BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_018560752.1 uncharacterized protein LOC108903154 [Anoplophora
glabripennis]

Length=128
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A0A0B4KEJ6_DROME  unnamed protein product                             33.1    0.054
A0A0B4K7L3_DROME  unnamed protein product                             32.7    0.070
B7YZD9_DROME  unnamed protein product                                 32.7    0.076
M9NF18_DROME  unnamed protein product                                 30.0    0.54 
Q9VYW5_DROME  unnamed protein product                                 30.0    0.54 


>A0A0B4KEJ6_DROME unnamed protein product
Length=1586

 Score = 33.1 bits (74),  Expect = 0.054, Method: Compositional matrix adjust.
 Identities = 25/79 (32%), Positives = 36/79 (46%), Gaps = 7/79 (9%)

Query  26    YNLVPSPVVIPQTYNGIGVIPGVIQAPQQQTDISHPAVVENAIAESQLPPELLNPFYKNP  85
             Y  +P+P+   Q  N     PG I+         H +V E    E+ L    L+P Y   
Sbjct  1095  YGTMPNPIKSAQ--NSYKNQPGRIE----NYTTGHSSVSEKEKKEN-LEQSKLSPLYTEG  1147

Query  86    GVASALAKESWFTNKEFLV  104
              ++ ALAKES +T+   LV
Sbjct  1148  NLSRALAKESGYTSDSNLV  1166


>A0A0B4K7L3_DROME unnamed protein product
Length=2505

 Score = 32.7 bits (73),  Expect = 0.070, Method: Compositional matrix adjust.
 Identities = 25/79 (32%), Positives = 36/79 (46%), Gaps = 7/79 (9%)

Query  26    YNLVPSPVVIPQTYNGIGVIPGVIQAPQQQTDISHPAVVENAIAESQLPPELLNPFYKNP  85
             Y  +P+P+   Q  N     PG I+         H +V E    E+ L    L+P Y   
Sbjct  2014  YGTMPNPIKSAQ--NSYKNQPGRIE----NYTTGHSSVSEKEKKEN-LEQSKLSPLYTEG  2066

Query  86    GVASALAKESWFTNKEFLV  104
              ++ ALAKES +T+   LV
Sbjct  2067  NLSRALAKESGYTSDSNLV  2085


>B7YZD9_DROME unnamed protein product
Length=2365

 Score = 32.7 bits (73),  Expect = 0.076, Method: Compositional matrix adjust.
 Identities = 25/79 (32%), Positives = 36/79 (46%), Gaps = 7/79 (9%)

Query  26    YNLVPSPVVIPQTYNGIGVIPGVIQAPQQQTDISHPAVVENAIAESQLPPELLNPFYKNP  85
             Y  +P+P+   Q  N     PG I+         H +V E    E+ L    L+P Y   
Sbjct  1874  YGTMPNPIKSAQ--NSYKNQPGRIE----NYTTGHSSVSEKEKKEN-LEQSKLSPLYTEG  1926

Query  86    GVASALAKESWFTNKEFLV  104
              ++ ALAKES +T+   LV
Sbjct  1927  NLSRALAKESGYTSDSNLV  1945


>M9NF18_DROME unnamed protein product
Length=1047

 Score = 30.0 bits (66),  Expect = 0.54, Method: Composition-based stats.
 Identities = 21/60 (35%), Positives = 30/60 (50%), Gaps = 6/60 (10%)

Query  32   PVVIPQTYNGIGVIPGVIQAPQQQT--DISHPAVVENAIAESQLPPELLNPFYKNPGVAS  89
            P V+P  ++G+ V P V   PQ++T    + PA + N   E Q  P L  P   +P  AS
Sbjct  193  PGVLP--WSGLKVFPRV--EPQEETAAGTTKPAHITNKSEEQQQQPSLTTPIMTSPLDAS  248


>Q9VYW5_DROME unnamed protein product
Length=1048

 Score = 30.0 bits (66),  Expect = 0.54, Method: Composition-based stats.
 Identities = 21/60 (35%), Positives = 30/60 (50%), Gaps = 6/60 (10%)

Query  32   PVVIPQTYNGIGVIPGVIQAPQQQT--DISHPAVVENAIAESQLPPELLNPFYKNPGVAS  89
            P V+P  ++G+ V P V   PQ++T    + PA + N   E Q  P L  P   +P  AS
Sbjct  193  PGVLP--WSGLKVFPRV--EPQEETAAGTTKPAHITNKSEEQQQQPSLTTPIMTSPLDAS  248



Lambda      K        H
   0.321    0.136    0.397 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 566763464


Query= XP_018560753.2 uncharacterized protein LOC108903155 isoform X1
[Anoplophora glabripennis]

Length=286
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O44203_DROME  unnamed protein product                                 50.8    5e-07
O61602_DROME  unnamed protein product                                 50.8    5e-07
O16114_DROME  unnamed protein product                                 50.8    5e-07
O17430_DROME  unnamed protein product                                 50.8    5e-07
Q9W1M6_DROME  unnamed protein product                                 50.8    5e-07


>O44203_DROME unnamed protein product
Length=484

 Score = 50.8 bits (120),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/111 (29%), Positives = 56/111 (50%), Gaps = 2/111 (2%)

Query  26   QKRPRSVNWEEKEKLVLLDGVKDNIKVLECKRKLTTANRDKAAAWNIIKRKLEVQ-GYFR  84
            +KR R+ NW  +EK  LLD  + +++++E KR        K  AW II +K   Q G  R
Sbjct  51   KKRERTQNWNHQEKKYLLDLCRKDMRIIENKRLDAGLTAVKNKAWKIIHQKFSNQFGTDR  110

Query  85   DIPKIKQEWQRLKVQAKKNICSYKKDKLKTGGGPAPN-EPTELDWIIYDLI  134
               ++K++W+R+K   +  I  Y     + G   A   +P+   + ++D +
Sbjct  111  TCNRLKEQWRRMKACTRNEILDYNNRLARFGAEVADRKKPSPFTFEVWDFM  161


>O61602_DROME unnamed protein product
Length=483

 Score = 50.8 bits (120),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/111 (29%), Positives = 56/111 (50%), Gaps = 2/111 (2%)

Query  26   QKRPRSVNWEEKEKLVLLDGVKDNIKVLECKRKLTTANRDKAAAWNIIKRKLEVQ-GYFR  84
            +KR R+ NW  +EK  LLD  + +++++E KR        K  AW II +K   Q G  R
Sbjct  51   KKRERTQNWNHQEKKYLLDLCRKDMRIIENKRLDAGLTAVKNKAWKIIHQKFSNQFGTDR  110

Query  85   DIPKIKQEWQRLKVQAKKNICSYKKDKLKTGGGPAPN-EPTELDWIIYDLI  134
               ++K++W+R+K   +  I  Y     + G   A   +P+   + ++D +
Sbjct  111  TCNRLKEQWRRMKACTRNEILDYNNRLARFGAEVADRKKPSPFTFEVWDFM  161


>O16114_DROME unnamed protein product
Length=484

 Score = 50.8 bits (120),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/111 (29%), Positives = 56/111 (50%), Gaps = 2/111 (2%)

Query  26   QKRPRSVNWEEKEKLVLLDGVKDNIKVLECKRKLTTANRDKAAAWNIIKRKLEVQ-GYFR  84
            +KR R+ NW  +EK  LLD  + +++++E KR        K  AW II +K   Q G  R
Sbjct  51   KKRERTQNWNHQEKKYLLDLCRKDMRIIENKRLDAGLTAVKNKAWKIIHQKFSNQFGTDR  110

Query  85   DIPKIKQEWQRLKVQAKKNICSYKKDKLKTGGGPAPN-EPTELDWIIYDLI  134
               ++K++W+R+K   +  I  Y     + G   A   +P+   + ++D +
Sbjct  111  TCNRLKEQWRRMKACTRNEILDYNNRLARFGAEVADRKKPSPFTFEVWDFM  161


>O17430_DROME unnamed protein product
Length=490

 Score = 50.8 bits (120),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/111 (29%), Positives = 56/111 (50%), Gaps = 2/111 (2%)

Query  26   QKRPRSVNWEEKEKLVLLDGVKDNIKVLECKRKLTTANRDKAAAWNIIKRKLEVQ-GYFR  84
            +KR R+ NW  +EK  LLD  + +++++E KR        K  AW II +K   Q G  R
Sbjct  57   KKRERTQNWNHQEKKYLLDLCRKDMRIIENKRLDAGLTAVKNKAWKIIHQKFSNQFGTDR  116

Query  85   DIPKIKQEWQRLKVQAKKNICSYKKDKLKTGGGPAPN-EPTELDWIIYDLI  134
               ++K++W+R+K   +  I  Y     + G   A   +P+   + ++D +
Sbjct  117  TCNRLKEQWRRMKACTRNEILDYNNRLARFGAEVADRKKPSPFTFEVWDFM  167


>Q9W1M6_DROME unnamed protein product
Length=489

 Score = 50.8 bits (120),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/111 (29%), Positives = 56/111 (50%), Gaps = 2/111 (2%)

Query  26   QKRPRSVNWEEKEKLVLLDGVKDNIKVLECKRKLTTANRDKAAAWNIIKRKLEVQ-GYFR  84
            +KR R+ NW  +EK  LLD  + +++++E KR        K  AW II +K   Q G  R
Sbjct  57   KKRERTQNWNHQEKKYLLDLCRKDMRIIENKRLDAGLTAVKNKAWKIIHQKFSNQFGTDR  116

Query  85   DIPKIKQEWQRLKVQAKKNICSYKKDKLKTGGGPAPN-EPTELDWIIYDLI  134
               ++K++W+R+K   +  I  Y     + G   A   +P+   + ++D +
Sbjct  117  TCNRLKEQWRRMKACTRNEILDYNNRLARFGAEVADRKKPSPFTFEVWDFM  167



Lambda      K        H
   0.321    0.136    0.397 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 566763464


Query= XP_018560754.2 uncharacterized protein LOC108903155 isoform X2
[Anoplophora glabripennis]

Length=281
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O61602_DROME  unnamed protein product                                 51.2    3e-07
O16114_DROME  unnamed protein product                                 51.2    3e-07
Q8MLR4_DROME  unnamed protein product                                 51.2    3e-07
O44203_DROME  unnamed protein product                                 51.2    3e-07
O17430_DROME  unnamed protein product                                 51.2    4e-07


>O61602_DROME unnamed protein product
Length=483

 Score = 51.2 bits (121),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/111 (29%), Positives = 56/111 (50%), Gaps = 2/111 (2%)

Query  26   QKRPRSVNWEEKEKLVLLDGVKDNIKVLECKRKLTTANRDKAAAWNIIKRKLEVQ-GYFR  84
            +KR R+ NW  +EK  LLD  + +++++E KR        K  AW II +K   Q G  R
Sbjct  51   KKRERTQNWNHQEKKYLLDLCRKDMRIIENKRLDAGLTAVKNKAWKIIHQKFSNQFGTDR  110

Query  85   DIPKIKQEWQRLKVQAKKNICSYKKDKLKTGGGPAPN-EPTELDWIIYDLI  134
               ++K++W+R+K   +  I  Y     + G   A   +P+   + ++D +
Sbjct  111  TCNRLKEQWRRMKACTRNEILDYNNRLARFGAEVADRKKPSPFTFEVWDFM  161


>O16114_DROME unnamed protein product
Length=484

 Score = 51.2 bits (121),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/111 (29%), Positives = 56/111 (50%), Gaps = 2/111 (2%)

Query  26   QKRPRSVNWEEKEKLVLLDGVKDNIKVLECKRKLTTANRDKAAAWNIIKRKLEVQ-GYFR  84
            +KR R+ NW  +EK  LLD  + +++++E KR        K  AW II +K   Q G  R
Sbjct  51   KKRERTQNWNHQEKKYLLDLCRKDMRIIENKRLDAGLTAVKNKAWKIIHQKFSNQFGTDR  110

Query  85   DIPKIKQEWQRLKVQAKKNICSYKKDKLKTGGGPAPN-EPTELDWIIYDLI  134
               ++K++W+R+K   +  I  Y     + G   A   +P+   + ++D +
Sbjct  111  TCNRLKEQWRRMKACTRNEILDYNNRLARFGAEVADRKKPSPFTFEVWDFM  161


>Q8MLR4_DROME unnamed protein product
Length=469

 Score = 51.2 bits (121),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/111 (29%), Positives = 56/111 (50%), Gaps = 2/111 (2%)

Query  26   QKRPRSVNWEEKEKLVLLDGVKDNIKVLECKRKLTTANRDKAAAWNIIKRKLEVQ-GYFR  84
            +KR R+ NW  +EK  LLD  + +++++E KR        K  AW II +K   Q G  R
Sbjct  37   KKRERTQNWNHQEKKYLLDLCRKDMRIIENKRLDAGLTAVKNKAWKIIHQKFSNQFGTDR  96

Query  85   DIPKIKQEWQRLKVQAKKNICSYKKDKLKTGGGPAPN-EPTELDWIIYDLI  134
               ++K++W+R+K   +  I  Y     + G   A   +P+   + ++D +
Sbjct  97   TCNRLKEQWRRMKACTRNEILDYNNRLARFGAEVADRKKPSPFTFEVWDFM  147


>O44203_DROME unnamed protein product
Length=484

 Score = 51.2 bits (121),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/111 (29%), Positives = 56/111 (50%), Gaps = 2/111 (2%)

Query  26   QKRPRSVNWEEKEKLVLLDGVKDNIKVLECKRKLTTANRDKAAAWNIIKRKLEVQ-GYFR  84
            +KR R+ NW  +EK  LLD  + +++++E KR        K  AW II +K   Q G  R
Sbjct  51   KKRERTQNWNHQEKKYLLDLCRKDMRIIENKRLDAGLTAVKNKAWKIIHQKFSNQFGTDR  110

Query  85   DIPKIKQEWQRLKVQAKKNICSYKKDKLKTGGGPAPN-EPTELDWIIYDLI  134
               ++K++W+R+K   +  I  Y     + G   A   +P+   + ++D +
Sbjct  111  TCNRLKEQWRRMKACTRNEILDYNNRLARFGAEVADRKKPSPFTFEVWDFM  161


>O17430_DROME unnamed protein product
Length=490

 Score = 51.2 bits (121),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/111 (29%), Positives = 56/111 (50%), Gaps = 2/111 (2%)

Query  26   QKRPRSVNWEEKEKLVLLDGVKDNIKVLECKRKLTTANRDKAAAWNIIKRKLEVQ-GYFR  84
            +KR R+ NW  +EK  LLD  + +++++E KR        K  AW II +K   Q G  R
Sbjct  57   KKRERTQNWNHQEKKYLLDLCRKDMRIIENKRLDAGLTAVKNKAWKIIHQKFSNQFGTDR  116

Query  85   DIPKIKQEWQRLKVQAKKNICSYKKDKLKTGGGPAPN-EPTELDWIIYDLI  134
               ++K++W+R+K   +  I  Y     + G   A   +P+   + ++D +
Sbjct  117  TCNRLKEQWRRMKACTRNEILDYNNRLARFGAEVADRKKPSPFTFEVWDFM  167



Lambda      K        H
   0.321    0.136    0.397 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 566763464


Query= XP_018560755.2 uncharacterized protein LOC108903155 isoform X3
[Anoplophora glabripennis]

Length=263
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O17430_DROME  unnamed protein product                                 53.1    7e-08
O44203_DROME  unnamed protein product                                 53.1    7e-08
O61602_DROME  unnamed protein product                                 53.1    7e-08
O16114_DROME  unnamed protein product                                 53.1    7e-08
A0A0B4KGD0_DROME  unnamed protein product                             53.1    7e-08


>O17430_DROME unnamed protein product
Length=490

 Score = 53.1 bits (126),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 57/113 (50%), Gaps = 2/113 (2%)

Query  1    MDKKRPRSVNWEEKEKLVLLDGVKDNIKVLECKRKLTTANRDKAAAWNIIKRKLEVQ-GY  59
            M KKR R+ NW  +EK  LLD  + +++++E KR        K  AW II +K   Q G 
Sbjct  55   MYKKRERTQNWNHQEKKYLLDLCRKDMRIIENKRLDAGLTAVKNKAWKIIHQKFSNQFGT  114

Query  60   FRDIPKIKQEWQRLKVQAKKNICSYKKDKLKTGGGPAPN-EPTELDWIIYDLI  111
             R   ++K++W+R+K   +  I  Y     + G   A   +P+   + ++D +
Sbjct  115  DRTCNRLKEQWRRMKACTRNEILDYNNRLARFGAEVADRKKPSPFTFEVWDFM  167


>O44203_DROME unnamed protein product
Length=484

 Score = 53.1 bits (126),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 57/113 (50%), Gaps = 2/113 (2%)

Query  1    MDKKRPRSVNWEEKEKLVLLDGVKDNIKVLECKRKLTTANRDKAAAWNIIKRKLEVQ-GY  59
            M KKR R+ NW  +EK  LLD  + +++++E KR        K  AW II +K   Q G 
Sbjct  49   MYKKRERTQNWNHQEKKYLLDLCRKDMRIIENKRLDAGLTAVKNKAWKIIHQKFSNQFGT  108

Query  60   FRDIPKIKQEWQRLKVQAKKNICSYKKDKLKTGGGPAPN-EPTELDWIIYDLI  111
             R   ++K++W+R+K   +  I  Y     + G   A   +P+   + ++D +
Sbjct  109  DRTCNRLKEQWRRMKACTRNEILDYNNRLARFGAEVADRKKPSPFTFEVWDFM  161


>O61602_DROME unnamed protein product
Length=483

 Score = 53.1 bits (126),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 57/113 (50%), Gaps = 2/113 (2%)

Query  1    MDKKRPRSVNWEEKEKLVLLDGVKDNIKVLECKRKLTTANRDKAAAWNIIKRKLEVQ-GY  59
            M KKR R+ NW  +EK  LLD  + +++++E KR        K  AW II +K   Q G 
Sbjct  49   MYKKRERTQNWNHQEKKYLLDLCRKDMRIIENKRLDAGLTAVKNKAWKIIHQKFSNQFGT  108

Query  60   FRDIPKIKQEWQRLKVQAKKNICSYKKDKLKTGGGPAPN-EPTELDWIIYDLI  111
             R   ++K++W+R+K   +  I  Y     + G   A   +P+   + ++D +
Sbjct  109  DRTCNRLKEQWRRMKACTRNEILDYNNRLARFGAEVADRKKPSPFTFEVWDFM  161


>O16114_DROME unnamed protein product
Length=484

 Score = 53.1 bits (126),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 57/113 (50%), Gaps = 2/113 (2%)

Query  1    MDKKRPRSVNWEEKEKLVLLDGVKDNIKVLECKRKLTTANRDKAAAWNIIKRKLEVQ-GY  59
            M KKR R+ NW  +EK  LLD  + +++++E KR        K  AW II +K   Q G 
Sbjct  49   MYKKRERTQNWNHQEKKYLLDLCRKDMRIIENKRLDAGLTAVKNKAWKIIHQKFSNQFGT  108

Query  60   FRDIPKIKQEWQRLKVQAKKNICSYKKDKLKTGGGPAPN-EPTELDWIIYDLI  111
             R   ++K++W+R+K   +  I  Y     + G   A   +P+   + ++D +
Sbjct  109  DRTCNRLKEQWRRMKACTRNEILDYNNRLARFGAEVADRKKPSPFTFEVWDFM  161


>A0A0B4KGD0_DROME unnamed protein product
Length=499

 Score = 53.1 bits (126),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 57/113 (50%), Gaps = 2/113 (2%)

Query  1    MDKKRPRSVNWEEKEKLVLLDGVKDNIKVLECKRKLTTANRDKAAAWNIIKRKLEVQ-GY  59
            M KKR R+ NW  +EK  LLD  + +++++E KR        K  AW II +K   Q G 
Sbjct  65   MYKKRERTQNWNHQEKKYLLDLCRKDMRIIENKRLDAGLTAVKNKAWKIIHQKFSNQFGT  124

Query  60   FRDIPKIKQEWQRLKVQAKKNICSYKKDKLKTGGGPAPN-EPTELDWIIYDLI  111
             R   ++K++W+R+K   +  I  Y     + G   A   +P+   + ++D +
Sbjct  125  DRTCNRLKEQWRRMKACTRNEILDYNNRLARFGAEVADRKKPSPFTFEVWDFM  177



Lambda      K        H
   0.321    0.136    0.397 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 566763464


Query= XP_018560756.1 uncharacterized protein LOC108917991 isoform X4
[Anoplophora glabripennis]

Length=556
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MIC60_DROME  unnamed protein product                                  33.5    0.52 
OR33A_DROME  unnamed protein product                                  32.3    0.97 
OR2A_DROME  unnamed protein product                                   32.0    1.4  
Q8I4F7_CAEEL  unnamed protein product                                 32.0    1.5  
P91821_CAEEL  unnamed protein product                                 32.0    1.6  


>MIC60_DROME unnamed protein product
Length=739

 Score = 33.5 bits (75),  Expect = 0.52, Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 38/77 (49%), Gaps = 6/77 (8%)

Query  70   LSAITFAGGVTLCYAKYDPDFRSVLTEYVPFIDPVIETIFLEKD--KSDTSNIIQANDYN  127
            +S +   GGV + YAKYD DFR ++ + VP    VI+    E+   K  T N+   ND  
Sbjct  78   VSPLAAVGGV-ITYAKYDDDFRKLVEKNVPGAGSVIKVALQEEPPFKGITKNV---NDQI  133

Query  128  KDFSKGLKNYIPSVGTV  144
                 G++    +V +V
Sbjct  134  DKVKSGIETVTSTVDSV  150


>OR33A_DROME unnamed protein product
Length=378

 Score = 32.3 bits (72),  Expect = 0.97, Method: Compositional matrix adjust.
 Identities = 22/85 (26%), Positives = 43/85 (51%), Gaps = 7/85 (8%)

Query  475  IQLLLIAYFNVPFTGQLENIAFSAFNATLLKDNPKFQELLEVSMKTIQNYVPNKIQS---  531
            I+L    Y+ +  T + + + ++ F++  LK + ++   L + M+     VP  I++   
Sbjct  294  IELFPSCYYGILMTMEFDKLPYAIFSSNWLKMDKRYNRSLIILMQL--TLVPVNIKAGGI  351

Query  532  --TDWLYYVNVMNMAYSFFTLAASY  554
               D   +   + MAYSF+TLA S+
Sbjct  352  VGIDMSAFFATVRMAYSFYTLALSF  376


>OR2A_DROME unnamed protein product
Length=397

 Score = 32.0 bits (71),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 20/105 (19%), Positives = 49/105 (47%), Gaps = 13/105 (12%)

Query  454  ISKEEDYSKVVTVLACATVISIQLLLIAYFNVPFTGQLENIAFSAFNATLLKDNPKFQEL  513
            ++ + D++ ++  +   + +++++ +I YF      Q E +  + ++   ++  PKF+  
Sbjct  293  VADDHDHTAMIISIVFFSAVTLEVFVICYFGDRMRTQSEALCDAFYDCNWIEQLPKFKRE  352

Query  514  LEVSMKTIQ--------NYVPNKIQSTDWLYYVNVMNMAYSFFTL  550
            L  ++   Q        NY+   +++ +      VM   YS FTL
Sbjct  353  LLFTLARTQRPSLIYAGNYIALSLETFE-----QVMRFTYSVFTL  392


>Q8I4F7_CAEEL unnamed protein product
Length=507

 Score = 32.0 bits (71),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 24/58 (41%), Gaps = 0/58 (0%)

Query  480  IAYFNVPFTGQLENIAFSAFNATLLKDNPKFQELLEVSMKTIQNYVPNKIQSTDWLYY  537
            I  F  PF  Q+ N   S F A  L+     ++LL         Y   + Q+T WL +
Sbjct  29   IKIFETPFATQVLNPKVSEFCANCLRGPAPGEKLLRCGGCNFSMYCSKECQATAWLVH  86


>P91821_CAEEL unnamed protein product
Length=501

 Score = 32.0 bits (71),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 24/58 (41%), Gaps = 0/58 (0%)

Query  480  IAYFNVPFTGQLENIAFSAFNATLLKDNPKFQELLEVSMKTIQNYVPNKIQSTDWLYY  537
            I  F  PF  Q+ N   S F A  L+     ++LL         Y   + Q+T WL +
Sbjct  29   IKIFETPFATQVLNPKVSEFCANCLRGPAPGEKLLRCGGCNFSMYCSKECQATAWLVH  86



Lambda      K        H
   0.321    0.136    0.397 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 566763464


Query= XP_018560757.1 uncharacterized protein LOC108903156 isoform X1
[Anoplophora glabripennis]

Length=77
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

LYS7_CAEEL  unnamed protein product                                   26.2    2.7  


>LYS7_CAEEL unnamed protein product
Length=283

 Score = 26.2 bits (56),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 25/41 (61%), Gaps = 1/41 (2%)

Query  3   KVIILFSIVAVATSYAGV-VAPVVGHSVVSSHSSVVAHPAP  42
           K I++FS++AV    A V V P+V  S+    S V+A PAP
Sbjct  4   KSIVIFSVLAVLCHSASVKVPPIVDSSLPVKFSEVIAEPAP  44



Lambda      K        H
   0.321    0.136    0.397 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 566763464


Query= XP_018560758.1 uncharacterized protein LOC108903156 isoform X2
[Anoplophora glabripennis]

Length=74
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

LYS7_CAEEL  unnamed protein product                                   24.6    7.9  


>LYS7_CAEEL unnamed protein product
Length=283

 Score = 24.6 bits (52),  Expect = 7.9, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 24/39 (62%), Gaps = 1/39 (3%)

Query  2   IILFSIVAVATSYAGV-VAPVVGHSVVSSHSSVVAHPAP  39
           I++FS++AV    A V V P+V  S+    S V+A PAP
Sbjct  6   IVIFSVLAVLCHSASVKVPPIVDSSLPVKFSEVIAEPAP  44



Lambda      K        H
   0.321    0.136    0.397 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 566763464


Query= XP_018560760.1 A-kinase anchor protein 14-like [Anoplophora
glabripennis]

Length=127
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PSV_DICDI  unnamed protein product                                    28.5    1.6  


>PSV_DICDI unnamed protein product
Length=514

 Score = 28.5 bits (62),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 24/55 (44%), Gaps = 4/55 (7%)

Query  46   VAVHTAPAVKSISA-HSTVVNHGSPL---VPVVHAAPVVHAAPVVHAAPVVHAAP  96
            V  +  PA +  SA H+    HG P        HA P  +A PV H A   HA P
Sbjct  284  VQRNAKPAQQQRSAQHAKPAQHGKPAQHATQQQHAKPAQNAKPVQHNAQQQHAKP  338


 Score = 26.2 bits (56),  Expect = 8.7, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 17/35 (49%), Gaps = 2/35 (6%)

Query  76   AAPVVHAAPVVHAAPVVH--AAPVVHAAPLVHSAP  108
            A PV H A   HA P  H  A PV H A   H+ P
Sbjct  371  AKPVQHNAQQQHAKPAAHTAAKPVQHNAAQQHAKP  405



Lambda      K        H
   0.321    0.136    0.397 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 566763464


Query= XP_018560761.1 glutathione S-transferase 1-1-like [Anoplophora
glabripennis]

Length=241
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VG92_DROME  unnamed protein product                                 169     1e-52
GSTD5_DROME  unnamed protein product                                  167     7e-52
Q9VGA1_DROME  unnamed protein product                                 163     3e-50
GSTD1_DROME  unnamed protein product                                  162     5e-50
GSTD4_DROME  unnamed protein product                                  161     1e-49


>Q9VG92_DROME unnamed protein product
Length=212

 Score = 169 bits (428),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 79/194 (41%), Positives = 121/194 (62%), Gaps = 1/194 (1%)

Query  23   IDIYYYHMSPPSRATLLLIRALGLKHNIKIVDIPNKGQMTSEFLKINPLHTIPVINDGEF  82
            +D YY+  S P R+ ++  +ALG+  N+K++ + +  Q+  EF+K+NP H IP + D  F
Sbjct  1    MDFYYHPCSAPCRSVIMTAKALGVDLNMKLLKVMDGEQLKPEFVKLNPQHCIPTLVDDGF  60

Query  83   IVYDSHVIMKYLVNQYAKDDSLYPKDPKKEAVVDQRLYFEASYLFPRFIAYFMPTLFGGQ  142
             +++S  I+ YLV +Y  DDSLYP DP+K+AVV+QRLYF+   LF  F+    P +    
Sbjct  61   SIWESRAILIYLVEKYGADDSLYPSDPQKKAVVNQRLYFDMGTLFQSFVEAIYPQIRNNH  120

Query  143  PPNEEAHKKLEEAFQHMDNFLKNQNWFAGTNMTIADFSLFSPFSTVVACDVFDFTNYQNL  202
            P + EA +K++ AF H+D FL++Q + AG  +TIAD +L +  ST    D FD   Y N+
Sbjct  121  PADPEAMQKVDSAFGHLDTFLEDQEYVAGDCLTIADIALLASVSTFEVVD-FDIAQYPNV  179

Query  203  WQWYQRAKSAMSGF  216
             +WY+ AK    G+
Sbjct  180  ARWYENAKEVTPGW  193


>GSTD5_DROME unnamed protein product
Length=216

 Score = 167 bits (424),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 79/194 (41%), Positives = 124/194 (64%), Gaps = 1/194 (1%)

Query  23   IDIYYYHMSPPSRATLLLIRALGLKHNIKIVDIPNKGQMTSEFLKINPLHTIPVINDGEF  82
            +D YY       R  +++ +ALG+K N+K+++   K Q+  EF+K+NP HTIP + D  F
Sbjct  1    MDFYYSPRGSGCRTVIMVAKALGVKLNMKLLNTLEKDQLKPEFVKLNPQHTIPTLVDNGF  60

Query  83   IVYDSHVIMKYLVNQYAKDDSLYPKDPKKEAVVDQRLYFEASYLFPRFIAYFMPTLFGGQ  142
             +++S  I  YLV +Y KDD+L+PKDPKK+A+V+QRLYF+   L+  F  Y+ P    G+
Sbjct  61   SIWESRAIAVYLVEKYGKDDTLFPKDPKKQALVNQRLYFDMGTLYDSFAKYYYPLFHTGK  120

Query  143  PPNEEAHKKLEEAFQHMDNFLKNQNWFAGTNMTIADFSLFSPFSTVVACDVFDFTNYQNL  202
            P ++E  KK+E +F++++ FL+ QN+ AG ++T+AD ++ S  ST    D FD   Y N+
Sbjct  121  PGSDEDFKKIESSFEYLNIFLEGQNYVAGDHLTVADIAILSTVSTFEIFD-FDLNKYPNV  179

Query  203  WQWYQRAKSAMSGF  216
             +WY  AK    G+
Sbjct  180  ARWYANAKKVTPGW  193


>Q9VGA1_DROME unnamed protein product
Length=210

 Score = 163 bits (412),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/212 (40%), Positives = 130/212 (61%), Gaps = 5/212 (2%)

Query  23   IDIYYYHMSPPSRATLLLIRALGLKHNIK-IVDIPNKGQMTSEFLKINPLHTIPVINDGE  81
            +D+YY   S P R+ L+  +ALG++ + K I++   + Q T E+LKINP HTIP ++D  
Sbjct  1    MDLYYRPGSAPCRSVLMTAKALGVEFDKKTIINTRAREQFTPEYLKINPQHTIPTLHDHG  60

Query  82   FIVYDSHVIMKYLVNQYAKDDSLYPKDPKKEAVVDQRLYFEASYLFPRFIAYFMPTLFGG  141
            F +++S  IM YLV +Y KDD L+PKD +K+A+++QRLYF+   L+  F  Y+ P +F  
Sbjct  61   FALWESRAIMVYLVEKYGKDDKLFPKDVQKQALINQRLYFDMGTLYKSFSEYYYPQIFLK  120

Query  142  QPPNEEAHKKLEEAFQHMDNFLKNQNWFAGTNMTIADFSLFSPFSTVVACDVFDFTNYQN  201
            +P NEE +KK+E AF+ ++ FL+ Q + AG + ++AD +  +  ST      FDF  Y N
Sbjct  121  KPANEENYKKIEVAFEFLNTFLEGQTYSAGGDYSLADIAFLATVSTFDVAG-FDFKRYAN  179

Query  202  LWQWYQRAKSAMSGFGYDEIEQEGANAFGGYY  233
            + +WY+ AK    G+   E    G   F  Y+
Sbjct  180  VARWYENAKKLTPGW---EENWAGCQEFRKYF  208


>GSTD1_DROME unnamed protein product
Length=209

 Score = 162 bits (411),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 78/194 (40%), Positives = 121/194 (62%), Gaps = 1/194 (1%)

Query  23   IDIYYYHMSPPSRATLLLIRALGLKHNIKIVDIPNKGQMTSEFLKINPLHTIPVINDGEF  82
            +D YY   S P R+ ++  +A+G++ N K++++     +  EFLKINP HTIP + D  F
Sbjct  2    VDFYYLPGSSPCRSVIMTAKAVGVELNKKLLNLQAGEHLKPEFLKINPQHTIPTLVDNGF  61

Query  83   IVYDSHVIMKYLVNQYAKDDSLYPKDPKKEAVVDQRLYFEASYLFPRFIAYFMPTLFGGQ  142
             +++S  I  YLV +Y K DSLYPK PKK AV++QRLYF+   L+  F  Y+ P +F   
Sbjct  62   ALWESRAIQVYLVEKYGKTDSLYPKCPKKRAVINQRLYFDMGTLYQSFANYYYPQVFAKA  121

Query  143  PPNEEAHKKLEEAFQHMDNFLKNQNWFAGTNMTIADFSLFSPFSTVVACDVFDFTNYQNL  202
            P + EA KK+E AF+ ++ FL+ Q++ AG ++T+AD +L +  ST      F+ + Y N+
Sbjct  122  PADPEAFKKIEAAFEFLNTFLEGQDYAAGDSLTVADIALVATVSTFEVAK-FEISKYANV  180

Query  203  WQWYQRAKSAMSGF  216
             +WY+ AK    G+
Sbjct  181  NRWYENAKKVTPGW  194


>GSTD4_DROME unnamed protein product
Length=215

 Score = 161 bits (408),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/194 (41%), Positives = 120/194 (62%), Gaps = 1/194 (1%)

Query  23   IDIYYYHMSPPSRATLLLIRALGLKHNIKIVDIPNKGQMTSEFLKINPLHTIPVINDGEF  82
            +D YY   S  SR  +++ +ALGL+ N K + I     +  EFLK+NP HTIP + D  F
Sbjct  1    MDFYYSPRSSGSRTIIMVAKALGLELNKKQLRITEGEHLKPEFLKLNPQHTIPTLVDNGF  60

Query  83   IVYDSHVIMKYLVNQYAKDDSLYPKDPKKEAVVDQRLYFEASYLFPRFIAYFMPTLFGGQ  142
             +++S  I  YLV +Y KDDSL+P DP+K A+++QRLYF+   L   F+ Y+ P +  GQ
Sbjct  61   AIWESRAIAVYLVEKYGKDDSLFPNDPQKRALINQRLYFDMGTLHDSFMKYYYPFIRTGQ  120

Query  143  PPNEEAHKKLEEAFQHMDNFLKNQNWFAGTNMTIADFSLFSPFSTVVACDVFDFTNYQNL  202
              N E +KK+E AF+ +D FL+ Q++ AG+ +T+AD ++ S  ST    + FD + Y N+
Sbjct  121  LGNAENYKKVEAAFEFLDIFLEGQDYVAGSQLTVADIAILSSVSTFEVVE-FDISKYPNV  179

Query  203  WQWYQRAKSAMSGF  216
             +WY  AK    G+
Sbjct  180  ARWYANAKKITPGW  193



Lambda      K        H
   0.321    0.136    0.397 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 566763464


Query= XP_018560762.2 uncharacterized protein LOC108903160 [Anoplophora
glabripennis]

Length=458
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GSTD1_DROME  unnamed protein product                                  243     1e-78
Q9VG92_DROME  unnamed protein product                                 233     1e-74
GSTD2_DROME  unnamed protein product                                  221     8e-70
GSTD5_DROME  unnamed protein product                                  213     9e-67
GSTD4_DROME  unnamed protein product                                  212     2e-66


>GSTD1_DROME unnamed protein product
Length=209

 Score = 243 bits (621),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 114/202 (56%), Positives = 140/202 (69%), Gaps = 1/202 (0%)

Query  244  LDLYYAPGSAPCRIVLLAAKAIGVDLNLKLLNLYEGEHLKPEFLKLNPQHTIPTLVDNGF  303
            +D YY PGS+PCR V++ AKA+GV+LN KLLNL  GEHLKPEFLK+NPQHTIPTLVDNGF
Sbjct  2    VDFYYLPGSSPCRSVIMTAKAVGVELNKKLLNLQAGEHLKPEFLKINPQHTIPTLVDNGF  61

Query  304  VIWESRAIITYLQNKYGRIDSLYPKEPKKRAVVDQRLFFDMD-FYFRLYQVYNRNTIGGG  362
             +WESRAI  YL  KYG+ DSLYPK PKKRAV++QRL+FDM   Y      Y        
Sbjct  62   ALWESRAIQVYLVEKYGKTDSLYPKCPKKRAVINQRLYFDMGTLYQSFANYYYPQVFAKA  121

Query  363  PPDPEKLKKANESLEFLDTFLNDSEFVAGDHLTLADLSLVVQISNLEVLKHDLSPYKNIR  422
            P DPE  KK   + EFL+TFL   ++ AGD LT+AD++LV  +S  EV K ++S Y N+ 
Sbjct  122  PADPEAFKKIEAAFEFLNTFLEGQDYAAGDSLTVADIALVATVSTFEVAKFEISKYANVN  181

Query  423  RWYDKVKVTAPGYKEANEDHLE  444
            RWY+  K   PG++E     LE
Sbjct  182  RWYENAKKVTPGWEENWAGCLE  203


 Score = 222 bits (566),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 104/195 (53%), Positives = 136/195 (70%), Gaps = 1/195 (1%)

Query  3    LDLYYNPISPSCRTVLLAAKAIGVDLNLKPLNILEGEQLKPEFLKLNPQHTIPTLVDNDF  62
            +D YY P S  CR+V++ AKA+GV+LN K LN+  GE LKPEFLK+NPQHTIPTLVDN F
Sbjct  2    VDFYYLPGSSPCRSVIMTAKAVGVELNKKLLNLQAGEHLKPEFLKINPQHTIPTLVDNGF  61

Query  63   SVWESRAIITYLQNKYGKNDSLYPKEPKKRALVDQRLFFDLD-LDSRFHQIYNRNTLGGA  121
            ++WESRAI  YL  KYGK DSLYPK PKKRA+++QRL+FD+  L   F   Y       A
Sbjct  62   ALWESRAIQVYLVEKYGKTDSLYPKCPKKRAVINQRLYFDMGTLYQSFANYYYPQVFAKA  121

Query  122  LPDPEKLKAANESLEFLNTFLNETEFVAGDHLTLSDLSLVAQISTLDVMKHDLSPYKDIK  181
              DPE  K    + EFLNTFL   ++ AGD LT++D++LVA +ST +V K ++S Y ++ 
Sbjct  122  PADPEAFKKIEAAFEFLNTFLEGQDYAAGDSLTVADIALVATVSTFEVAKFEISKYANVN  181

Query  182  RWYDKVRVTAPGYKE  196
            RWY+  +   PG++E
Sbjct  182  RWYENAKKVTPGWEE  196


>Q9VG92_DROME unnamed protein product
Length=212

 Score = 233 bits (595),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 109/215 (51%), Positives = 155/215 (72%), Gaps = 12/215 (6%)

Query  244  LDLYYAPGSAPCRIVLLAAKAIGVDLNLKLLNLYEGEHLKPEFLKLNPQHTIPTLVDNGF  303
            +D YY P SAPCR V++ AKA+GVDLN+KLL + +GE LKPEF+KLNPQH IPTLVD+GF
Sbjct  1    MDFYYHPCSAPCRSVIMTAKALGVDLNMKLLKVMDGEQLKPEFVKLNPQHCIPTLVDDGF  60

