  DPIKLP---VRNSLPCLGVDLITLCENVAKVLHCVERNISLAPDYDEGSF  185


>ICE2_DROME unnamed protein product
Length=684

 Score = 29.6 bits (65),  Expect = 1.6, Method: Composition-based stats.
 Identities = 14/28 (50%), Positives = 18/28 (64%), Gaps = 1/28 (4%)

Query  120  VRHQLHKY-NTSIRTLCSNRCDVFRLLD  146
            +  QLH Y NTS+  L SN C+  +LLD
Sbjct  504  LEQQLHDYYNTSMPQLLSNLCEFLKLLD  531



Lambda      K        H
   0.310    0.123    0.348 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3920191338


Query= XP_031327393.1 dipeptidase 1-like [Photinus pyralis]

Length=431
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O46091_DROME  unnamed protein product                                 32.3    0.88 
M9PG98_DROME  unnamed protein product                                 30.8    2.8  
Q7JUF8_DROME  unnamed protein product                                 30.8    2.9  


>O46091_DROME unnamed protein product
Length=995

 Score = 32.3 bits (72),  Expect = 0.88, Method: Compositional matrix adjust.
 Identities = 41/196 (21%), Positives = 78/196 (40%), Gaps = 22/196 (11%)

Query  93   VQYKDALAKTIDQIDVIKRLVKKYSKDLELVTTPEGIMGAFREKKIASLIGVEGGHSMDS  152
             Q +++ A   + ++ +K  +  Y+ D+  +    G+     +  ++S++G       +S
Sbjct  624  AQRRESFASASEALNYVKTFMGNYTMDVAFI---RGLQ--LYDTNMSSVLGTGAQKEYES  678

Query  153  RLGVLRMLYDLGVRYMTLTHSCNTPWADASPVD-TRTPVHNLTEFGKVVVKEMNRLGMMV  211
            R+  L  LY+L  +Y+              P D  R P H LTE        ++ L    
Sbjct  679  RMRTLWQLYELQQQYVANIRVIQGLGLLTFPADGDRIPSH-LTEV-------LDSLDKSA  730

Query  212  DLSHVSHNVMNQAISVSRAP-------VIFSHSSAYAV-FAHHRNIPDDTLRLLKKNTGV  263
             L H+    +   +S + +P       VI    +AYA+   +   + +  +R+    T  
Sbjct  731  HLEHMDLQDLETRVSNTSSPQLAHIREVILKARNAYAIAMVNTSAMQEFAIRIYLSGTSE  790

Query  264  AMVNFYPGFIHANASE  279
            A V  +P    A  SE
Sbjct  791  AGVRIHPLLEDAELSE  806


>M9PG98_DROME unnamed protein product
Length=1004

 Score = 30.8 bits (68),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 38/187 (20%), Positives = 75/187 (40%), Gaps = 22/187 (12%)

Query  93   VQYKDALAKTIDQIDVIKRLVKKYSKDLELVTTPEGIMGAFREKKIASLIGVEGGHSMDS  152
             Q +++ A   + ++ +K  +  Y+ D+  +    G+     +  ++S++G       +S
Sbjct  624  AQRRESFASASEALNYVKTFMGNYTMDVAFI---RGLQ--LYDTNMSSVLGTGAQKEYES  678

Query  153  RLGVLRMLYDLGVRYMTLTHSCNTPWADASPVD-TRTPVHNLTEFGKVVVKEMNRLGMMV  211
            R+  L  LY+L  +Y+              P D  R P H LTE        ++ L    
Sbjct  679  RMRTLWQLYELQQQYVANIRVIQGLGLLTFPADGDRIPSH-LTEV-------LDSLDKSA  730

Query  212  DLSHVSHNVMNQAISVSRAP-------VIFSHSSAYAV-FAHHRNIPDDTLRLLKKNTGV  263
             L H+    +   +S + +P       VI    +AYA+   +   + +  +R+    T  
Sbjct  731  HLEHMDLQDLETRVSNTSSPQLAHIREVILKARNAYAIAMVNTSAMQEFAIRIYLSGTSE  790

Query  264  AMVNFYP  270
            A V  +P
Sbjct  791  AGVRIHP  797


>Q7JUF8_DROME unnamed protein product
Length=982

 Score = 30.8 bits (68),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 38/187 (20%), Positives = 75/187 (40%), Gaps = 22/187 (12%)

Query  93   VQYKDALAKTIDQIDVIKRLVKKYSKDLELVTTPEGIMGAFREKKIASLIGVEGGHSMDS  152
             Q +++ A   + ++ +K  +  Y+ D+  +    G+     +  ++S++G       +S
Sbjct  624  AQRRESFASASEALNYVKTFMGNYTMDVAFI---RGLQ--LYDTNMSSVLGTGAQKEYES  678

Query  153  RLGVLRMLYDLGVRYMTLTHSCNTPWADASPVD-TRTPVHNLTEFGKVVVKEMNRLGMMV  211
            R+  L  LY+L  +Y+              P D  R P H LTE        ++ L    
Sbjct  679  RMRTLWQLYELQQQYVANIRVIQGLGLLTFPADGDRIPSH-LTEV-------LDSLDKSA  730

Query  212  DLSHVSHNVMNQAISVSRAP-------VIFSHSSAYAV-FAHHRNIPDDTLRLLKKNTGV  263
             L H+    +   +S + +P       VI    +AYA+   +   + +  +R+    T  
Sbjct  731  HLEHMDLQDLETRVSNTSSPQLAHIREVILKARNAYAIAMVNTSAMQEFAIRIYLSGTSE  790

Query  264  AMVNFYP  270
            A V  +P
Sbjct  791  AGVRIHP  797



Lambda      K        H
   0.310    0.123    0.348 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3920191338


Query= XP_031327394.1 ornithine decarboxylase 2-like isoform X1 [Photinus
pyralis]

Length=423
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DCOR_TRYBB  unnamed protein product                                   241     3e-75
M4TB00_TELCI  unnamed protein product                                 231     2e-71
DCOR_DICDI  unnamed protein product                                   224     2e-68


>DCOR_TRYBB unnamed protein product
Length=423

 Score = 241 bits (614),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 140/409 (34%), Positives = 225/409 (55%), Gaps = 27/409 (7%)

Query  1    MSVKYKEGYINVVDDKNAEDFINTIVSGTHIDRPLFVGDLNEIIFKHELWKKLTPRMQPY  60
            +S ++ EG+ N  D    +  +NT   G     P FV DL +I+ KHE WKK  PR+ P+
Sbjct  9    LSCRFLEGF-NTRDALCKKISMNTCDEGD----PFFVADLGDIVRKHETWKKCLPRVTPF  63

Query  61   YAVRCNNSDTVLRIMAKLGVGFVCVSKTELQQVLSIGVDPSQIIFGRTIKFVSHIQFAVD  120
            YAV+CN+   VL  +A LG GF C S TE+Q+V  IGV P +II+    K +SHI++A D
Sbjct  64   YAVKCNDDWRVLGTLAALGTGFDCASNTEIQRVRGIGVPPEKIIYANPCKQISHIRYARD  123

Query  121  NNIKLMTFDNKEELLKINNICPDARVLIHIRHDVKL-KAPFQTKFGCDPNTDAEVLLKLA  179
            + + +MTFD  +EL K+    P A++++ I  D  L +     KFG     D   +L+ A
Sbjct  124  SGVDVMTFDCVDELEKVAKTHPKAKMVLRISTDDSLARCRLSVKFGAKVE-DCRFILEQA  182

Query  180  FSLKIHVIGVTFEIDPES-DFRSICNSMNAARRLFNTAKTMGLNFSLLYINGERIGNPGH  238
              L I V GV+F +   S D  +   +++ +R +F+    +G N  +L I G   G PG 
Sbjct  183  KKLNIDVTGVSFHVGSGSTDASTFAQAISDSRFVFDMGTELGFNMHILDIGG---GFPGT  239

Query  239  NDELYNFSKEVSM---AIEEYF-PNRRIKVIFEDGSYFVRSAFKLATSVFGIKIK-----  289
             D    F +   +   A+E++F P+ ++ ++ E G Y+V SAF LA +V   K+      
Sbjct  240  RDAPLKFEEIAGVINNALEKHFPPDLKLTIVAEPGRYYVASAFTLAVNVIAKKVTPGVQT  299

Query  290  -----KEMSLVKYHYYMNHSTFLSLNSIVYWNTNTFPQTLQKTVKSG--FPSVLWGPTCD  342
                  E +   + YY+N   + S N I+Y +    P   ++ + +   +PS +WGPTCD
Sbjct  300  DVGAHAESNAQSFMYYVNDGVYGSFNCILYDHAVVRPLPQREPIPNEKLYPSSVWGPTCD  359

Query  343  SIDVLHNDTTLPILNCGDWIVFNNMGSYSLVLSTNFNGFSSFSAYYLIN  391
             +D +     LP +  G+W++F +MG+Y++V +++FNGF S + YY+++
Sbjct  360  GLDQIVERYYLPEMQVGEWLLFEDMGAYTVVGTSSFNGFQSPTIYYVVS  408


>M4TB00_TELCI unnamed protein product
Length=424

 Score = 231 bits (588),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 130/390 (33%), Positives = 211/390 (54%), Gaps = 25/390 (6%)

Query  31   IDRPLFVGDLNEIIFKHELWKKLTPRMQPYYAVRCNNSDTVLRIMAKLGVGFVCVSKTEL  90
            ID    + DL+ I  +  LWK+  P ++P+YAV+CN    ++R +A LG GF C S+ E+
Sbjct  40   IDDAFMLVDLDVIFERFLLWKREMPMIEPFYAVKCNTDRVLVRTLAALGAGFDCASREEI  99

Query  91   QQVLSIGVDPSQIIFGRTIKFVSHIQFAVDNNIKLMTFDNKEELLKINNICPDARVLIHI  150
              V+ +GV   +II+    K  S I  A + N+ +MTFD+ EEL KI ++ PDA++++ I
Sbjct  100  DIVMDMGVRAEKIIYANPCKTRSFITHAKEKNVSMMTFDSVEELAKIAHLHPDAKMILRI  159

Query  151  R-HDVKLKAPFQTKFGCDPNTDAEVLLKLAFSLKIHVIGVTFEI-----DPESDFRSICN  204
               D   + P   KFG DP T A  LL  A  L ++VIG++F +     DP + FR    
Sbjct  160  AVSDPTARCPLNLKFGVDPVTKAPHLLVHAKELGVNVIGISFHVGSGCNDPTA-FR---E  215

Query  205  SMNAARRLFNTAKTMGLNFSLLYINGERIGNPG--HNDELYNFSKEVSMAIEEYFPNR-R  261
            ++  AR L    + +G + +L+ + G   G PG        + +  +  A++E+ P    
Sbjct  216  ALTHARHLTELGRGLGFDMNLVDLGG---GYPGTLQQTSFEDIAAVIRSAVDEFLPPEFG  272

Query  262  IKVIFEDGSYFVRSAFKL------ATSVFGIKIKKEMSLVKYH---YYMNHSTFLSLNSI  312
            +++I E G +F  + F L      AT V   KI K    V +    YY+N   + S N I
Sbjct  273  VRLIAEPGRFFAAAPFTLVCNIIHATEVSAEKITKRPEDVDHRGFMYYVNDGVYGSFNCI  332

Query  313  VYWNTNTFPQTLQKTVKSGFPSVLWGPTCDSIDVLHNDTTLPILNCGDWIVFNNMGSYSL  372
            ++ + +     L   +   +PS +WGPTCDS+D + +   + +++ G+WIV+ NMG+Y+ 
Sbjct  333  LFDHVDPVGAPLFDEIVEEYPSTIWGPTCDSLDKIEDQKMMRMMSVGEWIVYQNMGAYTC  392

Query  373  VLSTNFNGFSSFSAYYLINKHNWIFLNKNP  402
              ST FNGF   +A Y+I++ NW  ++ +P
Sbjct  393  SASTTFNGFQRPNAVYVISRKNWARISTSP  422


>DCOR_DICDI unnamed protein product
Length=461

 Score = 224 bits (572),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 135/385 (35%), Positives = 216/385 (56%), Gaps = 22/385 (6%)

Query  19   EDFINTIVSGTHIDRPLFVGDLNEIIFKHELWKKLTPRMQPYYAVRCNNSDTVLRIMAKL  78
            ++ I +++  T  D   FV D+  II + + W K  P ++PYYAV+CN +  VLR++  L
Sbjct  72   QELITSLLDKTDRD-AFFVADVGVIIKQWQKWVKNLPNVKPYYAVKCNPTVGVLRVLDAL  130

Query  79   GVGFVCVSKTELQQVLSIGVDPSQIIFGRTIKFVSHIQFAVDNNIKLMTFDNKEELLKIN  138
            G  + C S+TE++ VL++GVDPS+II+    K +S ++FA  +N+KLMTFDN  EL KI 
Sbjct  131  GTNYDCASRTEIESVLNLGVDPSRIIYANPCKQISALKFARAHNVKLMTFDNLSELEKIE  190

Query  139  NICPDARVLIHIR-HDVKLKAPFQTKFGCDPNTDAEVLLKLAFSLKIHVIGVTFEIDPE-  196
               P+A +++ I   D K    F +KFG   + D   LL++A  + + V+GV+F +    
Sbjct  191  KFFPEAELVLRIAPDDSKSVMRFGSKFGVHID-DCNDLLEMAKEMNLKVVGVSFHVGSGC  249

Query  197  SDFRSICNSMNAARRLFNTAKTMGLNFSLLYINGERIGNPGHNDELYN-FSKEVSMAIEE  255
                S  +++   + +F+ AK + +  +L+ + G   G  G +DE +N F+K +     E
Sbjct  250  QSGDSYADALIMVKSVFDMAKKLNMELTLVDVGG---GFTGSDDEKFNAFTKVIREKTAE  306

Query  256  YF-PNRRIKVIFEDGSYFVRSAFKLATSVFGIK-IKKE----------MSLVKYHYYMNH  303
             F PN  +K+I E G YF   +  LA +V   + IK+E           ++ +Y+YY+  
Sbjct  307  LFSPN--VKIIAEPGRYFAAQSHTLAVTVISKRSIKQEDNRQHPRRTSNNMRQYNYYLAD  364

Query  304  STFLSLNSIVYWNTNTFPQTLQKTVKSGFPSVLWGPTCDSIDVLHNDTTLPILNCGDWIV  363
              + S N+  +      P  L+ + K   P  L+GPTCDSIDV+  DT +P L  GDW+ 
Sbjct  365  GVYGSFNNTKFDYAKVEPLLLKPSTKQPTPCTLFGPTCDSIDVVLKDTQIPELKIGDWLY  424

Query  364  FNNMGSYSLVLSTNFNGFSSFSAYY  388
            F +MG+Y++  S++FNGF     YY
Sbjct  425  FQDMGAYTIASSSSFNGFCPPPVYY  449



Lambda      K        H
   0.310    0.123    0.348 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3920191338


Query= XP_031327395.1 ornithine decarboxylase 2-like isoform X1 [Photinus
pyralis]

Length=423
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DCOR_TRYBB  unnamed protein product                                   241     3e-75
M4TB00_TELCI  unnamed protein product                                 231     2e-71
DCOR_DICDI  unnamed protein product                                   224     2e-68


>DCOR_TRYBB unnamed protein product
Length=423

 Score = 241 bits (614),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 140/409 (34%), Positives = 225/409 (55%), Gaps = 27/409 (7%)

Query  1    MSVKYKEGYINVVDDKNAEDFINTIVSGTHIDRPLFVGDLNEIIFKHELWKKLTPRMQPY  60
            +S ++ EG+ N  D    +  +NT   G     P FV DL +I+ KHE WKK  PR+ P+
Sbjct  9    LSCRFLEGF-NTRDALCKKISMNTCDEGD----PFFVADLGDIVRKHETWKKCLPRVTPF  63

Query  61   YAVRCNNSDTVLRIMAKLGVGFVCVSKTELQQVLSIGVDPSQIIFGRTIKFVSHIQFAVD  120
            YAV+CN+   VL  +A LG GF C S TE+Q+V  IGV P +II+    K +SHI++A D
Sbjct  64   YAVKCNDDWRVLGTLAALGTGFDCASNTEIQRVRGIGVPPEKIIYANPCKQISHIRYARD  123

Query  121  NNIKLMTFDNKEELLKINNICPDARVLIHIRHDVKL-KAPFQTKFGCDPNTDAEVLLKLA  179
            + + +MTFD  +EL K+    P A++++ I  D  L +     KFG     D   +L+ A
Sbjct  124  SGVDVMTFDCVDELEKVAKTHPKAKMVLRISTDDSLARCRLSVKFGAKVE-DCRFILEQA  182

Query  180  FSLKIHVIGVTFEIDPES-DFRSICNSMNAARRLFNTAKTMGLNFSLLYINGERIGNPGH  238
              L I V GV+F +   S D  +   +++ +R +F+    +G N  +L I G   G PG 
Sbjct  183  KKLNIDVTGVSFHVGSGSTDASTFAQAISDSRFVFDMGTELGFNMHILDIGG---GFPGT  239

Query  239  NDELYNFSKEVSM---AIEEYF-PNRRIKVIFEDGSYFVRSAFKLATSVFGIKIK-----  289
             D    F +   +   A+E++F P+ ++ ++ E G Y+V SAF LA +V   K+      
Sbjct  240  RDAPLKFEEIAGVINNALEKHFPPDLKLTIVAEPGRYYVASAFTLAVNVIAKKVTPGVQT  299

Query  290  -----KEMSLVKYHYYMNHSTFLSLNSIVYWNTNTFPQTLQKTVKSG--FPSVLWGPTCD  342
                  E +   + YY+N   + S N I+Y +    P   ++ + +   +PS +WGPTCD
Sbjct  300  DVGAHAESNAQSFMYYVNDGVYGSFNCILYDHAVVRPLPQREPIPNEKLYPSSVWGPTCD  359

Query  343  SIDVLHNDTTLPILNCGDWIVFNNMGSYSLVLSTNFNGFSSFSAYYLIN  391
             +D +     LP +  G+W++F +MG+Y++V +++FNGF S + YY+++
Sbjct  360  GLDQIVERYYLPEMQVGEWLLFEDMGAYTVVGTSSFNGFQSPTIYYVVS  408


>M4TB00_TELCI unnamed protein product
Length=424

 Score = 231 bits (588),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 130/390 (33%), Positives = 211/390 (54%), Gaps = 25/390 (6%)

Query  31   IDRPLFVGDLNEIIFKHELWKKLTPRMQPYYAVRCNNSDTVLRIMAKLGVGFVCVSKTEL  90
            ID    + DL+ I  +  LWK+  P ++P+YAV+CN    ++R +A LG GF C S+ E+
Sbjct  40   IDDAFMLVDLDVIFERFLLWKREMPMIEPFYAVKCNTDRVLVRTLAALGAGFDCASREEI  99

Query  91   QQVLSIGVDPSQIIFGRTIKFVSHIQFAVDNNIKLMTFDNKEELLKINNICPDARVLIHI  150
              V+ +GV   +II+    K  S I  A + N+ +MTFD+ EEL KI ++ PDA++++ I
Sbjct  100  DIVMDMGVRAEKIIYANPCKTRSFITHAKEKNVSMMTFDSVEELAKIAHLHPDAKMILRI  159

Query  151  R-HDVKLKAPFQTKFGCDPNTDAEVLLKLAFSLKIHVIGVTFEI-----DPESDFRSICN  204
               D   + P   KFG DP T A  LL  A  L ++VIG++F +     DP + FR    
Sbjct  160  AVSDPTARCPLNLKFGVDPVTKAPHLLVHAKELGVNVIGISFHVGSGCNDPTA-FR---E  215

Query  205  SMNAARRLFNTAKTMGLNFSLLYINGERIGNPG--HNDELYNFSKEVSMAIEEYFPNR-R  261
            ++  AR L    + +G + +L+ + G   G PG        + +  +  A++E+ P    
Sbjct  216  ALTHARHLTELGRGLGFDMNLVDLGG---GYPGTLQQTSFEDIAAVIRSAVDEFLPPEFG  272

Query  262  IKVIFEDGSYFVRSAFKL------ATSVFGIKIKKEMSLVKYH---YYMNHSTFLSLNSI  312
            +++I E G +F  + F L      AT V   KI K    V +    YY+N   + S N I
Sbjct  273  VRLIAEPGRFFAAAPFTLVCNIIHATEVSAEKITKRPEDVDHRGFMYYVNDGVYGSFNCI  332

Query  313  VYWNTNTFPQTLQKTVKSGFPSVLWGPTCDSIDVLHNDTTLPILNCGDWIVFNNMGSYSL  372
            ++ + +     L   +   +PS +WGPTCDS+D + +   + +++ G+WIV+ NMG+Y+ 
Sbjct  333  LFDHVDPVGAPLFDEIVEEYPSTIWGPTCDSLDKIEDQKMMRMMSVGEWIVYQNMGAYTC  392

Query  373  VLSTNFNGFSSFSAYYLINKHNWIFLNKNP  402
              ST FNGF   +A Y+I++ NW  ++ +P
Sbjct  393  SASTTFNGFQRPNAVYVISRKNWARISTSP  422


>DCOR_DICDI unnamed protein product
Length=461

 Score = 224 bits (572),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 135/385 (35%), Positives = 216/385 (56%), Gaps = 22/385 (6%)

Query  19   EDFINTIVSGTHIDRPLFVGDLNEIIFKHELWKKLTPRMQPYYAVRCNNSDTVLRIMAKL  78
            ++ I +++  T  D   FV D+  II + + W K  P ++PYYAV+CN +  VLR++  L
Sbjct  72   QELITSLLDKTDRD-AFFVADVGVIIKQWQKWVKNLPNVKPYYAVKCNPTVGVLRVLDAL  130

Query  79   GVGFVCVSKTELQQVLSIGVDPSQIIFGRTIKFVSHIQFAVDNNIKLMTFDNKEELLKIN  138
            G  + C S+TE++ VL++GVDPS+II+    K +S ++FA  +N+KLMTFDN  EL KI 
Sbjct  131  GTNYDCASRTEIESVLNLGVDPSRIIYANPCKQISALKFARAHNVKLMTFDNLSELEKIE  190

Query  139  NICPDARVLIHIR-HDVKLKAPFQTKFGCDPNTDAEVLLKLAFSLKIHVIGVTFEIDPE-  196
               P+A +++ I   D K    F +KFG   + D   LL++A  + + V+GV+F +    
Sbjct  191  KFFPEAELVLRIAPDDSKSVMRFGSKFGVHID-DCNDLLEMAKEMNLKVVGVSFHVGSGC  249

Query  197  SDFRSICNSMNAARRLFNTAKTMGLNFSLLYINGERIGNPGHNDELYN-FSKEVSMAIEE  255
                S  +++   + +F+ AK + +  +L+ + G   G  G +DE +N F+K +     E
Sbjct  250  QSGDSYADALIMVKSVFDMAKKLNMELTLVDVGG---GFTGSDDEKFNAFTKVIREKTAE  306

Query  256  YF-PNRRIKVIFEDGSYFVRSAFKLATSVFGIK-IKKE----------MSLVKYHYYMNH  303
             F PN  +K+I E G YF   +  LA +V   + IK+E           ++ +Y+YY+  
Sbjct  307  LFSPN--VKIIAEPGRYFAAQSHTLAVTVISKRSIKQEDNRQHPRRTSNNMRQYNYYLAD  364

Query  304  STFLSLNSIVYWNTNTFPQTLQKTVKSGFPSVLWGPTCDSIDVLHNDTTLPILNCGDWIV  363
              + S N+  +      P  L+ + K   P  L+GPTCDSIDV+  DT +P L  GDW+ 
Sbjct  365  GVYGSFNNTKFDYAKVEPLLLKPSTKQPTPCTLFGPTCDSIDVVLKDTQIPELKIGDWLY  424

Query  364  FNNMGSYSLVLSTNFNGFSSFSAYY  388
            F +MG+Y++  S++FNGF     YY
Sbjct  425  FQDMGAYTIASSSSFNGFCPPPVYY  449



Lambda      K        H
   0.310    0.123    0.348 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3920191338


Query= XP_031327396.1 ornithine decarboxylase-like isoform X2 [Photinus
pyralis]

Length=403
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DCOR_TRYBB  unnamed protein product                                   209     4e-63
M4TB00_TELCI  unnamed protein product                                 205     1e-61
DCOR_DICDI  unnamed protein product                                   191     3e-56


>DCOR_TRYBB unnamed protein product
Length=423

 Score = 209 bits (531),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 131/409 (32%), Positives = 210/409 (51%), Gaps = 47/409 (11%)

Query  1    MSVKYKEGYINVVDDKNAEDFINTIVSGTHIDRPLFVGDLNEIIFKHELWKKLTPRMQPY  60
            +S ++ EG+ N  D    +  +NT   G     P FV DL +I+ KHE WKK  PR+ P+
Sbjct  9    LSCRFLEGF-NTRDALCKKISMNTCDEGD----PFFVADLGDIVRKHETWKKCLPRVTPF  63

Query  61   YAVRCNNSDTVLRIMAKLGVGFVCVSKTELQQVLSIGVDPSQIIFGRTIK----------  110
            YAV+CN+   VL  +A LG GF C S TE+Q+V  IGV P +II+    K          
Sbjct  64   YAVKCNDDWRVLGTLAALGTGFDCASNTEIQRVRGIGVPPEKIIYANPCKQISHIRYARD  123

Query  111  ----------FEELLKINNICPDARVLIHIRHDVKL-KAPFQTKFGCDPNTDAEVLLKLA  159
                       +EL K+    P A++++ I  D  L +     KFG     D   +L+ A
Sbjct  124  SGVDVMTFDCVDELEKVAKTHPKAKMVLRISTDDSLARCRLSVKFGAKVE-DCRFILEQA  182

Query  160  FSLKIHVIGVTFEIDPES-DFRSICNSMNAARRLFNTAKTMGLNFSLLYINGERIGNPGH  218
              L I V GV+F +   S D  +   +++ +R +F+    +G N  +L I G   G PG 
Sbjct  183  KKLNIDVTGVSFHVGSGSTDASTFAQAISDSRFVFDMGTELGFNMHILDIGG---GFPGT  239

Query  219  NDELYNFSKEVSM---AIEEYF-PNRRIKVIFEDGSYFVRSAFKLATSVFGIKIK-----  269
             D    F +   +   A+E++F P+ ++ ++ E G Y+V SAF LA +V   K+      
Sbjct  240  RDAPLKFEEIAGVINNALEKHFPPDLKLTIVAEPGRYYVASAFTLAVNVIAKKVTPGVQT  299

Query  270  -----KEMSLVKYHYYMNHSTFLSLNSIVYWNTNTFPQTLQKTVKSG--FPSVLWGPTCD  322
                  E +   + YY+N   + S N I+Y +    P   ++ + +   +PS +WGPTCD
Sbjct  300  DVGAHAESNAQSFMYYVNDGVYGSFNCILYDHAVVRPLPQREPIPNEKLYPSSVWGPTCD  359

Query  323  SIDVLHNDTTLPILNCGDWIVFNNMGSYSLVLSTNFNGFSSFSAYYLIN  371
             +D +     LP +  G+W++F +MG+Y++V +++FNGF S + YY+++
Sbjct  360  GLDQIVERYYLPEMQVGEWLLFEDMGAYTVVGTSSFNGFQSPTIYYVVS  408


>M4TB00_TELCI unnamed protein product
Length=424

 Score = 205 bits (521),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 122/390 (31%), Positives = 199/390 (51%), Gaps = 45/390 (12%)

Query  31   IDRPLFVGDLNEIIFKHELWKKLTPRMQPYYAVRCNNSDTVLRIMAKLGVGFVCVSKTEL  90
            ID    + DL+ I  +  LWK+  P ++P+YAV+CN    ++R +A LG GF C S+ E+
Sbjct  40   IDDAFMLVDLDVIFERFLLWKREMPMIEPFYAVKCNTDRVLVRTLAALGAGFDCASREEI  99

Query  91   QQVLSIGVDPSQIIFGRTIK--------------------FEELLKINNICPDARVLIHI  130
              V+ +GV   +II+    K                     EEL KI ++ PDA++++ I
Sbjct  100  DIVMDMGVRAEKIIYANPCKTRSFITHAKEKNVSMMTFDSVEELAKIAHLHPDAKMILRI  159

Query  131  R-HDVKLKAPFQTKFGCDPNTDAEVLLKLAFSLKIHVIGVTFEI-----DPESDFRSICN  184
               D   + P   KFG DP T A  LL  A  L ++VIG++F +     DP + FR    
Sbjct  160  AVSDPTARCPLNLKFGVDPVTKAPHLLVHAKELGVNVIGISFHVGSGCNDPTA-FR---E  215

Query  185  SMNAARRLFNTAKTMGLNFSLLYINGERIGNPG--HNDELYNFSKEVSMAIEEYFPNR-R  241
            ++  AR L    + +G + +L+ + G   G PG        + +  +  A++E+ P    
Sbjct  216  ALTHARHLTELGRGLGFDMNLVDLGG---GYPGTLQQTSFEDIAAVIRSAVDEFLPPEFG  272

Query  242  IKVIFEDGSYFVRSAFKL------ATSVFGIKIKKEMSLVKYH---YYMNHSTFLSLNSI  292
            +++I E G +F  + F L      AT V   KI K    V +    YY+N   + S N I
Sbjct  273  VRLIAEPGRFFAAAPFTLVCNIIHATEVSAEKITKRPEDVDHRGFMYYVNDGVYGSFNCI  332

Query  293  VYWNTNTFPQTLQKTVKSGFPSVLWGPTCDSIDVLHNDTTLPILNCGDWIVFNNMGSYSL  352
            ++ + +     L   +   +PS +WGPTCDS+D + +   + +++ G+WIV+ NMG+Y+ 
Sbjct  333  LFDHVDPVGAPLFDEIVEEYPSTIWGPTCDSLDKIEDQKMMRMMSVGEWIVYQNMGAYTC  392

Query  353  VLSTNFNGFSSFSAYYLINKHNWIFLNKNP  382
              ST FNGF   +A Y+I++ NW  ++ +P
Sbjct  393  SASTTFNGFQRPNAVYVISRKNWARISTSP  422


>DCOR_DICDI unnamed protein product
Length=461

 Score = 191 bits (486),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 124/385 (32%), Positives = 200/385 (52%), Gaps = 42/385 (11%)

Query  19   EDFINTIVSGTHIDRPLFVGDLNEIIFKHELWKKLTPRMQPYYAVRCNNSDTVLRIMAKL  78
            ++ I +++  T  D   FV D+  II + + W K  P ++PYYAV+CN +  VLR++  L
Sbjct  72   QELITSLLDKTDRD-AFFVADVGVIIKQWQKWVKNLPNVKPYYAVKCNPTVGVLRVLDAL  130

Query  79   GVGFVCVSKTELQQVLSIGVDPSQIIFGRTIK--------------------FEELLKIN  118
            G  + C S+TE++ VL++GVDPS+II+    K                      EL KI 
Sbjct  131  GTNYDCASRTEIESVLNLGVDPSRIIYANPCKQISALKFARAHNVKLMTFDNLSELEKIE  190

Query  119  NICPDARVLIHIR-HDVKLKAPFQTKFGCDPNTDAEVLLKLAFSLKIHVIGVTFEIDPE-  176
               P+A +++ I   D K    F +KFG   + D   LL++A  + + V+GV+F +    
Sbjct  191  KFFPEAELVLRIAPDDSKSVMRFGSKFGVHID-DCNDLLEMAKEMNLKVVGVSFHVGSGC  249

Query  177  SDFRSICNSMNAARRLFNTAKTMGLNFSLLYINGERIGNPGHNDELYN-FSKEVSMAIEE  235
                S  +++   + +F+ AK + +  +L+ + G   G  G +DE +N F+K +     E
Sbjct  250  QSGDSYADALIMVKSVFDMAKKLNMELTLVDVGG---GFTGSDDEKFNAFTKVIREKTAE  306

Query  236  YF-PNRRIKVIFEDGSYFVRSAFKLATSVFGIK-IKKE----------MSLVKYHYYMNH  283
             F PN  +K+I E G YF   +  LA +V   + IK+E           ++ +Y+YY+  
Sbjct  307  LFSPN--VKIIAEPGRYFAAQSHTLAVTVISKRSIKQEDNRQHPRRTSNNMRQYNYYLAD  364

Query  284  STFLSLNSIVYWNTNTFPQTLQKTVKSGFPSVLWGPTCDSIDVLHNDTTLPILNCGDWIV  343
              + S N+  +      P  L+ + K   P  L+GPTCDSIDV+  DT +P L  GDW+ 
Sbjct  365  GVYGSFNNTKFDYAKVEPLLLKPSTKQPTPCTLFGPTCDSIDVVLKDTQIPELKIGDWLY  424

Query  344  FNNMGSYSLVLSTNFNGFSSFSAYY  368
            F +MG+Y++  S++FNGF     YY
Sbjct  425  FQDMGAYTIASSSSFNGFCPPPVYY  449



Lambda      K        H
   0.310    0.123    0.348 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3920191338


Query= XP_031327397.1 ghilanten-like [Photinus pyralis]

Length=203
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8SYF5_DROME  unnamed protein product                                 33.9    0.070
G5EF34_CAEEL  unnamed protein product                                 30.0    1.4  
M9NCR4_DROME  unnamed protein product                                 28.5    5.6  


>Q8SYF5_DROME unnamed protein product
Length=486

 Score = 33.9 bits (76),  Expect = 0.070, Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 39/93 (42%), Gaps = 23/93 (25%)

Query  100  RKCENLCPYGYAKDSDGCQTCDCIDHCKEMNCSSERVCQTEELCPTGDCGKTIKCVTICA  159
             KCE  C  GY  +S   ++C+ ID CKE N                       C  +C 
Sbjct  140  HKCE--CYEGYTLNSTDLRSCNDIDECKESNGG---------------------CSQVCN  176

Query  160  DLPCHANTQCPQGFQMDERNCPTCLCKEDCEFP  192
            +LP      C  GF++DE +  TCL  ++C  P
Sbjct  177  NLPGEFICTCNSGFEIDESDEKTCLDIDECADP  209


>G5EF34_CAEEL unnamed protein product
Length=966

 Score = 30.0 bits (66),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 37/100 (37%), Gaps = 35/100 (35%)

Query  24   CPDV-ICAIACLNGHDVDQFGCPICKCFDPCEGLICPVGQVCQSRAQTCTEDCCSRPSIC  82
            CP + +C++ C NG   D  GC +C+C  P E    P    C+                 
Sbjct  389  CPSLELCSLRCANGLRRDNIGCYVCECL-PDE---VPTNPRCR-----------------  427

Query  83   VPFSVSNLNASSPICPKRKCENLCPYGYAKDSDGCQTCDC  122
                   LN          CE  C +GY KD DGC  C C
Sbjct  428  ------ELN-------DENCEKQCAHGYLKDEDGCTVCKC  454


>M9NCR4_DROME unnamed protein product
Length=15105

 Score = 28.5 bits (62),  Expect = 5.6, Method: Compositional matrix adjust.
 Identities = 13/31 (42%), Positives = 15/31 (48%), Gaps = 0/31 (0%)

Query  40    DQFGCPICKCFDPCEGLICPVGQVCQSRAQT  70
             D   C   KC DPC G IC +  +C  R  T
Sbjct  9101  DTLSCINHKCVDPCAGAICGINAICNVRQHT  9131



Lambda      K        H
   0.310    0.123    0.348 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3920191338


Query= XP_031327398.1 piggyBac transposable element-derived protein 4-like
[Photinus pyralis]

Length=594
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SSLA1_DICDI  unnamed protein product                                  38.9    0.010
GCY23_CAEEL  unnamed protein product                                  33.1    0.76 
Q386R7_TRYB2  unnamed protein product                                 31.2    3.9  


>SSLA1_DICDI unnamed protein product
Length=578

 Score = 38.9 bits (89),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 40/177 (23%), Positives = 74/177 (42%), Gaps = 27/177 (15%)

Query  121  LFKLFISADIMRDLVTFTNQRGRFEVENRIRAGKTMV-YKDVDEIEIYAYIGLLICAGAL  179
             FKL ++ D+ + L++  N   R E E ++  GK +    D+ +I  + +I   +    +
Sbjct  55   FFKLLLNEDLSKFLISLINTNLRHEREKKLDKGKDISRLNDLTDITFWKFITDYL--KNI  112

Query  180  KSNREPVGMLWQDDHCFKRPIYSATMPRTRFSQITSWMRFDDKDTREQRRQYDKLAPIRN  239
             SN+        +D      I    M   R+S + + +     D +  R           
Sbjct  113  YSNK-------NNDKIPPELINLKMMDHNRYSAVHNVL-----DMKSHR--------FEE  152

Query  240  VLEMFVNNCQKYYNPGSHLTIDEQLVPFRGRCPFRVYM----KSKPAKYGIKIWCLA  292
              E+F+N+  KY N G+ L  DE +  + G+   + ++     SKP   GI+ + L 
Sbjct  153  YCEIFMNSALKYINIGNVLNCDETIYAYYGKDAIKDHILINNDSKPHSVGIEAYSLT  209


>GCY23_CAEEL unnamed protein product
Length=1073

 Score = 33.1 bits (74),  Expect = 0.76, Method: Compositional matrix adjust.
 Identities = 19/53 (36%), Positives = 29/53 (55%), Gaps = 0/53 (0%)

Query  18   AQNSEEYDNCVDDDLDAEPIDDSSEVEDNIETIIEERDEITGDSTDDEEMMDI  70
             +N E   N  D   ++  IDD +  ++ + T  +ER E +G STDD EM +I
Sbjct  262  GENGEYQQNVKDHFANSFIIDDVNGFDNTLVTPFKERLEASGYSTDDLEMKNI  314


>Q386R7_TRYB2 unnamed protein product
Length=4307

 Score = 31.2 bits (69),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 17/59 (29%), Positives = 33/59 (56%), Gaps = 1/59 (2%)

Query  112   VPPSTSMIELFKLFI-SADIMRDLVTFTNQRGRFEVENRIRAGKTMVYKDVDEIEIYAY  169
             + PS   IE  K+ + + +I+ ++ +  ++R    +E  +R GKT++  DVD +E   Y
Sbjct  3286  IDPSNQAIEWVKMNLKTNNIVSEVTSMHDERFSHTLELAVRFGKTLLVMDVDGVEPILY  3344



Lambda      K        H
   0.310    0.123    0.348 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3920191338


Query= XP_031327399.1 chymotrypsin-1-like [Photinus pyralis]

Length=257
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TRYDT_DROME  unnamed protein product                                  120     5e-33
Q9W2C8_DROME  unnamed protein product                                 116     3e-30
STUB_DROME  unnamed protein product                                   118     5e-30


>TRYDT_DROME unnamed protein product
Length=253

 Score = 120 bits (302),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 80/238 (34%), Positives = 125/238 (53%), Gaps = 15/238 (6%)

Query  16   TVNEGL--SLQNRIIGGTNAPDNQYPYMVSISYLGEHNCGGSVVDHEWIVTAAHCVDGFP  73
            TV EGL   L  RI+GG+    + +P+ +S+   G H+CGGS+     IVTAAHC+    
Sbjct  18   TVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSVS  77

Query  74   LNDLTIYIGSTKLSKGGSKHAIIEAHIHEQYDSRTIKNDVAILKI-APISYSTAVNFIKL  132
             + L I  GS+  S GG   ++     HE Y++ T+ ND+AI+KI   +++S+ +  I L
Sbjct  78   ASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGL  137

Query  133  GDDSVGGGQDCTLTGWGFTSFNVIGDTIPDDLQQISLKTITVEECQ----GYKLSVGMNQ  188
               +   G   +++GWG  S+     +IP  LQ +++  ++  +C     GY   +    
Sbjct  138  ASSNPANGAAASVSGWGTLSYG--SSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTM  195

Query  189  LCTFTKAGEGFCVHDSGGPLVMNIGGERKQIGIVSWGMHCA-RGYPDVYSRVSSYIEW  245
            +C    +G+  C  DSGGPLV         +G+VSWG  CA   YP VY+ V++   W
Sbjct  196  ICA-AASGKDACQGDSGGPLVS----GGVLVGVVSWGYGCAYSNYPGVYADVAALRSW  248


>Q9W2C8_DROME unnamed protein product
Length=372

 Score = 116 bits (290),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 72/236 (31%), Positives = 127/236 (54%), Gaps = 14/236 (6%)

Query  22   SLQNRIIGGTNAPDNQYPYMVSISYLGEHNCGGSVVDHEWIVTAAHCVDGFPLNDLTIYI  81
            ++Q RI+GG     +QYP++  + Y G   C  S+++ ++++TA+HCV GF    +++ +
Sbjct  122  NIQKRIVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTASHCVYGFRKERISVRL  181

Query  82   --GSTKLSKGGS-KHAIIEAHIHEQYDSRTIKNDVAILKI-APISYSTAVNFIKLGDDSV  137
                 K+S        + E   H +Y++R   ND+AI+K+  P+ ++  ++ + +     
Sbjct  182  LEHDRKMSHMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCMPTPGR  241

Query  138  G-GGQDCTLTGWGFTSFNVIGDTIPDDLQQISLKTITVEECQG--YKLSVGMNQLC-TFT  193
               G++  +TGWG      +G    D LQ++ +  ++ +EC+   Y   +  N LC  + 
Sbjct  242  SFKGENGIVTGWGALK---VGGPTSDTLQEVQVPILSQDECRKSRYGNKITDNMLCGGYD  298

Query  194  KAGEGFCVHDSGGPLVMNIGGERKQ--IGIVSWGMHCAR-GYPDVYSRVSSYIEWF  246
            + G+  C  DSGGPL +   G R+    G+VSWG  CA+ GYP VY+RV+ Y  W 
Sbjct  299  EGGKDSCQGDSGGPLHIVASGTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTWI  354


>STUB_DROME unnamed protein product
Length=787

 Score = 118 bits (296),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 77/244 (32%), Positives = 127/244 (52%), Gaps = 25/244 (10%)

Query  24   QNRIIGGTNAPDNQYPYMVSI---SYLG---EHNCGGSVVDHEWIVTAAHCVDGFPLNDL  77
            + RI+GG +A   ++P+ VS+   S+ G    H CGG++++  WI TA HCVD   ++ +
Sbjct  541  ETRIVGGKSAAFGRWPWQVSVRRTSFFGFSSTHRCGGALINENWIATAGHCVDDLLISQI  600

Query  78   TIYIGSTKLSKGGSKHAIIEAH-----IHEQYDSRTIKNDVAILKI-APISYSTAVNFIK  131
             I +G    S    +   IE       +H +Y   T + D+A++K+  P+ ++  V+ I 
Sbjct  601  RIRVGEYDFSHVQEQLPYIERGVAKKVVHPKYSFLTYEYDLALVKLEQPLEFAPHVSPIC  660

Query  132  LGD-DSVGGGQDCTLTGWGFTSFNVIGDTIPDDLQQISLKTITVEECQGYKLSVGMNQ--  188
            L + DS+  G + T+TGWG  S    G T+P  LQ++S+  ++ + C+   +  G  +  
Sbjct  661  LPETDSLLIGMNATVTGWGRLS---EGGTLPSVLQEVSVPIVSNDNCKSMFMRAGRQEFI  717

Query  189  ----LCT-FTKAGEGFCVHDSGGPL-VMNIGGERKQIGIVSWGMHCARG-YPDVYSRVSS  241
                LC  +   G+  C  DSGGPL   +  G     GI+SWG+ CA    P V +R+S 
Sbjct  718  PDIFLCAGYETGGQDSCQGDSGGPLQAKSQDGRFFLAGIISWGIGCAEANLPGVCTRISK  777

Query  242  YIEW  245
            +  W
Sbjct  778  FTPW  781



Lambda      K        H
   0.310    0.123    0.348 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3920191338


Query= XP_031327400.1 diacylglycerol O-acyltransferase 1-like [Photinus
pyralis]

Length=412
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8ST50_DROME  unnamed protein product                                 124     6e-31
Q960U8_DROME  unnamed protein product                                 124     9e-31
DGAT1_DICDI  unnamed protein product                                  98.2    6e-22


>Q8ST50_DROME unnamed protein product
Length=565

 Score = 124 bits (312),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 111/420 (26%), Positives = 187/420 (45%), Gaps = 33/420 (8%)

Query  13   ALTNWLVIFFLCFVLANILDNYKTYGIIRSPLQ---LTTDLYEFLIIWWWLFALFYLVIV  69
             L NW  +      L   L+N   YGI  +PL      +   E       + +++ LV  
Sbjct  138  GLVNWGFLLLCIGGLRLGLENLLKYGIRINPLDWFFFISGHNEGEGHNALILSIYSLV--  195

Query  70   LQIVISAVLEKCLLSRLMSENKGALLHTVNTFLLYNVFACICFYQKLNGIFAFALAPHLF  129
              I +   +EK L   +++E  G  +  VN  +L      +  + K +       +   F
Sbjct  196  -HISLCLAVEKGLAMEIIAEGLGLFIQIVNIVVLV-CLPVVTIHLKGHAFSLMGASTVCF  253

Query  130  FPT---MKLLSY-QLN----------NRRIRIQNEQTAELK--------SDQN-TKIEHF  166
            F +   +KL SY Q N          N R R  +   AELK         D++ +K+  +
Sbjct  254  FYSVLFLKLWSYVQTNMWCRQTYYQKNPRERRPSITLAELKKGVLNGGEEDEDVSKLVQY  313

Query  167  KIGSLRHLFRYMFCSGCLVYKFHTWKKGKSDYKASLTFILRSVAMLLACSLIMHQYVMTE  226
                  +   Y  C+  L Y+ +  +  +   +  L  +L  V  +     +  Q+++  
Sbjct  314  PDNLTYNDLLYFLCAPTLCYELNFPRTSRVRKRFLLKRLLEVVIGVNVVMALFQQWIIPS  373

Query  227  LQNASYYIDKRQHLNLLSTFLKLALPIHIVWSAFFYFYLYNACFKLPSILFGTEKITYIQ  286
            ++N+                LKLALP H+ W  FFY   ++    +  +L   ++  Y  
Sbjct  374  VRNSLIPFSNMDVALATERLLKLALPNHLCWLCFFYLMFHSFLNAVGELLNFADRNFYC-  432

Query  287  DWWNSANIGAYWATWNYPTHLFFKEEVFIPALEMGLSKHQAACVVGVVSGVIHEYLWTIP  346
            DWWN+ NI  +W TWN P H +    ++IP ++MG S  QA+ +V + S V HEYL ++P
Sbjct  433  DWWNANNIDTFWRTWNMPVHRWCVRHLYIPVVQMGYSSRQASTIVFLFSAVFHEYLVSVP  492

Query  347  FRIGYGGALLIMMAQIPFSSLSKHISYRFGNQWGNVLVWMQLIIGHTLYAILIHYFTQYL  406
             +I    A + MM QIP S++SK I  + G + GN++VW  +I+G  L   ++ Y+  Y+
Sbjct  493  LQIYKIWAFMGMMGQIPLSAISKSIEKKLGPRMGNIIVWASIILGQPL--CIMAYYHDYV  550