Query  304  VIWESRAIITYLQNKYGRIDSLYPKEPKKRAVVDQRLFFDMDFYFRLY------QVYNRN  357
             IWESRAI+ YL  KYG  DSLYP +P+K+AVV+QRL+FDM   F+ +      Q+ N +
Sbjct  61   SIWESRAILIYLVEKYGADDSLYPSDPQKKAVVNQRLYFDMGTLFQSFVEAIYPQIRNNH  120

Query  358  TIGGGPPDPEKLKKANESLEFLDTFLNDSEFVAGDHLTLADLSLVVQISNLEVLKHDLSP  417
                 P DPE ++K + +   LDTFL D E+VAGD LT+AD++L+  +S  EV+  D++ 
Sbjct  121  -----PADPEAMQKVDSAFGHLDTFLEDQEYVAGDCLTIADIALLASVSTFEVVDFDIAQ  175

Query  418  YKNIRRWYDKVKVTAPGYKEANEDHLEVVREMIEK  452
            Y N+ RWY+  K   PG++E N D ++++++++++
Sbjct  176  YPNVARWYENAKEVTPGWEE-NWDGVQLIKKLVQE  209


 Score = 218 bits (556),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 99/215 (46%), Positives = 157/215 (73%), Gaps = 12/215 (6%)

Query  3    LDLYYNPISPSCRTVLLAAKAIGVDLNLKPLNILEGEQLKPEFLKLNPQHTIPTLVDNDF  62
            +D YY+P S  CR+V++ AKA+GVDLN+K L +++GEQLKPEF+KLNPQH IPTLVD+ F
Sbjct  1    MDFYYHPCSAPCRSVIMTAKALGVDLNMKLLKVMDGEQLKPEFVKLNPQHCIPTLVDDGF  60

Query  63   SVWESRAIITYLQNKYGKNDSLYPKEPKKRALVDQRLFFDLD------LDSRFHQIYNRN  116
            S+WESRAI+ YL  KYG +DSLYP +P+K+A+V+QRL+FD+       +++ + QI N +
Sbjct  61   SIWESRAILIYLVEKYGADDSLYPSDPQKKAVVNQRLYFDMGTLFQSFVEAIYPQIRNNH  120

Query  117  TLGGALPDPEKLKAANESLEFLNTFLNETEFVAGDHLTLSDLSLVAQISTLDVMKHDLSP  176
                   DPE ++  + +   L+TFL + E+VAGD LT++D++L+A +ST +V+  D++ 
Sbjct  121  P-----ADPEAMQKVDSAFGHLDTFLEDQEYVAGDCLTIADIALLASVSTFEVVDFDIAQ  175

Query  177  YKDIKRWYDKVRVTAPGYKEANEDNLIILKEMIEK  211
            Y ++ RWY+  +   PG++E N D + ++K+++++
Sbjct  176  YPNVARWYENAKEVTPGWEE-NWDGVQLIKKLVQE  209


>GSTD2_DROME unnamed protein product
Length=215

 Score = 221 bits (562),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 107/209 (51%), Positives = 138/209 (66%), Gaps = 2/209 (1%)

Query  244  LDLYYAPGSAPCRIVLLAAKAIGVDLNLKLLNLYEGEHLKPEFLKLNPQHTIPTLVDNGF  303
            +D YY PG   CR V++ AKA+G++LN KLLN  EGE LKPEF+KLNPQHTIPTLVDNGF
Sbjct  1    MDFYYMPGGGGCRTVIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGF  60

Query  304  VIWESRAIITYLQNKYGRIDSLYPKEPKKRAVVDQRLFFDMDFYFRLYQVYNRNTIGGGP  363
             IWESRAI  YL  KYG+ D L P +PKKRAV++QRL+FDM   +  +  Y       G 
Sbjct  61   SIWESRAIAVYLVEKYGKDDYLLPNDPKKRAVINQRLYFDMGTLYESFAKYYYPLFRTGK  120

Query  364  PDP-EKLKKANESLEFLDTFLNDSEFVAGDHLTLADLSLVVQISNLEVLKHDLSPYKNIR  422
            P   E LK+   +  FLDTFL   E+VAGD LT+AD++++  +S  EV + D S Y N+ 
Sbjct  121  PGSDEDLKRIETAFGFLDTFLEGQEYVAGDQLTVADIAILSTVSTFEVSEFDFSKYSNVS  180

Query  423  RWYDKVKVTAPGYKEANEDHLEVVREMIE  451
            RWYD  K   PG+ E N + L  ++ + +
Sbjct  181  RWYDNAKKVTPGWDE-NWEGLMAMKALFD  208


 Score = 213 bits (543),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 103/209 (49%), Positives = 142/209 (68%), Gaps = 2/209 (1%)

Query  3    LDLYYNPISPSCRTVLLAAKAIGVDLNLKPLNILEGEQLKPEFLKLNPQHTIPTLVDNDF  62
            +D YY P    CRTV++ AKA+G++LN K LN +EGEQLKPEF+KLNPQHTIPTLVDN F
Sbjct  1    MDFYYMPGGGGCRTVIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGF  60

Query  63   SVWESRAIITYLQNKYGKNDSLYPKEPKKRALVDQRLFFDLD-LDSRFHQIYNRNTLGGA  121
            S+WESRAI  YL  KYGK+D L P +PKKRA+++QRL+FD+  L   F + Y      G 
Sbjct  61   SIWESRAIAVYLVEKYGKDDYLLPNDPKKRAVINQRLYFDMGTLYESFAKYYYPLFRTGK  120

Query  122  LPDPEKLKAANESLEFLNTFLNETEFVAGDHLTLSDLSLVAQISTLDVMKHDLSPYKDIK  181
                E LK    +  FL+TFL   E+VAGD LT++D+++++ +ST +V + D S Y ++ 
Sbjct  121  PGSDEDLKRIETAFGFLDTFLEGQEYVAGDQLTVADIAILSTVSTFEVSEFDFSKYSNVS  180

Query  182  RWYDKVRVTAPGYKEANEDNLIILKEMIE  210
            RWYD  +   PG+ E N + L+ +K + +
Sbjct  181  RWYDNAKKVTPGWDE-NWEGLMAMKALFD  208


>GSTD5_DROME unnamed protein product
Length=216

 Score = 213 bits (542),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 102/210 (49%), Positives = 139/210 (66%), Gaps = 15/210 (7%)

Query  244  LDLYYAPGSAPCRIVLLAAKAIGVDLNLKLLNLYEGEHLKPEFLKLNPQHTIPTLVDNGF  303
            +D YY+P  + CR V++ AKA+GV LN+KLLN  E + LKPEF+KLNPQHTIPTLVDNGF
Sbjct  1    MDFYYSPRGSGCRTVIMVAKALGVKLNMKLLNTLEKDQLKPEFVKLNPQHTIPTLVDNGF  60

Query  304  VIWESRAIITYLQNKYGRIDSLYPKEPKKRAVVDQRLFFDMD--------FYFRLYQVYN  355
             IWESRAI  YL  KYG+ D+L+PK+PKK+A+V+QRL+FDM         +Y+ L+    
Sbjct  61   SIWESRAIAVYLVEKYGKDDTLFPKDPKKQALVNQRLYFDMGTLYDSFAKYYYPLFHT--  118

Query  356  RNTIGGGPPDPEKLKKANESLEFLDTFLNDSEFVAGDHLTLADLSLVVQISNLEVLKHDL  415
                 G P   E  KK   S E+L+ FL    +VAGDHLT+AD++++  +S  E+   DL
Sbjct  119  -----GKPGSDEDFKKIESSFEYLNIFLEGQNYVAGDHLTVADIAILSTVSTFEIFDFDL  173

Query  416  SPYKNIRRWYDKVKVTAPGYKEANEDHLEV  445
            + Y N+ RWY   K   PG++E  +  +E+
Sbjct  174  NKYPNVARWYANAKKVTPGWEENWKGAVEL  203


 Score = 212 bits (539),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 100/195 (51%), Positives = 136/195 (70%), Gaps = 1/195 (1%)

Query  3    LDLYYNPISPSCRTVLLAAKAIGVDLNLKPLNILEGEQLKPEFLKLNPQHTIPTLVDNDF  62
            +D YY+P    CRTV++ AKA+GV LN+K LN LE +QLKPEF+KLNPQHTIPTLVDN F
Sbjct  1    MDFYYSPRGSGCRTVIMVAKALGVKLNMKLLNTLEKDQLKPEFVKLNPQHTIPTLVDNGF  60

Query  63   SVWESRAIITYLQNKYGKNDSLYPKEPKKRALVDQRLFFDLD-LDSRFHQIYNRNTLGGA  121
            S+WESRAI  YL  KYGK+D+L+PK+PKK+ALV+QRL+FD+  L   F + Y      G 
Sbjct  61   SIWESRAIAVYLVEKYGKDDTLFPKDPKKQALVNQRLYFDMGTLYDSFAKYYYPLFHTGK  120

Query  122  LPDPEKLKAANESLEFLNTFLNETEFVAGDHLTLSDLSLVAQISTLDVMKHDLSPYKDIK  181
                E  K    S E+LN FL    +VAGDHLT++D+++++ +ST ++   DL+ Y ++ 
Sbjct  121  PGSDEDFKKIESSFEYLNIFLEGQNYVAGDHLTVADIAILSTVSTFEIFDFDLNKYPNVA  180

Query  182  RWYDKVRVTAPGYKE  196
            RWY   +   PG++E
Sbjct  181  RWYANAKKVTPGWEE  195


>GSTD4_DROME unnamed protein product
Length=215

 Score = 212 bits (540),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/209 (48%), Positives = 143/209 (68%), Gaps = 2/209 (1%)

Query  3    LDLYYNPISPSCRTVLLAAKAIGVDLNLKPLNILEGEQLKPEFLKLNPQHTIPTLVDNDF  62
            +D YY+P S   RT+++ AKA+G++LN K L I EGE LKPEFLKLNPQHTIPTLVDN F
Sbjct  1    MDFYYSPRSSGSRTIIMVAKALGLELNKKQLRITEGEHLKPEFLKLNPQHTIPTLVDNGF  60

Query  63   SVWESRAIITYLQNKYGKNDSLYPKEPKKRALVDQRLFFDLD-LDSRFHQIYNRNTLGGA  121
            ++WESRAI  YL  KYGK+DSL+P +P+KRAL++QRL+FD+  L   F + Y      G 
Sbjct  61   AIWESRAIAVYLVEKYGKDDSLFPNDPQKRALINQRLYFDMGTLHDSFMKYYYPFIRTGQ  120

Query  122  LPDPEKLKAANESLEFLNTFLNETEFVAGDHLTLSDLSLVAQISTLDVMKHDLSPYKDIK  181
            L + E  K    + EFL+ FL   ++VAG  LT++D+++++ +ST +V++ D+S Y ++ 
Sbjct  121  LGNAENYKKVEAAFEFLDIFLEGQDYVAGSQLTVADIAILSSVSTFEVVEFDISKYPNVA  180

Query  182  RWYDKVRVTAPGYKEANEDNLIILKEMIE  210
            RWY   +   PG+ E N   L+ +K M E
Sbjct  181  RWYANAKKITPGWDE-NWKGLLQMKTMYE  208


 Score = 211 bits (537),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 100/198 (51%), Positives = 136/198 (69%), Gaps = 7/198 (4%)

Query  244  LDLYYAPGSAPCRIVLLAAKAIGVDLNLKLLNLYEGEHLKPEFLKLNPQHTIPTLVDNGF  303
            +D YY+P S+  R +++ AKA+G++LN K L + EGEHLKPEFLKLNPQHTIPTLVDNGF
Sbjct  1    MDFYYSPRSSGSRTIIMVAKALGLELNKKQLRITEGEHLKPEFLKLNPQHTIPTLVDNGF  60

Query  304  VIWESRAIITYLQNKYGRIDSLYPKEPKKRAVVDQRLFFDM----DFYFRLYQVYNRNTI  359
             IWESRAI  YL  KYG+ DSL+P +P+KRA+++QRL+FDM    D + + Y  + R   
Sbjct  61   AIWESRAIAVYLVEKYGKDDSLFPNDPQKRALINQRLYFDMGTLHDSFMKYYYPFIRT--  118

Query  360  GGGPPDPEKLKKANESLEFLDTFLNDSEFVAGDHLTLADLSLVVQISNLEVLKHDLSPYK  419
             G   + E  KK   + EFLD FL   ++VAG  LT+AD++++  +S  EV++ D+S Y 
Sbjct  119  -GQLGNAENYKKVEAAFEFLDIFLEGQDYVAGSQLTVADIAILSSVSTFEVVEFDISKYP  177

Query  420  NIRRWYDKVKVTAPGYKE  437
            N+ RWY   K   PG+ E
Sbjct  178  NVARWYANAKKITPGWDE  195



Lambda      K        H
   0.321    0.136    0.397 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 566763464


Query= XP_018560763.1 uncharacterized protein LOC108917991 isoform X5
[Anoplophora glabripennis]

Length=504
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MIC60_DROME  unnamed protein product                                  33.5    0.49 
OR33A_DROME  unnamed protein product                                  32.3    0.85 
OR2A_DROME  unnamed protein product                                   32.3    0.91 
P91821_CAEEL  unnamed protein product                                 31.6    1.7  
Q8I4F7_CAEEL  unnamed protein product                                 31.6    1.7  


>MIC60_DROME unnamed protein product
Length=739

 Score = 33.5 bits (75),  Expect = 0.49, Method: Compositional matrix adjust.
 Identities = 17/43 (40%), Positives = 25/43 (58%), Gaps = 1/43 (2%)

Query  70   LSAITFAGGVTLCYAKYDPDFRSVLTEYVPFIDPVIETIFLEK  112
            +S +   GGV + YAKYD DFR ++ + VP    VI+    E+
Sbjct  78   VSPLAAVGGV-ITYAKYDDDFRKLVEKNVPGAGSVIKVALQEE  119


>OR33A_DROME unnamed protein product
Length=378

 Score = 32.3 bits (72),  Expect = 0.85, Method: Compositional matrix adjust.
 Identities = 26/111 (23%), Positives = 55/111 (50%), Gaps = 8/111 (7%)

Query  397  LISSSISKEEDYSKVVTVLACATVISIQLLLIAYFNVPFTGQLENIAFSAFNATLLKDNP  456
            LI+     E +++ +   +  A ++ I+L    Y+ +  T + + + ++ F++  LK + 
Sbjct  269  LINILFFAENNFAMLYYAVFFAAML-IELFPSCYYGILMTMEFDKLPYAIFSSNWLKMDK  327

Query  457  KFQELLEVSMKTIQNYVPNKIQS-----TDWLYYVNVMNMAYSFFTLAASY  502
            ++   L + M+     VP  I++      D   +   + MAYSF+TLA S+
Sbjct  328  RYNRSLIILMQL--TLVPVNIKAGGIVGIDMSAFFATVRMAYSFYTLALSF  376


>OR2A_DROME unnamed protein product
Length=397

 Score = 32.3 bits (72),  Expect = 0.91, Method: Compositional matrix adjust.
 Identities = 20/105 (19%), Positives = 49/105 (47%), Gaps = 13/105 (12%)

Query  402  ISKEEDYSKVVTVLACATVISIQLLLIAYFNVPFTGQLENIAFSAFNATLLKDNPKFQEL  461
            ++ + D++ ++  +   + +++++ +I YF      Q E +  + ++   ++  PKF+  
Sbjct  293  VADDHDHTAMIISIVFFSAVTLEVFVICYFGDRMRTQSEALCDAFYDCNWIEQLPKFKRE  352

Query  462  LEVSMKTIQ--------NYVPNKIQSTDWLYYVNVMNMAYSFFTL  498
            L  ++   Q        NY+   +++ +      VM   YS FTL
Sbjct  353  LLFTLARTQRPSLIYAGNYIALSLETFE-----QVMRFTYSVFTL  392


>P91821_CAEEL unnamed protein product
Length=501

 Score = 31.6 bits (70),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 24/58 (41%), Gaps = 0/58 (0%)

Query  428  IAYFNVPFTGQLENIAFSAFNATLLKDNPKFQELLEVSMKTIQNYVPNKIQSTDWLYY  485
            I  F  PF  Q+ N   S F A  L+     ++LL         Y   + Q+T WL +
Sbjct  29   IKIFETPFATQVLNPKVSEFCANCLRGPAPGEKLLRCGGCNFSMYCSKECQATAWLVH  86


>Q8I4F7_CAEEL unnamed protein product
Length=507

 Score = 31.6 bits (70),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 24/58 (41%), Gaps = 0/58 (0%)

Query  428  IAYFNVPFTGQLENIAFSAFNATLLKDNPKFQELLEVSMKTIQNYVPNKIQSTDWLYY  485
            I  F  PF  Q+ N   S F A  L+     ++LL         Y   + Q+T WL +
Sbjct  29   IKIFETPFATQVLNPKVSEFCANCLRGPAPGEKLLRCGGCNFSMYCSKECQATAWLVH  86



Lambda      K        H
   0.321    0.136    0.397 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 566763464


Query= XP_018560768.1 glutathione S-transferase 1-1-like [Anoplophora
glabripennis]

Length=165
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GSTD1_DROME  unnamed protein product                                  190     4e-62
Q9VG92_DROME  unnamed protein product                                 181     3e-58
GSTD2_DROME  unnamed protein product                                  176     4e-56
GSTD5_DROME  unnamed protein product                                  169     2e-53
GSTD4_DROME  unnamed protein product                                  167     7e-53


>GSTD1_DROME unnamed protein product
Length=209

 Score = 190 bits (483),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 114/164 (70%), Gaps = 1/164 (1%)

Query  3    VGLYYTPGSSLCRTVLLAAKAIGVDLNLKLLDIAGGEQLKPQFIKFNPQPTIPTLVDNYF  62
            V  YY PGSS CR+V++ AKA+GV+LN KLL++  GE LKP+F+K NPQ TIPTLVDN F
Sbjct  2    VDFYYLPGSSPCRSVIMTAKAVGVELNKKLLNLQAGEHLKPEFLKINPQHTIPTLVDNGF  61

Query  63   VVWESRAIITYLQNKYGRNDSLYPKEPKKRAIVDQRLYFDMD-LFSRFHQVYNPKTLAAG  121
             +WESRAI  YL  KYG+ DSLYPK PKKRA+++QRLYFDM  L+  F   Y P+  A  
Sbjct  62   ALWESRAIQVYLVEKYGKTDSLYPKCPKKRAVINQRLYFDMGTLYQSFANYYYPQVFAKA  121

Query  122  HPDPEIVKSANEGLESSDTFLNKSEFVAGDQLTLADLAIVTQIS  165
              DPE  K      E  +TFL   ++ AGD LT+AD+A+V  +S
Sbjct  122  PADPEAFKKIEAAFEFLNTFLEGQDYAAGDSLTVADIALVATVS  165


>Q9VG92_DROME unnamed protein product
Length=212

 Score = 181 bits (458),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 118/165 (72%), Gaps = 3/165 (2%)

Query  3    VGLYYTPGSSLCRTVLLAAKAIGVDLNLKLLDIAGGEQLKPQFIKFNPQPTIPTLVDNYF  62
            +  YY P S+ CR+V++ AKA+GVDLN+KLL +  GEQLKP+F+K NPQ  IPTLVD+ F
Sbjct  1    MDFYYHPCSAPCRSVIMTAKALGVDLNMKLLKVMDGEQLKPEFVKLNPQHCIPTLVDDGF  60

Query  63   VVWESRAIITYLQNKYGRNDSLYPKEPKKRAIVDQRLYFDM-DLFSRFHQVYNPKTLAAG  121
             +WESRAI+ YL  KYG +DSLYP +P+K+A+V+QRLYFDM  LF  F +   P+ +   
Sbjct  61   SIWESRAILIYLVEKYGADDSLYPSDPQKKAVVNQRLYFDMGTLFQSFVEAIYPQ-IRNN  119

Query  122  HP-DPEIVKSANEGLESSDTFLNKSEFVAGDQLTLADLAIVTQIS  165
            HP DPE ++  +      DTFL   E+VAGD LT+AD+A++  +S
Sbjct  120  HPADPEAMQKVDSAFGHLDTFLEDQEYVAGDCLTIADIALLASVS  164


>GSTD2_DROME unnamed protein product
Length=215

 Score = 176 bits (445),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 110/162 (68%), Gaps = 1/162 (1%)

Query  5    LYYTPGSSLCRTVLLAAKAIGVDLNLKLLDIAGGEQLKPQFIKFNPQPTIPTLVDNYFVV  64
             YY PG   CRTV++ AKA+G++LN KLL+   GEQLKP+F+K NPQ TIPTLVDN F +
Sbjct  3    FYYMPGGGGCRTVIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSI  62

Query  65   WESRAIITYLQNKYGRNDSLYPKEPKKRAIVDQRLYFDMD-LFSRFHQVYNPKTLAAGHP  123
            WESRAI  YL  KYG++D L P +PKKRA+++QRLYFDM  L+  F + Y P        
Sbjct  63   WESRAIAVYLVEKYGKDDYLLPNDPKKRAVINQRLYFDMGTLYESFAKYYYPLFRTGKPG  122

Query  124  DPEIVKSANEGLESSDTFLNKSEFVAGDQLTLADLAIVTQIS  165
              E +K         DTFL   E+VAGDQLT+AD+AI++ +S
Sbjct  123  SDEDLKRIETAFGFLDTFLEGQEYVAGDQLTVADIAILSTVS  164


>GSTD5_DROME unnamed protein product
Length=216

 Score = 169 bits (427),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 112/163 (69%), Gaps = 3/163 (2%)

Query  5    LYYTPGSSLCRTVLLAAKAIGVDLNLKLLDIAGGEQLKPQFIKFNPQPTIPTLVDNYFVV  64
             YY+P  S CRTV++ AKA+GV LN+KLL+    +QLKP+F+K NPQ TIPTLVDN F +
Sbjct  3    FYYSPRGSGCRTVIMVAKALGVKLNMKLLNTLEKDQLKPEFVKLNPQHTIPTLVDNGFSI  62

Query  65   WESRAIITYLQNKYGRNDSLYPKEPKKRAIVDQRLYFDMD-LFSRFHQVYNPKTLAAGHP  123
            WESRAI  YL  KYG++D+L+PK+PKK+A+V+QRLYFDM  L+  F + Y P     G P
Sbjct  63   WESRAIAVYLVEKYGKDDTLFPKDPKKQALVNQRLYFDMGTLYDSFAKYYYP-LFHTGKP  121

Query  124  DP-EIVKSANEGLESSDTFLNKSEFVAGDQLTLADLAIVTQIS  165
               E  K      E  + FL    +VAGD LT+AD+AI++ +S
Sbjct  122  GSDEDFKKIESSFEYLNIFLEGQNYVAGDHLTVADIAILSTVS  164


>GSTD4_DROME unnamed protein product
Length=215

 Score = 167 bits (423),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 109/162 (67%), Gaps = 1/162 (1%)

Query  5    LYYTPGSSLCRTVLLAAKAIGVDLNLKLLDIAGGEQLKPQFIKFNPQPTIPTLVDNYFVV  64
             YY+P SS  RT+++ AKA+G++LN K L I  GE LKP+F+K NPQ TIPTLVDN F +
Sbjct  3    FYYSPRSSGSRTIIMVAKALGLELNKKQLRITEGEHLKPEFLKLNPQHTIPTLVDNGFAI  62

Query  65   WESRAIITYLQNKYGRNDSLYPKEPKKRAIVDQRLYFDMD-LFSRFHQVYNPKTLAAGHP  123
            WESRAI  YL  KYG++DSL+P +P+KRA+++QRLYFDM  L   F + Y P        
Sbjct  63   WESRAIAVYLVEKYGKDDSLFPNDPQKRALINQRLYFDMGTLHDSFMKYYYPFIRTGQLG  122

Query  124  DPEIVKSANEGLESSDTFLNKSEFVAGDQLTLADLAIVTQIS  165
            + E  K      E  D FL   ++VAG QLT+AD+AI++ +S
Sbjct  123  NAENYKKVEAAFEFLDIFLEGQDYVAGSQLTVADIAILSSVS  164



Lambda      K        H
   0.321    0.136    0.397 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 566763464


Query= XP_018560769.1 cadherin-89D [Anoplophora glabripennis]

Length=1881
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DS_DROME  unnamed protein product                                     330     1e-90
X2J8E9_DROME  unnamed protein product                                 330     1e-90
FAT_DROME  unnamed protein product                                    294     2e-79
CADN_DROME  unnamed protein product                                   254     2e-67
FAT2_DROME  unnamed protein product                                   249     5e-66


>DS_DROME unnamed protein product
Length=3503

 Score = 330 bits (846),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 381/1461 (26%), Positives = 637/1461 (44%), Gaps = 205/1461 (14%)

Query  109   DDGEDTITSSLSVTVYVEDINDHAPVFEGAPYHIDVDELTPVGLTVFRGIRAADHDKPNT  168
             D G   +   ++V + ++D+ND+ P+F  + Y   V E   VG +V + + A+D D    
Sbjct  207   DGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQ-VYASDTDADE-  264

Query  169   PNSDVQYAI--VAGNERGKFALESSHQAFLILRKSLDYDSGDRDFLLTITASDRGTPPKS  226
              N  V+YAI     ++   F ++    A  I  K+LD+++ +   L+ + A D G  P  
Sbjct  265   -NGLVEYAINRRQSDKEQMFRIDPRTGAIYI-NKALDFETKELHELVVV-AKDHGEQPLE  321

Query  227   TNATVRIKVNDNDDLPPK----FTKGVYRTKIKEFYPITGARIHQRLKFNPSIHAFDQDL  282
             T A V I+V D +D  P     F       KI E          Q  +F   I   D D 
Sbjct  322   TTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESA--------QPGEFVARISVHDPDS  373

Query  283   AIDSPIRYDIIAGNERHLFSLDHVNGSLFLEREIDLDAERSLPGNTFVLQIQASQMDNPL  342
               +       + G + H F+L   + S++L   + L  +R +  N + L + A+    P 
Sbjct  374   KTEYANVNVTLNGGDGH-FALTTRDNSIYLVI-VHLPLDREIVSN-YTLSVVATDKGTPP  430

Query  343   KTGVARVEVEIMDLNDNLPEFEVDFYNISIVENLPNGFSVLQIIATDQDQGDNAEFSYQL  402
                   + + I D+NDN PEFE D Y+ +++E    G SVLQ++A D+D+G N+  +Y L
Sbjct  431   LHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSL  490

Query  403   ----EDKSGAFTLDSRTGWLTVRDQTVLDREKRSTISMRVYAKE-KVPSVVTSQLGASSV  457
                 E  +  F +D +TG +T R    +D E      + V A++  VP +      +S+ 
Sbjct  491   AETPETHAQWFQIDPQTGLITTRSH--IDCETEPVPQLTVVARDGGVPPL------SSTA  542

Query  458   NIEVTLLDANDNNPTFIPNNLYEFIITTKAKKGDLVGQLHAIDPDLGRNGFVTYSIQKAP  517
              + VT+ D NDN P F   + Y   +      G  + ++ A DPD G N  V Y+I +  
Sbjct  543   TVLVTIHDVNDNEPIF-DQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGF  601

Query  518   NSSIPFEVDTKSGQIMVTQ--DDLQASEHLLFVEASDQPVNPSEKRSALAVVTVDIRDQN  575
                  FEV + SG+I +    D  + S +   V A+D+        S  A++ + + D N
Sbjct  602   KHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDR-----GGLSTTAMIKMQLTDVN  656

Query  576   ENREPDFIGAPYEFWVGGNVDIGTSVGQIRIT-------EFNNMGTILYDLLHSYHEGVP  628
             +NR P F    Y+  +  +    +      I        ++ N G + Y ++     G+ 
Sbjct  657   DNR-PVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGI-  714

Query  629   FAVEEKSGTITVV--DDLNKFNRENYDFEAFVNNEGDLSLVTN--VTIHVVDPKDEKTIL  684
             F ++  +G I VV  D L+   +  +       + G+L    +  V + ++D      I 
Sbjct  715   FRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIF  774

Query  685   MKTGTTPIEFHVKENEP-NILIGKLGFKTNGTNN---LKFTIANQKDVTDHISI-TSDGT  739
              K       ++VKE+ P   ++G +   +    +   ++++I +  D   + SI T+ G 
Sbjct  775   EKAR---YNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYS-GDPDGYFSIETNSGN  830

Query  740   LYTQKPLDRETRDIYRLTIIAEYNKGSVLGTGIYQVNVIVDDENDNKPLFERESYEGKIT  799
             +   KPLD E +    L I A   +  V G    QVN+ V+D NDN P FE       + 
Sbjct  831   IRIAKPLDHEAKSQVLLNIQATLGEPPVYGH--TQVNIEVEDVNDNAPEFEASMVRISVP  888

Query  800   ENSKSGTEVDLNYPIHVSDSDVGHNGQFTVTIFG-NGSEYFRLDRNLGKIQFTGANTPLD  858
             E+++ G  +   Y  H  D D G +GQ T ++   +G   F +D   G +  +     LD
Sbjct  889   ESAELGAPL---YAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILS---QHLD  942

Query  859   RETTSVYNLRLVATDEG--GLTSEAKLTIQVEDENDNSPLFVQFYLYPDKGIEVLQYDST  916
              E++  + L + ATD G   L++   + + V+D NDN P+F                   
Sbjct  943   YESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVF-------------------  983

Query  917   GSRVGHFEEASNSTPGLFVLTQNFLRIRKPKEKISPLVSLPEDIAVGSSVIKAIAEDKDD  976
                                            EK    V++ E  ++ + +I+  A D D 
Sbjct  984   -------------------------------EKDEYSVNVSESRSINAQIIQVNASDLDT  1012

Query  977   GENSVIKYEMVSETY--IPNELSSAPFHIIQYFMVQPTTGEVVIARALPAES--EFRLNI  1032
             G N+ I Y +V      + N +SS+   + Q+F + P +G + +   L  E+   ++L +
Sbjct  1013  GNNARITYRIVDAGVDNVTNSISSS--DVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTV  1070

Query  1033  SATDKGGFKDHLSVRITVR--DVNDHPPVFKKSWYNFDAEEASYTRNTLGRIEATDADFG  1090
              ATD G    H   R+ VR  D ND+ P F+KS Y F  EE     + +G + A+D D G
Sbjct  1071  LATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLG  1130

Query  1091  SNANITYS-IKNNSTVPFSISPTTGALRVDGLLDRETQDKYSFVVVAKDNPKSGKSLSSS  1149
              NA I YS +  NS+  F + P TG +     LDRE ++ Y  VV A+D     +  S+ 
Sbjct  1131  ENAAIRYSLLPINSS--FQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVR--SAR  1186

Query  1150  VNVEVNVLDINDNPPVFYGYDDLIPNPEANNFSNHNYQQKIPVYYATAAENSPMGTPITR  1209
             V V ++V D+NDN P        I +P+ +  S                E  P GT + R
Sbjct  1187  VPVRIHVSDVNDNAPE-------IADPQEDVVS--------------VREEQPPGTEVVR  1225

Query  1210  VFANDSDFTGNGNGLILFDIPYRKSR--QNLFAIDSKEGIVTTIGKLDYESEKSHNITIL  1267
             V A D D   N +  I + I   +      LF+ID   G++ T   LD+E    + + + 
Sbjct  1226  VRAVDRDHGQNAS--ITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVA  1283

Query  1268  ASDLGSPSLSSTAILIVNIIDVPEDIKSIERPVFAHRYYEVEVEENVPV-----------  1316
             ASD G+P   +  +L V ++D+ ++     RP F        V E+  +           
Sbjct  1284  ASDGGNPPRETVRMLRVEVLDLNDN-----RPTFTSSSLVFRVREDAALGHVVGSISPIE  1338

Query  1317  -PLRVLTLNVTEPYRSHKLRYSIVAENSSDVKRTFRIDPRNGSLYIIESPDREQKALYEL  1375
              P  V+  +V E +   ++ Y++       ++  F ID  +G+L +    DRE ++ + L
Sbjct  1339  RPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRL  1398

Query  1376  IIRLDQYKVGRDMTVMIYPVTNERLGNLGLNEVKVIVRVTDVNDNAPKFTVTGRPMIAAI  1435
              IR        D T    P +         + + V + V DVNDNAP++     P+   +
Sbjct  1399  EIR------ALDTTASNNPQS---------SAITVKIEVADVNDNAPEWPQD--PIDLQV  1441

Query  1436  PTTANYGYNVIRLQATDPDLGLNGEVRYQIL-------SRADEASRRFAIDPVTGQVRGI  1488
                   G  +    ATD D G NG+++Y+++          ++A   F +D +TG +   
Sbjct  1442  SEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQ  1501

Query  1489  STFTKEAGKVFGFDVKATDRS  1509
             +    EA + +   V+A D+S
Sbjct  1502  APLDFEAVQEYLLIVQALDQS  1522


 Score = 283 bits (723),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 381/1490 (26%), Positives = 629/1490 (42%), Gaps = 199/1490 (13%)

Query  109   DDGEDTITSSLSVTVYVEDINDHAPVFEGAPYHIDVDELTPVGLTVFRGIRAADHDKPNT  168
             D G   ++S+ +V V + D+ND+ P+F+ + Y++ V E  PVG  + + + A+D D    
Sbjct  532   DGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILK-VSASDPDC--G  588

Query  169   PNSDVQYAIVAG-NERGKFALESSHQAFLILRKSLDYDSGDRDFLLTITASDRGTPPKST  227
              N+ V Y I  G     +F + S+     I  + LD++     +   + A+DRG    ST
Sbjct  589   VNAMVNYTIGEGFKHLTEFEVRSASGEICIAGE-LDFER-RSSYEFPVLATDRGG--LST  644

Query  228   NATVRIKVNDNDDLPPKFTKGVYRTKIKEFYPITGARIHQRLKFNP--SIHAFDQDLAID  285
              A +++++ D +D  P F    Y+  ++E       +   +    P  ++ A D D    
Sbjct  645   TAMIKMQLTDVNDNRPVFYPREYKVSLRE-----SPKASSQASSTPIVAVVATDPDYGNF  699

Query  286   SPIRYDIIAGNERHLFSLDHVNGSLFLEREIDLDAERSLPGNTFVLQIQASQMDNPLKTG  345
               + Y I+AGNE  +F +D   G +F+ R  D+ + R+ P    +L I A+   N     
Sbjct  700   GQVSYRIVAGNEAGIFRIDRSTGEIFVVRP-DMLSVRTQP--MHMLNISATDGGNLRSNA  756

Query  346   VARVEVEIMDLNDNLPEFEVDFYNISIVENLPNGFSVLQIIATDQDQGDNAEFSYQL--E  403
              A V + I+D     P FE   YN  + E++P G  V  +IA   D    +   Y +   
Sbjct  757   DAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSG  816

Query  404   DKSGAFTLDSRTGWLTVRDQTVLDREKRSTISMRVYAKEKVPSVVTSQLGASSVNIEVTL  463
             D  G F++++ +G   +R    LD E +S + + + A    P V     G + VNIEV  
Sbjct  817   DPDGYFSIETNSG--NIRIAKPLDHEAKSQVLLNIQATLGEPPV----YGHTQVNIEVE-  869

Query  464   LDANDNNPTFIPNNLYEFIITTKAKKGDLVGQLHAIDPDLGRNGFVTYSIQKAPNSSIPF  523
              D NDN P F   ++    +   A+ G  +   HA D D G +G VTYS+ K     + F
Sbjct  870   -DVNDNAPEF-EASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGL-F  926

Query  524   EVDTKSGQIMVTQD-DLQASE-HLLFVEASDQPVNPSEKRSALAVVTVDIRDQNENREPD  581
              +D +SG ++++Q  D ++S+ H L V A+D  V PS   S    + VD++D N+N  P 
Sbjct  927   AIDARSGHLILSQHLDYESSQRHTLIVTATDGGV-PS--LSTNLTILVDVQDVNDN-PPV  982

Query  582   FIGAPYEFWVGGNVDIGTSVGQIRITEFN--NMGTILYDLLHSYHEGVP-----------  628
             F    Y   V  +  I   + Q+  ++ +  N   I Y ++ +  + V            
Sbjct  983   FEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQH  1042

Query  629   FAVEEKSGTITVVDDLNKFNRENYDFEAFVNNEGDLSL--VTNVTIHVVDPKDEKTILMK  686
             F +   SG I +   L++  R+ Y       + G  +    T V + V+D  D      K
Sbjct  1043  FGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQK  1102

Query  687   TGTTPIEFHVKENEPN------ILIGKLGFKTNGTNNLKFTIANQKDVTDHISITSDGTL  740
             +     EF ++EN         +    L    N          N       ++    G +
Sbjct  1103  SK---YEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQVHPVT----GEI  1155

Query  741   YTQKPLDRETRDIYRLTIIAEYNKGSVLGTGIYQVNVIVDDENDNKP-LFERESYEGKIT  799
              T++PLDRE R++Y L + A  ++G+ + +    V + V D NDN P + + +     + 
Sbjct  1156  STREPLDRELRELYDLVVEAR-DQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVR  1214

Query  800   ENSKSGTEVDLNYPIHVSDSDVGHNGQFTVTIF----GNGSEYFRLDRNLGKIQFTGANT  855
             E    GTEV     +   D D G N   T +I      +G   F +D   G I+      
Sbjct  1215  EEQPPGTEV---VRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIR---TRV  1268

Query  856   PLDRETTSVYNLRLVATDEGGLTSEA--KLTIQVEDENDNSPLFVQFYLYPDKGIEVLQY  913
              LD E  S+Y L + A+D G    E    L ++V D NDN P F    L           
Sbjct  1269  VLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSL-----------  1317

Query  914   DSTGSRVGHFEEASNSTPGLFVLTQNFLRIRKPKEKISPLVSLPEDIAVGSSV--IKAIA  971
                                         R+R             ED A+G  V  I  I 
Sbjct  1318  --------------------------VFRVR-------------EDAALGHVVGSISPIE  1338

Query  972   EDKDDGENSVIK-YEMVSETYIPNELSSAPFHIIQYFMVQPTTGEVVIARALPAE--SEF  1028
                D   NSV + +E +  TY  N L+     I   F +   +G +V+AR L  E  SEF
Sbjct  1339  RPADVVRNSVEESFEDLRVTYTLNPLTKD--LIEAAFDIDRHSGNLVVARLLDREVQSEF  1396

Query  1029  RLNISATDKGGFKD----HLSVRITVRDVNDHPPVFKKSWYNFDAEEASYTRNTLGRIEA  1084
             RL I A D     +     ++V+I V DVND+ P + +   +    EA+     +    A
Sbjct  1397  RLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTA  1456

Query  1085  TDADFGSNANITYSI----------KNNSTVPFSISPTTGALRVDGLLDRETQDKYSFVV  1134
             TDAD G+N ++ Y +          +  +   F +   TGAL +   LD E   +Y  +V
Sbjct  1457  TDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIV  1516

Query  1135  VAKDNPKS-GKSLSSSVNVEVNVLDINDNPPVFYGYDDLIPNPEANNFSNHNYQQKIPVY  1193
              A D   +  + L +SV V + +LD ND+ P F     + PN      ++        ++
Sbjct  1517  QALDQSSNVTERLQTSVTVRLRILDANDHAPHF-----VSPNSSGGKTAS--------LF  1563

Query  1194  YATAAENSPMGTPITRVFANDSDFTGNGNGLILFDIPYRKSRQNLFAIDSKEGIVTTIGK  1253
              + A     +G  +  + A D D     NG + ++I    + +  F I+S+ GI+  +  
Sbjct  1564  ISDATR---IGEVVAHIVAVDED--SGDNGQLTYEI-TGGNGEGRFRINSQTGIIELVKS  1617

Query  1254  L-----DYESEKSHNITILASDLGSPSLSSTAILIVNIIDVPEDIKSIERPVFAHRYYEV  1308
             L     D E     N+ I A D G P    +++ +  I+    +      P F    Y  
Sbjct  1618  LPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHN----NPPRFLQAVYRA  1673

Query  1309  EVEENVPVPLRVLTLNVTEPYRSH--KLRYSIVAENSSDVKRTFRIDPRNGSLYIIESPD  1366
              + ENVP    VL +     + +    L Y I A  ++D+   F +D + G +      D
Sbjct  1674  TILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDL---FHVDWQRGIITTRGQFD  1730