>Q960U8_DROME unnamed protein product
Length=565

 Score = 124 bits (311),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 111/420 (26%), Positives = 186/420 (44%), Gaps = 33/420 (8%)

Query  13   ALTNWLVIFFLCFVLANILDNYKTYGIIRSPLQ---LTTDLYEFLIIWWWLFALFYLVIV  69
             L NW  +      L   L+N   YGI  +PL      +   E       + +++ LV  
Sbjct  138  GLVNWGFLLLCIGGLRLGLENLLKYGIRINPLDWFFFISGHNEGEGHNALILSIYSLV--  195

Query  70   LQIVISAVLEKCLLSRLMSENKGALLHTVNTFLLYNVFACICFYQKLNGIFAFALAPHLF  129
              I +   +EK L   +++E  G  +  VN  +L      +  + K +       +   F
Sbjct  196  -HISLCLAVEKGLAMEIIAEGLGLFIQIVNIVVLV-CLPVVTIHLKGHAFSLMGASTVCF  253

Query  130  FPT---MKLLSY-QLN----------NRRIRIQNEQTAELK--------SDQN-TKIEHF  166
            F +   +KL SY Q N          N R R  +   AELK         D++ +K+  +
Sbjct  254  FYSVLFLKLWSYVQTNMWCRQTYYQKNPRERRPSITLAELKKGVLNGGEEDEDVSKLVQY  313

Query  167  KIGSLRHLFRYMFCSGCLVYKFHTWKKGKSDYKASLTFILRSVAMLLACSLIMHQYVMTE  226
                      Y  C+  L Y+ +  +  +   +  L  +L  V  +     +  Q+++  
Sbjct  314  PDNLTYKDLLYFLCAPTLCYELNFPRTSRVRKRFLLKRLLEVVIGVNVVMALFQQWIIPS  373

Query  227  LQNASYYIDKRQHLNLLSTFLKLALPIHIVWSAFFYFYLYNACFKLPSILFGTEKITYIQ  286
            ++N+                LKLALP H+ W  FFY   ++    +  +L   ++  Y  
Sbjct  374  VRNSLIPFSNMDVALATERLLKLALPNHLCWLCFFYLMFHSFLNAVGELLNFADRNFYC-  432

Query  287  DWWNSANIGAYWATWNYPTHLFFKEEVFIPALEMGLSKHQAACVVGVVSGVIHEYLWTIP  346
            DWWN+ NI  +W TWN P H +    ++IP ++MG S  QA+ +V + S V HEYL ++P
Sbjct  433  DWWNANNIDTFWRTWNMPVHRWCVRHLYIPVVQMGYSSRQASTIVFLFSAVFHEYLVSVP  492

Query  347  FRIGYGGALLIMMAQIPFSSLSKHISYRFGNQWGNVLVWMQLIIGHTLYAILIHYFTQYL  406
             +I    A + MM QIP S++SK I  + G + GN++VW  +I+G  L   ++ Y+  Y+
Sbjct  493  LQIYKIWAFMGMMGQIPLSAISKSIEKKLGPRMGNIIVWASIILGQPL--CIMAYYHDYV  550


>DGAT1_DICDI unnamed protein product
Length=617

 Score = 98.2 bits (243),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 100/377 (27%), Positives = 177/377 (47%), Gaps = 31/377 (8%)

Query  33   NYKTYGIIRSPLQLTTDLYEFLIIWWWLFALFYLVIVLQIVISAVLEKCLLSRLMSENKG  92
            N+  YGI     ++  DLY+      W   +  L+I L I+ + ++EK    +L+ +   
Sbjct  233  NHLLYGI-----RINLDLYKISEYHRWPGVMISLMINLFIIAAYLIEKAAAKQLLPDRIC  287

Query  93   ALLHTVN--TFLLYNVFACICFY-QKLNGIFAFALAPHLFFPTMKLLSYQLNNRRIRIQN  149
             LL  +N    ++    + I F     +GI    L       +MK++SY   N + R  N
Sbjct  288  YLLRIINCAAVIIVPSGSIIAFSPNPASGIIVMILICTF---SMKIISYAYENSKQRKLN  344

Query  150  EQTAELKSDQ-NTKIEHFKIGSLRHLFRYMFCSGCLVYKFHTWKKGKSDYKASLTFILRS  208
                +   D  NT I    + SLR  + +M     LVY+  ++ +     K    ++LR 
Sbjct  345  PDNKKFVIDPTNTSIYPNNL-SLRSTYWFMLVP-TLVYQL-SYPRSPKIRKG---YLLRR  398

Query  209  VAMLLACSLIM----HQYVMTELQNASYYIDKRQHLNLLSTFLKLALPIHIVWSAFFY--  262
            +   L+ SL++    +QY++  +QN+   ++K   + ++   +KL+LP   VW   FY  
Sbjct  399  IVEALSLSLLILWMVNQYMLPLVQNSIEPLEKIDIVLIVERIMKLSLPNLYVWLLGFYVF  458

Query  263  FYLY-NACFKLPSILFGTEKITYIQDWWNSANIGAYWATWNYPTHLFFKEEVFIPALEMG  321
            F+LY N   ++    FG  +  + +DWWNS  +  +W TWN P H +    ++ P    G
Sbjct  459  FHLYLNIVAEI--TRFGDRE--FYRDWWNSTGLDYFWRTWNMPVHHWMVVLIYTPMRRRG  514

Query  322  LSKHQAACVVGVVSGVIHEYLWTIPFRIGYGGALLIMMAQIPFSSLSKHISYRFGNQWGN  381
             SK+    +   VS + HE + +IPF          +M+Q+   +L+K++    G   GN
Sbjct  515  FSKNMGYFMCFFVSAIFHELVISIPFHSLKLWGFFGIMSQMVLIALTKNLMN--GRNLGN  572

Query  382  VLVWMQLIIGHTLYAIL  398
            V+ W+ +++G  L  +L
Sbjct  573  VIFWISIVLGQPLVVLL  589



Lambda      K        H
   0.310    0.123    0.348 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3920191338


Query= XP_031327401.1 elongation of very long chain fatty acids protein
1-like [Photinus pyralis]

Length=259
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VCY6_DROME  unnamed protein product                                 165     1e-49
Q9VHX7_DROME  unnamed protein product                                 157     3e-46
Q5JZZ4_DROME  unnamed protein product                                 132     3e-37


>Q9VCY6_DROME unnamed protein product
Length=295

 Score = 165 bits (417),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 96/255 (38%), Positives = 139/255 (55%), Gaps = 14/255 (5%)

Query  3    TATEYYNFMFVTQADKRTTTWPLMSSPLLPLALICGYLFAVYHFLPKYMTGRRPYRLKGY  62
            T  +Y+NF+F   AD RT  W L+ SPL  L ++  YLF V  + PK+M  R+P++L+  
Sbjct  7    TQVDYWNFLFTDLADPRTNDWFLIKSPLPLLGILAFYLFFVLSWGPKFMKDRKPFKLERT  66

Query  63   LWVYNLAQV-VSCFVIIYGLTA---SGWRIHHLVDCQVIDLSNNPNAIRTAQCVWFYFAL  118
            L VYN  QV +S +++  G+       WR      CQ +D S  P A R A+ V+ Y+  
Sbjct  67   LLVYNFFQVALSVWMVYEGVVIWQYYSWR------CQPVDWSRTPKAYREARVVYVYYLA  120

Query  119  KVVELTETFVFILRKKYKQVSPLHVFHHASTVFCAWVGVKFYPGGMSSIPIILNSIVHIV  178
            K+ EL +T  F+LRK  +QV+ LHV+HH      +W   K+YPGG  +    +NS VHI+
Sbjct  121  KITELLDTIFFVLRKNDRQVTFLHVYHHTVMPMISWGTSKYYPGGHGTFIGWINSFVHII  180

Query  179  MYSYYFLSSLGPGVQRK-WLQPIKPIVTRIQIIQLLILLVLAPQAFSPRCAVPDLLIYLC  237
            MYSYYFLS+ GP +Q+  W    K  +T +Q+IQ     +   Q     C  P   +   
Sbjct  181  MYSYYFLSAFGPQMQKYLWW---KKYITNLQMIQFCCAFIHQTQLLYTDCGYPRWSVCFT  237

Query  238  VPDFIINLILFLRFY  252
            +P+ +    LF  FY
Sbjct  238  LPNAVFFYFLFNDFY  252


>Q9VHX7_DROME unnamed protein product
Length=329

 Score = 157 bits (397),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 96/248 (39%), Positives = 139/248 (56%), Gaps = 5/248 (2%)

Query  14   TQADKRTTTWPLMSSPLLPLALICGYLFAVYHFLPKYMTGRRPYRLKGYLWVYNLAQVVS  73
             ++D RT  +PLMSSP   +A+   Y + V    PK M  R+P+ L+  L VYN AQV+ 
Sbjct  17   NKSDPRTRDYPLMSSPFPTIAISLTYAYIVKVLGPKLMENRKPFELRKVLIVYNAAQVIF  76

Query  74   CFVIIYGLTASGWRIHHLVDCQVIDLSNNPNAIRTAQCVWFYFALKVVELTETFVFILRK  133
               + Y     GW   + + C+ ++ S +P AIRTA+  W+Y+  K  E  +TF F++RK
Sbjct  77   SAWLFYESCIGGWLNGYNLRCEPVNYSYSPKAIRTAEGCWWYYFSKFTEFFDTFFFVMRK  136

Query  134  KYKQVSPLHVFHHASTVFCAWVGVKFYPGGMSSIPIILNSIVHIVMYSYYFLSSLGPGVQ  193
            +Y QVS LHV HH       W GVKF PGG S+    LN+ VHI MY+YY L+++GP VQ
Sbjct  137  RYDQVSTLHVIHHGIMPVSVWWGVKFTPGGHSTFFGFLNTFVHIFMYAYYMLAAMGPKVQ  196

Query  194  RK-WLQPIKPIVTRIQIIQLLILLVLAPQA-FSPRCAVPDLLIYLCVPDFIINLILFLRF  251
            +  W    K  +T +Q+IQ ++++V + Q  F   C  P    Y      ++   LF  F
Sbjct  197  KYLWW---KKYLTVMQMIQFVLVMVHSFQLFFKNDCNYPIGFAYFIGAHAVMFYFLFSNF  253

Query  252  YARSYNKK  259
            Y R+Y K+
Sbjct  254  YKRAYVKR  261


>Q5JZZ4_DROME unnamed protein product
Length=262

 Score = 132 bits (332),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 81/246 (33%), Positives = 130/246 (53%), Gaps = 3/246 (1%)

Query  12   FVTQADKRTTTWPLMSSPLLPLALICGYLFAVYHFLPKYMTGRRPYRLKGYLWVYNLAQV  71
            F  Q D+RT  WPL+ S      L+  YL  V  + PK+ T  +P +L+  L+ ++LA V
Sbjct  11   FPDQPDERTRNWPLVDSFWTVPVLLSIYLLMV-RYAPKWTTRHKPLQLRAPLFCHSLAMV  69

Query  72   VSCFVIIYGLTASGWRIHHLVDCQVIDLSNNPNAIRTAQCVWFYFALKVVELTETFVFIL  131
                 I   L A+   + +   CQ   +S +P+ +R  +  W+++  K++E  +T  FIL
Sbjct  70   FLNGYICLELYAATRDLDYNFGCQPCRVSFDPHEMRLTKAFWWFYISKILEFADTAFFIL  129

Query  132  RKKYKQVSPLHVFHHASTVFCAWVGVKFYPGGMSSIPIILNSIVHIVMYSYYFLSSLGPG  191
            R+K+ Q+S LHV+HH++     W+ +K+ P G + +P ++NS VHI+MY YY LS LGP 
Sbjct  130  RQKWSQLSFLHVYHHSTMFVFCWILIKWMPTGSTYVPAMINSFVHIIMYGYYALSVLGPR  189

Query  192  VQRKWLQPIKPIVTRIQIIQLLILLVLAPQAFSPRCAVPDLLIYLCVPDFIINLILFLRF  251
            VQR      K  +T +Q++Q  I+   A Q     C     +        +  L +F +F
Sbjct  190  VQR--FLWWKRYLTGLQLVQFTIIFFWASQMLVRGCEYGTWITLSMAIYSLPFLFMFGKF  247

Query  252  YARSYN  257
            Y + Y 
Sbjct  248  YMQKYT  253



Lambda      K        H
   0.310    0.123    0.348 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3920191338


Query= XP_031327402.1 DNA polymerase epsilon subunit 2 [Photinus pyralis]

Length=521
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VRQ7_DROME  unnamed protein product                                 320     3e-103
Q95RJ7_DROME  unnamed protein product                                 258     8e-81 
Q38CZ7_TRYB2  unnamed protein product                                 88.2    2e-18 


>Q9VRQ7_DROME unnamed protein product
Length=525

 Score = 320 bits (819),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 179/521 (34%), Positives = 278/521 (53%), Gaps = 20/521 (4%)

Query  7    LNKKLYNTLKLSGFLVRREFCTYVIEKLLQENIQLDENATFDKYVKTLCSNLEKQCLINK  66
            L K++ NT KL GFL+R E  +Y+ E+LL  +      A  DK++  +  NL+ Q L+  
Sbjct  8    LRKRITNTFKLCGFLIRSENSSYLAEQLLPFDA-----AERDKWLTVITENLQSQKLLTP  62

Query  67   SIEKHHIECVVEIALNSGYDKQETIFSTIGAFEFPKLRYDSDRRIYLPAISKSRLLSGPN  126
             +E+  +E  +      G D+ ET+F+ I AF  P+ RY+   + +       +LL+ P 
Sbjct  63   HVERAALEKAINELNRVGLDEGETVFALIDAFTVPRFRYNQRIKKFELDTQPRQLLTAPR  122

Query  127  SKTQLFLDRYNTVLQRTQRN--FKNKI------TKKESDRLFLQTVDYLFTKGSVTLNKT  178
             K+     RY  +LQ+T R+  F   +       + ++ +  LQ  + L    +  + + 
Sbjct  123  MKSDYMQQRYAMLLQKTLRHDLFAPAVIQDGVGAEAQAKKFKLQFAENLLATSA--MKEA  180

Query  179  LILGALFQMSEGKFALEDPSGLVELDFSDAKYHGGFFVENSFVLVNGYYEDKLIKVSTVI  238
            ++LG L Q+ EGKF +EDP+G V+LD + A++H GFF E  FVL  G Y + ++KV  + 
Sbjct  181  VVLGLLTQLKEGKFYVEDPTGCVQLDLTGARFHAGFFCEGCFVLAEGNYNNGVLKVDGLG  240

Query  239  SPPGEEYKDSILSFGSINYYGGPSITPLRNSQNLAEQLRLNPNNSIMLFSDVWLDHPMIF  298
             PP E    S   FG+ N +GG S   L+ S  L E  R N   +I+  SDV LD P++ 
Sbjct  241  FPPAEPANSSRAFFGTANTWGGESAKLLKYSAGLQELERTNTETTIVFLSDVRLDLPVVM  300

Query  299  EKLEILFNGFHHSPPIAFIFMGNFMQDYQGLEKIDNYKKLFKKFGELLSNYTELVHKSKF  358
            EKL  LF G+   PP A + MG F    +   ++ ++       G L +   +L  ++  
Sbjct  301  EKLRQLFVGYDSCPPQAIVLMGPFTASTRNHHELRHH---LDALGGLAAGCEQLKKQTDL  357

Query  359  VFVPSMTDPCHLHILPRFPLPSHVTEEFQKSVPSAIFTTNPCRLQYYTKEIVLFRADILP  418
            + VPS  DP   +ILPR P+P  +     K+ P     TNPCRLQY T++IV+ R D++ 
Sbjct  358  ILVPSSEDPTAPNILPRAPIPECLAAGLLKAWPRTQLATNPCRLQYCTQQIVVCRLDLMA  417

Query  419  KLMQGALEKPQ-IEEIPEFITRTIIGQGHLCPFSLNAVTVNWDFDYTLRLFPLPNLIVLG  477
            K  +  L  P+   +I +   RTI+ QGHL P    A+ V+WD+D  L L+PLP+LIV+G
Sbjct  418  KFCRNTLHFPEDTSQIEQHFARTIVCQGHLVPIHPIAMPVHWDYDPALWLYPLPDLIVMG  477

Query  478  DKSEAYQGKYKECQLVNPGSFCGDEEFQFMSYVPFDETIQE  518
            D  +++      C ++N GSF    +F F  Y+P   TI++
Sbjct  478  DSCQSFSSSQHGCTVLNTGSFV-KSKFAFKVYIPATRTIED  517


>Q95RJ7_DROME unnamed protein product
Length=403

 Score = 258 bits (658),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 141/400 (35%), Positives = 215/400 (54%), Gaps = 15/400 (4%)

Query  128  KTQLFLDRYNTVLQRTQRN--FKNKI------TKKESDRLFLQTVDYLFTKGSVTLNKTL  179
            K+     RY  +LQ+T R+  F   +       + ++ +  LQ  + L    +  + + +
Sbjct  2    KSDYMQQRYAMLLQKTLRHDLFAPAVIQDGVGAEAQAKKFKLQFAENLLATSA--MKEAV  59

Query  180  ILGALFQMSEGKFALEDPSGLVELDFSDAKYHGGFFVENSFVLVNGYYEDKLIKVSTVIS  239
            +LG L Q+ EGKF +EDP+G V+LD + A++H GFF E  FVL  G Y + ++KV  +  
Sbjct  60   VLGLLTQLKEGKFYVEDPTGCVQLDLTGARFHAGFFCEGCFVLAEGNYNNGVLKVDGLGF  119

Query  240  PPGEEYKDSILSFGSINYYGGPSITPLRNSQNLAEQLRLNPNNSIMLFSDVWLDHPMIFE  299
            PP E    S   FG+ N +GG S   L+ S  L E  R N   +I+  SDV LD P++ E
Sbjct  120  PPAEPANSSRAFFGTANTWGGESAKLLKYSAGLQELERTNTETTIVFLSDVRLDLPVVME  179

Query  300  KLEILFNGFHHSPPIAFIFMGNFMQDYQGLEKIDNYKKLFKKFGELLSNYTELVHKSKFV  359
            KL  LF G+   PP A + MG F    +   ++ ++       G L +   +L  ++  +
Sbjct  180  KLRQLFVGYDSCPPQAIVLMGPFTASTRNHHELRHH---LDALGGLAAGCEQLKKQTDLI  236

Query  360  FVPSMTDPCHLHILPRFPLPSHVTEEFQKSVPSAIFTTNPCRLQYYTKEIVLFRADILPK  419
             VPS  DP   +ILPR P+P  +     K+ P     TNPCRLQY T++IV+ R D++ K
Sbjct  237  LVPSSEDPTAPNILPRAPIPECLAAGLLKAWPRTQLATNPCRLQYCTQQIVVCRLDLMAK  296

Query  420  LMQGALEKPQ-IEEIPEFITRTIIGQGHLCPFSLNAVTVNWDFDYTLRLFPLPNLIVLGD  478
              +  L  P+   +I +   RTI+ QGHL P    A+ V+WD+D  L L+PLP+LIV+GD
Sbjct  297  FCRNTLHFPEDTSQIEQHFARTIVCQGHLVPIHPIAMPVHWDYDPALWLYPLPDLIVMGD  356

Query  479  KSEAYQGKYKECQLVNPGSFCGDEEFQFMSYVPFDETIQE  518
              +++      C ++N GSF    +F F  Y+P   TI++
Sbjct  357  SCQSFSSSQHGCTVLNTGSFV-KSKFAFKVYIPATRTIED  395


>Q38CZ7_TRYB2 unnamed protein product
Length=535

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 119/524 (23%), Positives = 209/524 (40%), Gaps = 65/524 (12%)

Query  35   LQENIQLDENATFDKYVKTLCSNLEKQCLINKSIEKHHIECVVEIALNSGYDKQETIFST  94
            L  NI    NA  D +     + L + C + + ++   ++ VV +  +      + +  T
Sbjct  33   LNGNIDAQRNALRDIF-----ALLHRACGLERFVDGEKVKSVVSLHSSKVQGAIDGVVPT  87

Query  95   IGAFEFPKLRYDSDRRIYLPAISKSRLLSGPNSKTQLFL---DRYNTVLQRTQRN--FKN  149
            +         Y      Y+   S    +         F     RY    +R  R+  F  
Sbjct  88   VDVLSLDDTPY-----AYIDEWSGEVRVQSTRQHGDRFTVLNQRYLFARKRCLRSGLFSR  142

Query  150  KITKKESDRLFLQTVDYLFTKGSVTLNKTLILGALFQMSEGKFALEDPSGLVELDFSDAK  209
              +K+  D+     V  +  +G    +   +LG L + S   + LED  G V+L      
Sbjct  143  DSSKQPIDQGLPSLVPSIALEGIDPSDTVAVLGMLVKHSSATY-LEDIYGRVKLIMRGCV  201

Query  210  YH-GGFFVENSFVLVNGYYEDKLIKVSTVISPPGEEYKDSILSFGS-INYYGGPSITPLR  267
            +   G   E  FV+V G +   L  V++V  PP E  +D++   GS  + +G       R
Sbjct  202  HPPVGVVGEGFFVVVKGQWVGGLFVVASVDLPPAERREDTLRVVGSDFDLFG-------R  254

Query  268  NSQNLAEQLR---LNPNNSIMLFSDVWLDHPMIFEKLEILFNGFHH--------------  310
               ++    R    +  + +++ S + LD     + L   F    +              
Sbjct  255  RPDDVVAAFRREKTSLGSVVIVMSQIHLDQRSTVDSLISFFREMQNRSEAELTDTTLVMV  314

Query  311  ----SPPIAFIFMGNFMQDYQGLEKIDNYKKLFKKFGELLSNYTELVHK-SKFVFVPSMT  365
                S PI +  + +  + ++G    D Y+ L      +++ +   V + ++ V VP   
Sbjct  315  GEFCSSPIHYDDVSHLPEPFEG---CDRYRSLMNILATVITVHAPSVAQLTQVVIVPGCG  371

Query  366  DPCHL-HILPRFPLPSHVTEEFQKSVPSAIFTTNPCRLQYYTKEIVLFRADILPKLMQG-  423
            D   L  +LP+ P+ S   +  Q  +   +   NPCRL+++T E+++ R D    L +  
Sbjct  372  DITGLLGVLPQPPIVSTFGKVLQARLKKVVLAPNPCRLRFFTHEMIVVRRDFSRSLREKE  431

Query  424  -ALEKPQIEEIP-----EFITRTIIGQGHLCPFSLNAVTVNWDFDYTLRLFPLPNLIVLG  477
               E  + E        E I +TI+ + HL P     +   W  D  L L  LP+L+V+ 
Sbjct  432  RTFEWSRHEASTPVISFESIAKTILDEAHLAPGVTEGIL--WKADKALCLPVLPHLLVMC  489

Query  478  DKSEAYQGKYKECQLVNPGSFCGDEEFQFMSYVPFDETIQECSL  521
            D +E ++  YK  ++VNPG F   +   F+ Y P D    ECSL
Sbjct  490  DSTEQWECSYKGVRIVNPGPFSLGK--TFLWYTPAD---GECSL  528



Lambda      K        H
   0.310    0.123    0.348 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3920191338


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jan 28, 2021  9:24 PM
  Number of letters in database: 17,197,330
  Number of sequences in database:  25,232



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= XP_031327403.1 uncharacterized protein LOC116158714 [Photinus
pyralis]

Length=442
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

F0JAQ8_DROME  unnamed protein product                                 33.5    0.36 
A0A0B4KFS6_DROME  unnamed protein product                             33.5    0.37 
A1Z951_DROME  unnamed protein product                                 33.5    0.41 


>F0JAQ8_DROME unnamed protein product
Length=662

 Score = 33.5 bits (75),  Expect = 0.36, Method: Compositional matrix adjust.
 Identities = 34/144 (24%), Positives = 64/144 (44%), Gaps = 11/144 (8%)

Query  209  QHSSCSAASIDVECEELI--LPELHTANKRKENSQTRDDTMVETTMQGQ-TRGQSIKAIS  265
            Q S C + + + E  E I  +  +  + +RK+    RD   ++T    Q +  QS++  +
Sbjct  100  QKSQCGSPTFEKELREQIENMNRIMKSKERKQMQTCRDHKALQTRFARQESLLQSMQQEN  159

Query  266  R------KGDGHGQDGTQTIKYLQQIIKKQNILQSILMDISNRITNLESQNSTQTQENVD  319
            R      +   H  D     K +  I+ + N+ + + M +  R+ +LE+QN+  +   V 
Sbjct  160  RSLLTRIRQYEHCLDDVMR-KVVDAIVAEDNLREEVSM-LKGRVRDLEAQNAALSASPVK  217

Query  320  DNAESFFVIMTNLPIDSQEHLNDL  343
               E +  + +  P  S  HL DL
Sbjct  218  GRDEGYCTMSSGQPQPSNGHLEDL  241


>A0A0B4KFS6_DROME unnamed protein product
Length=661

 Score = 33.5 bits (75),  Expect = 0.37, Method: Compositional matrix adjust.
 Identities = 34/144 (24%), Positives = 64/144 (44%), Gaps = 11/144 (8%)

Query  209  QHSSCSAASIDVECEELI--LPELHTANKRKENSQTRDDTMVETTMQGQ-TRGQSIKAIS  265
            Q S C + + + E  E I  +  +  + +RK+    RD   ++T    Q +  QS++  +
Sbjct  100  QKSQCGSPTFEKELREQIENMNRIMKSKERKQMQTCRDHKALQTRFARQESLLQSMQQEN  159

Query  266  R------KGDGHGQDGTQTIKYLQQIIKKQNILQSILMDISNRITNLESQNSTQTQENVD  319
            R      +   H  D     K +  I+ + N+ + + M +  R+ +LE+QN+  +   V 
Sbjct  160  RSLLTRIRQYEHCLDDVMR-KVVDAIVAEDNLREEVSM-LKGRVRDLEAQNAALSASPVK  217

Query  320  DNAESFFVIMTNLPIDSQEHLNDL  343
               E +  + +  P  S  HL DL
Sbjct  218  GRDEGYCTMSSGQPQPSNGHLEDL  241


>A1Z951_DROME unnamed protein product
Length=639

 Score = 33.5 bits (75),  Expect = 0.41, Method: Compositional matrix adjust.
 Identities = 17/64 (27%), Positives = 32/64 (50%), Gaps = 1/64 (2%)

Query  280  KYLQQIIKKQNILQSILMDISNRITNLESQNSTQTQENVDDNAESFFVIMTNLPIDSQEH  339
            K +  I+ + N+ + + M +  R+ +LE+QN+  +   V    E +  + +  P  S  H
Sbjct  156  KVVDAIVAEDNLREEVSM-LKGRVRDLEAQNAALSASPVKGRDEGYCTMSSGQPQPSNGH  214

Query  340  LNDL  343
            L DL
Sbjct  215  LEDL  218



Lambda      K        H
   0.316    0.129    0.381 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4879639968


Query= XP_031327404.1 microsomal glutathione S-transferase 1-like [Photinus
pyralis]

Length=151
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

VIT3_DROME  unnamed protein product                                   28.9    1.6  
G5ECI9_CAEEL  unnamed protein product                                 26.9    8.9  


>VIT3_DROME unnamed protein product
Length=420

 Score = 28.9 bits (63),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 14/59 (24%), Positives = 27/59 (46%), Gaps = 2/59 (3%)

Query  74   DMENIPLFFVVGFTYILTNPAPLIASYIFRIYTVSRIIHTFVYAIYVIPQPARGLAWVV  132
            ++EN+P    + +  +   P    A  I +IY V +I H    +   +P P+    W++
Sbjct  38   ELENVPSLNDITWERLENQPLEQGAKVIEKIYHVGQIKHDLTPSF--VPSPSNVPVWII  94


>G5ECI9_CAEEL unnamed protein product
Length=2092

 Score = 26.9 bits (58),  Expect = 8.9, Method: Compositional matrix adjust.
 Identities = 22/74 (30%), Positives = 37/74 (50%), Gaps = 12/74 (16%)

Query  67    VRRAHLN------DMENIPLFFVVGFTYILTNPAPLIASYIFRI-YTVSRIIHTFVYAIY  119
             +R  H N      D E I L  +   T++   P+ + A  +F+I YTV+R+I T +Y  +
Sbjct  1501  LRCGHCNEAIEMFDEETISLCLIALETFLHREPS-MAAPILFKILYTVTRLIDTPMYPWH  1559

Query  120   ----VIPQPARGLA  129
                  +P  +R +A
Sbjct  1560  STEMFVPANSRSVA  1573



Lambda      K        H
   0.316    0.129    0.381 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4879639968


Query= XP_031327405.1 phospholipid-transporting ATPase ABCA1-like [Photinus
pyralis]

Length=1615
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q0E8Q7_DROME  unnamed protein product                                 443     1e-129
Q385F7_TRYB2  unnamed protein product                                 350     3e-98 
ABCA6_DICDI  unnamed protein product                                  339     1e-94 


>Q0E8Q7_DROME unnamed protein product
Length=1597

 Score = 443 bits (1139),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 391/1517 (26%), Positives = 689/1517 (45%), Gaps = 184/1517 (12%)

Query  172   YVNRGFLAFQMALESSYIEM--------VSNTSLPIAINVEEFPYPPHINDSELKNVIIY  223
             Y+  GFL+ Q  L+  Y++         V  +S+P   N+E      H         + Y
Sbjct  174   YIRSGFLSLQHILDKQYMKYQELGKDFEVVVSSMP---NMEVISMDSH--------RLTY  222

Query  224   FLPVITVLSFTLLCPMIISSVMEDKVTGMKELMRVMGLKSGMMWFTWFLDMF-CWNFISL  282
             F  + ++L   +L    +   +E+K  G+KE + ++   S +   T+FL  F C+  + +
Sbjct  223   FGTLCSILFNVVLLSSFVVPFVEEKQNGLKEFLNLVTPMSFLNGLTFFLIRFVCYTLLMI  282

Query  283   VVITAMLVYLKSDTRPPLLEHCSFSVLLTFFSLYSAALITFCFALSSFFNKPIHSITTAI  342
              V+    +Y         L    F+ +   F LY  + +++ + +S  F    HS+  A 
Sbjct  283   FVLVVAYLY-------KALGSICFAYVAVLFLLYILSTMSYAYLISICF----HSVFYAK  331

Query  343   LAWILTFVIPQRWIYSDPSFFQRIIMIFPNAGLLFGYKIISDY----ETRELGVQWVNIF  398
             +  +   +IP  + +          + F     L G  I   +    + RE G   V++F
Sbjct  332   IGGLAMLIIPYAFSFVRSWATSLAFVCFSTNTFLEGLDIFQTFSNKRKNREFGA--VDVF  389

Query  399   ESPSWQKNEFTMGSIFVCFIVQCLVYITITLYMSEIKPGIYGKAQVWYF---PLLWFRRK  455
                  + N  TM S++V  + Q  +Y  +  Y+  + PG  G  +  +F   P  + +R+
Sbjct  390   RV--IKSNSSTMFSVYVVLVFQSFLYAMLYNYLGCVFPGPGGLKRPMFFFLDPKTYMKRQ  447

Query  456   IEQNECGPKPNNFGPYIEEINLPVSVKVRNLCKHFGSEKA----VDNLSMDIYEQQITVL  511
               +    P+  +            ++ +  LCK F + K      DNL+M I  ++ITVL
Sbjct  448   RNEYTTTPRGTH------------AIIITELCKKFQTSKRDTLISDNLNMTINNKEITVL  495

Query  512   LGKNGAGKTTTLSMIAGILSLTSGTI---SIKDLCNTNNFVSICPQSNLQFHALTVLHHL  568
             LG NGAGKTT ++MI G++   SG I   S +D+ +  + +  CPQ ++    +T   HL
Sbjct  496   LGHNGAGKTTMMNMIMGLVPKDSGKIIVCSERDVASYRHLIGFCPQHSVFMSYMTCHQHL  555

Query  569   KFYGILKGLSADDAIEEAEHMIGVTNLSSKKNCLPSELSTGMQRRLSISVAVIGSNNVVI  628
             +F+  L+G    DA + A+  +    LS K+N     LS GM+RRLS+ +A+ G+  +VI
Sbjct  556   EFFAQLRGACRSDARDWADEKLKKLGLSDKRNEFGKNLSGGMKRRLSLGIAIAGNTKIVI  615

Query  629   LDEPTAGLDPECRRDIWNILIRLRGYRTIIVTTHSMEEAEVLGDRIAIMDRGVLKSYGTP  688
             LDEP++GLD   RR++W+IL+ LR  + ++VTTH MEEAEVLGD I I+  G L+S G+P
Sbjct  616   LDEPSSGLDINSRRELWDILLNLRKEKAVLVTTHYMEEAEVLGDTICILANGKLQSIGSP  675

Query  689   IFLRNKLGAGSHIAVKLKKSSDVERLVSAVKKNPNLNDKPKTVARDEITICVSSSTNNEI  748
             + L+ K G G  + +++   +  E  +  +  +     +   V    + IC+  +  N  
Sbjct  676   LELKRKSGIGYRLKLEINDFTSREVEIMEIIHHFVPTARVLNVVNPTVYICLPYAYKNCF  735

Query  749   RDAVKWFEDSQNFYNIENIGLTKMTMEEIFLKASTLGFNYQPRSSD----EKP--THFKK  802
                +   E       I  I +T  ++E++FL+ +  G   Q  + D    + P   H+K+
Sbjct  736   AQMLYRLETESKELGIHTISMTDTSLEDVFLRCA--GEQDQVDTPDGSRNDAPLLAHYKR  793

Query  803   MKEINTWRQFKILLLKWLKFTRKKLQFIQ-----IVIMILCMVICLCGS---ENSEDASE  854
             +++    R    L   W+    KK  FI       +IM+    +C+ G+    ++    E
Sbjct  794   LQDHPPHRG---LFQLWMAVFYKKWTFISNEWLYTLIMLCIPFVCVFGAILVMHAMSLVE  850

Query  855   SDKVVPLNLQTYSDSAVFIGRNQSGMFSKIAHYYEDSLNGSVVYSKTVQ-----NLSDEI  909
             +++ +PL L       +++  N +G  + +       +  + + +KT+      ++ +E 
Sbjct  851   NEEALPLKLSQMGSGVIYV-HNPTGHHAHLEQQLRQQIELNGITAKTMHLRGSNDVKNES  909

Query  910   IQQGINNIEFYKKRMVVAVSFDDFIGKHSATA-------FYSNKAVHGAPISLNLLTNAV  962
             +    +N+  + ++++  +   D  G    T+       FYS    H +   +NL+ +A+
Sbjct  910   LDLQRDNLADFLEQVIGII---DMYGGGRGTSDTPTIEIFYSGNRYHSSVELINLVDSAM  966

Query  963   LKSLKGPDYGIKVGNHPLTSPYQHRVQHLSMIQVLLIWYIFLPLGALLLVGISIFCPYSE  1022
             LK L  P+  I     P+    +  V  +S  + L  + + +P+G    +   I  P+ E
Sbjct  967   LK-LGRPESEIDTTYVPI----RRFVSDISPSR-LEYYAVIVPIGMFFFMFYFISLPFRE  1020

Query  1023  YASKIMHLQQMCGVSKWVYWLSCYVKDVVVY-FISIGIVIGITYALNSYLTMSSIFGDAE  1081
             YA+    LQ M   S++ YW + +  D+++  F+ + +     ++L S +  S ++  AE
Sbjct  1021  YANGFKQLQTM---SRFTYWFAHFTFDMLILIFVCVAL-----FSLQSLMMPSELYTTAE  1072

Query  1082  MGTLFVILAVFGVSAIPYSYLFIYRSSGFVGYGLFIITSLLISNTIVIGVFYMEFSEDED  1141
             +  + + +  +G S +P  Y     + G     +  I++ L+   IV  +  +  S +  
Sbjct  1073  LKVIVLSIFFYGCSYLPILY-----ALGNNFKSISTISTYLLLMLIVSAIAPLITSSNAA  1127

Query  1142  LKTIANGINYFFVLFPTFGLKYTMMKLIKQSVWNYNWRVRSPEHKQAICATNYNSCCYGD  1201
                +      F    P F L +         + N N+  R   H   I            
Sbjct  1128  AMKLHETKIAFLCFLPDFNLNHQF------RIINENFITR--RHPALI------------  1167

Query  1202  DSQGCIRYQSYLLGENAVATTLYEMLASSALYFSLLYLFHSNSFSKGYSKVK-------K  1254
               +G I   ++     AV   +         +  L    H   +   + + K        
Sbjct  1168  --KGLISQDTFFAYATAVGVMVMAFFTIVLEHKYLRRRIHDGIWEWAFQRKKYNSTGTLP  1225

Query  1255  ILKRNEKKDKAEESE---NQVFNP-SDGSLNADIKSKKIGSQVVLNDINFKIQPKQCVGL  1310
                 +E  D A E +   + + +P +D SL      K+ G ++ ++ ++F     +C GL
Sbjct  1226  STPISEIDDCAREEKRVTDLIKDPLNDHSLIVHNLRKRYGDKLAVDGVSFAAAQGECFGL  1285

Query  1311  LGVNGAGKSTTFRLLAGEDRLENGEIILHANKKRVSINENKLEYLQNIGYCPQFDELSEL  1370
             LGVNGAGK++TF+++A    L+ G I +    K   I E++L+Y +  GYCPQ+D L++ 
Sbjct  1286  LGVNGAGKTSTFQMIAANLPLDGGTIRI----KGADIREHELKYREYFGYCPQYDALNKF  1341

Query  1371  TSGRELLRLFAGLRGIE--------SVEEEVDKFLEIFDLTKYADRLCNTYSIGCKRKLF  1422
              +  + L   A LRG+         S +E V  +LE   LTKY       YS G KRKL 
Sbjct  1342  MTAEQCLYYMALLRGLSRRRTDGPASCKEHVKYWLEKMHLTKYQKVQVRHYSGGTKRKLL  1401

Query  1423  TALALIGMPPFILLDEPTAGVDLSSRRKLWDALILTKNSDSSIILSTHNMDECEILCENI  1482
              A+A+IG P  +LLDEPT GVD  SRR LW  +   +  D +++L++H+MDECE LC  +
Sbjct  1402  AAMAMIGAPALVLLDEPTTGVDPISRRFLWQCIKDFQGKDRTVVLTSHSMDECEELCNRL  1461

Query  1483  VTLKSGKIIFNGSISSLKSKYKDSCIIALKLAPMIKIVVVQSTKKKLQLCNNVEPNWMTD  1542
               +  GK     +I +LK           +L+         + K K++     E N ++ 
Sbjct  1462  AIMAHGKFKCLNNICALK-----------RLSGF-------TIKLKMKADTETEMN-VST  1502

Query  1543  LKDVIEKEFTDHELLDQHATLLKYRV--QRNGKTLSEIFRIVEKIRLD--NYFIEDFDIS  1598
             +   ++ EF   EL + HA  L Y V  Q +    S +F+I E+   D  +  + D+ ++
Sbjct  1503  ITGTLKSEFPGLELRESHAGTLTYFVSTQESVVLWSSVFKIAEEYLGDRLSALVADYSVN  1562

Query  1599  EVTLETLFLNINNENVS  1615
             E TLE +FL    E  S
Sbjct  1563  ECTLEDIFLKFEREAKS  1579


>Q385F7_TRYB2 unnamed protein product
Length=1738

 Score = 350 bits (899),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 366/1526 (24%), Positives = 666/1526 (44%), Gaps = 213/1526 (14%)

Query  169   SEMYVNRGFLAFQMALESSYIEMVSNTSLPIAINVEEFPYPP---HINDSELKNVIIYFL  225
             +EMY   G+L  Q  +   ++ + +     + +N+  +  P       ++ L       L
Sbjct  332   AEMYALSGYLTLQKEISEHHMGLFNPG---MGLNITPYMMPQGFVEFTETPLLQTARGIL  388

Query  226   PVITVLSFTLLCPMIISSVMEDKVTGMKELMRVMGLKSGMMWFTWFLDMFCWNFISLVVI  285
             PV+  L+F       +   + +K + ++E + +MG++  ++   WFL       I LVV 
Sbjct  389   PVLFGLAFLFTVTSRVHVNVMEKESKIRETILIMGMRKSVLNVVWFLKPL---LIDLVVC  445

Query  286   TAMLVYLKSDTRPPLLEHCSFSVLLTFFSLYSAALITFCFALSSFFNKP-IHSITTAILA  344
             + + V LK    P      S S+ +  F +++   I     +S FF+K  +  + + I+ 
Sbjct  446   SLITVLLKLTYMP---RSGSVSLFVVLF-VFALTTIPLSGVISCFFSKTRLALLVSPIIY  501

Query  345   WILTFVIPQRWIYSDPSFFQRIIMIFPNAGLLFGYKIISDYETRELGVQWVN----IFES  400
             +++T           P   +R     P  GLL    +IS   +    +  V+    +  S
Sbjct  502   FLMTL----------PYAVER-----PTNGLLC---MISALLSPTAFISIVHGALAMEVS  543

Query  401   PSWQKNEFTMGSIFVC-------FIVQCLVYITITLYMSEIKPGIYGKAQVWYF------  447
               +   +  +G   VC        +   ++Y  + LY+  +    +G  +   F      
Sbjct  544   GGFHLTQLRIGGDPVCAEMLLIMLVADLVLYTLLMLYLDTVLQNDWGTTKHPLFFITNPI  603

Query  448   -PLLWFRRKIEQNEC----GPKPNNFGPYIEEINLPVSVKVRNLCKHF--GSEK--AVDN  498
               L W RRK+  + C    G   N     I +     +V +  L K +  G +   AV+N
Sbjct  604   RALFWERRKVGTSACPFTDGRADNGVFEDIGDTKEEATVVMAGLRKEYQRGGDTFVAVNN  663

Query  499   LSMDIYEQQITVLLGKNGAGKTTTLSMIAGILSLTSGTISI------KDLCNTNNFVSIC  552
                 +   +I+VLLG NGAGK+T ++MI G++   +G   +      ++L      +  C
Sbjct  664   FCWSMGRGEISVLLGLNGAGKSTVINMITGMVKPDAGDCYVNGRSVRRELSAARQQMGFC  723

Query  553   PQSNLQFHALTVLHHLKFYGILKGLSADDAIEEAEHMIGVTNLSSKKNCLPSELSTGMQR  612
             PQ N+ +  LT   HL+F+G +KGL          H++  T LS K + L   LS G +R
Sbjct  724   PQHNILWPQLTCREHLEFFGKIKGLKGKALDLAVGHVLHETGLSEKSDDLAGHLSGGQKR  783

Query  613   RLSISVAVIGSNNVVILDEPTAGLDPECRRDIWNILIRLRGYRTIIVTTHSMEEAEVLGD  672
              LS+ +A +G + +V+LDEPTAG+D   RR  W +L R+  + TI++TTH M+EA++LG 
Sbjct  784   MLSVGIAFVGGSPLVLLDEPTAGMDASSRRHAWGLLQRMAAHHTILLTTHFMDEADILGH  843

Query  673   RIAIMDRGVLKSYGTPIFLRNKLGAGSHIAVKLKKSSDVERLVSAVKKNPNLNDKPKTVA  732
             RIAI++ G L+  G+ +FL++KLG G  + V ++   +   +  AVKK+           
Sbjct  844   RIAILNDGRLQCSGSSMFLKSKLGLGYSLTVVMRSKDNFCFVDDAVKKH--------VPG  895

Query  733   RDEITICVSSSTNNEIRDAVKWFE------DSQNFYNIENIGLTKMTMEEIFLKASTLGF  786
              + ++ C            V  F       +  +  N+ +  L   T+EE+FL+      
Sbjct  896   AELLSYCGCEVIYRLPLGGVAAFPSLIEKLEIASDVNLNSYSLAATTLEEVFLRVCG---  952

Query  787   NYQPRSSDEKPTHFKKM-----KEINTWRQFKILLLK--WLKFTRKKLQFIQIVIMI-LC  838
                 + S EKP     +     +      Q K ++LK  +     +++  +Q+V +  + 
Sbjct  953   --GQQCSAEKPRDCSSLWGRARRRAAGITQLKAIMLKRIFTALRDRRMHMLQVVCLTSVL  1010

Query  839   MVICLCGSENSEDASESDKVVPLNLQTYSDSAVFIGRNQSGMFSKIAHYYEDSLNGSVVY  898
             +   L GS  ++        +PL    Y D  V +     G+F   +    + ++ S + 
Sbjct  1011  LATVLIGSNPAQVGP-----LPLTFDLY-DEKVIVDSANCGLFWGKSPGVPN-VHISEIS  1063

Query  899   SKTVQNLSDEIIQQGINN------IEFYKKRMVVAVSFDDFIGKHSATAFYSNKAVHGAP  952
             +K  + LS   ++    +        F   RM+    ++  +        Y++ A+H   
Sbjct  1064  AKDTRELSIYGMKTWFAHEYPRYAAIFCGDRML----YNPKLRGMPVVMLYNSSALHQVA  1119

Query  953   ISLNLLTNAVLKSLKGPDYGIKVGNHPLTSPYQHRVQHLSMIQVLLIWYIFLPLGALLLV  1012
             I++++    VL+ + G    +      L    +    ++  +Q++LI       GA++++
Sbjct  1120  ITMSMFYQLVLQRVSGVQANVSWSVGVL----EDEATYVGALQLMLI-------GAIMMI  1168

Query  1013  GISIFC--PYS----EYASKIMHLQQMCGVSKWVYWLSCYVKDVVVYFISIGIVIGITYA  1066
              +++    P +    E     +H+Q++ G+   +YW S ++ D+ +YFIS+  ++ +   
Sbjct  1169  PLTLISSNPLAWVVKERECGSLHMQRIAGLRFPIYWASNFLFDITMYFISVSAIVSVLML  1228

Query  1067  LNSYLTMSSIFGDAEMGTLFVILAVFGVSAIPYSYL--FIYRS---SGFVGYGLFIITSL  1121
              +         G   +G     L ++G+++I ++YL  F++R    +  V  G   +   
Sbjct  1229  FDQ----EDYVGSETIGAFITALMLYGLTSIVFAYLLSFLFREHSKAQLVVMGFNFVVGF  1284

Query  1122  LISNTIVIGVFYMEFSEDEDLKTIANGINYFFVLFPTFGLKYTMMKLIKQSVWNYNWRVR  1181
             L  + IV+ V    FS  E  +  +  + + F L P+F +   ++ +   S + +   V 
Sbjct  1285  L--SVIVVYV----FSLLEITRETSESLRWPFRLIPSFCVGEAIINI---SHFRFGKAVG  1335