Query  1367  REQKALYELIIRLDQYKVGRDMTVMIYPVTNER----LGNLG----LNEVKVIVRVTDVN  1418
             RE +A Y L + +      R  T+    V  +R    +G+       +   + + V DVN
Sbjct  1731  RESQASYVLPVYV--RDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVN  1788

Query  1419  DNAPKFTVTGRPMIAAIPTTANYGYNVIRLQATDPDLGLNGEVRYQILSRADEASRRFAI  1478
             DN+P+F   G     ++P  +  G  +  + A+D D G N ++ Y I         +F+I
Sbjct  1789  DNSPEFR-PGSCYGLSVPENSEPGV-IHTVVASDLDEGPNADLIYSIT--GGNLGNKFSI  1844

Query  1479  DPVTGQVRGISTFTKEAGKVFGFDVKATDRSGADDGKSSIANVFVYVLDE  1528
             D  +G++       +E    +   ++A+DR G    +    N+ ++V D+
Sbjct  1845  DSSSGELSA-RPLDREQHSRYTLQIQASDR-GQPKSRQGHCNITIFVEDQ  1892


 Score = 281 bits (720),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 366/1358 (27%), Positives = 574/1358 (42%), Gaps = 225/1358 (17%)

Query  111   GEDTITSSLSVTVYVEDINDHAPVFEGAPYHIDVDELTPVGLTVFRGIRAADHDKPNTPN  170
             GE  +     V + VED+ND+AP FE +   I V E   +G  ++    A  HDK +  +
Sbjct  854   GEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYA---AHAHDKDSGSS  910

Query  171   SDVQYAIVAGNERGKFALESSHQAFLILRKSLDYDSGDRDFLLTITASDRGTPPKSTNAT  230
               V Y++V  + +G FA+++     LIL + LDY+S  R  L+ +TA+D G P  STN T
Sbjct  911   GQVTYSLVKESGKGLFAIDA-RSGHLILSQHLDYESSQRHTLI-VTATDGGVPSLSTNLT  968

Query  231   VRIKVNDNDDLPPKFTKGVYRTKIKEFYPITGARIHQRLKFNPSIHAFDQDLAIDSPIRY  290
             + + V D +D PP F K  Y   + E   I    I         ++A D D   ++ I Y
Sbjct  969   ILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQ--------VNASDLDTGNNARITY  1020

Query  291   DII------------AGNERHLFSLDHVNGSLFLEREIDLDAERSLPGNTFVLQIQASQM  338
              I+            + +    F +   +G ++L   +D +       + + L + A+  
Sbjct  1021  RIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETR-----DRYQLTVLATDN  1075

Query  339   DNPLKTGVARVEVEIMDLNDNLPEFEVDFYNISIVENLPNGFSVLQIIATDQDQGDNAEF  398
               P      RV V ++D NDN P+F+   Y   I ENL  G  V  + A+D D G+NA  
Sbjct  1076  GTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAI  1135

Query  399   SYQLEDKSGAFTLDSRTGWLTVRDQTVLDREKRSTISMRVYAKEKVPSVVTSQLGASSVN  458
              Y L   + +F +   TG ++ R+   LDRE R    + V A+++   V +++     V 
Sbjct  1136  RYSLLPINSSFQVHPVTGEISTREP--LDRELRELYDLVVEARDQGTPVRSAR-----VP  1188

Query  459   IEVTLLDANDNNPTFIPNNLYEFIITTKAKK--GDLVGQLHAIDPDLGRNGFVTYSIQKA  516
             + + + D NDN P     +  E +++ + ++  G  V ++ A+D D G+N  +TYSI K 
Sbjct  1189  VRIHVSDVNDNAPEIA--DPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKG  1246

Query  517   PNSSIP--FEVDTKSGQI--MVTQDDLQASEHLLFVEASDQPVNPSEKRSALAVVTVDIR  572
              +S     F +D  SG I   V  D  + S + L V ASD    P   R  + ++ V++ 
Sbjct  1247  RDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPP---RETVRMLRVEVL  1303

Query  573   DQNENREPDFIGAPYEFWVGGNVDIGTSVGQIRITE------FNNMGTILYDLLHSYHEG  626
             D N+NR P F  +   F V  +  +G  VG I   E       N++     DL  +Y   
Sbjct  1304  DLNDNR-PTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLN  1362

Query  627   --------VPFAVEEKSGTITVVDDLNK-----FNRENYDFEAFVNNEGDLSLVTNVTIH  673
                       F ++  SG + V   L++     F  E    +   +N    S +T V I 
Sbjct  1363  PLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAIT-VKIE  1421

Query  674   VVDPKDEKTILMKTGTTPIEFHVKENEP------NILIGKLGFKTNGTNNLKFTI-----  722
             V D  D      +    PI+  V E  P      N         TNG  +L++ +     
Sbjct  1422  VADVNDNAP---EWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNG--DLQYRLIRYFP  1476

Query  723   ---ANQKDVTDHISITS-DGTLYTQKPLDRETRDIYRLTIIAEYNKGSV---LGTGIYQV  775
                 +Q+       + S  G L  Q PLD E    Y L + A     +V   L T +  V
Sbjct  1477  QLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSV-TV  1535

Query  776   NVIVDDENDNKPLFERESYEGK------ITENSKSGTEVDLNYPIHVSDSDVGHNGQFTV  829
              + + D ND+ P F   +  G       I++ ++ G  V     I   D D G NGQ T 
Sbjct  1536  RLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVV---AHIVAVDEDSGDNGQLTY  1592

Query  830   TIF-GNGSEYFRLDRNLGKIQFTGANTPL--DRETTSVYNLRLVATDEGG---LTSEAKL  883
              I  GNG   FR++   G I+   +  P   D E    +NL + A D G      S   L
Sbjct  1593  EITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNL  1652

Query  884   TIQVEDENDNSPLFVQFYLYPDKGIEVLQYDSTGSRVGHFEEASNSTPGLFVLTQNFLRI  943
              + V+  ++N P F+Q  +Y    +E                  N   G FVL       
Sbjct  1653  HLIVQGSHNNPPRFLQ-AVYRATILE------------------NVPSGSFVL-------  1686

Query  944   RKPKEKISPLVSLPEDIAVGSSVIKAIAEDKDDGENSVIKYEMVSETYIPNELSSAPFHI  1003
                                     +  A+     EN+ + YE      IP  +++  FH+
Sbjct  1687  ------------------------QVTAKSLHGAENANLSYE------IPAGVANDLFHV  1716

Query  1004  IQYFMVQPTTG----EVVIARALP-----AESEFRLNISATDK------------GGFKD  1042
                  +  T G    E   +  LP     A  +  L+ SA  K            G   D
Sbjct  1717  DWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFD  1776

Query  1043  HLSVRITVRDVNDHPPVFKK-SWYNFDAEEASYTRNTLGRIEATDADFGSNANITYSIK-  1100
               ++ ITV DVND+ P F+  S Y     E S     +  + A+D D G NA++ YSI  
Sbjct  1777  VATIYITVGDVNDNSPEFRPGSCYGLSVPENSEP-GVIHTVVASDLDEGPNADLIYSITG  1835

Query  1101  NNSTVPFSISPTTGALRVDGLLDRETQDKYSFVVVAKDNPKSGKSLSSSVNVEVNVLDIN  1160
              N    FSI  ++G L     LDRE   +Y+  + A D  +  KS     N+ + V D N
Sbjct  1836  GNLGNKFSIDSSSGELSARP-LDREQHSRYTLQIQASDRGQP-KSRQGHCNITIFVEDQN  1893

Query  1161  DNPPVFYGYDDLIPNPEANNFSNHNYQQKIPVYYATAAENSPMGTPITRVFANDSDFTGN  1220
             DN P F                      K+  Y  +  E++P+GT + ++ A D+D   N
Sbjct  1894  DNAPRF----------------------KLSKYTGSVQEDAPLGTSVVQISAVDADLGVN  1931

Query  1221  GNGLILFDIPYRKSRQNLFAIDSKEGIVTTIGKLDYESEKSHNITILASDLGSPSLSSTA  1280
                 +++ +      Q  FAID + G++TT+GKLD E + S+N  +LA+D G   + S  
Sbjct  1932  AR--LVYSLANETQWQ--FAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSAT  1987

Query  1281  ILI-VNIIDVPEDIKSIERPVFAHRYYEVEVEENVPVPLRVLTLNVTEP--YRSHKLRYS  1337
             + + +N++D+ ++     RP+F    Y  +V   +     +L +   +     + ++ YS
Sbjct  1988  VPVQINVLDINDN-----RPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYS  2042

Query  1338  IVAENSSDVKRTFRIDPRNGSLYIIESPDREQKALYEL  1375
             + AENS+ V   FRI+P  G+L   +S   E   L  L
Sbjct  2043  LNAENSA-VSAKFRINPSTGALSASQSLASESGKLLHL  2079


 Score = 267 bits (682),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 381/1542 (25%), Positives = 650/1542 (42%), Gaps = 292/1542 (19%)

Query  109   DDGEDTITSSLSVTVYVEDINDHAPVFEGAPYHIDVDELTPVGLTVFRGIRAADHDKPNT  168
             D G  +++++L++ V V+D+ND+ PVFE   Y ++V E   +   + + + A+D D  N 
Sbjct  957   DGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQ-VNASDLDTGN-  1014

Query  169   PNSDVQYAIV-AGNERGKFALESS----------HQAFLILRKSLDYDSGDRDFLLTITA  217
              N+ + Y IV AG +    ++ SS          +  ++ LR  LD ++ DR + LT+ A
Sbjct  1015  -NARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDR-YQLTVLA  1072

Query  218   SDRGTPPKSTNATVRIKVNDNDDLPPKFTKGVYRTKIKEFYPITGARIHQRLKFNPSIHA  277
             +D GTP       V ++V D +D  PKF K  Y  +I+E          +R      + A
Sbjct  1073  TDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENL--------RRGSVVGVVTA  1124

Query  278   FDQDLAIDSPIRYDIIAGNERHLFSLDHVNGSLFLEREIDLDAERSLPGNTFVLQIQASQ  337
              D DL  ++ IRY ++  N    F +  V G +     +D +  R L    + L ++A  
Sbjct  1125  SDLDLGENAAIRYSLLPINSS--FQVHPVTGEISTREPLDREL-REL----YDLVVEARD  1177

Query  338   MDNPLKTGVARVEVEIMDLNDNLPEFEVDFYNI-SIVENLPNGFSVLQIIATDQDQGDNA  396
                P+++    V + + D+NDN PE      ++ S+ E  P G  V+++ A D+D G NA
Sbjct  1178  QGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNA  1237

Query  397   EFSYQL-----EDKSGAFTLDSRTGWLTVRDQTVLDREKRSTISMRVYAKEKV-PSVVTS  450
               +Y +      D  G F++D  +G   +R + VLD E+RS   + V A +   P   T 
Sbjct  1238  SITYSIVKGRDSDGHGLFSIDPTSG--VIRTRVVLDHEERSIYRLGVAASDGGNPPRETV  1295

Query  451   QLGASSVNIEVTLLDANDNNPTFIPNNLYEFIITTKAKKGDLVGQLHAID--PDLGRNGF  508
             ++      + V +LD NDN PTF  ++L  F +   A  G +VG +  I+   D+ RN  
Sbjct  1296  RM------LRVEVLDLNDNRPTFTSSSLV-FRVREDAALGHVVGSISPIERPADVVRNSV  1348

Query  509   --------VTYSIQKAPNSSI--PFEVDTKSGQIMVTQ--DDLQASEHLLFVEASDQPVN  556
                     VTY++       I   F++D  SG ++V +  D    SE  L + A D   +
Sbjct  1349  EESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTAS  1408

Query  557   PSEKRSALAVVTVDIRDQNENREPDFIGAPYEFWVGGNVDIGTSVGQIRITEFNNM--GT  614
              + + SA+  V +++ D N+N  P++   P +  V     +GT +     T+ +    G 
Sbjct  1409  NNPQSSAI-TVKIEVADVNDN-APEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGD  1466

Query  615   ILYDLLHSYHEGVPFAVEEKSGTITVVDDLNKFN--RENYDFEAF---------VNNEGD  663
             + Y L+  + +      +E++ ++  +D L      +   DFEA          ++   +
Sbjct  1467  LQYRLIRYFPQ--LNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSN  1524

Query  664   LS--LVTNVTIH--VVDPKDEKTILM-------KTGTTPIEFHVKENEPNILI-------  705
             ++  L T+VT+   ++D  D     +       KT +  I    +  E    I       
Sbjct  1525  VTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDS  1584

Query  706   ---GKLGFK-TNGTNNLKFTIANQKDVTDHISITSDGTLYTQKPLDRETRDIYRLTIIAE  761
                G+L ++ T G    +F I +Q  + + +      T       D E    + L I A+
Sbjct  1585  GDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATE------DVEKGGRFNLIIGAK  1638

Query  762   YNKGSVLGTGIYQVNVIVDDENDNKPLFERESYEGKITENSKSGTEVDLNYPIHVSDSDV  821
              +           +++IV   ++N P F +  Y   I EN  SG+ V     + V+   +
Sbjct  1639  DHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFV-----LQVTAKSL  1693

Query  822   --GHNGQFTVTI-FGNGSEYFRLDRNLGKIQFTGANTPLDRETTSVYNL-----------  867
                 N   +  I  G  ++ F +D   G I   G     DRE+ + Y L           
Sbjct  1694  HGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQ---FDRESQASYVLPVYVRDANRQS  1750

Query  868   --------RLVATDEGGLTSE------AKLTIQVEDENDNSPLFVQFYLYPDKGIEVLQY  913
                     +  ++D  G TS       A + I V D NDNSP F     Y   G+ V + 
Sbjct  1751  TLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCY---GLSVPE-  1806

Query  914   DSTGSRVGHFEEASNSTPGLFVLTQNFLRIRKPKEKISPLVSLPEDIAVGSSVIKAIAED  973
                           NS PG+                                +   +A D
Sbjct  1807  --------------NSEPGV--------------------------------IHTVVASD  1820

Query  974   KDDGENSVIKYEMVSETYIPNELSSAPFHIIQYFMVQPTTGEVVIARALPAE--SEFRLN  1031
              D+G N+ + Y +               ++   F +  ++GE+  AR L  E  S + L 
Sbjct  1821  LDEGPNADLIYSITGG------------NLGNKFSIDSSSGELS-ARPLDREQHSRYTLQ  1867

Query  1032  ISATDKGGFKD---HLSVRITVRDVNDHPPVFKKSWYNFDAEEASYTRNTLGRIEATDAD  1088
             I A+D+G  K    H ++ I V D ND+ P FK S Y    +E +    ++ +I A DAD
Sbjct  1868  IQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDAD  1927

Query  1089  FGSNANITYSIKNNSTVPFSISPTTGALRVDGLLDRETQDKYSFVVVAKDNPKSGKSLSS  1148
              G NA + YS+ N +   F+I   +G +   G LDRE Q  Y+F+V+A D  +  +  S+
Sbjct  1928  LGVNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRY-EVRSA  1986

Query  1149  SVNVEVNVLDINDNPPVFYGYDDLIPNPEANNFSNHNYQQKIPVYYATAAENSPMGTPIT  1208
             +V V++NVLDINDN P+F  Y                Y  ++P            G  + 
Sbjct  1987  TVPVQINVLDINDNRPIFERYP---------------YIGQVPALIQP-------GQTLL  2024

Query  1209  RVFANDSDFTGNGNGLILFDIPYRKSRQNL-FAIDSKEGIVTTIGKLDYESEKSHNITIL  1267
             +V A D+D   N    I++ +    S  +  F I+   G ++    L  ES K  ++ ++
Sbjct  2025  KVQALDADLGANAE--IVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVV  2082

Query  1268  ASDLGSPSLSSTAILIVNIIDVPEDIKSIERPVFAHRYYEVEVEENVPVPLRVL-TLNVT  1326
             A D G+P  SS  ++ + I + P+    +    F +  Y V ++EN P   R+L  + + 
Sbjct  2083  ARDKGNPPQSSLGLIELLIGEAPQGTPVLR---FQNETYRVMLKENSPSGTRLLQVVALR  2139

Query  1327  EPYRSHKLRYSIVAENSSDVKRTFRIDPRNGSLYI----------IESPDREQ----KAL  1372
                R  K+++S  A N   +     +D  +G + +            +P        +AL
Sbjct  2140  SDGRRQKVQFSFGAGNEDGI---LSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRAL  2196

Query  1373  YELIIRL--------DQYKVGRDMTVMIYPVTNERLGNLGLNEVKV--------------  1410
             +              +  +  R +T   + +TN +      NE++V              
Sbjct  2197  HYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQ-----PNEIRVVLVARTADAPFLAS  2251

Query  1411  ----IVRVTDVNDNAPKFTVTGRPMIAAIPTTANYGYNVIRLQATDPDLGLNGEVRYQIL  1466
                 ++ + D NDN+PKF  + +  +A +    N G  V ++ A D D G N  +RY I+
Sbjct  2252  YAELVIELEDENDNSPKF--SQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIV  2309

Query  1467  SRADEASRRFAIDPV-TGQVRGISTFTKEAGKVFGFDVKATD  1507
                 + +  F I+P  +G VR      +E   ++   + ATD
Sbjct  2310  DGNHDNA--FVIEPAFSGIVRTNIVLDREIRDIYKLKIIATD  2349


 Score = 265 bits (677),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 373/1513 (25%), Positives = 623/1513 (41%), Gaps = 264/1513 (17%)

Query  96    PRNVLKFKVTCDYDDGEDTITSSLSVTVYVEDINDHAPVFEGAPYHIDVDELTPVGLTVF  155
             P ++L    T   D G     +   V + + D     P+FE A Y+  V E  P G TV 
Sbjct  738   PMHMLNISAT---DGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRG-TVV  793

Query  156   RGIRAADHDKPNTPNSDVQYAIVAGNERGKFALESSHQAFLILRKSLDYDSGDRDFLLTI  215
               + AA  D  +   S V+Y+I +G+  G F++E++     I  K LD+++  +  LL I
Sbjct  794   GSVIAASGDVAH--RSPVRYSIYSGDPDGYFSIETNSGNIRIA-KPLDHEAKSQ-VLLNI  849

Query  216   TASDRGTPPKSTNATVRIKVNDNDDLPPKFTKGVYRTKIKEFYPITGARIHQRLKFNPSI  275
              A+  G PP   +  V I+V D +D  P+F   + R  + E   + GA ++       + 
Sbjct  850   QAT-LGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAEL-GAPLY-------AA  900

Query  276   HAFDQDLAIDSPIRYDIIAGNERHLFSLDHVNGSLFLEREIDLDAERSLPGNTFVLQIQA  335
             HA D+D      + Y ++  + + LF++D  +G L L + +D ++ +        L + A
Sbjct  901   HAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYESSQR-----HTLIVTA  955

Query  336   SQMDNPLKTGVARVEVEIMDLNDNLPEFEVDFYNISIVENLPNGFSVLQIIATDQDQGDN  395
             +    P  +    + V++ D+NDN P FE D Y++++ E+      ++Q+ A+D D G+N
Sbjct  956   TDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNN  1015

Query  396   AEFSYQL--------------EDKSGAFTLDSRTGWLTVRDQTVLDREKRSTISMRVYAK  441
             A  +Y++               D S  F +   +GW+ +R    LDRE R    + V A 
Sbjct  1016  ARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLR--APLDRETRDRYQLTVLAT  1073

Query  442   EKVPSVVTSQLGASSVNIEVTLLDANDNNPTFIPNNLYEFIITTKAKKGDLVGQLHAIDP  501
             +       +    +   + V +LDANDN+P F   + YEF I    ++G +VG + A D 
Sbjct  1074  DN-----GTPAAHAKTRVIVRVLDANDNDPKF-QKSKYEFRIEENLRRGSVVGVVTASDL  1127

Query  502   DLGRNGFVTYSIQKAPNSSIPFEVDTKSGQIMVTQD-DLQASE-HLLFVEASDQ--PVNP  557
             DLG N  + YS+    NSS  F+V   +G+I   +  D +  E + L VEA DQ  PV  
Sbjct  1128  DLGENAAIRYSLLPI-NSS--FQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPV--  1182

Query  558   SEKRSALAVVTVDIRDQNENREPDFIGAPYEFWVGGNVDI--GTSVGQIRITEFNNM--G  613
                RSA   V + + D N+N  P+ I  P E  V    +   GT V ++R  + ++    
Sbjct  1183  ---RSARVPVRIHVSDVNDN-APE-IADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNA  1237

Query  614   TILYDLLH---SYHEGVPFAVEEKSGTITVVDDLNKFNRENYDFEAFVNNEGD--LSLVT  668
             +I Y ++    S   G+ F+++  SG I     L+   R  Y      ++ G+     V 
Sbjct  1238  SITYSIVKGRDSDGHGL-FSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVR  1296

Query  669   NVTIHVVDPKDEKTILMKTGTTPIEFHVKENEP-NILIGKLGFKTNGTN-----------  716
              + + V+D  D +       ++ + F V+E+     ++G +       +           
Sbjct  1297  MLRVEVLDLNDNRPTFT---SSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFE  1353

Query  717   NLKFTIANQKDVTDHISITSD-----GTLYTQKPLDRETRDIYRLTIIA-EYNKGSVLGT  770
             +L+ T        D I    D     G L   + LDRE +  +RL I A +    +   +
Sbjct  1354  DLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQS  1413

Query  771   GIYQVNVIVDDENDNKPLFERESYEGKITENSKSGTEVDLNYPIHVSDSDVGHNGQFTVT  830
                 V + V D NDN P + ++  + +++E +  GT +   +    +D+D G NG     
Sbjct  1414  SAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTII---HNFTATDADTGTNGDLQYR  1470

Query  831   IF----------GNGSEYFRLDRNLGKIQFTGANTPLDRETTSVYNLRLVATDEGG----  876
             +                 FR+D   G +       PLD E    Y L + A D+      
Sbjct  1471  LIRYFPQLNESQEQAMSLFRMDSLTGALSL---QAPLDFEAVQEYLLIVQALDQSSNVTE  1527

Query  877   -LTSEAKLTIQVEDENDNSPLFVQFYLYPDKGIEVLQYDSTGSRVGHFEEASNSTPGLFV  935
              L +   + +++ D ND++P FV               +S+G +          T  LF+
Sbjct  1528  RLQTSVTVRLRILDANDHAPHFVS-------------PNSSGGK----------TASLFI  1564

Query  936   LTQNFLRIRKPKEKISPLVSLPEDIAVGSSVIKAIAEDKDDGENSVIKYEMVSETYIPNE  995
                                   +   +G  V   +A D+D G+N  + YE+         
Sbjct  1565  ---------------------SDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGR-  1602

Query  996   LSSAPFHIIQYFMVQPTTGEVVIARALPAESE-------FRLNISATDKGG---FKDHLS  1045
                        F +   TG + + ++LP  +E       F L I A D G     K  L+
Sbjct  1603  -----------FRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLN  1651

Query  1046  VRITVRDVNDHPPVFKKSWYNFDAEEASYTRNTLGRIEATDADFGSNANITYSIKNN-ST  1104
             + + V+  +++PP F ++ Y     E   + + + ++ A       NAN++Y I    + 
Sbjct  1652  LHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVAN  1711

Query  1105  VPFSISPTTGALRVDGLLDRETQDKYSFVVVAKDNPKSGKSLSSSV--------------  1150
               F +    G +   G  DRE+Q  Y   V  +D  +     SS+V              
Sbjct  1712  DLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSN  1771

Query  1151  -------NVEVNVLDINDNPPVFYGYDDLIPNPEANNFSNHNYQQKIPVYYATAAENSPM  1203
                     + + V D+NDN P F                     +    Y  +  ENS  
Sbjct  1772  GQHFDVATIYITVGDVNDNSPEF---------------------RPGSCYGLSVPENSEP  1810

Query  1204  GTPITRVFANDSDFTGNGNGLILFDIPYRKSRQNL---FAIDSKEGIVTTIGKLDYESEK  1260
             G  I  V A+D D   N       D+ Y  +  NL   F+IDS  G ++    LD E   
Sbjct  1811  GV-IHTVVASDLDEGPNA------DLIYSITGGNLGNKFSIDSSSGELSA-RPLDREQHS  1862

Query  1261  SHNITILASDLGSPSLSSTAILIVNIIDVPEDIKSIERPVFAHRYYEVEVEENVPVPLRV  1320
              + + I ASD G P        I   ++   D      P F    Y   V+E+ P+   V
Sbjct  1863  RYTLQIQASDRGQPKSRQGHCNITIFVEDQND----NAPRFKLSKYTGSVQEDAPLGTSV  1918

Query  1321  LTLNVTEP--YRSHKLRYSIVAENSSDVKRTFRIDPRNGSLYIIESPDREQKALYELIIR  1378
             + ++  +     + +L YS+  E     +  F ID ++G +  +   DRE +A Y  ++ 
Sbjct  1919  VQISAVDADLGVNARLVYSLANE----TQWQFAIDGQSGLITTVGKLDRELQASYNFMVL  1974

Query  1379  L---DQYKVGRDMTVMIYPVTNERLGNLGLNEVKVIVRVTDVNDNAPKFTVTGRPMIAAI  1435
                  +Y+V R  TV                   V + V D+NDN P F     P I  +
Sbjct  1975  ATDGGRYEV-RSATV------------------PVQINVLDINDNRPIFE--RYPYIGQV  2013

Query  1436  PTTANYGYNVIRLQATDPDLGLNGEVRYQILSRADEASRRFAIDPVTGQVRGISTFTKEA  1495
             P     G  ++++QA D DLG N E+ Y + +     S +F I+P TG +    +   E+
Sbjct  2014  PALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASES  2073

Query  1496  GKVFGFDVKATDR  1508
             GK+   +V A D+
Sbjct  2074  GKLLHLEVVARDK  2086


 Score = 263 bits (671),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 376/1484 (25%), Positives = 610/1484 (41%), Gaps = 239/1484 (16%)

Query  119   LSVTVYVEDINDHAPVFEGAPYHIDVDELTPVGLTVFRGIRAADHDKPNTPNSDVQYAIV  178
             + V V V+D ND+AP F     HI+  E TP    V R +  A  D    P +  +Y IV
Sbjct  105   IRVLVTVKDENDNAPTFPQTSMHIEFPENTP--REVKRTLLPA-RDLDLEPYNTQRYNIV  161

Query  179   AGNERGKFALESSHQAFLILRKSLDYDSG--DRD----FLLTITASDRGTPPKSTNATVR  232
             +GN    F L S  +   +L   L   SG  DR+    + L I A D GTPP     TV 
Sbjct  162   SGNVNDAFRLSSHRERDGVLYLDLQI-SGFLDRETTPGYSLLIEALDGGTPPLRGFMTVN  220

Query  233   IKVNDNDDLPPKFTKGVYRTKIKEFYPITGARIHQRLKFNPSIHAFDQDLAIDSPIRYDI  292
             I + D +D  P F +  Y   + E   + G  + Q       ++A D D   +  + Y I
Sbjct  221   ITIQDVNDNQPIFNQSRYFATVPENATV-GTSVLQ-------VYASDTDADENGLVEYAI  272

Query  293   --IAGNERHLFSLDHVNGSLFLEREIDLDAERSLPGNTFVLQIQASQMDNPLKTGVARVE  350
                  ++  +F +D   G++++ + +D + +        ++ +     + PL+T  A V 
Sbjct  273   NRRQSDKEQMFRIDPRTGAIYINKALDFETKELHE----LVVVAKDHGEQPLET-TAFVS  327

Query  351   VEIMDLNDNLPEFEVDFY----NISIVENLPNGFSVLQIIATDQD-QGDNAEFSYQLEDK  405
             + + D+NDN P   V F     +  I E+   G  V +I   D D + + A  +  L   
Sbjct  328   IRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGG  387

Query  406   SGAFTLDSRTGWL-TVRDQTVLDREKRSTISMRVYAKEKVPSVVTSQLGASSVNIEVTLL  464
              G F L +R   +  V     LDRE  S  ++ V A +K     T  L AS  +I + + 
Sbjct  388   DGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDK----GTPPLHASK-SIFLRIT  442

Query  465   DANDNNPTFIPNNLYEFIITTKAKKGDLVGQLHAIDPDLGRNGFVTYSIQKAPNSSIP-F  523
             D NDN P F   +LY   +   A  G  V Q+ A D D G N  +TYS+ + P +    F
Sbjct  443   DVNDNPPEF-EQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWF  501

Query  524   EVDTKSGQIMVTQDDLQASEHL--LFVEASDQPVNPSEKRSALAVVTVDIRDQNENREPD  581
             ++D ++G I         +E +  L V A D  V P    S+ A V V I D N+N EP 
Sbjct  502   QIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPP---LSSTATVLVTIHDVNDN-EPI  557

Query  582   FIGAPYEFWVGGNVDIGTSVGQIRITE----FNNMGTILYDLLHSYHEGVPFAVEEKSGT  637
             F  + Y   V  N  +G  + ++  ++     N M  + Y +   +     F V   SG 
Sbjct  558   FDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAM--VNYTIGEGFKHLTEFEVRSASGE  615

Query  638   ITVVDDLNKFNRENYDFEAFVNNEGDLSLVTNVTIHVVDPKDEKTILM------------  685
             I +  +L+   R +Y+F     + G LS    + + + D  D + +              
Sbjct  616   ICIAGELDFERRSSYEFPVLATDRGGLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESP  675

Query  686   ----KTGTTPIEFHVKENEPNILIGKLGFKTNGTNNLKFTIANQKDVTDHISITSDGTLY  741
                 +  +TPI   V  +      G++ ++    N       ++          S G ++
Sbjct  676   KASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDR----------STGEIF  725

Query  742   TQKP--LDRETRDIYRLTIIAEYNKGSVLGTGIYQVNVIVDDENDNKPLFERESYEGKIT  799
               +P  L   T+ ++ L I A  + G++       V + + D     P+FE+  Y   + 
Sbjct  726   VVRPDMLSVRTQPMHMLNISAT-DGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVK  784

Query  800   ENSKSGTEVDLNYPIHVSDSDVGHNGQFTVTIF-GNGSEYFRLDRNLGKIQFTGANTPLD  858
             E+   GT V     +  +  DV H      +I+ G+   YF ++ N G I+      PLD
Sbjct  785   EDIPRGTVVG---SVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIA---KPLD  838

Query  859   RETTSVYNLRLVAT-DEGGLTSEAKLTIQVEDENDNSPLFVQFYLYPDKGIEVLQYDSTG  917
              E  S   L + AT  E  +    ++ I+VED NDN+P F                    
Sbjct  839   HEAKSQVLLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEF--------------------  878

Query  918   SRVGHFEEASNSTPGLFVLTQNFLRIRKPKEKISPLVSLPEDIAVGSSVIKAIAEDKDDG  977
                    EAS             +RI           S+PE   +G+ +  A A DKD G
Sbjct  879   -------EAS------------MVRI-----------SVPESAELGAPLYAAHAHDKDSG  908

Query  978   ENSVIKYEMVSETYIPNELSSAPFHIIQYFMVQPTTGEVVIARALPAESEFR--LNISAT  1035
              +  + Y +V E+                F +   +G +++++ L  ES  R  L ++AT
Sbjct  909   SSGQVTYSLVKESG------------KGLFAIDARSGHLILSQHLDYESSQRHTLIVTAT  956

Query  1036  DKG--GFKDHLSVRITVRDVNDHPPVFKKSWYNFDAEEASYTRNTLGRIEATDADFGSNA  1093
             D G      +L++ + V+DVND+PPVF+K  Y+ +  E+      + ++ A+D D G+NA
Sbjct  957   DGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNA  1016

Query  1094  NITYSI-------------KNNSTVPFSISPTTGALRVDGLLDRETQDKYSFVVVAKDNP  1140
              ITY I              ++ +  F I P +G + +   LDRET+D+Y   V+A DN 
Sbjct  1017  RITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDN-  1075

Query  1141  KSGKSLSSSVNVEVNVLDINDNPPVFYGYDDLIPNPEANNFSNHNYQQKIPVYYATAAEN  1200
                 +  +   V V VLD NDN P                F    Y+ +I        EN
Sbjct  1076  -GTPAAHAKTRVIVRVLDANDNDP---------------KFQKSKYEFRI-------EEN  1112

Query  1201  SPMGTPITRVFANDSDFTGNGNGLILFDIPYRKSRQNLFAIDSKEGIVTTIGKLDYESEK  1260
                G+ +  V A+D D  G    +    +P   S    F +    G ++T   LD E  +
Sbjct  1113  LRRGSVVGVVTASDLDL-GENAAIRYSLLPINSS----FQVHPVTGEISTREPLDRELRE  1167

Query  1261  SHNITILASDLGSPSLSSTAILIVNIIDVPEDIKSIERPVFAHRYYEVEVEENVPVPLRV  1320
              +++ + A D G+P  S+   + +++ DV ++   I  P    +   V V E  P    V
Sbjct  1168  LYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADP----QEDVVSVREEQPPGTEV  1223

Query  1321  LTLNVTEPYRSH----KLRYSIVAENSSDVKRTFRIDPRNGSLYIIESPDREQKALYELI  1376
             + +   +  R H     + YSIV    SD    F IDP +G +      D E++++Y L 
Sbjct  1224  VRVRAVD--RDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRL-  1280

Query  1377  IRLDQYKVGRDMTVMIYPVTNERLGNLGLNEVKVI-VRVTDVNDNAPKFTVTGRPMIAAI  1435
                               V     GN     V+++ V V D+NDN P FT +   ++  +
Sbjct  1281  -----------------GVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSS--LVFRV  1321

Query  1436  PTTANYGY------------NVIRLQATDPDLGLNGEVRYQILSRADEASRRFAIDPVTG  1483
                A  G+            +V+R    +    L        L++ D     F ID  +G
Sbjct  1322  REDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTK-DLIEAAFDIDRHSG  1380

Query  1484  QVRGISTFTKEAGKVFGFDVKATDRSGADDGKSSIANVFVYVLD  1527
              +       +E    F  +++A D + +++ +SS   V + V D
Sbjct  1381  NLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVAD  1424


 Score = 254 bits (649),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 378/1500 (25%), Positives = 631/1500 (42%), Gaps = 255/1500 (17%)

Query  109   DDGEDTITSSLSVTVYVEDINDHAP-VFEGAPYHIDVDELTPVGLTVFRGIRAADHDKPN  167
             D G    ++ + V ++V D+ND+AP + +     + V E  P G  V R +RA D D  +
Sbjct  1177  DQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVR-VRAVDRD--H  1233

Query  168   TPNSDVQYAIVAGNERGKFALESSHQAFLILRKSLDYDSGDRD-FLLTITASDRGTPPKS  226
               N+ + Y+IV G +     L S      ++R  +  D  +R  + L + ASD G PP+ 
Sbjct  1234  GQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRE  1293

Query  227   TNATVRIKVNDNDDLPPKFTKGVYRTKIKEFYPITGARIHQRLKFNP----------SIH  276
             T   +R++V D +D  P FT      +++E      A  H     +P          S+ 
Sbjct  1294  TVRMLRVEVLDLNDNRPTFTSSSLVFRVRE----DAALGHVVGSISPIERPADVVRNSVE  1349

Query  277   AFDQDLAID---SPIRYDIIAGNERHLFSLDHVNGSLFLEREIDLDAERSLPGNTFVLQI  333
                +DL +    +P+  D+I       F +D  +G+L + R +D + +     + F L+I
Sbjct  1350  ESFEDLRVTYTLNPLTKDLIEA----AFDIDRHSGNLVVARLLDREVQ-----SEFRLEI  1400

Query  334   QA---SQMDNPLKTGVARVEVEIMDLNDNLPEFEVDFYNISIVENLPNGFSVLQIIATDQ  390
             +A   +  +NP  + +  V++E+ D+NDN PE+  D  ++ + E  P G  +    ATD 
Sbjct  1401  RALDTTASNNPQSSAIT-VKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDA  1459

Query  391   DQGDNAEFSYQL-----------EDKSGAFTLDSRTGWLTVRDQTVLDREKRSTISMRVY  439
             D G N +  Y+L           E     F +DS TG L++  Q  LD E      + V 
Sbjct  1460  DTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSL--QAPLDFEAVQEYLLIVQ  1517

Query  440   AKEKVPSVVTSQLGASSVNIEVTLLDANDNNPTFI-PNN----LYEFIITTKAKKGDLVG  494
             A ++  S VT +L  +SV + + +LDAND+ P F+ PN+         I+   + G++V 
Sbjct  1518  ALDQ-SSNVTERL-QTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVA  1575

Query  495   QLHAIDPDLGRNGFVTYSIQKAPNSSIPFEVDTKSGQIMVTQDDLQASEHL-------LF  547
              + A+D D G NG +TY I    N    F +++++G I + +    A+E +       L 
Sbjct  1576  HIVAVDEDSGDNGQLTYEITGG-NGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLI  1634

Query  548   VEASDQPVNPSEKRSALAVVTVDIRDQNENREPDFIGAPYEFWVGGNVDIGTSVGQIRIT  607
             + A D    P  K+S+L +    I   + N  P F+ A Y   +  NV  G+ V Q+   
Sbjct  1635  IGAKDHG-QPEPKKSSLNLHL--IVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAK  1691

Query  608   EFNNMGTILYDLLHSYHEGVP---FAVEEKSGTITVVDDLNKFNRENYDFEAFVNNEGDL  664
               +  G    +L +    GV    F V+ + G IT     ++ ++ +Y    +V +    
Sbjct  1692  SLH--GAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQ  1749

Query  665   SLVTNVTIHVVDPKDE------------KTILMKTG----TTPIEFH--------VKEN-  699
             S +++  +      D              TI +  G     +P EF         V EN 
Sbjct  1750  STLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSP-EFRPGSCYGLSVPENS  1808

Query  700   EPNILIGKLGFKTN-GTN-NLKFTIANQKDVTDHISITSDGTLYTQKPLDRETRDIYRLT  757
             EP ++   +    + G N +L ++I    ++ +  SI S     + +PLDRE    Y L 
Sbjct  1809  EPGVIHTVVASDLDEGPNADLIYSITG-GNLGNKFSIDSSSGELSARPLDREQHSRYTLQ  1867

Query  758   IIAEYNKGSVLGTGIYQVNVIVDDENDNKPLFERESYEGKITENSKSGTEVDLNYPIHVS  817
             I A          G   + + V+D+NDN P F+   Y G + E++  GT V     I   
Sbjct  1868  IQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSV---VQISAV  1924

Query  818   DSDVGHNGQFTVTIFGNGSEYFRLDRNLGKIQFTGANTPLDRETTSVYNLRLVATDEGGL  877
             D+D+G N +   ++       F +D   G I   G    LDRE  + YN  ++ATD G  
Sbjct  1925  DADLGVNARLVYSLANETQWQFAIDGQSGLITTVGK---LDRELQASYNFMVLATDGGRY  1981

Query  878   ---TSEAKLTIQVEDENDNSPLFVQFYLYPDKGIEVLQYDSTGSRVGHFEEASNSTPGLF  934
                ++   + I V D NDN P+F +   YP  G                           
Sbjct  1982  EVRSATVPVQINVLDINDNRPIFER---YPYIG---------------------------  2011

Query  935   VLTQNFLRIRKPKEKISPLVSLPEDIAVGSSVIKAIAEDKDDGENSVIKYEMVSETYIPN  994
                                  +P  I  G +++K  A D D G N+ I Y + +E    N
Sbjct  2012  --------------------QVPALIQPGQTLLKVQALDADLGANAEIVYSLNAE----N  2047

Query  995   ELSSAPFHIIQYFMVQPTTGEVVIARALPAESE--FRLNISATDKGGF-KDHLS-VRITV  1050
                SA F I       P+TG +  +++L +ES     L + A DKG   +  L  + + +
Sbjct  2048  SAVSAKFRI------NPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLI  2101

Query  1051  RDVNDHPPV--FKKSWYNFDAEEASYTRNTLGRIEATDADFGSNANITYSI-KNNSTVPF  1107
              +     PV  F+   Y    +E S +   L ++ A  +D G    + +S    N     
Sbjct  2102  GEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSD-GRRQKVQFSFGAGNEDGIL  2160

Query  1108  SISPTTGALRVDG--LLDRETQDKYSFVVVAK-------------------DNPKSGKSL  1146
             S+   +G +RV+   LLD +     S   +++                   ++ +S ++L
Sbjct  2161  SLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRAL  2220

Query  1147  SSSV---------NVEVNVLDINDNPPVFYGYDDLIPNPEANNFSNHNYQQKIPVYYATA  1197
             +SS           + V ++    + P    Y +L+   E  N ++  + QK   + AT 
Sbjct  2221  TSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQK--QFVATV  2278

Query  1198  AENSPMGTPITRVFANDSDFTGNGNGLILFDIPYRKSRQNLFAIDSK-EGIVTTIGKLDY  1256
             +E +  GT + +V A DSD     N  + + I    +  N F I+    GIV T   LD 
Sbjct  2279  SEGNNKGTFVAQVHAFDSD--AGSNARLRYHI-VDGNHDNAFVIEPAFSGIVRTNIVLDR  2335

Query  1257  ESEKSHNITILASDLGSPSLSSTAILIVNIIDVPEDIKSIERPVFAHRYYEVEVEENVPV  1316
             E    + + I+A+D G P ++ TA + V I+DV ++     +P F      V V E   +
Sbjct  2336  EIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDN-----QPTFPPNNL-VTVSEATEL  2389

Query  1317  PLRVLTLNVTEPYRSHKLRYSIVAENSSDVKRT--FRIDPRNGSLYIIESPDREQKALYE  1374
                + +++  +      L Y + AE++ D++    F +D  +G L +    D E +  YE
Sbjct  2390  GAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYE  2449

Query  1375  L-IIRLDQYKVGRDMTVMIYPVTNERLGNLGLNEVKVIVRVTDVNDNAPKFTVTG-----  1428
             L +I  D     R +                     + VRV D NDNAP F         
Sbjct  2450  LDVIASDAAHEARTV---------------------LTVRVNDENDNAPVFLAQQPPAYF  2488

Query  1429  --RPMIAAIPTTANYGYNVIRLQATDPDL-GLNGEVRYQILSRADEASRRFAIDPVTGQV  1485
                P I+ I  + +  ++++ + ATD D  G N +V Y I    + A   F++ P  G V
Sbjct  2489  AILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYII----EPAQEGFSVHPSNGVV  2544


 Score = 216 bits (551),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 308/1213 (25%), Positives = 509/1213 (42%), Gaps = 217/1213 (18%)

Query  409   FTLDSRTGWLTVRDQTVLDREKRSTISMRVYAKEKVPSVVTSQLGASSVNIEVTLLDAND  468
               +D  TG   +R +  LDRE R++ S+           V   L   ++ + VT+ D ND
Sbjct  70    LAIDRATG--EIRTKVKLDRETRASYSL-----------VAIPLSGRNIRVLVTVKDEND  116

Query  469   NNPTFIPNNLY-EFIITTKAKKGDLVGQLHAIDPDLGRNGFVTYSIQKAPNSSIPFEVDT  527
             N PTF   +++ EF   T  +    +  L A D DL       Y+I    N +  F + +
Sbjct  117   NAPTFPQTSMHIEFPENTPREVKRTL--LPARDLDLEPYNTQRYNIVSG-NVNDAFRLSS  173

Query  528   KSGQIMVTQDDLQASEHL---------LFVEASDQPVNPSEKRSALAVVTVDIRDQNENR  578
                +  V   DLQ S  L         L +EA D    P         V + I+D N+N 
Sbjct  174   HRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLR---GFMTVNITIQDVNDN-  229

Query  579   EPDFIGAPYEFWVGGNVDIGTSVGQIRI--TEFNNMGTILYDL--LHSYHEGVPFAVEEK  634
             +P F  + Y   V  N  +GTSV Q+    T+ +  G + Y +    S  E + F ++ +
Sbjct  230   QPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQM-FRIDPR  288

Query  635   SGTITVVDDLNKFNRENYDFEAFVNNEGDLSLVTN--VTIHVVDPKDEK----TILMKTG  688
             +G I +   L+   +E ++      + G+  L T   V+I V D  D +     I +   
Sbjct  289   TGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDD  348

Query  689   TTPIEFHVKEN-EPNILIGKLGFKTNGTN----NLKFTIANQKDVTDHISITS-DGTLY-  741
              +P    + E+ +P   + ++      +     N+  T+ N  D   H ++T+ D ++Y 
Sbjct  349   ASP---KISESAQPGEFVARISVHDPDSKTEYANVNVTL-NGGD--GHFALTTRDNSIYL  402

Query  742   --TQKPLDRETRDIYRLTIIAEYNKGSVLGTGIYQVNVIVDDENDNKPLFERESYEGKIT  799
                  PLDRE    Y L+++A  +KG+        + + + D NDN P FE++ Y   + 
Sbjct  403   VIVHLPLDREIVSNYTLSVVAT-DKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVM  461

Query  800   ENSKSGTEVDLNYPIHVSDSDVGHNGQFTVTIF---GNGSEYFRLDRNLGKIQFTGANTP  856
             E +  GT V     +   D D G N   T ++       +++F++D   G I      + 
Sbjct  462   EVADPGTSV---LQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLIT---TRSH  515

Query  857   LDRETTSVYNLRLVATDEG--GLTSEAKLTIQVEDENDNSPLFVQ-FYLY----------  903
             +D ET  V  L +VA D G   L+S A + + + D NDN P+F Q FY            
Sbjct  516   IDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGR  575

Query  904   ---------PDKGIEVLQYDSTGSRVGH---FEEASNSTPGLFVLTQNFLR---------  942
                      PD G+  +   + G    H   FE  S S         +F R         
Sbjct  576   CILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVL  635

Query  943   -------------------------IRKPKEKISPLVSLPEDIAVGSS--VIKAIAEDKD  975
                                      +  P+E    L   P+  +  SS  ++  +A D D
Sbjct  636   ATDRGGLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPD  695

Query  976   DGENSVIKYEMVSETYIPNELSSAPFHIIQYFMVQPTTGEVVIAR----ALPAESEFRLN  1031
              G    + Y +V+     NE           F +  +TGE+ + R    ++  +    LN
Sbjct  696   YGNFGQVSYRIVAG----NEAG--------IFRIDRSTGEIFVVRPDMLSVRTQPMHMLN  743

Query  1032  ISATDKGGFKDHLS--VRITVRDVNDHPPVFKKSWYNFDAEEASYTRNTLGRIEATDADF  1089
             ISATD G  + +    V +++ D    PP+F+K+ YN+  +E       +G + A   D 
Sbjct  744   ISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDV  803

Query  1090  GSNANITYSI-KNNSTVPFSISPTTGALRVDGLLDRETQDKYSFVVVAK--DNPKSGKSL  1146
                + + YSI   +    FSI   +G +R+   LD E + +    + A   + P  G   
Sbjct  804   AHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVYGH--  861

Query  1147  SSSVNVEVNVLDINDNPPVFYGYDDLIPNPEANNFSNHNYQQKIPVYYATAAENSPMGTP  1206
              + VN+EV   D+NDN P F          EA+            +   +  E++ +G P
Sbjct  862   -TQVNIEVE--DVNDNAPEF----------EAS------------MVRISVPESAELGAP  896

Query  1207  ITRVFANDSDFTGNGNGLILFDIPYRKSRQNLFAIDSKEGIVTTIGKLDYESEKSHNITI  1266
             +    A+D D     +G + + +  ++S + LFAID++ G +     LDYES + H + +
Sbjct  897   LYAAHAHDKD--SGSSGQVTYSL-VKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIV  953

Query  1267  LASDLGSPSLSSTAILIVNIIDVPEDIKSIERPVFAHRYYEVEVEENVPVPLRVLTLNVT  1326
              A+D G PSLS+   ++V++ DV ++      PVF    Y V V E+  +  +++ +N +
Sbjct  954   TATDGGVPSLSTNLTILVDVQDVNDN-----PPVFEKDEYSVNVSESRSINAQIIQVNAS  1008

Query  1327  EPYRSHKLR--YSIV---------AENSSDVKRTFRIDPRNGSLYIIESPDREQKALYEL  1375
             +    +  R  Y IV         + +SSDV + F I P +G +Y+    DRE +  Y+L
Sbjct  1009  DLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQL  1068

Query  1376  IIRLDQYKVGRDMTVMIYPVTNERLGNLGLNEVKVIVRVTDVNDNAPKFTVTGRPMIAAI  1435
              +           T    P  + +         +VIVRV D NDN PKF  +       I
Sbjct  1069  TVL---------ATDNGTPAAHAK--------TRVIVRVLDANDNDPKFQKSKYEF--RI  1109

Query  1436  PTTANYGYNVIRLQATDPDLGLNGEVRYQILSRADEASRRFAIDPVTGQVRGISTFTKEA  1495
                   G  V  + A+D DLG N  +RY +L      +  F + PVTG++       +E 
Sbjct  1110  EENLRRGSVVGVVTASDLDLGENAAIRYSLLP----INSSFQVHPVTGEISTREPLDREL  1165

Query  1496  GKVFGFDVKATDR  1508
              +++   V+A D+
Sbjct  1166  RELYDLVVEARDQ  1178


 Score = 157 bits (396),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 280/1155 (24%), Positives = 471/1155 (41%), Gaps = 237/1155 (21%)

Query  116   TSSLSVTVYVEDINDHAPVFEGAPYHIDVDELTPVGLTVFRGIRAADHDKPNTPNSDVQY  175
             ++++ V + V DIND+ P+FE  PY   V  L   G T+ + ++A D D     N+++ Y
Sbjct  1985  SATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLK-VQALDADL--GANAEIVY  2041

Query  176   AIVAGNE--RGKFALESSHQAFLILRKSLDYDSGDRDFLLTITASDRGTPPKSTNATVRI  233
             ++ A N     KF +  S  A L   +SL  +SG +   L + A D+G PP+S+   + +
Sbjct  2042  SLNAENSAVSAKFRINPSTGA-LSASQSLASESG-KLLHLEVVARDKGNPPQSSLGLIEL  2099

Query  234   KVNDNDDLPP--KFTKGVYRTKIKEFYPITGARIHQRLKFNPSIHAFDQDLAIDSPIRYD  291
              + +     P  +F    YR  +KE  P +G R+ Q       + A   D      +++ 
Sbjct  2100  LIGEAPQGTPVLRFQNETYRVMLKENSP-SGTRLLQ-------VVALRSD-GRRQKVQFS  2150

Query  292   IIAGNERHLFSLDHVNGSLFLEREIDLD--------------------------------  319
               AGNE  + SLD ++G + + +   LD                                
Sbjct  2151  FGAGNEDGILSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDP  2210

Query  320   -----AERSLPGNTFVLQ----------IQASQMDNPLKTGVARVEVEIMDLNDNLPEFE  364
                  ++R+L  ++F L           + A   D P     A + +E+ D NDN P+F 
Sbjct  2211  NNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFS  2270

Query  365   VDFYNISIVENLPNGFSVLQIIATDQDQGDNAEFSYQLEDKS--GAFTLDSRTGWLTVRD  422
                +  ++ E    G  V Q+ A D D G NA   Y + D +   AF ++     + VR 
Sbjct  2271  QKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGI-VRT  2329

Query  423   QTVLDREKRSTISMRVYAK-EKVPSVVTSQLGASSVNIEVTLLDANDNNPTFIPNNLYEF  481
               VLDRE R    +++ A  E VP +        +  I V ++D NDN PTF PNNL   
Sbjct  2330  NIVLDREIRDIYKLKIIATDEGVPQMT------GTATIRVQIVDVNDNQPTFPPNNL--V  2381

Query  482   IITTKAKKGDLVGQLHAIDPD--------LGRNGFVTYSIQKAPNSSIPFEVDTKSGQIM  533
              ++   + G ++  + A D D        LG    V        N SI F +D  SG+++
Sbjct  2382  TVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIE-----NMSI-FALDRYSGKLV  2435

Query  534   VTQD---DLQASEHLLFVEASDQPVNPSEKRSALAVVTVDIRDQNENREPDFIGAPYEFW  590
             + +    +LQ  E+ L V ASD          A  V+TV + D+N+N        P  ++
Sbjct  2436  LKRRLDYELQ-QEYELDVIASDA------AHEARTVLTVRVNDENDNAPVFLAQQPPAYF  2488

Query  591   --------VGGNVDIGTSVGQIRITEFNNMGT---ILYDLLHSYHEGVPFAVEEKSGTIT  639
                     +  ++ +   +  +  T+ ++ G    ++Y ++    EG  F+V   +G ++
Sbjct  2489  AILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIY-IIEPAQEG--FSVHPSNGVVS  2545

Query  640   VVDDLNKFNRENYDFEAFVNNEGDLSLVTNVTIHVVDPKDEKTILMKT-----GTTPIEF  694
             V       +R     +  V++ GD   V  +      P  + + L++      G+   +F
Sbjct  2546  V-----NMSR----LQPAVSSSGDY-FVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQF  2595

Query  695   -------HVKENEP-NILIGKLGFKTNGTNNLKFTIANQKDVTDHISITSDGTLYTQKPL  746
                     + E  P   ++ +LG +     +L     N++       +     +   KPL
Sbjct  2596  LQNQYRAQISEAAPLGSVVLQLG-QDALDQSLAIIAGNEESA---FELLQSKAIVLVKPL  2651

Query  747   DRETRDIYRLTIIAEYNKG-----SVLGTGIYQVNVIVDDENDNKPLFERES-YEGKITE  800
             DRE  D+Y+L ++  +  G     S+  +    V + + D NDN P+F+R + YE +I+E
Sbjct  2652  DRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISE  2711

Query  801   NSKSGTEVDLNYPIHV-----SDSDVGHNGQFTVTIF-GNGSEYFRLDRNLGKIQFTGAN  854
              +       L Y I       +D +   N +    I  GN    F +D   G + F   N
Sbjct  2712  LAP------LRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTG-VLFV--N  2762

Query  855   TPLDRETTS-VYNLRLVATD---EGGLTSEAKLTIQVEDENDNSPLFVQFYLYPDKGIEV  910
               LD ++ +  Y L + A D   +  L S     +++ DENDN P F            +
Sbjct  2763  NRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKF-----------PL  2811

Query  911   LQYDSTGSRVGHFEEASNSTPGLFVLTQNFLRIRKPKEKISPLVSLPEDIAVGSSVIKAI  970
              +Y        HF                                L E+  VGSSV +A 
Sbjct  2812  TEY-------VHF--------------------------------LAENEPVGSSVFRAH  2832

Query  971   AEDKDDGENSVIKYEMVSETYIPNELSSAPFHIIQYFMVQPTTGEVVIARALPAESEFR-  1029
             A D D G    + Y +      P++ SS      + F V   +G V  A     E   R 
Sbjct  2833  ASDLDKGPFGQLNYSIGPA---PSDESS-----WKMFRVDSESGLVTSAFVFDYEQRQRY  2884

Query  1030  -LNISATDKGGFKDHLSVRITVRDVNDHPPVFKKSWYNF--DAEEASYTRNTLGRIEATD  1086
              + + A+D GG K  ++VR+ +   ++  P F +  Y F   A  A      +G++ ATD
Sbjct  2885  DMELLASDMGGKKASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATD  2944

Query  1087  ADFGSNANITYSIKNNSTVPFSISPTTGA------LRVDGLLDRET-QDKYSFVVVAKDN  1139
             +D G +  + Y +    +  F ++ ++GA      L++DG  D     D     +V   +
Sbjct  2945  SDSGPDGRVVYQLSAPHS-HFKVNRSSGAVLIKRKLKLDGDGDGNLYMDGRDISLVISAS  3003

Query  1140  PKSGKSLSSSVNVEV  1154
                  SLSS   VE+
Sbjct  3004  SGRHNSLSSMAVVEI  3018


 Score = 155 bits (393),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 225/834 (27%), Positives = 351/834 (42%), Gaps = 180/834 (22%)

Query  738   GTLYTQKPLDRETRDIYRLTIIAEYNKGSVLGTGIYQVNVIVDDENDNKPLFERESYEGK  797
             G + T+  LDRETR  Y L  I       + G  I +V V V DENDN P F + S   +
Sbjct  77    GEIRTKVKLDRETRASYSLVAIP------LSGRNI-RVLVTVKDENDNAPTFPQTSMHIE  129

Query  798   ITENSKSGTEVDLNYPIHVSDSDV-GHNGQFTVTIFGNGSEYFRLDRNLGK-------IQ  849
               EN+    +  L   +   D D+  +N Q    + GN ++ FRL  +  +       +Q
Sbjct  130   FPENTPREVKRTL---LPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQ  186

Query  850   FTGANTPLDRETTSVYNLRLVATDEGG--LTSEAKLTIQVEDENDNSPLFVQ---FYLYP  904
              +G    LDRETT  Y+L + A D G   L     + I ++D NDN P+F Q   F   P
Sbjct  187   ISGF---LDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVP  243

Query  905   DKGIEVLQYDSTGSRVGHFEEASNSTPGLFVLTQNFLRIRKPKEKISPLVSLPEDIAVGS  964
             +                      N+T G  VL                            
Sbjct  244   E----------------------NATVGTSVL----------------------------  253

Query  965   SVIKAIAEDKDDGENSVIKYEMVSETYIPNELSSAPFHIIQYFMVQPTTGEVVIARALPA  1024
                +  A D D  EN +++Y +       N   S      Q F + P TG + I +AL  
Sbjct  254   ---QVYASDTDADENGLVEYAI-------NRRQSDKE---QMFRIDPRTGAIYINKALDF  300

Query  1025  ESE--FRLNISATDKG--GFKDHLSVRITVRDVNDHPPVFKKSWYNFDA----EEASYTR  1076
             E++    L + A D G    +    V I V DVND+ P     + + DA     E++   
Sbjct  301   ETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPG  360

Query  1077  NTLGRIEATDADFG---SNANITYSIKNNSTVPFSISPTTGALR---VDGLLDRETQDKY  1130
               + RI   D D     +N N+T    N     F+++    ++    V   LDRE    Y
Sbjct  361   EFVARISVHDPDSKTEYANVNVTL---NGGDGHFALTTRDNSIYLVIVHLPLDREIVSNY  417

Query  1131  SFVVVAKDNPKSGKSLSSSVNVEVNVLDINDNPPVFYGYDDLIPNPEANNFSNHNYQQKI  1190
             +  VVA D  K    L +S ++ + + D+NDNPP F                    +Q +
Sbjct  418   TLSVVATD--KGTPPLHASKSIFLRITDVNDNPPEF--------------------EQDL  455

Query  1191  PVYYATAAENSPMGTPITRVFANDSDFTGNGNGLILFDIPYRKSRQNLFAIDSKEGIVTT  1250
               Y+A   E +  GT + +V A+D D  G  + L        ++    F ID + G++TT
Sbjct  456   --YHANVMEVADPGTSVLQVLAHDRD-EGLNSALTYSLAETPETHAQWFQIDPQTGLITT  512

Query  1251  IGKLDYESEKSHNITILASDLGSPSLSSTAILIVNIIDVPEDIKSIERPVFAHRYYEVEV  1310
                +D E+E    +T++A D G P LSSTA ++V I DV ++      P+F   +Y V V
Sbjct  513   RSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDN-----EPIFDQSFYNVSV  567

Query  1311  EENVPVPLRVLTLNVTEP--YRSHKLRYSIVAENSSDVKRTFRIDPRNGSLYIIESPDRE  1368
              EN PV   +L ++ ++P    +  + Y+I  E    +   F +   +G + I    D E
Sbjct  568   AENEPVGRCILKVSASDPDCGVNAMVNYTI-GEGFKHLTE-FEVRSASGEICIAGELDFE  625

Query  1369  QKALYELIIRLDQYKVGRDMTVMIYPVTNERLGNLGLNEVKVIVRVTDVNDNAPKF----  1424
             +++ YE                  +PV     G L    + + +++TDVNDN P F    
Sbjct  626   RRSSYE------------------FPVLATDRGGLSTTAM-IKMQLTDVNDNRPVFYPRE  666

Query  1425  -TVTGRPMIAAIPTTANYGYNVIRLQATDPDLGLNGEVRYQILSRADEASRRFAIDPVTG  1483
               V+ R    A  ++      ++ + ATDPD G  G+V Y+I++  +EA   F ID  TG
Sbjct  667   YKVSLRESPKA--SSQASSTPIVAVVATDPDYGNFGQVSYRIVA-GNEAG-IFRIDRSTG  722

Query  1484  QVRGI--STFTKEAGKVFGFDVKATD----RSGADDGKSSIANVFVYVLDEQKQ  1531
             ++  +     +     +   ++ ATD    RS AD      A VF+ ++D  ++
Sbjct  723   EIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNAD------AVVFLSIIDAMQR  770


 Score = 115 bits (288),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 272/1249 (22%), Positives = 470/1249 (38%), Gaps = 235/1249 (19%)

Query  121   VTVYVEDINDHAPVFEGAPYHIDVDELTPVGLTVFRGIRAADHDKPNTPNSDVQYAIVAG  180
             +T++VED ND+AP F+ + Y   V E  P+G +V + I A D D     N+ + Y++ A 
Sbjct  1885  ITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQ-ISAVDADL--GVNARLVYSL-AN  1940

Query  181   NERGKFALESSHQAFLILRKSLDYD-SGDRDFLLTITASDRGTPPKSTNATVRIKVNDND  239
               + +FA++        + K LD +     +F++  T   R    +S    V+I V D +
Sbjct  1941  ETQWQFAIDGQSGLITTVGK-LDRELQASYNFMVLATDGGR-YEVRSATVPVQINVLDIN  1998

Query  240   DLPPKFTKGVYRTKIKEFYPITGA--RIHQRLKFNPSIHAFDQDLAIDSPIRYDIIAGNE  297
             D  P F          E YP  G    + Q  +    + A D DL  ++ I Y + A N 
Sbjct  1999  DNRPIF----------ERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENS  2048

Query  298   --RHLFSLDHVNGSLFLEREIDLDAERSLPGNTFVLQIQASQMDNPLKTGVARVEVEIMD  355
                  F ++   G+L   + +      S  G    L++ A    NP ++ +  +E+ I +
Sbjct  2049  AVSAKFRINPSTGALSASQSL-----ASESGKLLHLEVVARDKGNPPQSSLGLIELLIGE  2103

Query  356   LNDNLP--EFEVDFYNISIVENLPNGFSVLQIIATDQD-QGDNAEFSYQLEDKSGAFTLD  412
                  P   F+ + Y + + EN P+G  +LQ++A   D +    +FS+   ++ G  +LD
Sbjct  2104  APQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSDGRRQKVQFSFGAGNEDGILSLD  2163

Query  413   SRTGWLTVRDQTVLDREKRSTISMRVYAKEK-----------------------------  443
             S +G + V    +LD ++ ST SM   ++ +                             
Sbjct  2164  SLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSS  2223

Query  444   ----------------VPSVVTSQLGASSVNIEVTLLDANDNNPTFIPNNLYEFIITTKA  487
                             V     +   AS   + + L D NDN+P F   +  +F+ T   
Sbjct  2224  SFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKF---SQKQFVATVSE  2280

Query  488   --KKGDLVGQLHAIDPDLGRNGFVTYSIQKAPNSSIPFEVDTKSGQIMVTQ---DDLQAS  542
                KG  V Q+HA D D G N  + Y I    N    F ++     I+ T    D     
Sbjct  2281  GNNKGTFVAQVHAFDSDAGSNARLRYHIVDG-NHDNAFVIEPAFSGIVRTNIVLDREIRD  2339

Query  543   EHLLFVEASDQPVNPSEKRSALAVVTVDIRDQNENREPDFIGAPYEF-WVGGNVDIGTSV  601
              + L + A+D+ V    + +  A + V I D N+N +P F   P     V    ++G  +
Sbjct  2340  IYKLKIIATDEGV---PQMTGTATIRVQIVDVNDN-QPTF--PPNNLVTVSEATELGAVI  2393

Query  602   GQIRITEFNNMGTILYDLLHSYHEGVP----FAVEEKSGTITVVDDLNKFNRENYDFEAF  657
               I   + +    + Y L       +     FA++  SG + +   L+   ++ Y+ +  
Sbjct  2394  TSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVI  2453

Query  658   VNNEGDLSLVTNVTIHVVDPKDEKTILMKTGTTPIEFHV----KENEPNILIGKLGFKTN  713
              ++    +  T +T+ V D  D   + +     P  F +     E   ++ +       N
Sbjct  2454  ASDAAHEAR-TVLTVRVNDENDNAPVFLAQ-QPPAYFAILPAISEISESLSVDFDLLTVN  2511

Query  714   GT------NNLKFTIANQKDVTDHISITSDGTLYTQ----KPLDRETRDIYRLTIIAEYN  763
              T      NN K     +          S+G +       +P    + D +   I  +  
Sbjct  2512  ATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAG  2571

Query  764   KGSVLGTGIYQVNVIVDDENDNKPLFERESYEGKITENSKSGTEVDLNYPIHVSDSDVGH  823
             K ++  + + +V    +D    +  F +  Y  +I+E +  G+ V            +G 
Sbjct  2572  KPALKSSTLLRVQA--NDNGSGRSQFLQNQYRAQISEAAPLGSVV----------LQLGQ  2619

Query  824   NG--QFTVTIFGNGSEYFRLDRNLGKIQFTGANTPLDRETTSVYNLRLVATDEGG-----  876
             +   Q    I GN    F L ++   +       PLDRE   +Y LRLV +   G     
Sbjct  2620  DALDQSLAIIAGNEESAFELLQSKAIVLVK----PLDRERNDLYKLRLVLSHPHGPPLIS  2675

Query  877   ---LTSEAKLTIQVEDENDNSPLFVQFYLYPDKGIEVLQYDSTGSRVGHFEEASNSTPGL  933
                 +S   + I + D NDN P+F                                    
Sbjct  2676  SLNSSSGISVIITILDANDNFPIFD-----------------------------------  2700

Query  934   FVLTQNFLRIRKPKEKISPLVSLPEDIAVGSSVIKAIAEDKDDGENSVIKYEMVSETYIP  993
                     R  K + +IS L  L   IA     ++AI  D+++  NS + Y++ S     
Sbjct  2701  --------RSAKYEAEISELAPLRYSIAQ----LQAIDADQENTPNSEVVYDITSGN---  2745

Query  994   NELSSAPFHIIQYFMVQPTTGEVVIARALPAES---EFRLNISATDKGGFKDHLSV---R  1047
             +E           F +   TG + +   L  +S    + L I A D    +   S+   R
Sbjct  2746  DE---------HMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFR  2796

Query  1048  ITVRDVNDHPPVFKKSWYNFDAEEASYTRNTLGRIEATDADFGSNANITYSI-----KNN  1102
             + + D ND+ P F  + Y     E     +++ R  A+D D G    + YSI       +
Sbjct  2797  LELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDES  2856

Query  1103  STVPFSISPTTGALRVDGLLDRETQDKYSFVVVAKDNPKSGKSLSSSVNVEVNVLDINDN  1162
             S   F +   +G +    + D E + +Y   ++A D    GK  S +V VE+        
Sbjct  2857  SWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASD--MGGKKASVAVRVEIE-------  2907

Query  1163  PPVFYGYDDLIPNPEANNFSNHNYQQKIPVYYATAAENSPMGTPITRVFANDSDFTGNGN  1222
                    D+  P      F+   Y+  +P     AA   P G  + +V A DSD   +G 
Sbjct  2908  -----SRDEFTPQ-----FTERTYRFVLP-----AAVALPQGYVVGQVTATDSDSGPDGR  2952

Query  1223  GLILFDIPYRKSRQNLFAIDSKEGIVTTIGKLDYESEKSHNITILASDL  1271
              +     P+       F ++   G V    KL  + +   N+ +   D+
Sbjct  2953  VVYQLSAPHSH-----FKVNRSSGAVLIKRKLKLDGDGDGNLYMDGRDI  2996


 Score = 115 bits (288),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 126/447 (28%), Positives = 198/447 (44%), Gaps = 57/447 (13%)

Query  109   DDGEDTITSSLSVTVYVEDINDHAPVFEGAPYHIDVDELTPVGLTVFR-GIRAADHDKPN  167
             D G+  + SS  + V   D       F    Y   + E  P+G  V + G  A D     
Sbjct  2569  DAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQ----  2624

Query  168   TPNSDVQYAIVAGNERGKFALESSHQAFLILRKSLDYDSGDRDFLLTITASDRGTPPKST  227
                     AI+AGNE   F L  S    ++L K LD +  D   L  + +   G P  S+
Sbjct  2625  ------SLAIIAGNEESAFELLQSKA--IVLVKPLDRERNDLYKLRLVLSHPHGPPLISS  2676

Query  228   NAT-----VRIKVNDNDDLPPKFTKGV-YRTKIKEFYPITGARIHQRLKFNPSIHAFDQD  281
               +     V I + D +D  P F +   Y  +I E  P+  + I Q    +      DQ+
Sbjct  2677  LNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYS-IAQLQAIDA-----DQE  2730

Query  282   LAIDSPIRYDIIAGNERHLFSLDHVNGSLFLEREIDLDAERSLPGNTFVLQIQA--SQMD  339
                +S + YDI +GN+ H+F++D V G LF+   +D D+       ++ L I+A  S   
Sbjct  2731  NTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSG----AKSYELIIRACDSHHQ  2786

Query  340   NPLKTGVARVEVEIMDLNDNLPEFEVDFYNISIVENLPNGFSVLQIIATDQDQGDNAEFS  399
              PL   +    +E+ D NDN P+F +  Y   + EN P G SV +  A+D D+G   + +
Sbjct  2787  RPL-CSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLN  2845

Query  400   YQL------EDKSGAFTLDSRTGWLTVRDQTVLDREKRSTISMRVYAKEKVPSVVTSQLG  453
             Y +      E     F +DS +G +T     V D E+R    M + A         S +G
Sbjct  2846  YSIGPAPSDESSWKMFRVDSESGLVT--SAFVFDYEQRQRYDMELLA---------SDMG  2894

Query  454   A--SSVNIEVTLLDANDNNPTFIPNNLYEFIITTKAK--KGDLVGQLHAIDPDLGRNGFV  509
                +SV + V +   ++  P F     Y F++       +G +VGQ+ A D D G +G V
Sbjct  2895  GKKASVAVRVEIESRDEFTPQFT-ERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRV  2953

Query  510   TYSIQKAPNSSIPFEVDTKSGQIMVTQ  536
              Y +  AP+S   F+V+  SG +++ +
Sbjct  2954  VYQL-SAPHSH--FKVNRSSGAVLIKR  2977


 Score = 88.6 bits (218),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 187/759 (25%), Positives = 294/759 (39%), Gaps = 157/759 (21%)

Query  738   GTLYTQKPLDRETRDIYRLTIIAEYNKGSVLGTGIYQVNVIVDDENDNKPLFE-------  790
             G + T   LDRE RDIY+L IIA  ++G    TG   + V + D NDN+P F        
Sbjct  2325  GIVRTNIVLDREIRDIYKLKIIAT-DEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLVTV  2383

Query  791   RESYEGKITENSKSGTEVDLNYPIHVSDSDVGHNGQFTVTIFGNGSEYFRLDRNLGKIQF  850
              E+ E      S S  +VD  YP            + TV I       F LDR  GK+  
Sbjct  2384  SEATELGAVITSISANDVD-TYPALT----YRLGAESTVDI--ENMSIFALDRYSGKLVL  2436

Query  851   TGANTPLDRETTSVYNLRLVATDEGGLTSEAK--LTIQVEDENDNSPLFVQFYLYPDKGI  908
                   LD E    Y L ++A+D      EA+  LT++V DENDN+P+F+          
Sbjct  2437  ---KRRLDYELQQEYELDVIASDAA---HEARTVLTVRVNDENDNAPVFL----------  2480

Query  909   EVLQYDSTGSRVGHFEEASNSTPGLFVLTQNFLRIRKPKEKISPLVS-LPEDIAVGSSVI  967
                               +   P  F               I P +S + E ++V   ++
Sbjct  2481  ------------------AQQPPAYFA--------------ILPAISEISESLSVDFDLL  2508

Query  968   KAIAEDKD-DGENSVIKYEMVSETYIPNELSSAPFHIIQYFMVQPTTGEVVI--ARALPA  1024
                A D D +G NS + Y +                  + F V P+ G V +  +R  PA
Sbjct  2509  TVNATDADSEGNNSKVIYIIEPAQ--------------EGFSVHPSNGVVSVNMSRLQPA  2554

Query  1025  ES---EFRLNISATDKG--GFKDHLSVRITVRDVNDHPPVFKKSWYNFDAEEASYTRNTL  1079
              S   ++ + I A D G    K    +R+   D       F ++ Y     EA+     L
Sbjct  2555  VSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAA----PL  2610

Query  1080  GRIEATDADFGSNANITYSIKNNSTVPFSISPTTGALRVDGLLDRETQDKYSFVVVAKDN  1139
             G +         + ++   I  N    F +  +   + V  L DRE  D Y   +V   +
Sbjct  2611  GSVVLQLGQDALDQSLAI-IAGNEESAFELLQSKAIVLVKPL-DRERNDLYKLRLVLS-H  2667

Query  1140  PKS-----GKSLSSSVNVEVNVLDINDNPPVFYGYDDLIPNPEANNFSNHNYQQKIPVYY  1194
             P         + SS ++V + +LD NDN P+F                      +   Y 
Sbjct  2668  PHGPPLISSLNSSSGISVIITILDANDNFPIF---------------------DRSAKYE  2706

Query  1195  ATAAENSPMGTPITRVFANDSDFTGNGNGLILFDIPYRKSRQNLFAIDSKEGIVTTIGKL  1254
             A  +E +P+   I ++ A D+D     N  +++DI    + +++F ID   G++    +L
Sbjct  2707  AEISELAPLRYSIAQLQAIDADQENTPNSEVVYDI-TSGNDEHMFTIDLVTGVLFVNNRL  2765

Query  1255  DYES-EKSHNITILASDLGSPSLSSTAILIVNIIDVPEDIKSIERPVFAHRYYEVEVEEN  1313
             DY+S  KS+ + I A D    S     +  +    +    ++   P F    Y   + EN
Sbjct  2766  DYDSGAKSYELIIRACD----SHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAEN  2821

Query  1314  VPVPLRVLTLNVTE----PYRSHKLRYSI-VAENSSDVKRTFRIDPRNGSLYIIESPDRE  1368
              PV   V   + ++    P+   +L YSI  A +     + FR+D  +G +      D E
Sbjct  2822  EPVGSSVFRAHASDLDKGPF--GQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYE  2879

Query  1369  QKALYELIIRLDQYKVGRDMTVMIYPVTNERLGNLGLNEVKVIVRVT--DVNDNAPKFTV  1426
             Q+  Y             DM ++          ++G  +  V VRV     ++  P+FT 
Sbjct  2880  QRQRY-------------DMELLA--------SDMGGKKASVAVRVEIESRDEFTPQFTE  2918

Query  1427  TGRPMIAAIPTTANYGYNVIRLQATDPDLGLNGEVRYQI  1465
                  +         GY V ++ ATD D G +G V YQ+
Sbjct  2919  RTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQL  2957


 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 155/607 (26%), Positives = 262/607 (43%), Gaps = 52/607 (9%)

Query  97    RNVLKFKVTCDYDDGEDTITSSLSVTVYVEDINDHAPVFEGAPYH-IDVDELTPVGLTVF  155
             R++ K K+    D+G   +T + ++ V + D+ND+ P F   P + + V E T +G  V 
Sbjct  2338  RDIYKLKIIAT-DEGVPQMTGTATIRVQIVDVNDNQPTF--PPNNLVTVSEATELG-AVI  2393

Query  156   RGIRAADHDK-PNTPNSDVQYAIVAGNERGKFALESSHQAFLILRKSLDYDSGDRDFLLT  214
               I A D D  P         + V       FAL+  +   L+L++ LDY+   +++ L 
Sbjct  2394  TSISANDVDTYPALTYRLGAESTVDIENMSIFALD-RYSGKLVLKRRLDYEL-QQEYELD  2451

Query  215   ITASDRGTPPKSTNATVRIKVNDNDDLPPKFTKGVYRTKIKEFYPITGA--RIHQRLKFN  272
             + ASD     ++    + ++VND +D  P F       +   ++ I  A   I + L  +
Sbjct  2452  VIASDAAHEART---VLTVRVNDENDNAPVFLA----QQPPAYFAILPAISEISESLSVD  2504

Query  273   ---PSIHAFDQDL-AIDSPIRYDIIAGNERHLFSLDHVNG--SLFLEREIDLDAERSLPG  326
                 +++A D D    +S + Y I    E   FS+   NG  S+ + R   L    S  G
Sbjct  2505  FDLLTVNATDADSEGNNSKVIYIIEPAQEG--FSVHPSNGVVSVNMSR---LQPAVSSSG  2559

Query  327   NTFVLQIQASQMDNPLKTGVARVEVEIMDLNDNLPEFEVDFYNISIVENLPNGFSVLQII  386
             + FV +I A     P       + V+  D      +F  + Y   I E  P G  VLQ+ 
Sbjct  2560  DYFV-RIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQL-  2617

Query  387   ATDQDQGDNAEFSYQLEDKSGAFTLDSRTGWLTVRDQTVLDREKRSTISMR-VYAKEKVP  445
                QD  D +  +    ++  AF L      + V+    LDRE+     +R V +    P
Sbjct  2618  --GQDALDQS-LAIIAGNEESAFELLQSKAIVLVKP---LDRERNDLYKLRLVLSHPHGP  2671

Query  446   SVVTSQLGASSVNIEVTLLDANDNNPTFIPNNLYEFIITTKAKKGDLVGQLHAIDPDLGR  505
              +++S   +S +++ +T+LDANDN P F  +  YE  I+  A     + QL AID D   
Sbjct  2672  PLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQEN  2731

Query  506   --NGFVTYSIQKAPNSSIPFEVDTKSGQIMVTQD---DLQASEHLLFVEASDQPVNPSEK  560
               N  V Y I    N    F +D  +G + V      D  A  + L + A D   +    
Sbjct  2732  TPNSEVVYDITSG-NDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDS--HHQRP  2788

Query  561   RSALAVVTVDIRDQNENREPDFIGAPYEFWVGGNVDIGTSVGQIRITEFNN--MGTILYD  618
               +L    +++ D+N+N EP F    Y  ++  N  +G+SV +   ++ +    G + Y 
Sbjct  2789  LCSLQPFRLELHDENDN-EPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYS  2847

Query  619   LLHSYHEGVP---FAVEEKSGTITVVDDLNKFNRENYDFEAFVNNEGDLSLVTNVTIHVV  675
             +  +  +      F V+ +SG +T     +   R+ YD E   ++ G       V +  +
Sbjct  2848  IGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGGKKASVAVRVE-I  2906

Query  676   DPKDEKT  682
             + +DE T
Sbjct  2907  ESRDEFT  2913


 Score = 71.6 bits (174),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 134/569 (24%), Positives = 239/569 (42%), Gaps = 73/569 (13%)

Query  115   ITSSLSVTVYVEDINDHAPVFEGAPYHIDVDELTPVGLTVFRGIRAADHDKPNTPNSDVQ  174
             + S   + + +ED ND++P F    +   V E    G T    + A D D  +  N+ ++
Sbjct  2249  LASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKG-TFVAQVHAFDSDAGS--NARLR  2305

Query  175   YAIVAGNERGKFALESSHQAFLILRKSLDYDSGDRD-FLLTITASDRGTPPKSTNATVRI  233
             Y IV GN    F +E +     I+R ++  D   RD + L I A+D G P  +  AT+R+
Sbjct  2306  YHIVDGNHDNAFVIEPAFSG--IVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRV  2363

Query  234   KVNDNDDLPPKFTKG--VYRTKIKEFYPITGARIHQRLKFNPSIHAFDQDLAIDSPIRYD  291
             ++ D +D  P F     V  ++  E   +  +     +   P   A    L  +S +  +
Sbjct  2364  QIVDVNDNQPTFPPNNLVTVSEATELGAVITSISANDVDTYP---ALTYRLGAESTVDIE  2420

Query  292   IIAGNERHLFSLDHVNGSLFLEREIDLDAERSLPGNTFVLQIQASQMDNPLKTGVARVEV  351
              ++     +F+LD  +G L L+R +D + ++      + L + AS   +  +T +    V
Sbjct  2421  NMS-----IFALDRYSGKLVLKRRLDYELQQE-----YELDVIASDAAHEARTVLT---V  2467