Query  1182  SPEHKQAICATNYNSCCYGDDSQGCIRYQSYLLGENAVATTLYEMLASSALYFSLL-YLF  1240
             +      +  T Y                             +  LA     FSLL +LF
Sbjct  1336  NATSAFDMDVTGYP----------------------------FIYLAVEFPIFSLLGFLF  1367

Query  1241  -HSNSFS----KGYSKVKKILKRNEKKDKAEESENQVFNPS-DG-----SLNADIKSKKI  1289
              H    +    + Y + K   + +      EE   +V  P  DG     +   ++  K  
Sbjct  1368  DHPRRRAWWNRRSYDRTKVFDEAHSGDSDVEEERCRVCLPMVDGPGYPPARVVNLSKKYP  1427

Query  1290  GSQVVLNDINFKIQPKQCVGLLGVNGAGKSTTFRLLAGEDRLENGEIILHANKKRVSINE  1349
               +  + D+ F +   +   LLG NGAGK+TT  +L  ++ +  G ++         I +
Sbjct  1428  NGKEAVRDLFFLVSSGEIFALLGTNGAGKTTTMSILC-QELMPTGGVVETCG---CDIVK  1483

Query  1350  NKLEYLQNIGYCPQFDELSELTSGRELLRLFAGLRGI--ESVEEEVDKFLEIFDLTKYAD  1407
                + L+ IGYCPQFD    L S  E +RL AGL G+  E VE  V   L + DLTKY  
Sbjct  1484  QGGKALRCIGYCPQFDTCISLLSVEEHIRLQAGLYGMVGEEVENVVTDLLYMCDLTKYRK  1543

Query  1408  RLCNTYSIGCKRKLFTALALIGMPPFILLDEPTAGVDLSSRRKLWDALILTKNSDSSIIL  1467
              L    S G +RKL  A+AL+G P  I LDEPTAG+D  +RRK+W ++I       +++L
Sbjct  1544  SLAGELSGGNRRKLSLAVALVGGPGVIFLDEPTAGMDPIARRKIW-SVIERAACQCAVVL  1602

Query  1468  STHNMDECEILCENIVTLKSGKIIFNGSISSLKSKYKDSCIIALKLAPMIKIVVVQSTKK  1527
             +TH+++E E L   +  +K G +   G  + LK KY                        
Sbjct  1603  TTHHLEEVEALAHRVAIMKDGTMRCVGRNAHLKDKY--------------------GAGY  1642

Query  1528  KLQLCNNVEPNWMTDLKDVIEKEFTDHELLDQHATLLKYRVQRNGKTLSEIFRIVEKIRL  1587
             ++ +C   E      +++ ++++F    L +     L Y + R+  +L++ FR +E  + 
Sbjct  1643  EMHIC-VAEGELPALVREFVDRQFAGATLRECKGRQLVYALPRS-TSLADAFRTLESSK-  1699

Query  1588  DNYFIEDFDISEVTLETLFLNINNEN  1613
             D   I D+ +S+ T+E +FL I  ++
Sbjct  1700  DLLGIVDYSVSQATIERVFLQITEQD  1725


>ABCA6_DICDI unnamed protein product
Length=1631

 Score = 339 bits (869),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 394/1562 (25%), Positives = 704/1562 (45%), Gaps = 215/1562 (14%)

Query  158   NSGESYVPDQG-SEMYVNRGFLAFQMALESSYIEMVSNTSLPIAINVEEFPYP-PHI---  212
             ++ E+   D G S +Y+N  F + Q+A++ +   +     L + +N+    YP P+    
Sbjct  170   DTSETGKVDGGDSSIYLNDNFASIQVAMDQA---IFGYFGLDMVLNISGRHYPDPYTELW  226

Query  213   ------NDSELKNV-IIYFLPVITVLSFTLLCPMIISSVMEDKVTGMKELMRVMGLKSGM  265
                    D+ +K+   ++    + + SF L+  ++I     +K T + E MR+M L S  
Sbjct  227   QEWITGRDAIIKSAGSVFITAALMMFSFRLVTDVVI-----EKETKIVEAMRMMSLNSLA  281

Query  266   MWFTWFLDMFCWNFISLVVITAMLVYLKSDTRPPLLEHCSFSVLLTFFSLYSAALITFCF  325
              + +W +     + I+ + +T ++V +   ++  L+   S+ +++  F LY   L+   F
Sbjct  282   YFSSWIIT----SLITSLPVTLLIVVIFKGSQ--LIYSTSWGIVIITFVLYLITLLLLSF  335

Query  326   ALSSFFNKPIHSITTAILAWILTFVIPQRWIYSDPSFF----QRIIMIFPNAGLLFGYKI  381
               S FFN   +S    +L++++   I    I+   + F    + ++ IF          I
Sbjct  336   IFSIFFN---NSKFCGLLSFVIVIAINICGIFVSKNEFSVSVKLLLSIFSPIAFSNSIYI  392

Query  382   ISDYE-TRELGVQWVNIFESPSWQKNEFTMGSIFVCFIVQCLVYITITLYMSEIKPGIYG  440
             +S  + T  L + W  I           T     +   +  ++YI +  Y  ++ PG YG
Sbjct  393   MSVKDLTMILNLNWDYIV----------TENQSILMLGIDIIIYIILIWYFEKVIPGEYG  442

Query  441   KAQVWYFPLL---WFRRKIEQNECGPKPNNFGPY-IEEINLPV----SVKVRNLCKHF--  490
               + +YF      WF +K    E     + F    +E I L V    ++ +RNL K F  
Sbjct  443   TKEKFYFLFTKNYWFGKKRSIGEIDDIESTFDSEDVETIPLKVLKNSTISIRNLRKEFET  502

Query  491   --GSEKAVDNLSMDIYEQQITVLLGKNGAGKTTTLSMIAGILSLTSGTISIK------DL  542
               G   AV++L +D++E QI  LLG NG GK+TT+ M+ G++S TSG+  I+       +
Sbjct  503   GDGLRVAVNDLYLDMFEDQIHALLGPNGCGKSTTIGMLTGLISPTSGSAFIRGYDITSQM  562

Query  543   CNTNNFVSICPQSNLQFHALTVLHHLKFYGILKGLSADDAIEEAEHMIGVTNLSSKKNCL  602
                  ++  C Q+++ +  LTVL HL  Y  LKG+   +   EAE M     L+ K N  
Sbjct  563   SKIRPYIGCCLQTDIIWSQLTVLEHLVIYASLKGVEGRNIQREAERMATEVGLAEKMNAP  622

Query  603   PSELSTGMQRRLSISVAVIGSNNVVILDEPTAGLDPECRRDIWNILIRLRGYRTIIVTTH  662
                LS G +R+L + +A IG + ++ LDE T+G+DP  RR +W+ L++ +  +TII+TTH
Sbjct  623   AGSLSGGQKRKLCLGIAFIGRSKIIFLDEVTSGMDPVSRRQVWDFLLKYKKGKTIILTTH  682

Query  663   SMEEAEVLGDRIAIMDRGVLKSYGTPIFLRNKLGAGSHIAV--KLKKSSDV--ERLVSAV  718
              +EEA+ LGDRIAI+ +G L+  GT +FL+N+ G G  +    KL+ +S+      VS  
Sbjct  683   YLEEADYLGDRIAIISQGKLRCDGTSLFLKNRFGQGYLLTCNKKLENASNGFNTNQVSEF  742

Query  719   KKNPNLNDKPKTVARDEITICVSSSTNNEIRDAVKWFEDSQNFYNIENIGLTKMTMEEIF  778
              KN        T +  E++  + + + +        F+ + + ++I+  G++  ++EE+F
Sbjct  743   IKNFIPGASILTDSGAELSYRLPTESLSNFPQFFTEFDLNLSKFSIQTYGISVTSLEEVF  802

Query  779   LK-----ASTLGFNYQPRSSDEKPTHFKKMK--------EINTWRQFKILLLKWLKFTRK  825
             +      +  L  N    +   K    + +K         IN  +QFK LL+K ++ ++K
Sbjct  803   ISLGQEDSKKLNNNANGNNEFNKQNEMESLKLAIATPSDGINQIQQFKGLLIKRIQQSKK  862

Query  826   KLQ--FIQIVIMILCMV--ICLCGSENSEDA----SESDKVVPLNLQTYSDSAVFIGRNQ  877
               +  F+ I++ +  ++  I L  S N +      + S + + ++L  Y+DS   I    
Sbjct  863   DARSFFLSIILPMALIIGSIILYKSMNDQKQVLFYNNSTQPLTMSLSIYTDSDNTINVPM  922

Query  878   SGMFSKIAHYYEDSLNGSVVYSK-----TVQNLSDEIIQQ---GINNIEFYKKRMVVAVS  929
               + +++   + +  N S  ++K        N +D +I      I  I F  +     +S
Sbjct  923   QLLNNELE--WSNLFNNSPYFNKFKYINESINFNDYLIDNYKLSIGAINFTNQ----PIS  976

Query  930   FDDFIGKHSAT----AFYSNKAVHGAPISLNLLTNAVLKSLKGPDYGIKVGNHPLTSPYQ  985
              DD     S      A+Y++  +H  PI +NL+ +A+L+  K     +       + P+ 
Sbjct  977   IDDNNNGQSTNCSYIAYYNSDYIHSFPIHVNLINDALLRKFKNISISVT------SMPFD  1030

Query  986   H-----RVQHLSMIQVLLIWYIFLPLGAL-LLVGISIFCPYSEYASKIMHLQQMCGVSKW  1039
             H      +    +    +I+++F+ +    L+ G        E  +++  L  + G  K 
Sbjct  1031  HILTAFEISSSDINASAIIYFVFILMAGFSLMAGSFAGSIAQERTNRVKRLLYVSGCKKH  1090

Query  1040  VYWLSCYVKDVVVYFI----SIGIVIGITYALNSYLTMSSIFGDAEMGTLFVILAVFGVS  1095
             +YWLS  V D    FI    S  I+ G+         +   F + + G+  + L +   +
Sbjct  1091  IYWLSNLVWDFFFAFIISILSCSILAGV---------IKGAFKE-QFGSFLLCLILLSCA  1140

Query  1096  AIPYSYLFIYRSSGFVGYGLFIITSLLISNTIVIGVFYME------FSEDEDLKTIANGI  1149
              IP  YL  Y+   + G  +  IT++L    +V  +  +        +++   + +A+ I
Sbjct  1141  IIPLGYLMSYKFQTY-GKAVGAITAILFVFGLVFTIASLNVRIQAVVNQNSTTQKVADII  1199

Query  1150  NYFF-VLFPTFGLKYTMMKLIKQSVWNYNWRVRSPEHKQAICATNYNSCCYGDDSQGCIR  1208
             +  F ++ P F L   +  L                           S   G    G  +
Sbjct  1200  DLIFSIISPIFALNRIVFIL---------------------------SGFPGSTRLGTFK  1232

Query  1209  YQSYLLGENAVATTLYEMLASSALYFSLLYLFHSNSFSKGYSKVKKIL-----KRNEKKD  1263
               +Y    + + T L  +   + L+   + L       KG+ K  K L      ++E  D
Sbjct  1233  VDNY-WSFDYLGTPLIVLAGHAVLWNVWILLLDYVPQIKGFFKNPKNLPAPSPPQDEDYD  1291

Query  1264  KAEESENQV-FNPSDGSLNAD------IKSKKIGSQVVLNDINFKIQPKQCVGLLGVNGA  1316
              ++E    +   PS+  +           S K  S+  + +    I   Q  GLLG+NG 
Sbjct  1292  VSQERRRLLNMRPSEEPIQFKNLHKLFPGSGKNPSKTAVYNSTLGIPRGQTFGLLGLNGG  1351

Query  1317  GKSTTFRLLAGEDRLENGEIILHANKKRVSINENKLEYLQNIGYCPQFDELSELTSGREL  1376
             GKSTT  +L+GE    +GEI ++       +  N+ + L NI    QFD L  L S RE 
Sbjct  1352  GKSTTLSMLSGEIVPSSGEISING----YDVITNREKALGNISMVFQFDALISLLSAREH  1407

Query  1377  LRLFAGLRGIE--SVEEEVDKFLEIFDLTKYADRLCNTYSIGCKRKLFTALALIGMPPFI  1434
             L LF+ ++GI+   +E  V+ F+++ DLT+ A+  C  YS G KRK+  ++A++G P   
Sbjct  1408  LWLFSRIKGIKESQIENCVEAFIKMVDLTRIANSGCGGYSGGNKRKVSLSMAMLGNPSVC  1467

Query  1435  LLDEPTAGVDLSSRRKLWDALILTKNSDSSIILSTHNMDECEILCENIVTLKSGKIIFNG  1494
              LDE + G D   RR+LWD +I     D SIIL++H+M E E LC  I  +K GK     
Sbjct  1468  FLDEISCGCDAVVRRQLWD-VISELGKDKSIILTSHSMSEVEALCSRITIMKEGKYTCLN  1526

Query  1495  SISSLKSKYKDSCIIALKLAPMIKIVVVQSTKKKLQLCNNVEPNWMTDLKDVIEKEFTDH  1554
             +I  +K+++     I +K         +Q+  + +  C                      
Sbjct  1527  TIQGVKNRFGAGYSIDVKFKKEYLETGIQTILQSIPNCT---------------------  1565

Query  1555  ELLDQHATLLKYRVQR---NGKTLSEIFRIVEKIRLDNYFIEDFDISEVTLETLFLNINN  1611
              +LDQH  +  + V     N   LS IF I+  + +    ++D+++ + +LE++FL +  
Sbjct  1566  -VLDQHDVMASFEVPNPPGNPIKLSNIFSILSNLPI----LDDYNVGQTSLESVFLKLTG  1620

Query  1612  EN  1613
              N
Sbjct  1621  AN  1622


 Score = 116 bits (290),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 155/628 (25%), Positives = 271/628 (43%), Gaps = 56/628 (9%)

Query  199   IAINVEEFPYPP-----HINDSELKNVIIYFLPVITVLSFTLLCPMIISSVMEDKVTGMK  253
             I+I+V   P+        I+ S++    I +   I +  F+L+      S+ +++   +K
Sbjct  1020  ISISVTSMPFDHILTAFEISSSDINASAIIYFVFILMAGFSLMAGSFAGSIAQERTNRVK  1079

Query  254   ELMRVMGLKSGMMWFTWFLDMFCWNFISLVVITAMLVYLKSDTRPPLLEHCSFSVLLTFF  313
              L+ V G K  + W    L    W+F    +I+ +   + +       +   F   L   
Sbjct  1080  RLLYVSGCKKHIYW----LSNLVWDFFFAFIISILSCSILAGVIKGAFKE-QFGSFLLCL  1134

Query  314   SLYSAALITFCFALSSFFN---KPIHSITTAILAWILTFVIPQ-----RWIYSDPSFFQR  365
              L S A+I   + +S  F    K + +IT  +  + L F I       + + +  S  Q+
Sbjct  1135  ILLSCAIIPLGYLMSYKFQTYGKAVGAITAILFVFGLVFTIASLNVRIQAVVNQNSTTQK  1194

Query  366   II----MIFPNAGLLFGYKIISDYETRELGVQWVNIFESPSWQKNEFTMGSIFVCFIVQC  421
             +     +IF     +F    I    +   G   +  F+  ++   ++ +G+  +      
Sbjct  1195  VADIIDLIFSIISPIFALNRIVFILSGFPGSTRLGTFKVDNYWSFDY-LGTPLIVLAGHA  1253

Query  422   L---VYITITLYMSEIKPGIYGKAQVWYFPLLWFRRKIEQNECGPKPNNFGPYIEEINLP  478
             +   V+I +  Y+ +IK G +   +    P        + ++   +  N  P  E I   
Sbjct  1254  VLWNVWILLLDYVPQIK-GFFKNPKNLPAPSPPQDEDYDVSQERRRLLNMRPSEEPI---  1309

Query  479   VSVKVRNLCKHF-GSEK-----AVDNLSMDIYEQQITVLLGKNGAGKTTTLSMIAGILSL  532
                + +NL K F GS K     AV N ++ I   Q   LLG NG GK+TTLSM++G +  
Sbjct  1310  ---QFKNLHKLFPGSGKNPSKTAVYNSTLGIPRGQTFGLLGLNGGGKSTTLSMLSGEIVP  1366

Query  533   TSGTISIKDLCNTNNF------VSICPQSNLQFHALTVLHHLKFYGILKGLSADDAIEEA  586
             +SG ISI       N       +S+  Q +     L+   HL  +  +KG+         
Sbjct  1367  SSGEISINGYDVITNREKALGNISMVFQFDALISLLSAREHLWLFSRIKGIKESQIENCV  1426

Query  587   EHMIGVTNLSSKKNCLPSELSTGMQRRLSISVAVIGSNNVVILDEPTAGLDPECRRDIWN  646
             E  I + +L+   N      S G +R++S+S+A++G+ +V  LDE + G D   RR +W+
Sbjct  1427  EAFIKMVDLTRIANSGCGGYSGGNKRKVSLSMAMLGNPSVCFLDEISCGCDAVVRRQLWD  1486

Query  647   ILIRLRGYRTIIVTTHSMEEAEVLGDRIAIMDRGVLKSYGTPIFLRNKLGAGSHIAVKLK  706
             ++  L   ++II+T+HSM E E L  RI IM  G      T   ++N+ GAG  I VK K
Sbjct  1487  VISELGKDKSIILTSHSMSEVEALCSRITIMKEGKYTCLNTIQGVKNRFGAGYSIDVKFK  1546

Query  707   KSSDVERLVSAVKKNPNLNDKPKTVARDEITICVSSSTNNEIRDAVKW---FEDSQNFYN  763
             K    E L + ++    L   P     D+  +  S    N   + +K    F    N   
Sbjct  1547  K----EYLETGIQT--ILQSIPNCTVLDQHDVMASFEVPNPPGNPIKLSNIFSILSNLPI  1600

Query  764   IENIGLTKMTMEEIFLKASTLGFNYQPR  791
             +++  + + ++E +FLK +  G N+  R
Sbjct  1601  LDDYNVGQTSLESVFLKLT--GANHDQR  1626



Lambda      K        H
   0.316    0.129    0.381 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4879639968


Query= XP_031327406.1 phospholipid-transporting ATPase ABCA1-like [Photinus
pyralis]

Length=1615
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q0E8Q7_DROME  unnamed protein product                                 443     1e-129
Q385F7_TRYB2  unnamed protein product                                 350     3e-98 
ABCA6_DICDI  unnamed protein product                                  339     1e-94 


>Q0E8Q7_DROME unnamed protein product
Length=1597

 Score = 443 bits (1139),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 391/1517 (26%), Positives = 689/1517 (45%), Gaps = 184/1517 (12%)

Query  172   YVNRGFLAFQMALESSYIEM--------VSNTSLPIAINVEEFPYPPHINDSELKNVIIY  223
             Y+  GFL+ Q  L+  Y++         V  +S+P   N+E      H         + Y
Sbjct  174   YIRSGFLSLQHILDKQYMKYQELGKDFEVVVSSMP---NMEVISMDSH--------RLTY  222

Query  224   FLPVITVLSFTLLCPMIISSVMEDKVTGMKELMRVMGLKSGMMWFTWFLDMF-CWNFISL  282
             F  + ++L   +L    +   +E+K  G+KE + ++   S +   T+FL  F C+  + +
Sbjct  223   FGTLCSILFNVVLLSSFVVPFVEEKQNGLKEFLNLVTPMSFLNGLTFFLIRFVCYTLLMI  282

Query  283   VVITAMLVYLKSDTRPPLLEHCSFSVLLTFFSLYSAALITFCFALSSFFNKPIHSITTAI  342
              V+    +Y         L    F+ +   F LY  + +++ + +S  F    HS+  A 
Sbjct  283   FVLVVAYLY-------KALGSICFAYVAVLFLLYILSTMSYAYLISICF----HSVFYAK  331

Query  343   LAWILTFVIPQRWIYSDPSFFQRIIMIFPNAGLLFGYKIISDY----ETRELGVQWVNIF  398
             +  +   +IP  + +          + F     L G  I   +    + RE G   V++F
Sbjct  332   IGGLAMLIIPYAFSFVRSWATSLAFVCFSTNTFLEGLDIFQTFSNKRKNREFGA--VDVF  389

Query  399   ESPSWQKNEFTMGSIFVCFIVQCLVYITITLYMSEIKPGIYGKAQVWYF---PLLWFRRK  455
                  + N  TM S++V  + Q  +Y  +  Y+  + PG  G  +  +F   P  + +R+
Sbjct  390   RV--IKSNSSTMFSVYVVLVFQSFLYAMLYNYLGCVFPGPGGLKRPMFFFLDPKTYMKRQ  447

Query  456   IEQNECGPKPNNFGPYIEEINLPVSVKVRNLCKHFGSEKA----VDNLSMDIYEQQITVL  511
               +    P+  +            ++ +  LCK F + K      DNL+M I  ++ITVL
Sbjct  448   RNEYTTTPRGTH------------AIIITELCKKFQTSKRDTLISDNLNMTINNKEITVL  495

Query  512   LGKNGAGKTTTLSMIAGILSLTSGTI---SIKDLCNTNNFVSICPQSNLQFHALTVLHHL  568
             LG NGAGKTT ++MI G++   SG I   S +D+ +  + +  CPQ ++    +T   HL
Sbjct  496   LGHNGAGKTTMMNMIMGLVPKDSGKIIVCSERDVASYRHLIGFCPQHSVFMSYMTCHQHL  555

Query  569   KFYGILKGLSADDAIEEAEHMIGVTNLSSKKNCLPSELSTGMQRRLSISVAVIGSNNVVI  628
             +F+  L+G    DA + A+  +    LS K+N     LS GM+RRLS+ +A+ G+  +VI
Sbjct  556   EFFAQLRGACRSDARDWADEKLKKLGLSDKRNEFGKNLSGGMKRRLSLGIAIAGNTKIVI  615

Query  629   LDEPTAGLDPECRRDIWNILIRLRGYRTIIVTTHSMEEAEVLGDRIAIMDRGVLKSYGTP  688
             LDEP++GLD   RR++W+IL+ LR  + ++VTTH MEEAEVLGD I I+  G L+S G+P
Sbjct  616   LDEPSSGLDINSRRELWDILLNLRKEKAVLVTTHYMEEAEVLGDTICILANGKLQSIGSP  675

Query  689   IFLRNKLGAGSHIAVKLKKSSDVERLVSAVKKNPNLNDKPKTVARDEITICVSSSTNNEI  748
             + L+ K G G  + +++   +  E  +  +  +     +   V    + IC+  +  N  
Sbjct  676   LELKRKSGIGYRLKLEINDFTSREVEIMEIIHHFVPTARVLNVVNPTVYICLPYAYKNCF  735

Query  749   RDAVKWFEDSQNFYNIENIGLTKMTMEEIFLKASTLGFNYQPRSSD----EKP--THFKK  802
                +   E       I  I +T  ++E++FL+ +  G   Q  + D    + P   H+K+
Sbjct  736   AQMLYRLETESKELGIHTISMTDTSLEDVFLRCA--GEQDQVDTPDGSRNDAPLLAHYKR  793

Query  803   MKEINTWRQFKILLLKWLKFTRKKLQFIQ-----IVIMILCMVICLCGS---ENSEDASE  854
             +++    R    L   W+    KK  FI       +IM+    +C+ G+    ++    E
Sbjct  794   LQDHPPHRG---LFQLWMAVFYKKWTFISNEWLYTLIMLCIPFVCVFGAILVMHAMSLVE  850

Query  855   SDKVVPLNLQTYSDSAVFIGRNQSGMFSKIAHYYEDSLNGSVVYSKTVQ-----NLSDEI  909
             +++ +PL L       +++  N +G  + +       +  + + +KT+      ++ +E 
Sbjct  851   NEEALPLKLSQMGSGVIYV-HNPTGHHAHLEQQLRQQIELNGITAKTMHLRGSNDVKNES  909

Query  910   IQQGINNIEFYKKRMVVAVSFDDFIGKHSATA-------FYSNKAVHGAPISLNLLTNAV  962
             +    +N+  + ++++  +   D  G    T+       FYS    H +   +NL+ +A+
Sbjct  910   LDLQRDNLADFLEQVIGII---DMYGGGRGTSDTPTIEIFYSGNRYHSSVELINLVDSAM  966

Query  963   LKSLKGPDYGIKVGNHPLTSPYQHRVQHLSMIQVLLIWYIFLPLGALLLVGISIFCPYSE  1022
             LK L  P+  I     P+    +  V  +S  + L  + + +P+G    +   I  P+ E
Sbjct  967   LK-LGRPESEIDTTYVPI----RRFVSDISPSR-LEYYAVIVPIGMFFFMFYFISLPFRE  1020

Query  1023  YASKIMHLQQMCGVSKWVYWLSCYVKDVVVY-FISIGIVIGITYALNSYLTMSSIFGDAE  1081
             YA+    LQ M   S++ YW + +  D+++  F+ + +     ++L S +  S ++  AE
Sbjct  1021  YANGFKQLQTM---SRFTYWFAHFTFDMLILIFVCVAL-----FSLQSLMMPSELYTTAE  1072

Query  1082  MGTLFVILAVFGVSAIPYSYLFIYRSSGFVGYGLFIITSLLISNTIVIGVFYMEFSEDED  1141
             +  + + +  +G S +P  Y     + G     +  I++ L+   IV  +  +  S +  
Sbjct  1073  LKVIVLSIFFYGCSYLPILY-----ALGNNFKSISTISTYLLLMLIVSAIAPLITSSNAA  1127

Query  1142  LKTIANGINYFFVLFPTFGLKYTMMKLIKQSVWNYNWRVRSPEHKQAICATNYNSCCYGD  1201
                +      F    P F L +         + N N+  R   H   I            
Sbjct  1128  AMKLHETKIAFLCFLPDFNLNHQF------RIINENFITR--RHPALI------------  1167

Query  1202  DSQGCIRYQSYLLGENAVATTLYEMLASSALYFSLLYLFHSNSFSKGYSKVK-------K  1254
               +G I   ++     AV   +         +  L    H   +   + + K        
Sbjct  1168  --KGLISQDTFFAYATAVGVMVMAFFTIVLEHKYLRRRIHDGIWEWAFQRKKYNSTGTLP  1225

Query  1255  ILKRNEKKDKAEESE---NQVFNP-SDGSLNADIKSKKIGSQVVLNDINFKIQPKQCVGL  1310
                 +E  D A E +   + + +P +D SL      K+ G ++ ++ ++F     +C GL
Sbjct  1226  STPISEIDDCAREEKRVTDLIKDPLNDHSLIVHNLRKRYGDKLAVDGVSFAAAQGECFGL  1285

Query  1311  LGVNGAGKSTTFRLLAGEDRLENGEIILHANKKRVSINENKLEYLQNIGYCPQFDELSEL  1370
             LGVNGAGK++TF+++A    L+ G I +    K   I E++L+Y +  GYCPQ+D L++ 
Sbjct  1286  LGVNGAGKTSTFQMIAANLPLDGGTIRI----KGADIREHELKYREYFGYCPQYDALNKF  1341

Query  1371  TSGRELLRLFAGLRGIE--------SVEEEVDKFLEIFDLTKYADRLCNTYSIGCKRKLF  1422
              +  + L   A LRG+         S +E V  +LE   LTKY       YS G KRKL 
Sbjct  1342  MTAEQCLYYMALLRGLSRRRTDGPASCKEHVKYWLEKMHLTKYQKVQVRHYSGGTKRKLL  1401

Query  1423  TALALIGMPPFILLDEPTAGVDLSSRRKLWDALILTKNSDSSIILSTHNMDECEILCENI  1482
              A+A+IG P  +LLDEPT GVD  SRR LW  +   +  D +++L++H+MDECE LC  +
Sbjct  1402  AAMAMIGAPALVLLDEPTTGVDPISRRFLWQCIKDFQGKDRTVVLTSHSMDECEELCNRL  1461

Query  1483  VTLKSGKIIFNGSISSLKSKYKDSCIIALKLAPMIKIVVVQSTKKKLQLCNNVEPNWMTD  1542
               +  GK     +I +LK           +L+         + K K++     E N ++ 
Sbjct  1462  AIMAHGKFKCLNNICALK-----------RLSGF-------TIKLKMKADTETEMN-VST  1502

Query  1543  LKDVIEKEFTDHELLDQHATLLKYRV--QRNGKTLSEIFRIVEKIRLD--NYFIEDFDIS  1598
             +   ++ EF   EL + HA  L Y V  Q +    S +F+I E+   D  +  + D+ ++
Sbjct  1503  ITGTLKSEFPGLELRESHAGTLTYFVSTQESVVLWSSVFKIAEEYLGDRLSALVADYSVN  1562

Query  1599  EVTLETLFLNINNENVS  1615
             E TLE +FL    E  S
Sbjct  1563  ECTLEDIFLKFEREAKS  1579


>Q385F7_TRYB2 unnamed protein product
Length=1738

 Score = 350 bits (899),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 366/1526 (24%), Positives = 666/1526 (44%), Gaps = 213/1526 (14%)

Query  169   SEMYVNRGFLAFQMALESSYIEMVSNTSLPIAINVEEFPYPP---HINDSELKNVIIYFL  225
             +EMY   G+L  Q  +   ++ + +     + +N+  +  P       ++ L       L
Sbjct  332   AEMYALSGYLTLQKEISEHHMGLFNPG---MGLNITPYMMPQGFVEFTETPLLQTARGIL  388

Query  226   PVITVLSFTLLCPMIISSVMEDKVTGMKELMRVMGLKSGMMWFTWFLDMFCWNFISLVVI  285
             PV+  L+F       +   + +K + ++E + +MG++  ++   WFL       I LVV 
Sbjct  389   PVLFGLAFLFTVTSRVHVNVMEKESKIRETILIMGMRKSVLNVVWFLKPL---LIDLVVC  445

Query  286   TAMLVYLKSDTRPPLLEHCSFSVLLTFFSLYSAALITFCFALSSFFNKP-IHSITTAILA  344
             + + V LK    P      S S+ +  F +++   I     +S FF+K  +  + + I+ 
Sbjct  446   SLITVLLKLTYMP---RSGSVSLFVVLF-VFALTTIPLSGVISCFFSKTRLALLVSPIIY  501

Query  345   WILTFVIPQRWIYSDPSFFQRIIMIFPNAGLLFGYKIISDYETRELGVQWVN----IFES  400
             +++T           P   +R     P  GLL    +IS   +    +  V+    +  S
Sbjct  502   FLMTL----------PYAVER-----PTNGLLC---MISALLSPTAFISIVHGALAMEVS  543

Query  401   PSWQKNEFTMGSIFVC-------FIVQCLVYITITLYMSEIKPGIYGKAQVWYF------  447
               +   +  +G   VC        +   ++Y  + LY+  +    +G  +   F      
Sbjct  544   GGFHLTQLRIGGDPVCAEMLLIMLVADLVLYTLLMLYLDTVLQNDWGTTKHPLFFITNPI  603

Query  448   -PLLWFRRKIEQNEC----GPKPNNFGPYIEEINLPVSVKVRNLCKHF--GSEK--AVDN  498
               L W RRK+  + C    G   N     I +     +V +  L K +  G +   AV+N
Sbjct  604   RALFWERRKVGTSACPFTDGRADNGVFEDIGDTKEEATVVMAGLRKEYQRGGDTFVAVNN  663

Query  499   LSMDIYEQQITVLLGKNGAGKTTTLSMIAGILSLTSGTISI------KDLCNTNNFVSIC  552
                 +   +I+VLLG NGAGK+T ++MI G++   +G   +      ++L      +  C
Sbjct  664   FCWSMGRGEISVLLGLNGAGKSTVINMITGMVKPDAGDCYVNGRSVRRELSAARQQMGFC  723

Query  553   PQSNLQFHALTVLHHLKFYGILKGLSADDAIEEAEHMIGVTNLSSKKNCLPSELSTGMQR  612
             PQ N+ +  LT   HL+F+G +KGL          H++  T LS K + L   LS G +R
Sbjct  724   PQHNILWPQLTCREHLEFFGKIKGLKGKALDLAVGHVLHETGLSEKSDDLAGHLSGGQKR  783

Query  613   RLSISVAVIGSNNVVILDEPTAGLDPECRRDIWNILIRLRGYRTIIVTTHSMEEAEVLGD  672
              LS+ +A +G + +V+LDEPTAG+D   RR  W +L R+  + TI++TTH M+EA++LG 
Sbjct  784   MLSVGIAFVGGSPLVLLDEPTAGMDASSRRHAWGLLQRMAAHHTILLTTHFMDEADILGH  843

Query  673   RIAIMDRGVLKSYGTPIFLRNKLGAGSHIAVKLKKSSDVERLVSAVKKNPNLNDKPKTVA  732
             RIAI++ G L+  G+ +FL++KLG G  + V ++   +   +  AVKK+           
Sbjct  844   RIAILNDGRLQCSGSSMFLKSKLGLGYSLTVVMRSKDNFCFVDDAVKKH--------VPG  895

Query  733   RDEITICVSSSTNNEIRDAVKWFE------DSQNFYNIENIGLTKMTMEEIFLKASTLGF  786
              + ++ C            V  F       +  +  N+ +  L   T+EE+FL+      
Sbjct  896   AELLSYCGCEVIYRLPLGGVAAFPSLIEKLEIASDVNLNSYSLAATTLEEVFLRVCG---  952

Query  787   NYQPRSSDEKPTHFKKM-----KEINTWRQFKILLLK--WLKFTRKKLQFIQIVIMI-LC  838
                 + S EKP     +     +      Q K ++LK  +     +++  +Q+V +  + 
Sbjct  953   --GQQCSAEKPRDCSSLWGRARRRAAGITQLKAIMLKRIFTALRDRRMHMLQVVCLTSVL  1010

Query  839   MVICLCGSENSEDASESDKVVPLNLQTYSDSAVFIGRNQSGMFSKIAHYYEDSLNGSVVY  898
             +   L GS  ++        +PL    Y D  V +     G+F   +    + ++ S + 
Sbjct  1011  LATVLIGSNPAQVGP-----LPLTFDLY-DEKVIVDSANCGLFWGKSPGVPN-VHISEIS  1063

Query  899   SKTVQNLSDEIIQQGINN------IEFYKKRMVVAVSFDDFIGKHSATAFYSNKAVHGAP  952
             +K  + LS   ++    +        F   RM+    ++  +        Y++ A+H   
Sbjct  1064  AKDTRELSIYGMKTWFAHEYPRYAAIFCGDRML----YNPKLRGMPVVMLYNSSALHQVA  1119

Query  953   ISLNLLTNAVLKSLKGPDYGIKVGNHPLTSPYQHRVQHLSMIQVLLIWYIFLPLGALLLV  1012
             I++++    VL+ + G    +      L    +    ++  +Q++LI       GA++++
Sbjct  1120  ITMSMFYQLVLQRVSGVQANVSWSVGVL----EDEATYVGALQLMLI-------GAIMMI  1168

Query  1013  GISIFC--PYS----EYASKIMHLQQMCGVSKWVYWLSCYVKDVVVYFISIGIVIGITYA  1066
              +++    P +    E     +H+Q++ G+   +YW S ++ D+ +YFIS+  ++ +   
Sbjct  1169  PLTLISSNPLAWVVKERECGSLHMQRIAGLRFPIYWASNFLFDITMYFISVSAIVSVLML  1228

Query  1067  LNSYLTMSSIFGDAEMGTLFVILAVFGVSAIPYSYL--FIYRS---SGFVGYGLFIITSL  1121
              +         G   +G     L ++G+++I ++YL  F++R    +  V  G   +   
Sbjct  1229  FDQ----EDYVGSETIGAFITALMLYGLTSIVFAYLLSFLFREHSKAQLVVMGFNFVVGF  1284

Query  1122  LISNTIVIGVFYMEFSEDEDLKTIANGINYFFVLFPTFGLKYTMMKLIKQSVWNYNWRVR  1181
             L  + IV+ V    FS  E  +  +  + + F L P+F +   ++ +   S + +   V 
Sbjct  1285  L--SVIVVYV----FSLLEITRETSESLRWPFRLIPSFCVGEAIINI---SHFRFGKAVG  1335

Query  1182  SPEHKQAICATNYNSCCYGDDSQGCIRYQSYLLGENAVATTLYEMLASSALYFSLL-YLF  1240
             +      +  T Y                             +  LA     FSLL +LF
Sbjct  1336  NATSAFDMDVTGYP----------------------------FIYLAVEFPIFSLLGFLF  1367

Query  1241  -HSNSFS----KGYSKVKKILKRNEKKDKAEESENQVFNPS-DG-----SLNADIKSKKI  1289
              H    +    + Y + K   + +      EE   +V  P  DG     +   ++  K  
Sbjct  1368  DHPRRRAWWNRRSYDRTKVFDEAHSGDSDVEEERCRVCLPMVDGPGYPPARVVNLSKKYP  1427

Query  1290  GSQVVLNDINFKIQPKQCVGLLGVNGAGKSTTFRLLAGEDRLENGEIILHANKKRVSINE  1349
               +  + D+ F +   +   LLG NGAGK+TT  +L  ++ +  G ++         I +
Sbjct  1428  NGKEAVRDLFFLVSSGEIFALLGTNGAGKTTTMSILC-QELMPTGGVVETCG---CDIVK  1483

Query  1350  NKLEYLQNIGYCPQFDELSELTSGRELLRLFAGLRGI--ESVEEEVDKFLEIFDLTKYAD  1407
                + L+ IGYCPQFD    L S  E +RL AGL G+  E VE  V   L + DLTKY  
Sbjct  1484  QGGKALRCIGYCPQFDTCISLLSVEEHIRLQAGLYGMVGEEVENVVTDLLYMCDLTKYRK  1543

Query  1408  RLCNTYSIGCKRKLFTALALIGMPPFILLDEPTAGVDLSSRRKLWDALILTKNSDSSIIL  1467
              L    S G +RKL  A+AL+G P  I LDEPTAG+D  +RRK+W ++I       +++L
Sbjct  1544  SLAGELSGGNRRKLSLAVALVGGPGVIFLDEPTAGMDPIARRKIW-SVIERAACQCAVVL  1602

Query  1468  STHNMDECEILCENIVTLKSGKIIFNGSISSLKSKYKDSCIIALKLAPMIKIVVVQSTKK  1527
             +TH+++E E L   +  +K G +   G  + LK KY                        
Sbjct  1603  TTHHLEEVEALAHRVAIMKDGTMRCVGRNAHLKDKY--------------------GAGY  1642

Query  1528  KLQLCNNVEPNWMTDLKDVIEKEFTDHELLDQHATLLKYRVQRNGKTLSEIFRIVEKIRL  1587
             ++ +C   E      +++ ++++F    L +     L Y + R+  +L++ FR +E  + 
Sbjct  1643  EMHIC-VAEGELPALVREFVDRQFAGATLRECKGRQLVYALPRS-TSLADAFRTLESSK-  1699

Query  1588  DNYFIEDFDISEVTLETLFLNINNEN  1613
             D   I D+ +S+ T+E +FL I  ++
Sbjct  1700  DLLGIVDYSVSQATIERVFLQITEQD  1725


>ABCA6_DICDI unnamed protein product
Length=1631

 Score = 339 bits (869),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 394/1562 (25%), Positives = 704/1562 (45%), Gaps = 215/1562 (14%)

Query  158   NSGESYVPDQG-SEMYVNRGFLAFQMALESSYIEMVSNTSLPIAINVEEFPYP-PHI---  212
             ++ E+   D G S +Y+N  F + Q+A++ +   +     L + +N+    YP P+    
Sbjct  170   DTSETGKVDGGDSSIYLNDNFASIQVAMDQA---IFGYFGLDMVLNISGRHYPDPYTELW  226

Query  213   ------NDSELKNV-IIYFLPVITVLSFTLLCPMIISSVMEDKVTGMKELMRVMGLKSGM  265
                    D+ +K+   ++    + + SF L+  ++I     +K T + E MR+M L S  
Sbjct  227   QEWITGRDAIIKSAGSVFITAALMMFSFRLVTDVVI-----EKETKIVEAMRMMSLNSLA  281

Query  266   MWFTWFLDMFCWNFISLVVITAMLVYLKSDTRPPLLEHCSFSVLLTFFSLYSAALITFCF  325
              + +W +     + I+ + +T ++V +   ++  L+   S+ +++  F LY   L+   F
Sbjct  282   YFSSWIIT----SLITSLPVTLLIVVIFKGSQ--LIYSTSWGIVIITFVLYLITLLLLSF  335

Query  326   ALSSFFNKPIHSITTAILAWILTFVIPQRWIYSDPSFF----QRIIMIFPNAGLLFGYKI  381
               S FFN   +S    +L++++   I    I+   + F    + ++ IF          I
Sbjct  336   IFSIFFN---NSKFCGLLSFVIVIAINICGIFVSKNEFSVSVKLLLSIFSPIAFSNSIYI  392

Query  382   ISDYE-TRELGVQWVNIFESPSWQKNEFTMGSIFVCFIVQCLVYITITLYMSEIKPGIYG  440
             +S  + T  L + W  I           T     +   +  ++YI +  Y  ++ PG YG
Sbjct  393   MSVKDLTMILNLNWDYIV----------TENQSILMLGIDIIIYIILIWYFEKVIPGEYG  442

Query  441   KAQVWYFPLL---WFRRKIEQNECGPKPNNFGPY-IEEINLPV----SVKVRNLCKHF--  490
               + +YF      WF +K    E     + F    +E I L V    ++ +RNL K F  
Sbjct  443   TKEKFYFLFTKNYWFGKKRSIGEIDDIESTFDSEDVETIPLKVLKNSTISIRNLRKEFET  502

Query  491   --GSEKAVDNLSMDIYEQQITVLLGKNGAGKTTTLSMIAGILSLTSGTISIK------DL  542
               G   AV++L +D++E QI  LLG NG GK+TT+ M+ G++S TSG+  I+       +
Sbjct  503   GDGLRVAVNDLYLDMFEDQIHALLGPNGCGKSTTIGMLTGLISPTSGSAFIRGYDITSQM  562

Query  543   CNTNNFVSICPQSNLQFHALTVLHHLKFYGILKGLSADDAIEEAEHMIGVTNLSSKKNCL  602
                  ++  C Q+++ +  LTVL HL  Y  LKG+   +   EAE M     L+ K N  
Sbjct  563   SKIRPYIGCCLQTDIIWSQLTVLEHLVIYASLKGVEGRNIQREAERMATEVGLAEKMNAP  622

Query  603   PSELSTGMQRRLSISVAVIGSNNVVILDEPTAGLDPECRRDIWNILIRLRGYRTIIVTTH  662
                LS G +R+L + +A IG + ++ LDE T+G+DP  RR +W+ L++ +  +TII+TTH
Sbjct  623   AGSLSGGQKRKLCLGIAFIGRSKIIFLDEVTSGMDPVSRRQVWDFLLKYKKGKTIILTTH  682

Query  663   SMEEAEVLGDRIAIMDRGVLKSYGTPIFLRNKLGAGSHIAV--KLKKSSDV--ERLVSAV  718
              +EEA+ LGDRIAI+ +G L+  GT +FL+N+ G G  +    KL+ +S+      VS  
Sbjct  683   YLEEADYLGDRIAIISQGKLRCDGTSLFLKNRFGQGYLLTCNKKLENASNGFNTNQVSEF  742

Query  719   KKNPNLNDKPKTVARDEITICVSSSTNNEIRDAVKWFEDSQNFYNIENIGLTKMTMEEIF  778
              KN        T +  E++  + + + +        F+ + + ++I+  G++  ++EE+F
Sbjct  743   IKNFIPGASILTDSGAELSYRLPTESLSNFPQFFTEFDLNLSKFSIQTYGISVTSLEEVF  802

Query  779   LK-----ASTLGFNYQPRSSDEKPTHFKKMK--------EINTWRQFKILLLKWLKFTRK  825
             +      +  L  N    +   K    + +K         IN  +QFK LL+K ++ ++K
Sbjct  803   ISLGQEDSKKLNNNANGNNEFNKQNEMESLKLAIATPSDGINQIQQFKGLLIKRIQQSKK  862

Query  826   KLQ--FIQIVIMILCMV--ICLCGSENSEDA----SESDKVVPLNLQTYSDSAVFIGRNQ  877
               +  F+ I++ +  ++  I L  S N +      + S + + ++L  Y+DS   I    
Sbjct  863   DARSFFLSIILPMALIIGSIILYKSMNDQKQVLFYNNSTQPLTMSLSIYTDSDNTINVPM  922

Query  878   SGMFSKIAHYYEDSLNGSVVYSK-----TVQNLSDEIIQQ---GINNIEFYKKRMVVAVS  929
               + +++   + +  N S  ++K        N +D +I      I  I F  +     +S
Sbjct  923   QLLNNELE--WSNLFNNSPYFNKFKYINESINFNDYLIDNYKLSIGAINFTNQ----PIS  976

Query  930   FDDFIGKHSAT----AFYSNKAVHGAPISLNLLTNAVLKSLKGPDYGIKVGNHPLTSPYQ  985
              DD     S      A+Y++  +H  PI +NL+ +A+L+  K     +       + P+ 
Sbjct  977   IDDNNNGQSTNCSYIAYYNSDYIHSFPIHVNLINDALLRKFKNISISVT------SMPFD  1030

Query  986   H-----RVQHLSMIQVLLIWYIFLPLGAL-LLVGISIFCPYSEYASKIMHLQQMCGVSKW  1039
             H      +    +    +I+++F+ +    L+ G        E  +++  L  + G  K 
Sbjct  1031  HILTAFEISSSDINASAIIYFVFILMAGFSLMAGSFAGSIAQERTNRVKRLLYVSGCKKH  1090

Query  1040  VYWLSCYVKDVVVYFI----SIGIVIGITYALNSYLTMSSIFGDAEMGTLFVILAVFGVS  1095
             +YWLS  V D    FI    S  I+ G+         +   F + + G+  + L +   +
Sbjct  1091  IYWLSNLVWDFFFAFIISILSCSILAGV---------IKGAFKE-QFGSFLLCLILLSCA  1140

Query  1096  AIPYSYLFIYRSSGFVGYGLFIITSLLISNTIVIGVFYME------FSEDEDLKTIANGI  1149
              IP  YL  Y+   + G  +  IT++L    +V  +  +        +++   + +A+ I
Sbjct  1141  IIPLGYLMSYKFQTY-GKAVGAITAILFVFGLVFTIASLNVRIQAVVNQNSTTQKVADII  1199

Query  1150  NYFF-VLFPTFGLKYTMMKLIKQSVWNYNWRVRSPEHKQAICATNYNSCCYGDDSQGCIR  1208
             +  F ++ P F L   +  L                           S   G    G  +
Sbjct  1200  DLIFSIISPIFALNRIVFIL---------------------------SGFPGSTRLGTFK  1232

Query  1209  YQSYLLGENAVATTLYEMLASSALYFSLLYLFHSNSFSKGYSKVKKIL-----KRNEKKD  1263
               +Y    + + T L  +   + L+   + L       KG+ K  K L      ++E  D
Sbjct  1233  VDNY-WSFDYLGTPLIVLAGHAVLWNVWILLLDYVPQIKGFFKNPKNLPAPSPPQDEDYD  1291