Query  352   EIMDLNDNLPEFEVD----FYNI-----SIVENLPNGFSVLQIIATDQD-QGDNAEFSYQ  401
              + D NDN P F       ++ I      I E+L   F +L + ATD D +G+N++  Y 
Sbjct  2468  RVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYI  2527

Query  402   LEDKSGAFTLDSRTGWLTVRDQTVLDREKRSTIS-----MRVYAKEK-VPSVVTSQLGAS  455
             +E     F++    G ++V     + R + +  S     +R+ AK+   P++ +S L   
Sbjct  2528  IEPAQEGFSVHPSNGVVSVN----MSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTL---  2580

Query  456   SVNIEVTLLDANDNNPTFIPNNLYEFIITTKAKKGDLVGQLHAIDPDLGRNGFVTYSIQK  515
                + V   D       F+ N  Y   I+  A  G +V Q       LG++         
Sbjct  2581  ---LRVQANDNGSGRSQFLQNQ-YRAQISEAAPLGSVVLQ-------LGQDALDQSLAII  2629

Query  516   APNSSIPFEVDTKSGQIMVTQDDLQASE----HLLFVEASDQPVNPSEKRSALAVVTVDI  571
             A N    FE+      ++V   D + ++     L+       P+  S   S+   V + I
Sbjct  2630  AGNEESAFELLQSKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITI  2689

Query  572   RDQNENREPDFIGAPYEFWVGGNVDIGTSVGQIRITEFNNMGT----ILYDLLHSYHEGV  627
              D N+N       A YE  +     +  S+ Q++  + +   T    ++YD+     E +
Sbjct  2690  LDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHM  2749

Query  628   PFAVEEKSGTITVVDDLNKFNRENYDFEA  656
              F ++  +G + V       NR +YD  A
Sbjct  2750  -FTIDLVTGVLFV------NNRLDYDSGA  2771


>X2J8E9_DROME unnamed protein product
Length=3556

 Score = 330 bits (845),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 381/1461 (26%), Positives = 637/1461 (44%), Gaps = 205/1461 (14%)

Query  109   DDGEDTITSSLSVTVYVEDINDHAPVFEGAPYHIDVDELTPVGLTVFRGIRAADHDKPNT  168
             D G   +   ++V + ++D+ND+ P+F  + Y   V E   VG +V + + A+D D    
Sbjct  260   DGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQ-VYASDTDADE-  317

Query  169   PNSDVQYAI--VAGNERGKFALESSHQAFLILRKSLDYDSGDRDFLLTITASDRGTPPKS  226
              N  V+YAI     ++   F ++    A  I  K+LD+++ +   L+ + A D G  P  
Sbjct  318   -NGLVEYAINRRQSDKEQMFRIDPRTGAIYI-NKALDFETKELHELVVV-AKDHGEQPLE  374

Query  227   TNATVRIKVNDNDDLPPK----FTKGVYRTKIKEFYPITGARIHQRLKFNPSIHAFDQDL  282
             T A V I+V D +D  P     F       KI E          Q  +F   I   D D 
Sbjct  375   TTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESA--------QPGEFVARISVHDPDS  426

Query  283   AIDSPIRYDIIAGNERHLFSLDHVNGSLFLEREIDLDAERSLPGNTFVLQIQASQMDNPL  342
               +       + G + H F+L   + S++L   + L  +R +  N + L + A+    P 
Sbjct  427   KTEYANVNVTLNGGDGH-FALTTRDNSIYLVI-VHLPLDREIVSN-YTLSVVATDKGTPP  483

Query  343   KTGVARVEVEIMDLNDNLPEFEVDFYNISIVENLPNGFSVLQIIATDQDQGDNAEFSYQL  402
                   + + I D+NDN PEFE D Y+ +++E    G SVLQ++A D+D+G N+  +Y L
Sbjct  484   LHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSL  543

Query  403   ----EDKSGAFTLDSRTGWLTVRDQTVLDREKRSTISMRVYAKE-KVPSVVTSQLGASSV  457
                 E  +  F +D +TG +T R    +D E      + V A++  VP +      +S+ 
Sbjct  544   AETPETHAQWFQIDPQTGLITTRSH--IDCETEPVPQLTVVARDGGVPPL------SSTA  595

Query  458   NIEVTLLDANDNNPTFIPNNLYEFIITTKAKKGDLVGQLHAIDPDLGRNGFVTYSIQKAP  517
              + VT+ D NDN P F   + Y   +      G  + ++ A DPD G N  V Y+I +  
Sbjct  596   TVLVTIHDVNDNEPIF-DQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGF  654

Query  518   NSSIPFEVDTKSGQIMVTQ--DDLQASEHLLFVEASDQPVNPSEKRSALAVVTVDIRDQN  575
                  FEV + SG+I +    D  + S +   V A+D+        S  A++ + + D N
Sbjct  655   KHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDR-----GGLSTTAMIKMQLTDVN  709

Query  576   ENREPDFIGAPYEFWVGGNVDIGTSVGQIRIT-------EFNNMGTILYDLLHSYHEGVP  628
             +NR P F    Y+  +  +    +      I        ++ N G + Y ++     G+ 
Sbjct  710   DNR-PVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGI-  767

Query  629   FAVEEKSGTITVV--DDLNKFNRENYDFEAFVNNEGDLSLVTN--VTIHVVDPKDEKTIL  684
             F ++  +G I VV  D L+   +  +       + G+L    +  V + ++D      I 
Sbjct  768   FRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIF  827

Query  685   MKTGTTPIEFHVKENEP-NILIGKLGFKTNGTNN---LKFTIANQKDVTDHISI-TSDGT  739
              K       ++VKE+ P   ++G +   +    +   ++++I +  D   + SI T+ G 
Sbjct  828   EKAR---YNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYS-GDPDGYFSIETNSGN  883

Query  740   LYTQKPLDRETRDIYRLTIIAEYNKGSVLGTGIYQVNVIVDDENDNKPLFERESYEGKIT  799
             +   KPLD E +    L I A   +  V G    QVN+ V+D NDN P FE       + 
Sbjct  884   IRIAKPLDHEAKSQVLLNIQATLGEPPVYGH--TQVNIEVEDVNDNAPEFEASMVRISVP  941

Query  800   ENSKSGTEVDLNYPIHVSDSDVGHNGQFTVTIFG-NGSEYFRLDRNLGKIQFTGANTPLD  858
             E+++ G  +   Y  H  D D G +GQ T ++   +G   F +D   G +  +     LD
Sbjct  942   ESAELGAPL---YAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILS---QHLD  995

Query  859   RETTSVYNLRLVATDEG--GLTSEAKLTIQVEDENDNSPLFVQFYLYPDKGIEVLQYDST  916
              E++  + L + ATD G   L++   + + V+D NDN P+F                   
Sbjct  996   YESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVF-------------------  1036

Query  917   GSRVGHFEEASNSTPGLFVLTQNFLRIRKPKEKISPLVSLPEDIAVGSSVIKAIAEDKDD  976
                                            EK    V++ E  ++ + +I+  A D D 
Sbjct  1037  -------------------------------EKDEYSVNVSESRSINAQIIQVNASDLDT  1065

Query  977   GENSVIKYEMVSETY--IPNELSSAPFHIIQYFMVQPTTGEVVIARALPAES--EFRLNI  1032
             G N+ I Y +V      + N +SS+   + Q+F + P +G + +   L  E+   ++L +
Sbjct  1066  GNNARITYRIVDAGVDNVTNSISSS--DVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTV  1123

Query  1033  SATDKGGFKDHLSVRITVR--DVNDHPPVFKKSWYNFDAEEASYTRNTLGRIEATDADFG  1090
              ATD G    H   R+ VR  D ND+ P F+KS Y F  EE     + +G + A+D D G
Sbjct  1124  LATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLG  1183

Query  1091  SNANITYS-IKNNSTVPFSISPTTGALRVDGLLDRETQDKYSFVVVAKDNPKSGKSLSSS  1149
              NA I YS +  NS+  F + P TG +     LDRE ++ Y  VV A+D     +  S+ 
Sbjct  1184  ENAAIRYSLLPINSS--FQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVR--SAR  1239

Query  1150  VNVEVNVLDINDNPPVFYGYDDLIPNPEANNFSNHNYQQKIPVYYATAAENSPMGTPITR  1209
             V V ++V D+NDN P        I +P+ +  S                E  P GT + R
Sbjct  1240  VPVRIHVSDVNDNAPE-------IADPQEDVVS--------------VREEQPPGTEVVR  1278

Query  1210  VFANDSDFTGNGNGLILFDIPYRKSR--QNLFAIDSKEGIVTTIGKLDYESEKSHNITIL  1267
             V A D D   N +  I + I   +      LF+ID   G++ T   LD+E    + + + 
Sbjct  1279  VRAVDRDHGQNAS--ITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVA  1336

Query  1268  ASDLGSPSLSSTAILIVNIIDVPEDIKSIERPVFAHRYYEVEVEENVPV-----------  1316
             ASD G+P   +  +L V ++D+ ++     RP F        V E+  +           
Sbjct  1337  ASDGGNPPRETVRMLRVEVLDLNDN-----RPTFTSSSLVFRVREDAALGHVVGSISPIE  1391

Query  1317  -PLRVLTLNVTEPYRSHKLRYSIVAENSSDVKRTFRIDPRNGSLYIIESPDREQKALYEL  1375
              P  V+  +V E +   ++ Y++       ++  F ID  +G+L +    DRE ++ + L
Sbjct  1392  RPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRL  1451

Query  1376  IIRLDQYKVGRDMTVMIYPVTNERLGNLGLNEVKVIVRVTDVNDNAPKFTVTGRPMIAAI  1435
              IR        D T    P +         + + V + V DVNDNAP++     P+   +
Sbjct  1452  EIR------ALDTTASNNPQS---------SAITVKIEVADVNDNAPEWPQD--PIDLQV  1494

Query  1436  PTTANYGYNVIRLQATDPDLGLNGEVRYQIL-------SRADEASRRFAIDPVTGQVRGI  1488
                   G  +    ATD D G NG+++Y+++          ++A   F +D +TG +   
Sbjct  1495  SEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQ  1554

Query  1489  STFTKEAGKVFGFDVKATDRS  1509
             +    EA + +   V+A D+S
Sbjct  1555  APLDFEAVQEYLLIVQALDQS  1575


 Score = 283 bits (724),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 381/1490 (26%), Positives = 629/1490 (42%), Gaps = 199/1490 (13%)

Query  109   DDGEDTITSSLSVTVYVEDINDHAPVFEGAPYHIDVDELTPVGLTVFRGIRAADHDKPNT  168
             D G   ++S+ +V V + D+ND+ P+F+ + Y++ V E  PVG  + + + A+D D    
Sbjct  585   DGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILK-VSASDPDC--G  641

Query  169   PNSDVQYAIVAG-NERGKFALESSHQAFLILRKSLDYDSGDRDFLLTITASDRGTPPKST  227
              N+ V Y I  G     +F + S+     I  + LD++     +   + A+DRG    ST
Sbjct  642   VNAMVNYTIGEGFKHLTEFEVRSASGEICIAGE-LDFER-RSSYEFPVLATDRGG--LST  697

Query  228   NATVRIKVNDNDDLPPKFTKGVYRTKIKEFYPITGARIHQRLKFNP--SIHAFDQDLAID  285
              A +++++ D +D  P F    Y+  ++E       +   +    P  ++ A D D    
Sbjct  698   TAMIKMQLTDVNDNRPVFYPREYKVSLRE-----SPKASSQASSTPIVAVVATDPDYGNF  752

Query  286   SPIRYDIIAGNERHLFSLDHVNGSLFLEREIDLDAERSLPGNTFVLQIQASQMDNPLKTG  345
               + Y I+AGNE  +F +D   G +F+ R  D+ + R+ P    +L I A+   N     
Sbjct  753   GQVSYRIVAGNEAGIFRIDRSTGEIFVVRP-DMLSVRTQP--MHMLNISATDGGNLRSNA  809

Query  346   VARVEVEIMDLNDNLPEFEVDFYNISIVENLPNGFSVLQIIATDQDQGDNAEFSYQL--E  403
              A V + I+D     P FE   YN  + E++P G  V  +IA   D    +   Y +   
Sbjct  810   DAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSG  869

Query  404   DKSGAFTLDSRTGWLTVRDQTVLDREKRSTISMRVYAKEKVPSVVTSQLGASSVNIEVTL  463
             D  G F++++ +G   +R    LD E +S + + + A    P V     G + VNIEV  
Sbjct  870   DPDGYFSIETNSG--NIRIAKPLDHEAKSQVLLNIQATLGEPPV----YGHTQVNIEVE-  922

Query  464   LDANDNNPTFIPNNLYEFIITTKAKKGDLVGQLHAIDPDLGRNGFVTYSIQKAPNSSIPF  523
              D NDN P F   ++    +   A+ G  +   HA D D G +G VTYS+ K     + F
Sbjct  923   -DVNDNAPEF-EASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGL-F  979

Query  524   EVDTKSGQIMVTQD-DLQASE-HLLFVEASDQPVNPSEKRSALAVVTVDIRDQNENREPD  581
              +D +SG ++++Q  D ++S+ H L V A+D  V PS   S    + VD++D N+N  P 
Sbjct  980   AIDARSGHLILSQHLDYESSQRHTLIVTATDGGV-PS--LSTNLTILVDVQDVNDN-PPV  1035

Query  582   FIGAPYEFWVGGNVDIGTSVGQIRITEFN--NMGTILYDLLHSYHEGVP-----------  628
             F    Y   V  +  I   + Q+  ++ +  N   I Y ++ +  + V            
Sbjct  1036  FEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQH  1095

Query  629   FAVEEKSGTITVVDDLNKFNRENYDFEAFVNNEGDLSL--VTNVTIHVVDPKDEKTILMK  686
             F +   SG I +   L++  R+ Y       + G  +    T V + V+D  D      K
Sbjct  1096  FGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQK  1155

Query  687   TGTTPIEFHVKENEPN------ILIGKLGFKTNGTNNLKFTIANQKDVTDHISITSDGTL  740
             +     EF ++EN         +    L    N          N       ++    G +
Sbjct  1156  SK---YEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQVHPVT----GEI  1208

Query  741   YTQKPLDRETRDIYRLTIIAEYNKGSVLGTGIYQVNVIVDDENDNKP-LFERESYEGKIT  799
              T++PLDRE R++Y L + A  ++G+ + +    V + V D NDN P + + +     + 
Sbjct  1209  STREPLDRELRELYDLVVEAR-DQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVR  1267

Query  800   ENSKSGTEVDLNYPIHVSDSDVGHNGQFTVTIF----GNGSEYFRLDRNLGKIQFTGANT  855
             E    GTEV     +   D D G N   T +I      +G   F +D   G I+      
Sbjct  1268  EEQPPGTEV---VRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIR---TRV  1321

Query  856   PLDRETTSVYNLRLVATDEGGLTSEA--KLTIQVEDENDNSPLFVQFYLYPDKGIEVLQY  913
              LD E  S+Y L + A+D G    E    L ++V D NDN P F    L           
Sbjct  1322  VLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSL-----------  1370

Query  914   DSTGSRVGHFEEASNSTPGLFVLTQNFLRIRKPKEKISPLVSLPEDIAVGSSV--IKAIA  971
                                         R+R             ED A+G  V  I  I 
Sbjct  1371  --------------------------VFRVR-------------EDAALGHVVGSISPIE  1391

Query  972   EDKDDGENSVIK-YEMVSETYIPNELSSAPFHIIQYFMVQPTTGEVVIARALPAE--SEF  1028
                D   NSV + +E +  TY  N L+     I   F +   +G +V+AR L  E  SEF
Sbjct  1392  RPADVVRNSVEESFEDLRVTYTLNPLTKD--LIEAAFDIDRHSGNLVVARLLDREVQSEF  1449

Query  1029  RLNISATDKGGFKD----HLSVRITVRDVNDHPPVFKKSWYNFDAEEASYTRNTLGRIEA  1084
             RL I A D     +     ++V+I V DVND+ P + +   +    EA+     +    A
Sbjct  1450  RLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTA  1509

Query  1085  TDADFGSNANITYSI----------KNNSTVPFSISPTTGALRVDGLLDRETQDKYSFVV  1134
             TDAD G+N ++ Y +          +  +   F +   TGAL +   LD E   +Y  +V
Sbjct  1510  TDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIV  1569

Query  1135  VAKDNPKS-GKSLSSSVNVEVNVLDINDNPPVFYGYDDLIPNPEANNFSNHNYQQKIPVY  1193
              A D   +  + L +SV V + +LD ND+ P F     + PN      ++        ++
Sbjct  1570  QALDQSSNVTERLQTSVTVRLRILDANDHAPHF-----VSPNSSGGKTAS--------LF  1616

Query  1194  YATAAENSPMGTPITRVFANDSDFTGNGNGLILFDIPYRKSRQNLFAIDSKEGIVTTIGK  1253
              + A     +G  +  + A D D     NG + ++I    + +  F I+S+ GI+  +  
Sbjct  1617  ISDATR---IGEVVAHIVAVDED--SGDNGQLTYEI-TGGNGEGRFRINSQTGIIELVKS  1670

Query  1254  L-----DYESEKSHNITILASDLGSPSLSSTAILIVNIIDVPEDIKSIERPVFAHRYYEV  1308
             L     D E     N+ I A D G P    +++ +  I+    +      P F    Y  
Sbjct  1671  LPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHN----NPPRFLQAVYRA  1726

Query  1309  EVEENVPVPLRVLTLNVTEPYRSH--KLRYSIVAENSSDVKRTFRIDPRNGSLYIIESPD  1366
              + ENVP    VL +     + +    L Y I A  ++D+   F +D + G +      D
Sbjct  1727  TILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDL---FHVDWQRGIITTRGQFD  1783

Query  1367  REQKALYELIIRLDQYKVGRDMTVMIYPVTNER----LGNLG----LNEVKVIVRVTDVN  1418
             RE +A Y L + +      R  T+    V  +R    +G+       +   + + V DVN
Sbjct  1784  RESQASYVLPVYV--RDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVN  1841

Query  1419  DNAPKFTVTGRPMIAAIPTTANYGYNVIRLQATDPDLGLNGEVRYQILSRADEASRRFAI  1478
             DN+P+F   G     ++P  +  G  +  + A+D D G N ++ Y I         +F+I
Sbjct  1842  DNSPEFR-PGSCYGLSVPENSEPGV-IHTVVASDLDEGPNADLIYSIT--GGNLGNKFSI  1897

Query  1479  DPVTGQVRGISTFTKEAGKVFGFDVKATDRSGADDGKSSIANVFVYVLDE  1528
             D  +G++       +E    +   ++A+DR G    +    N+ ++V D+
Sbjct  1898  DSSSGELSA-RPLDREQHSRYTLQIQASDR-GQPKSRQGHCNITIFVEDQ  1945


 Score = 281 bits (719),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 366/1358 (27%), Positives = 574/1358 (42%), Gaps = 225/1358 (17%)

Query  111   GEDTITSSLSVTVYVEDINDHAPVFEGAPYHIDVDELTPVGLTVFRGIRAADHDKPNTPN  170
             GE  +     V + VED+ND+AP FE +   I V E   +G  ++    A  HDK +  +
Sbjct  907   GEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYA---AHAHDKDSGSS  963

Query  171   SDVQYAIVAGNERGKFALESSHQAFLILRKSLDYDSGDRDFLLTITASDRGTPPKSTNAT  230
               V Y++V  + +G FA+++     LIL + LDY+S  R  L+ +TA+D G P  STN T
Sbjct  964   GQVTYSLVKESGKGLFAIDA-RSGHLILSQHLDYESSQRHTLI-VTATDGGVPSLSTNLT  1021

Query  231   VRIKVNDNDDLPPKFTKGVYRTKIKEFYPITGARIHQRLKFNPSIHAFDQDLAIDSPIRY  290
             + + V D +D PP F K  Y   + E   I    I         ++A D D   ++ I Y
Sbjct  1022  ILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQ--------VNASDLDTGNNARITY  1073

Query  291   DII------------AGNERHLFSLDHVNGSLFLEREIDLDAERSLPGNTFVLQIQASQM  338
              I+            + +    F +   +G ++L   +D +       + + L + A+  
Sbjct  1074  RIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETR-----DRYQLTVLATDN  1128

Query  339   DNPLKTGVARVEVEIMDLNDNLPEFEVDFYNISIVENLPNGFSVLQIIATDQDQGDNAEF  398
               P      RV V ++D NDN P+F+   Y   I ENL  G  V  + A+D D G+NA  
Sbjct  1129  GTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAI  1188

Query  399   SYQLEDKSGAFTLDSRTGWLTVRDQTVLDREKRSTISMRVYAKEKVPSVVTSQLGASSVN  458
              Y L   + +F +   TG ++ R+   LDRE R    + V A+++   V +++     V 
Sbjct  1189  RYSLLPINSSFQVHPVTGEISTREP--LDRELRELYDLVVEARDQGTPVRSAR-----VP  1241

Query  459   IEVTLLDANDNNPTFIPNNLYEFIITTKAKK--GDLVGQLHAIDPDLGRNGFVTYSIQKA  516
             + + + D NDN P     +  E +++ + ++  G  V ++ A+D D G+N  +TYSI K 
Sbjct  1242  VRIHVSDVNDNAPEIA--DPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKG  1299

Query  517   PNSSIP--FEVDTKSGQI--MVTQDDLQASEHLLFVEASDQPVNPSEKRSALAVVTVDIR  572
              +S     F +D  SG I   V  D  + S + L V ASD    P   R  + ++ V++ 
Sbjct  1300  RDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPP---RETVRMLRVEVL  1356

Query  573   DQNENREPDFIGAPYEFWVGGNVDIGTSVGQIRITE------FNNMGTILYDLLHSYHEG  626
             D N+NR P F  +   F V  +  +G  VG I   E       N++     DL  +Y   
Sbjct  1357  DLNDNR-PTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLN  1415

Query  627   --------VPFAVEEKSGTITVVDDLNK-----FNRENYDFEAFVNNEGDLSLVTNVTIH  673
                       F ++  SG + V   L++     F  E    +   +N    S +T V I 
Sbjct  1416  PLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAIT-VKIE  1474

Query  674   VVDPKDEKTILMKTGTTPIEFHVKENEP------NILIGKLGFKTNGTNNLKFTI-----  722
             V D  D      +    PI+  V E  P      N         TNG  +L++ +     
Sbjct  1475  VADVNDNAP---EWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNG--DLQYRLIRYFP  1529

Query  723   ---ANQKDVTDHISITS-DGTLYTQKPLDRETRDIYRLTIIAEYNKGSV---LGTGIYQV  775
                 +Q+       + S  G L  Q PLD E    Y L + A     +V   L T +  V
Sbjct  1530  QLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSV-TV  1588

Query  776   NVIVDDENDNKPLFERESYEGK------ITENSKSGTEVDLNYPIHVSDSDVGHNGQFTV  829
              + + D ND+ P F   +  G       I++ ++ G  V     I   D D G NGQ T 
Sbjct  1589  RLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVV---AHIVAVDEDSGDNGQLTY  1645

Query  830   TIF-GNGSEYFRLDRNLGKIQFTGANTPL--DRETTSVYNLRLVATDEGG---LTSEAKL  883
              I  GNG   FR++   G I+   +  P   D E    +NL + A D G      S   L
Sbjct  1646  EITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNL  1705

Query  884   TIQVEDENDNSPLFVQFYLYPDKGIEVLQYDSTGSRVGHFEEASNSTPGLFVLTQNFLRI  943
              + V+  ++N P F+Q  +Y    +E                  N   G FVL       
Sbjct  1706  HLIVQGSHNNPPRFLQ-AVYRATILE------------------NVPSGSFVL-------  1739

Query  944   RKPKEKISPLVSLPEDIAVGSSVIKAIAEDKDDGENSVIKYEMVSETYIPNELSSAPFHI  1003
                                     +  A+     EN+ + YE      IP  +++  FH+
Sbjct  1740  ------------------------QVTAKSLHGAENANLSYE------IPAGVANDLFHV  1769

Query  1004  IQYFMVQPTTG----EVVIARALP-----AESEFRLNISATDK------------GGFKD  1042
                  +  T G    E   +  LP     A  +  L+ SA  K            G   D
Sbjct  1770  DWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFD  1829

Query  1043  HLSVRITVRDVNDHPPVFKK-SWYNFDAEEASYTRNTLGRIEATDADFGSNANITYSIK-  1100
               ++ ITV DVND+ P F+  S Y     E S     +  + A+D D G NA++ YSI  
Sbjct  1830  VATIYITVGDVNDNSPEFRPGSCYGLSVPENSEP-GVIHTVVASDLDEGPNADLIYSITG  1888

Query  1101  NNSTVPFSISPTTGALRVDGLLDRETQDKYSFVVVAKDNPKSGKSLSSSVNVEVNVLDIN  1160
              N    FSI  ++G L     LDRE   +Y+  + A D  +  KS     N+ + V D N
Sbjct  1889  GNLGNKFSIDSSSGELSARP-LDREQHSRYTLQIQASDRGQP-KSRQGHCNITIFVEDQN  1946

Query  1161  DNPPVFYGYDDLIPNPEANNFSNHNYQQKIPVYYATAAENSPMGTPITRVFANDSDFTGN  1220
             DN P F                      K+  Y  +  E++P+GT + ++ A D+D   N
Sbjct  1947  DNAPRF----------------------KLSKYTGSVQEDAPLGTSVVQISAVDADLGVN  1984

Query  1221  GNGLILFDIPYRKSRQNLFAIDSKEGIVTTIGKLDYESEKSHNITILASDLGSPSLSSTA  1280
                 +++ +      Q  FAID + G++TT+GKLD E + S+N  +LA+D G   + S  
Sbjct  1985  AR--LVYSLANETQWQ--FAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSAT  2040

Query  1281  ILI-VNIIDVPEDIKSIERPVFAHRYYEVEVEENVPVPLRVLTLNVTEP--YRSHKLRYS  1337
             + + +N++D+ ++     RP+F    Y  +V   +     +L +   +     + ++ YS
Sbjct  2041  VPVQINVLDINDN-----RPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYS  2095

Query  1338  IVAENSSDVKRTFRIDPRNGSLYIIESPDREQKALYEL  1375
             + AENS+ V   FRI+P  G+L   +S   E   L  L
Sbjct  2096  LNAENSA-VSAKFRINPSTGALSASQSLASESGKLLHL  2132


 Score = 266 bits (681),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 378/1537 (25%), Positives = 650/1537 (42%), Gaps = 282/1537 (18%)

Query  109   DDGEDTITSSLSVTVYVEDINDHAPVFEGAPYHIDVDELTPVGLTVFRGIRAADHDKPNT  168
             D G  +++++L++ V V+D+ND+ PVFE   Y ++V E   +   + + + A+D D  N 
Sbjct  1010  DGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQ-VNASDLDTGN-  1067

Query  169   PNSDVQYAIV-AGNERGKFALESS----------HQAFLILRKSLDYDSGDRDFLLTITA  217
              N+ + Y IV AG +    ++ SS          +  ++ LR  LD ++ DR + LT+ A
Sbjct  1068  -NARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDR-YQLTVLA  1125

Query  218   SDRGTPPKSTNATVRIKVNDNDDLPPKFTKGVYRTKIKEFYPITGARIHQRLKFNPSIHA  277
             +D GTP       V ++V D +D  PKF K  Y  +I+E          +R      + A
Sbjct  1126  TDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENL--------RRGSVVGVVTA  1177

Query  278   FDQDLAIDSPIRYDIIAGNERHLFSLDHVNGSLFLEREIDLDAERSLPGNTFVLQIQASQ  337
              D DL  ++ IRY ++  N    F +  V G +     +D +  R L    + L ++A  
Sbjct  1178  SDLDLGENAAIRYSLLPINSS--FQVHPVTGEISTREPLDREL-REL----YDLVVEARD  1230

Query  338   MDNPLKTGVARVEVEIMDLNDNLPEFEVDFYNI-SIVENLPNGFSVLQIIATDQDQGDNA  396
                P+++    V + + D+NDN PE      ++ S+ E  P G  V+++ A D+D G NA
Sbjct  1231  QGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNA  1290

Query  397   EFSYQL-----EDKSGAFTLDSRTGWLTVRDQTVLDREKRSTISMRVYAKEKV-PSVVTS  450
               +Y +      D  G F++D  +G   +R + VLD E+RS   + V A +   P   T 
Sbjct  1291  SITYSIVKGRDSDGHGLFSIDPTSG--VIRTRVVLDHEERSIYRLGVAASDGGNPPRETV  1348

Query  451   QLGASSVNIEVTLLDANDNNPTFIPNNLYEFIITTKAKKGDLVGQLHAID--PDLGRNGF  508
             ++      + V +LD NDN PTF  ++L  F +   A  G +VG +  I+   D+ RN  
Sbjct  1349  RM------LRVEVLDLNDNRPTFTSSSLV-FRVREDAALGHVVGSISPIERPADVVRNSV  1401

Query  509   --------VTYSIQKAPNSSI--PFEVDTKSGQIMVTQ--DDLQASEHLLFVEASDQPVN  556
                     VTY++       I   F++D  SG ++V +  D    SE  L + A D   +
Sbjct  1402  EESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTAS  1461

Query  557   PSEKRSALAVVTVDIRDQNENREPDFIGAPYEFWVGGNVDIGTSVGQIRITEFNNM--GT  614
              + + SA+  V +++ D N+N  P++   P +  V     +GT +     T+ +    G 
Sbjct  1462  NNPQSSAI-TVKIEVADVNDN-APEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGD  1519

Query  615   ILYDLLHSYHEGVPFAVEEKSGTITVVDDLNKFN--RENYDFEAF---------VNNEGD  663
             + Y L+  + +      +E++ ++  +D L      +   DFEA          ++   +
Sbjct  1520  LQYRLIRYFPQ--LNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSN  1577

Query  664   LS--LVTNVTIH--VVDPKDEKTILM-------KTGTTPIEFHVKENEPNILI-------  705
             ++  L T+VT+   ++D  D     +       KT +  I    +  E    I       
Sbjct  1578  VTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDS  1637

Query  706   ---GKLGFKTNGTNNL-KFTIANQKDVTDHISITSDGTLYTQKPLDRETRDIYRLTIIAE  761
                G+L ++  G N   +F I +Q  + + +      T       D E    + L I A+
Sbjct  1638  GDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATE------DVEKGGRFNLIIGAK  1691

Query  762   YNKGSVLGTGIYQVNVIVDDENDNKPLFERESYEGKITENSKSGTEVDLNYPIHVSDSDV  821
              +           +++IV   ++N P F +  Y   I EN  SG+ V     + V+   +
Sbjct  1692  DHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFV-----LQVTAKSL  1746

Query  822   --GHNGQFTVTI-FGNGSEYFRLDRNLGKIQFTGANTPLDRETTSVYNL-----------  867
                 N   +  I  G  ++ F +D   G I   G     DRE+ + Y L           
Sbjct  1747  HGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQ---FDRESQASYVLPVYVRDANRQS  1803

Query  868   --------RLVATDEGGLTSE------AKLTIQVEDENDNSPLFVQFYLYPDKGIEVLQY  913
                     +  ++D  G TS       A + I V D NDNSP F     Y   G+ V + 
Sbjct  1804  TLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCY---GLSVPE-  1859

Query  914   DSTGSRVGHFEEASNSTPGLFVLTQNFLRIRKPKEKISPLVSLPEDIAVGSSVIKAIAED  973
                           NS PG+                                +   +A D
Sbjct  1860  --------------NSEPGV--------------------------------IHTVVASD  1873

Query  974   KDDGENSVIKYEMVSETYIPNELSSAPFHIIQYFMVQPTTGEVVIARALPAE--SEFRLN  1031
              D+G N+ + Y +               ++   F +  ++GE+  AR L  E  S + L 
Sbjct  1874  LDEGPNADLIYSITGG------------NLGNKFSIDSSSGELS-ARPLDREQHSRYTLQ  1920

Query  1032  ISATDKGGFKD---HLSVRITVRDVNDHPPVFKKSWYNFDAEEASYTRNTLGRIEATDAD  1088
             I A+D+G  K    H ++ I V D ND+ P FK S Y    +E +    ++ +I A DAD
Sbjct  1921  IQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDAD  1980

Query  1089  FGSNANITYSIKNNSTVPFSISPTTGALRVDGLLDRETQDKYSFVVVAKDNPKSGKSLSS  1148
              G NA + YS+ N +   F+I   +G +   G LDRE Q  Y+F+V+A D  +  +  S+
Sbjct  1981  LGVNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRY-EVRSA  2039

Query  1149  SVNVEVNVLDINDNPPVFYGYDDLIPNPEANNFSNHNYQQKIPVYYATAAENSPMGTPIT  1208
             +V V++NVLDINDN P+F  Y                Y  ++P            G  + 
Sbjct  2040  TVPVQINVLDINDNRPIFERYP---------------YIGQVPALIQP-------GQTLL  2077

Query  1209  RVFANDSDFTGNGNGLILFDIPYRKSRQNL-FAIDSKEGIVTTIGKLDYESEKSHNITIL  1267
             +V A D+D   N    I++ +    S  +  F I+   G ++    L  ES K  ++ ++
Sbjct  2078  KVQALDADLGANAE--IVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVV  2135

Query  1268  ASDLGSPSLSSTAILIVNIIDVPEDIKSIERPVFAHRYYEVEVEENVPVPLRVL-TLNVT  1326
             A D G+P  SS  ++ + I + P+    +    F +  Y V ++EN P   R+L  + + 
Sbjct  2136  ARDKGNPPQSSLGLIELLIGEAPQGTPVLR---FQNETYRVMLKENSPSGTRLLQVVALR  2192

Query  1327  EPYRSHKLRYSIVAENSSDVKRTFRIDPRNGSLYI----------IESPDREQ----KAL  1372
                R  K+++S  A N   +     +D  +G + +            +P        +AL
Sbjct  2193  SDGRRQKVQFSFGAGNEDGI---LSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRAL  2249

Query  1373  YELIIRL--------DQYKVGRDMTVMIYPVTNERLGNLGL-------------NEVKVI  1411
             +              +  +  R +T   + +TN +   + +             +  +++
Sbjct  2250  HYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELV  2309

Query  1412  VRVTDVNDNAPKFTVTGRPMIAAIPTTANYGYNVIRLQATDPDLGLNGEVRYQILSRADE  1471
             + + D NDN+PKF  + +  +A +    N G  V ++ A D D G N  +RY I+    +
Sbjct  2310  IELEDENDNSPKF--SQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHD  2367

Query  1472  ASRRFAIDPV-TGQVRGISTFTKEAGKVFGFDVKATD  1507
              +  F I+P  +G VR      +E   ++   + ATD
Sbjct  2368  NA--FVIEPAFSGIVRTNIVLDREIRDIYKLKIIATD  2402


 Score = 265 bits (677),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 373/1513 (25%), Positives = 623/1513 (41%), Gaps = 264/1513 (17%)

Query  96    PRNVLKFKVTCDYDDGEDTITSSLSVTVYVEDINDHAPVFEGAPYHIDVDELTPVGLTVF  155
             P ++L    T   D G     +   V + + D     P+FE A Y+  V E  P G TV 
Sbjct  791   PMHMLNISAT---DGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRG-TVV  846

Query  156   RGIRAADHDKPNTPNSDVQYAIVAGNERGKFALESSHQAFLILRKSLDYDSGDRDFLLTI  215
               + AA  D  +   S V+Y+I +G+  G F++E++     I  K LD+++  +  LL I
Sbjct  847   GSVIAASGDVAH--RSPVRYSIYSGDPDGYFSIETNSGNIRIA-KPLDHEAKSQ-VLLNI  902

Query  216   TASDRGTPPKSTNATVRIKVNDNDDLPPKFTKGVYRTKIKEFYPITGARIHQRLKFNPSI  275
              A+  G PP   +  V I+V D +D  P+F   + R  + E   + GA ++       + 
Sbjct  903   QAT-LGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAEL-GAPLY-------AA  953

Query  276   HAFDQDLAIDSPIRYDIIAGNERHLFSLDHVNGSLFLEREIDLDAERSLPGNTFVLQIQA  335
             HA D+D      + Y ++  + + LF++D  +G L L + +D ++ +        L + A
Sbjct  954   HAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYESSQR-----HTLIVTA  1008

Query  336   SQMDNPLKTGVARVEVEIMDLNDNLPEFEVDFYNISIVENLPNGFSVLQIIATDQDQGDN  395
             +    P  +    + V++ D+NDN P FE D Y++++ E+      ++Q+ A+D D G+N
Sbjct  1009  TDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNN  1068

Query  396   AEFSYQL--------------EDKSGAFTLDSRTGWLTVRDQTVLDREKRSTISMRVYAK  441
             A  +Y++               D S  F +   +GW+ +R    LDRE R    + V A 
Sbjct  1069  ARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLR--APLDRETRDRYQLTVLAT  1126

Query  442   EKVPSVVTSQLGASSVNIEVTLLDANDNNPTFIPNNLYEFIITTKAKKGDLVGQLHAIDP  501
             +       +    +   + V +LDANDN+P F   + YEF I    ++G +VG + A D 
Sbjct  1127  DN-----GTPAAHAKTRVIVRVLDANDNDPKF-QKSKYEFRIEENLRRGSVVGVVTASDL  1180

Query  502   DLGRNGFVTYSIQKAPNSSIPFEVDTKSGQIMVTQD-DLQASE-HLLFVEASDQ--PVNP  557
             DLG N  + YS+    NSS  F+V   +G+I   +  D +  E + L VEA DQ  PV  
Sbjct  1181  DLGENAAIRYSLLPI-NSS--FQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPV--  1235

Query  558   SEKRSALAVVTVDIRDQNENREPDFIGAPYEFWVGGNVDI--GTSVGQIRITEFNNM--G  613
                RSA   V + + D N+N  P+ I  P E  V    +   GT V ++R  + ++    
Sbjct  1236  ---RSARVPVRIHVSDVNDN-APE-IADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNA  1290

Query  614   TILYDLLH---SYHEGVPFAVEEKSGTITVVDDLNKFNRENYDFEAFVNNEGD--LSLVT  668
             +I Y ++    S   G+ F+++  SG I     L+   R  Y      ++ G+     V 
Sbjct  1291  SITYSIVKGRDSDGHGL-FSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVR  1349

Query  669   NVTIHVVDPKDEKTILMKTGTTPIEFHVKENEP-NILIGKLGFKTNGTN-----------  716
              + + V+D  D +       ++ + F V+E+     ++G +       +           
Sbjct  1350  MLRVEVLDLNDNRPTFT---SSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFE  1406

Query  717   NLKFTIANQKDVTDHISITSD-----GTLYTQKPLDRETRDIYRLTIIA-EYNKGSVLGT  770
             +L+ T        D I    D     G L   + LDRE +  +RL I A +    +   +
Sbjct  1407  DLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQS  1466

Query  771   GIYQVNVIVDDENDNKPLFERESYEGKITENSKSGTEVDLNYPIHVSDSDVGHNGQFTVT  830
                 V + V D NDN P + ++  + +++E +  GT +   +    +D+D G NG     
Sbjct  1467  SAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTII---HNFTATDADTGTNGDLQYR  1523

Query  831   IF----------GNGSEYFRLDRNLGKIQFTGANTPLDRETTSVYNLRLVATDEGG----  876
             +                 FR+D   G +       PLD E    Y L + A D+      
Sbjct  1524  LIRYFPQLNESQEQAMSLFRMDSLTGALSL---QAPLDFEAVQEYLLIVQALDQSSNVTE  1580

Query  877   -LTSEAKLTIQVEDENDNSPLFVQFYLYPDKGIEVLQYDSTGSRVGHFEEASNSTPGLFV  935
              L +   + +++ D ND++P FV               +S+G +          T  LF+
Sbjct  1581  RLQTSVTVRLRILDANDHAPHFVS-------------PNSSGGK----------TASLFI  1617

Query  936   LTQNFLRIRKPKEKISPLVSLPEDIAVGSSVIKAIAEDKDDGENSVIKYEMVSETYIPNE  995
                                   +   +G  V   +A D+D G+N  + YE+         
Sbjct  1618  ---------------------SDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGR-  1655