Query  1264  KAEESENQV-FNPSDGSLNAD------IKSKKIGSQVVLNDINFKIQPKQCVGLLGVNGA  1316
              ++E    +   PS+  +           S K  S+  + +    I   Q  GLLG+NG 
Sbjct  1292  VSQERRRLLNMRPSEEPIQFKNLHKLFPGSGKNPSKTAVYNSTLGIPRGQTFGLLGLNGG  1351

Query  1317  GKSTTFRLLAGEDRLENGEIILHANKKRVSINENKLEYLQNIGYCPQFDELSELTSGREL  1376
             GKSTT  +L+GE    +GEI ++       +  N+ + L NI    QFD L  L S RE 
Sbjct  1352  GKSTTLSMLSGEIVPSSGEISING----YDVITNREKALGNISMVFQFDALISLLSAREH  1407

Query  1377  LRLFAGLRGIE--SVEEEVDKFLEIFDLTKYADRLCNTYSIGCKRKLFTALALIGMPPFI  1434
             L LF+ ++GI+   +E  V+ F+++ DLT+ A+  C  YS G KRK+  ++A++G P   
Sbjct  1408  LWLFSRIKGIKESQIENCVEAFIKMVDLTRIANSGCGGYSGGNKRKVSLSMAMLGNPSVC  1467

Query  1435  LLDEPTAGVDLSSRRKLWDALILTKNSDSSIILSTHNMDECEILCENIVTLKSGKIIFNG  1494
              LDE + G D   RR+LWD +I     D SIIL++H+M E E LC  I  +K GK     
Sbjct  1468  FLDEISCGCDAVVRRQLWD-VISELGKDKSIILTSHSMSEVEALCSRITIMKEGKYTCLN  1526

Query  1495  SISSLKSKYKDSCIIALKLAPMIKIVVVQSTKKKLQLCNNVEPNWMTDLKDVIEKEFTDH  1554
             +I  +K+++     I +K         +Q+  + +  C                      
Sbjct  1527  TIQGVKNRFGAGYSIDVKFKKEYLETGIQTILQSIPNCT---------------------  1565

Query  1555  ELLDQHATLLKYRVQR---NGKTLSEIFRIVEKIRLDNYFIEDFDISEVTLETLFLNINN  1611
              +LDQH  +  + V     N   LS IF I+  + +    ++D+++ + +LE++FL +  
Sbjct  1566  -VLDQHDVMASFEVPNPPGNPIKLSNIFSILSNLPI----LDDYNVGQTSLESVFLKLTG  1620

Query  1612  EN  1613
              N
Sbjct  1621  AN  1622


 Score = 116 bits (290),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 155/628 (25%), Positives = 271/628 (43%), Gaps = 56/628 (9%)

Query  199   IAINVEEFPYPP-----HINDSELKNVIIYFLPVITVLSFTLLCPMIISSVMEDKVTGMK  253
             I+I+V   P+        I+ S++    I +   I +  F+L+      S+ +++   +K
Sbjct  1020  ISISVTSMPFDHILTAFEISSSDINASAIIYFVFILMAGFSLMAGSFAGSIAQERTNRVK  1079

Query  254   ELMRVMGLKSGMMWFTWFLDMFCWNFISLVVITAMLVYLKSDTRPPLLEHCSFSVLLTFF  313
              L+ V G K  + W    L    W+F    +I+ +   + +       +   F   L   
Sbjct  1080  RLLYVSGCKKHIYW----LSNLVWDFFFAFIISILSCSILAGVIKGAFKE-QFGSFLLCL  1134

Query  314   SLYSAALITFCFALSSFFN---KPIHSITTAILAWILTFVIPQ-----RWIYSDPSFFQR  365
              L S A+I   + +S  F    K + +IT  +  + L F I       + + +  S  Q+
Sbjct  1135  ILLSCAIIPLGYLMSYKFQTYGKAVGAITAILFVFGLVFTIASLNVRIQAVVNQNSTTQK  1194

Query  366   II----MIFPNAGLLFGYKIISDYETRELGVQWVNIFESPSWQKNEFTMGSIFVCFIVQC  421
             +     +IF     +F    I    +   G   +  F+  ++   ++ +G+  +      
Sbjct  1195  VADIIDLIFSIISPIFALNRIVFILSGFPGSTRLGTFKVDNYWSFDY-LGTPLIVLAGHA  1253

Query  422   L---VYITITLYMSEIKPGIYGKAQVWYFPLLWFRRKIEQNECGPKPNNFGPYIEEINLP  478
             +   V+I +  Y+ +IK G +   +    P        + ++   +  N  P  E I   
Sbjct  1254  VLWNVWILLLDYVPQIK-GFFKNPKNLPAPSPPQDEDYDVSQERRRLLNMRPSEEPI---  1309

Query  479   VSVKVRNLCKHF-GSEK-----AVDNLSMDIYEQQITVLLGKNGAGKTTTLSMIAGILSL  532
                + +NL K F GS K     AV N ++ I   Q   LLG NG GK+TTLSM++G +  
Sbjct  1310  ---QFKNLHKLFPGSGKNPSKTAVYNSTLGIPRGQTFGLLGLNGGGKSTTLSMLSGEIVP  1366

Query  533   TSGTISIKDLCNTNNF------VSICPQSNLQFHALTVLHHLKFYGILKGLSADDAIEEA  586
             +SG ISI       N       +S+  Q +     L+   HL  +  +KG+         
Sbjct  1367  SSGEISINGYDVITNREKALGNISMVFQFDALISLLSAREHLWLFSRIKGIKESQIENCV  1426

Query  587   EHMIGVTNLSSKKNCLPSELSTGMQRRLSISVAVIGSNNVVILDEPTAGLDPECRRDIWN  646
             E  I + +L+   N      S G +R++S+S+A++G+ +V  LDE + G D   RR +W+
Sbjct  1427  EAFIKMVDLTRIANSGCGGYSGGNKRKVSLSMAMLGNPSVCFLDEISCGCDAVVRRQLWD  1486

Query  647   ILIRLRGYRTIIVTTHSMEEAEVLGDRIAIMDRGVLKSYGTPIFLRNKLGAGSHIAVKLK  706
             ++  L   ++II+T+HSM E E L  RI IM  G      T   ++N+ GAG  I VK K
Sbjct  1487  VISELGKDKSIILTSHSMSEVEALCSRITIMKEGKYTCLNTIQGVKNRFGAGYSIDVKFK  1546

Query  707   KSSDVERLVSAVKKNPNLNDKPKTVARDEITICVSSSTNNEIRDAVKW---FEDSQNFYN  763
             K    E L + ++    L   P     D+  +  S    N   + +K    F    N   
Sbjct  1547  K----EYLETGIQT--ILQSIPNCTVLDQHDVMASFEVPNPPGNPIKLSNIFSILSNLPI  1600

Query  764   IENIGLTKMTMEEIFLKASTLGFNYQPR  791
             +++  + + ++E +FLK +  G N+  R
Sbjct  1601  LDDYNVGQTSLESVFLKLT--GANHDQR  1626



Lambda      K        H
   0.316    0.129    0.381 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4879639968


Query= XP_031327407.1 phospholipid-transporting ATPase ABCA1-like [Photinus
pyralis]

Length=1615
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q0E8Q7_DROME  unnamed protein product                                 443     1e-129
Q385F7_TRYB2  unnamed protein product                                 350     3e-98 
ABCA6_DICDI  unnamed protein product                                  339     1e-94 


>Q0E8Q7_DROME unnamed protein product
Length=1597

 Score = 443 bits (1139),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 391/1517 (26%), Positives = 689/1517 (45%), Gaps = 184/1517 (12%)

Query  172   YVNRGFLAFQMALESSYIEM--------VSNTSLPIAINVEEFPYPPHINDSELKNVIIY  223
             Y+  GFL+ Q  L+  Y++         V  +S+P   N+E      H         + Y
Sbjct  174   YIRSGFLSLQHILDKQYMKYQELGKDFEVVVSSMP---NMEVISMDSH--------RLTY  222

Query  224   FLPVITVLSFTLLCPMIISSVMEDKVTGMKELMRVMGLKSGMMWFTWFLDMF-CWNFISL  282
             F  + ++L   +L    +   +E+K  G+KE + ++   S +   T+FL  F C+  + +
Sbjct  223   FGTLCSILFNVVLLSSFVVPFVEEKQNGLKEFLNLVTPMSFLNGLTFFLIRFVCYTLLMI  282

Query  283   VVITAMLVYLKSDTRPPLLEHCSFSVLLTFFSLYSAALITFCFALSSFFNKPIHSITTAI  342
              V+    +Y         L    F+ +   F LY  + +++ + +S  F    HS+  A 
Sbjct  283   FVLVVAYLY-------KALGSICFAYVAVLFLLYILSTMSYAYLISICF----HSVFYAK  331

Query  343   LAWILTFVIPQRWIYSDPSFFQRIIMIFPNAGLLFGYKIISDY----ETRELGVQWVNIF  398
             +  +   +IP  + +          + F     L G  I   +    + RE G   V++F
Sbjct  332   IGGLAMLIIPYAFSFVRSWATSLAFVCFSTNTFLEGLDIFQTFSNKRKNREFGA--VDVF  389

Query  399   ESPSWQKNEFTMGSIFVCFIVQCLVYITITLYMSEIKPGIYGKAQVWYF---PLLWFRRK  455
                  + N  TM S++V  + Q  +Y  +  Y+  + PG  G  +  +F   P  + +R+
Sbjct  390   RV--IKSNSSTMFSVYVVLVFQSFLYAMLYNYLGCVFPGPGGLKRPMFFFLDPKTYMKRQ  447

Query  456   IEQNECGPKPNNFGPYIEEINLPVSVKVRNLCKHFGSEKA----VDNLSMDIYEQQITVL  511
               +    P+  +            ++ +  LCK F + K      DNL+M I  ++ITVL
Sbjct  448   RNEYTTTPRGTH------------AIIITELCKKFQTSKRDTLISDNLNMTINNKEITVL  495

Query  512   LGKNGAGKTTTLSMIAGILSLTSGTI---SIKDLCNTNNFVSICPQSNLQFHALTVLHHL  568
             LG NGAGKTT ++MI G++   SG I   S +D+ +  + +  CPQ ++    +T   HL
Sbjct  496   LGHNGAGKTTMMNMIMGLVPKDSGKIIVCSERDVASYRHLIGFCPQHSVFMSYMTCHQHL  555

Query  569   KFYGILKGLSADDAIEEAEHMIGVTNLSSKKNCLPSELSTGMQRRLSISVAVIGSNNVVI  628
             +F+  L+G    DA + A+  +    LS K+N     LS GM+RRLS+ +A+ G+  +VI
Sbjct  556   EFFAQLRGACRSDARDWADEKLKKLGLSDKRNEFGKNLSGGMKRRLSLGIAIAGNTKIVI  615

Query  629   LDEPTAGLDPECRRDIWNILIRLRGYRTIIVTTHSMEEAEVLGDRIAIMDRGVLKSYGTP  688
             LDEP++GLD   RR++W+IL+ LR  + ++VTTH MEEAEVLGD I I+  G L+S G+P
Sbjct  616   LDEPSSGLDINSRRELWDILLNLRKEKAVLVTTHYMEEAEVLGDTICILANGKLQSIGSP  675

Query  689   IFLRNKLGAGSHIAVKLKKSSDVERLVSAVKKNPNLNDKPKTVARDEITICVSSSTNNEI  748
             + L+ K G G  + +++   +  E  +  +  +     +   V    + IC+  +  N  
Sbjct  676   LELKRKSGIGYRLKLEINDFTSREVEIMEIIHHFVPTARVLNVVNPTVYICLPYAYKNCF  735

Query  749   RDAVKWFEDSQNFYNIENIGLTKMTMEEIFLKASTLGFNYQPRSSD----EKP--THFKK  802
                +   E       I  I +T  ++E++FL+ +  G   Q  + D    + P   H+K+
Sbjct  736   AQMLYRLETESKELGIHTISMTDTSLEDVFLRCA--GEQDQVDTPDGSRNDAPLLAHYKR  793

Query  803   MKEINTWRQFKILLLKWLKFTRKKLQFIQ-----IVIMILCMVICLCGS---ENSEDASE  854
             +++    R    L   W+    KK  FI       +IM+    +C+ G+    ++    E
Sbjct  794   LQDHPPHRG---LFQLWMAVFYKKWTFISNEWLYTLIMLCIPFVCVFGAILVMHAMSLVE  850

Query  855   SDKVVPLNLQTYSDSAVFIGRNQSGMFSKIAHYYEDSLNGSVVYSKTVQ-----NLSDEI  909
             +++ +PL L       +++  N +G  + +       +  + + +KT+      ++ +E 
Sbjct  851   NEEALPLKLSQMGSGVIYV-HNPTGHHAHLEQQLRQQIELNGITAKTMHLRGSNDVKNES  909

Query  910   IQQGINNIEFYKKRMVVAVSFDDFIGKHSATA-------FYSNKAVHGAPISLNLLTNAV  962
             +    +N+  + ++++  +   D  G    T+       FYS    H +   +NL+ +A+
Sbjct  910   LDLQRDNLADFLEQVIGII---DMYGGGRGTSDTPTIEIFYSGNRYHSSVELINLVDSAM  966

Query  963   LKSLKGPDYGIKVGNHPLTSPYQHRVQHLSMIQVLLIWYIFLPLGALLLVGISIFCPYSE  1022
             LK L  P+  I     P+    +  V  +S  + L  + + +P+G    +   I  P+ E
Sbjct  967   LK-LGRPESEIDTTYVPI----RRFVSDISPSR-LEYYAVIVPIGMFFFMFYFISLPFRE  1020

Query  1023  YASKIMHLQQMCGVSKWVYWLSCYVKDVVVY-FISIGIVIGITYALNSYLTMSSIFGDAE  1081
             YA+    LQ M   S++ YW + +  D+++  F+ + +     ++L S +  S ++  AE
Sbjct  1021  YANGFKQLQTM---SRFTYWFAHFTFDMLILIFVCVAL-----FSLQSLMMPSELYTTAE  1072

Query  1082  MGTLFVILAVFGVSAIPYSYLFIYRSSGFVGYGLFIITSLLISNTIVIGVFYMEFSEDED  1141
             +  + + +  +G S +P  Y     + G     +  I++ L+   IV  +  +  S +  
Sbjct  1073  LKVIVLSIFFYGCSYLPILY-----ALGNNFKSISTISTYLLLMLIVSAIAPLITSSNAA  1127

Query  1142  LKTIANGINYFFVLFPTFGLKYTMMKLIKQSVWNYNWRVRSPEHKQAICATNYNSCCYGD  1201
                +      F    P F L +         + N N+  R   H   I            
Sbjct  1128  AMKLHETKIAFLCFLPDFNLNHQF------RIINENFITR--RHPALI------------  1167

Query  1202  DSQGCIRYQSYLLGENAVATTLYEMLASSALYFSLLYLFHSNSFSKGYSKVK-------K  1254
               +G I   ++     AV   +         +  L    H   +   + + K        
Sbjct  1168  --KGLISQDTFFAYATAVGVMVMAFFTIVLEHKYLRRRIHDGIWEWAFQRKKYNSTGTLP  1225

Query  1255  ILKRNEKKDKAEESE---NQVFNP-SDGSLNADIKSKKIGSQVVLNDINFKIQPKQCVGL  1310
                 +E  D A E +   + + +P +D SL      K+ G ++ ++ ++F     +C GL
Sbjct  1226  STPISEIDDCAREEKRVTDLIKDPLNDHSLIVHNLRKRYGDKLAVDGVSFAAAQGECFGL  1285

Query  1311  LGVNGAGKSTTFRLLAGEDRLENGEIILHANKKRVSINENKLEYLQNIGYCPQFDELSEL  1370
             LGVNGAGK++TF+++A    L+ G I +    K   I E++L+Y +  GYCPQ+D L++ 
Sbjct  1286  LGVNGAGKTSTFQMIAANLPLDGGTIRI----KGADIREHELKYREYFGYCPQYDALNKF  1341

Query  1371  TSGRELLRLFAGLRGIE--------SVEEEVDKFLEIFDLTKYADRLCNTYSIGCKRKLF  1422
              +  + L   A LRG+         S +E V  +LE   LTKY       YS G KRKL 
Sbjct  1342  MTAEQCLYYMALLRGLSRRRTDGPASCKEHVKYWLEKMHLTKYQKVQVRHYSGGTKRKLL  1401

Query  1423  TALALIGMPPFILLDEPTAGVDLSSRRKLWDALILTKNSDSSIILSTHNMDECEILCENI  1482
              A+A+IG P  +LLDEPT GVD  SRR LW  +   +  D +++L++H+MDECE LC  +
Sbjct  1402  AAMAMIGAPALVLLDEPTTGVDPISRRFLWQCIKDFQGKDRTVVLTSHSMDECEELCNRL  1461

Query  1483  VTLKSGKIIFNGSISSLKSKYKDSCIIALKLAPMIKIVVVQSTKKKLQLCNNVEPNWMTD  1542
               +  GK     +I +LK           +L+         + K K++     E N ++ 
Sbjct  1462  AIMAHGKFKCLNNICALK-----------RLSGF-------TIKLKMKADTETEMN-VST  1502

Query  1543  LKDVIEKEFTDHELLDQHATLLKYRV--QRNGKTLSEIFRIVEKIRLD--NYFIEDFDIS  1598
             +   ++ EF   EL + HA  L Y V  Q +    S +F+I E+   D  +  + D+ ++
Sbjct  1503  ITGTLKSEFPGLELRESHAGTLTYFVSTQESVVLWSSVFKIAEEYLGDRLSALVADYSVN  1562

Query  1599  EVTLETLFLNINNENVS  1615
             E TLE +FL    E  S
Sbjct  1563  ECTLEDIFLKFEREAKS  1579


>Q385F7_TRYB2 unnamed protein product
Length=1738

 Score = 350 bits (899),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 366/1526 (24%), Positives = 666/1526 (44%), Gaps = 213/1526 (14%)

Query  169   SEMYVNRGFLAFQMALESSYIEMVSNTSLPIAINVEEFPYPP---HINDSELKNVIIYFL  225
             +EMY   G+L  Q  +   ++ + +     + +N+  +  P       ++ L       L
Sbjct  332   AEMYALSGYLTLQKEISEHHMGLFNPG---MGLNITPYMMPQGFVEFTETPLLQTARGIL  388

Query  226   PVITVLSFTLLCPMIISSVMEDKVTGMKELMRVMGLKSGMMWFTWFLDMFCWNFISLVVI  285
             PV+  L+F       +   + +K + ++E + +MG++  ++   WFL       I LVV 
Sbjct  389   PVLFGLAFLFTVTSRVHVNVMEKESKIRETILIMGMRKSVLNVVWFLKPL---LIDLVVC  445

Query  286   TAMLVYLKSDTRPPLLEHCSFSVLLTFFSLYSAALITFCFALSSFFNKP-IHSITTAILA  344
             + + V LK    P      S S+ +  F +++   I     +S FF+K  +  + + I+ 
Sbjct  446   SLITVLLKLTYMP---RSGSVSLFVVLF-VFALTTIPLSGVISCFFSKTRLALLVSPIIY  501

Query  345   WILTFVIPQRWIYSDPSFFQRIIMIFPNAGLLFGYKIISDYETRELGVQWVN----IFES  400
             +++T           P   +R     P  GLL    +IS   +    +  V+    +  S
Sbjct  502   FLMTL----------PYAVER-----PTNGLLC---MISALLSPTAFISIVHGALAMEVS  543

Query  401   PSWQKNEFTMGSIFVC-------FIVQCLVYITITLYMSEIKPGIYGKAQVWYF------  447
               +   +  +G   VC        +   ++Y  + LY+  +    +G  +   F      
Sbjct  544   GGFHLTQLRIGGDPVCAEMLLIMLVADLVLYTLLMLYLDTVLQNDWGTTKHPLFFITNPI  603

Query  448   -PLLWFRRKIEQNEC----GPKPNNFGPYIEEINLPVSVKVRNLCKHF--GSEK--AVDN  498
               L W RRK+  + C    G   N     I +     +V +  L K +  G +   AV+N
Sbjct  604   RALFWERRKVGTSACPFTDGRADNGVFEDIGDTKEEATVVMAGLRKEYQRGGDTFVAVNN  663

Query  499   LSMDIYEQQITVLLGKNGAGKTTTLSMIAGILSLTSGTISI------KDLCNTNNFVSIC  552
                 +   +I+VLLG NGAGK+T ++MI G++   +G   +      ++L      +  C
Sbjct  664   FCWSMGRGEISVLLGLNGAGKSTVINMITGMVKPDAGDCYVNGRSVRRELSAARQQMGFC  723

Query  553   PQSNLQFHALTVLHHLKFYGILKGLSADDAIEEAEHMIGVTNLSSKKNCLPSELSTGMQR  612
             PQ N+ +  LT   HL+F+G +KGL          H++  T LS K + L   LS G +R
Sbjct  724   PQHNILWPQLTCREHLEFFGKIKGLKGKALDLAVGHVLHETGLSEKSDDLAGHLSGGQKR  783

Query  613   RLSISVAVIGSNNVVILDEPTAGLDPECRRDIWNILIRLRGYRTIIVTTHSMEEAEVLGD  672
              LS+ +A +G + +V+LDEPTAG+D   RR  W +L R+  + TI++TTH M+EA++LG 
Sbjct  784   MLSVGIAFVGGSPLVLLDEPTAGMDASSRRHAWGLLQRMAAHHTILLTTHFMDEADILGH  843

Query  673   RIAIMDRGVLKSYGTPIFLRNKLGAGSHIAVKLKKSSDVERLVSAVKKNPNLNDKPKTVA  732
             RIAI++ G L+  G+ +FL++KLG G  + V ++   +   +  AVKK+           
Sbjct  844   RIAILNDGRLQCSGSSMFLKSKLGLGYSLTVVMRSKDNFCFVDDAVKKH--------VPG  895

Query  733   RDEITICVSSSTNNEIRDAVKWFE------DSQNFYNIENIGLTKMTMEEIFLKASTLGF  786
              + ++ C            V  F       +  +  N+ +  L   T+EE+FL+      
Sbjct  896   AELLSYCGCEVIYRLPLGGVAAFPSLIEKLEIASDVNLNSYSLAATTLEEVFLRVCG---  952

Query  787   NYQPRSSDEKPTHFKKM-----KEINTWRQFKILLLK--WLKFTRKKLQFIQIVIMI-LC  838
                 + S EKP     +     +      Q K ++LK  +     +++  +Q+V +  + 
Sbjct  953   --GQQCSAEKPRDCSSLWGRARRRAAGITQLKAIMLKRIFTALRDRRMHMLQVVCLTSVL  1010

Query  839   MVICLCGSENSEDASESDKVVPLNLQTYSDSAVFIGRNQSGMFSKIAHYYEDSLNGSVVY  898
             +   L GS  ++        +PL    Y D  V +     G+F   +    + ++ S + 
Sbjct  1011  LATVLIGSNPAQVGP-----LPLTFDLY-DEKVIVDSANCGLFWGKSPGVPN-VHISEIS  1063

Query  899   SKTVQNLSDEIIQQGINN------IEFYKKRMVVAVSFDDFIGKHSATAFYSNKAVHGAP  952
             +K  + LS   ++    +        F   RM+    ++  +        Y++ A+H   
Sbjct  1064  AKDTRELSIYGMKTWFAHEYPRYAAIFCGDRML----YNPKLRGMPVVMLYNSSALHQVA  1119

Query  953   ISLNLLTNAVLKSLKGPDYGIKVGNHPLTSPYQHRVQHLSMIQVLLIWYIFLPLGALLLV  1012
             I++++    VL+ + G    +      L    +    ++  +Q++LI       GA++++
Sbjct  1120  ITMSMFYQLVLQRVSGVQANVSWSVGVL----EDEATYVGALQLMLI-------GAIMMI  1168

Query  1013  GISIFC--PYS----EYASKIMHLQQMCGVSKWVYWLSCYVKDVVVYFISIGIVIGITYA  1066
              +++    P +    E     +H+Q++ G+   +YW S ++ D+ +YFIS+  ++ +   
Sbjct  1169  PLTLISSNPLAWVVKERECGSLHMQRIAGLRFPIYWASNFLFDITMYFISVSAIVSVLML  1228

Query  1067  LNSYLTMSSIFGDAEMGTLFVILAVFGVSAIPYSYL--FIYRS---SGFVGYGLFIITSL  1121
              +         G   +G     L ++G+++I ++YL  F++R    +  V  G   +   
Sbjct  1229  FDQ----EDYVGSETIGAFITALMLYGLTSIVFAYLLSFLFREHSKAQLVVMGFNFVVGF  1284

Query  1122  LISNTIVIGVFYMEFSEDEDLKTIANGINYFFVLFPTFGLKYTMMKLIKQSVWNYNWRVR  1181
             L  + IV+ V    FS  E  +  +  + + F L P+F +   ++ +   S + +   V 
Sbjct  1285  L--SVIVVYV----FSLLEITRETSESLRWPFRLIPSFCVGEAIINI---SHFRFGKAVG  1335

Query  1182  SPEHKQAICATNYNSCCYGDDSQGCIRYQSYLLGENAVATTLYEMLASSALYFSLL-YLF  1240
             +      +  T Y                             +  LA     FSLL +LF
Sbjct  1336  NATSAFDMDVTGYP----------------------------FIYLAVEFPIFSLLGFLF  1367

Query  1241  -HSNSFS----KGYSKVKKILKRNEKKDKAEESENQVFNPS-DG-----SLNADIKSKKI  1289
              H    +    + Y + K   + +      EE   +V  P  DG     +   ++  K  
Sbjct  1368  DHPRRRAWWNRRSYDRTKVFDEAHSGDSDVEEERCRVCLPMVDGPGYPPARVVNLSKKYP  1427

Query  1290  GSQVVLNDINFKIQPKQCVGLLGVNGAGKSTTFRLLAGEDRLENGEIILHANKKRVSINE  1349
               +  + D+ F +   +   LLG NGAGK+TT  +L  ++ +  G ++         I +
Sbjct  1428  NGKEAVRDLFFLVSSGEIFALLGTNGAGKTTTMSILC-QELMPTGGVVETCG---CDIVK  1483

Query  1350  NKLEYLQNIGYCPQFDELSELTSGRELLRLFAGLRGI--ESVEEEVDKFLEIFDLTKYAD  1407
                + L+ IGYCPQFD    L S  E +RL AGL G+  E VE  V   L + DLTKY  
Sbjct  1484  QGGKALRCIGYCPQFDTCISLLSVEEHIRLQAGLYGMVGEEVENVVTDLLYMCDLTKYRK  1543

Query  1408  RLCNTYSIGCKRKLFTALALIGMPPFILLDEPTAGVDLSSRRKLWDALILTKNSDSSIIL  1467
              L    S G +RKL  A+AL+G P  I LDEPTAG+D  +RRK+W ++I       +++L
Sbjct  1544  SLAGELSGGNRRKLSLAVALVGGPGVIFLDEPTAGMDPIARRKIW-SVIERAACQCAVVL  1602

Query  1468  STHNMDECEILCENIVTLKSGKIIFNGSISSLKSKYKDSCIIALKLAPMIKIVVVQSTKK  1527
             +TH+++E E L   +  +K G +   G  + LK KY                        
Sbjct  1603  TTHHLEEVEALAHRVAIMKDGTMRCVGRNAHLKDKY--------------------GAGY  1642

Query  1528  KLQLCNNVEPNWMTDLKDVIEKEFTDHELLDQHATLLKYRVQRNGKTLSEIFRIVEKIRL  1587
             ++ +C   E      +++ ++++F    L +     L Y + R+  +L++ FR +E  + 
Sbjct  1643  EMHIC-VAEGELPALVREFVDRQFAGATLRECKGRQLVYALPRS-TSLADAFRTLESSK-  1699

Query  1588  DNYFIEDFDISEVTLETLFLNINNEN  1613
             D   I D+ +S+ T+E +FL I  ++
Sbjct  1700  DLLGIVDYSVSQATIERVFLQITEQD  1725


>ABCA6_DICDI unnamed protein product
Length=1631

 Score = 339 bits (869),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 394/1562 (25%), Positives = 704/1562 (45%), Gaps = 215/1562 (14%)

Query  158   NSGESYVPDQG-SEMYVNRGFLAFQMALESSYIEMVSNTSLPIAINVEEFPYP-PHI---  212
             ++ E+   D G S +Y+N  F + Q+A++ +   +     L + +N+    YP P+    
Sbjct  170   DTSETGKVDGGDSSIYLNDNFASIQVAMDQA---IFGYFGLDMVLNISGRHYPDPYTELW  226

Query  213   ------NDSELKNV-IIYFLPVITVLSFTLLCPMIISSVMEDKVTGMKELMRVMGLKSGM  265
                    D+ +K+   ++    + + SF L+  ++I     +K T + E MR+M L S  
Sbjct  227   QEWITGRDAIIKSAGSVFITAALMMFSFRLVTDVVI-----EKETKIVEAMRMMSLNSLA  281

Query  266   MWFTWFLDMFCWNFISLVVITAMLVYLKSDTRPPLLEHCSFSVLLTFFSLYSAALITFCF  325
              + +W +     + I+ + +T ++V +   ++  L+   S+ +++  F LY   L+   F
Sbjct  282   YFSSWIIT----SLITSLPVTLLIVVIFKGSQ--LIYSTSWGIVIITFVLYLITLLLLSF  335

Query  326   ALSSFFNKPIHSITTAILAWILTFVIPQRWIYSDPSFF----QRIIMIFPNAGLLFGYKI  381
               S FFN   +S    +L++++   I    I+   + F    + ++ IF          I
Sbjct  336   IFSIFFN---NSKFCGLLSFVIVIAINICGIFVSKNEFSVSVKLLLSIFSPIAFSNSIYI  392

Query  382   ISDYE-TRELGVQWVNIFESPSWQKNEFTMGSIFVCFIVQCLVYITITLYMSEIKPGIYG  440
             +S  + T  L + W  I           T     +   +  ++YI +  Y  ++ PG YG
Sbjct  393   MSVKDLTMILNLNWDYIV----------TENQSILMLGIDIIIYIILIWYFEKVIPGEYG  442

Query  441   KAQVWYFPLL---WFRRKIEQNECGPKPNNFGPY-IEEINLPV----SVKVRNLCKHF--  490
               + +YF      WF +K    E     + F    +E I L V    ++ +RNL K F  
Sbjct  443   TKEKFYFLFTKNYWFGKKRSIGEIDDIESTFDSEDVETIPLKVLKNSTISIRNLRKEFET  502

Query  491   --GSEKAVDNLSMDIYEQQITVLLGKNGAGKTTTLSMIAGILSLTSGTISIK------DL  542
               G   AV++L +D++E QI  LLG NG GK+TT+ M+ G++S TSG+  I+       +
Sbjct  503   GDGLRVAVNDLYLDMFEDQIHALLGPNGCGKSTTIGMLTGLISPTSGSAFIRGYDITSQM  562

Query  543   CNTNNFVSICPQSNLQFHALTVLHHLKFYGILKGLSADDAIEEAEHMIGVTNLSSKKNCL  602
                  ++  C Q+++ +  LTVL HL  Y  LKG+   +   EAE M     L+ K N  
Sbjct  563   SKIRPYIGCCLQTDIIWSQLTVLEHLVIYASLKGVEGRNIQREAERMATEVGLAEKMNAP  622

Query  603   PSELSTGMQRRLSISVAVIGSNNVVILDEPTAGLDPECRRDIWNILIRLRGYRTIIVTTH  662
                LS G +R+L + +A IG + ++ LDE T+G+DP  RR +W+ L++ +  +TII+TTH
Sbjct  623   AGSLSGGQKRKLCLGIAFIGRSKIIFLDEVTSGMDPVSRRQVWDFLLKYKKGKTIILTTH  682

Query  663   SMEEAEVLGDRIAIMDRGVLKSYGTPIFLRNKLGAGSHIAV--KLKKSSDV--ERLVSAV  718
              +EEA+ LGDRIAI+ +G L+  GT +FL+N+ G G  +    KL+ +S+      VS  
Sbjct  683   YLEEADYLGDRIAIISQGKLRCDGTSLFLKNRFGQGYLLTCNKKLENASNGFNTNQVSEF  742

Query  719   KKNPNLNDKPKTVARDEITICVSSSTNNEIRDAVKWFEDSQNFYNIENIGLTKMTMEEIF  778
              KN        T +  E++  + + + +        F+ + + ++I+  G++  ++EE+F
Sbjct  743   IKNFIPGASILTDSGAELSYRLPTESLSNFPQFFTEFDLNLSKFSIQTYGISVTSLEEVF  802

Query  779   LK-----ASTLGFNYQPRSSDEKPTHFKKMK--------EINTWRQFKILLLKWLKFTRK  825
             +      +  L  N    +   K    + +K         IN  +QFK LL+K ++ ++K
Sbjct  803   ISLGQEDSKKLNNNANGNNEFNKQNEMESLKLAIATPSDGINQIQQFKGLLIKRIQQSKK  862

Query  826   KLQ--FIQIVIMILCMV--ICLCGSENSEDA----SESDKVVPLNLQTYSDSAVFIGRNQ  877
               +  F+ I++ +  ++  I L  S N +      + S + + ++L  Y+DS   I    
Sbjct  863   DARSFFLSIILPMALIIGSIILYKSMNDQKQVLFYNNSTQPLTMSLSIYTDSDNTINVPM  922

Query  878   SGMFSKIAHYYEDSLNGSVVYSK-----TVQNLSDEIIQQ---GINNIEFYKKRMVVAVS  929
               + +++   + +  N S  ++K        N +D +I      I  I F  +     +S
Sbjct  923   QLLNNELE--WSNLFNNSPYFNKFKYINESINFNDYLIDNYKLSIGAINFTNQ----PIS  976

Query  930   FDDFIGKHSAT----AFYSNKAVHGAPISLNLLTNAVLKSLKGPDYGIKVGNHPLTSPYQ  985
              DD     S      A+Y++  +H  PI +NL+ +A+L+  K     +       + P+ 
Sbjct  977   IDDNNNGQSTNCSYIAYYNSDYIHSFPIHVNLINDALLRKFKNISISVT------SMPFD  1030

Query  986   H-----RVQHLSMIQVLLIWYIFLPLGAL-LLVGISIFCPYSEYASKIMHLQQMCGVSKW  1039
             H      +    +    +I+++F+ +    L+ G        E  +++  L  + G  K 
Sbjct  1031  HILTAFEISSSDINASAIIYFVFILMAGFSLMAGSFAGSIAQERTNRVKRLLYVSGCKKH  1090

Query  1040  VYWLSCYVKDVVVYFI----SIGIVIGITYALNSYLTMSSIFGDAEMGTLFVILAVFGVS  1095
             +YWLS  V D    FI    S  I+ G+         +   F + + G+  + L +   +
Sbjct  1091  IYWLSNLVWDFFFAFIISILSCSILAGV---------IKGAFKE-QFGSFLLCLILLSCA  1140

Query  1096  AIPYSYLFIYRSSGFVGYGLFIITSLLISNTIVIGVFYME------FSEDEDLKTIANGI  1149
              IP  YL  Y+   + G  +  IT++L    +V  +  +        +++   + +A+ I
Sbjct  1141  IIPLGYLMSYKFQTY-GKAVGAITAILFVFGLVFTIASLNVRIQAVVNQNSTTQKVADII  1199

Query  1150  NYFF-VLFPTFGLKYTMMKLIKQSVWNYNWRVRSPEHKQAICATNYNSCCYGDDSQGCIR  1208
             +  F ++ P F L   +  L                           S   G    G  +
Sbjct  1200  DLIFSIISPIFALNRIVFIL---------------------------SGFPGSTRLGTFK  1232

Query  1209  YQSYLLGENAVATTLYEMLASSALYFSLLYLFHSNSFSKGYSKVKKIL-----KRNEKKD  1263
               +Y    + + T L  +   + L+   + L       KG+ K  K L      ++E  D
Sbjct  1233  VDNY-WSFDYLGTPLIVLAGHAVLWNVWILLLDYVPQIKGFFKNPKNLPAPSPPQDEDYD  1291

Query  1264  KAEESENQV-FNPSDGSLNAD------IKSKKIGSQVVLNDINFKIQPKQCVGLLGVNGA  1316
              ++E    +   PS+  +           S K  S+  + +    I   Q  GLLG+NG 
Sbjct  1292  VSQERRRLLNMRPSEEPIQFKNLHKLFPGSGKNPSKTAVYNSTLGIPRGQTFGLLGLNGG  1351

Query  1317  GKSTTFRLLAGEDRLENGEIILHANKKRVSINENKLEYLQNIGYCPQFDELSELTSGREL  1376
             GKSTT  +L+GE    +GEI ++       +  N+ + L NI    QFD L  L S RE 
Sbjct  1352  GKSTTLSMLSGEIVPSSGEISING----YDVITNREKALGNISMVFQFDALISLLSAREH  1407

Query  1377  LRLFAGLRGIE--SVEEEVDKFLEIFDLTKYADRLCNTYSIGCKRKLFTALALIGMPPFI  1434
             L LF+ ++GI+   +E  V+ F+++ DLT+ A+  C  YS G KRK+  ++A++G P   
Sbjct  1408  LWLFSRIKGIKESQIENCVEAFIKMVDLTRIANSGCGGYSGGNKRKVSLSMAMLGNPSVC  1467

Query  1435  LLDEPTAGVDLSSRRKLWDALILTKNSDSSIILSTHNMDECEILCENIVTLKSGKIIFNG  1494
              LDE + G D   RR+LWD +I     D SIIL++H+M E E LC  I  +K GK     
Sbjct  1468  FLDEISCGCDAVVRRQLWD-VISELGKDKSIILTSHSMSEVEALCSRITIMKEGKYTCLN  1526

Query  1495  SISSLKSKYKDSCIIALKLAPMIKIVVVQSTKKKLQLCNNVEPNWMTDLKDVIEKEFTDH  1554
             +I  +K+++     I +K         +Q+  + +  C                      
Sbjct  1527  TIQGVKNRFGAGYSIDVKFKKEYLETGIQTILQSIPNCT---------------------  1565

Query  1555  ELLDQHATLLKYRVQR---NGKTLSEIFRIVEKIRLDNYFIEDFDISEVTLETLFLNINN  1611
              +LDQH  +  + V     N   LS IF I+  + +    ++D+++ + +LE++FL +  
Sbjct  1566  -VLDQHDVMASFEVPNPPGNPIKLSNIFSILSNLPI----LDDYNVGQTSLESVFLKLTG  1620

Query  1612  EN  1613
              N
Sbjct  1621  AN  1622


 Score = 116 bits (290),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 155/628 (25%), Positives = 271/628 (43%), Gaps = 56/628 (9%)

Query  199   IAINVEEFPYPP-----HINDSELKNVIIYFLPVITVLSFTLLCPMIISSVMEDKVTGMK  253
             I+I+V   P+        I+ S++    I +   I +  F+L+      S+ +++   +K
Sbjct  1020  ISISVTSMPFDHILTAFEISSSDINASAIIYFVFILMAGFSLMAGSFAGSIAQERTNRVK  1079

Query  254   ELMRVMGLKSGMMWFTWFLDMFCWNFISLVVITAMLVYLKSDTRPPLLEHCSFSVLLTFF  313
              L+ V G K  + W    L    W+F    +I+ +   + +       +   F   L   
Sbjct  1080  RLLYVSGCKKHIYW----LSNLVWDFFFAFIISILSCSILAGVIKGAFKE-QFGSFLLCL  1134

Query  314   SLYSAALITFCFALSSFFN---KPIHSITTAILAWILTFVIPQ-----RWIYSDPSFFQR  365
              L S A+I   + +S  F    K + +IT  +  + L F I       + + +  S  Q+
Sbjct  1135  ILLSCAIIPLGYLMSYKFQTYGKAVGAITAILFVFGLVFTIASLNVRIQAVVNQNSTTQK  1194

Query  366   II----MIFPNAGLLFGYKIISDYETRELGVQWVNIFESPSWQKNEFTMGSIFVCFIVQC  421
             +     +IF     +F    I    +   G   +  F+  ++   ++ +G+  +      
Sbjct  1195  VADIIDLIFSIISPIFALNRIVFILSGFPGSTRLGTFKVDNYWSFDY-LGTPLIVLAGHA  1253

Query  422   L---VYITITLYMSEIKPGIYGKAQVWYFPLLWFRRKIEQNECGPKPNNFGPYIEEINLP  478
             +   V+I +  Y+ +IK G +   +    P        + ++   +  N  P  E I   
Sbjct  1254  VLWNVWILLLDYVPQIK-GFFKNPKNLPAPSPPQDEDYDVSQERRRLLNMRPSEEPI---  1309

Query  479   VSVKVRNLCKHF-GSEK-----AVDNLSMDIYEQQITVLLGKNGAGKTTTLSMIAGILSL  532
                + +NL K F GS K     AV N ++ I   Q   LLG NG GK+TTLSM++G +  
Sbjct  1310  ---QFKNLHKLFPGSGKNPSKTAVYNSTLGIPRGQTFGLLGLNGGGKSTTLSMLSGEIVP  1366

Query  533   TSGTISIKDLCNTNNF------VSICPQSNLQFHALTVLHHLKFYGILKGLSADDAIEEA  586
             +SG ISI       N       +S+  Q +     L+   HL  +  +KG+         
Sbjct  1367  SSGEISINGYDVITNREKALGNISMVFQFDALISLLSAREHLWLFSRIKGIKESQIENCV  1426

Query  587   EHMIGVTNLSSKKNCLPSELSTGMQRRLSISVAVIGSNNVVILDEPTAGLDPECRRDIWN  646
             E  I + +L+   N      S G +R++S+S+A++G+ +V  LDE + G D   RR +W+
Sbjct  1427  EAFIKMVDLTRIANSGCGGYSGGNKRKVSLSMAMLGNPSVCFLDEISCGCDAVVRRQLWD  1486

Query  647   ILIRLRGYRTIIVTTHSMEEAEVLGDRIAIMDRGVLKSYGTPIFLRNKLGAGSHIAVKLK  706
             ++  L   ++II+T+HSM E E L  RI IM  G      T   ++N+ GAG  I VK K
Sbjct  1487  VISELGKDKSIILTSHSMSEVEALCSRITIMKEGKYTCLNTIQGVKNRFGAGYSIDVKFK  1546

Query  707   KSSDVERLVSAVKKNPNLNDKPKTVARDEITICVSSSTNNEIRDAVKW---FEDSQNFYN  763
             K    E L + ++    L   P     D+  +  S    N   + +K    F    N   
Sbjct  1547  K----EYLETGIQT--ILQSIPNCTVLDQHDVMASFEVPNPPGNPIKLSNIFSILSNLPI  1600

Query  764   IENIGLTKMTMEEIFLKASTLGFNYQPR  791
             +++  + + ++E +FLK +  G N+  R
Sbjct  1601  LDDYNVGQTSLESVFLKLT--GANHDQR  1626



Lambda      K        H
   0.316    0.129    0.381 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4879639968


Query= XP_031327408.1 peroxisomal leader peptide-processing protease
isoform X1 [Photinus pyralis]

Length=499
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

HTRA2_DROME  unnamed protein product                                  42.7    5e-04
SKA1_CAEEL  unnamed protein product                                   28.9    8.1  


>HTRA2_DROME unnamed protein product
Length=422

 Score = 42.7 bits (99),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 52/195 (27%), Positives = 91/195 (47%), Gaps = 44/195 (23%)

Query  299  GTGILLNKTKGIFITNSHVI--QPHTEVFVY---WRTLEIKATVLHRTPDFEPFDLAILK  353
            G+G ++ +  G+ +TN+HV+  +PHT V V     RT       + +T D     + +  
Sbjct  141  GSGFIIEQN-GLILTNAHVVINKPHTMVQVRLSDGRTFPATIEDVDQTSDLATLRIQV--  197

Query  354  ANPRDLEKLDISSSVLSTEAAQRGDQIYAVGYPLFPRNLMVRPSITRGCVSLVQEY----  409
             N   + +L  SS++ S      G+ + A+G PL   N     ++T G +S  Q      
Sbjct  198  -NNLSVMRLGKSSTLRS------GEWVVALGSPLALSN-----TVTAGVISSTQRASQEL  245

Query  410  --------VVKTTATVLPGSSGGAIFNDNGKLIAITVSNTKMEDVGVVYPRINLAVPILA  461
                     ++T A +  G+SGG + N +G+  AI V++ K      V   I+ A+PI  
Sbjct  246  GLRNRDINYLQTDAAITFGNSGGPLVNLDGE--AIGVNSMK------VTAGISFAIPI--  295

Query  462  ILEYLQLFLQTGDTK  476
              +Y+++FL+    K
Sbjct  296  --DYVKVFLERAAEK  308


>SKA1_CAEEL unnamed protein product
Length=243

 Score = 28.9 bits (63),  Expect = 8.1, Method: Compositional matrix adjust.
 Identities = 28/132 (21%), Positives = 58/132 (44%), Gaps = 30/132 (23%)

Query  232  SCLNWWKG---EWVGLTL-AANLVPLLRELIPPCYQNINVLKSN----------------  271
            +C+N  K    +++G+ + A+ +V +  +L+P   ++  ++++N                
Sbjct  61   TCMNCTKSQLNDFLGIKVEASTIVDVKSQLVPQSKESSALVETNEPNEQGLSSKPKENDI  120

Query  272  ---PTFANEELQL-----LATLTKSVVQIVSGSLWGTGILLNKTKGIFITNSHVIQPHTE  323
               P   +EE +      L  LT  ++  +   +     L+ K+K +  TN  + +   E
Sbjct  121  RIVPQITDEEFKTIPKYQLGRLTLEMMNEIVSKM--DDFLMKKSKILGKTNKQLTRSDRE  178

Query  324  VFVYWRTLEIKA  335
            V   WR LE+KA
Sbjct  179  VLDNWRELEMKA  190



Lambda      K        H
   0.316    0.129    0.381 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4879639968


Query= XP_031327409.1 peroxisomal leader peptide-processing protease
isoform X2 [Photinus pyralis]

Length=497
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

HTRA2_DROME  unnamed protein product                                  42.7    5e-04
SKA1_CAEEL  unnamed protein product                                   29.3    7.5  


>HTRA2_DROME unnamed protein product
Length=422

 Score = 42.7 bits (99),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 52/195 (27%), Positives = 91/195 (47%), Gaps = 44/195 (23%)

Query  297  GTGILLNKTKGIFITNSHVI--QPHTEVFVY---WRTLEIKATVLHRTPDFEPFDLAILK  351
            G+G ++ +  G+ +TN+HV+  +PHT V V     RT       + +T D     + +  
Sbjct  141  GSGFIIEQN-GLILTNAHVVINKPHTMVQVRLSDGRTFPATIEDVDQTSDLATLRIQV--  197

Query  352  ANPRDLEKLDISSSVLSTEAAQRGDQIYAVGYPLFPRNLMVRPSITRGCVSLVQEY----  407
             N   + +L  SS++ S      G+ + A+G PL   N     ++T G +S  Q      
Sbjct  198  -NNLSVMRLGKSSTLRS------GEWVVALGSPLALSN-----TVTAGVISSTQRASQEL  245

Query  408  --------VVKTTATVLPGSSGGAIFNDNGKLIAITVSNTKMEDVGVVYPRINLAVPILA  459
                     ++T A +  G+SGG + N +G+  AI V++ K      V   I+ A+PI  
Sbjct  246  GLRNRDINYLQTDAAITFGNSGGPLVNLDGE--AIGVNSMK------VTAGISFAIPI--  295

Query  460  ILEYLQLFLQTGDTK  474
              +Y+++FL+    K
Sbjct  296  --DYVKVFLERAAEK  308


>SKA1_CAEEL unnamed protein product
Length=243

 Score = 29.3 bits (64),  Expect = 7.5, Method: Compositional matrix adjust.
 Identities = 28/132 (21%), Positives = 58/132 (44%), Gaps = 30/132 (23%)

Query  230  SCLNWWKG---EWVGLTL-AANLVPLLRELIPPCYQNINVLKSN----------------  269
            +C+N  K    +++G+ + A+ +V +  +L+P   ++  ++++N                
Sbjct  61   TCMNCTKSQLNDFLGIKVEASTIVDVKSQLVPQSKESSALVETNEPNEQGLSSKPKENDI  120

Query  270  ---PTFANEELQL-----LATLTKSVVQIVSGSLWGTGILLNKTKGIFITNSHVIQPHTE  321
               P   +EE +      L  LT  ++  +   +     L+ K+K +  TN  + +   E
Sbjct  121  RIVPQITDEEFKTIPKYQLGRLTLEMMNEIVSKM--DDFLMKKSKILGKTNKQLTRSDRE  178

Query  322  VFVYWRTLEIKA  333
            V   WR LE+KA
Sbjct  179  VLDNWRELEMKA  190



Lambda      K        H
   0.316    0.129    0.381 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4879639968


Query= XP_031327410.1 ras-related protein Rab6-like [Photinus pyralis]

Length=208
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RAB6_DROME  unnamed protein product                                   330     2e-116
RAB6A_CAEEL  unnamed protein product                                  294     3e-102
RAB6B_CAEEL  unnamed protein product                                  290     8e-101


>RAB6_DROME unnamed protein product
Length=208

 Score = 330 bits (845),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 161/208 (77%), Positives = 175/208 (84%), Gaps = 0/208 (0%)

Query  1    MSSSSDVNRVKKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTVYLEDAT  60
            MSS    N ++KFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKT+YLED T
Sbjct  1    MSSGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRT  60

Query  61   VRLQLWDTAGQERFRSLIPSYIRDSKVAIVVYDITNVNSFYQTAKWIGNVRTERGGDVII  120
            VRLQLWDTAGQERFRSLIPSYIRDS VA+VVYDITN NSF+QT+KWI +VRTERG DVII
Sbjct  61   VRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNTNSFHQTSKWIDDVRTERGSDVII  120

Query  121  VLVGNKTDLAADRQVSVEEGERMANEMGVMFIETSAKLGYNVRQLFRRVASGLPQMDLAE  180
            +LVGNKTDL+  RQVS EEGER A E+ VMFIETSAK GYNV+QLFRRVA+ LP MD  E
Sbjct  121  MLVGNKTDLSDKRQVSTEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGMDSTE  180

Query  181  KMTPESLQEVVLKDTGNVVKDPYEKCLC  208
                E +QEVVLKD+ N  KDP   C C
Sbjct  181  NKPSEDMQEVVLKDSPNETKDPEGGCAC  208


>RAB6A_CAEEL unnamed protein product
Length=205

 Score = 294 bits (752),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 141/201 (70%), Positives = 165/201 (82%), Gaps = 2/201 (1%)

Query  8    NRVKKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTVYLEDATVRLQLWD  67
            N +KKFKLVFLGEQSVGKTS+ITRFMYDSFDNTYQATIGIDFLSKT+YLED T+RLQLWD
Sbjct  7    NALKKFKLVFLGEQSVGKTSIITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTIRLQLWD  66

Query  68   TAGQERFRSLIPSYIRDSKVAIVVYDITNVNSFYQTAKWIGNVRTERGGDVIIVLVGNKT  127
            TAGQERFRSLIPSYIRDS VA+VVYDITN NSF+QT KW+ +VR ERG DVIIVLVGNKT
Sbjct  67   TAGQERFRSLIPSYIRDSSVAVVVYDITNANSFHQTTKWVDDVRNERGCDVIIVLVGNKT  126

Query  128  DLAADRQVSVEEGERMANEMGVMFIETSAKLGYNVRQLFRRVASGLPQMDLAEKMTPESL  187
            DLA  RQVS E+GE+ A ++ VMFIETSAK GYNV+QLFR++A+ LP   + ++ TPE  
Sbjct  127  DLADKRQVSTEDGEKKARDLNVMFIETSAKAGYNVKQLFRKIATALP--GIVQEETPEQP  184

Query  188  QEVVLKDTGNVVKDPYEKCLC  208
              V++    +  +    +C C
Sbjct  185  NIVIMNPPKDAEESQGRQCPC  205


>RAB6B_CAEEL unnamed protein product
Length=205

 Score = 290 bits (742),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 145/208 (70%), Positives = 166/208 (80%), Gaps = 15/208 (7%)

Query  8    NRVKKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTVYLEDATVRLQLWD  67
            N +KKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKT+YLED TVRLQLWD
Sbjct  6    NPLKKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWD  65

Query  68   TAGQERFRSLIPSYIRDSKVAIVVYDITNVNSFYQTAKWIGNVRTERGGDVIIVLVGNKT  127
            TAGQERFRSLIPSYIRDS VA+VVYDITN NSF+QT+KWI +VRTERG DVII+LVGNKT
Sbjct  66   TAGQERFRSLIPSYIRDSTVAVVVYDITNSNSFHQTSKWIDDVRTERGSDVIIMLVGNKT  125

Query  128  DLAADRQVSVEEGERMANEMGVMFIETSAKLGYNVRQLFRRVASGLPQMDLAEKMTPESL  187
            DL+  RQV+ +EGER A E+ VMFIETSAK GYNV+QLFRR+A  LP +   + + P ++
Sbjct  126  DLSDKRQVTTDEGERKAKELNVMFIETSAKAGYNVKQLFRRIAGALPGIIKDDPVEPPNV  185

Query  188  -------QEVVLKDTGNVVKDPYEKCLC  208
                   Q  ++ D G+        C C
Sbjct  186  VTMDPIRQRQIVTDEGS--------CWC  205



Lambda      K        H
   0.316    0.129    0.381 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4879639968


Query= XP_031327411.1 ion transport peptide-like isoform X1 [Photinus
pyralis]

Length=124
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

E1JGW3_DROME  unnamed protein product                                 90.5    1e-24
Q9W151_DROME  unnamed protein product                                 85.9    1e-22
Q0E8W5_DROME  unnamed protein product                                 84.7    4e-22


>E1JGW3_DROME unnamed protein product
Length=108

 Score = 90.5 bits (223),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 71/113 (63%), Gaps = 8/113 (7%)

Query  11   TKGVWVCMALTLVIQLAHCTPTQRSRPLLSHHLTKRA-FADQQCKGVYDKSIYARLDRIC  69
            ++ + + + L LV+      P   + P  +H+L+KR+ F D +CKG+++K+++ RLDRIC
Sbjct  3    SRNIKISVVLFLVL-----IPIFAALPH-NHNLSKRSNFFDLECKGIFNKTMFFRLDRIC  56

Query  70   EDCYNLFREPELHSLCKKNCFKSPYFQTCIDTLNLGSEAAREVYEWVKRMNKR  122
            EDCY LFRE  +H LCK+ CF SP+F  CI+ L L  E  +   EW   + ++
Sbjct  57   EDCYQLFRETSIHRLCKQECFGSPFFNACIEALQLHEEMDK-YNEWRDTLGRK  108


>Q9W151_DROME unnamed protein product
Length=119

 Score = 85.9 bits (211),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 58/82 (71%), Gaps = 1/82 (1%)

Query  40   SHHLTKRA-FADQQCKGVYDKSIYARLDRICEDCYNLFREPELHSLCKKNCFKSPYFQTC  98
            +H+L+KR+ F D +CKG+++K+++ RLDRICEDCY LFRE  +H LCKK+CF S +F  C
Sbjct  26   NHNLSKRSNFFDLECKGIFNKTMFFRLDRICEDCYQLFRETSIHRLCKKDCFDSKWFGEC  85

Query  99   IDTLNLGSEAAREVYEWVKRMN  120
            +  L +  E    +  +++ +N
Sbjct  86   LKVLLIPEEEISNLQHFLRVVN  107


>Q0E8W5_DROME unnamed protein product
Length=119

 Score = 84.7 bits (208),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 68/111 (61%), Gaps = 7/111 (6%)

Query  11   TKGVWVCMALTLVIQLAHCTPTQRSRPLLSHHLTKRA-FADQQCKGVYDKSIYARLDRIC  69
            ++ + + + L LV+      P   + P  +H+L+KR+ F D +CKG+++K+++ RLDRIC
Sbjct  3    SRNIKISVVLFLVL-----IPIFAALPH-NHNLSKRSNFFDLECKGIFNKTMFFRLDRIC  56

Query  70   EDCYNLFREPELHSLCKKNCFKSPYFQTCIDTLNLGSEAAREVYEWVKRMN  120
            EDCY LFRE  +H LCK NCF    F  C+  L +  E   ++  ++K +N
Sbjct  57   EDCYQLFRETSIHRLCKANCFVHETFGDCLKVLLIDDEEISQLQHYLKVIN  107



Lambda      K        H
   0.316    0.129    0.381 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4879639968


Query= XP_031327412.1 ion transport peptide isoform X2 [Photinus pyralis]

Length=123
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

E1JGW3_DROME  unnamed protein product                                 95.9    8e-27
Q9W151_DROME  unnamed protein product                                 89.0    7e-24
Q0E8W5_DROME  unnamed protein product                                 86.7    6e-23


>E1JGW3_DROME unnamed protein product
Length=108

 Score = 95.9 bits (237),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 73/112 (65%), Gaps = 7/112 (6%)

Query  11   TKGVWVCMALTLVIQLAHCTPTQRSRPLLSHHLTKRA-FADQQCKGVYDKSIYARLDRIC  69
            ++ + + + L LV+      P   + P  +H+L+KR+ F D +CKG+++K+++ RLDRIC
Sbjct  3    SRNIKISVVLFLVL-----IPIFAALPH-NHNLSKRSNFFDLECKGIFNKTMFFRLDRIC  56

Query  70   EDCYNLFREPELHSLCKSQCFSSQFFTGCLEALLLSEESEKFNHMIEYLKGK  121
            EDCY LFRE  +H LCK +CF S FF  C+EAL L EE +K+N   + L  K
Sbjct  57   EDCYQLFRETSIHRLCKQECFGSPFFNACIEALQLHEEMDKYNEWRDTLGRK  108


>Q9W151_DROME unnamed protein product
Length=119

 Score = 89.0 bits (219),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 58/83 (70%), Gaps = 2/83 (2%)

Query  40   SHHLTKRA-FADQQCKGVYDKSIYARLDRICEDCYNLFREPELHSLCKSQCFSSQFFTGC  98
            +H+L+KR+ F D +CKG+++K+++ RLDRICEDCY LFRE  +H LCK  CF S++F  C
Sbjct  26   NHNLSKRSNFFDLECKGIFNKTMFFRLDRICEDCYQLFRETSIHRLCKKDCFDSKWFGEC  85

Query  99   LEALLLSEES-EKFNHMIEYLKG  120
            L+ LL+ EE      H +  + G
Sbjct  86   LKVLLIPEEEISNLQHFLRVVNG  108


>Q0E8W5_DROME unnamed protein product
Length=119

 Score = 86.7 bits (213),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 71/112 (63%), Gaps = 8/112 (7%)

Query  11   TKGVWVCMALTLVIQLAHCTPTQRSRPLLSHHLTKRA-FADQQCKGVYDKSIYARLDRIC  69
            ++ + + + L LV+      P   + P  +H+L+KR+ F D +CKG+++K+++ RLDRIC
Sbjct  3    SRNIKISVVLFLVL-----IPIFAALPH-NHNLSKRSNFFDLECKGIFNKTMFFRLDRIC  56

Query  70   EDCYNLFREPELHSLCKSQCFSSQFFTGCLEALLL-SEESEKFNHMIEYLKG  120
            EDCY LFRE  +H LCK+ CF  + F  CL+ LL+  EE  +  H ++ + G
Sbjct  57   EDCYQLFRETSIHRLCKANCFVHETFGDCLKVLLIDDEEISQLQHYLKVING  108



Lambda      K        H
   0.316    0.129    0.381 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4879639968


Query= XP_031327413.1 sodium-dependent noradrenaline transporter-like
[Photinus pyralis]

Length=151
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DAT_DROME  unnamed protein product                                    152     1e-43
G5EF43_CAEEL  unnamed protein product                                 112     1e-29
Q9V4E7_DROME  unnamed protein product                                 106     3e-27


>DAT_DROME unnamed protein product
Length=631

 Score = 152 bits (383),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 95/133 (71%), Gaps = 0/133 (0%)

Query  2    FHLFDTYAAGLSLLTSALFEAIAVSWFYGLNKFTQDVDAMLGIKPGLYWRICWKFVSPSF  61
            FHL D YAAG S+L +  FEAIAVSW YG N+F++D+  M+G  PG YW++CW+FV+P F
Sbjct  471  FHLLDRYAAGYSILVAVFFEAIAVSWIYGTNRFSEDIRDMIGFPPGRYWQVCWRFVAPIF  530

Query  62   LIGVILFGLIFPVPLKYEDYDYPIWAESIGWCLALASILMIPLNAIWQLLKAPGTFKEKL  121
            L+ + ++GLI   PL Y DY YP WA ++GWC+A +S++MIP  AI++LL  PG+ +++ 
Sbjct  531  LLFITVYGLIGYEPLTYADYVYPSWANALGWCIAGSSVVMIPAVAIFKLLSTPGSLRQRF  590

Query  122  AICITPVDEHEYL  134
             I  TP  + + +
Sbjct  591  TILTTPWRDQQSM  603


>G5EF43_CAEEL unnamed protein product
Length=610

 Score = 112 bits (281),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/151 (42%), Positives = 90/151 (60%), Gaps = 7/151 (5%)

Query  1    MFHLFDTYAA-GLSLLTSALFEAIAVSWFYGLNKFTQDVDAMLGIKPGLYWRICWKFVSP  59
            +F LFD YAA G +LL    FE IA+SW  G++++ + + +M+G  P  +W+ CW F +P
Sbjct  457  VFQLFDFYAASGWALLWLLFFECIAISWSLGIDRWYEHMKSMIGYYPSAWWKFCWVFATP  516

Query  60   SFLIGVILFGLIFPVPLKYE--DYDYPIWAESIGWCLALASILMIPLNAIWQLLKAPGTF  117
            S   GV+LFGLI   PL+ +  +YDYP+W    GW L+L+S+L IP  AIW   K PGT 
Sbjct  517  SVCFGVLLFGLIKYQPLRIDAYNYDYPVWGHIFGWFLSLSSMLCIPGYAIWIWFKTPGTV  576

Query  118  KEKLAICITPVDE----HEYLRETKLVSRFK  144
            +EK+ +   P  E     E     +LV  F+
Sbjct  577  QEKIKLLCRPDIEIKGAMENAENLELVEDFQ  607


>Q9V4E7_DROME unnamed protein product
Length=636

 Score = 106 bits (264),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 80/140 (57%), Gaps = 1/140 (1%)

Query  1    MFHLFDTYA-AGLSLLTSALFEAIAVSWFYGLNKFTQDVDAMLGIKPGLYWRICWKFVSP  59
            +F + D+YA +G  LL    FE +++SW YG+++F   +  M+G  P ++W+ CW   +P
Sbjct  484  IFQILDSYAVSGFCLLWLIFFECVSISWCYGVDRFYDGIKDMIGYYPTVWWKFCWCVTTP  543

Query  60   SFLIGVILFGLIFPVPLKYEDYDYPIWAESIGWCLALASILMIPLNAIWQLLKAPGTFKE  119
            +  +GV  F ++   P+KY DY YP WA + GW  AL+S+L IPL   W   + PG   E
Sbjct  544  AICLGVFFFNIVQWTPVKYLDYSYPWWAHAFGWFTALSSMLYIPLYMFWLWKRTPGELSE  603

Query  120  KLAICITPVDEHEYLRETKL  139
            K+   +   ++   LRE  L
Sbjct  604  KIRALVRIDEDVTRLREKML  623



Lambda      K        H
   0.316    0.129    0.381 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4879639968


Query= XP_031327414.1 cilia- and flagella-associated protein 251-like
[Photinus pyralis]

Length=387
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q587D3_TRYB2  unnamed protein product                                 33.9    0.18 
RBP2A_PLAF7  unnamed protein product                                  34.3    0.20 


>Q587D3_TRYB2 unnamed protein product
Length=358

 Score = 33.9 bits (76),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 16/31 (52%), Positives = 22/31 (71%), Gaps = 0/31 (0%)

Query  226  GVVYDGEFDDGQYHGDGTLTYPMGHKFYGTW  256
            G VY+GE+ DG+ HG GT  +P G+K+ G W
Sbjct  166  GGVYEGEWVDGRMHGRGTYVFPNGNKYEGEW  196


 Score = 33.1 bits (74),  Expect = 0.40, Method: Compositional matrix adjust.
 Identities = 19/53 (36%), Positives = 27/53 (51%), Gaps = 1/53 (2%)

Query  227  VVYDGEFDDGQYHGDGTLTYPMGHKFYGTWCHG-RLINYRFQFPDSLEYVTDW  278
            ++Y GE ++GQ HG G L YP   K+ G W  G R     + + D   Y  +W
Sbjct  1    MIYSGEIENGQMHGRGCLQYPNKEKYDGDWVFGKRHGTGVYVYADGSRYEGEW  53


 Score = 31.6 bits (70),  Expect = 0.97, Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 4/58 (7%)

Query  203  FQSLTNRYCGNWDVFGLNKEELY----GVVYDGEFDDGQYHGDGTLTYPMGHKFYGTW  256
            + +  N Y G W +  +N   +     G  Y+GE+ DG+ HG GT  Y  G K+ G W
Sbjct  65   YYTSGNVYTGEWSMGRINGRGVLEYHDGDRYEGEWKDGRMHGKGTYCYSNGDKYEGEW  122


 Score = 31.6 bits (70),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 48/94 (51%), Gaps = 10/94 (11%)

Query  209  RYCGNWDVFG-LNKEELY----GVVYDGEFDDGQYHGDGTLTYPMGHKFYGTWCHGRLIN  263
            +Y G+W VFG  +   +Y    G  Y+GE+ D + HG+G   Y  G+ + G W  GR IN
Sbjct  25   KYDGDW-VFGKRHGTGVYVYADGSRYEGEWVDDKVHGNGACYYTSGNVYTGEWSMGR-IN  82

Query  264  YR--FQFPDSLEYVTDWKYCKMPDRRYFACIQDG  295
             R   ++ D   Y  +WK  +M  +  + C  +G
Sbjct  83   GRGVLEYHDGDRYEGEWKDGRMHGKGTY-CYSNG  115


>RBP2A_PLAF7 unnamed protein product
Length=3130

 Score = 34.3 bits (77),  Expect = 0.20, Method: Composition-based stats.
 Identities = 37/145 (26%), Positives = 72/145 (50%), Gaps = 11/145 (8%)

Query  52    QEEALTEESENVVEEDVGQIGRDQEEALTEVSKNVVEEDVGHMERE----EEKALTEDSE  107
             +EE   +E E +  E   Q+ +++E    E  +   EE +   E+E    EE+   ++ E
Sbjct  2750  EEELKRQEQERLEREKQEQLQKEEELKRQEQERLQKEEALKRQEQERLQKEEELKRQEQE  2809

Query  108   NPVEQNVGQMDREEEAWTEESENLVEEDIGYMDREEEATLTEESENWVEEDVGQMDREEE  167
                 +   Q+ +EEE   +E E L +E+   + R+E+  L +E E   +E   +++R++ 
Sbjct  2810  RLEREKQEQLQKEEELKRQEQERLQKEEA--LKRQEQERLQKEEELKRQEQ-ERLERKKI  2866

Query  168   EALTENSENV---VEEDVKSKVSDE  189
             E L E  +++   +E D+   + DE
Sbjct  2867  E-LAEREQHIKSKLESDMVKIIKDE  2890


 Score = 33.5 bits (75),  Expect = 0.43, Method: Composition-based stats.
 Identities = 29/118 (25%), Positives = 58/118 (49%), Gaps = 7/118 (6%)

Query  58    EESENVVEEDVGQIGRDQEEALTEVSKNVVEEDVGHMEREEEKALTEDSENPVEQNVGQM  117
             +E E + +E+  ++ R ++E L    +  ++++     +E+E+   E++    EQ   ++
Sbjct  2742  QEQERLQKEE--ELKRQEQERLEREKQEQLQKEEELKRQEQERLQKEEALKRQEQE--RL  2797

Query  118   DREEEAWTEESENLVEEDIGYMDREEEATLTEESENWVEEDVGQMDREEEEALTENSE  175
              +EEE   +E E L  E    + +EEE    E+     EE    + R+E+E L +  E
Sbjct  2798  QKEEELKRQEQERLEREKQEQLQKEEELKRQEQERLQKEE---ALKRQEQERLQKEEE  2852



Lambda      K        H
   0.316    0.129    0.381 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4879639968


Query= XP_031327415.1 uncharacterized protein LOC116158725 [Photinus
pyralis]

Length=144
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SPI1_CRAVI  unnamed protein product                                   31.6    0.073
CCNA1_CAEEL  unnamed protein product                                  32.0    0.16 
SCC1_CAEEL  unnamed protein product                                   30.8    0.43 


>SPI1_CRAVI unnamed protein product
Length=90

 Score = 31.6 bits (70),  Expect = 0.073, Method: Compositional matrix adjust.
 Identities = 14/37 (38%), Positives = 20/37 (54%), Gaps = 0/37 (0%)

Query  1   MDHIFLLLITLCLFGHTFEVDIPDSALTPEDYECMSA  37
           MD +  L++ +CLFG TF V   D   T  + +C S 
Sbjct  1   MDVVRTLILCVCLFGLTFAVPCIDGVCTSNELQCASG  37


>CCNA1_CAEEL unnamed protein product
Length=485

 Score = 32.0 bits (71),  Expect = 0.16, Method: Composition-based stats.
 Identities = 14/41 (34%), Positives = 24/41 (59%), Gaps = 1/41 (2%)

Query  45   VERFFDGDYLFVLNLPLADKYSECWIKKMNFVND-KNEFNY  84
            +ERF  G + FV+ +P +  +  C+ K+MNF    +N  +Y
Sbjct  328  MERFLLGKFDFVVAMPTSSWFGTCFAKRMNFTKKMRNTVHY  368


>SCC1_CAEEL unnamed protein product
Length=645

 Score = 30.8 bits (68),  Expect = 0.43, Method: Composition-based stats.
 Identities = 25/72 (35%), Positives = 35/72 (49%), Gaps = 6/72 (8%)

Query  15   GHTFEVDIPDSALTPEDYE-CMSALNIGREQVERFFDGDYLFVLNLPLADKYSECWIKKM  73
            G +FEVDIP++A   ED+   +   NI    V  F D DY   L +    +  +  +K+ 
Sbjct  92   GFSFEVDIPENAEIEEDFSNFIDKYNI---TVPEFHDADYNEQLIMANVSRREDITMKET  148

Query  74   NFVNDKNEFNYD  85
              VN   EFN D
Sbjct  149  --VNFNVEFNID  158



Lambda      K        H
   0.316    0.129    0.381 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4879639968


Query= XP_031327416.1 uncharacterized protein LOC116158726 [Photinus
pyralis]

Length=173
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GPRK2_DROME  unnamed protein product                                  30.0    1.2  
FEM2_CAEEL  unnamed protein product                                   28.1    4.2  
Q9VZ77_DROME  unnamed protein product                                 28.1    4.7  


>GPRK2_DROME unnamed protein product
Length=714

 Score = 30.0 bits (66),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 33/72 (46%), Gaps = 8/72 (11%)

Query  93   LFHFSQILWRRLQSIGLQSTYQTKDEQELRSSFHSLIALAFVPVEDIEKVFDDVVDSCDE  152
             FH +Q+ WRRL++  L+  +            H++ A   + +E    V    +D  D 
Sbjct  573  FFHSTQLNWRRLEAGMLEPPFVPDP--------HAVYAKDVLDIEQFSTVKGVNIDESDT  624

Query  153  RVLEKYDTGNVN  164
                K++TG+V+
Sbjct  625  NFYTKFNTGSVS  636


>FEM2_CAEEL unnamed protein product
Length=449

 Score = 28.1 bits (61),  Expect = 4.2, Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 23/39 (59%), Gaps = 5/39 (13%)

Query  54   AVKTQYNKLLELLFVAVDFEKAAISAIKECFKGAAISGC  92
            +++ Q  K LELL      E+  + ++KEC+KG + + C
Sbjct  233  SLEDQLRKSLELLD-----ERMTVRSVKECWKGGSTAVC  266


>Q9VZ77_DROME unnamed protein product
Length=4385

 Score = 28.1 bits (61),  Expect = 4.7, Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 31/76 (41%), Gaps = 17/76 (22%)

Query  50    CVKKAVKTQYNKLLELLFVAVDFEKAAISAIKECFKGAAISGCLF-HFSQILWRRL----  104
             C+      Q  KL+ ++F   D E+A+ + +  C       G ++   SQ+ WR L    
Sbjct  2046  CLMSGEIMQMTKLMNMMFEPADLEQASPATVSRC-------GMIYMEPSQLGWRALHKSF  2098

Query  105   -----QSIGLQSTYQT  115
                    +GL   Y T
Sbjct  2099  INVLVNKVGLGDIYMT  2114



Lambda      K        H
   0.316    0.129    0.381 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4879639968


Query= XP_031327417.1 uncharacterized protein LOC116158727 isoform X1
[Photinus pyralis]

Length=380
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

YPO4_CAEEL  unnamed protein product                                   30.8    2.5  


>YPO4_CAEEL unnamed protein product
Length=1131

 Score = 30.8 bits (68),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 27/58 (47%), Gaps = 2/58 (3%)

Query  191  EKYINLY--RKYTSLRPPAMESRRFFLKFQNGKCYRMVMGIHTISNVPKTVATFLKLP  246
            +++I +Y  R Y +L P  M     F +F    C R+ +   T+ N P   AT+   P
Sbjct  218  DQFIKVYDLRMYKALSPIGMPYLPQFARFMPSYCERVCVTYQTMYNQPGQTATWSNHP  275



Lambda      K        H
   0.316    0.129    0.381 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4879639968


Query= XP_031327418.1 uncharacterized protein LOC116158727 isoform X2
[Photinus pyralis]

Length=360


***** No hits found *****



Lambda      K        H
   0.316    0.129    0.381 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4879639968


Query= XP_031327419.1 trypsin beta-like [Photinus pyralis]

Length=253
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TRYDT_DROME  unnamed protein product                                  213     4e-69
Q9W2C8_DROME  unnamed protein product                                 157     1e-45
Q9VQ97_DROME  unnamed protein product                                 152     2e-45


>TRYDT_DROME unnamed protein product
Length=253

 Score = 213 bits (543),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 119/253 (47%), Positives = 156/253 (62%), Gaps = 5/253 (2%)

Query  4    MFRLVLLLTAVTLAAGAKLQNATPPRLDGKIVGGKPVKIEDYPYQVSLQYYGSHICGGSI  63
            M + V+LL+AV  A G  +     P+LDG+IVGG    I  +P+Q+SLQ  GSH CGGSI
Sbjct  1    MLKFVILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSI  60

Query  64   IGPNKVLTAAHCTSGSSASSLSIRHSSTYKGSEGVVIKVASIAQNPAYNPSTISDDVTVL  123
               N ++TAAHC    SAS L IR  S+Y  S GV   V+S   +  YN +T+ +D+ ++
Sbjct  61   YSSNVIVTAAHCLQSVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAII  120

Query  124  TLAEPIKDSDIGKPIAMVEANATEGDREAVCTGWGTLSSGGSS-PRQLQAVDVKEVDRKE  182
             +   +  S   K I +  +N   G   +V +GWGTLS G SS P QLQ V+V  V + +
Sbjct  121  KINGALTFSSTIKAIGLASSNPANGAAASV-SGWGTLSYGSSSIPSQLQYVNVNIVSQSQ  179

Query  183  CNES---YGGDITDTMICFGSPGKDSCQGDSGGPLVVGEKQVGIVSWGYGCAHPEYPGVY  239
            C  S   YG  I  TMIC  + GKD+CQGDSGGPLV G   VG+VSWGYGCA+  YPGVY
Sbjct  180  CASSTYGYGSQIRSTMICAAASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVY  239

Query  240  AHVASLRTFIDKN  252
            A VA+LR+++  N
Sbjct  240  ADVAALRSWVISN  252


>Q9W2C8_DROME unnamed protein product
Length=372

 Score = 157 bits (396),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 88/236 (37%), Positives = 126/236 (53%), Gaps = 13/236 (6%)

Query  30   LDGKIVGGKPVKIEDYPYQVSLQYYGSHICGGSIIGPNKVLTAAHCTSGSSASSLSIR--  87
            +  +IVGG+  ++  YP+   L Y G   C  S++    +LTA+HC  G     +S+R  
Sbjct  123  IQKRIVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTASHCVYGFRKERISVRLL  182

Query  88   -HSSTYKGSEGVVIKVASIAQNPAYNPSTISDDVTVLTLAEPIKDSDIGKPIAMVEANAT  146
             H       + +  KVA +  +P YN     +D+ ++ L EP++ +++  P+ M     +
Sbjct  183  EHDRKMSHMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCMPTPGRS  242

Query  147  EGDREAVCTGWGTLSSGGSSPRQLQAVDVKEVDRKECNES-YGGDITDTMIC--FGSPGK  203
                  + TGWG L  GG +   LQ V V  + + EC +S YG  ITD M+C  +   GK
Sbjct  243  FKGENGIVTGWGALKVGGPTSDTLQEVQVPILSQDECRKSRYGNKITDNMLCGGYDEGGK  302

Query  204  DSCQGDSGGPLVV-----GEKQV-GIVSWGYGCAHPEYPGVYAHVASLRTFIDKNL  253
            DSCQGDSGGPL +      E Q+ G+VSWG GCA   YPGVYA V    T+I KNL
Sbjct  303  DSCQGDSGGPLHIVASGTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTWI-KNL  357


>Q9VQ97_DROME unnamed protein product
Length=245

 Score = 152 bits (384),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 97/244 (40%), Positives = 134/244 (55%), Gaps = 9/244 (4%)

Query  9    LLLTAVTLAAGAKLQNA--TPPRLDGKIVGGKPVKIEDYPYQVSLQYYGSHICGGSIIGP  66
            +LL  + L A   L +A  +P R    IVGG PV I + P+Q +L Y   +ICG  I   
Sbjct  1    MLLHWLVLVASVTLISAGSSPER----IVGGHPVLISEVPWQAALMYSEKYICGAVIYSD  56

Query  67   NKVLTAAHCTSGSSASSLSIRHSSTYKGSEGVVIKVASIAQNPAYNPSTI-SDDVTVLTL  125
              ++TAAHC      +  S+R  S +K   G   +VA I ++  Y  STI  +D+ V+ L
Sbjct  57   KIIITAAHCVERPFDTLYSVRVGSVWKNLGGQHARVAVIRKHEDYVSSTILFNDIAVIRL  116

Query  126  AEPIKDSDIGKPIAMVEANATEGDREAVCTGWGTLSSGGSSPRQLQAVDVKEVDRKECNE  185
             + +  +   +PI + ++    G  EA  +GWG +      P  L    VK +D   C  
Sbjct  117  VDTLIFNAEVRPIQLADSAPAAGT-EASVSGWGEIGILWLQPTSLLKTSVKILDPNVCKR  175

Query  186  SYGGDITDTMICFGSPGKDSCQGDSGGPLVVGEKQVGIVSWGYGCAHPEYPGVYAHVASL  245
            SY   IT TMIC  +  KDSC GDSGGPLV G + VGIVS+G GCA+P +PGVYA+VA L
Sbjct  176  SYQ-YITKTMICAAALLKDSCHGDSGGPLVSGGQLVGIVSYGIGCANPFFPGVYANVAEL  234

Query  246  RTFI  249
            + +I
Sbjct  235  KPWI  238



Lambda      K        H
   0.316    0.129    0.381 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4879639968


Query= XP_031327420.1 proton-coupled folate transporter-like [Photinus
pyralis]

Length=478
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q961H2_DROME  unnamed protein product                                 95.9    6e-21
Q8MT20_DROME  unnamed protein product                                 30.4    2.9  
M9PJI2_DROME  unnamed protein product                                 28.1    3.0  


>Q961H2_DROME unnamed protein product
Length=507

 Score = 95.9 bits (237),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 91/442 (21%), Positives = 190/442 (43%), Gaps = 39/442 (9%)

Query  32   VEPVLVLFMLSSSISALAIENLNLEKSCYVNLNLSTSICDAMQQRNRSGFSEMD-EITVQ  90
            +EP + L   + ++     +N  L ++C      + + C+ +   +R   ++ + E+ VQ
Sbjct  54   LEPAVFLIFFARNLIGAVYQNQILYQTCITIEKFNATQCEPLLGIDRGSDADKEVEVIVQ  113

Query  91   KVVAAAGIWKSAAYCVLITVLLPLF-----GSWSDRNKTVKILILLPILGEIVANIGLIL  145
               A   +  S     L+  ++P F     G WSD+     IL L    G +   + LI+
Sbjct  114  TYSANIMMTTS-----LLESIIPAFASLFLGPWSDKFGRRPIL-LTTFTGYLTGALILIV  167

Query  146  CTYFYYE-----WPMEVNSIFEILPTAITGGIPLALAGVFTYMSSNTTNENRTFRLGIIH  200
             TY         W   ++S+    P+ ++GG    + G++ Y+S       +  R+ +  
Sbjct  168  ITYITRSTNISPWWFLLSSV----PSVVSGGTCALITGIYCYISDVAKERKKALRMVLNE  223

Query  201  TLVVICKTIGGTLSGVLYQLVGLYGVFSVTLALYVLGAVYTQFMLPSCTSTKD-----QK  255
              +     +G   SG +Y       +FS+  +L +   +Y    +P   +  D     + 
Sbjct  224  ASLCAGIMVGNVASGYIYAATNALVLFSIAGSLMMFALMYVLLFVPESLNPGDIHTGSRV  283

Query  256  RSLNKCELIVDVVNVKKTVGSFSFIATEGSGIQRRQLYAILFLDFIIVGPFVGQASVMYL  315
            R   + +L+ D++                    R  ++  +    I +    G+++V Y+
Sbjct  284  REFFRFDLVTDLIRT---------CFKRRPNFDRTIIWLTMIALTIAIFDMEGESTVNYM  334

Query  316  YTRLRFNWDAMDYSVFGAYSAVCHLIGNVGSIVIFSKLLKADDSILGGVSSMSRILGGIG  375
            + + +FNW   D+S+F A   V  ++G++  +++  ++LK     +  +S    +L    
Sbjct  335  FVQDKFNWTIKDFSLFNASRIVIQIVGSIVGMLVLRRVLKMSIVTMAMLSLACCVLESTV  394

Query  376  YALSPTVIW--FYACTLLDVVNGTAFIVSRSMATKLVTESNMGKVNSLFGVIEALSALAC  433
             A +  V W   Y    L ++ G    + R++ + +   + +GK+ +L   +E++S L  
Sbjct  395  RATA--VYWQELYLGMTLGMMRGVMGPMCRAILSHVAPATEVGKIFALTTSMESVSPLGA  452

Query  434  TPAYSAFYRVTIEIFPGAFNIL  455
             P Y+  Y+ T+E +PGAFN +
Sbjct  453  APLYTTVYKATLENYPGAFNFI  474


>Q8MT20_DROME unnamed protein product
Length=281

 Score = 30.4 bits (67),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 33/75 (44%), Gaps = 1/75 (1%)

Query  187  TTNENRTFRLGIIHTLVVICKTIGGTLSGVLYQLVGLYGVFSVTLALYVLGAVYTQFML-  245
            T ++ R   +GI    + +   IG    GV+Y+ VG    F +  AL +   +   FML 
Sbjct  51   TDDKERGNAMGIALGGLALGVLIGPPFGGVMYEFVGKSAPFLILAALALGDGLLQLFMLQ  110

Query  246  PSCTSTKDQKRSLNK  260
            PS    + +  SL  
Sbjct  111  PSIQKAETEPPSLKS  125


>M9PJI2_DROME unnamed protein product
Length=65

 Score = 28.1 bits (61),  Expect = 3.0, Method: Composition-based stats.
 Identities = 12/20 (60%), Positives = 14/20 (70%), Gaps = 1/20 (5%)

Query  99   WKSAAYCVLITVLLPLFGSW  118
            W SA   +LIT +LPL GSW
Sbjct  40   WSSAPQMILIT-MLPLLGSW  58



Lambda      K        H
   0.316    0.129    0.381 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4879639968


Query= XP_031327421.1 proton-coupled folate transporter-like [Photinus
pyralis]

Length=478
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q961H2_DROME  unnamed protein product                                 95.9    6e-21
Q8MT20_DROME  unnamed protein product                                 30.4    2.9  
M9PJI2_DROME  unnamed protein product                                 28.1    3.0  


>Q961H2_DROME unnamed protein product
Length=507

 Score = 95.9 bits (237),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 91/442 (21%), Positives = 190/442 (43%), Gaps = 39/442 (9%)

Query  32   VEPVLVLFMLSSSISALAIENLNLEKSCYVNLNLSTSICDAMQQRNRSGFSEMD-EITVQ  90
            +EP + L   + ++     +N  L ++C      + + C+ +   +R   ++ + E+ VQ
Sbjct  54   LEPAVFLIFFARNLIGAVYQNQILYQTCITIEKFNATQCEPLLGIDRGSDADKEVEVIVQ  113

Query  91   KVVAAAGIWKSAAYCVLITVLLPLF-----GSWSDRNKTVKILILLPILGEIVANIGLIL  145
               A   +  S     L+  ++P F     G WSD+     IL L    G +   + LI+
Sbjct  114  TYSANIMMTTS-----LLESIIPAFASLFLGPWSDKFGRRPIL-LTTFTGYLTGALILIV  167

Query  146  CTYFYYE-----WPMEVNSIFEILPTAITGGIPLALAGVFTYMSSNTTNENRTFRLGIIH  200
             TY         W   ++S+    P+ ++GG    + G++ Y+S       +  R+ +  
Sbjct  168  ITYITRSTNISPWWFLLSSV----PSVVSGGTCALITGIYCYISDVAKERKKALRMVLNE  223

Query  201  TLVVICKTIGGTLSGVLYQLVGLYGVFSVTLALYVLGAVYTQFMLPSCTSTKD-----QK  255
              +     +G   SG +Y       +FS+  +L +   +Y    +P   +  D     + 
Sbjct  224  ASLCAGIMVGNVASGYIYAATNALVLFSIAGSLMMFALMYVLLFVPESLNPGDIHTGSRV  283

Query  256  RSLNKCELIVDVVNVKKTVGSFSFIATEGSGIQRRQLYAILFLDFIIVGPFVGQASVMYL  315
            R   + +L+ D++                    R  ++  +    I +    G+++V Y+
Sbjct  284  REFFRFDLVTDLIRT---------CFKRRPNFDRTIIWLTMIALTIAIFDMEGESTVNYM  334

Query  316  YTRLRFNWDAMDYSVFGAYSAVCHLIGNVGSIVIFSKLLKADDSILGGVSSMSRILGGIG  375
            + + +FNW   D+S+F A   V  ++G++  +++  ++LK     +  +S    +L    
Sbjct  335  FVQDKFNWTIKDFSLFNASRIVIQIVGSIVGMLVLRRVLKMSIVTMAMLSLACCVLESTV  394

Query  376  YALSPTVIW--FYACTLLDVVNGTAFIVSRSMATKLVTESNMGKVNSLFGVIEALSALAC  433
             A +  V W   Y    L ++ G    + R++ + +   + +GK+ +L   +E++S L  
Sbjct  395  RATA--VYWQELYLGMTLGMMRGVMGPMCRAILSHVAPATEVGKIFALTTSMESVSPLGA  452

Query  434  TPAYSAFYRVTIEIFPGAFNIL  455
             P Y+  Y+ T+E +PGAFN +
Sbjct  453  APLYTTVYKATLENYPGAFNFI  474


>Q8MT20_DROME unnamed protein product
Length=281

 Score = 30.4 bits (67),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 33/75 (44%), Gaps = 1/75 (1%)

Query  187  TTNENRTFRLGIIHTLVVICKTIGGTLSGVLYQLVGLYGVFSVTLALYVLGAVYTQFML-  245
            T ++ R   +GI    + +   IG    GV+Y+ VG    F +  AL +   +   FML 
Sbjct  51   TDDKERGNAMGIALGGLALGVLIGPPFGGVMYEFVGKSAPFLILAALALGDGLLQLFMLQ  110

Query  246  PSCTSTKDQKRSLNK  260
            PS    + +  SL  
Sbjct  111  PSIQKAETEPPSLKS  125


>M9PJI2_DROME unnamed protein product
Length=65

 Score = 28.1 bits (61),  Expect = 3.0, Method: Composition-based stats.
 Identities = 12/20 (60%), Positives = 14/20 (70%), Gaps = 1/20 (5%)

Query  99   WKSAAYCVLITVLLPLFGSW  118
            W SA   +LIT +LPL GSW
Sbjct  40   WSSAPQMILIT-MLPLLGSW  58



Lambda      K        H
   0.316    0.129    0.381 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4879639968


Query= XP_031327422.1 pro-neuropeptide Y-like isoform X1 [Photinus pyralis]

Length=109
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ABCC9_DICDI  unnamed protein product                                  27.3    3.0  
H9G352_CAEEL  unnamed protein product                                 27.3    3.0  
H9G353_CAEEL  unnamed protein product                                 27.3    3.0  


>ABCC9_DICDI unnamed protein product
Length=1345

 Score = 27.3 bits (59),  Expect = 3.0, Method: Composition-based stats.
 Identities = 20/56 (36%), Positives = 26/56 (46%), Gaps = 0/56 (0%)

Query  9    KMKNRFEMFNWRIVSLILLIVIAIVTSQDLELLARPIRPEKFTSHGELQDYLQKLK  64
            K++  F   N      ILLIV+       +EL+    R EKF S  E+Q  LQ  K
Sbjct  389  KLETAFTAMNILDSIRILLIVMPYCYYSIMELIPSNKRIEKFLSTLEIQQNLQTTK  444


>H9G352_CAEEL unnamed protein product
Length=2193

 Score = 27.3 bits (59),  Expect = 3.0, Method: Composition-based stats.
 Identities = 23/75 (31%), Positives = 32/75 (43%), Gaps = 26/75 (35%)

Query  47   PEKF-----TSHGELQDYLQKLKAYHLQNGHS---------------RYGKR--FYAPAE  84
            PEKF     TS+G   +Y  K       NG+S               +Y  R  FYA  E
Sbjct  505  PEKFLGDKVTSYGGTLEYTFKFSG----NGNSDQSADVILRGNDIALQYKHREPFYADRE  560

Query  85   NKLQKQFLPENWQDI  99
            NK+Q + +  +WQ +
Sbjct  561  NKVQIKIIETSWQRV  575


>H9G353_CAEEL unnamed protein product
Length=2196

 Score = 27.3 bits (59),  Expect = 3.0, Method: Composition-based stats.
 Identities = 23/75 (31%), Positives = 32/75 (43%), Gaps = 26/75 (35%)

Query  47   PEKF-----TSHGELQDYLQKLKAYHLQNGHS---------------RYGKR--FYAPAE  84
            PEKF     TS+G   +Y  K       NG+S               +Y  R  FYA  E
Sbjct  794  PEKFLGDKVTSYGGTLEYTFKFSG----NGNSDQSADVILRGNDIALQYKHREPFYADRE  849

Query  85   NKLQKQFLPENWQDI  99
            NK+Q + +  +WQ +
Sbjct  850  NKVQIKIIETSWQRV  864



Lambda      K        H
   0.316    0.129    0.381 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4879639968


Query= XP_031327423.1 pro-neuropeptide Y-like isoform X2 [Photinus pyralis]

Length=108
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

H9G352_CAEEL  unnamed protein product                                 28.5    1.3  
H9G353_CAEEL  unnamed protein product                                 28.5    1.3  
H9G354_CAEEL  unnamed protein product                                 28.5    1.3  


>H9G352_CAEEL unnamed protein product
Length=2193

 Score = 28.5 bits (62),  Expect = 1.3, Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 28/53 (53%), Gaps = 5/53 (9%)

Query  49   KFTSHG---ELQDYLQKLKAYHLQNGHRYGKRFYAPAENKLQKQFLPENWQDI  98
            KF+ +G   +  D + +     LQ  HR  + FYA  ENK+Q + +  +WQ +
Sbjct  525  KFSGNGNSDQSADVILRGNDIALQYKHR--EPFYADRENKVQIKIIETSWQRV  575


>H9G353_CAEEL unnamed protein product
Length=2196

 Score = 28.5 bits (62),  Expect = 1.3, Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 28/53 (53%), Gaps = 5/53 (9%)

Query  49   KFTSHG---ELQDYLQKLKAYHLQNGHRYGKRFYAPAENKLQKQFLPENWQDI  98
            KF+ +G   +  D + +     LQ  HR  + FYA  ENK+Q + +  +WQ +
Sbjct  814  KFSGNGNSDQSADVILRGNDIALQYKHR--EPFYADRENKVQIKIIETSWQRV  864


>H9G354_CAEEL unnamed protein product
Length=2289

 Score = 28.5 bits (62),  Expect = 1.3, Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 28/53 (53%), Gaps = 5/53 (9%)

Query  49   KFTSHG---ELQDYLQKLKAYHLQNGHRYGKRFYAPAENKLQKQFLPENWQDI  98
            KF+ +G   +  D + +     LQ  HR  + FYA  ENK+Q + +  +WQ +
Sbjct  814  KFSGNGNSDQSADVILRGNDIALQYKHR--EPFYADRENKVQIKIIETSWQRV  864



Lambda      K        H
   0.316    0.129    0.381 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4879639968


Query= XP_031327424.1 proteasome activator complex subunit 4B-like
[Photinus pyralis]