Query  996   LSSAPFHIIQYFMVQPTTGEVVIARALPAESE-------FRLNISATDKGG---FKDHLS  1045
                        F +   TG + + ++LP  +E       F L I A D G     K  L+
Sbjct  1656  -----------FRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLN  1704

Query  1046  VRITVRDVNDHPPVFKKSWYNFDAEEASYTRNTLGRIEATDADFGSNANITYSIKNN-ST  1104
             + + V+  +++PP F ++ Y     E   + + + ++ A       NAN++Y I    + 
Sbjct  1705  LHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVAN  1764

Query  1105  VPFSISPTTGALRVDGLLDRETQDKYSFVVVAKDNPKSGKSLSSSV--------------  1150
               F +    G +   G  DRE+Q  Y   V  +D  +     SS+V              
Sbjct  1765  DLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSN  1824

Query  1151  -------NVEVNVLDINDNPPVFYGYDDLIPNPEANNFSNHNYQQKIPVYYATAAENSPM  1203
                     + + V D+NDN P F                     +    Y  +  ENS  
Sbjct  1825  GQHFDVATIYITVGDVNDNSPEF---------------------RPGSCYGLSVPENSEP  1863

Query  1204  GTPITRVFANDSDFTGNGNGLILFDIPYRKSRQNL---FAIDSKEGIVTTIGKLDYESEK  1260
             G  I  V A+D D   N       D+ Y  +  NL   F+IDS  G ++    LD E   
Sbjct  1864  GV-IHTVVASDLDEGPNA------DLIYSITGGNLGNKFSIDSSSGELSA-RPLDREQHS  1915

Query  1261  SHNITILASDLGSPSLSSTAILIVNIIDVPEDIKSIERPVFAHRYYEVEVEENVPVPLRV  1320
              + + I ASD G P        I   ++   D      P F    Y   V+E+ P+   V
Sbjct  1916  RYTLQIQASDRGQPKSRQGHCNITIFVEDQND----NAPRFKLSKYTGSVQEDAPLGTSV  1971

Query  1321  LTLNVTEP--YRSHKLRYSIVAENSSDVKRTFRIDPRNGSLYIIESPDREQKALYELIIR  1378
             + ++  +     + +L YS+  E     +  F ID ++G +  +   DRE +A Y  ++ 
Sbjct  1972  VQISAVDADLGVNARLVYSLANE----TQWQFAIDGQSGLITTVGKLDRELQASYNFMVL  2027

Query  1379  L---DQYKVGRDMTVMIYPVTNERLGNLGLNEVKVIVRVTDVNDNAPKFTVTGRPMIAAI  1435
                  +Y+V R  TV                   V + V D+NDN P F     P I  +
Sbjct  2028  ATDGGRYEV-RSATV------------------PVQINVLDINDNRPIFE--RYPYIGQV  2066

Query  1436  PTTANYGYNVIRLQATDPDLGLNGEVRYQILSRADEASRRFAIDPVTGQVRGISTFTKEA  1495
             P     G  ++++QA D DLG N E+ Y + +     S +F I+P TG +    +   E+
Sbjct  2067  PALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASES  2126

Query  1496  GKVFGFDVKATDR  1508
             GK+   +V A D+
Sbjct  2127  GKLLHLEVVARDK  2139


 Score = 263 bits (671),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 376/1484 (25%), Positives = 610/1484 (41%), Gaps = 239/1484 (16%)

Query  119   LSVTVYVEDINDHAPVFEGAPYHIDVDELTPVGLTVFRGIRAADHDKPNTPNSDVQYAIV  178
             + V V V+D ND+AP F     HI+  E TP    V R +  A  D    P +  +Y IV
Sbjct  158   IRVLVTVKDENDNAPTFPQTSMHIEFPENTP--REVKRTLLPA-RDLDLEPYNTQRYNIV  214

Query  179   AGNERGKFALESSHQAFLILRKSLDYDSG--DRD----FLLTITASDRGTPPKSTNATVR  232
             +GN    F L S  +   +L   L   SG  DR+    + L I A D GTPP     TV 
Sbjct  215   SGNVNDAFRLSSHRERDGVLYLDLQI-SGFLDRETTPGYSLLIEALDGGTPPLRGFMTVN  273

Query  233   IKVNDNDDLPPKFTKGVYRTKIKEFYPITGARIHQRLKFNPSIHAFDQDLAIDSPIRYDI  292
             I + D +D  P F +  Y   + E   + G  + Q       ++A D D   +  + Y I
Sbjct  274   ITIQDVNDNQPIFNQSRYFATVPENATV-GTSVLQ-------VYASDTDADENGLVEYAI  325

Query  293   --IAGNERHLFSLDHVNGSLFLEREIDLDAERSLPGNTFVLQIQASQMDNPLKTGVARVE  350
                  ++  +F +D   G++++ + +D + +        ++ +     + PL+T  A V 
Sbjct  326   NRRQSDKEQMFRIDPRTGAIYINKALDFETKELHE----LVVVAKDHGEQPLET-TAFVS  380

Query  351   VEIMDLNDNLPEFEVDFY----NISIVENLPNGFSVLQIIATDQD-QGDNAEFSYQLEDK  405
             + + D+NDN P   V F     +  I E+   G  V +I   D D + + A  +  L   
Sbjct  381   IRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGG  440

Query  406   SGAFTLDSRTGWL-TVRDQTVLDREKRSTISMRVYAKEKVPSVVTSQLGASSVNIEVTLL  464
              G F L +R   +  V     LDRE  S  ++ V A +K     T  L AS  +I + + 
Sbjct  441   DGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDK----GTPPLHASK-SIFLRIT  495

Query  465   DANDNNPTFIPNNLYEFIITTKAKKGDLVGQLHAIDPDLGRNGFVTYSIQKAPNSSIP-F  523
             D NDN P F   +LY   +   A  G  V Q+ A D D G N  +TYS+ + P +    F
Sbjct  496   DVNDNPPEF-EQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWF  554

Query  524   EVDTKSGQIMVTQDDLQASEHL--LFVEASDQPVNPSEKRSALAVVTVDIRDQNENREPD  581
             ++D ++G I         +E +  L V A D  V P    S+ A V V I D N+N EP 
Sbjct  555   QIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPP---LSSTATVLVTIHDVNDN-EPI  610

Query  582   FIGAPYEFWVGGNVDIGTSVGQIRITE----FNNMGTILYDLLHSYHEGVPFAVEEKSGT  637
             F  + Y   V  N  +G  + ++  ++     N M  + Y +   +     F V   SG 
Sbjct  611   FDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAM--VNYTIGEGFKHLTEFEVRSASGE  668

Query  638   ITVVDDLNKFNRENYDFEAFVNNEGDLSLVTNVTIHVVDPKDEKTILM------------  685
             I +  +L+   R +Y+F     + G LS    + + + D  D + +              
Sbjct  669   ICIAGELDFERRSSYEFPVLATDRGGLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESP  728

Query  686   ----KTGTTPIEFHVKENEPNILIGKLGFKTNGTNNLKFTIANQKDVTDHISITSDGTLY  741
                 +  +TPI   V  +      G++ ++    N       ++          S G ++
Sbjct  729   KASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDR----------STGEIF  778

Query  742   TQKP--LDRETRDIYRLTIIAEYNKGSVLGTGIYQVNVIVDDENDNKPLFERESYEGKIT  799
               +P  L   T+ ++ L I A  + G++       V + + D     P+FE+  Y   + 
Sbjct  779   VVRPDMLSVRTQPMHMLNISAT-DGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVK  837

Query  800   ENSKSGTEVDLNYPIHVSDSDVGHNGQFTVTIF-GNGSEYFRLDRNLGKIQFTGANTPLD  858
             E+   GT V     +  +  DV H      +I+ G+   YF ++ N G I+      PLD
Sbjct  838   EDIPRGTVVG---SVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIA---KPLD  891

Query  859   RETTSVYNLRLVAT-DEGGLTSEAKLTIQVEDENDNSPLFVQFYLYPDKGIEVLQYDSTG  917
              E  S   L + AT  E  +    ++ I+VED NDN+P F                    
Sbjct  892   HEAKSQVLLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEF--------------------  931

Query  918   SRVGHFEEASNSTPGLFVLTQNFLRIRKPKEKISPLVSLPEDIAVGSSVIKAIAEDKDDG  977
                    EAS             +RI           S+PE   +G+ +  A A DKD G
Sbjct  932   -------EAS------------MVRI-----------SVPESAELGAPLYAAHAHDKDSG  961

Query  978   ENSVIKYEMVSETYIPNELSSAPFHIIQYFMVQPTTGEVVIARALPAESEFR--LNISAT  1035
              +  + Y +V E+                F +   +G +++++ L  ES  R  L ++AT
Sbjct  962   SSGQVTYSLVKESG------------KGLFAIDARSGHLILSQHLDYESSQRHTLIVTAT  1009

Query  1036  DKG--GFKDHLSVRITVRDVNDHPPVFKKSWYNFDAEEASYTRNTLGRIEATDADFGSNA  1093
             D G      +L++ + V+DVND+PPVF+K  Y+ +  E+      + ++ A+D D G+NA
Sbjct  1010  DGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNA  1069

Query  1094  NITYSI-------------KNNSTVPFSISPTTGALRVDGLLDRETQDKYSFVVVAKDNP  1140
              ITY I              ++ +  F I P +G + +   LDRET+D+Y   V+A DN 
Sbjct  1070  RITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDN-  1128

Query  1141  KSGKSLSSSVNVEVNVLDINDNPPVFYGYDDLIPNPEANNFSNHNYQQKIPVYYATAAEN  1200
                 +  +   V V VLD NDN P                F    Y+ +I        EN
Sbjct  1129  -GTPAAHAKTRVIVRVLDANDNDP---------------KFQKSKYEFRI-------EEN  1165

Query  1201  SPMGTPITRVFANDSDFTGNGNGLILFDIPYRKSRQNLFAIDSKEGIVTTIGKLDYESEK  1260
                G+ +  V A+D D  G    +    +P   S    F +    G ++T   LD E  +
Sbjct  1166  LRRGSVVGVVTASDLDL-GENAAIRYSLLPINSS----FQVHPVTGEISTREPLDRELRE  1220

Query  1261  SHNITILASDLGSPSLSSTAILIVNIIDVPEDIKSIERPVFAHRYYEVEVEENVPVPLRV  1320
              +++ + A D G+P  S+   + +++ DV ++   I  P    +   V V E  P    V
Sbjct  1221  LYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADP----QEDVVSVREEQPPGTEV  1276

Query  1321  LTLNVTEPYRSH----KLRYSIVAENSSDVKRTFRIDPRNGSLYIIESPDREQKALYELI  1376
             + +   +  R H     + YSIV    SD    F IDP +G +      D E++++Y L 
Sbjct  1277  VRVRAVD--RDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRL-  1333

Query  1377  IRLDQYKVGRDMTVMIYPVTNERLGNLGLNEVKVI-VRVTDVNDNAPKFTVTGRPMIAAI  1435
                               V     GN     V+++ V V D+NDN P FT +   ++  +
Sbjct  1334  -----------------GVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSS--LVFRV  1374

Query  1436  PTTANYGY------------NVIRLQATDPDLGLNGEVRYQILSRADEASRRFAIDPVTG  1483
                A  G+            +V+R    +    L        L++ D     F ID  +G
Sbjct  1375  REDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTK-DLIEAAFDIDRHSG  1433

Query  1484  QVRGISTFTKEAGKVFGFDVKATDRSGADDGKSSIANVFVYVLD  1527
              +       +E    F  +++A D + +++ +SS   V + V D
Sbjct  1434  NLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVAD  1477


 Score = 254 bits (649),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 378/1500 (25%), Positives = 631/1500 (42%), Gaps = 255/1500 (17%)

Query  109   DDGEDTITSSLSVTVYVEDINDHAP-VFEGAPYHIDVDELTPVGLTVFRGIRAADHDKPN  167
             D G    ++ + V ++V D+ND+AP + +     + V E  P G  V R +RA D D  +
Sbjct  1230  DQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVR-VRAVDRD--H  1286

Query  168   TPNSDVQYAIVAGNERGKFALESSHQAFLILRKSLDYDSGDRD-FLLTITASDRGTPPKS  226
               N+ + Y+IV G +     L S      ++R  +  D  +R  + L + ASD G PP+ 
Sbjct  1287  GQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRE  1346

Query  227   TNATVRIKVNDNDDLPPKFTKGVYRTKIKEFYPITGARIHQRLKFNP----------SIH  276
             T   +R++V D +D  P FT      +++E      A  H     +P          S+ 
Sbjct  1347  TVRMLRVEVLDLNDNRPTFTSSSLVFRVRE----DAALGHVVGSISPIERPADVVRNSVE  1402

Query  277   AFDQDLAID---SPIRYDIIAGNERHLFSLDHVNGSLFLEREIDLDAERSLPGNTFVLQI  333
                +DL +    +P+  D+I       F +D  +G+L + R +D + +     + F L+I
Sbjct  1403  ESFEDLRVTYTLNPLTKDLIEA----AFDIDRHSGNLVVARLLDREVQ-----SEFRLEI  1453

Query  334   QA---SQMDNPLKTGVARVEVEIMDLNDNLPEFEVDFYNISIVENLPNGFSVLQIIATDQ  390
             +A   +  +NP  + +  V++E+ D+NDN PE+  D  ++ + E  P G  +    ATD 
Sbjct  1454  RALDTTASNNPQSSAIT-VKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDA  1512

Query  391   DQGDNAEFSYQL-----------EDKSGAFTLDSRTGWLTVRDQTVLDREKRSTISMRVY  439
             D G N +  Y+L           E     F +DS TG L++  Q  LD E      + V 
Sbjct  1513  DTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSL--QAPLDFEAVQEYLLIVQ  1570

Query  440   AKEKVPSVVTSQLGASSVNIEVTLLDANDNNPTFI-PNN----LYEFIITTKAKKGDLVG  494
             A ++  S VT +L  +SV + + +LDAND+ P F+ PN+         I+   + G++V 
Sbjct  1571  ALDQ-SSNVTERL-QTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVA  1628

Query  495   QLHAIDPDLGRNGFVTYSIQKAPNSSIPFEVDTKSGQIMVTQDDLQASEHL-------LF  547
              + A+D D G NG +TY I    N    F +++++G I + +    A+E +       L 
Sbjct  1629  HIVAVDEDSGDNGQLTYEITGG-NGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLI  1687

Query  548   VEASDQPVNPSEKRSALAVVTVDIRDQNENREPDFIGAPYEFWVGGNVDIGTSVGQIRIT  607
             + A D    P  K+S+L +    I   + N  P F+ A Y   +  NV  G+ V Q+   
Sbjct  1688  IGAKDHG-QPEPKKSSLNLHL--IVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAK  1744

Query  608   EFNNMGTILYDLLHSYHEGVP---FAVEEKSGTITVVDDLNKFNRENYDFEAFVNNEGDL  664
               +  G    +L +    GV    F V+ + G IT     ++ ++ +Y    +V +    
Sbjct  1745  SLH--GAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQ  1802

Query  665   SLVTNVTIHVVDPKDE------------KTILMKTG----TTPIEFH--------VKEN-  699
             S +++  +      D              TI +  G     +P EF         V EN 
Sbjct  1803  STLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSP-EFRPGSCYGLSVPENS  1861

Query  700   EPNILIGKLGFKTN-GTN-NLKFTIANQKDVTDHISITSDGTLYTQKPLDRETRDIYRLT  757
             EP ++   +    + G N +L ++I    ++ +  SI S     + +PLDRE    Y L 
Sbjct  1862  EPGVIHTVVASDLDEGPNADLIYSITG-GNLGNKFSIDSSSGELSARPLDREQHSRYTLQ  1920

Query  758   IIAEYNKGSVLGTGIYQVNVIVDDENDNKPLFERESYEGKITENSKSGTEVDLNYPIHVS  817
             I A          G   + + V+D+NDN P F+   Y G + E++  GT V     I   
Sbjct  1921  IQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSV---VQISAV  1977

Query  818   DSDVGHNGQFTVTIFGNGSEYFRLDRNLGKIQFTGANTPLDRETTSVYNLRLVATDEGGL  877
             D+D+G N +   ++       F +D   G I   G    LDRE  + YN  ++ATD G  
Sbjct  1978  DADLGVNARLVYSLANETQWQFAIDGQSGLITTVGK---LDRELQASYNFMVLATDGGRY  2034

Query  878   ---TSEAKLTIQVEDENDNSPLFVQFYLYPDKGIEVLQYDSTGSRVGHFEEASNSTPGLF  934
                ++   + I V D NDN P+F +   YP  G                           
Sbjct  2035  EVRSATVPVQINVLDINDNRPIFER---YPYIG---------------------------  2064

Query  935   VLTQNFLRIRKPKEKISPLVSLPEDIAVGSSVIKAIAEDKDDGENSVIKYEMVSETYIPN  994
                                  +P  I  G +++K  A D D G N+ I Y + +E    N
Sbjct  2065  --------------------QVPALIQPGQTLLKVQALDADLGANAEIVYSLNAE----N  2100

Query  995   ELSSAPFHIIQYFMVQPTTGEVVIARALPAESE--FRLNISATDKGGF-KDHLS-VRITV  1050
                SA F I       P+TG +  +++L +ES     L + A DKG   +  L  + + +
Sbjct  2101  SAVSAKFRI------NPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLI  2154

Query  1051  RDVNDHPPV--FKKSWYNFDAEEASYTRNTLGRIEATDADFGSNANITYSI-KNNSTVPF  1107
              +     PV  F+   Y    +E S +   L ++ A  +D G    + +S    N     
Sbjct  2155  GEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSD-GRRQKVQFSFGAGNEDGIL  2213

Query  1108  SISPTTGALRVDG--LLDRETQDKYSFVVVAK-------------------DNPKSGKSL  1146
             S+   +G +RV+   LLD +     S   +++                   ++ +S ++L
Sbjct  2214  SLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRAL  2273

Query  1147  SSSV---------NVEVNVLDINDNPPVFYGYDDLIPNPEANNFSNHNYQQKIPVYYATA  1197
             +SS           + V ++    + P    Y +L+   E  N ++  + QK   + AT 
Sbjct  2274  TSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQK--QFVATV  2331

Query  1198  AENSPMGTPITRVFANDSDFTGNGNGLILFDIPYRKSRQNLFAIDSK-EGIVTTIGKLDY  1256
             +E +  GT + +V A DSD     N  + + I    +  N F I+    GIV T   LD 
Sbjct  2332  SEGNNKGTFVAQVHAFDSD--AGSNARLRYHI-VDGNHDNAFVIEPAFSGIVRTNIVLDR  2388

Query  1257  ESEKSHNITILASDLGSPSLSSTAILIVNIIDVPEDIKSIERPVFAHRYYEVEVEENVPV  1316
             E    + + I+A+D G P ++ TA + V I+DV ++     +P F      V V E   +
Sbjct  2389  EIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDN-----QPTFPPNNL-VTVSEATEL  2442

Query  1317  PLRVLTLNVTEPYRSHKLRYSIVAENSSDVKRT--FRIDPRNGSLYIIESPDREQKALYE  1374
                + +++  +      L Y + AE++ D++    F +D  +G L +    D E +  YE
Sbjct  2443  GAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYE  2502

Query  1375  L-IIRLDQYKVGRDMTVMIYPVTNERLGNLGLNEVKVIVRVTDVNDNAPKFTVTG-----  1428
             L +I  D     R +                     + VRV D NDNAP F         
Sbjct  2503  LDVIASDAAHEARTV---------------------LTVRVNDENDNAPVFLAQQPPAYF  2541

Query  1429  --RPMIAAIPTTANYGYNVIRLQATDPDL-GLNGEVRYQILSRADEASRRFAIDPVTGQV  1485
                P I+ I  + +  ++++ + ATD D  G N +V Y I    + A   F++ P  G V
Sbjct  2542  AILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYII----EPAQEGFSVHPSNGVV  2597


 Score = 216 bits (551),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 306/1213 (25%), Positives = 508/1213 (42%), Gaps = 217/1213 (18%)

Query  409   FTLDSRTGWLTVRDQTVLDREKRSTISMRVYAKEKVPSVVTSQLGASSVNIEVTLLDAND  468
               +D  TG   +R +  LDRE R++ S+           V   L   ++ + VT+ D ND
Sbjct  123   LAIDRATG--EIRTKVKLDRETRASYSL-----------VAIPLSGRNIRVLVTVKDEND  169

Query  469   NNPTFIPNNLY-EFIITTKAKKGDLVGQLHAIDPDLGRNGFVTYSIQKAPNSSIPFEVDT  527
             N PTF   +++ EF   T  +    +  L A D DL       Y+I    N +  F + +
Sbjct  170   NAPTFPQTSMHIEFPENTPREVKRTL--LPARDLDLEPYNTQRYNIVSG-NVNDAFRLSS  226

Query  528   KSGQIMVTQDDLQASEHL---------LFVEASDQPVNPSEKRSALAVVTVDIRDQNENR  578
                +  V   DLQ S  L         L +EA D    P         V + I+D N+N 
Sbjct  227   HRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLR---GFMTVNITIQDVNDN-  282

Query  579   EPDFIGAPYEFWVGGNVDIGTSVGQIRI--TEFNNMGTILYDL--LHSYHEGVPFAVEEK  634
             +P F  + Y   V  N  +GTSV Q+    T+ +  G + Y +    S  E + F ++ +
Sbjct  283   QPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQM-FRIDPR  341

Query  635   SGTITVVDDLNKFNRENYDFEAFVNNEGDLSLVTN--VTIHVVDPKDEK----TILMKTG  688
             +G I +   L+   +E ++      + G+  L T   V+I V D  D +     I +   
Sbjct  342   TGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDD  401

Query  689   TTPIEFHVKEN-EPNILIGKLGFKTNGTN----NLKFTIANQKDVTDHISITS-DGTLY-  741
              +P    + E+ +P   + ++      +     N+  T+ N  D   H ++T+ D ++Y 
Sbjct  402   ASP---KISESAQPGEFVARISVHDPDSKTEYANVNVTL-NGGD--GHFALTTRDNSIYL  455

Query  742   --TQKPLDRETRDIYRLTIIAEYNKGSVLGTGIYQVNVIVDDENDNKPLFERESYEGKIT  799
                  PLDRE    Y L+++A  +KG+        + + + D NDN P FE++ Y   + 
Sbjct  456   VIVHLPLDREIVSNYTLSVVAT-DKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVM  514

Query  800   ENSKSGTEVDLNYPIHVSDSDVGHNGQFTVTIF---GNGSEYFRLDRNLGKIQFTGANTP  856
             E +  GT V     +   D D G N   T ++       +++F++D   G I      + 
Sbjct  515   EVADPGTSV---LQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLIT---TRSH  568

Query  857   LDRETTSVYNLRLVATDEG--GLTSEAKLTIQVEDENDNSPLFVQ-FYLY----------  903
             +D ET  V  L +VA D G   L+S A + + + D NDN P+F Q FY            
Sbjct  569   IDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGR  628

Query  904   ---------PDKGIEVLQYDSTGSRVGH---FEEASNSTPGLFVLTQNFLR---------  942
                      PD G+  +   + G    H   FE  S S         +F R         
Sbjct  629   CILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVL  688

Query  943   -------------------------IRKPKEKISPLVSLPEDIAVGSS--VIKAIAEDKD  975
                                      +  P+E    L   P+  +  SS  ++  +A D D
Sbjct  689   ATDRGGLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPD  748

Query  976   DGENSVIKYEMVSETYIPNELSSAPFHIIQYFMVQPTTGEVVIAR----ALPAESEFRLN  1031
              G    + Y +V+     NE           F +  +TGE+ + R    ++  +    LN
Sbjct  749   YGNFGQVSYRIVAG----NEAG--------IFRIDRSTGEIFVVRPDMLSVRTQPMHMLN  796

Query  1032  ISATDKGGFKDHLS--VRITVRDVNDHPPVFKKSWYNFDAEEASYTRNTLGRIEATDADF  1089
             ISATD G  + +    V +++ D    PP+F+K+ YN+  +E       +G + A   D 
Sbjct  797   ISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDV  856

Query  1090  GSNANITYSI-KNNSTVPFSISPTTGALRVDGLLDRETQDKYSFVVVAK--DNPKSGKSL  1146
                + + YSI   +    FSI   +G +R+   LD E + +    + A   + P  G   
Sbjct  857   AHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVYGH--  914

Query  1147  SSSVNVEVNVLDINDNPPVFYGYDDLIPNPEANNFSNHNYQQKIPVYYATAAENSPMGTP  1206
              + VN+EV   D+NDN P F          EA+            +   +  E++ +G P
Sbjct  915   -TQVNIEVE--DVNDNAPEF----------EAS------------MVRISVPESAELGAP  949

Query  1207  ITRVFANDSDFTGNGNGLILFDIPYRKSRQNLFAIDSKEGIVTTIGKLDYESEKSHNITI  1266
             +    A+D D     +G + + +  ++S + LFAID++ G +     LDYES + H + +
Sbjct  950   LYAAHAHDKD--SGSSGQVTYSL-VKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIV  1006

Query  1267  LASDLGSPSLSSTAILIVNIIDVPEDIKSIERPVFAHRYYEVEVEENVPVPLRVLTLNVT  1326
              A+D G PSLS+   ++V++ DV ++      PVF    Y V V E+  +  +++ +N +
Sbjct  1007  TATDGGVPSLSTNLTILVDVQDVNDN-----PPVFEKDEYSVNVSESRSINAQIIQVNAS  1061

Query  1327  EPYRSHKLR--YSIV---------AENSSDVKRTFRIDPRNGSLYIIESPDREQKALYEL  1375
             +    +  R  Y IV         + +SSDV + F I P +G +Y+    DRE +  Y+L
Sbjct  1062  DLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQL  1121

Query  1376  IIRLDQYKVGRDMTVMIYPVTNERLGNLGLNEVKVIVRVTDVNDNAPKFTVTGRPMIAAI  1435
              +                 +  +        + +VIVRV D NDN PKF  +       I
Sbjct  1122  TV-----------------LATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEF--RI  1162

Query  1436  PTTANYGYNVIRLQATDPDLGLNGEVRYQILSRADEASRRFAIDPVTGQVRGISTFTKEA  1495
                   G  V  + A+D DLG N  +RY +L      +  F + PVTG++       +E 
Sbjct  1163  EENLRRGSVVGVVTASDLDLGENAAIRYSLLP----INSSFQVHPVTGEISTREPLDREL  1218

Query  1496  GKVFGFDVKATDR  1508
              +++   V+A D+
Sbjct  1219  RELYDLVVEARDQ  1231


 Score = 157 bits (396),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 280/1155 (24%), Positives = 471/1155 (41%), Gaps = 237/1155 (21%)

Query  116   TSSLSVTVYVEDINDHAPVFEGAPYHIDVDELTPVGLTVFRGIRAADHDKPNTPNSDVQY  175
             ++++ V + V DIND+ P+FE  PY   V  L   G T+ + ++A D D     N+++ Y
Sbjct  2038  SATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLK-VQALDADL--GANAEIVY  2094

Query  176   AIVAGNE--RGKFALESSHQAFLILRKSLDYDSGDRDFLLTITASDRGTPPKSTNATVRI  233
             ++ A N     KF +  S  A L   +SL  +SG +   L + A D+G PP+S+   + +
Sbjct  2095  SLNAENSAVSAKFRINPSTGA-LSASQSLASESG-KLLHLEVVARDKGNPPQSSLGLIEL  2152

Query  234   KVNDNDDLPP--KFTKGVYRTKIKEFYPITGARIHQRLKFNPSIHAFDQDLAIDSPIRYD  291
              + +     P  +F    YR  +KE  P +G R+ Q       + A   D      +++ 
Sbjct  2153  LIGEAPQGTPVLRFQNETYRVMLKENSP-SGTRLLQ-------VVALRSD-GRRQKVQFS  2203

Query  292   IIAGNERHLFSLDHVNGSLFLEREIDLD--------------------------------  319
               AGNE  + SLD ++G + + +   LD                                
Sbjct  2204  FGAGNEDGILSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDP  2263

Query  320   -----AERSLPGNTFVLQ----------IQASQMDNPLKTGVARVEVEIMDLNDNLPEFE  364
                  ++R+L  ++F L           + A   D P     A + +E+ D NDN P+F 
Sbjct  2264  NNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFS  2323

Query  365   VDFYNISIVENLPNGFSVLQIIATDQDQGDNAEFSYQLEDKS--GAFTLDSRTGWLTVRD  422
                +  ++ E    G  V Q+ A D D G NA   Y + D +   AF ++     + VR 
Sbjct  2324  QKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGI-VRT  2382

Query  423   QTVLDREKRSTISMRVYAK-EKVPSVVTSQLGASSVNIEVTLLDANDNNPTFIPNNLYEF  481
               VLDRE R    +++ A  E VP +        +  I V ++D NDN PTF PNNL   
Sbjct  2383  NIVLDREIRDIYKLKIIATDEGVPQMT------GTATIRVQIVDVNDNQPTFPPNNL--V  2434

Query  482   IITTKAKKGDLVGQLHAIDPD--------LGRNGFVTYSIQKAPNSSIPFEVDTKSGQIM  533
              ++   + G ++  + A D D        LG    V        N SI F +D  SG+++
Sbjct  2435  TVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIE-----NMSI-FALDRYSGKLV  2488

Query  534   VTQD---DLQASEHLLFVEASDQPVNPSEKRSALAVVTVDIRDQNENREPDFIGAPYEFW  590
             + +    +LQ  E+ L V ASD          A  V+TV + D+N+N        P  ++
Sbjct  2489  LKRRLDYELQ-QEYELDVIASDA------AHEARTVLTVRVNDENDNAPVFLAQQPPAYF  2541

Query  591   --------VGGNVDIGTSVGQIRITEFNNMGT---ILYDLLHSYHEGVPFAVEEKSGTIT  639
                     +  ++ +   +  +  T+ ++ G    ++Y ++    EG  F+V   +G ++
Sbjct  2542  AILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIY-IIEPAQEG--FSVHPSNGVVS  2598

Query  640   VVDDLNKFNRENYDFEAFVNNEGDLSLVTNVTIHVVDPKDEKTILMKT-----GTTPIEF  694
             V       +R     +  V++ GD   V  +      P  + + L++      G+   +F
Sbjct  2599  V-----NMSR----LQPAVSSSGDY-FVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQF  2648

Query  695   -------HVKENEP-NILIGKLGFKTNGTNNLKFTIANQKDVTDHISITSDGTLYTQKPL  746
                     + E  P   ++ +LG +     +L     N++       +     +   KPL
Sbjct  2649  LQNQYRAQISEAAPLGSVVLQLG-QDALDQSLAIIAGNEESA---FELLQSKAIVLVKPL  2704

Query  747   DRETRDIYRLTIIAEYNKG-----SVLGTGIYQVNVIVDDENDNKPLFERES-YEGKITE  800
             DRE  D+Y+L ++  +  G     S+  +    V + + D NDN P+F+R + YE +I+E
Sbjct  2705  DRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISE  2764

Query  801   NSKSGTEVDLNYPIHV-----SDSDVGHNGQFTVTIF-GNGSEYFRLDRNLGKIQFTGAN  854
              +       L Y I       +D +   N +    I  GN    F +D   G + F   N
Sbjct  2765  LAP------LRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTG-VLFV--N  2815

Query  855   TPLDRETTS-VYNLRLVATD---EGGLTSEAKLTIQVEDENDNSPLFVQFYLYPDKGIEV  910
               LD ++ +  Y L + A D   +  L S     +++ DENDN P F            +
Sbjct  2816  NRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKF-----------PL  2864

Query  911   LQYDSTGSRVGHFEEASNSTPGLFVLTQNFLRIRKPKEKISPLVSLPEDIAVGSSVIKAI  970
              +Y        HF                                L E+  VGSSV +A 
Sbjct  2865  TEY-------VHF--------------------------------LAENEPVGSSVFRAH  2885

Query  971   AEDKDDGENSVIKYEMVSETYIPNELSSAPFHIIQYFMVQPTTGEVVIARALPAESEFR-  1029
             A D D G    + Y +      P++ SS      + F V   +G V  A     E   R 
Sbjct  2886  ASDLDKGPFGQLNYSIGPA---PSDESS-----WKMFRVDSESGLVTSAFVFDYEQRQRY  2937

Query  1030  -LNISATDKGGFKDHLSVRITVRDVNDHPPVFKKSWYNF--DAEEASYTRNTLGRIEATD  1086
              + + A+D GG K  ++VR+ +   ++  P F +  Y F   A  A      +G++ ATD
Sbjct  2938  DMELLASDMGGKKASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATD  2997

Query  1087  ADFGSNANITYSIKNNSTVPFSISPTTGA------LRVDGLLDRET-QDKYSFVVVAKDN  1139
             +D G +  + Y +    +  F ++ ++GA      L++DG  D     D     +V   +
Sbjct  2998  SDSGPDGRVVYQLSAPHS-HFKVNRSSGAVLIKRKLKLDGDGDGNLYMDGRDISLVISAS  3056

Query  1140  PKSGKSLSSSVNVEV  1154
                  SLSS   VE+
Sbjct  3057  SGRHNSLSSMAVVEI  3071


 Score = 155 bits (393),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 225/834 (27%), Positives = 351/834 (42%), Gaps = 180/834 (22%)

Query  738   GTLYTQKPLDRETRDIYRLTIIAEYNKGSVLGTGIYQVNVIVDDENDNKPLFERESYEGK  797
             G + T+  LDRETR  Y L  I       + G  I +V V V DENDN P F + S   +
Sbjct  130   GEIRTKVKLDRETRASYSLVAIP------LSGRNI-RVLVTVKDENDNAPTFPQTSMHIE  182

Query  798   ITENSKSGTEVDLNYPIHVSDSDV-GHNGQFTVTIFGNGSEYFRLDRNLGK-------IQ  849
               EN+    +  L   +   D D+  +N Q    + GN ++ FRL  +  +       +Q
Sbjct  183   FPENTPREVKRTL---LPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQ  239

Query  850   FTGANTPLDRETTSVYNLRLVATDEGG--LTSEAKLTIQVEDENDNSPLFVQ---FYLYP  904
              +G    LDRETT  Y+L + A D G   L     + I ++D NDN P+F Q   F   P
Sbjct  240   ISGF---LDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVP  296

Query  905   DKGIEVLQYDSTGSRVGHFEEASNSTPGLFVLTQNFLRIRKPKEKISPLVSLPEDIAVGS  964
             +                      N+T G  VL                            
Sbjct  297   E----------------------NATVGTSVL----------------------------  306

Query  965   SVIKAIAEDKDDGENSVIKYEMVSETYIPNELSSAPFHIIQYFMVQPTTGEVVIARALPA  1024
                +  A D D  EN +++Y +       N   S      Q F + P TG + I +AL  
Sbjct  307   ---QVYASDTDADENGLVEYAI-------NRRQSDKE---QMFRIDPRTGAIYINKALDF  353

Query  1025  ESE--FRLNISATDKG--GFKDHLSVRITVRDVNDHPPVFKKSWYNFDA----EEASYTR  1076
             E++    L + A D G    +    V I V DVND+ P     + + DA     E++   
Sbjct  354   ETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPG  413

Query  1077  NTLGRIEATDADFG---SNANITYSIKNNSTVPFSISPTTGALR---VDGLLDRETQDKY  1130
               + RI   D D     +N N+T    N     F+++    ++    V   LDRE    Y
Sbjct  414   EFVARISVHDPDSKTEYANVNVTL---NGGDGHFALTTRDNSIYLVIVHLPLDREIVSNY  470

Query  1131  SFVVVAKDNPKSGKSLSSSVNVEVNVLDINDNPPVFYGYDDLIPNPEANNFSNHNYQQKI  1190
             +  VVA D  K    L +S ++ + + D+NDNPP F                    +Q +
Sbjct  471   TLSVVATD--KGTPPLHASKSIFLRITDVNDNPPEF--------------------EQDL  508

Query  1191  PVYYATAAENSPMGTPITRVFANDSDFTGNGNGLILFDIPYRKSRQNLFAIDSKEGIVTT  1250
               Y+A   E +  GT + +V A+D D  G  + L        ++    F ID + G++TT
Sbjct  509   --YHANVMEVADPGTSVLQVLAHDRD-EGLNSALTYSLAETPETHAQWFQIDPQTGLITT  565

Query  1251  IGKLDYESEKSHNITILASDLGSPSLSSTAILIVNIIDVPEDIKSIERPVFAHRYYEVEV  1310
                +D E+E    +T++A D G P LSSTA ++V I DV ++      P+F   +Y V V
Sbjct  566   RSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDN-----EPIFDQSFYNVSV  620

Query  1311  EENVPVPLRVLTLNVTEP--YRSHKLRYSIVAENSSDVKRTFRIDPRNGSLYIIESPDRE  1368
              EN PV   +L ++ ++P    +  + Y+I  E    +   F +   +G + I    D E
Sbjct  621   AENEPVGRCILKVSASDPDCGVNAMVNYTI-GEGFKHLTE-FEVRSASGEICIAGELDFE  678

Query  1369  QKALYELIIRLDQYKVGRDMTVMIYPVTNERLGNLGLNEVKVIVRVTDVNDNAPKF----  1424
             +++ YE                  +PV     G L    + + +++TDVNDN P F    
Sbjct  679   RRSSYE------------------FPVLATDRGGLSTTAM-IKMQLTDVNDNRPVFYPRE  719

Query  1425  -TVTGRPMIAAIPTTANYGYNVIRLQATDPDLGLNGEVRYQILSRADEASRRFAIDPVTG  1483
               V+ R    A  ++      ++ + ATDPD G  G+V Y+I++  +EA   F ID  TG
Sbjct  720   YKVSLRESPKA--SSQASSTPIVAVVATDPDYGNFGQVSYRIVA-GNEAG-IFRIDRSTG  775

Query  1484  QVRGI--STFTKEAGKVFGFDVKATD----RSGADDGKSSIANVFVYVLDEQKQ  1531
             ++  +     +     +   ++ ATD    RS AD      A VF+ ++D  ++
Sbjct  776   EIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNAD------AVVFLSIIDAMQR  823


 Score = 115 bits (288),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 272/1249 (22%), Positives = 470/1249 (38%), Gaps = 235/1249 (19%)

Query  121   VTVYVEDINDHAPVFEGAPYHIDVDELTPVGLTVFRGIRAADHDKPNTPNSDVQYAIVAG  180
             +T++VED ND+AP F+ + Y   V E  P+G +V + I A D D     N+ + Y++ A 
Sbjct  1938  ITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQ-ISAVDADL--GVNARLVYSL-AN  1993

Query  181   NERGKFALESSHQAFLILRKSLDYD-SGDRDFLLTITASDRGTPPKSTNATVRIKVNDND  239
               + +FA++        + K LD +     +F++  T   R    +S    V+I V D +
Sbjct  1994  ETQWQFAIDGQSGLITTVGK-LDRELQASYNFMVLATDGGR-YEVRSATVPVQINVLDIN  2051

Query  240   DLPPKFTKGVYRTKIKEFYPITGA--RIHQRLKFNPSIHAFDQDLAIDSPIRYDIIAGNE  297
             D  P F          E YP  G    + Q  +    + A D DL  ++ I Y + A N 
Sbjct  2052  DNRPIF----------ERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENS  2101

Query  298   --RHLFSLDHVNGSLFLEREIDLDAERSLPGNTFVLQIQASQMDNPLKTGVARVEVEIMD  355
                  F ++   G+L   + +      S  G    L++ A    NP ++ +  +E+ I +
Sbjct  2102  AVSAKFRINPSTGALSASQSL-----ASESGKLLHLEVVARDKGNPPQSSLGLIELLIGE  2156

Query  356   LNDNLP--EFEVDFYNISIVENLPNGFSVLQIIATDQD-QGDNAEFSYQLEDKSGAFTLD  412
                  P   F+ + Y + + EN P+G  +LQ++A   D +    +FS+   ++ G  +LD
Sbjct  2157  APQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSDGRRQKVQFSFGAGNEDGILSLD  2216

Query  413   SRTGWLTVRDQTVLDREKRSTISMRVYAKEK-----------------------------  443
             S +G + V    +LD ++ ST SM   ++ +                             
Sbjct  2217  SLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSS  2276