Length=579
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SIBD_DICDI  unnamed protein product                                   29.6    8.7  


>SIBD_DICDI unnamed protein product
Length=1957

 Score = 29.6 bits (65),  Expect = 8.7, Method: Composition-based stats.
 Identities = 12/43 (28%), Positives = 26/43 (60%), Gaps = 1/43 (2%)

Query  382   NLISHFSNLAPLVNSSEANNYYDD-LTEEEHIICEASAGLEDF  423
             N++ + +N+AP+VN  +  + Y D L  + H++    A ++D+
Sbjct  1120  NIVGYRTNVAPVVNKIQDYSVYQDYLDSDAHVVTGTDADIDDY  1162



Lambda      K        H
   0.316    0.129    0.381 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4879639968


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jan 28, 2021  9:24 PM
  Number of letters in database: 17,197,330
  Number of sequences in database:  25,232



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= XP_031327425.1 probable splicing factor, arginine/serine-rich 7
[Photinus pyralis]

Length=562
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VL71_DROME  unnamed protein product                                 330     7e-107
O61646_DROME  unnamed protein product                                 330     9e-107
Q9VRM6_DROME  unnamed protein product                                 43.1    6e-04 


>Q9VL71_DROME unnamed protein product
Length=513

 Score = 330 bits (846),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 175/287 (61%), Positives = 218/287 (76%), Gaps = 5/287 (2%)

Query  1    MAIGGT-KVVQVTNIAPQATKDQMQTLFGYLGKIDDIRLYPTIRDVSCPVQSRICYIKFM  59
            MA G T +V+QVTNIAPQATKDQMQTLFG +GKI++IRLYPTIRDVSCPVQSRICY+K+ 
Sbjct  1    MAGGNTPRVIQVTNIAPQATKDQMQTLFGNIGKIEEIRLYPTIRDVSCPVQSRICYVKYT  60

Query  60   ESVTVGIAQHMTNTVFIDRALIVIPVQNGDIPDEYFALEMTRNGTIVPGLCAAEPNLPPH  119
            ++ +V +AQH+TNTVFIDRALIVIPV    IP+EY ALEM +NGTIVPGL   +  LPP 
Sbjct  61   DTTSVPVAQHLTNTVFIDRALIVIPVLA--IPEEYRALEMLKNGTIVPGLQKPDSKLPPE  118

Query  120  VVNTITNLGAGQVIITYDPKLEANGLPPYPPLPANYDSNKIEEIRRTVLMVNVDPSTPTE  179
            V+N I      QVI TYDPKL    LP YP LP+ YD+ KIEEIRRT+++ +V      +
Sbjct  119  VINRIEGQLPQQVIKTYDPKLVEFNLPEYPALPSFYDARKIEEIRRTIIVCDVKNEWRLD  178

Query  180  EYIDFFTSAGEVKYLRQCTRASDSNAHMLLEFNDQPSIIEVLKMNGKEFKGQTVRIVHAT  239
            + ++ F  AGEVKY R   +  D+  + ++EF +Q SII  L+M G+EFKG  + + H+T
Sbjct  179  DLMECFQRAGEVKYARWAEK--DNKTYCMIEFCEQTSIIHALRMQGQEFKGGHLSVYHST  236

Query  240  QAIVKPQAKSNEAAQREIEEAMSRVKEAQNLISATIDPVIGMLSKDK  286
             +I KP+AKSNEAAQ EIEEAM+ VKEAQ++ISA IDPVIGML+KDK
Sbjct  237  YSITKPEAKSNEAAQAEIEEAMTIVKEAQSMISAAIDPVIGMLAKDK  283


>O61646_DROME unnamed protein product
Length=513

 Score = 330 bits (845),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 175/287 (61%), Positives = 218/287 (76%), Gaps = 5/287 (2%)

Query  1    MAIGGT-KVVQVTNIAPQATKDQMQTLFGYLGKIDDIRLYPTIRDVSCPVQSRICYIKFM  59
            MA G T +V+QVTNIAPQATKDQMQTLFG +GKI++IRLYPTIRDVSCPVQSRICY+K+ 
Sbjct  1    MAGGNTPRVIQVTNIAPQATKDQMQTLFGNIGKIEEIRLYPTIRDVSCPVQSRICYVKYT  60

Query  60   ESVTVGIAQHMTNTVFIDRALIVIPVQNGDIPDEYFALEMTRNGTIVPGLCAAEPNLPPH  119
            ++ +V +AQH+TNTVFIDRALIVIPV    IP+EY ALEM +NGTIVPGL   +  LPP 
Sbjct  61   DTTSVPVAQHLTNTVFIDRALIVIPVLA--IPEEYRALEMLKNGTIVPGLQKPDSKLPPE  118

Query  120  VVNTITNLGAGQVIITYDPKLEANGLPPYPPLPANYDSNKIEEIRRTVLMVNVDPSTPTE  179
            V+N I      QVI TYDPKL    LP YP LP+ YD+ KIEEIRRT+++ +V      +
Sbjct  119  VINRIEGQLPQQVIKTYDPKLVEFNLPEYPALPSFYDARKIEEIRRTIIVCDVKNEWRLD  178

Query  180  EYIDFFTSAGEVKYLRQCTRASDSNAHMLLEFNDQPSIIEVLKMNGKEFKGQTVRIVHAT  239
            + ++ F  AGEVKY R   +  D+  + ++EF +Q SII  L+M G+EFKG  + + H+T
Sbjct  179  DLMECFQRAGEVKYARWAEK--DNKTYCMIEFCEQTSIIHALRMQGQEFKGGHLSVYHST  236

Query  240  QAIVKPQAKSNEAAQREIEEAMSRVKEAQNLISATIDPVIGMLSKDK  286
             +I KP+AKSNEAAQ EIEEAM+ VKEAQ++ISA IDPVIGML+KDK
Sbjct  237  YSITKPEAKSNEAAQAEIEEAMTIVKEAQSMISAAIDPVIGMLAKDK  283


>Q9VRM6_DROME unnamed protein product
Length=1929

 Score = 43.1 bits (100),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 60/216 (28%), Positives = 106/216 (49%), Gaps = 30/216 (14%)

Query  287  RSSRRSRSRSRGRRRRSRTRSRSRRSRSRQRSRRSRSHSRRSKSKDR-----KHRSKSKS  341
            ++S RS  R++ R    RTR RS+ S  +           R K ++R     K R +S+ 
Sbjct  304  KTSNRSHDRTQNR---GRTRERSKESHGKSTENSKNKDEGRGKGRERDLFRRKSRERSQD  360

Query  342  RRRSRSRSRR---------SQSRNSKSRKSRSKSRSRTSRGERNRHKSKERGKSRDKSKE  392
            +  +R++S            + RN+ S KS+ + +SR    +R+R + + R K+R+KS+ 
Sbjct  361  KNLNRAKSMNLSKEKDEVGGEPRNTASGKSQERDQSRGKTKDRSRERDRTRNKTREKSQA  420

Query  393  KEKRSQLSRDRDRSRERDRKSRDRDNELKEKRSEKDGPVEMEEKRS-----------SKK  441
            +++    + D + +R + RK     ++ +EK  EK G  E  E  S           S+K
Sbjct  421  RDQTRSKANDAEHTRAKSRKRSSSRDKRREKSKEKLGDKEKNEDLSKEKLEGKSTEHSEK  480

Query  442  RSLSPVRGK-FRSHSRDRKIRSRSRDRRSRSRGRRH  476
            R+ S V+ K     + ++K+R RS+D R+ S+ R H
Sbjct  481  RNESKVKNKDTNEENANKKLRERSKD-RNHSKERLH  515


 Score = 38.5 bits (88),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 51/183 (28%), Positives = 100/183 (55%), Gaps = 13/183 (7%)

Query  291  RSRSRSRGRRRRSRTRSRSR-RSRSRQRSRRSRSHSRRSKSKDRKHRSKSKSRRRSRSRS  349
            +++ RS   R R RTR+++R +S++R ++R   + +  +++K RK RS S+ +RR +S+ 
Sbjct  399  KTKDRS---RERDRTRNKTREKSQARDQTRSKANDAEHTRAKSRK-RSSSRDKRREKSKE  454

Query  350  RRSQSRNSKSRKSRSKSRSRTSRGERNRHKSKERGKSRDKSKEKEKRSQLSRDRDRSRER  409
            +      ++   S+ K   +++     R++SK + K  ++    +K  + S+DR+ S+ER
Sbjct  455  KLGDKEKNEDL-SKEKLEGKSTEHSEKRNESKVKNKDTNEENANKKLRERSKDRNHSKER  513

Query  410  -----DRKSRDRDNELKEKRSEKDGPVEMEEKRSSKKRSLSPVRGKFRSHSRDRKIRSRS  464
                   KS +R  E K+ R+  +   E    R  K + L P+  K    S+D++I+ RS
Sbjct  514  LHERTQNKSEERKPEAKKVRNAIENSKEAPTDR-KKDKLLGPLGEKTDERSKDKQIK-RS  571

Query  465  RDR  467
            R++
Sbjct  572  REQ  574


 Score = 35.8 bits (81),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 65/215 (30%), Positives = 105/215 (49%), Gaps = 27/215 (13%)

Query  309  SRRSRSRQRSRRSRSHSRRSKSKDRKHRSKSKSRRR--SRSRSRR-SQSRNSKSRKSRSK  365
            S  S ++  + R+++ +    SK+ K  S++KS       +RSR   Q +N    K+ ++
Sbjct  249  SECSNTKHENCRTKAETTDHNSKESKLPSETKSTEPLIENNRSRELPQHKNYVRGKTSNR  308

Query  366  SRSRTSRGERNRHKSKE-RGKSRDKSKEKEKRSQLSRDRD----RSRERDRK---SRDRD  417
            S  RT    R R +SKE  GKS + SK K++     R+RD    +SRER +    +R + 
Sbjct  309  SHDRTQNRGRTRERSKESHGKSTENSKNKDEGRGKGRERDLFRRKSRERSQDKNLNRAKS  368

Query  418  NELKEKRSEKDGPVEMEEKRSSKKRSLSPVRGKFRSHSRDR-----KIRSRSRDR---RS  469
              L +++ E  G  E     S K +     RGK +  SR+R     K R +S+ R   RS
Sbjct  369  MNLSKEKDEVGG--EPRNTASGKSQERDQSRGKTKDRSRERDRTRNKTREKSQARDQTRS  426

Query  470  RSRGRRHSPSPRPLRRRSRTKSRDRDQKRDKRDRK  504
            ++    H+      R +SR +S  RD++R+K   K
Sbjct  427  KANDAEHT------RAKSRKRSSSRDKRREKSKEK  455



Lambda      K        H
   0.313    0.128    0.351 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6570412396


Query= XP_031327426.1 uncharacterized protein LOC116158734 [Photinus
pyralis]

Length=283
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q580G3_TRYB2  unnamed protein product                                 31.6    0.89 
Q8IDJ8_PLAF7  unnamed protein product                                 30.8    1.2  
CDGAP_DROME  unnamed protein product                                  30.4    2.3  


>Q580G3_TRYB2 unnamed protein product
Length=584

 Score = 31.6 bits (70),  Expect = 0.89, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 28/52 (54%), Gaps = 9/52 (17%)

Query  155  PELYSFIKSL---GIQKQYEVDNIIRNHGHDVLRLPPYHCEFNAIELVWAHA  203
            PELY  +K L   G+ + YE+    RN G D+   P    EF ++E  WA+A
Sbjct  286  PELY--LKKLVVGGLDRVYEIGKQFRNEGIDLTHNP----EFTSVESYWAYA  331


>Q8IDJ8_PLAF7 unnamed protein product
Length=583

 Score = 30.8 bits (68),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 20/39 (51%), Gaps = 4/39 (10%)

Query  165  GIQKQYEVDNIIRNHGHDVLRLPPYHCEFNAIELVWAHA  203
            GI K YE+  + RN G D    P    EF + E  WA+A
Sbjct  318  GIDKVYEIGKVFRNEGIDNTHNP----EFTSCEFYWAYA  352


>CDGAP_DROME unnamed protein product
Length=1843

 Score = 30.4 bits (67),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 38/71 (54%), Gaps = 5/71 (7%)

Query  156  ELY-SFIKSLGIQKQYEVDNIIRNHGHDVLRLPPYHCEFNAIELVWAHAKSYYDKHIGRD  214
            +LY +F++++ + K  E D  +R     VL+LPP H  +  ++ +  H      +H GR 
Sbjct  513  QLYDNFVEAIQV-KADEADERLRLMKETVLKLPPPH--YRTLKYLAEHLYK-VSQHHGRT  568

Query  215  GYSDHSVISMW  225
            G +D ++  +W
Sbjct  569  GMTDKNLAIVW  579



Lambda      K        H
   0.313    0.128    0.351 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6570412396


Query= XP_031327427.1 cuticle protein 1 [Photinus pyralis]

Length=162


***** No hits found *****



Lambda      K        H
   0.313    0.128    0.351 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6570412396


Query= XP_031327428.1 uncharacterized protein LOC116158732 [Photinus
pyralis]

Length=505
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q38AZ9_TRYB2  unnamed protein product                                 33.1    0.22 
Q9GRG8_9TRYP  unnamed protein product                                 33.1    0.22 
Q383X8_TRYB2  unnamed protein product                                 33.1    0.53 


>Q38AZ9_TRYB2 unnamed protein product
Length=140

 Score = 33.1 bits (74),  Expect = 0.22, Method: Composition-based stats.
 Identities = 17/48 (35%), Positives = 21/48 (44%), Gaps = 11/48 (23%)

Query  233  MEGG--CWNCGGPRHPRNSCP--------AKDYTC-KCGKVGHFKKMC  269
            M GG  C+NCG P H    CP            +C  CG+ GH  + C
Sbjct  35   MGGGRSCYNCGQPDHISRDCPNARTGGNMGGGRSCYNCGRPGHISRDC  82


 Score = 29.6 bits (65),  Expect = 3.3, Method: Composition-based stats.
 Identities = 12/25 (48%), Positives = 14/25 (56%), Gaps = 2/25 (8%)

Query  231  DIMEGG--CWNCGGPRHPRNSCPAK  253
            D   GG  C+NCG P H   +CP K
Sbjct  116  DAAAGGRACFNCGQPGHLSRACPVK  140


 Score = 28.5 bits (62),  Expect = 7.0, Method: Composition-based stats.
 Identities = 13/42 (31%), Positives = 17/42 (40%), Gaps = 9/42 (21%)

Query  237  CWNCGGPRHPRNSCP--------AKDYTC-KCGKVGHFKKMC  269
            C+NCG P H    CP            +C  CG+  H  + C
Sbjct  13   CYNCGQPGHMSRECPNARSGGNMGGGRSCYNCGQPDHISRDC  54


 Score = 28.5 bits (62),  Expect = 8.1, Method: Composition-based stats.
 Identities = 16/48 (33%), Positives = 19/48 (40%), Gaps = 11/48 (23%)

Query  233  MEGG--CWNCGGPRHPRNSCP--------AKDYTC-KCGKVGHFKKMC  269
            M GG  C+NCG P H    CP             C  C + GH  + C
Sbjct  63   MGGGRSCYNCGRPGHISRDCPNARSGGNMGGGRACYHCQQEGHIAREC  110


>Q9GRG8_9TRYP unnamed protein product
Length=140

 Score = 33.1 bits (74),  Expect = 0.22, Method: Composition-based stats.
 Identities = 17/48 (35%), Positives = 21/48 (44%), Gaps = 11/48 (23%)

Query  233  MEGG--CWNCGGPRHPRNSCP--------AKDYTC-KCGKVGHFKKMC  269
            M GG  C+NCG P H    CP            +C  CG+ GH  + C
Sbjct  35   MGGGRSCYNCGQPDHISRDCPNARTGGNMGGGRSCYNCGRPGHISRDC  82


 Score = 29.6 bits (65),  Expect = 3.3, Method: Composition-based stats.
 Identities = 12/25 (48%), Positives = 14/25 (56%), Gaps = 2/25 (8%)

Query  231  DIMEGG--CWNCGGPRHPRNSCPAK  253
            D   GG  C+NCG P H   +CP K
Sbjct  116  DAAAGGRACFNCGQPGHLSRACPVK  140


 Score = 28.5 bits (62),  Expect = 8.1, Method: Composition-based stats.
 Identities = 16/48 (33%), Positives = 19/48 (40%), Gaps = 11/48 (23%)

Query  233  MEGG--CWNCGGPRHPRNSCP--------AKDYTC-KCGKVGHFKKMC  269
            M GG  C+NCG P H    CP             C  C + GH  + C
Sbjct  63   MGGGRSCYNCGRPGHISRDCPNARSGGNMGGGRACYHCQQEGHIAREC  110


>Q383X8_TRYB2 unnamed protein product
Length=516

 Score = 33.1 bits (74),  Expect = 0.53, Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 28/60 (47%), Gaps = 3/60 (5%)

Query  213  DRIHSSSSSKFPLKESTTDIMEGGCWNCGGPRHPRNSCP--AKDYTC-KCGKVGHFKKMC  269
            D++   S+ K P  E   + +   C +CG  RH   SCP   K   C +C + GH   MC
Sbjct  40   DKVACLSARKRPRTEEEEEALPSVCRSCGSSRHAEASCPLRMKSMECFQCHQKGHLLPMC  99



Lambda      K        H
   0.313    0.128    0.351 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6570412396


Query= XP_031327429.1 uncharacterized protein LOC116158737 [Photinus
pyralis]

Length=319
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9PC48_DROME  unnamed protein product                                 41.6    0.001
M9PCJ6_DROME  unnamed protein product                                 41.6    0.001
M9PEH5_DROME  unnamed protein product                                 40.4    0.002


>M9PC48_DROME unnamed protein product
Length=18095

 Score = 41.6 bits (96),  Expect = 0.001, Method: Composition-based stats.
 Identities = 39/140 (28%), Positives = 49/140 (35%), Gaps = 34/140 (24%)

Query  204    IDAFDEPRTPYPGHNNPAYGWENEQPKFDARPSSGNH------------------DYPGG  245
              I ++  P  P P   +P Y    EQPK   RPS  N                   +YP  
Sbjct  14219  IPSYPTPVAPTP--QSPIYIPSQEQPKPTTRPSVINVPSVPQPAYPTPQAPVYDVNYPTS  14276

Query  246    NNSRPQADRVAGLG---------KQGPKSYPQNI--LPAEQPNNYRYPTPHIP-QPDYYP  293
               +  P    V  +          KQ P   P  +   PA QP     P+   P  P Y P
Sbjct  14277  PSVIPHQPGVVNIPSVPLPAPPVKQRPVFVPSPVHPTPAPQPGVVNIPSVAQPVHPTYQP  14336

Query  294    PQQSNPAMKR--FPPPPPNP  311
              P    PA+    +PPPP  P
Sbjct  14337  PVVERPAIYDVYYPPPPSRP  14356


 Score = 37.7 bits (86),  Expect = 0.014, Method: Composition-based stats.
 Identities = 34/127 (27%), Positives = 41/127 (32%), Gaps = 22/127 (17%)

Query  207    FDEPRTPYPGHNNPAYGWENEQPKFDARPSSGNHDYP-------GGNNSRPQADRVAGLG  259
              +D P  PYP         + +QP     PS+    YP         N   PQ       G
Sbjct  13913  YDTPSPPYPVAIPDLVYVQQQQPGIVNIPSAPQPIYPTPQSPQYNVNYPSPQPANPQKPG  13972

Query  260    KQGPKSYPQNILPAEQPNNY--RYPTPHIPQ----------PDYYPPQQSNPAMKRFP--  305
                   S PQ + P+ QP  Y   YPT  + Q          P   PP    P     P  
Sbjct  13973  VVNIPSVPQPVYPSPQPPVYDVNYPTTPVSQHPGVVNIPSAPRLVPPTSQRPVFITSPGN  14032

Query  306    -PPPPNP  311
                P P P
Sbjct  14033  LSPTPQP  14039


>M9PCJ6_DROME unnamed protein product
Length=18641

 Score = 41.6 bits (96),  Expect = 0.001, Method: Composition-based stats.
 Identities = 39/140 (28%), Positives = 49/140 (35%), Gaps = 34/140 (24%)

Query  204    IDAFDEPRTPYPGHNNPAYGWENEQPKFDARPSSGNH------------------DYPGG  245
              I ++  P  P P   +P Y    EQPK   RPS  N                   +YP  
Sbjct  14765  IPSYPTPVAPTP--QSPIYIPSQEQPKPTTRPSVINVPSVPQPAYPTPQAPVYDVNYPTS  14822

Query  246    NNSRPQADRVAGLG---------KQGPKSYPQNI--LPAEQPNNYRYPTPHIP-QPDYYP  293
               +  P    V  +          KQ P   P  +   PA QP     P+   P  P Y P
Sbjct  14823  PSVIPHQPGVVNIPSVPLPAPPVKQRPVFVPSPVHPTPAPQPGVVNIPSVAQPVHPTYQP  14882

Query  294    PQQSNPAMKR--FPPPPPNP  311
              P    PA+    +PPPP  P
Sbjct  14883  PVVERPAIYDVYYPPPPSRP  14902


 Score = 37.7 bits (86),  Expect = 0.014, Method: Composition-based stats.
 Identities = 34/132 (26%), Positives = 44/132 (33%), Gaps = 32/132 (24%)

Query  207    FDEPRTPYPGHNNPAYGWENEQPKFDARPSSG------------NHDYPGGNNSRPQADR  254
              +D P  PYP         + +QP     PS+             N +YP    + PQ   
Sbjct  14459  YDTPSPPYPVAIPDLVYVQQQQPGIVNIPSAPQPIYPTPQSPQYNVNYPSPQPANPQKPG  14518

Query  255    VAGLGKQGPKSYPQNILPAEQPNNY--RYPTPHIPQ----------PDYYPPQQSNPAMK  302
              V  +      S PQ + P+ QP  Y   YPT  + Q          P   PP    P   
Sbjct  14519  VVNI-----PSVPQPVYPSPQPPVYDVNYPTTPVSQHPGVVNIPSAPRLVPPTSQRPVFI  14573

Query  303    RFP---PPPPNP  311
                P    P P P
Sbjct  14574  TSPGNLSPTPQP  14585


>M9PEH5_DROME unnamed protein product
Length=20710

 Score = 40.4 bits (93),  Expect = 0.002, Method: Composition-based stats.
 Identities = 39/140 (28%), Positives = 49/140 (35%), Gaps = 34/140 (24%)

Query  204    IDAFDEPRTPYPGHNNPAYGWENEQPKFDARPSSGNH------------------DYPGG  245
              I ++  P  P P   +P Y    EQPK   RPS  N                   +YP  
Sbjct  16834  IPSYPTPVAPTP--QSPIYIPSQEQPKPTTRPSVINVPSVPQPAYPTPQAPVYDVNYPTS  16891

Query  246    NNSRPQADRVAGLG---------KQGPKSYPQNI--LPAEQPNNYRYPTPHIP-QPDYYP  293
               +  P    V  +          KQ P   P  +   PA QP     P+   P  P Y P
Sbjct  16892  PSVIPHQPGVVNIPSVPLPAPPVKQRPVFVPSPVHPTPAPQPGVVNIPSVAQPVHPTYQP  16951

Query  294    PQQSNPAMKR--FPPPPPNP  311
              P    PA+    +PPPP  P
Sbjct  16952  PVVERPAIYDVYYPPPPSRP  16971


 Score = 37.0 bits (84),  Expect = 0.023, Method: Composition-based stats.
 Identities = 34/127 (27%), Positives = 41/127 (32%), Gaps = 22/127 (17%)

Query  207    FDEPRTPYPGHNNPAYGWENEQPKFDARPSSGNHDYP-------GGNNSRPQADRVAGLG  259
              +D P  PYP         + +QP     PS+    YP         N   PQ       G
Sbjct  16528  YDTPSPPYPVAIPDLVYVQQQQPGIVNIPSAPQPIYPTPQSPQYNVNYPSPQPANPQKPG  16587

Query  260    KQGPKSYPQNILPAEQPNNY--RYPTPHIPQ----------PDYYPPQQSNPAMKRFP--  305
                   S PQ + P+ QP  Y   YPT  + Q          P   PP    P     P  
Sbjct  16588  VVNIPSVPQPVYPSPQPPVYDVNYPTTPVSQHPGVVNIPSAPRLVPPTSQRPVFITSPGN  16647

Query  306    -PPPPNP  311
                P P P
Sbjct  16648  LSPTPQP  16654



Lambda      K        H
   0.313    0.128    0.351 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6570412396


Query= XP_031327430.1 BRCA1-associated RING domain protein 1-like [Photinus
pyralis]

Length=452
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TNKS_DROME  unnamed protein product                                   73.6    1e-13
BARD1_CAEEL  unnamed protein product                                  73.2    2e-13
Q7KU95_DROME  unnamed protein product                                 70.1    2e-12


>TNKS_DROME unnamed protein product
Length=1181

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 76/274 (28%), Positives = 118/274 (43%), Gaps = 15/274 (5%)

Query  113  TQLHKYCRAGNIASVSTLVESGMDVNVQDFASWTPLHEAVLNQRVGIVKLLLANGALVNV  172
            T LH       +  V  L+E G +V   D     PLH A       + +LL+ +GA VNV
Sbjct  522  TPLHFAAGFNRVPVVQFLLEHGAEVYAADKGGLVPLHNACSYGHYEVTELLVKHGANVNV  581

Query  173  PGLDYLTPLHSAVLEKNDEIAKLLIQHGARCTAYNKDGKTPLDLC-DSD-DMRDAICMTN  230
              L   TPLH A  +   +I KLL++HGA     N+DG TP DL  +SD D+ + +   +
Sbjct  582  SDLWKFTPLHEAAAKGKYDICKLLLKHGADPMKKNRDGATPADLVKESDHDVAELLRGPS  641

Query  231  MLPSIVRTYVIPELRIFLNNVSKDISDRIGQLPGVTLMQKAHLLNFSNVKYF------VI  284
             L    +   +  ++  +   S +  D  G+     L   A   NF   +Y       V 
Sbjct  642  ALLDAAKKGNLARVQRLVTPESINCRDAQGR-NSTPLHLAAGYNNFECAEYLLENGADVN  700

Query  285  GNDKPNLMYLQAAMLQGAIICSMDFVGDLISKHSALNPMNYFADVPNYAISKAGLNSLNK  344
              DK  L+ L  A   G     +D    LI   + +N  + +   P +  ++ G   L  
Sbjct  701  AQDKGGLIPLHNASSYG----HLDIAALLIKHKTVVNATDKWGFTPLHEAAQKGRTQLCS  756

Query  345  LPKLFDGIHFYLVNISKKTVNDMEYTSEDIKTLI  378
            L  L  G   Y+ N   +T  ++  T++D+K L+
Sbjct  757  L-LLAHGADAYMKNQEGQTPIELA-TADDVKCLL  788


 Score = 72.4 bits (176),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 47/163 (29%), Positives = 79/163 (48%), Gaps = 5/163 (3%)

Query  63   IKNSE-DINTILSHVNSLYQFINSIQNGGTTKISYLFISDSYNYK-RHHNGETQLHKYCR  120
            +K S+ D+  +L   ++L   +++ + G   ++  L   +S N +       T LH    
Sbjct  626  VKESDHDVAELLRGPSAL---LDAAKKGNLARVQRLVTPESINCRDAQGRNSTPLHLAAG  682

Query  121  AGNIASVSTLVESGMDVNVQDFASWTPLHEAVLNQRVGIVKLLLANGALVNVPGLDYLTP  180
              N      L+E+G DVN QD     PLH A     + I  LL+ +  +VN       TP
Sbjct  683  YNNFECAEYLLENGADVNAQDKGGLIPLHNASSYGHLDIAALLIKHKTVVNATDKWGFTP  742

Query  181  LHSAVLEKNDEIAKLLIQHGARCTAYNKDGKTPLDLCDSDDMR  223
            LH A  +   ++  LL+ HGA     N++G+TP++L  +DD++
Sbjct  743  LHEAAQKGRTQLCSLLLAHGADAYMKNQEGQTPIELATADDVK  785


 Score = 59.7 bits (143),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 53/116 (46%), Gaps = 0/116 (0%)

Query  113  TQLHKYCRAGNIASVSTLVESGMDVNVQDFASWTPLHEAVLNQRVGIVKLLLANGALVNV  172
            T LH       I  V  L+ +G DV+ +D     PLH A       + KLL+  GA VN 
Sbjct  212  TPLHLAAGYNRIGIVEILLANGADVHAKDKGGLVPLHNACSYGHFDVTKLLIQAGANVNA  271

Query  173  PGLDYLTPLHSAVLEKNDEIAKLLIQHGARCTAYNKDGKTPLDLCDSDDMRDAICM  228
              L   TPLH A  +   E+  LL+  GA  T  N   K+ +D   + ++R+ I  
Sbjct  272  NDLWAFTPLHEAASKSRVEVCSLLLSRGADPTLLNCHSKSAIDAAPTRELRERIAF  327


 Score = 57.0 bits (136),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 60/144 (42%), Gaps = 1/144 (1%)

Query  77   NSLYQFINSIQNGGTTKISYLFISDSYNYKRHHNGE-TQLHKYCRAGNIASVSTLVESGM  135
            + L +   + + G   K+  L    + N +     + T LH     G    V  L+ SG 
Sbjct  22   DPLRELFEACKTGEIAKVKKLITPQTVNARDTAGRKSTPLHFAAGYGRREVVEFLLNSGA  81

Query  136  DVNVQDFASWTPLHEAVLNQRVGIVKLLLANGALVNVPGLDYLTPLHSAVLEKNDEIAKL  195
             +   D     PLH         +V+LLL  GA  N       TPLH A  +   ++   
Sbjct  82   SIQACDEGGLHPLHNCCSFGHAEVVRLLLKAGASPNTTDNWNYTPLHEAASKGKVDVCLA  141

Query  196  LIQHGARCTAYNKDGKTPLDLCDS  219
            L+QHGA  T  N + KTPL+L D 
Sbjct  142  LLQHGANHTIRNSEQKTPLELADE  165


 Score = 52.4 bits (124),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 45/80 (56%), Gaps = 0/80 (0%)

Query  135  MDVNVQDFASWTPLHEAVLNQRVGIVKLLLANGALVNVPGLDYLTPLHSAVLEKNDEIAK  194
            ++ +  D    TPLH A    R+GIV++LLANGA V+      L PLH+A    + ++ K
Sbjct  201  VNCHASDGRRSTPLHLAAGYNRIGIVEILLANGADVHAKDKGGLVPLHNACSYGHFDVTK  260

Query  195  LLIQHGARCTAYNKDGKTPL  214
            LLIQ GA   A +    TPL
Sbjct  261  LLIQAGANVNANDLWAFTPL  280


 Score = 52.4 bits (124),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 64/123 (52%), Gaps = 8/123 (7%)

Query  102  SYNYKRHHNGETQLHKYCRAGNIASVSTLVESGMDVNVQDFASWTPLHEAVLN---QRVG  158
            ++ YK H      L   CR  +++    LV + +   V  +   TPLH AV++   +R  
Sbjct  326  AFEYKGH-----CLLDACRKCDVSRAKKLVCAEIVNFVHPYTGDTPLHLAVVSPDGKRKQ  380

Query  159  IVKLLLANGALVNVPGLDYLTPLHSAVLEKNDEIAKLLIQHGARCTAYNKDGKTPLDLCD  218
            +++LL   G+L+N     +LTPLH A    + +  ++L++ GA+  A +  G+TPL  C 
Sbjct  381  LMELLTRKGSLLNEKNKAFLTPLHLAAELLHYDAMEVLLKQGAKVNALDSLGQTPLHRCA  440

Query  219  SDD  221
             D+
Sbjct  441  RDE  443


 Score = 48.9 bits (115),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 38/75 (51%), Gaps = 0/75 (0%)

Query  94   ISYLFISDSYNYKRHHNGETQLHKYCRAGNIASVSTLVESGMDVNVQDFASWTPLHEAVL  153
            +  L  + +  + +   G   LH  C  G+      L+++G +VN  D  ++TPLHEA  
Sbjct  226  VEILLANGADVHAKDKGGLVPLHNACSYGHFDVTKLLIQAGANVNANDLWAFTPLHEAAS  285

Query  154  NQRVGIVKLLLANGA  168
              RV +  LLL+ GA
Sbjct  286  KSRVEVCSLLLSRGA  300


 Score = 32.7 bits (73),  Expect = 0.70, Method: Compositional matrix adjust.
 Identities = 26/84 (31%), Positives = 40/84 (48%), Gaps = 6/84 (7%)

Query  113  TQLHKYCRAGNIASVSTLVESGMDVNVQDFASWTPLHEAVLNQRVGIVKLLLANGALVNV  172
            T LH      +  ++  L++ G  VN  D    TPLH    +++   V+LLL+  A  N+
Sbjct  401  TPLHLAAELLHYDAMEVLLKQGAKVNALDSLGQTPLHRCARDEQA--VRLLLSYAADTNI  458

Query  173  PGLDYLTPLHSAVLEKNDEIAKLL  196
              L+ LT    A    +D + KLL
Sbjct  459  VSLEGLTAAQLA----SDSVLKLL  478


>BARD1_CAEEL unnamed protein product
Length=702

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 90/368 (24%), Positives = 158/368 (43%), Gaps = 41/368 (11%)

Query  102  SYNYKRHHNGETQLHKYCRAGNIASVSTLVESGMDVNVQDFASWTPLHEAVLNQRVGIVK  161
            SY  +R   GE  L    R   I  + + VE+G  VN ++    TPL+ AV N  +  VK
Sbjct  342  SYGTRR---GEAVLVNSIRNNRIPQLRSAVEAGTCVNEKEDGK-TPLYVAVENSSLEAVK  397

Query  162  LLLANGALVNVP-GLDYLTPLHSAVLEKNDEIAKLLIQHGARCTAYNKDGKTPLDLCDSD  220
            +L+  GA++N   G    T LH AV  +N +I + L+  GA     N  GKT  ++  SD
Sbjct  398  ILVEAGAVINASCGSTLETTLHEAVRRQNTQIVEYLLSKGASIKIRNIAGKTVEEMAKSD  457

Query  221  -DMRDAICMTNMLPSIVRTYVIP-----------ELRIFLNNVSKDISDRIGQLPGVTLM  268
              +R  I        +++  V P           + ++   +  + +  +I  +P   + 
Sbjct  458  PKIRKIIEKFKTEQRVLQPVVAPPKSRLHFVQLIDEKMLTESEKRKLPGKINIVPA-DMD  516

Query  269  QKAHLLNFSNVKYFVIGNDKPNLMYLQAAMLQGAIICSMDFVGDLISKHSAL-NPMNYFA  327
               H++   ++K  V+  +K ++  +  A+++  +I S D++   I   S + +  +Y  
Sbjct  517  SPTHVVVTVDLKTRVLNINKEHIGEILKAIIKSGMIVSRDWLRACIIDPSKVDDDRSYMV  576

Query  328  DVPNYAISKAGLNSLNKL--------PKLFDGIHFYLVNISKKTVNDMEYTSEDIKTLIY  379
                +   +   N++ +         PKLF G  F+   I K   N ++  +  +  +I 
Sbjct  577  QKVRWMEGEVFENTIEQWKKTITKMQPKLFAGCKFF---IPKPKYNFLDRPA--LFEIIR  631

Query  380  LGGGKIDTRAPSGSNYTVSYPYHTCKTESNATVSCYLIYDEAKNLKRKTFPDQIKYQTV-  438
              GG+   R P         PYH    + N     +++Y    ++  K F D  KY  V 
Sbjct  632  SAGGQAAAREPIIDEKDPP-PYHNANLKPN-----FVLYSLTHDIGDK-FRDCTKYNLVS  684

Query  439  -QWLINSI  445
             QWLI +I
Sbjct  685  EQWLIEAI  692


>Q7KU95_DROME unnamed protein product
Length=2404

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 44/106 (42%), Positives = 55/106 (52%), Gaps = 0/106 (0%)

Query  111  GETQLHKYCRAGNIASVSTLVESGMDVNVQDFASWTPLHEAVLNQRVGIVKLLLANGALV  170
            GET LH   RA     +  L+ +G  V+ +     TPLH A     V IV LLL +GA V
Sbjct  436  GETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQV  495

Query  171  NVPGLDYLTPLHSAVLEKNDEIAKLLIQHGARCTAYNKDGKTPLDL  216
            +    D  T LH A  E  DE+A +LI++GA   A  K G TPL L
Sbjct  496  DATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHL  541


 Score = 66.6 bits (161),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 41/112 (37%), Positives = 52/112 (46%), Gaps = 0/112 (0%)

Query  110  NGETQLHKYCRAGNIASVSTLVESGMDVNVQDFASWTPLHEAVLNQRVGIVKLLLANGAL  169
            NG T LH  C   N      L+E G   +       TPLH A    ++ I   LL  GAL
Sbjct  567  NGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGAL  626

Query  170  VNVPGLDYLTPLHSAVLEKNDEIAKLLIQHGARCTAYNKDGKTPLDLCDSDD  221
             N       TPLH +  E + EI+ LLI+H A      K+G TP+ LC  +D
Sbjct  627  ANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQED  678


 Score = 64.7 bits (156),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 38/105 (36%), Positives = 53/105 (50%), Gaps = 0/105 (0%)

Query  110  NGETQLHKYCRAGNIASVSTLVESGMDVNVQDFASWTPLHEAVLNQRVGIVKLLLANGAL  169
            NG T LH   R   +   +TL+E G   N +  A +TPLH +       I  LL+ + A 
Sbjct  600  NGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAA  659

Query  170  VNVPGLDYLTPLHSAVLEKNDEIAKLLIQHGARCTAYNKDGKTPL  214
            VN P  + LTP+H    E N  +A++L ++GA      K G TPL
Sbjct  660  VNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPL  704


 Score = 63.2 bits (152),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 40/105 (38%), Positives = 56/105 (53%), Gaps = 0/105 (0%)

Query  110  NGETQLHKYCRAGNIASVSTLVESGMDVNVQDFASWTPLHEAVLNQRVGIVKLLLANGAL  169
            NG   LH   + G+I  VS L+  G  V+       T LH A L  +  +VKLLL + A 
Sbjct  43   NGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNAS  102

Query  170  VNVPGLDYLTPLHSAVLEKNDEIAKLLIQHGARCTAYNKDGKTPL  214
            VNV   +  TPL+ A  E +D + +LL+ +GA  +   +DG TPL
Sbjct  103  VNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPL  147


 Score = 62.8 bits (151),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 37/116 (32%), Positives = 57/116 (49%), Gaps = 0/116 (0%)

Query  110  NGETQLHKYCRAGNIASVSTLVESGMDVNVQDFASWTPLHEAVLNQRVGIVKLLLANGAL  169
            +G T LH     GN    + L++ G DVN     + +PLH A    +  +V LLL  G  
Sbjct  204  SGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGN  263

Query  170  VNVPGLDYLTPLHSAVLEKNDEIAKLLIQHGARCTAYNKDGKTPLDLCDSDDMRDA  225
            +     D LTPLH A    ++++  +L++ GA  +A  K+G  PL +    +  DA
Sbjct  264  IEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDA  319


 Score = 62.4 bits (150),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 56/186 (30%), Positives = 83/186 (45%), Gaps = 19/186 (10%)

Query  61   KNIKNSEDINTILSHVNSLYQFINSIQNGGTTKISYLF----ISDSYNYKRHHNGETQLH  116
            +++KN+ DINT  S+ N L     + ++G    +S L     I DS   K    G T LH
Sbjct  29   EHLKNNIDINT--SNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKK----GNTALH  82

Query  117  KYCRAGNIASVSTLVESGMDVNVQDFASWTPLHEAVLNQRVGIVKLLLANGALVNVPGLD  176
                AG    V  L+E    VNVQ    +TPL+ A       +V+LLL+NGA  ++   D
Sbjct  83   IASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATED  142

Query  177  YLTPLHSAVLEKNDEIAKLLIQHGAR---------CTAYNKDGKTPLDLCDSDDMRDAIC  227
              TPL  A+ + +D++  +L++   R           A   D K    L D+D   D   
Sbjct  143  GFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTS  202

Query  228  MTNMLP  233
             +   P
Sbjct  203  KSGFTP  208


 Score = 60.5 bits (145),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 34/107 (32%), Positives = 55/107 (51%), Gaps = 0/107 (0%)

Query  110  NGETQLHKYCRAGNIASVSTLVESGMDVNVQDFASWTPLHEAVLNQRVGIVKLLLANGAL  169
            NG T +H   +  N+     L ++G ++++   A +TPLH A    +  +V+ LL NGA 
Sbjct  666  NGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGAN  725

Query  170  VNVPGLDYLTPLHSAVLEKNDEIAKLLIQHGARCTAYNKDGKTPLDL  216
            V+       TPLH    + +  I  LL++H A   A   +G+TPL +
Sbjct  726  VDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHI  772


 Score = 59.7 bits (143),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 43/164 (26%), Positives = 76/164 (46%), Gaps = 19/164 (12%)

Query  110  NGETQLHKYCRAGNIASVSTLVESGMDVNVQDFASWTPLHEAVLNQRVGIVKLLLANGAL  169
            +G T   +  RAGN+  V   +++ +D+N  +      LH A  +  + +V  LL  GA+
Sbjct  10   DGNTSFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAI  69

Query  170  VNVPGLDYLTPLHSAVLEKNDEIAKLLIQHGARCTAYNKDGKTPLDLCDSDDMRDAICMT  229
            V+       T LH A L   +E+ KLL++H A     +++G TPL +   ++  DA+   
Sbjct  70   VDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQEN-HDAV---  125

Query  230  NMLPSIVRTYVIPELRIFLNN-VSKDISDRIGQLPGVTLMQKAH  272
                          +R+ L+N  ++ ++   G  P    MQ+ H
Sbjct  126  --------------VRLLLSNGANQSLATEDGFTPLAVAMQQGH  155


 Score = 59.7 bits (143),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 35/112 (31%), Positives = 55/112 (49%), Gaps = 0/112 (0%)

Query  113  TQLHKYCRAGNIASVSTLVESGMDVNVQDFASWTPLHEAVLNQRVGIVKLLLANGALVNV  172
            T LH   + G     + L+E+G  ++      +TPLH       + + +LLL   A V+ 
Sbjct  504  TALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDA  563

Query  173  PGLDYLTPLHSAVLEKNDEIAKLLIQHGARCTAYNKDGKTPLDLCDSDDMRD  224
             G + +TPLH A    N ++A LL++ GA   A  K+G TPL +    +  D
Sbjct  564  QGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMD  615


 Score = 58.9 bits (141),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 35/110 (32%), Positives = 56/110 (51%), Gaps = 0/110 (0%)

Query  107  RHHNGETQLHKYCRAGNIASVSTLVESGMDVNVQDFASWTPLHEAVLNQRVGIVKLLLAN  166
            R  NG T LH  C+   +  V  L+  G  ++    +  TPLH A     + IV  LL +
Sbjct  366  RALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQH  425

Query  167  GALVNVPGLDYLTPLHSAVLEKNDEIAKLLIQHGARCTAYNKDGKTPLDL  216
             A  +VP +   TPLH A      +I ++L+++GA+  A  ++ +TPL +
Sbjct  426  DASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHI  475


 Score = 58.9 bits (141),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 37/114 (32%), Positives = 52/114 (46%), Gaps = 0/114 (0%)

Query  113  TQLHKYCRAGNIASVSTLVESGMDVNVQDFASWTPLHEAVLNQRVGIVKLLLANGALVNV  172
            T LH     G++     L++   D N +    +TPLH A    R+ +V+LLL +GA ++ 
Sbjct  339  TALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISA  398

Query  173  PGLDYLTPLHSAVLEKNDEIAKLLIQHGARCTAYNKDGKTPLDLCDSDDMRDAI  226
                 LTPLH A       I   L+QH A        G+TPL L    +  D I
Sbjct  399  TTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDII  452


 Score = 57.8 bits (138),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 41/136 (30%), Positives = 64/136 (47%), Gaps = 1/136 (1%)

Query  89   GGTTKISYLFISDSYNYKRHHNGETQLHKYCRAGNIASVSTLVESGMDVNVQDFASWTPL  148
            G T  +S L         +  +G T LH   R+G+   V  L+E G  ++ +      PL
Sbjct  249  GKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPL  308

Query  149  HEAVLNQRVGIVKLLLANGALVNVPGLDYLTPLHSAVLEKNDEIAKLLIQHGARCTAYNK  208
            H A   + V   ++LL + A V+   +DYLT LH A    +  +AKLL+   A   A   
Sbjct  309  HMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARAL  368

Query  209  DGKTPLDL-CDSDDMR  223
            +G TPL + C  + ++
Sbjct  369  NGFTPLHIACKKNRLK  384


 Score = 57.4 bits (137),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 38/107 (36%), Positives = 53/107 (50%), Gaps = 0/107 (0%)

Query  110  NGETQLHKYCRAGNIASVSTLVESGMDVNVQDFASWTPLHEAVLNQRVGIVKLLLANGAL  169
            +G T LH     G +  V  L++     +V      TPLH A    +  I+++LL NGA 
Sbjct  402  SGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQ  461

Query  170  VNVPGLDYLTPLHSAVLEKNDEIAKLLIQHGARCTAYNKDGKTPLDL  216
            V+    +  TPLH A    N +I  LL+QHGA+  A  KD  T L +
Sbjct  462  VDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHI  508


 Score = 55.5 bits (132),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 37/110 (34%), Positives = 52/110 (47%), Gaps = 0/110 (0%)

Query  111  GETQLHKYCRAGNIASVSTLVESGMDVNVQDFASWTPLHEAVLNQRVGIVKLLLANGALV  170
            G T LH   + G+I     L++   DV+ Q     TPLH A       +  LLL  GA  
Sbjct  535  GFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASP  594

Query  171  NVPGLDYLTPLHSAVLEKNDEIAKLLIQHGARCTAYNKDGKTPLDLCDSD  220
            +    +  TPLH A  +   +IA  L+++GA   A +K G TPL L   +
Sbjct  595  HATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQE  644


 Score = 53.9 bits (128),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 36/123 (29%), Positives = 60/123 (49%), Gaps = 1/123 (1%)

Query  107  RHHNGETQLHKYCRAGNIASVSTLVESGMDVNVQDFASWTPLHEAVLNQRVGIVKLLLAN  166
            R    +T LH   R GN+  V  L++ G  V+      +T LH A    +  +  +L+ N
Sbjct  465  RAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIEN  524

Query  167  GALVNVPGLDYLTPLHSAVLEKNDEIAKLLIQHGARCTAYNKDGKTPLDL-CDSDDMRDA  225
            GA ++       TPLH      + ++A+LL+Q  A   A  K+G TPL + C  ++ + A
Sbjct  525  GAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVA  584

Query  226  ICM  228
            + +
Sbjct  585  LLL  587


 Score = 50.4 bits (119),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 35/130 (27%), Positives = 59/130 (45%), Gaps = 4/130 (3%)

Query  85   SIQNGGTTKISYLFISDSYNYKRHHNGETQLHKYCRAGNIASVSTLVESGMDVNVQDFAS  144
            ++Q G    ++ L  SD+    R       LH   +  ++ + + L+++  + +V   + 
Sbjct  150  AMQQGHDKVVAVLLESDTRGKVRL----PALHIAAKKDDVKAATLLLDNDHNPDVTSKSG  205

Query  145  WTPLHEAVLNQRVGIVKLLLANGALVNVPGLDYLTPLHSAVLEKNDEIAKLLIQHGARCT  204
            +TPLH A       I  LL+  GA VN      ++PLH A       +  LL++ G    
Sbjct  206  FTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIE  265

Query  205  AYNKDGKTPL  214
            A  +DG TPL
Sbjct  266  AKTRDGLTPL  275


 Score = 40.8 bits (94),  Expect = 0.002, Method: Composition-based stats.
 Identities = 25/74 (34%), Positives = 35/74 (47%), Gaps = 0/74 (0%)

Query  111  GETQLHKYCRAGNIASVSTLVESGMDVNVQDFASWTPLHEAVLNQRVGIVKLLLANGALV  170
            G T LH     G    V  L+++G +V+      +TPLH+        IV LLL + A  
Sbjct  700  GYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANA  759

Query  171  NVPGLDYLTPLHSA  184
            N   ++  TPLH A
Sbjct  760  NAQTVNGQTPLHIA  773



Lambda      K        H
   0.313    0.128    0.351 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6570412396


Query= XP_031327431.1 trypsin alpha-4-like [Photinus pyralis]

Length=250
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TRYDT_DROME  unnamed protein product                                  208     3e-67
Q52V24_ASTLP  unnamed protein product                                 152     2e-45
Q9VQ97_DROME  unnamed protein product                                 150     1e-44


>TRYDT_DROME unnamed protein product
Length=253

 Score = 208 bits (530),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 117/253 (46%), Positives = 155/253 (61%), Gaps = 5/253 (2%)

Query  1    MFRLVLLLTVITIASAARPQLRTPPRLDGKIVGGKPVKIEEYPYQVSLQRYGSHVCGGSI  60
            M + V+LL+ +  A          P+LDG+IVGG    I  +P+Q+SLQR GSH CGGSI
Sbjct  1    MLKFVILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSI  60

Query  61   IGPNKVLTAAHCTSGSSASSLSIRHSSTFRGSEGVVIKVASIAQNPAYNPSTISDDVTVL  120
               N ++TAAHC    SAS L IR  S++  S GV   V+S   +  YN +T+ +D+ ++
Sbjct  61   YSSNVIVTAAHCLQSVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAII  120

Query  121  TLAEPIKDSDIGKPIAMVEANAAEGDREAVCTGWGTLSAGGSS-PRQLQAVDVKEVDRKE  179
             +   +  S   K I +  +N A G   +V +GWGTLS G SS P QLQ V+V  V + +
Sbjct  121  KINGALTFSSTIKAIGLASSNPANGAAASV-SGWGTLSYGSSSIPSQLQYVNVNIVSQSQ  179

Query  180  CNAS---YGGGITDTMICFGSPGKDSCQGDSGGPLVVGEKQVGIVSWGYGCAHPEYPGVY  236
            C +S   YG  I  TMIC  + GKD+CQGDSGGPLV G   VG+VSWGYGCA+  YPGVY
Sbjct  180  CASSTYGYGSQIRSTMICAAASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVY  239

Query  237  AHVAPLRTFIDQN  249
            A VA LR+++  N
Sbjct  240  ADVAALRSWVISN  252


>Q52V24_ASTLP unnamed protein product
Length=237

 Score = 152 bits (384),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 99/238 (42%), Positives = 130/238 (55%), Gaps = 22/238 (9%)

Query  31   IVGGKPVKIEEYPYQVSLQR----YGSHVCGGSIIGPNKVLTAAHCTSGS---SASSLSI  83
            IVGG    + E+PYQ+S Q     +  H CG SI   N  +TA HC  G    + S L I
Sbjct  1    IVGGTDATLGEFPYQLSFQETFIGFSFHFCGASIYNENYAITAGHCAYGDDYENPSGLQI  60

Query  84   ----RHSSTFRGSEGVVIKVASIAQNPAYNPSTISDDVTVLTLAEPIKDSDIGKPIAMVE  139
                   S   GSE  +I V+ I  +  ++ + + +D+++L L+  +  +D   PIA+ E
Sbjct  61   VAGELDMSVNEGSE-QIITVSKIILHENFDYNLLDNDISLLKLSGSLTFNDNVAPIALPE  119

Query  140  -ANAAEGDREAVCTGWGTLSAGGSSPRQLQAVDVKEVDRKECNASYGGG-ITDTMICFGS  197
              + A GD   + TGWGT S GG++P  LQ V V  V  ++C A YG   I D+MIC G 
Sbjct  120  QGHTATGD--VIVTGWGTTSEGGNTPDVLQKVTVPLVSDEDCRADYGADEILDSMICAGV  177

Query  198  P--GKDSCQGDSGGPLVVGEK----QVGIVSWGYGCAHPEYPGVYAHVAPLRTFIDQN  249
            P  GKDSCQGDSGGPL   +       GIVSWGYGCA P YPGVY  V+    +I  N
Sbjct  178  PEGGKDSCQGDSGGPLAASDTGSTYLAGIVSWGYGCARPGYPGVYTEVSYHVDWIKAN  235


>Q9VQ97_DROME unnamed protein product
Length=245

 Score = 150 bits (378),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 94/247 (38%), Positives = 136/247 (55%), Gaps = 12/247 (5%)

Query  1    MFRLVLLLTVITIASAARPQLRTPPRLDGKIVGGKPVKIEEYPYQVSLQRYGSHVCGGSI  60
            +  LVL+ +V  I++ + P+         +IVGG PV I E P+Q +L     ++CG  I
Sbjct  3    LHWLVLVASVTLISAGSSPE---------RIVGGHPVLISEVPWQAALMYSEKYICGAVI  53

Query  61   IGPNKVLTAAHCTSGSSASSLSIRHSSTFRGSEGVVIKVASIAQNPAYNPSTI-SDDVTV  119
                 ++TAAHC      +  S+R  S ++   G   +VA I ++  Y  STI  +D+ V
Sbjct  54   YSDKIIITAAHCVERPFDTLYSVRVGSVWKNLGGQHARVAVIRKHEDYVSSTILFNDIAV  113

Query  120  LTLAEPIKDSDIGKPIAMVEANAAEGDREAVCTGWGTLSAGGSSPRQLQAVDVKEVDRKE  179
            + L + +  +   +PI + ++  A G  EA  +GWG +      P  L    VK +D   
Sbjct  114  IRLVDTLIFNAEVRPIQLADSAPAAGT-EASVSGWGEIGILWLQPTSLLKTSVKILDPNV  172

Query  180  CNASYGGGITDTMICFGSPGKDSCQGDSGGPLVVGEKQVGIVSWGYGCAHPEYPGVYAHV  239
            C  SY   IT TMIC  +  KDSC GDSGGPLV G + VGIVS+G GCA+P +PGVYA+V
Sbjct  173  CKRSYQY-ITKTMICAAALLKDSCHGDSGGPLVSGGQLVGIVSYGIGCANPFFPGVYANV  231

Query  240  APLRTFI  246
            A L+ +I
Sbjct  232  AELKPWI  238



Lambda      K        H
   0.313    0.128    0.351 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6570412396


Query= XP_031327432.1 uncharacterized protein LOC116158740 [Photinus
pyralis]

Length=514
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q384R7_TRYB2  unnamed protein product                                 32.3    1.3  
OR42A_DROME  unnamed protein product                                  31.2    2.2  
UBC1_CAEEL  unnamed protein product                                   29.3    5.9  


>Q384R7_TRYB2 unnamed protein product
Length=972

 Score = 32.3 bits (72),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 20/65 (31%), Positives = 30/65 (46%), Gaps = 3/65 (5%)

Query  169  STETKYYLNMLETLGLTQIIEKATRLGTSLLDHIIVSNPIVVKKSGTNGMLFADHETIFC  228
            S + +  ++ L  L L Q +E     GT LL+ I    P+  K+ G+   LF+ H     
Sbjct  185  SAQAEENISNLSCLTLRQFLEGCVTAGTDLLEMIQPDRPVEGKEQGSARALFSPH---LA  241

Query  229  ELVLD  233
            E  LD
Sbjct  242  ESALD  246


>OR42A_DROME unnamed protein product
Length=406

 Score = 31.2 bits (69),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 62/157 (39%), Gaps = 15/157 (10%)

Query  78   DVSDEHITIPGYNLVRHDRVNRGSNQYTIEHLWLNIKTSTQSVVVGV-IYRPPNQNYKVF  136
            D  D  IT PG  L  H  V+  SN+     + + +  +T + +  + I RPP QNY  F
Sbjct  118  DEMDRRITDPGERLQIHRAVSL-SNRIFFFFMAVYMVYATNTFLSAIFIGRPPYQNYYPF  176

Query  137  CDELEG---VCLEALL-------ACESLVCVGDVNINILNKSSTETKYYLNMLETLG---  183
             D       + L+A L       AC   VCV    +N +         +   L  LG   
Sbjct  177  LDWRSSTLHLALQAGLEYFAMAGACFQDVCVDCYPVNFVLVLRAHMSIFAERLRRLGTYP  236

Query  184  LTQIIEKATRLGTSLLDHIIVSNPIVVKKSGTNGMLF  220
                 +K  RL   + DH ++   +   +   +G +F
Sbjct  237  YESQEQKYERLVQCIQDHKVILRFVDCLRPVISGTIF  273


>UBC1_CAEEL unnamed protein product
Length=192

 Score = 29.3 bits (64),  Expect = 5.9, Method: Compositional matrix adjust.
 Identities = 12/28 (43%), Positives = 17/28 (61%), Gaps = 0/28 (0%)

Query  75   LKNDVSDEHITIPGYNLVRHDRVNRGSN  102
            LK+DV  E I  PG N    DR++ G++
Sbjct  161  LKDDVEIEEIAAPGANDADDDRMDEGAS  188



Lambda      K        H
   0.313    0.128    0.351 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6570412396


Query= XP_031327433.1 uncharacterized protein LOC116158741 [Photinus
pyralis]

Length=572
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7JWH6_DROME  unnamed protein product                                 43.9    2e-04
Q8WQF3_CAEEL  unnamed protein product                                 36.2    0.068
Q20445_CAEEL  unnamed protein product                                 35.8    0.081


>Q7JWH6_DROME unnamed protein product
Length=372

 Score = 43.9 bits (102),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 35/59 (59%), Gaps = 0/59 (0%)

Query  71   EVDDLLRQWQLESLRPCFIENQIDLTALKHAQPHHINELLNSVPLGLRIKLEQNISKWK  129
            E+ DLL+ W +  L P   +  I++  L+  + HH++ELL +   G RI+ E ++ +W+
Sbjct  41   ELRDLLQSWDVADLLPHLQDEAINVDELQMIKRHHLSELLRNFRFGTRIRFEHHLERWR  99


>Q8WQF3_CAEEL unnamed protein product
Length=368

 Score = 36.2 bits (82),  Expect = 0.068, Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 64/152 (42%), Gaps = 25/152 (16%)

Query  217  QQNQKLNVSAAKTISIQINKLFPEETP--EYYFAPQTGKAPKGKLLSKYYNQVRRLTDSG  274
            QQ +KLN         QI+K+   ETP  +Y+F  +TGK        + Y+  R+  D  
Sbjct  142  QQIRKLN--QPDDARTQIDKM---ETPLVKYFFEKETGK-------RRDYDARRQRRDEK  189

Query  275  LLGKKVKLRSSIKHRNI------EELPAAEENCVTIKEKLK-----YVQEGERWEQLVVM  323
               K+ K+    KH+N+        +P A  +  T K+ LK       +E ERWE+    
Sbjct  190  RAEKRDKVDKFEKHKNVLDILMKPSVPMASTSATTSKKDLKKEKPMTEKEKERWEKQDAK  249

Query  324  WKSVQNYRRKMLLENQESSIVSFLNEWPAFKR  355
             K     R++  L+ ++        + P   R
Sbjct  250  RKERNMIRKQKFLDEKKKKHEEREQDGPRVPR  281


>Q20445_CAEEL unnamed protein product
Length=329

 Score = 35.8 bits (81),  Expect = 0.081, Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 64/152 (42%), Gaps = 25/152 (16%)

Query  217  QQNQKLNVSAAKTISIQINKLFPEETP--EYYFAPQTGKAPKGKLLSKYYNQVRRLTDSG  274
            QQ +KLN         QI+K+   ETP  +Y+F  +TGK        + Y+  R+  D  
Sbjct  142  QQIRKLN--QPDDARTQIDKM---ETPLVKYFFEKETGK-------RRDYDARRQRRDEK  189

Query  275  LLGKKVKLRSSIKHRNI------EELPAAEENCVTIKEKLK-----YVQEGERWEQLVVM  323
               K+ K+    KH+N+        +P A  +  T K+ LK       +E ERWE+    
Sbjct  190  RAEKRDKVDKFEKHKNVLDILMKPSVPMASTSATTSKKDLKKEKPMTEKEKERWEKQDAK  249

Query  324  WKSVQNYRRKMLLENQESSIVSFLNEWPAFKR  355
             K     R++  L+ ++        + P   R
Sbjct  250  RKERNMIRKQKFLDEKKKKHEEREQDGPRVPR  281



Lambda      K        H
   0.313    0.128    0.351 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6570412396


Query= XP_031327434.1 uncharacterized protein LOC116158742 [Photinus
pyralis]

Length=317
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SLX1_CAEEL  unnamed protein product                                   32.0    0.75 
A1Z8W9_DROME  unnamed protein product                                 30.4    2.2  
A0A0B4K7N0_DROME  unnamed protein product                             30.4    2.3  


>SLX1_CAEEL unnamed protein product
Length=443

 Score = 32.0 bits (71),  Expect = 0.75, Method: Compositional matrix adjust.
 Identities = 31/126 (25%), Positives = 47/126 (37%), Gaps = 16/126 (13%)

Query  6    SARSRLELTLRFLATGESYRSLMYSSRIHESTISLFIPEVCEVIFNVLKDEFLMTPSTPE  65
            SA  R  LT R+L T E    L + +       S   P+  ++ F  +K E  + PS  E
Sbjct  283  SAFCRFALTFRWLITTEE---LPFPT-------SCVPPDHTKLRFGKVKKEMSLVPSKRE  332

Query  66   SWQSIAD------QFMELWQFPQCVGALDGRHITFRSPKSAGSFYHNYKGDHSLVLLAMA  119
             +  + +         +LW   +C+ A    H   +     G    N   DH   L A  
Sbjct  333  DYLEMGECRICGKDIEKLWSLVRCISATCPSHFHSKCLSENGLKLKNEHVDHVYPLKANC  392

Query  120  DACCKF  125
              C +F
Sbjct  393  PTCGQF  398


>A1Z8W9_DROME unnamed protein product
Length=1740

 Score = 30.4 bits (67),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 26/109 (24%), Positives = 45/109 (41%), Gaps = 5/109 (5%)

Query  61   PSTPESWQSIA-DQFMELWQFPQCVGALDGRHITFRSPKSAGSFYHNYKGDHSLVLLAMA  119
            P TP   + +A D  ++LW+ P  V  L   +I +         + +     S   L+  
Sbjct  477  PKTPYEMRELALDNLLQLWRIPGFVTEL---YINYDCDLYCTDMFESLTNLLSKYTLSAT  533

Query  120  DACCKFTYINIGVNGRISDGGVFRDCTLSKAIQNNSLNFPQSRPLPGSS  168
            +A      I++     + D  + R+C  SK   NN  + P++ P  G S
Sbjct  534  NAVYSTHIISMDTLLSVIDS-IERNCAASKNSSNNRESLPEAAPATGGS  581


>A0A0B4K7N0_DROME unnamed protein product
Length=1741

 Score = 30.4 bits (67),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 26/109 (24%), Positives = 45/109 (41%), Gaps = 5/109 (5%)

Query  61   PSTPESWQSIA-DQFMELWQFPQCVGALDGRHITFRSPKSAGSFYHNYKGDHSLVLLAMA  119
            P TP   + +A D  ++LW+ P  V  L   +I +         + +     S   L+  
Sbjct  477  PKTPYEMRELALDNLLQLWRIPGFVTEL---YINYDCDLYCTDMFESLTNLLSKYTLSAT  533

Query  120  DACCKFTYINIGVNGRISDGGVFRDCTLSKAIQNNSLNFPQSRPLPGSS  168
            +A      I++     + D  + R+C  SK   NN  + P++ P  G S
Sbjct  534  NAVYSTHIISMDTLLSVIDS-IERNCAASKNSSNNRESLPEAAPATGGS  581



Lambda      K        H
   0.313    0.128    0.351 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6570412396


Query= XP_031327435.1 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase
[Photinus pyralis]

Length=183
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MTND_DROME  unnamed protein product                                   241     3e-82
Q57UT9_TRYB2  unnamed protein product                                 98.2    4e-25
Q9W259_DROME  unnamed protein product                                 28.9    2.6  


>MTND_DROME unnamed protein product
Length=186

 Score = 241 bits (615),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 106/174 (61%), Positives = 135/174 (78%), Gaps = 0/174 (0%)

Query  1    MVRAWYMSNDVEDQRLENHLTPQKMVSLDEVKRLTGVEYFGINLNTYQTDGVLDNIKKER  60
            MV+ WYM  +  DQRLE+H  P   + LD++ + TGVEYF IN + YQ+D  L  ++ +R
Sbjct  1    MVQVWYMDTEETDQRLEHHRNPPAYLELDDLYQKTGVEYFKINADEYQSDNTLTELRAKR  60

Query  61   GYTYEDELVCSKECLQNYEEKLKIFFAEHLHTDEEIRFVVEGSGYFDVRDKNDEWIRIEV  120
            GYTY+DE+ CS++CL +Y  KLK FF EHLHTDEEIR ++EGSGYFDVRD  D W+RI+V
Sbjct  61   GYTYDDEITCSEKCLPDYANKLKAFFTEHLHTDEEIRLILEGSGYFDVRDNEDNWLRIKV  120

Query  121  KPGDLIILPSGIYHRFTLDTTNFIRAKRFFVGEPVWTAYNRPADHFECRKSYVE  174
              GDLII+P+GIYHRFTLDT NFIR +R+FVGEPVW  +NRPAD  +CRKSY++
Sbjct  121  VKGDLIIIPAGIYHRFTLDTNNFIRTRRYFVGEPVWAPHNRPADEMDCRKSYIK  174


>Q57UT9_TRYB2 unnamed protein product
Length=280

 Score = 98.2 bits (243),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 77/124 (62%), Gaps = 6/124 (5%)

Query  27   SLDEVKRLTGVEYFGINLNTYQTDGVLDNIKKERGYTYEDELVCSKECLQNYEEKLKIFF  86
            +L ++K L G+ YF ++LN +    V+  I KER Y + DE+  S+ C    E+ L+ ++
Sbjct  122  TLQQLKEL-GIIYFNVSLNDF---SVVRQIVKERNYKHTDEVKLSQTC--KDEQFLERWY  175

Query  87   AEHLHTDEEIRFVVEGSGYFDVRDKNDEWIRIEVKPGDLIILPSGIYHRFTLDTTNFIRA  146
             EH + DE+IR VV+GS + DVR K D+WIRI  K GDL + P G+Y R TLD  +F+  
Sbjct  176  QEHYNEDEQIRIVVDGSCFIDVRSKQDKWIRIHAKTGDLFVFPPGLYQRGTLDEDDFVAL  235

Query  147  KRFF  150
             R F
Sbjct  236  YRIF  239


>Q9W259_DROME unnamed protein product
Length=503

 Score = 28.9 bits (63),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 17/28 (61%), Gaps = 5/28 (18%)

Query  101  EGSGYFDVRDKNDEWIRIEVKPGDLIIL  128
            E   YFDV D     +R+E KPGD +IL
Sbjct  67   EAPPYFDVTD-----LRVEAKPGDDVIL  89



Lambda      K        H
   0.313    0.128    0.351 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6570412396


Query= XP_031327436.1 bis(5'-nucleosyl)-tetraphosphatase
[asymmetrical]-like [Photinus pyralis]

Length=140
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

AP4A_CAEEL  unnamed protein product                                   140     8e-44
C0H4F3_PLAF7  unnamed protein product                                 88.2    5e-23
Q8T3N6_DROME  unnamed protein product                                 37.0    0.003


>AP4A_CAEEL unnamed protein product
Length=138

 Score = 140 bits (354),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 90/137 (66%), Gaps = 2/137 (1%)

Query  1    MTKTAAGLVIFRKHLNAIQYLLLQTSYGEHHWTPPKGHVDPGETDPMVTALRETSEESGL  60
            M   AAGLVI+RK    I++LLLQ SY  HHWTPPKGHVDPGE D    A+RET EE+ +
Sbjct  1    MVVKAAGLVIYRKLAGKIEFLLLQASYPPHHWTPPKGHVDPGE-DEWQAAIRETKEEANI  59

Query  61   RQSDLNIFHDSKHILNYNVRGKPKIVIYWLAELINPSAGVRLSDEHQDFKWLELEEACRF  120
             +  L I  D    L Y  +GKPK V YWLA+L NP   V+LS EHQ++KW ELE+A + 
Sbjct  60   TKEQLTIHEDCHETLFYEAKGKPKSVKYWLAKLNNPD-DVQLSHEHQNWKWCELEDAIKI  118

Query  121  GNYTDMQVMLKHYDNFI  137
             +Y +M  +L+ +  F+
Sbjct  119  ADYAEMGSLLRKFSAFL  135


>C0H4F3_PLAF7 unnamed protein product
Length=152

 Score = 88.2 bits (217),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 72/123 (59%), Gaps = 2/123 (2%)

Query  15   LNAIQYLLLQTSYGEHHWTPPKGHVDPGETDPMVTALRETSEESGLRQSDLNIFHDSKHI  74
            +N  ++L L+ SY + HWTPPKG  +  E+  + TA+RET EE+G+ +    + +  K  
Sbjct  27   INKFEFLFLKASYADKHWTPPKGLHENNESG-LETAVRETLEETGINKDKYKLLNYQK-T  84

Query  75   LNYNVRGKPKIVIYWLAELINPSAGVRLSDEHQDFKWLELEEACRFGNYTDMQVMLKHYD  134
            L YNV+ KPK   Y+LA L+N    V LSDEH D+KW+   E+  +     +  +LK  +
Sbjct  85   LKYNVKDKPKETTYYLAMLLNNEENVILSDEHTDYKWIGSHESDTYNLPESLADLLKEAE  144

Query  135  NFI  137
             F+
Sbjct  145  EFL  147


>Q8T3N6_DROME unnamed protein product
Length=512

 Score = 37.0 bits (84),  Expect = 0.003, Method: Composition-based stats.
 Identities = 18/45 (40%), Positives = 26/45 (58%), Gaps = 1/45 (2%)

Query  21  LLLQTSYGEHHWTPPKGHVDPGETDPMVTALRETSEESGLRQSDL  65
           LL+Q+ +  + W  PKG ++  E DP   A RE  EE+G   +DL
Sbjct  47  LLVQSYFARNSWGFPKGKINENE-DPAHCATREVYEETGFDITDL  90



Lambda      K        H
   0.313    0.128    0.351 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6570412396


Query= XP_031327437.1 uncharacterized protein LOC116158746 [Photinus
pyralis]

Length=146
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q21836_CAEEL  unnamed protein product                                 26.6    8.6  
MAD_DROME  unnamed protein product                                    26.6    9.8  


>Q21836_CAEEL unnamed protein product
Length=362

 Score = 26.6 bits (57),  Expect = 8.6, Method: Compositional matrix adjust.
 Identities = 14/65 (22%), Positives = 31/65 (48%), Gaps = 5/65 (8%)

Query  45   PSYEHVLEETRLQAQKEDSTPTDPTKGPEIFHKSSKELYKAVAKQFGITCKMSDQCRCLD  104
            P+ +++LE   +   +E+ +P+D T  P+   K  +  Y+     F +     D+   + 
Sbjct  82   PTGDNILEAASVLDNRENGSPSDGTNSPDDNGKRKQRRYRTTFSAFQL-----DELEKVF  136

Query  105  CQSHY  109
             ++HY
Sbjct  137  ARTHY  141


>MAD_DROME unnamed protein product
Length=455

 Score = 26.6 bits (57),  Expect = 9.8, Method: Composition-based stats.
 Identities = 13/57 (23%), Positives = 24/57 (42%), Gaps = 10/57 (18%)

Query  19   DTEIGSPTKNFTEMTDATDGIPSSPPPSYEHVLEETRLQAQKEDSTPTDPTKGPEIF  75
            +T +GSP+   +      D +  +PPP+Y          +  ED    +P  G ++ 
Sbjct  197  NTSVGSPSSVNSNPNSPYDSLAGTPPPAY----------SPSEDGNSNNPNDGGQLL  243



Lambda      K        H
   0.313    0.128    0.351 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6570412396


Query= XP_031327438.1 uncharacterized protein LOC116158747 [Photinus
pyralis]

Length=373
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TDR12_BOMMO  unnamed protein product                                  31.6    1.3  
O76555_CAEEL  unnamed protein product                                 31.2    1.5  
SLIT1_CAEEL  unnamed protein product                                  30.8    2.1  


>TDR12_BOMMO unnamed protein product
Length=1759

 Score = 31.6 bits (70),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 28/58 (48%), Gaps = 6/58 (10%)

Query  285  TLQPIIVAVGDDLIHINSYYVFYDDIKYKFDNCLAALDSCF-KIFHVLNLKYPRCGQN  341
            TL PI+V    +L+H+N       D  Y     L AL S F K F VLN  YP   +N
Sbjct  887  TLGPILVCCDSNLVHLN-----VTDASYLIHYSLPALFSTFCKRFSVLNDNYPSIFKN  939


>O76555_CAEEL unnamed protein product
Length=690

 Score = 31.2 bits (69),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 36/69 (52%), Gaps = 11/69 (16%)

Query  12   NNVKLRREGFERI----SEEIEQRFHDDKFIYYKKRGLKQIPSGRLYDK--YYNHTKRLK  65
            N  K + E FE +    SEE +++ +DD F +  ++ ++     RLY K   Y HTK LK
Sbjct  422  NEEKSKIEVFEDLDKSYSEEQKKKLNDDGFAFLTEKQME-----RLYGKESPYKHTKALK  476

Query  66   KIGLIQQSP  74
            K   ++  P
Sbjct  477  KFKRLRDDP  485


>SLIT1_CAEEL unnamed protein product
Length=1410

 Score = 30.8 bits (68),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 44/100 (44%), Gaps = 10/100 (10%)

Query  19   EGFERISEEIEQRFHDDKFIYYKKRGLKQIPSGRLYDKYYNHTKRLKKIGLIQQSPITPR  78
            + FE++S+  E R +D+K  ++    L +  +  + D   N+ +    I           
Sbjct  555  KSFEKLSKLRELRLNDNKLHHFSSMVLDEQSNLEILDLSGNNIQCFSSIFF---------  605

Query  79   TSTVANIENIGVIDDQNITDDEILNLTAWLRINNSPWTDV  118
             +    I  I VI +  + D  IL L +WLR N+S   D+
Sbjct  606  -NKATRIREIKVIGNDLLCDCRILPLMSWLRSNSSHSIDI  644



Lambda      K        H
   0.313    0.128    0.351 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6570412396


Query= XP_031327439.1 E3 ubiquitin-protein ligase synoviolin-like [Photinus
pyralis]

Length=546
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

HRD1_DROME  unnamed protein product                                   572     0.0   
HRD1_CAEEL  unnamed protein product                                   398     3e-132
Q8ILM8_PLAF7  unnamed protein product                                 140     1e-35 


>HRD1_DROME unnamed protein product
Length=626

 Score = 572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/609 (50%), Positives = 385/609 (63%), Gaps = 75/609 (12%)

Query  6    ISVLSVVLTTVVLANAYYQKKQFYPSVVYITKSNPSMAVIYIQAFILVFLTGKLMRKVFF  65
            +S + + LT+ V+  AYYQK+QFYP+VVYITKSN SM VIYIQ F++VF+ GKL+ K+F 
Sbjct  5    LSSVCMALTSAVIGFAYYQKQQFYPAVVYITKSNASMGVIYIQFFVIVFMFGKLLSKIFL  64

Query  66   GQLRTAEFEHLMERAWYAITETCLAFTVFRDDFTPKFVALFTILLFLKSFHWLAEDRIDY  125
            G LR AEFEHL+ER WYA+TETCLAFTVFRDDF P+FVALFT+LLFLKSFHWLAE+R+D+
Sbjct  65   GTLRAAEFEHLLERFWYALTETCLAFTVFRDDFNPRFVALFTVLLFLKSFHWLAEERVDF  124

Query  126  MERSPVISWVFHIRVLSLLLVLGTSDFYFLQHAYLSTMAMGPSVQLVFGFEYAILLTMVA  185
            MERSPV+ W+FHIRV SLL VLG  D+  L HAY ST+  GP+VQLVFGFEYAILLT++A
Sbjct  125  MERSPVLGWLFHIRVGSLLTVLGILDYVLLIHAYNSTLVRGPTVQLVFGFEYAILLTVIA  184

Query  186  NIALKYVLHTIDLNSEAPWANKAVFLLYTELVMGLIKVVLYIAFLIIMIKLYTLPLFAFR  245
            + A+KYVLH  ++ ++ PW NKAVFLLYTELV+GLIKVVLYI F++IM K+Y LP+F FR
Sbjct  185  STAIKYVLHAAEMRTDTPWENKAVFLLYTELVIGLIKVVLYILFVVIMAKIYALPMFVFR  244

Query  246  PMYYTLRNFKKAFNNVILSRRAIHNMNTLYADATPEELQAADNVCIICREEMTTSSKKLP  305
            PM++T+RNF+KA N+VI+SRRAI NMNTLY DATPEEL+ +DN+CIICRE+M   SKKLP
Sbjct  245  PMFFTIRNFRKALNDVIMSRRAIRNMNTLYPDATPEELRQSDNICIICREDMVNHSKKLP  304

Query  306  CNHIFHTACLRSWFQRQQTCPTCRLNILRNP---------------ATARAEPRPQAQPM  350
            C HIFHT CLRSWFQRQQTCPTCRLNILR P               A A   P P A  +
Sbjct  305  CGHIFHTTCLRSWFQRQQTCPTCRLNILRTPTVNSTAMPRQGDEAVAAAAGNPIPAAAGV  364

Query  351  PNPFAGPPFVFQPLINPMQ---DLNQGAAAQPPPTAPPTSTSQSTTQQGPVPPFA----L  403
                  PP     +++  Q   D+N       PP         S    G +P  A     
Sbjct  365  QPAGGVPPPAPTAVVDGNQARADVNVAGGQALPPNFADLFGDASGLPNG-LPNLAGLQIP  423

Query  404  PPFMPFPFLPFMSPPPMP----------SSNLASLSAEELRRMEGNEREHVEARIRCLQN  453
            PP +     PFM PP               +L + + EELR MEG +R+H+  R++ LQN
Sbjct  424  PPPVMPMISPFMIPPHFGYLTPLPPPPIPQDLTNFTDEELRAMEGLQRDHIVQRLKLLQN  483

Query  454  IQVMLDAAVLMMNQYSAAVA--------------------------TSGTIPSHPPTDNV  487
            I +MLD+A +MM+QY +  A                          TS T  +   T  V
Sbjct  484  INLMLDSAGIMMSQYQSLSARLQLTAVTPATAVNGSADSSVYDMPSTSATAMAQLETHQV  543

Query  488  PPAANDSSNT--------------SKESEGGTSSSSNSNASIPATSSANPLSAEE--EIR  531
             P A  SS +              +   E    S++    SIP + +    ++ E  E+R
Sbjct  544  TPTAAASSASPTMPAEKVTIEDLGADADEDDIPSTATEAVSIPNSDADFEENSSELGELR  603

Query  532  RRRLQRFEQ  540
            +RRL+  E+
Sbjct  604  KRRLKFLEE  612


>HRD1_CAEEL unnamed protein product
Length=610

 Score = 398 bits (1023),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 182/328 (55%), Positives = 241/328 (73%), Gaps = 2/328 (1%)

Query  10   SVVLTTVVLANAYYQKKQFYPSVVYITKSNPSMAVIYIQAFILVFLTGKLMRKVFFGQLR  69
            S V T   + NA+   KQFYPS+VY++KSN SMAVIY+Q  +LV+L  +L++ + FG LR
Sbjct  12   SCVATAATILNAFLINKQFYPSIVYLSKSNASMAVIYVQGIVLVYLMFQLLKSILFGDLR  71

Query  70   TAEFEHLMERAWYAITETCLAFTVFRDDFTPKFVALFTILLFLKSFHWLAEDRIDYMERS  129
             AE EHL ER W+A+ ETCLAFTVFRDDF+  FV  F  LLF+K FHWLA+DR+D MERS
Sbjct  72   AAEAEHLSERTWHAVLETCLAFTVFRDDFSAIFVMQFIGLLFIKCFHWLADDRVDMMERS  131

Query  130  PVISWVFHIRVLSLLLVLGTSDFYFLQHAYLSTMAMGPSVQLVFGFEYAILLTMVANIAL  189
            PVI+  FH+R++++L  LG +D YF+  AY +T+  G S Q+VFGFEYAILL +V ++ +
Sbjct  132  PVITLRFHLRMMTVLAALGFADSYFVSSAYFTTITRGASAQIVFGFEYAILLALVLHVTI  191

Query  190  KYVLHTIDLNSEAPWANKAVFLLYTELVMGLIKVVLYIAFLIIMIKLYTLPLFAFRPMYY  249
            KY+LH  DL +   W NKAV+LLY EL + LI+ +LY  F ++M++++T PLF+ RP Y 
Sbjct  192  KYLLHMHDLRNPQSWDNKAVYLLYAELFINLIRCLLYGFFAVVMLRVHTFPLFSVRPFYQ  251

Query  250  TLRNFKKAFNNVILSRRAIHNMNTLYADATPEELQAADNVCIICREEMTT--SSKKLPCN  307
            ++R   KAF +VILSRRAI+ MN+ +   + E+L A D  CIICREEMT   S K+LPC+
Sbjct  252  SVRALHKAFLDVILSRRAINAMNSQFPVVSAEDLAAMDATCIICREEMTVDASPKRLPCS  311

Query  308  HIFHTACLRSWFQRQQTCPTCRLNILRN  335
            H+FH  CLRSWFQRQQTCPTCR +I + 
Sbjct  312  HVFHAHCLRSWFQRQQTCPTCRTDIWQG  339


>Q8ILM8_PLAF7 unnamed protein product
Length=510

 Score = 140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 102/404 (25%), Positives = 189/404 (47%), Gaps = 25/404 (6%)

Query  17   VLANAYYQKKQFYPSVVYITKSNPSMAVIYIQAFILVFLT-GKLMRKVFFGQLRTAEFEH  75
            +L  A+ +  +FY +VVY++       +IY   F++VF+   KL+  VF G+LR  E E 
Sbjct  19   ILMYAFMKYDEFYLAVVYLSTEKFPRTIIY-NFFLMVFIVLCKLLLNVFIGELRYLEVEQ  77

Query  76   LMERAWYAITETCLAFTVFRDDFTPK------FVALFTILLFLKSFHWLAEDRIDYMERS  129
            L++ A   I +T L   + +     K       +   +I++ LK++H +   R+  +   
Sbjct  78   LIDNARAFIMDTILFLVLSKPTINGKEVSSIILIKYLSIIVILKAYHLVLYSRVSNIFEL  137

Query  130  PVISWVFHIRVLSLLLVLGTSDFYFLQHAYLSTMAMGPSVQLVFGFEYAILLTMVANIAL  189
             V      +++   + +L  ++     + Y +++    ++ L   FE   +         
Sbjct  138  GVPRTRVLVKLFIFMCLLSIANLSLFTYFYKNSLK-NSTMYLWLFFECLSIFESCQISIC  196

Query  190  KYVLHTIDLNSEAPWANKAVFLLYTELVMGLIKVVLYIAFLIIMI--KLYTLPLFAFRPM  247
            K+ ++ IDL S+   ++KA  L + +++  ++ +++++ F+++ +      LPL     +
Sbjct  197  KFFVNVIDLRSQNGLSSKATILFFLDILHDIMSLIIFLVFILVFVLNNFSNLPLHMTADI  256

Query  248  YYTLRNFKKAFNNVILSRRAIHNMNTLYADATPEELQAADNVCIICREEMTTSSKKLPCN  307
             + ++     F +    R    N+ T +A+AT EEL+ A   CIICR+++   SKKL C+
Sbjct  257  IHVVKTLISRFKSFQKYRELTKNIETKFANATEEELKEA-GTCIICRDDLKEGSKKLSCS  315

Query  308  HIFHTACLRSWFQRQQTCPTCRLNI---LRNPATARAEPRPQAQPMPNPFAGP---PFVF  361
            HIFH  CL+SWF +QQTCP CR  I    +N          Q +        P     + 
Sbjct  316  HIFHVDCLKSWFIQQQTCPICRTEIKPYAKNEQNKSENDTTQKEKQEEKIEQPTIQEIIT  375

Query  362  QP--LINP----MQDLN-QGAAAQPPPTAPPTSTSQSTTQQGPV  398
            +P  LIN     + D N  G         PP + + +T +Q  +
Sbjct  376  KPNFLINDQHLYLNDTNVMGTLNINQQYYPPINKNINTKEQIKI  419



Lambda      K        H
   0.313    0.128    0.351 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6570412396


Query= XP_031327440.1 uncharacterized protein LOC116158749 [Photinus
pyralis]

Length=224
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q580A9_TRYB2  unnamed protein product                                 31.2    0.71 
Q9Y134_DROME  unnamed protein product                                 28.9    3.9  
Q93765_CAEEL  unnamed protein product                                 28.9    3.9  


>Q580A9_TRYB2 unnamed protein product
Length=483

 Score = 31.2 bits (69),  Expect = 0.71, Method: Compositional matrix adjust.
 Identities = 29/109 (27%), Positives = 52/109 (48%), Gaps = 8/109 (7%)

Query  107  LDGVRRALKGACKDGDFVERFKRIRCNTPTVDFLCLTVVKCLPQLKIIANVDKMLLFFNK  166
            L G+R AL+    +GD +    R+ CNT     + L+ +       I   +D + L  + 
Sbjct  355  LLGIRLALEMKPPEGDPIPAM-RLLCNT----TVSLSSLYFDSSGAIPLEMDLLDLAIDV  409

Query  167  QDV---CIDIRTYRDVLMETMNERCNVSIDDKIWVLTIFEDLTEECENV  212
            +      ID  T  D+L   + ++   ++++KI  +TIF++ TE   NV
Sbjct  410  ETSNIGAIDQLTLNDILSRELRDKVIPAVNEKISTITIFDNTTEPLLNV  458


>Q9Y134_DROME unnamed protein product
Length=1055

 Score = 28.9 bits (63),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 40/99 (40%), Gaps = 12/99 (12%)

Query  49   EFEKTLE--PFVDVPRCFATQYLTPNGICENYEKESCLKEPLYSIKRCLDSDEHYFPDFV  106
            +FEK LE  P    P            I   Y+ +  L++ L  +K  L +         
Sbjct  812  QFEKRLEEHPLHKSPEL--------ERIHRRYQDKVTLQKQLQDLKAELKAARSLLQMDE  863

Query  107  LDGVRRALK--GACKDGDFVERFKRIRCNTPTVDFLCLT  143
            L   +R L+  G CK GD +E   R+ C   + D L +T
Sbjct  864  LKHRKRVLRRMGYCKPGDVIEFKGRVACELSSADELLMT  902


>Q93765_CAEEL unnamed protein product
Length=494

 Score = 28.9 bits (63),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 26/82 (32%), Positives = 38/82 (46%), Gaps = 9/82 (11%)

Query  68   YLTPN---GICENYEKESCLKEPLYSIKRCLDSDEHYFPDF-VLDGVRRALKGACKDG--  121
            Y TP+   GI  +Y   S  K+  YS+ R L S   +F  F V DGV+ A+   C D   
Sbjct  214  YETPSQSYGIANDYSIVSRYKD--YSL-RILSSGSDFFERFFVPDGVKSAVTFFCPDSME  270

Query  122  DFVERFKRIRCNTPTVDFLCLT  143
             ++     ++ N P   F+  T
Sbjct  271  TYITGLTIVKQNFPGEKFVSFT  292



Lambda      K        H
   0.313    0.128    0.351 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6570412396


Query= XP_031327441.1 WD repeat-containing protein 92-like [Photinus
pyralis]

Length=357
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q387Q4_TRYB2  unnamed protein product                                 279     2e-91
WDR24_DROME  unnamed protein product                                  45.8    3e-05
Q86BR7_DROME  unnamed protein product                                 45.8    4e-05


>Q387Q4_TRYB2 unnamed protein product
Length=386

 Score = 279 bits (713),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 148/365 (41%), Positives = 209/365 (57%), Gaps = 22/365 (6%)

Query  9    IICHLEKDVNYSVHEVKWIPSSAKFVAMGGKSNGTGIVEIYAMSGDGLEKISEFAKADQF  68
            II H++K++ Y+  +VKW+P SA    +G   N  G +    ++   L    E       
Sbjct  25   IIEHVKKNLLYTAFDVKWVPHSACLAIVGQYPNNQGALSFMQLNKGELTVRHEIRTKLPL  84

Query  69   KCGTFEASSLR----ARHLATGDFGGRLQVWDLE------------DSLLPVYKSTK-HT  111
            KC TF  +S +    A  +A GDF G L +WD+E            D    ++K+ + H 
Sbjct  85   KCCTFAHNSRQMSSAALTIAAGDFAGGLSLWDVERLSSSSGDNGKFDENEALFKAPRAHE  144

Query  112  AIINSIDGIAGTKVGCGAPELVTGSRDGSVMVWDVRQKDIPVAKFLPSEGTAARDCWVVA  171
             IIN++DG   T    G PE+ +  RDG V VWDVRQ   PV    P++   ARDCW V 
Sbjct  145  NIINAVDGAQFT----GPPEIASCGRDGCVKVWDVRQAAKPVVVLSPADPARARDCWTVR  200

Query  172  FGNSYNSEERVVCAGYDNGDVKMFDLKSMSLRWSKCLKNGVVGLQFDRKDIPMNKLVATT  231
             GNS + +ERVV AGYDNGDVK+FDL++  +     + NGV  ++FDR DIPMNKL+ + 
Sbjct  201  LGNSSDPDERVVVAGYDNGDVKLFDLRTQKMLHEFNVGNGVCDVEFDRPDIPMNKLIVSL  260

Query  232  LESKLYCFDVRTQHPKKGFAQVTEKAHGSTVWSVKHLPQNREIFMTTGGAGSLCLWKYNY  291
            LE ++  +DVRT HP  G+A V E+    TVW  + LPQNRE+F   GG G + L +Y Y
Sbjct  261  LEGRVRVYDVRTLHPTLGYAYVEERVSSGTVWCSRALPQNREVF-ACGGGGEVTLCRYRY  319

Query  292  PHKRVDKDGDGLEMGVPGELSLLQNSTVSTQPITSFDWCNDKIGLSVCSAYDQTVRVLIT  351
            P +R  +D DG+  G+ G +  L  + V  QPI + DW   K GL  C+++DQ++RV++ 
Sbjct  320  PPERTLRDSDGVAKGIAGCVEELNKAKVGDQPIHTMDWNRSKEGLLACASFDQSIRVMLV  379

Query  352  TKLNL  356
            TKL+L
Sbjct  380  TKLSL  384


>WDR24_DROME unnamed protein product
Length=776

 Score = 45.8 bits (107),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 43/180 (24%), Positives = 81/180 (45%), Gaps = 26/180 (14%)

Query  34   VAMGGKSNGTGIVEIYAMSGDGLEKISEFAKADQ---FKCGTFEASSLRARHLATGDFGG  90
            +A+ G+S    ++++Y+++ +G  +       +Q   +       S+L +  LAT    G
Sbjct  33   IALAGRS----LLKVYSINSNGFTESCNMRGKNQNLSYSANDVAWSTLDSNLLATAATNG  88

Query  91   RLQVWDLEDSLLPVYKSTKHTAIINSIDGIAGT-KVGCGAPE-LVTGSRDGSVMVWDVRQ  148
             + VWDL       +   K   + N  +  A T       P  L++GS+DG++  +D+R 
Sbjct  89   VVSVWDLSK-----FGRQKQLLVYNEHERTAHTVTFHSSEPNILISGSQDGTIKCFDIRS  143

Query  149  KDIPVAKFLPSEGTAARDCWVVAFGNSYNSEERVVCAGYDNGDVKMFDLKSMSLRWSKCL  208
                   F  SE  + RD   V F       + +  A  +NG V+++D++    +W KC+
Sbjct  144  DKSINTYFCNSE--SVRD---VKFS---PHTQNIFSAVSENGTVQLWDMR----KWDKCM  191


 Score = 34.3 bits (77),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 37/75 (49%), Gaps = 6/75 (8%)

Query  83   LATGDFGGRLQVWDLEDSLLPVYKSTKHT-AIINSIDGIAGTKVGCGAPELVTGSRDGSV  141
            LATG    +++VW+++    P  + T HT A++  +           +  LV    D SV
Sbjct  213  LATGSRDKQIKVWNMDGR--PGLEHTIHTIAVVGRVKWRPERTYHIASCALVV---DYSV  267

Query  142  MVWDVRQKDIPVAKF  156
             VWD+R+  IP A F
Sbjct  268  HVWDIRRPYIPFASF  282


 Score = 30.0 bits (66),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 29/148 (20%), Positives = 62/148 (42%), Gaps = 11/148 (7%)

Query  15   KDVNYSVHEVKWIPSSAKFVAMGGKSNGTGIVEIYAMSGDGLEKISEFAKADQFKCGTFE  74
            ++++YS ++V W    +  +A    +   G+V ++ +S  G +K        +    T  
Sbjct  62   QNLSYSANDVAWSTLDSNLLATAATN---GVVSVWDLSKFGRQKQLLVYNEHERTAHTVT  118

Query  75   ASSLRARHLATGDFGGRLQVWDLEDSLLPVYKSTKHTAIINSIDGIAGTKVGCGAPELVT  134
              S     L +G   G ++ +D+          + +T   NS + +   K       + +
Sbjct  119  FHSSEPNILISGSQDGTIKCFDIRSD------KSINTYFCNS-ESVRDVKFSPHTQNIFS  171

Query  135  G-SRDGSVMVWDVRQKDIPVAKFLPSEG  161
              S +G+V +WD+R+ D  + +F    G
Sbjct  172  AVSENGTVQLWDMRKWDKCMVQFTAHYG  199