Query  444   ----------------VPSVVTSQLGASSVNIEVTLLDANDNNPTFIPNNLYEFIITTKA  487
                             V     +   AS   + + L D NDN+P F   +  +F+ T   
Sbjct  2277  SFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKF---SQKQFVATVSE  2333

Query  488   --KKGDLVGQLHAIDPDLGRNGFVTYSIQKAPNSSIPFEVDTKSGQIMVTQ---DDLQAS  542
                KG  V Q+HA D D G N  + Y I    N    F ++     I+ T    D     
Sbjct  2334  GNNKGTFVAQVHAFDSDAGSNARLRYHIVDG-NHDNAFVIEPAFSGIVRTNIVLDREIRD  2392

Query  543   EHLLFVEASDQPVNPSEKRSALAVVTVDIRDQNENREPDFIGAPYEF-WVGGNVDIGTSV  601
              + L + A+D+ V    + +  A + V I D N+N +P F   P     V    ++G  +
Sbjct  2393  IYKLKIIATDEGV---PQMTGTATIRVQIVDVNDN-QPTF--PPNNLVTVSEATELGAVI  2446

Query  602   GQIRITEFNNMGTILYDLLHSYHEGVP----FAVEEKSGTITVVDDLNKFNRENYDFEAF  657
               I   + +    + Y L       +     FA++  SG + +   L+   ++ Y+ +  
Sbjct  2447  TSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVI  2506

Query  658   VNNEGDLSLVTNVTIHVVDPKDEKTILMKTGTTPIEFHV----KENEPNILIGKLGFKTN  713
              ++    +  T +T+ V D  D   + +     P  F +     E   ++ +       N
Sbjct  2507  ASDAAHEAR-TVLTVRVNDENDNAPVFLAQ-QPPAYFAILPAISEISESLSVDFDLLTVN  2564

Query  714   GT------NNLKFTIANQKDVTDHISITSDGTLYTQ----KPLDRETRDIYRLTIIAEYN  763
              T      NN K     +          S+G +       +P    + D +   I  +  
Sbjct  2565  ATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAG  2624

Query  764   KGSVLGTGIYQVNVIVDDENDNKPLFERESYEGKITENSKSGTEVDLNYPIHVSDSDVGH  823
             K ++  + + +V    +D    +  F +  Y  +I+E +  G+ V            +G 
Sbjct  2625  KPALKSSTLLRVQA--NDNGSGRSQFLQNQYRAQISEAAPLGSVV----------LQLGQ  2672

Query  824   NG--QFTVTIFGNGSEYFRLDRNLGKIQFTGANTPLDRETTSVYNLRLVATDEGG-----  876
             +   Q    I GN    F L ++   +       PLDRE   +Y LRLV +   G     
Sbjct  2673  DALDQSLAIIAGNEESAFELLQSKAIVLVK----PLDRERNDLYKLRLVLSHPHGPPLIS  2728

Query  877   ---LTSEAKLTIQVEDENDNSPLFVQFYLYPDKGIEVLQYDSTGSRVGHFEEASNSTPGL  933
                 +S   + I + D NDN P+F                                    
Sbjct  2729  SLNSSSGISVIITILDANDNFPIFD-----------------------------------  2753

Query  934   FVLTQNFLRIRKPKEKISPLVSLPEDIAVGSSVIKAIAEDKDDGENSVIKYEMVSETYIP  993
                     R  K + +IS L  L   IA     ++AI  D+++  NS + Y++ S     
Sbjct  2754  --------RSAKYEAEISELAPLRYSIAQ----LQAIDADQENTPNSEVVYDITSGN---  2798

Query  994   NELSSAPFHIIQYFMVQPTTGEVVIARALPAES---EFRLNISATDKGGFKDHLSV---R  1047
             +E           F +   TG + +   L  +S    + L I A D    +   S+   R
Sbjct  2799  DE---------HMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFR  2849

Query  1048  ITVRDVNDHPPVFKKSWYNFDAEEASYTRNTLGRIEATDADFGSNANITYSI-----KNN  1102
             + + D ND+ P F  + Y     E     +++ R  A+D D G    + YSI       +
Sbjct  2850  LELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDES  2909

Query  1103  STVPFSISPTTGALRVDGLLDRETQDKYSFVVVAKDNPKSGKSLSSSVNVEVNVLDINDN  1162
             S   F +   +G +    + D E + +Y   ++A D    GK  S +V VE+        
Sbjct  2910  SWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASD--MGGKKASVAVRVEIE-------  2960

Query  1163  PPVFYGYDDLIPNPEANNFSNHNYQQKIPVYYATAAENSPMGTPITRVFANDSDFTGNGN  1222
                    D+  P      F+   Y+  +P     AA   P G  + +V A DSD   +G 
Sbjct  2961  -----SRDEFTPQ-----FTERTYRFVLP-----AAVALPQGYVVGQVTATDSDSGPDGR  3005

Query  1223  GLILFDIPYRKSRQNLFAIDSKEGIVTTIGKLDYESEKSHNITILASDL  1271
              +     P+       F ++   G V    KL  + +   N+ +   D+
Sbjct  3006  VVYQLSAPHSH-----FKVNRSSGAVLIKRKLKLDGDGDGNLYMDGRDI  3049


 Score = 115 bits (288),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 126/447 (28%), Positives = 198/447 (44%), Gaps = 57/447 (13%)

Query  109   DDGEDTITSSLSVTVYVEDINDHAPVFEGAPYHIDVDELTPVGLTVFR-GIRAADHDKPN  167
             D G+  + SS  + V   D       F    Y   + E  P+G  V + G  A D     
Sbjct  2622  DAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQ----  2677

Query  168   TPNSDVQYAIVAGNERGKFALESSHQAFLILRKSLDYDSGDRDFLLTITASDRGTPPKST  227
                     AI+AGNE   F L  S    ++L K LD +  D   L  + +   G P  S+
Sbjct  2678  ------SLAIIAGNEESAFELLQSKA--IVLVKPLDRERNDLYKLRLVLSHPHGPPLISS  2729

Query  228   NAT-----VRIKVNDNDDLPPKFTKGV-YRTKIKEFYPITGARIHQRLKFNPSIHAFDQD  281
               +     V I + D +D  P F +   Y  +I E  P+  + I Q    +      DQ+
Sbjct  2730  LNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYS-IAQLQAIDA-----DQE  2783

Query  282   LAIDSPIRYDIIAGNERHLFSLDHVNGSLFLEREIDLDAERSLPGNTFVLQIQA--SQMD  339
                +S + YDI +GN+ H+F++D V G LF+   +D D+       ++ L I+A  S   
Sbjct  2784  NTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSG----AKSYELIIRACDSHHQ  2839

Query  340   NPLKTGVARVEVEIMDLNDNLPEFEVDFYNISIVENLPNGFSVLQIIATDQDQGDNAEFS  399
              PL   +    +E+ D NDN P+F +  Y   + EN P G SV +  A+D D+G   + +
Sbjct  2840  RPL-CSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLN  2898

Query  400   YQL------EDKSGAFTLDSRTGWLTVRDQTVLDREKRSTISMRVYAKEKVPSVVTSQLG  453
             Y +      E     F +DS +G +T     V D E+R    M + A         S +G
Sbjct  2899  YSIGPAPSDESSWKMFRVDSESGLVT--SAFVFDYEQRQRYDMELLA---------SDMG  2947

Query  454   A--SSVNIEVTLLDANDNNPTFIPNNLYEFIITTKAK--KGDLVGQLHAIDPDLGRNGFV  509
                +SV + V +   ++  P F     Y F++       +G +VGQ+ A D D G +G V
Sbjct  2948  GKKASVAVRVEIESRDEFTPQFT-ERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRV  3006

Query  510   TYSIQKAPNSSIPFEVDTKSGQIMVTQ  536
              Y +  AP+S   F+V+  SG +++ +
Sbjct  3007  VYQL-SAPHSH--FKVNRSSGAVLIKR  3030


 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 187/759 (25%), Positives = 294/759 (39%), Gaps = 157/759 (21%)

Query  738   GTLYTQKPLDRETRDIYRLTIIAEYNKGSVLGTGIYQVNVIVDDENDNKPLFE-------  790
             G + T   LDRE RDIY+L IIA  ++G    TG   + V + D NDN+P F        
Sbjct  2378  GIVRTNIVLDREIRDIYKLKIIAT-DEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLVTV  2436

Query  791   RESYEGKITENSKSGTEVDLNYPIHVSDSDVGHNGQFTVTIFGNGSEYFRLDRNLGKIQF  850
              E+ E      S S  +VD  YP            + TV I       F LDR  GK+  
Sbjct  2437  SEATELGAVITSISANDVD-TYPALT----YRLGAESTVDI--ENMSIFALDRYSGKLVL  2489

Query  851   TGANTPLDRETTSVYNLRLVATDEGGLTSEAK--LTIQVEDENDNSPLFVQFYLYPDKGI  908
                   LD E    Y L ++A+D      EA+  LT++V DENDN+P+F+          
Sbjct  2490  ---KRRLDYELQQEYELDVIASDAA---HEARTVLTVRVNDENDNAPVFL----------  2533

Query  909   EVLQYDSTGSRVGHFEEASNSTPGLFVLTQNFLRIRKPKEKISPLVS-LPEDIAVGSSVI  967
                               +   P  F               I P +S + E ++V   ++
Sbjct  2534  ------------------AQQPPAYFA--------------ILPAISEISESLSVDFDLL  2561

Query  968   KAIAEDKD-DGENSVIKYEMVSETYIPNELSSAPFHIIQYFMVQPTTGEVVI--ARALPA  1024
                A D D +G NS + Y +                  + F V P+ G V +  +R  PA
Sbjct  2562  TVNATDADSEGNNSKVIYIIEPAQ--------------EGFSVHPSNGVVSVNMSRLQPA  2607

Query  1025  ES---EFRLNISATDKG--GFKDHLSVRITVRDVNDHPPVFKKSWYNFDAEEASYTRNTL  1079
              S   ++ + I A D G    K    +R+   D       F ++ Y     EA+     L
Sbjct  2608  VSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAA----PL  2663

Query  1080  GRIEATDADFGSNANITYSIKNNSTVPFSISPTTGALRVDGLLDRETQDKYSFVVVAKDN  1139
             G +         + ++   I  N    F +  +   + V  L DRE  D Y   +V   +
Sbjct  2664  GSVVLQLGQDALDQSLAI-IAGNEESAFELLQSKAIVLVKPL-DRERNDLYKLRLVLS-H  2720

Query  1140  PKS-----GKSLSSSVNVEVNVLDINDNPPVFYGYDDLIPNPEANNFSNHNYQQKIPVYY  1194
             P         + SS ++V + +LD NDN P+F                      +   Y 
Sbjct  2721  PHGPPLISSLNSSSGISVIITILDANDNFPIF---------------------DRSAKYE  2759

Query  1195  ATAAENSPMGTPITRVFANDSDFTGNGNGLILFDIPYRKSRQNLFAIDSKEGIVTTIGKL  1254
             A  +E +P+   I ++ A D+D     N  +++DI    + +++F ID   G++    +L
Sbjct  2760  AEISELAPLRYSIAQLQAIDADQENTPNSEVVYDI-TSGNDEHMFTIDLVTGVLFVNNRL  2818

Query  1255  DYES-EKSHNITILASDLGSPSLSSTAILIVNIIDVPEDIKSIERPVFAHRYYEVEVEEN  1313
             DY+S  KS+ + I A D    S     +  +    +    ++   P F    Y   + EN
Sbjct  2819  DYDSGAKSYELIIRACD----SHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAEN  2874

Query  1314  VPVPLRVLTLNVTE----PYRSHKLRYSI-VAENSSDVKRTFRIDPRNGSLYIIESPDRE  1368
              PV   V   + ++    P+   +L YSI  A +     + FR+D  +G +      D E
Sbjct  2875  EPVGSSVFRAHASDLDKGPF--GQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYE  2932

Query  1369  QKALYELIIRLDQYKVGRDMTVMIYPVTNERLGNLGLNEVKVIVRVT--DVNDNAPKFTV  1426
             Q+  Y             DM ++          ++G  +  V VRV     ++  P+FT 
Sbjct  2933  QRQRY-------------DMELLA--------SDMGGKKASVAVRVEIESRDEFTPQFTE  2971

Query  1427  TGRPMIAAIPTTANYGYNVIRLQATDPDLGLNGEVRYQI  1465
                  +         GY V ++ ATD D G +G V YQ+
Sbjct  2972  RTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQL  3010


 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 155/607 (26%), Positives = 262/607 (43%), Gaps = 52/607 (9%)

Query  97    RNVLKFKVTCDYDDGEDTITSSLSVTVYVEDINDHAPVFEGAPYH-IDVDELTPVGLTVF  155
             R++ K K+    D+G   +T + ++ V + D+ND+ P F   P + + V E T +G  V 
Sbjct  2391  RDIYKLKIIAT-DEGVPQMTGTATIRVQIVDVNDNQPTF--PPNNLVTVSEATELG-AVI  2446

Query  156   RGIRAADHDK-PNTPNSDVQYAIVAGNERGKFALESSHQAFLILRKSLDYDSGDRDFLLT  214
               I A D D  P         + V       FAL+  +   L+L++ LDY+   +++ L 
Sbjct  2447  TSISANDVDTYPALTYRLGAESTVDIENMSIFALD-RYSGKLVLKRRLDYEL-QQEYELD  2504

Query  215   ITASDRGTPPKSTNATVRIKVNDNDDLPPKFTKGVYRTKIKEFYPITGA--RIHQRLKFN  272
             + ASD     ++    + ++VND +D  P F       +   ++ I  A   I + L  +
Sbjct  2505  VIASDAAHEART---VLTVRVNDENDNAPVFLA----QQPPAYFAILPAISEISESLSVD  2557

Query  273   ---PSIHAFDQDL-AIDSPIRYDIIAGNERHLFSLDHVNG--SLFLEREIDLDAERSLPG  326
                 +++A D D    +S + Y I    E   FS+   NG  S+ + R   L    S  G
Sbjct  2558  FDLLTVNATDADSEGNNSKVIYIIEPAQEG--FSVHPSNGVVSVNMSR---LQPAVSSSG  2612

Query  327   NTFVLQIQASQMDNPLKTGVARVEVEIMDLNDNLPEFEVDFYNISIVENLPNGFSVLQII  386
             + FV +I A     P       + V+  D      +F  + Y   I E  P G  VLQ+ 
Sbjct  2613  DYFV-RIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQL-  2670

Query  387   ATDQDQGDNAEFSYQLEDKSGAFTLDSRTGWLTVRDQTVLDREKRSTISMR-VYAKEKVP  445
                QD  D +  +    ++  AF L      + V+    LDRE+     +R V +    P
Sbjct  2671  --GQDALDQS-LAIIAGNEESAFELLQSKAIVLVKP---LDRERNDLYKLRLVLSHPHGP  2724

Query  446   SVVTSQLGASSVNIEVTLLDANDNNPTFIPNNLYEFIITTKAKKGDLVGQLHAIDPDLGR  505
              +++S   +S +++ +T+LDANDN P F  +  YE  I+  A     + QL AID D   
Sbjct  2725  PLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQEN  2784

Query  506   --NGFVTYSIQKAPNSSIPFEVDTKSGQIMVTQD---DLQASEHLLFVEASDQPVNPSEK  560
               N  V Y I    N    F +D  +G + V      D  A  + L + A D   +    
Sbjct  2785  TPNSEVVYDITSG-NDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDS--HHQRP  2841

Query  561   RSALAVVTVDIRDQNENREPDFIGAPYEFWVGGNVDIGTSVGQIRITEFNN--MGTILYD  618
               +L    +++ D+N+N EP F    Y  ++  N  +G+SV +   ++ +    G + Y 
Sbjct  2842  LCSLQPFRLELHDENDN-EPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYS  2900

Query  619   LLHSYHEGVP---FAVEEKSGTITVVDDLNKFNRENYDFEAFVNNEGDLSLVTNVTIHVV  675
             +  +  +      F V+ +SG +T     +   R+ YD E   ++ G       V +  +
Sbjct  2901  IGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGGKKASVAVRVE-I  2959

Query  676   DPKDEKT  682
             + +DE T
Sbjct  2960  ESRDEFT  2966


 Score = 71.2 bits (173),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 133/566 (23%), Positives = 238/566 (42%), Gaps = 73/566 (13%)

Query  115   ITSSLSVTVYVEDINDHAPVFEGAPYHIDVDELTPVGLTVFRGIRAADHDKPNTPNSDVQ  174
             + S   + + +ED ND++P F    +   V E    G T    + A D D  +  N+ ++
Sbjct  2302  LASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKG-TFVAQVHAFDSDAGS--NARLR  2358

Query  175   YAIVAGNERGKFALESSHQAFLILRKSLDYDSGDRD-FLLTITASDRGTPPKSTNATVRI  233
             Y IV GN    F +E +     I+R ++  D   RD + L I A+D G P  +  AT+R+
Sbjct  2359  YHIVDGNHDNAFVIEPAFSG--IVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRV  2416

Query  234   KVNDNDDLPPKFTKG--VYRTKIKEFYPITGARIHQRLKFNPSIHAFDQDLAIDSPIRYD  291
             ++ D +D  P F     V  ++  E   +  +     +   P   A    L  +S +  +
Sbjct  2417  QIVDVNDNQPTFPPNNLVTVSEATELGAVITSISANDVDTYP---ALTYRLGAESTVDIE  2473

Query  292   IIAGNERHLFSLDHVNGSLFLEREIDLDAERSLPGNTFVLQIQASQMDNPLKTGVARVEV  351
              ++     +F+LD  +G L L+R +D + ++      + L + AS   +  +T +    V
Sbjct  2474  NMS-----IFALDRYSGKLVLKRRLDYELQQE-----YELDVIASDAAHEARTVLT---V  2520

Query  352   EIMDLNDNLPEFEVD----FYNI-----SIVENLPNGFSVLQIIATDQD-QGDNAEFSYQ  401
              + D NDN P F       ++ I      I E+L   F +L + ATD D +G+N++  Y 
Sbjct  2521  RVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYI  2580

Query  402   LEDKSGAFTLDSRTGWLTVRDQTVLDREKRSTIS-----MRVYAKEK-VPSVVTSQLGAS  455
             +E     F++    G ++V     + R + +  S     +R+ AK+   P++ +S L   
Sbjct  2581  IEPAQEGFSVHPSNGVVSVN----MSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTL---  2633

Query  456   SVNIEVTLLDANDNNPTFIPNNLYEFIITTKAKKGDLVGQLHAIDPDLGRNGFVTYSIQK  515
                + V   D       F+ N  Y   I+  A  G +V Q       LG++         
Sbjct  2634  ---LRVQANDNGSGRSQFLQNQ-YRAQISEAAPLGSVVLQ-------LGQDALDQSLAII  2682

Query  516   APNSSIPFEVDTKSGQIMVTQDDLQASE----HLLFVEASDQPVNPSEKRSALAVVTVDI  571
             A N    FE+      ++V   D + ++     L+       P+  S   S+   V + I
Sbjct  2683  AGNEESAFELLQSKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITI  2742

Query  572   RDQNENREPDFIGAPYEFWVGGNVDIGTSVGQIRITEFNNMGT----ILYDLLHSYHEGV  627
              D N+N       A YE  +     +  S+ Q++  + +   T    ++YD+     E +
Sbjct  2743  LDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHM  2802

Query  628   PFAVEEKSGTITVVDDLNKFNRENYD  653
              F ++  +G + V       NR +YD
Sbjct  2803  -FTIDLVTGVLFV------NNRLDYD  2821


>FAT_DROME unnamed protein product
Length=5147

 Score = 294 bits (752),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 371/1421 (26%), Positives = 626/1421 (44%), Gaps = 220/1421 (15%)

Query  109   DDGEDTITSSLSVTVYVEDINDHAPVFEGAPYHIDVDELTPVGLTVFRGIRAADHDKPNT  168
             D GE   ++   + + + D ND++PVF+   Y   V E   +G  V + + A D D+   
Sbjct  2252  DRGEPPQSTESQLLIRILDENDNSPVFDPKQYSASVAENASIGAMVLQ-VSATDVDE--G  2308

Query  169   PNSDVQYAIVAGNERGKFALESSHQAFLILRKSLDYDSGDRDFLLTITASDRGTP-PKST  227
              N  ++Y+IV G++   F++ S     + + K+L+Y+   R + LT+ A D     P   
Sbjct  2309  ANGRIRYSIVLGDQNHDFSI-SEDTGVVRVAKNLNYERLSR-YSLTVRAEDCALENPAGD  2366

Query  228   NATVRIKVNDNDDLPPKFTKGVYRTKIKE-FYPITGARIHQRLKFNPSIHAFDQDLA-ID  285
              A + I + D +D  P F    Y  ++ E   P  G  +        +++A+D D   ++
Sbjct  2367  TAELTINILDINDNRPTFLDSPYLARVMENTVPPNGGYVL-------TVNAYDADTPPLN  2419

Query  286   SPIRYDIIAGNERHLFSLDHVNGSLFLEREIDLDAERSLPGNTFVLQIQASQMDNPLKTG  345
             S +RY +  G+   LF ++  +G + L + +D + +     + + L + A    +P  TG
Sbjct  2420  SQVRYFLKEGDS-DLFRINASSGDIALLKPLDREQQ-----SEYTLTLVAMDTGSPPLTG  2473

Query  346   VARVEVEIMDLNDNLPEFEVDFYNISIVENLPNGFSVLQIIATDQDQGDNAEFSYQ-LED  404
                V VE+ D+NDN P FE+  Y+ ++ ENLP+G  VL   ATD+D+G NA+  +  L +
Sbjct  2474  TGIVRVEVQDINDNDPVFELQSYHATVRENLPSGTHVLTPRATDKDEGLNAKLRFNLLGE  2533

Query  405   KSGAFTLDSRTGWLTVRDQTVLDREKRSTISMRVYAKEKVPSVVTSQLGASSVNIEVTLL  464
                 F +DS TG ++    T LDRE+ S   + + A++   S +T +  ASSVN+ +++ 
Sbjct  2534  HMHRFHIDSETGEIST--ATTLDREETSVYHLTLMAQD---SSIT-EPRASSVNLTISVS  2587

Query  465   DANDNNPTFIPNNLYEFIITTKAKKGDLVGQLHAIDPDLGRNGFVTYSIQKAPNSSIPFE  524
             D NDN P F  +  Y   +  +  KG+ V    A+D D G N  V Y+I         F+
Sbjct  2588  DVNDNIPKF-DSTTYNVAVPERISKGEFVFGARALDLDDGENAVVHYTISGRDQHY--FD  2644

Query  525   VDTKSGQIMV---------TQDDLQASEHLLFVEASDQPVNPSEKRSALAVVTVDIRDQN  575
             ++TK+G +           + DDL    + + + A DQ       ++ L V+        
Sbjct  2645  INTKTGVVSTKLELKTKTKSHDDLT---YTIVISAMDQGEQSLSSKAELTVIL-------  2694

Query  576   ENREPDFIG-----APYEFWVGGNVDIGTSVGQIRITEFNN--MGTILYDLLHSYHEGVP  628
               R P+        A   F +  +V  G  + ++  T      +G I Y +      G  
Sbjct  2695  --RPPELFPTFAYMANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAIAGGIM-GDS  2751

Query  629   FAVEEKSGTITVVDDLNKFNRENYDFEAFVN-NEGD---LSLVTNVTIHVVDPKDEKTIL  684
               V+  SG ++V  D   +   +  +E ++   +GD   L  VT +T++V D  D   + 
Sbjct  2752  LRVDPNSGLLSVGQDGLDYELTHL-YEIWIEAADGDTPSLRSVTLITLNVTDANDNAPV-  2809

Query  685   MKTGTTPIEFHVKENEPNIL-IGKLGFKTNGTN-NLKFTIANQKDVTDHISITSDGTLYT  742
             M+      E   +E+ P ++ + K   + +G N N+ + + N  D T    IT  G +YT
Sbjct  2810  MEQLIYNAEVLEEESPPQLIAVVKASDRDSGDNGNVIYRLQNDFDGT--FEITESGEIYT  2867

Query  743   QKPLDRETRDIYRLTIIAEYNKGSVLGTGIYQVNVIVDDENDNKPLFERESYEGKITENS  802
             +  LDRE    Y   ++   ++G    TG   V + + D+NDN P F R  +   +TEN+
Sbjct  2868  RMRLDREEIGDYAF-VVEAVDQGVPHMTGTASVLLHLLDKNDNPPKFTR-LFSLNVTENA  2925

Query  803   KSGTEVDLNYPIHVSDSDVGHNGQFTVTIFGNGSEYFRLDRNLGKIQFTGANTPLDRETT  862
             + G+ V     +  SD D+G N   + +   N  E FR++   G I   G    LDRE  
Sbjct  2926  EIGSFV---IRVTSSDLDLGANANASYSFSENPGEKFRIEPQSGNITVAGH---LDREQQ  2979

Query  863   SVYNLRLVATDEGGLTSEAKLTIQVEDENDNSPLFVQ-FYLYPDKGIEVLQYDSTGSRVG  921
               Y L++VA+D G   +E  +TI ++D+NDN+P F   FY +                  
Sbjct  2980  DEYILKVVASD-GAWRAETPITITIQDQNDNAPEFEHSFYSF------------------  3020

Query  922   HFEEASNSTPGLFVLTQNFLRIRKPKEKISPLVSLPEDIAVGSSVIKAIAEDKD-DGENS  980
                                              S PE     + V + IA D+D  G NS
Sbjct  3021  ---------------------------------SFPELQQSIALVGQIIATDRDKQGPNS  3047

Query  981   VIKYEMVSETYIPNELSSAPFHIIQYFMVQPTTGEVVIARAL---------PAESEFRLN  1031
             VI Y +   + +              F + P TGEV   +A+           E+ + L 
Sbjct  3048  VISYSLQQPSPM--------------FSIDPATGEVFSKKAVRFKHSQYVRSPENMYALT  3093

Query  1032  ISATDKGG--FKDHLSVRITVRDVNDHPPVFKKSWYNFDAEEASYTRNTLGRIEATDA-D  1088
             + ATD G         V I + D +++PP F+++ Y     + +     + R+ A D  D
Sbjct  3094  VLATDNGKPPLYSECLVNINIVDAHNNPPKFEQAEYLAPLPQDAVRGQRIVRVHANDKQD  3153

Query  1089  FGSNANITYSIKN-NSTVPFSISPTTGALRVDGLLDRETQDKYSFVVVAKDNPKSGKSLS  1147
              G+N  + YS+   N +  FS+    G + +   +      +Y  VV A D     +S  
Sbjct  3154  LGTN-EMDYSLMTFNLSSIFSVGRHDGWITLVKPIQVPPNTRYELVVRATDRGVPPQSDE  3212

Query  1148  SSVNVEVNVLDINDNPPVFYGYDDLIPNPEANNFSNHNYQQKIPVYYATAAENSPMGTPI  1207
             + V + V   ++ D P                 FS ++YQ  +P       EN P+G+ I
Sbjct  3213  TRVVIVVTGENM-DTP----------------RFSVNSYQVIVP-------ENEPVGSTI  3248

Query  1208  TRVFANDSDFTGNGNGLILFDIPYRKSRQNLFAIDSKEGIVTTIGKLDYESEKSHNITIL  1267
               V A D D TG  NG++ + I     RQ+ F++D + G +    +LDY+  + +++ I 
Sbjct  3249  LTVGATDDD-TGP-NGMLRYSISGGNERQD-FSVDERTGGIVIQQQLDYDLIQEYHLNIT  3305

Query  1268  ASDLGSPSLSSTAILIVNIIDVPEDIKSIERPVFAHRYYEVEVEENVPVPLRVLTLNVT-  1326
               DLG   LSS A+L + + DV ++      PVF H+ Y   + EN PV   V   +   
Sbjct  3306  VQDLGYHPLSSVAMLTIILTDVNDN-----PPVFNHKEYHCYIPENKPVGTFVFQAHAAD  3360

Query  1327  -EPYRSHKLRYSIVAENSSDVKRTFRIDPRNGSLYIIESPDREQKALYELIIRLDQYKVG  1385
              +  ++  + Y+ +   S   +  F ++  NG++    S D E++ +Y L I+       
Sbjct  3361  KDSPKNAIIHYAFLP--SGPDRHFFIMNQSNGTISSAVSFDYEERRIYTLQIKAKNPDSS  3418

Query  1386  RDMTVMIYPVTNERLGNLGLNEVKVIVRVTDVNDNAPKFTVTGRPMIA-AIPTTANYGYN  1444
              +    +Y                  V V  VN+  P+F    +P+    +  T+  G  
Sbjct  3419  MESYANLY------------------VHVLGVNEFYPQFL---QPVFHFDVSETSAVGTR  3457

Query  1445  VIRLQATDPDLGLNGEVRYQILSRADEASRRFAIDPVTGQV  1485
             V  +QATD D G +G V Y ++  +++  + F ID  TG +
Sbjct  3458  VGAVQATDKDSGEDGRVYYLLVGSSND--KGFRIDTNTGLI  3496


 Score = 287 bits (734),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 377/1489 (25%), Positives = 649/1489 (44%), Gaps = 226/1489 (15%)

Query  121   VTVYVEDINDHAPVF----EGAPYHIDVDELTPVGLTVFRGIRAADHDKPNTPNSDVQYA  176
             V + + D+ND+APVF    E  P  I + E   VG  ++   R  D D     NS + Y+
Sbjct  928   VNIAIIDLNDNAPVFALDRESEPT-ISLPENAAVGQEIYLS-RVRDRDA--GVNSRISYS  983

Query  177   IVAGNERGKFALESSHQAFLILRKSLDYDSGDRDFLLTITASDRGTPPKSTNATVRIKVN  236
             +   N   +F +       L L++ +  + G     + + A+D G+PP S+  ++ + + 
Sbjct  984   LT-NNPNQQFRI-GPVTGVLYLQRPIRAEPGSL-IHVELMATDAGSPPLSSKLSLSVLIA  1040

Query  237   DNDDLPPKFTKGVYRTKIKEFYPITGARIHQRLKFNPSIHAFDQDLAIDSPIRYDIIAGN  296
             D +D  P F    Y T + E       +++ R     ++ A D DL  +  I Y+II GN
Sbjct  1041  DVNDHTPVFDHTSYETSLPET-----TKVNTRFF---ALAATDIDLGDNGRISYEIIEGN  1092

Query  297   ERHLFSLDHVNGSLFLEREIDLDAERSLPGNTFVLQIQASQMDNPLKTGVARVEVEIMDL  356
                +F +   +G LF+   +D + ER    + + L +       P ++ V  V + ++D 
Sbjct  1093  TERMFGV-FPDGYLFVRAPLDRE-ER----DYYALTVSCRDAGQPSRSSVVPVVIHVIDE  1146

Query  357   NDNLPEFEVDFYNISIVENLPNGFSVLQIIATDQDQGDNAEFSYQLEDKSGAFTLDSRTG  416
             NDN P+F    +  SI EN P    V ++ A D+D G NAE S+ L  ++  FT+D+R G
Sbjct  1147  NDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRDIGRNAELSFTLSSQTQDFTIDTRNG  1206

Query  417   WL-TVRDQTVLDREKRSTISMRVYAKEKVPSVVTSQLG-----------------ASSVN  458
             ++ T+R     DRE    +S    A  +  S+  S  G                    V 
Sbjct  1207  FIKTLRP---FDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVK  1263

Query  459   IEVTLLDANDNNPTFIPNNLYEFIITTKAKKGDLVGQLHAIDPDLGRNGFVTYSIQKAPN  518
             ++V + D NDN P F+    Y   I+  A +G  +  +   D D G NG V YS+ K  N
Sbjct  1264  VKVIVTDVNDNAPEFL-RAPYHVTISEGASEGTHITHVFTQDADEGLNGDVYYSLAKG-N  1321

Query  519   SSIPFEVDTKSGQIMVTQD-DLQASE-HLLFVEASDQPVNPSEKRSALAVVTVDIRDQNE  576
              +  F +D+ +GQ+ + +  D ++ E H L V A D  +      S+ A +T+ + D+N+
Sbjct  1322  EAGQFNLDSATGQLSLGRRLDRESQEIHHLIVVAKDAALK--HPLSSNASITIVVLDEND  1379

Query  577   NREPDFIGAPYEFWVGGNVDIGTSVGQIRITEFNN-MGTILYDLLHSYHEGVPFAVEEKS  635
             N  P+F  +  E  V      GT + + R ++ +  + + +   + + +    F ++  +
Sbjct  1380  N-APEFTQSSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISAGNRRDTFHIDSIT  1438

Query  636   GTITVVDDLNKFNRENYDFEAFVNNEGDLSLVTNV--TIHVVDPKDEKTILMKTGTTPIE  693
             G++ +   L+  +  +Y      ++ G  SL T V   + VVD  D   I   T    I 
Sbjct  1439  GSLYLHKPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPIFPSTA---IV  1495

Query  694   FHVKENEP---NILIGKLGFKTNGTNN-LKFTIANQKDVTD---HISI-TSDGTLYTQKP  745
               +KE  P    I+        +G N  + + I+ Q+       H  I T  G ++T + 
Sbjct  1496  RQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGINTETGVIHTLRE  1555

Query  746   LDRETRDIYRLTIIA-EYNKGSVLGTGIYQ-VNVIVDDENDNKPLF---ERESYEGKITE  800
             +DRE+ D +RLT++A +  + S       + V VIV+D NDN P+F          K + 
Sbjct  1556  IDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFST  1615

Query  801   NSKSGTEVDLNYPIHVSDSDVGHNGQFTVTIFGNGSEYFRLDRNLGKIQFTGANTPLDRE  860
             +  S T V     +H  D+D   NG  T  I     E F+L RN G I FT    P  ++
Sbjct  1616  SKGSSTAV---MQVHAKDADSSSNGLVTYEIVSGPQELFKLQRNTGIITFTPG--PQFKQ  1670

Query  861   TTSVYNLRLVATDEGGLTSEAKLTIQVEDENDNSPLFVQFYLYPDKGIEVLQYDSTGSRV  920
                 Y L L +TDE            V+ E  +S +++   + P  G        + S V
Sbjct  1671  EVR-YQLTLKSTDEA-----------VQSERRSSEVYITI-ITPGSG-------GSESSV  1710

Query  921   GHFEEASNSTPGLFVLTQNFLRIRKPKEKISPLVSLPEDIAVGSSVIKAIAEDKDDGENS  980
               FE+ S  +  ++                       E+  +G+S++   A       ++
Sbjct  1711  PQFEQRSKLSGSVY-----------------------ENEPIGTSILTVTAHLA----SA  1743

Query  981   VIKYEMVSETYIPNELSSAPFHIIQYFMVQPTTGEVVIARALPAES---EFRLNISATDK  1037
              I+Y + + T      + +   + + F +    G +  A  L  E+   E+ + + A   
Sbjct  1744  EIEYFVTNVT-----ATGSRGQVDRLFDIDAKLGILSTAAELDREAGPEEYEVEVYAIAL  1798

Query  1038  GG--FKDHLSVRITVRDVNDHPPVFKKSWYNFDAEEASYTRNTLGRIEATDADFGSNANI  1095
             GG        VR+TV D ND PP F  + + ++  E     +T+  + A D D  +  ++
Sbjct  1799  GGQPRTSRTKVRVTVLDKNDSPPQFLDTPFVYNVSEDLQIGHTISTLRAHDPD--TLGSV  1856

Query  1096  TYSIKNNSTVPFSISPTTGALRVDGLLDRETQDKYSFVVVAKDNPKSGKSLSSSVNVEVN  1155
             T+ + +     F + P+TG L ++  LDRET+ KY   +   D  +  ++ ++     + 
Sbjct  1857  TFLLMDGHDGKFLLEPSTGKLILNDTLDRETKSKYELRIRVSDGVQYTEAYAT-----IQ  1911

Query  1156  VLDINDNPPVFYGYDDLIPNPEANNFSNHNYQQKIPVYYATAAENSPMGTPITRVFANDS  1215
             V D NDNPP+F   +D +            Y   IP       EN+  G  + ++ A D+
Sbjct  1912  VSDTNDNPPLF---EDTV------------YSFDIP-------ENAQRGYQVGQIVARDA  1949

Query  1216  DFTGNGN---GLILFDIPYRKSRQNLFAIDSKEGIVTTIGKLDYESEKSHNITILASDLG  1272
             D   N     G++           ++F+++ + G++T   +LDYE  + + + + A D G
Sbjct  1950  DLGQNAQLSYGVV------SDWANDVFSLNPQTGMLTLTARLDYEEVQHYILIVQAQDNG  2003

Query  1273  SPSLSSTAILIVNIIDVPEDIKSIERPVFAHRYYEVEVEENVPVPLRVLTLNVTEPYRSH  1332
              PSLS+T  +  N++D+ ++      P+F    Y  EV ENVP+   V+T++  +    +
Sbjct  2004  QPSLSTTITVYCNVLDLNDNA-----PIFDPMSYSSEVFENVPIATEVVTVSAKDIDSGN  2058

Query  1333  K--LRYSIVAENSSDVKRTFRIDPRNGSLYIIESPDREQKALYELIIR----LDQY----  1382
                + YSI A    DV   F ID  NG++    + DRE ++ Y L +      D++    
Sbjct  2059  NGLIEYSITA---GDVDSEFGID-SNGTIRTRRNLDREHRSTYTLTVTARDCADEFASFS  2114

Query  1383  ---------------KVGRDMTVMIYPVTNERLGNLGLNEVKVIVRVTDVNDNAPKFTVT  1427
                            K  +     +     +RL +     VKV + + DVND  P F   
Sbjct  2115  ELEETQLKLKYRSPRKYQQTRQEFLAHQKQQRLSST----VKVTILIKDVNDEVPVFISA  2170

Query  1428  GRPMI---AAIPTTANYGYNVIRLQATDPDLGLNGEVRYQILSRADEASRR-----FAID  1479
                 I    AI T       VI ++A D D G NG + Y +    DE   +     F+++
Sbjct  2171  NETAIMENVAINTV------VIAVKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLPFSLN  2224

Query  1480  PVTGQVRGISTFTKEAGKVFGFDVKATDRSGADDGKSSIANVFVYVLDE  1528
             P  GQ+R +    +E    +  ++ A DR   +  +S+ + + + +LDE
Sbjct  2225  PTDGQLRVVDALDRELRSSYLLNITARDR--GEPPQSTESQLLIRILDE  2271


 Score = 281 bits (718),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 377/1404 (27%), Positives = 614/1404 (44%), Gaps = 179/1404 (13%)

Query  115   ITSSLSVTVYVEDINDHAPVFEGAPYHIDVDELTPVGLTVFRGIRAADHDKPNTPNSDVQ  174
             ++S+ S+T+ V D ND+AP F  +   + V E +P G  + R  RA+D D+    NS V 
Sbjct  1364  LSSNASITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELMR-FRASDADQ--GVNSQVV  1420

Query  175   YAIVAGNERGKFALESSHQAFLILRKSLDYDSGDRDFLLTITASDRGTPPKSTNATVRIK  234
             ++I AGN R  F ++S   + L L K LDY+     + L ITASD GTP  ST     + 
Sbjct  1421  FSISAGNRRDTFHIDSITGS-LYLHKPLDYED-ITSYTLNITASDCGTPSLSTTVLYNVL  1478

Query  235   VNDNDDLPPKFTKGVYRTKIKEFYPITGARIHQRLKFNPSIHAFDQDLAIDSPIRYDIIA  294
             V D++D PP F       +IKE  P+    +        ++ A D D  ++  + Y  I+
Sbjct  1479  VVDDNDNPPIFPSTAIVRQIKEGIPLKTPIV--------TVTADDPDSGLNGKVSY-AIS  1529

Query  295   GNERHL-----FSLDHVNGSLFLEREIDLDAERSLPGNTFVLQIQASQMDNPLKTGVAR-  348
               E  L     F ++   G +   REID ++      +TF L + A+    P +  ++  
Sbjct  1530  KQEPQLPQGRHFGINTETGVIHTLREIDRESI-----DTFRLTVVATDRAQPSERQLSTE  1584