>Q86BR7_DROME unnamed protein product
Length=777

 Score = 45.8 bits (107),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 43/180 (24%), Positives = 81/180 (45%), Gaps = 26/180 (14%)

Query  34   VAMGGKSNGTGIVEIYAMSGDGLEKISEFAKADQ---FKCGTFEASSLRARHLATGDFGG  90
            +A+ G+S    ++++Y+++ +G  +       +Q   +       S+L +  LAT    G
Sbjct  33   IALAGRS----LLKVYSINSNGFTESCNMRGKNQNLSYSANDVAWSTLDSNLLATAATNG  88

Query  91   RLQVWDLEDSLLPVYKSTKHTAIINSIDGIAGT-KVGCGAPE-LVTGSRDGSVMVWDVRQ  148
             + VWDL       +   K   + N  +  A T       P  L++GS+DG++  +D+R 
Sbjct  89   VVSVWDLSK-----FGRQKQLLVYNEHERTAHTVTFHSSEPNILISGSQDGTIKCFDIRS  143

Query  149  KDIPVAKFLPSEGTAARDCWVVAFGNSYNSEERVVCAGYDNGDVKMFDLKSMSLRWSKCL  208
                   F  SE  + RD   V F       + +  A  +NG V+++D++    +W KC+
Sbjct  144  DKSINTYFCNSE--SVRD---VKFS---PHTQNIFSAVSENGTVQLWDMR----KWDKCM  191


 Score = 34.3 bits (77),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 37/75 (49%), Gaps = 6/75 (8%)

Query  83   LATGDFGGRLQVWDLEDSLLPVYKSTKHT-AIINSIDGIAGTKVGCGAPELVTGSRDGSV  141
            LATG    +++VW+++    P  + T HT A++  +           +  LV    D SV
Sbjct  213  LATGSRDKQIKVWNMDGR--PGLEHTIHTIAVVGRVKWRPERTYHIASCALVV---DYSV  267

Query  142  MVWDVRQKDIPVAKF  156
             VWD+R+  IP A F
Sbjct  268  HVWDIRRPYIPFASF  282


 Score = 30.0 bits (66),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 29/148 (20%), Positives = 62/148 (42%), Gaps = 11/148 (7%)

Query  15   KDVNYSVHEVKWIPSSAKFVAMGGKSNGTGIVEIYAMSGDGLEKISEFAKADQFKCGTFE  74
            ++++YS ++V W    +  +A    +   G+V ++ +S  G +K        +    T  
Sbjct  62   QNLSYSANDVAWSTLDSNLLATAATN---GVVSVWDLSKFGRQKQLLVYNEHERTAHTVT  118

Query  75   ASSLRARHLATGDFGGRLQVWDLEDSLLPVYKSTKHTAIINSIDGIAGTKVGCGAPELVT  134
              S     L +G   G ++ +D+          + +T   NS + +   K       + +
Sbjct  119  FHSSEPNILISGSQDGTIKCFDIRSD------KSINTYFCNS-ESVRDVKFSPHTQNIFS  171

Query  135  G-SRDGSVMVWDVRQKDIPVAKFLPSEG  161
              S +G+V +WD+R+ D  + +F    G
Sbjct  172  AVSENGTVQLWDMRKWDKCMVQFTAHYG  199



Lambda      K        H
   0.313    0.128    0.351 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6570412396


Query= XP_031327442.1 JNK1/MAPK8-associated membrane protein-like [Photinus
pyralis]

Length=299
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

INSR_DROME  unnamed protein product                                   29.3    5.8  
Q9W0F4_DROME  unnamed protein product                                 28.9    5.8  
Q9W0F1_DROME  unnamed protein product                                 28.5    6.4  


>INSR_DROME unnamed protein product
Length=2144

 Score = 29.3 bits (64),  Expect = 5.8, Method: Composition-based stats.
 Identities = 9/23 (39%), Positives = 17/23 (74%), Gaps = 1/23 (4%)

Query  19   GEC-GACPRGYRRNDSTFICDPC  40
            G+C   CP GY+++++  +C+PC
Sbjct  616  GQCITHCPTGYQKSENKRMCEPC  638


>Q9W0F4_DROME unnamed protein product
Length=973

 Score = 28.9 bits (63),  Expect = 5.8, Method: Compositional matrix adjust.
 Identities = 20/63 (32%), Positives = 32/63 (51%), Gaps = 1/63 (2%)

Query  48   DWLYLGFMVLLALVLHWFFIDLVVMRRNFNKEVIMLHCSAFIEIVLACVLTLLSTE-PFG  106
            D+L    +    LVL W  +  V++    ++E+  +HCS+ I I+LA V    + E P G
Sbjct  398  DYLVDSLIDNCELVLDWKSMIAVLLENPKSRELSDIHCSSLIAILLAGVKQATAGEIPPG  457

Query  107  TLT  109
              T
Sbjct  458  RYT  460


>Q9W0F1_DROME unnamed protein product
Length=330

 Score = 28.5 bits (62),  Expect = 6.4, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 24/49 (49%), Gaps = 9/49 (18%)

Query  23   ACPRGYRRNDSTFICDPCTDNP----LFY-----DWLYLGFMVLLALVL  62
            A PRG   +DS FI  P   +     LFY      WL+LGF V + LV 
Sbjct  91   AAPRGPIPSDSMFIYRPDKRHEIWRFLFYMVLHAGWLHLGFNVAVQLVF  139



Lambda      K        H
   0.313    0.128    0.351 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6570412396


Query= XP_031327443.1 uncharacterized protein LOC116158753 [Photinus
pyralis]

Length=162
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O97267_PLAF7  unnamed protein product                                 36.6    0.006
PRP39_DROME  unnamed protein product                                  29.3    1.6  


>O97267_PLAF7 unnamed protein product
Length=2114

 Score = 36.6 bits (83),  Expect = 0.006, Method: Composition-based stats.
 Identities = 35/127 (28%), Positives = 51/127 (40%), Gaps = 34/127 (27%)

Query  1    MKIKVIDQRLCAKSALKMLA------------------LVLVASLLASAQC----IPLDA  38
            +K+ V+   L  + +LK+LA                  L  +  +L    C    + L  
Sbjct  443  VKLIVVGVNLATEKSLKLLAGCTENEECLRVIKCEWNDLTNITKILTDKICNTGSVELPK  502

Query  39   PEKNESPLQAEQPKGEETKLPEKAPEDLKVPEISPNPV----PESGPALPEDIGPLSDDN  94
            PE+N  P+  E+P  EE   P + P     PE +PNPV    PE  P   E   P  + N
Sbjct  503  PEENPEPV--EKPNPEENPNPVEKP----TPEENPNPVEKPTPEENPNPVEK--PEPEKN  554

Query  95   PAVGQPD  101
            P +   D
Sbjct  555  PCINMED  561


>PRP39_DROME unnamed protein product
Length=1066

 Score = 29.3 bits (64),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 28/64 (44%), Gaps = 13/64 (20%)

Query  112   WGWGYRRPYY------------SGWRSYYSSPWRRWGYGNYGYGRGFGGWGWGRG-WGWR  158
             + +G   PYY            +  ++ Y S + +WGYG+ G     GG G+  G W   
Sbjct  1003  YNYGAANPYYGQQNTAAAYPSQTPQQASYDSYYNQWGYGSGGASANSGGSGYNYGQWSGY  1062

Query  159   GGYW  162
             G Y+
Sbjct  1063  GNYY  1066



Lambda      K        H
   0.313    0.128    0.351 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6570412396


Query= XP_031327444.1 uncharacterized protein LOC116158754 [Photinus
pyralis]

Length=145
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

OB99A_DROME  unnamed protein product                                  37.7    8e-04
OB76A_DROME  unnamed protein product                                  32.7    0.048
C5210_DROME  unnamed protein product                                  30.0    0.66 


>OB99A_DROME unnamed protein product
Length=142

 Score = 37.7 bits (86),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 32/79 (41%), Gaps = 11/79 (14%)

Query  71   DYPDDRPYWCYTKCMASRIGLYNVSLGEFEYVGRPRDLTKELYDH----------CAPKY  120
            +YP+D    CY KC+ ++ GL++V  G F      + L     DH          C  K 
Sbjct  51   EYPNDAKTQCYIKCVFTKWGLFDVQSG-FNVENIHQQLVGNHADHNEAFHASLAACVDKN  109

Query  121  RDESDECRKVYSTIVCFLK  139
               S+ C   Y    C LK
Sbjct  110  EQGSNACEWAYRGATCLLK  128


>OB76A_DROME unnamed protein product
Length=153

 Score = 32.7 bits (73),  Expect = 0.048, Method: Compositional matrix adjust.
 Identities = 17/77 (22%), Positives = 36/77 (47%), Gaps = 10/77 (13%)

Query  71   DYPDDRPYWCYTKCMASRIGLYNV--------SLGEFEYVGRPR--DLTKELYDHCAPKY  120
            ++P  +   CYTKC++   G  N         +L +  ++  P   +++++  + C   +
Sbjct  66   NFPPSQDLMCYTKCVSLMAGTVNKKGEFNAPKALAQLPHLVPPEMMEMSRKSVEACRDTH  125

Query  121  RDESDECRKVYSTIVCF  137
            +   + C +VY T  CF
Sbjct  126  KQFKESCERVYQTAKCF  142


>C5210_DROME unnamed protein product
Length=452

 Score = 30.0 bits (66),  Expect = 0.66, Method: Composition-based stats.
 Identities = 18/49 (37%), Positives = 23/49 (47%), Gaps = 6/49 (12%)

Query  78   YWCYTKCMASRIGLYNVSLGEFEYVGRPRDLTKELYDHCAPKYRDESDE  126
            YW    C AS+I   NV +  +   GRP  LT +  D   P  +D  DE
Sbjct  291  YWLRNNCPASKI---NVGVATY---GRPWKLTDDSGDTGVPPVKDVKDE  333



Lambda      K        H
   0.313    0.128    0.351 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6570412396


Query= XP_031327445.1 diacylglycerol O-acyltransferase 1-like isoform X1
[Photinus pyralis]

Length=404
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q960U8_DROME  unnamed protein product                                 130     4e-33
Q8ST50_DROME  unnamed protein product                                 129     2e-32
DGAT1_DICDI  unnamed protein product                                  104     5e-24


>Q960U8_DROME unnamed protein product
Length=565

 Score = 130 bits (328),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 101/416 (24%), Positives = 187/416 (45%), Gaps = 34/416 (8%)

Query  15   NGLSNWFRLMLAITLAILALDNYRRFGIIMNPFEIVKLVTVTIFNHSWLYGIIFLCI--L  72
            +GL NW  L+L I    L L+N  ++GI +NP +      ++  N    +  + L I  L
Sbjct  137  SGLVNWGFLLLCIGGLRLGLENLLKYGIRINPLDW--FFFISGHNEGEGHNALILSIYSL  194

Query  73   QQMAQTFFIEKLLSWNRLSERQGMTLHAINAFFVAVTFVVTVRFNQASFGVIRTVSSTLV  132
              ++    +EK L+   ++E  G+ +  +N   +    VVT+     +F ++   +    
Sbjct  195  VHISLCLAVEKGLAMEIIAEGLGLFIQIVNIVVLVCLPVVTIHLKGHAFSLMGASTVCFF  254

Query  133  QCSI-IKTWSYAYVN---------------------KELRKQSIK--RDDKGTS---QYP  165
               + +K WSY   N                      EL+K  +    +D+  S   QYP
Sbjct  255  YSVLFLKLWSYVQTNMWCRQTYYQKNPRERRPSITLAELKKGVLNGGEEDEDVSKLVQYP  314

Query  166  RNVTLKNLCEYMLCTPHVQYKLSYPDRQYPTFRECMRQLFLAFSVICGMTFLAKQFIFPE  225
             N+T K+L  Y LC P + Y+L++P       R  +++L      +  +  L +Q+I P 
Sbjct  315  DNLTYKDLL-YFLCAPTLCYELNFPRTSRVRKRFLLKRLLEVVIGVNVVMALFQQWIIPS  373

Query  226  LK--LLKHNHFNGTEKVQRFFTVMVFLHLFWILGYFLFYRIIHPTYAILTGMPHVVFEED  283
            ++  L+  ++ +     +R   + +  HL W+  ++L +         L       F  D
Sbjct  374  VRNSLIPFSNMDVALATERLLKLALPNHLCWLCFFYLMFHSFLNAVGELLNFADRNFYCD  433

Query  284  WWNSPNMDEFWRLWNRLIYDALKLTVMIPLLRKGFGKRTAKTISFLIAGLLHEIVNTLPL  343
            WWN+ N+D FWR WN  ++      + IP+++ G+  R A TI FL + + HE + ++PL
Sbjct  434  WWNANNIDTFWRTWNMPVHRWCVRHLYIPVVQMGYSSRQASTIVFLFSAVFHEYLVSVPL  493

Query  344  GIYSGAGILVTLFEIPVGYVSTYVTRRFGDEVGNTLIWVYFNINHTVSFVFAYITY  399
             IY     +  + +IP+  +S  + ++ G  +GN ++W    +   +  +  Y  Y
Sbjct  494  QIYKIWAFMGMMGQIPLSAISKSIEKKLGPRMGNIIVWASIILGQPLCIMAYYHDY  549


>Q8ST50_DROME unnamed protein product
Length=565

 Score = 129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 100/416 (24%), Positives = 186/416 (45%), Gaps = 34/416 (8%)

Query  15   NGLSNWFRLMLAITLAILALDNYRRFGIIMNPFEIVKLVTVTIFNHSWLYGIIFLCI--L  72
            +GL NW  L+L I    L L+N  ++GI +NP +      ++  N    +  + L I  L
Sbjct  137  SGLVNWGFLLLCIGGLRLGLENLLKYGIRINPLDW--FFFISGHNEGEGHNALILSIYSL  194

Query  73   QQMAQTFFIEKLLSWNRLSERQGMTLHAINAFFVAVTFVVTVRFNQASFGVIRTVSSTLV  132
              ++    +EK L+   ++E  G+ +  +N   +    VVT+     +F ++   +    
Sbjct  195  VHISLCLAVEKGLAMEIIAEGLGLFIQIVNIVVLVCLPVVTIHLKGHAFSLMGASTVCFF  254

Query  133  QCSI-IKTWSYAYVN---------------------KELRKQSIK--RDDKGTS---QYP  165
               + +K WSY   N                      EL+K  +    +D+  S   QYP
Sbjct  255  YSVLFLKLWSYVQTNMWCRQTYYQKNPRERRPSITLAELKKGVLNGGEEDEDVSKLVQYP  314

Query  166  RNVTLKNLCEYMLCTPHVQYKLSYPDRQYPTFRECMRQLFLAFSVICGMTFLAKQFIFPE  225
             N+T  +L  Y LC P + Y+L++P       R  +++L      +  +  L +Q+I P 
Sbjct  315  DNLTYNDLL-YFLCAPTLCYELNFPRTSRVRKRFLLKRLLEVVIGVNVVMALFQQWIIPS  373

Query  226  LK--LLKHNHFNGTEKVQRFFTVMVFLHLFWILGYFLFYRIIHPTYAILTGMPHVVFEED  283
            ++  L+  ++ +     +R   + +  HL W+  ++L +         L       F  D
Sbjct  374  VRNSLIPFSNMDVALATERLLKLALPNHLCWLCFFYLMFHSFLNAVGELLNFADRNFYCD  433

Query  284  WWNSPNMDEFWRLWNRLIYDALKLTVMIPLLRKGFGKRTAKTISFLIAGLLHEIVNTLPL  343
            WWN+ N+D FWR WN  ++      + IP+++ G+  R A TI FL + + HE + ++PL
Sbjct  434  WWNANNIDTFWRTWNMPVHRWCVRHLYIPVVQMGYSSRQASTIVFLFSAVFHEYLVSVPL  493

Query  344  GIYSGAGILVTLFEIPVGYVSTYVTRRFGDEVGNTLIWVYFNINHTVSFVFAYITY  399
             IY     +  + +IP+  +S  + ++ G  +GN ++W    +   +  +  Y  Y
Sbjct  494  QIYKIWAFMGMMGQIPLSAISKSIEKKLGPRMGNIIVWASIILGQPLCIMAYYHDY  549


>DGAT1_DICDI unnamed protein product
Length=617

 Score = 104 bits (260),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 93/344 (27%), Positives = 157/344 (46%), Gaps = 39/344 (11%)

Query  60   HSWLYGIIFLCILQQMAQTFFIEKLLSWNRLSERQGMTLHAINA---FFVAVTFVVTVRF  116
            H W   +I L I   +   + IEK  +   L +R    L  IN      V    ++    
Sbjct  252  HRWPGVMISLMINLFIIAAYLIEKAAAKQLLPDRICYLLRIINCAAVIIVPSGSIIAFSP  311

Query  117  NQASFGVIRTVSSTLVQCSIIKTWSYAYVNKELRKQSIKR-----DDKGTSQYPRNVTLK  171
            N AS G+I  +   L+    +K  SYAY N + RK +        D   TS YP N++L+
Sbjct  312  NPAS-GIIVMI---LICTFSMKIISYAYENSKQRKLNPDNKKFVIDPTNTSIYPNNLSLR  367

Query  172  NLCEYMLCTPHVQYKLSYPDRQYPTFRE--CMRQLFLAFSVICGMTFLAKQFIFPELKLL  229
            +   +ML  P + Y+LSYP  + P  R+   +R++  A S+   + ++  Q++ P    L
Sbjct  368  STYWFMLV-PTLVYQLSYP--RSPKIRKGYLLRRIVEALSLSLLILWMVNQYMLP----L  420

Query  230  KHNHFNGTEKVQRFFTVMVFLHL------FWILGYFLFYRIIHPTYAILTGMPHVVFEED  283
              N     EK+     V   + L       W+LG+++F+ +     A +T      F  D
Sbjct  421  VQNSIEPLEKIDIVLIVERIMKLSLPNLYVWLLGFYVFFHLYLNIVAEITRFGDREFYRD  480

Query  284  WWNSPNMDEFWRLWNRLIYDALKLTVMIPLLRKGFGKRTAKTISFLIAGLLHEIVNTLP-  342
            WWNS  +D FWR WN  ++  + + +  P+ R+GF K     + F ++ + HE+V ++P 
Sbjct  481  WWNSTGLDYFWRTWNMPVHHWMVVLIYTPMRRRGFSKNMGYFMCFFVSAIFHELVISIPF  540

Query  343  --LGIYSGAGILVTLFEIPVGYVSTYVTRRF--GDEVGNTLIWV  382
              L ++   GI+  +       V   +T+    G  +GN + W+
Sbjct  541  HSLKLWGFFGIMSQM-------VLIALTKNLMNGRNLGNVIFWI  577



Lambda      K        H
   0.313    0.128    0.351 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6570412396


Query= XP_031327446.1 diacylglycerol O-acyltransferase 1-like isoform X2
[Photinus pyralis]

Length=403
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q960U8_DROME  unnamed protein product                                 127     7e-32
Q8ST50_DROME  unnamed protein product                                 125     3e-31
DGAT1_DICDI  unnamed protein product                                  99.8    2e-22


>Q960U8_DROME unnamed protein product
Length=565

 Score = 127 bits (319),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 101/416 (24%), Positives = 187/416 (45%), Gaps = 35/416 (8%)

Query  15   NGLSNWFRLMLAITLAILALDNYRRFGIIMNPFEIVKLVTVTIFNHSWLYGIIFLCI--L  72
            +GL NW  L+L I    L L+N  ++GI +NP +      ++  N    +  + L I  L
Sbjct  137  SGLVNWGFLLLCIGGLRLGLENLLKYGIRINPLDW--FFFISGHNEGEGHNALILSIYSL  194

Query  73   QQMAQTFFIEKLLSWNRLSERQGMTLHAINAFFVAVTFVVTVRFNQASFGVIRTVSSTLV  132
              ++    +EK L+   ++E  G+ +  +N   +    VVT+     +F ++   +    
Sbjct  195  VHISLCLAVEKGLAMEIIAEGLGLFIQIVNIVVLVCLPVVTIHLKGHAFSLMGASTVCFF  254

Query  133  QCSI-IKTWSYAYVN---------------------KELRKQSIK--RDDKGTS---QYP  165
               + +K WSY   N                      EL+K  +    +D+  S   QYP
Sbjct  255  YSVLFLKLWSYVQTNMWCRQTYYQKNPRERRPSITLAELKKGVLNGGEEDEDVSKLVQYP  314

Query  166  RNVTLKNLCEYMLCTPHVQYKLSYPDRQYPTFRECMRQLFLAFSVICGMTFLAKQFIFPE  225
             N+T K+L  Y LC P + Y+L++P       R  +++L      +  +  L +Q+I P 
Sbjct  315  DNLTYKDLL-YFLCAPTLCYELNFPRTSRVRKRFLLKRLLEVVIGVNVVMALFQQWIIPS  373

Query  226  LK--LLKHNHFNGTEKVQRFFTVMVFLHLFWILGYFLFYRIIHPTYAILTGMPHVVFEED  283
            ++  L+  ++ +     +R   + +  HL W+  ++L +         L       F  D
Sbjct  374  VRNSLIPFSNMDVALATERLLKLALPNHLCWLCFFYLMFHSFLNAVGELLNFADRNFYCD  433

Query  284  WWNSPNMDEFWRLWNRLIYDALKLTVMIPLLRKGFGKRTAKTISFLIAGLLHE-INTLPL  342
            WWN+ N+D FWR WN  ++      + IP+++ G+  R A TI FL + + HE + ++PL
Sbjct  434  WWNANNIDTFWRTWNMPVHRWCVRHLYIPVVQMGYSSRQASTIVFLFSAVFHEYLVSVPL  493

Query  343  GIYSGAGILVTLFEIPVGYVSTYVTRRFGDEVGNTLIWVYFNINHTVSFVFAYITY  398
             IY     +  + +IP+  +S  + ++ G  +GN ++W    +   +  +  Y  Y
Sbjct  494  QIYKIWAFMGMMGQIPLSAISKSIEKKLGPRMGNIIVWASIILGQPLCIMAYYHDY  549


>Q8ST50_DROME unnamed protein product
Length=565

 Score = 125 bits (314),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 100/416 (24%), Positives = 186/416 (45%), Gaps = 35/416 (8%)

Query  15   NGLSNWFRLMLAITLAILALDNYRRFGIIMNPFEIVKLVTVTIFNHSWLYGIIFLCI--L  72
            +GL NW  L+L I    L L+N  ++GI +NP +      ++  N    +  + L I  L
Sbjct  137  SGLVNWGFLLLCIGGLRLGLENLLKYGIRINPLDW--FFFISGHNEGEGHNALILSIYSL  194

Query  73   QQMAQTFFIEKLLSWNRLSERQGMTLHAINAFFVAVTFVVTVRFNQASFGVIRTVSSTLV  132
              ++    +EK L+   ++E  G+ +  +N   +    VVT+     +F ++   +    
Sbjct  195  VHISLCLAVEKGLAMEIIAEGLGLFIQIVNIVVLVCLPVVTIHLKGHAFSLMGASTVCFF  254

Query  133  QCSI-IKTWSYAYVN---------------------KELRKQSIK--RDDKGTS---QYP  165
               + +K WSY   N                      EL+K  +    +D+  S   QYP
Sbjct  255  YSVLFLKLWSYVQTNMWCRQTYYQKNPRERRPSITLAELKKGVLNGGEEDEDVSKLVQYP  314

Query  166  RNVTLKNLCEYMLCTPHVQYKLSYPDRQYPTFRECMRQLFLAFSVICGMTFLAKQFIFPE  225
             N+T  +L  Y LC P + Y+L++P       R  +++L      +  +  L +Q+I P 
Sbjct  315  DNLTYNDLL-YFLCAPTLCYELNFPRTSRVRKRFLLKRLLEVVIGVNVVMALFQQWIIPS  373

Query  226  LK--LLKHNHFNGTEKVQRFFTVMVFLHLFWILGYFLFYRIIHPTYAILTGMPHVVFEED  283
            ++  L+  ++ +     +R   + +  HL W+  ++L +         L       F  D
Sbjct  374  VRNSLIPFSNMDVALATERLLKLALPNHLCWLCFFYLMFHSFLNAVGELLNFADRNFYCD  433

Query  284  WWNSPNMDEFWRLWNRLIYDALKLTVMIPLLRKGFGKRTAKTISFLIAGLLHE-INTLPL  342
            WWN+ N+D FWR WN  ++      + IP+++ G+  R A TI FL + + HE + ++PL
Sbjct  434  WWNANNIDTFWRTWNMPVHRWCVRHLYIPVVQMGYSSRQASTIVFLFSAVFHEYLVSVPL  493

Query  343  GIYSGAGILVTLFEIPVGYVSTYVTRRFGDEVGNTLIWVYFNINHTVSFVFAYITY  398
             IY     +  + +IP+  +S  + ++ G  +GN ++W    +   +  +  Y  Y
Sbjct  494  QIYKIWAFMGMMGQIPLSAISKSIEKKLGPRMGNIIVWASIILGQPLCIMAYYHDY  549


>DGAT1_DICDI unnamed protein product
Length=617

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 93/340 (27%), Positives = 153/340 (45%), Gaps = 32/340 (9%)

Query  60   HSWLYGIIFLCILQQMAQTFFIEKLLSWNRLSERQGMTLHAINAFFVAVT---FVVTVRF  116
            H W   +I L I   +   + IEK  +   L +R    L  IN   V +     ++    
Sbjct  252  HRWPGVMISLMINLFIIAAYLIEKAAAKQLLPDRICYLLRIINCAAVIIVPSGSIIAFSP  311

Query  117  NQASFGVIRTVSSTLVQCSIIKTWSYAYVNKELRKQSIKR-----DDKGTSQYPRNVTLK  171
            N AS G+I  +   L+    +K  SYAY N + RK +        D   TS YP N++L+
Sbjct  312  NPAS-GIIVMI---LICTFSMKIISYAYENSKQRKLNPDNKKFVIDPTNTSIYPNNLSLR  367

Query  172  NLCEYMLCTPHVQYKLSYPDRQYPTFRE--CMRQLFLAFSVICGMTFLAKQFIFPELKLL  229
            +   +ML  P + Y+LSYP  + P  R+   +R++  A S+   + ++  Q++ P    L
Sbjct  368  STYWFMLV-PTLVYQLSYP--RSPKIRKGYLLRRIVEALSLSLLILWMVNQYMLP----L  420

Query  230  KHNHFNGTEKVQRFFTVMVFLHL------FWILGYFLFYRIIHPTYAILTGMPHVVFEED  283
              N     EK+     V   + L       W+LG+++F+ +     A +T      F  D
Sbjct  421  VQNSIEPLEKIDIVLIVERIMKLSLPNLYVWLLGFYVFFHLYLNIVAEITRFGDREFYRD  480

Query  284  WWNSPNMDEFWRLWNRLIYDALKLTVMIPLLRKGFGKRTAKTISFLIAGLLHEINTLPLG  343
            WWNS  +D FWR WN  ++  + + +  P+ R+GF K     + F ++ + HE   L + 
Sbjct  481  WWNSTGLDYFWRTWNMPVHHWMVVLIYTPMRRRGFSKNMGYFMCFFVSAIFHE---LVIS  537

Query  344  IYSGAGILVTLFEIPVGYVSTYVTRRF--GDEVGNTLIWV  381
            I   +  L   F I    V   +T+    G  +GN + W+
Sbjct  538  IPFHSLKLWGFFGIMSQMVLIALTKNLMNGRNLGNVIFWI  577



Lambda      K        H
   0.313    0.128    0.351 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6570412396


Query= XP_031327447.1 techylectin-5B-like [Photinus pyralis]

Length=215
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TL5B_TACTR  unnamed protein product                                   202     1e-64
TL5A_TACTR  unnamed protein product                                   150     2e-44
SCA_DROME  unnamed protein product                                    116     6e-30


>TL5B_TACTR unnamed protein product
Length=316

 Score = 202 bits (514),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 98/195 (50%), Positives = 134/195 (69%), Gaps = 6/195 (3%)

Query  19   LKVFCEQDVADGGWTLIQRRDDFGEPRENFNRDWNDYKNGFGDPAKEFWLGNENIYMLTN  78
            + VFC+ + A GGWT+IQRR DFG+P +NF + W  YKNGFG+  KEFWLGN+ I++LTN
Sbjct  120  ISVFCDMETAGGGWTVIQRRGDFGQPIQNFYQTWESYKNGFGNLTKEFWLGNDIIFVLTN  179

Query  79   NEEYILRVELEDFEGNKRYAQYSHFKIHSEAEYYKLELDGYEGNAGDSLNDPWYGSNHSP  138
             +  +LRV+LEDFEG +RYA+   F + SE E YK+    Y+G+AGDSL+      N+ P
Sbjct  180  QDSVVLRVDLEDFEGGRRYAEAVEFLVRSEIELYKMSFKTYKGDAGDSLSQ----HNNMP  235

Query  139  FSTYNRDNDRSSLNCASMLKGGWWWKSCGRG-LNGLYLHDPQDLTARQGIVWFRWRGWDY  197
            F+T +RDND+   NCA   KGGWW+ +C    LNG+YL  P + +A  G+ W++WRG +Y
Sbjct  236  FTTKDRDNDKWEKNCAEAYKGGWWYNACHHSNLNGMYLRGPHEESA-VGVNWYQWRGHNY  294

Query  198  TLKKSIMMIKPKGLV  212
            +LK S M I+P   V
Sbjct  295  SLKVSEMKIRPIIFV  309


>TL5A_TACTR unnamed protein product
Length=292

 Score = 150 bits (379),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/209 (41%), Positives = 121/209 (58%), Gaps = 7/209 (3%)

Query  2    RQSGVYYLQIRG-TTYWFLKVFCEQDVADGGWTLIQRRDDFGEPRENFNRDWNDYKNGFG  60
            R SG Y +  +   T   L V+C+ +   GGWT+IQRR ++G P + F + W +YK GFG
Sbjct  81   RSSGGYRIWPKSWMTVGTLNVYCDMETDGGGWTVIQRRGNYGNPSDYFYKPWKNYKLGFG  140

Query  61   DPAKEFWLGNENIYMLTNNEEYILRVELEDFEGNKRYAQYSHFKIHSEAEYYKLELDGYE  120
            +  K+FWLGN+ I+ LTN   Y++R +L+D E + RYA Y  F I +E   Y L +  Y 
Sbjct  141  NIEKDFWLGNDRIFALTNQRNYMIRFDLKDKENDTRYAIYQDFWIENEDYLYCLHIGNYS  200

Query  121  GNAGDSLNDPWYGSNHSPFSTYNRDNDRSSLNCASMLKGGWWWKSCGRG-LNGLYLHDPQ  179
            G+AG+S        N   FST ++D+D    +CA   KGGWW+  C    LNGLYL+   
Sbjct  201  GDAGNSFGR----HNGHNFSTIDKDHDTHETHCAQTYKGGWWYDRCHESNLNGLYLNGEH  256

Query  180  DLTARQGIVWFRWRGWDYTLKKSIMMIKP  208
            +  A  GI W  W+G+ Y+L +  M I+P
Sbjct  257  NSYA-DGIEWRAWKGYHYSLPQVEMKIRP  284


>SCA_DROME unnamed protein product
Length=799

 Score = 116 bits (291),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 69/179 (39%), Positives = 93/179 (52%), Gaps = 18/179 (10%)

Query  31   GWTLIQRRDDFGEPRENFNRDWNDYKNGFGDPAKEFWLGNENIYMLTNNEEYILRVELED  90
            GWT +QRR D      +FNR W DY  GFG P  EFW+GNE ++ LT +    L+V+++D
Sbjct  572  GWTTVQRRFD---GSADFNRSWADYAQGFGAPGGEFWIGNEQLHHLTLDNCSRLQVQMQD  628

Query  91   FEGNKRYAQYSHFKIHSEAEYYKLELDGYEGNAGDSLNDPWYGSNHSPFSTYNRDNDRSS  150
               N   A+Y  F I S A+ Y+L +  Y GNA D+LN   Y      FS  + D D S 
Sbjct  629  IYDNVWVAEYKRFYISSRADGYRLHIAEYSGNASDALN---YQQGMQ-FSAIDDDRDISQ  684

Query  151  LNCASMLKGGWWWKSCGRG-LNGLYLHDPQDLTARQGIVWF-RWRGWDYTLKKSIMMIK  207
             +CA+  +GGWW+  C    LNG Y           G+ WF   R     +K S M++K
Sbjct  685  THCAANYEGGWWFSHCQHANLNGRY---------NLGLTWFDAARNEWIAVKSSRMLVK  734



Lambda      K        H
   0.313    0.128    0.351 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6570412396


Query= XP_031327448.1 uncharacterized protein LOC116158758 [Photinus
pyralis]

Length=290
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q1LZ24_DROME  unnamed protein product                                 52.4    2e-07
Q9VSB8_DROME  unnamed protein product                                 45.8    2e-05
Q7YU57_DROME  unnamed protein product                                 33.1    0.27 


>Q1LZ24_DROME unnamed protein product
Length=586

 Score = 52.4 bits (124),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/105 (30%), Positives = 54/105 (51%), Gaps = 8/105 (8%)

Query  22   LIHLYEEHPCLYLTSCNSYKNKNVRNAAYNSITAELNKNLNKSLTVKDVQTKLHDLRTQY  81
            LI  Y+EHPCL+  S   Y+++  R+ AY +I   +++  N   TV++++  L  L  QY
Sbjct  202  LIQAYKEHPCLWNPSDEHYQDEPARSMAYEAIMERMDRKANVLFTVEELKKTLEQLHVQY  261

Query  82   LSELGKIKKSKVSGTSSDEVYTPKWQYFEILAFIGQSTVVTEGES  126
               L   ++ K+ G ++        +YF    F+  + VVT  E+
Sbjct  262  TLALETKQRGKLVGLAA--------RYFAKCEFLSVAPVVTPREN  298


>Q9VSB8_DROME unnamed protein product
Length=348

 Score = 45.8 bits (107),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/98 (31%), Positives = 50/98 (51%), Gaps = 5/98 (5%)

Query  21   VLIHLYEEHPCLYLTSCNSYKNKNVRNAAYNSITAELNKNLNKSLTVKDVQTKLHDLRTQ  80
              I  Y + P L+ TS   Y N+  R  AY  +   +   L +  TV+DV+ K++ LRT 
Sbjct  25   AFIQTYRDLPVLWDTSLRDYTNREKRAEAYLRLVP-IYHYLKRDATVEDVKKKINTLRTN  83

Query  81   YLSELGKIKKSKVSGTSSDEVYTPKWQYFEILAFIGQS  118
            Y  EL  ++ +  SG+    +++P+   F+ L F+  S
Sbjct  84   YRKELKVVESALRSGS----LHSPRCWTFQELDFLRNS  117


>Q7YU57_DROME unnamed protein product
Length=1105

 Score = 33.1 bits (74),  Expect = 0.27, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 43/93 (46%), Gaps = 22/93 (24%)

Query  15  TPDVTTV------LIHLYEEHPCLYLTSCNSYKNKNVRNAAYNSITAELNKNLNKSLTVK  68
           TP +TTV      LI     +P LY ++C  Y+N   R   +++I+ E          V 
Sbjct  5   TPPITTVATGYSVLIEAVSAYPLLYDSTCTGYQNTRHRFLIWSAISNE----------VH  54

Query  69  DVQTKLH----DLRTQYLSELGKIKKSKVSGTS  97
           D  TKL      L+T+Y  EL  I + +  GTS
Sbjct  55  DKATKLMKCWLKLQTRYEWEL--IHRPRHIGTS  85



Lambda      K        H
   0.313    0.128    0.351 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6570412396


Query= XP_031327449.1 transcription initiation factor TFIID subunit 6-like
[Photinus pyralis]

Length=650
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TAF6_DROME  unnamed protein product                                   672     0.0  
Q8IG94_DROME  unnamed protein product                                 209     2e-59
Q9VND0_DROME  unnamed protein product                                 209     3e-59


>TAF6_DROME unnamed protein product
Length=606

 Score = 672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/537 (63%), Positives = 405/537 (75%), Gaps = 32/537 (6%)

Query  9    LYGTSFSIESMKVIAESIGIANLPDDAAKELADDISFRLKHFIQDSAKFMHHARRNKLMY  68
            LYG+S S ESMKVIAESIG+ +L DDAAKELA+D+S +LK  +QD+AKFM+HA+R KL  
Sbjct  16   LYGSSISAESMKVIAESIGVGSLSDDAAKELAEDVSIKLKRIVQDAAKFMNHAKRQKLSV  75

Query  69   HDIDATLRSRNIEPQYGFHSVDSLPFRFASGGGRELHFIEEKEVDLHDFVTNTNVKAPLD  128
             DID +L+ RN+EPQYGF + D +PFRFASGGGRELHF E+KE+DL +  +  +VK PLD
Sbjct  76   RDIDMSLKVRNVEPQYGFVAKDFIPFRFASGGGRELHFTEDKEIDLGEITSTNSVKIPLD  135

Query  129  ITLRSHWLCIDGIQPAIPENPPPQDKEIQKLESVDPVNKMNKP-NKESSGKPSTGK-QKL  186
            +TLRSHW  ++G+QP +PENPPP  K+ Q L+SV+PV KM++  NK+++GKP+TGK  KL
Sbjct  136  LTLRSHWFVVEGVQPTVPENPPPLSKDSQLLDSVNPVIKMDQGLNKDAAGKPTTGKIHKL  195

Query  187  RNVETVQIKQLATHELSVEQQLYYKEITEACVGSDETRRIEALQSLALDPGLYEMLPRMC  246
            +NVET+ +KQLATHELSVEQQLYYKEITEACVGSDE RR EALQSL  DPGL+EMLPRMC
Sbjct  196  KNVETIHVKQLATHELSVEQQLYYKEITEACVGSDEPRRGEALQSLGSDPGLHEMLPRMC  255

Query  247  TFIIEGVRVNVVQNNLALLIYLMRMVKALLDNQSLYLEKYLHELIPSVITCIVSKQLCTR  306
            TFI EGV+VNVVQNNLALLIYLMRMV+ALLDN SL+LEKYLHELIPSV+TCIVSKQLC R
Sbjct  256  TFIAEGVKVNVVQNNLALLIYLMRMVRALLDNPSLFLEKYLHELIPSVMTCIVSKQLCMR  315

Query  307  PEFDNHWALRDFASRLNAQICKNFNTSTNNIQTRVTRIFTNSVQQGDKLPLSSLYGALHG  366
            PE DNHWALRDFASRL AQICKNFNT TNN+QTRVTRIF+ ++Q  DK  LSSLYG++ G
Sbjct  316  PELDNHWALRDFASRLMAQICKNFNTLTNNLQTRVTRIFSKALQN-DKTHLSSLYGSIAG  374

Query  367  LSELGTEVIKTFILPHIKTIGARIEVHLEGSLMSNLDKVASGHIKALLVKVLAPIIKNLR  426
            LSELG EVIK FI+P +K I  RIE HL G+ +SN DK A+GHI+A+L K   PI++ +R
Sbjct  375  LSELGGEVIKVFIIPRLKFISERIEPHLLGTSISNTDKTAAGHIRAMLQKCCPPILRQMR  434

Query  427  APPDYFEEYKADYGYLGPTLQSAVMKARTQPPQPV---------TPTNTSIAPVSATISR  477
            + PD  E+YK D+G+LGP+L  AV+K R  P   +         T   TS A  + TI R
Sbjct  435  SAPDTAEDYKNDFGFLGPSLCQAVVKVRNAPASSIVTLSSNTINTAPITSAAQTATTIGR  494

Query  478  NITAPMGIVQNTVTPG-------RTIVMNQPNRGTPTTGNQKFVFVTQRS--QGAAQ  525
                 M   Q   +PG       R I  NQP         QKFV VTQ S  QG A+
Sbjct  495  ---VSMPTTQRQGSPGVSSLPQIRAIQANQP--------AQKFVIVTQNSPQQGQAK  540


>Q8IG94_DROME unnamed protein product
Length=566

 Score = 209 bits (532),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 110/289 (38%), Positives = 180/289 (62%), Gaps = 6/289 (2%)

Query  170  KPNKESSGKPSTGKQKLRNVETVQIKQLATHELSVEQQLYYKEITEACVGSDETRRIEAL  229
            +P  E+S +P         VE V +K    + LS+EQQ +++ +TEACVG  E+RR+ AL
Sbjct  154  EPVPETSLEPPPMHTGWLKVEQVLLKPSKRYPLSMEQQNFFEFVTEACVGDLESRRVLAL  213

Query  230  QSLALDPGLYEMLPRMCTFIIEGVRVNVVQNNLALLIYLMRMVKALLDNQSLYLEKYLHE  289
            ++++ DP L E+LPR+  FI + V +NV Q NL LL+YLMRMV+ALL NQ   L +YLH 
Sbjct  214  KAISTDPSLEELLPRLTKFIADAVAINVAQQNLPLLLYLMRMVRALLGNQRFSLLQYLHL  273

Query  290  LIPSVITCIVSKQLCTRPEFDNHWALRDFASRLNAQICKNFNTSTNNIQTRVTRIFTNSV  349
            L+P+V++C+++KQ+C  P  ++HWALR+++  + A I + F+ + N I  RV  ++  ++
Sbjct  274  LLPAVLSCLLAKQVCASPNSEDHWALREYSGNIMAHIVRQFDAADNGILPRVIGVYNKAL  333

Query  350  QQGDKLPLSSLYGALHGLSELGTEVIKTFILPHIKTIGARIEVHLEG---SLMSNLDKVA  406
                K PL++++GA+ GL ++G   ++  ILP +K +   I+ H+     S  S++D+ A
Sbjct  334  L---KKPLTTVFGAVIGLGKMGNHAVRACILPQLKYLSEHIDSHMAASNDSPSSSVDRQA  390

Query  407  SGHIKALLVKVLAPIIKNLRAPPDYFEEYKADYGYLGPTLQSAVMKART  455
              +I+  L+K+ +P++  +  PPD  EE+   YG LG  +   V   RT
Sbjct  391  VKYIRHRLMKMCSPVLMGIHQPPDLPEEFMERYGSLGTLMSDGVTVMRT  439


>Q9VND0_DROME unnamed protein product
Length=589

 Score = 209 bits (532),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 110/289 (38%), Positives = 180/289 (62%), Gaps = 6/289 (2%)

Query  170  KPNKESSGKPSTGKQKLRNVETVQIKQLATHELSVEQQLYYKEITEACVGSDETRRIEAL  229
            +P  E+S +P         VE V +K    + LS+EQQ +++ +TEACVG  E+RR+ AL
Sbjct  150  EPVPETSLEPPPMHTGWLKVEQVLLKPSKRYPLSMEQQNFFELVTEACVGDLESRRVLAL  209

Query  230  QSLALDPGLYEMLPRMCTFIIEGVRVNVVQNNLALLIYLMRMVKALLDNQSLYLEKYLHE  289
            ++++ DP L E+LPR+  FI + V +NV Q NL LL+YLMRMV+ALL NQ   L +YLH 
Sbjct  210  KAISTDPSLEELLPRLTKFIADAVAINVAQQNLPLLLYLMRMVRALLGNQRFSLLQYLHL  269

Query  290  LIPSVITCIVSKQLCTRPEFDNHWALRDFASRLNAQICKNFNTSTNNIQTRVTRIFTNSV  349
            L+P+V++C+++KQ+C  P  ++HWALR+++  + A I + F+ + N I  RV  ++  ++
Sbjct  270  LLPAVLSCLLAKQVCASPNSEDHWALREYSGNIMAHIVRQFDAADNGILPRVIGVYNKAL  329

Query  350  QQGDKLPLSSLYGALHGLSELGTEVIKTFILPHIKTIGARIEVHLEG---SLMSNLDKVA  406
                K PL++++GA+ GL ++G   ++  ILP +K +   I+ H+     S  S++D+ A
Sbjct  330  L---KKPLTTVFGAVIGLGKMGNHAVRACILPQLKYLSEHIDSHMAASNDSPSSSVDRQA  386

Query  407  SGHIKALLVKVLAPIIKNLRAPPDYFEEYKADYGYLGPTLQSAVMKART  455
              +I+  L+K+ +P++  +  PPD  EE+   YG LG  +   V   RT
Sbjct  387  VKYIRHRLMKMCSPVLMGIHQPPDLPEEFMERYGSLGTLMSDGVTVMRT  435



Lambda      K        H
   0.313    0.128    0.351 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6570412396


Query= XP_031327450.1 protein ALP1-like isoform X1 [Photinus pyralis]

Length=418
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

LIG_DROME  unnamed protein product                                    33.1    0.58 
LIN2_CAEEL  unnamed protein product                                   30.0    4.3  
Q8I629_PLAF7  unnamed protein product                                 29.3    6.4  


>LIG_DROME unnamed protein product
Length=1375

 Score = 33.1 bits (74),  Expect = 0.58, Method: Composition-based stats.
 Identities = 19/71 (27%), Positives = 36/71 (51%), Gaps = 4/71 (6%)

Query  196  FSVVLLAVCDSKYRFTFVDIGAYGSQSDGGVLKNSVFGKCLEESTLKIPKPTSLPSSEVV  255
            +S    +V  S+Y  T+ ++ A G+ +  G  + S     +  + +K+P P+ +P+S V 
Sbjct  526  YSQTSTSVGVSQYPNTYANVFASGTAAGAGTAEQSQQQPQIRRARVKLPPPSKIPASAVE  585

Query  256  LPYFLVGDEAF  266
            +P    GD A 
Sbjct  586  MP----GDNAL  592


>LIN2_CAEEL unnamed protein product
Length=961

 Score = 30.0 bits (66),  Expect = 4.3, Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 39/83 (47%), Gaps = 11/83 (13%)

Query  6    VLLGLSGVLLCYAAAKIIQRRPRRFK------TRPINRDRKLTGNYRYY----QKLKNLD  55
            VLLG  GV   +    +I R P RF       TRP  +D ++ G + Y+    Q + ++ 
Sbjct  778  VLLGAHGVGRRHIKNTLIHRHPNRFAYPIPHTTRPPRKD-EVDGKHYYFVTNEQMMADIQ  836

Query  56   SPQFFKYTRMSLPIFQKLLDMIK  78
            + ++ +Y      ++   L+ I+
Sbjct  837  NNEYLEYGTHEESMYGTKLETIR  859


>Q8I629_PLAF7 unnamed protein product
Length=347

 Score = 29.3 bits (64),  Expect = 6.4, Method: Compositional matrix adjust.
 Identities = 35/141 (25%), Positives = 54/141 (38%), Gaps = 27/141 (19%)

Query  213  VDIGAYGSQSDGGVLKNSVFGKCLEESTLKIPKPTSLPSSEVVLPYFLVGDEAFPLKEYI  272
            + IG +G  S+     N     CL   ++K  K   L         F VG   + L   +
Sbjct  213  IKIGDFGISSEQSSNNNLGTLNCLSYESIKFKKTNKLS------DLFQV