Query  349   --VEVEIMDLNDNLPEFEVDFYNISIVENLPNGFS--------VLQIIATDQDQGDNAEF  398
               V V + D+NDN P F     N +I   LP  FS        V+Q+ A D D   N   
Sbjct  1585  KLVTVIVEDINDNAPVFVS--MNAAI---LPPKFSTSKGSSTAVMQVHAKDADSSSNGLV  1639

Query  399   SYQL-EDKSGAFTLDSRTGWLTVRDQTVLDREKRSTISMRVYAKEKVPSVVTSQLGASSV  457
             +Y++       F L   TG +T        +E R  ++++          V S+  +S V
Sbjct  1640  TYEIVSGPQELFKLQRNTGIITFTPGPQFKQEVRYQLTLK-----STDEAVQSERRSSEV  1694

Query  458   NIEVTLLDANDNNPTFIPNNLYEFIITTKAKKGDLVG-QLHAIDPDLGR---NGFVTYSI  513
              I + +   +  + + +P       ++    + + +G  +  +   L       FVT   
Sbjct  1695  YITI-ITPGSGGSESSVPQFEQRSKLSGSVYENEPIGTSILTVTAHLASAEIEYFVTNVT  1753

Query  514   QKAPNSSIP--FEVDTKSGQIMVTQD-DLQASEHLLFVEASDQPVNPSEKRSALAVVTVD  570
                    +   F++D K G +    + D +A      VE     +   + R++   V V 
Sbjct  1754  ATGSRGQVDRLFDIDAKLGILSTAAELDREAGPEEYEVEVYAIALG-GQPRTSRTKVRVT  1812

Query  571   IRDQNENREPDFIGAPYEFWVGGNVDIGTSVGQIRITEFNNMGTILYDLLHSYHEGVPFA  630
             + D+N++  P F+  P+ + V  ++ IG ++  +R  + + +G++ + LL   H+G  F 
Sbjct  1813  VLDKNDS-PPQFLDTPFVYNVSEDLQIGHTISTLRAHDPDTLGSVTF-LLMDGHDG-KFL  1869

Query  631   VEEKSGTITVVDDLNKFNRENYDFEAFVNNEGDLSLVTNVTIHVVDPKDEKTILMKTGTT  690
             +E  +G + + D L++  +  Y+    V+ +G        TI V D  D   +   T  +
Sbjct  1870  LEPSTGKLILNDTLDRETKSKYELRIRVS-DGVQYTEAYATIQVSDTNDNPPLFEDTVYS  1928

Query  691   PIEFHVKEN-EPNILIGKLGFK-TNGTNNLKFTIANQKD-VTDHISITSD-GTLYTQKPL  746
                F + EN +    +G++  +  +   N + +     D   D  S+    G L     L
Sbjct  1929  ---FDIPENAQRGYQVGQIVARDADLGQNAQLSYGVVSDWANDVFSLNPQTGMLTLTARL  1985

Query  747   DRETRDIYRLTIIAEYNKGSVLGTGIYQVNVIVDDENDNKPLFERESYEGKITENSKSGT  806
             D E    Y L + A+ N    L T I  V   V D NDN P+F+  SY  ++ EN    T
Sbjct  1986  DYEEVQHYILIVQAQDNGQPSLSTTI-TVYCNVLDLNDNAPIFDPMSYSSEVFENVPIAT  2044

Query  807   EVDLNYPIHVSDSDVGHNG--QFTVTIFGNGSEYFRLDRNLGKIQFTGANTPLDRETTSV  864
             EV     +   D D G+NG  ++++T  G+    F +D N G I+ T  N  LDRE  S 
Sbjct  2045  EV---VTVSAKDIDSGNNGLIEYSITA-GDVDSEFGIDSN-GTIR-TRRN--LDREHRST  2096

Query  865   YNLRLVATDEGGLTSEAKLTIQVEDENDNSPLFVQFYLYPDKGIEVLQYDSTGSRVGHFE  924
             Y L + A D               DE      F  F    +  ++ L+Y S        +
Sbjct  2097  YTLTVTARD-------------CADE------FASFSELEETQLK-LKYRSPRKYQQTRQ  2136

Query  925   E--ASNSTPGLFVLTQNFLRIRKPKEKISPLVS-----LPEDIAVGSSVIKAIAEDKDDG  977
             E  A      L    +  + I+   +++   +S     + E++A+ + VI   A D D+G
Sbjct  2137  EFLAHQKQQRLSSTVKVTILIKDVNDEVPVFISANETAIMENVAINTVVIAVKAVDNDEG  2196

Query  978   ENSVIKYEMVSETYIPNELSSAPFHIIQYFMVQPTTGEVVIARALPAE--SEFRLNISAT  1035
              N  I Y ++ E    +   S P      F + PT G++ +  AL  E  S + LNI+A 
Sbjct  2197  RNGYIDY-LMKEARDEDMGQSDPLP----FSLNPTDGQLRVVDALDRELRSSYLLNITAR  2251

Query  1036  DKGGFKDHLSVRITVR--DVNDHPPVFKKSWYNFDAEEASYTRNTLGRIEATDADFGSNA  1093
             D+G        ++ +R  D ND+ PVF    Y+    E +     + ++ ATD D G+N 
Sbjct  2252  DRGEPPQSTESQLLIRILDENDNSPVFDPKQYSASVAENASIGAMVLQVSATDVDEGANG  2311

Query  1094  NITYSI-KNNSTVPFSISPTTGALRVDGLLDRETQDKYSFVVVAKD----NPKSGKSLSS  1148
              I YSI   +    FSIS  TG +RV   L+ E   +YS  V A+D    NP        
Sbjct  2312  RIRYSIVLGDQNHDFSISEDTGVVRVAKNLNYERLSRYSLTVRAEDCALENPAG-----D  2366

Query  1149  SVNVEVNVLDINDNPPVFYGYDDLIPNPEANNFSNHNYQQKIPVYYATAAENS--PMGTP  1206
             +  + +N+LDINDN P F      + +P                Y A   EN+  P G  
Sbjct  2367  TAELTINILDINDNRPTF------LDSP----------------YLARVMENTVPPNGGY  2404

Query  1207  ITRVFANDSDFTGNGNGLILFDIPYRKSRQNLFAIDSKEGIVTTIGKLDYESEKSHNITI  1266
             +  V A D+D     + +  F    ++   +LF I++  G +  +  LD E +  + +T+
Sbjct  2405  VLTVNAYDADTPPLNSQVRYF---LKEGDSDLFRINASSGDIALLKPLDREQQSEYTLTL  2461

Query  1267  LASDLGSPSLSSTAILIVNIIDVPEDIKSIERPVFAHRYYEVEVEENVPVPLRVLTLNVT  1326
             +A D GSP L+ T I+ V + D+ ++      PVF  + Y   V EN+P    VLT   T
Sbjct  2462  VAMDTGSPPLTGTGIVRVEVQDINDN-----DPVFELQSYHATVRENLPSGTHVLTPRAT  2516

Query  1327  EPYR--SHKLRYSIVAENSSDVKRTFRIDPRNGSLYIIESPDREQKALYELIIRLDQYKV  1384
             +     + KLR++++ E+       F ID   G +    + DRE+ ++Y L +      +
Sbjct  2517  DKDEGLNAKLRFNLLGEH----MHRFHIDSETGEISTATTLDREETSVYHLTL------M  2566

Query  1385  GRDMTVMIYPVTNERLGNLGLNEVKVIVRVTDVNDNAPKFTVTGRPMIAAIPTTANYGYN  1444
              +D +     +T  R      + V + + V+DVNDN PKF  T   +  A+P   + G  
Sbjct  2567  AQDSS-----ITEPR-----ASSVNLTISVSDVNDNIPKFDSTTYNV--AVPERISKGEF  2614

Query  1445  VIRLQATDPDLGLNGEVRYQILSR  1468
             V   +A D D G N  V Y I  R
Sbjct  2615  VFGARALDLDDGENAVVHYTISGR  2638


 Score = 272 bits (696),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 407/1602 (25%), Positives = 667/1602 (42%), Gaps = 300/1602 (19%)

Query  97    RNVLKFKVTCDYDDGEDTITSSLSVTVYVEDINDHAPVFEGAPYHIDVDELTPVGLTVFR  156
             R+     V+C  D G+ + +S + V ++V D ND+AP F  + +   + E  P    V +
Sbjct  1116  RDYYALTVSC-RDAGQPSRSSVVPVVIHVIDENDNAPQFTNSTFTFSIPENAPADTFVGK  1174

Query  157   GIRAADHDKPNTPNSDVQYAIVAGNERGKFALESSHQAFLI------------------L  198
              + A D D             +  N    F L S  Q F I                  +
Sbjct  1175  -LTAVDRD-------------IGRNAELSFTLSSQTQDFTIDTRNGFIKTLRPFDREALV  1220

Query  199   RKSLDYDSGDRD-----------FLLTITASDRGTPPKSTNATVRIKVNDNDDLPPKFTK  247
             + S + ++   D            LL  T SD G P       V++ V D +D  P+F +
Sbjct  1221  KVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLR  1280

Query  248   GVYRTKIKEFYPITGARIHQRLKFNPSIHAFDQDL--AIDSPIRYDIIAGNERHLFSLDH  305
               Y   I E     GA     +      H F QD    ++  + Y +  GNE   F+LD 
Sbjct  1281  APYHVTISE-----GASEGTHIT-----HVFTQDADEGLNGDVYYSLAKGNEAGQFNLDS  1330

Query  306   VNGSLFLEREIDLDAERSLPGNTFVLQIQASQMDNPLKTGVARVEVEIMDLNDNLPEFEV  365
               G L L R +D +++     +  ++  + + + +PL +  A + + ++D NDN PEF  
Sbjct  1331  ATGQLSLGRRLDRESQEI---HHLIVVAKDAALKHPLSSN-ASITIVVLDENDNAPEFTQ  1386

Query  366   DFYNISIVENLPNGFSVLQIIATDQDQGDNAE--FSYQLEDKSGAFTLDSRTGWLTVRDQ  423
                 +S++E  P G  +++  A+D DQG N++  FS    ++   F +DS TG L +   
Sbjct  1387  SSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISAGNRRDTFHIDSITGSLYLHKP  1446

Query  424   TVLDREKRSTISMRVYAKE-KVPSVVTSQLGASSVNIEVTLLDANDNNPTFIPNNLYEFI  482
               LD E  ++ ++ + A +   PS+ T+ L        V ++D NDN P F    +   I
Sbjct  1447  --LDYEDITSYTLNITASDCGTPSLSTTVL------YNVLVVDDNDNPPIFPSTAIVRQI  1498

Query  483   ITTKAKKGDLVGQLHAIDPDLGRNGFVTYSIQKAPNSSIP----FEVDTKSGQIMVTQD-  537
                   K  +V  + A DPD G NG V+Y+I K     +P    F ++T++G I   ++ 
Sbjct  1499  KEGIPLKTPIV-TVTADDPDSGLNGKVSYAISKQ-EPQLPQGRHFGINTETGVIHTLREI  1556

Query  538   DLQASEHL-LFVEASDQPVNPSEKR-SALAVVTVDIRDQNENREPDFIGA-----PYEFW  590
             D ++ +   L V A+D+   PSE++ S   +VTV + D N+N  P F+       P +F 
Sbjct  1557  DRESIDTFRLTVVATDR-AQPSERQLSTEKLVTVIVEDINDN-APVFVSMNAAILPPKFS  1614

Query  591   VGGNVDIGTSVGQIRITEFNNMGTILYDLLHSYHEGVPFAVEEKSGTITVVDDLNKFNRE  650
                           +  + ++ G + Y+++    E   F ++  +G IT      +F +E
Sbjct  1615  TSKGSSTAVMQVHAKDADSSSNGLVTYEIVSGPQE--LFKLQRNTGIITFTPG-PQFKQE  1671

Query  651   -NYDFEAFVNNEGDLS--LVTNVTIHVVDPKD---EKTILMKTGTTPIEFHVKENEPNIL  704
               Y       +E   S    + V I ++ P     E ++      + +   V ENEP I 
Sbjct  1672  VRYQLTLKSTDEAVQSERRSSEVYITIITPGSGGSESSVPQFEQRSKLSGSVYENEP-IG  1730

Query  705   IGKLGFKTN-GTNNLKFTIAN------QKDVTDHISITSD-GTLYTQKPLDRETR-DIYR  755
                L    +  +  +++ + N      +  V     I +  G L T   LDRE   + Y 
Sbjct  1731  TSILTVTAHLASAEIEYFVTNVTATGSRGQVDRLFDIDAKLGILSTAAELDREAGPEEYE  1790

Query  756   LTIIAEYNKGSVLGTGIYQVNVIVDDENDNKPLFERESYEGKITENSKSGTEVDLNYPIH  815
             + + A    G    T   +V V V D+ND+ P F    +   ++E+ + G  +     + 
Sbjct  1791  VEVYA-IALGGQPRTSRTKVRVTVLDKNDSPPQFLDTPFVYNVSEDLQIGHTIST---LR  1846

Query  816   VSDSDVGHNGQFTVTIFGNGSEYFRLDRNLGKIQFTGANTPLDRETTSVYNLRLVATDEG  875
               D D    G  T  +       F L+ + GK+     N  LDRET S Y LR+  +D G
Sbjct  1847  AHDPDT--LGSVTFLLMDGHDGKFLLEPSTGKLIL---NDTLDRETKSKYELRIRVSD-G  1900

Query  876   GLTSEAKLTIQVEDENDNSPLF---VQFYLYPD---KGIEVLQYDSTGSRVGHFEEAS--  927
                +EA  TIQV D NDN PLF   V  +  P+   +G +V Q  +  + +G   + S  
Sbjct  1901  VQYTEAYATIQVSDTNDNPPLFEDTVYSFDIPENAQRGYQVGQIVARDADLGQNAQLSYG  1960

Query  928   ------------NSTPGLFVLT--------QNFLRIRKPKEKISPLVSLP----------  957
                         N   G+  LT        Q+++ I + ++   P +S            
Sbjct  1961  VVSDWANDVFSLNPQTGMLTLTARLDYEEVQHYILIVQAQDNGQPSLSTTITVYCNVLDL  2020

Query  958   -----------------EDIAVGSSVIKAIAEDKDDGENSVIKYEMVSETYIPNELSSAP  1000
                              E++ + + V+   A+D D G N +I+Y + +          + 
Sbjct  2021  NDNAPIFDPMSYSSEVFENVPIATEVVTVSAKDIDSGNNGLIEYSITAGDV------DSE  2074

Query  1001  FHIIQYFMVQPTTGEVVIARALPAE--SEFRLNISATD----------------------  1036
             F I        + G +   R L  E  S + L ++A D                      
Sbjct  2075  FGI-------DSNGTIRTRRNLDREHRSTYTLTVTARDCADEFASFSELEETQLKLKYRS  2127

Query  1037  -------KGGFKDH---------LSVRITVRDVNDHPPVFKKSWYNFDAEEASYTRNTLG  1080
                    +  F  H         + V I ++DVND  PVF  +      E  +     + 
Sbjct  2128  PRKYQQTRQEFLAHQKQQRLSSTVKVTILIKDVNDEVPVFISANETAIMENVAINTVVIA  2187

Query  1081  RIEATDADFGSNANITYSIK--------NNSTVPFSISPTTGALRVDGLLDRETQDKYSF  1132
              ++A D D G N  I Y +K         +  +PFS++PT G LRV   LDRE +  Y  
Sbjct  2188  -VKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLPFSLNPTDGQLRVVDALDRELRSSYLL  2246

Query  1133  VVVAKDNPKSGKSLSSSVNVEVNVLDINDNPPVFYGYDDLIPNPEANNFSNHNYQQKIPV  1192
              + A+D  +  +S  S   + + +LD NDN PVF        +P+               
Sbjct  2247  NITARDRGEPPQSTES--QLLIRILDENDNSPVF--------DPKQ--------------  2282

Query  1193  YYATAAENSPMGTPITRVFANDSDFTGNGNGLILFDIPYRKSRQNLFAIDSKEGIVTTIG  1252
             Y A+ AEN+ +G  + +V A D D     NG I + I       + F+I    G+V    
Sbjct  2283  YSASVAENASIGAMVLQVSATDVD--EGANGRIRYSIVLGDQNHD-FSISEDTGVVRVAK  2339

Query  1253  KLDYESEKSHNITILASD--LGSPSLSSTAILIVNIIDVPEDIKSIERPVFAHRYYEVEV  1310
              L+YE    +++T+ A D  L +P+   TA L +NI+D+ ++     RP F    Y   V
Sbjct  2340  NLNYERLSRYSLTVRAEDCALENPA-GDTAELTINILDINDN-----RPTFLDSPYLARV  2393

Query  1311  EENVPVP--LRVLTLNVTE---PYRSHKLRYSIVAENSSDVKRTFRIDPRNGSLYIIESP  1365
              EN   P    VLT+N  +   P  + ++RY  + E  SD+   FRI+  +G + +++  
Sbjct  2394  MENTVPPNGGYVLTVNAYDADTPPLNSQVRY-FLKEGDSDL---FRINASSGDIALLKPL  2449

Query  1366  DREQKALYELIIRLDQYKVGRDMTVMIYPVTNERLGNLGLNEVKVIVRVTDVNDNAPKFT  1425
             DREQ++ Y L             T++     +  L   G+    V V V D+NDN P F 
Sbjct  2450  DREQQSEYTL-------------TLVAMDTGSPPLTGTGI----VRVEVQDINDNDPVFE  2492

Query  1426  VTGRPMIAAIPTTANYGYNVIRLQATDPDLGLNGEVRYQILSRADEASRRFAIDPVTGQV  1485
             +  +   A +      G +V+  +ATD D GLN ++R+ +L    E   RF ID  TG++
Sbjct  2493  L--QSYHATVRENLPSGTHVLTPRATDKDEGLNAKLRFNLLG---EHMHRFHIDSETGEI  2547

Query  1486  RGISTFTKEAGKVFGFDVKATDRSGADDGKSSIANVFVYVLD  1527
                +T  +E   V+   + A D S  +   SS+ N+ + V D
Sbjct  2548  STATTLDREETSVYHLTLMAQDSSITEPRASSV-NLTISVSD  2588


 Score = 268 bits (686),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 368/1500 (25%), Positives = 631/1500 (42%), Gaps = 259/1500 (17%)

Query  125   VEDINDHAPVFEGAPYHIDVDELTPVGLTVFRGIRAADHDKPNTPNSDVQYAIVAGNERG  184
             + D+NDH PVF+   Y   + E T V  T F  + A D D  +  N  + Y I+ GN   
Sbjct  1039  IADVNDHTPVFDHTSYETSLPETTKVN-TRFFALAATDIDLGD--NGRISYEIIEGNTER  1095

Query  185   KFALESSHQAFLILRKSLDYDSGDRDFLLTITASDRGTPPKSTNATVRIKVNDNDDLPPK  244
              F +      +L +R  LD +  D  + LT++  D G P +S+   V I V D +D  P+
Sbjct  1096  MFGVFP--DGYLFVRAPLDREERDY-YALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQ  1152

Query  245   FTKGVYRTKIKEFYPITGARIHQRLKFNPSIHAFDQDLAIDSPIRYDIIAGNERHLFSLD  304
             FT   +   I E  P           F   + A D+D+  ++ + + +   ++   F++D
Sbjct  1153  FTNSTFTFSIPENAPAD--------TFVGKLTAVDRDIGRNAELSFTL--SSQTQDFTID  1202

Query  305   HVNGSLFLEREIDLDA-----------------ERSLPGNTFVLQIQASQMDNPLKTGVA  347
               NG +   R  D +A                   S+ GN  +L+   S    P      
Sbjct  1203  TRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKV  1262

Query  348   RVEVEIMDLNDNLPEFEVDFYNISIVENLPNGFSVLQIIATDQDQGDNAEFSYQLE--DK  405
             +V+V + D+NDN PEF    Y+++I E    G  +  +   D D+G N +  Y L   ++
Sbjct  1263  KVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHITHVFTQDADEGLNGDVYYSLAKGNE  1322

Query  406   SGAFTLDSRTGWLTVRDQTVLDREKRSTISMRVYAKEKVPSVVTSQLGASSVNIEVTLLD  465
             +G F LDS TG L++  +  LDRE +    + V AK+   + +   L +S+ +I + +LD
Sbjct  1323  AGQFNLDSATGQLSLGRR--LDRESQEIHHLIVVAKD---AALKHPL-SSNASITIVVLD  1376

Query  466   ANDNNPTFIPNNLYEFIITTKAKKGDLVGQLHAIDPDLGRNGFVTYSIQKAPNSSIPFEV  525
              NDN P F  ++    ++ T     +L+ +  A D D G N  V +SI  A N    F +
Sbjct  1377  ENDNAPEFTQSSSEVSVLETSPTGTELM-RFRASDADQGVNSQVVFSI-SAGNRRDTFHI  1434

Query  526   DTKSGQIMVTQ--DDLQASEHLLFVEASDQPVNPSEKRSALAVVTVDIRDQNENREPDFI  583
             D+ +G + + +  D    + + L + ASD    PS   + L  V V   D N+N  P F 
Sbjct  1435  DSITGSLYLHKPLDYEDITSYTLNITASDCGT-PSLSTTVLYNVLV--VDDNDN-PPIFP  1490

Query  584   GAPYEFWVGGNVDIGTSVGQIRITEFNNM--GTILYDLLH---SYHEGVPFAVEEKSGTI  638
                    +   + + T +  +   + ++   G + Y +        +G  F +  ++G I
Sbjct  1491  STAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGINTETGVI  1550

Query  639   TVVDDLNKFNRENYDFEAFVNN-----EGDLSLVTNVTIHVVDPKDEKTIL--MKTGTTP  691
               + ++++ + + +       +     E  LS    VT+ V D  D   +   M     P
Sbjct  1551  HTLREIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILP  1610

Query  692   IEFHVKENEPNILIGKLGFKTNGTNNLKFTIANQKDVTDHISITSDGTLYTQKPLDRETR  751
              +F   +     ++       + ++N   T        +   +  +  + T  P  +  +
Sbjct  1611  PKFSTSKGSSTAVMQVHAKDADSSSNGLVTYEIVSGPQELFKLQRNTGIITFTPGPQFKQ  1670

Query  752   DI-YRLTIIA--EYNKGSVLGTGIYQVNVIVDDENDNK---PLFE-RESYEGKITENSKS  804
             ++ Y+LT+ +  E  +     + +Y + +I      ++   P FE R    G + EN   
Sbjct  1671  EVRYQLTLKSTDEAVQSERRSSEVY-ITIITPGSGGSESSVPQFEQRSKLSGSVYENEPI  1729

Query  805   GTEVDLNYPIHVSDSDVGHNGQFTVTIFGNGS-----EYFRLDRNLGKIQFTGANTPLDR  859
             GT + L    H++ +++ +   F   +   GS       F +D  LG I  T A   LDR
Sbjct  1730  GTSI-LTVTAHLASAEIEY---FVTNVTATGSRGQVDRLFDIDAKLG-ILSTAAE--LDR  1782

Query  860   ET-TSVYNLRLVATDEGGL--TSEAKLTIQVEDENDNSPLFVQFYLYPDKGIEVLQYDST  916
             E     Y + + A   GG   TS  K+ + V D+ND+ P F+                  
Sbjct  1783  EAGPEEYEVEVYAIALGGQPRTSRTKVRVTVLDKNDSPPQFLD-----------------  1825

Query  917   GSRVGHFEEASNSTPGLFVLTQNFLRIRKPKEKISPLVSLPEDIAVGSSVIKAIAEDKDD  976
                          TP ++                    ++ ED+ +G ++    A D   
Sbjct  1826  -------------TPFVY--------------------NVSEDLQIGHTISTLRAHD---  1849

Query  977   GENSVIKYEMVSETYIPNELSSAPFHIIQ----YFMVQPTTGEVVIARALPAE--SEFRL  1030
                             P+ L S  F ++      F+++P+TG++++   L  E  S++ L
Sbjct  1850  ----------------PDTLGSVTFLLMDGHDGKFLLEPSTGKLILNDTLDRETKSKYEL  1893

Query  1031  NISATDKGGFKDHLSVRITVRDVNDHPPVFKKSWYNFDAEEASYTRNTLGRIEATDADFG  1090
              I  +D   + +  +  I V D ND+PP+F+ + Y+FD  E +     +G+I A DAD G
Sbjct  1894  RIRVSDGVQYTEAYAT-IQVSDTNDNPPLFEDTVYSFDIPENAQRGYQVGQIVARDADLG  1952

Query  1091  SNANITYSIKNN-STVPFSISPTTGALRVDGLLDRETQDKYSFVVVAKDNPKSGKSLSSS  1149
              NA ++Y + ++ +   FS++P TG L +   LD E    Y  +V A+DN +   SLS++
Sbjct  1953  QNAQLSYGVVSDWANDVFSLNPQTGMLTLTARLDYEEVQHYILIVQAQDNGQ--PSLSTT  2010

Query  1150  VNVEVNVLDINDNPPVFYGYDDLIPNPEANNFSNHNYQQKIPVYYATAAENSPMGTPITR  1209
             + V  NVLD+NDN P+F        +P +              Y +   EN P+ T +  
Sbjct  2011  ITVYCNVLDLNDNAPIF--------DPMS--------------YSSEVFENVPIATEVVT  2048

Query  1210  VFANDSDFTGNGNGLILFDIPYRKSRQNLFAIDSKEGIVTTIGKLDYESEKSHNITILAS  1269
             V A D D +GN NGLI + I       + F IDS  G + T   LD E   ++ +T+ A 
Sbjct  2049  VSAKDID-SGN-NGLIEYSI-TAGDVDSEFGIDSN-GTIRTRRNLDREHRSTYTLTVTAR  2104

Query  1270  DLG-------------------SP-----------------SLSSTAILIVNIIDVPEDI  1293
             D                     SP                  LSST  + + I DV +++
Sbjct  2105  DCADEFASFSELEETQLKLKYRSPRKYQQTRQEFLAHQKQQRLSSTVKVTILIKDVNDEV  2164

Query  1294  KSIERPVFAHRYYEVEVEENVPVPLRVLTLNVT--EPYRSHKLRYSIVAENSSDVKRT--  1349
                  PVF     E  + ENV +   V+ +     +  R+  + Y +      D+ ++  
Sbjct  2165  -----PVFISA-NETAIMENVAINTVVIAVKAVDNDEGRNGYIDYLMKEARDEDMGQSDP  2218

Query  1350  --FRIDPRNGSLYIIESPDREQKALYELIIRLDQYKVGRDMTVMIYPVTNERLGNLGLNE  1407
               F ++P +G L ++++ DRE ++ Y L I        RD           R       E
Sbjct  2219  LPFSLNPTDGQLRVVDALDRELRSSYLLNI------TARD-----------RGEPPQSTE  2261

Query  1408  VKVIVRVTDVNDNAPKFTVTGRPMIAAIPTTANYGYNVIRLQATDPDLGLNGEVRYQILS  1467
              ++++R+ D NDN+P F    +   A++   A+ G  V+++ ATD D G NG +RY I+ 
Sbjct  2262  SQLLIRILDENDNSPVFDP--KQYSASVAENASIGAMVLQVSATDVDEGANGRIRYSIV-  2318

Query  1468  RADEASRRFAIDPVTGQVRGISTFTKEAGKVFGFDVKATDRSGADDGKSSIANVFVYVLD  1527
                + +  F+I   TG VR       E    +   V+A D    ++     A + + +LD
Sbjct  2319  -LGDQNHDFSISEDTGVVRVAKNLNYERLSRYSLTVRAED-CALENPAGDTAELTINILD  2376


 Score = 268 bits (685),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 367/1478 (25%), Positives = 628/1478 (42%), Gaps = 220/1478 (15%)

Query  95    SPRNVLKFKVTCDYDDGEDTITSSLSVTVYVEDINDHAPVFEGAPYHIDVDELTPVGLTV  154
             SPR   + +        +  ++S++ VT+ ++D+ND  PVF  A     + E   +  TV
Sbjct  2127  SPRKYQQTRQEFLAHQKQQRLSSTVKVTILIKDVNDEVPVFISA-NETAIMENVAIN-TV  2184

Query  155   FRGIRAADHDKPNTPNSDVQYAIVAGNERGK-----FALESSHQAFLILRKSLDYDSGDR  209
                ++A D+D+      D         + G+     F+L  +     ++      D+ DR
Sbjct  2185  VIAVKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLPFSLNPTDGQLRVV------DALDR  2238

Query  210   D----FLLTITASDRGTPPKSTNATVRIKVNDNDDLPPKFTKGVYRTKIKEFYPITGARI  265
             +    +LL ITA DRG PP+ST + + I++ D +D  P F    Y   + E   I GA +
Sbjct  2239  ELRSSYLLNITARDRGEPPQSTESQLLIRILDENDNSPVFDPKQYSASVAENASI-GAMV  2297

Query  266   HQRLKFNPSIHAFDQDLAIDSPIRYDIIAGNERHLFSLDHVNGSLFLEREIDLDAERSLP  325
              Q       + A D D   +  IRY I+ G++ H FS+    G + + +  +L+ ER L 
Sbjct  2298  LQ-------VSATDVDEGANGRIRYSIVLGDQNHDFSISEDTGVVRVAK--NLNYER-LS  2347

Query  326   GNTFVLQIQASQMDNPLKTGVARVEVEIMDLNDNLPEFEVDFYNISIVENL--PNGFSVL  383
               +  ++ +   ++NP     A + + I+D+NDN P F    Y   ++EN   PNG  VL
Sbjct  2348  RYSLTVRAEDCALENP-AGDTAELTINILDINDNRPTFLDSPYLARVMENTVPPNGGYVL  2406

Query  384   QIIATDQDQGD-NAEFSYQL-EDKSGAFTLDSRTGWLTVRDQTVLDREKRSTISMRVYAK  441
              + A D D    N++  Y L E  S  F +++ +G + +     LDRE++S  ++ + A 
Sbjct  2407  TVNAYDADTPPLNSQVRYFLKEGDSDLFRINASSGDIALLKP--LDREQQSEYTLTLVAM  2464

Query  442   EKVPSVVTSQLGASSVNIEVTLLDANDNNPTFIPNNLYEFIITTKAKKGDLVGQLHAIDP  501
             +     +T   G   V +EV   D NDN+P F   + Y   +      G  V    A D 
Sbjct  2465  DTGSPPLT---GTGIVRVEVQ--DINDNDPVFELQS-YHATVRENLPSGTHVLTPRATDK  2518

Query  502   DLGRNGFVTYSIQKAPNSSIPFEVDTKSGQI--MVTQDDLQASEHLLFVEASDQPVNPSE  559
             D G N  + +++         F +D+++G+I    T D  + S + L + A D  +  +E
Sbjct  2519  DEGLNAKLRFNLLGEHMHR--FHIDSETGEISTATTLDREETSVYHLTLMAQDSSI--TE  2574

Query  560   KRSALAVVTVDIRDQNENREPDFIGAPYEFWVGGNVDIGTSVGQIRITEFNNMGTILYDL  619
              R++   +T+ + D N+N  P F    Y   V   +  G  V   R  + ++    +   
Sbjct  2575  PRASSVNLTISVSDVNDNI-PKFDSTTYNVAVPERISKGEFVFGARALDLDDGENAVVHY  2633

Query  620   LHSYHEGVPFAVEEKSGTITVVDDLNKFNRENYDF------EAFVNNEGDLSLVTNVTIH  673
               S  +   F +  K+G ++   +L    + + D        A    E  LS    +T+ 
Sbjct  2634  TISGRDQHYFDINTKTGVVSTKLELKTKTKSHDDLTYTIVISAMDQGEQSLSSKAELTVI  2693

Query  674   VVDPKDEKTILMKTGTTPIEFHVKEN-EPNILIGKLGF---KTNGTNNLKFTIANQKDVT  729
             +  P+   T      +    F + E+  P  +I K+     K      +++ IA    + 
Sbjct  2694  LRPPELFPTFAYMANS---HFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAIAGGI-MG  2749

Query  730   DHISITSDGTLYT--QKPLDRETRDIYRLTI-IAEYNKGSVLGTGIYQVNVIVDDENDNK  786
             D + +  +  L +  Q  LD E   +Y + I  A+ +  S+    +  +NV   D NDN 
Sbjct  2750  DSLRVDPNSGLLSVGQDGLDYELTHLYEIWIEAADGDTPSLRSVTLITLNVT--DANDNA  2807

Query  787   PLFERESYEGKITENSKSGTEVDLNYPIHVSDSDVGHNGQFTVTIFGNGSEYFRLDRNLG  846
             P+ E+  Y  ++ E       + +   +  SD D G NG     +  +    F +  + G
Sbjct  2808  PVMEQLIYNAEVLEEESPPQLIAV---VKASDRDSGDNGNVIYRLQNDFDGTFEITES-G  2863

Query  847   KIQFTGANTPLDRETTSVYNLRLVATDEG--GLTSEAKLTIQVEDENDNSPLFVQFYLYP  904
             +I        LDRE    Y   + A D+G   +T  A + + + D+NDN P F +     
Sbjct  2864  EIY---TRMRLDREEIGDYAFVVEAVDQGVPHMTGTASVLLHLLDKNDNPPKFTR-----  2915

Query  905   DKGIEVLQYDSTGSRVGHFEEASNSTPGLFVLTQNFLRIRKPKEKISPLVSLPEDIAVGS  964
                                         LF L                  ++ E+  +GS
Sbjct  2916  ----------------------------LFSL------------------NVTENAEIGS  2929

Query  965   SVIKAIAEDKDDGENSVIKYEMVSETYIPNELSSAPFHIIQYFMVQPTTGEVVIARALPA  1024
              VI+  + D D G N+   Y   SE   P E           F ++P +G + +A  L  
Sbjct  2930  FVIRVTSSDLDLGANANASYSF-SEN--PGE----------KFRIEPQSGNITVAGHLDR  2976

Query  1025  ES--EFRLNISATDKGGFKDHLSVRITVRDVNDHPPVFKKSWYNFDAEEASYTRNTLGRI  1082
             E   E+ L + A+D G ++    + IT++D ND+ P F+ S+Y+F   E   +   +G+I
Sbjct  2977  EQQDEYILKVVASD-GAWRAETPITITIQDQNDNAPEFEHSFYSFSFPELQQSIALVGQI  3035

Query  1083  EATDADF-GSNANITYSIKNNSTVPFSISPTTG------ALRVD-GLLDRETQDKYSFVV  1134
              ATD D  G N+ I+YS++  S + FSI P TG      A+R       R  ++ Y+  V
Sbjct  3036  IATDRDKQGPNSVISYSLQQPSPM-FSIDPATGEVFSKKAVRFKHSQYVRSPENMYALTV  3094

Query  1135  VAKDNPKSGKSLSSSVNVEVNVLDINDNPPVFYGYDDLIPNPEANNFSNHNYQQKIPVYY  1194
             +A DN K    L S   V +N++D ++NPP F   + L P P                  
Sbjct  3095  LATDNGK--PPLYSECLVNINIVDAHNNPPKFEQAEYLAPLP------------------  3134

Query  1195  ATAAENSPMGTPITRVFANDSDFTGNGN---GLILFDIPYRKSRQNLFAIDSKEGIVTTI  1251
                 +++  G  I RV AND    G       L+ F++       ++F++   +G +T +
Sbjct  3135  ----QDAVRGQRIVRVHANDKQDLGTNEMDYSLMTFNL------SSIFSVGRHDGWITLV  3184

Query  1252  GKLDYESEKSHNITILASDLGSPSLSSTAILIVNIIDVPEDIKSIERPVFAHRYYEVEVE  1311
               +       + + + A+D G P  S    +++ +       ++++ P F+   Y+V V 
Sbjct  3185  KPIQVPPNTRYELVVRATDRGVPPQSDETRVVIVVTG-----ENMDTPRFSVNSYQVIVP  3239

Query  1312  ENVPVPLRVLTLNVT--EPYRSHKLRYSIVAENSSDVKRTFRIDPRNGSLYIIESPDREQ  1369
             EN PV   +LT+  T  +   +  LRYSI   N    ++ F +D R G + I      +Q
Sbjct  3240  ENEPVGSTILTVGATDDDTGPNGMLRYSISGGNE---RQDFSVDERTGGIVI------QQ  3290

Query  1370  KALYELIIRLDQYKVGRDMTVMIYPVTNERLGNLGLNEVKVI-VRVTDVNDNAPKFTVTG  1428
             +  Y+LI    +Y +          +T + LG   L+ V ++ + +TDVNDN P F    
Sbjct  3291  QLDYDLI---QEYHLN---------ITVQDLGYHPLSSVAMLTIILTDVNDNPPVF--NH  3336

Query  1429  RPMIAAIPTTANYGYNVIRLQATDPDLGLNGEVRYQILSRADEASRRFAIDPVTGQVRGI  1488
             +     IP     G  V +  A D D   N  + Y  L    +    F ++   G +   
Sbjct  3337  KEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPD-RHFFIMNQSNGTISSA  3395

Query  1489  STFTKEAGKVFGFDVKATDRSGADDGKSSIANVFVYVL  1526
              +F  E  +++   +KA +    D    S AN++V+VL
Sbjct  3396  VSFDYEERRIYTLQIKAKN---PDSSMESYANLYVHVL  3430


 Score = 266 bits (680),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 365/1485 (25%), Positives = 641/1485 (43%), Gaps = 221/1485 (15%)

Query  119   LSVTVYVEDINDHAPVFEGAPYHIDVDELTPVGLTVFRGIRAADHDKPNTPNSDVQYAIV  178
             L V V + D+ND+ P+F+ + Y++ ++E    G  V   + A+D+D  +  NS + Y + 
Sbjct  254   LQVNVTILDVNDNPPIFDHSDYNVSLNETALPGTPVVT-VMASDNDLGD--NSKITYYLA  310

Query  179   AGNERGKF-----ALESSHQAFLILRKSLDYDSGDRDFLLTITASDRGTPPKSTNATVRI  233
                 +         + ++ +     + ++   +  +  + T+ A D G+P +     V +
Sbjct  311   ETEHQFTVNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSPRQDGRTYVTV  370

Query  234   KVNDNDDLPPKFTKGVYRTKIKEFYPITG--ARIHQRLKFNPSIHAF---DQDLAIDSPI  288
              + D +D  P  +   +R     F+P  G  A + +       + A    D D  ++   
Sbjct  371   NLLDTNDHDPIIS---FR-----FFPDGGKVATVDENAVNGTVVAAVAVKDSDSGLNGRT  422

Query  289   RYDIIAGNERHLFSLDHVNGSLFLEREIDLDAERSLPGNTFVLQIQASQMDNPLKTGVAR  348
                I++GNE   F L+       +     LD E       + L + A     P +T  A 
Sbjct  423   SVRIVSGNELGHFRLEEAADLHIVRVNGVLDREEI---GKYNLTVVAMDQGTPARTTTAH  479

Query  349   VEVEIMDLNDNLPEFEVDFYNISIVENLPNGFSVLQIIATDQDQGDNAEFSYQL--EDKS  406
             + +++ D+ND+ P FE   Y+  + E  P G  V  I ATD+D G NA+  Y +   ++ 
Sbjct  480   LIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDILSGNEL  539

Query  407   GAFTLDSRTGWLTVRDQTVLDREKRSTISMRVYAKEKVPSVVTSQLGASSVNIEVTLLDA  466
               F++D  TG +       LDRE R T+ + + A++  P+        +   ++V +LD 
Sbjct  540   KWFSMDPLTGLIVTTGP--LDREIRDTVELSISARDGGPNP-----KFAYTQLKVIILDE  592

Query  467   NDNNPTFIPNNLYEFIITTKAKKGDLVGQLHAIDPDLGRNGFVTYSIQKAPNSSIP--FE  524
             ND  P F         +   A    +V  + A D D G NG VT+++  +     P  F 
Sbjct  593   NDEAPQF-SQREQNVTLGEDAPPQTIVALMTATDHDQGTNGSVTFALAPSVERLYPLQFA  651

Query  525   VDTKSGQIMVTQ--DDLQASEHLLFVEASDQPVNPSEKRSALAVVTVDIRDQNENREPDF  582
             +D  +GQ+   +  D  + S++ + V A DQ       +SA A V +++ D N+N +P F
Sbjct  652   LDALTGQLTTRRPLDREKMSQYEISVIARDQ--GAPTPQSATATVWLNVADVNDN-DPQF  708

Query  583   IGAPYEFWVG---GNVDIGTSVGQIRI------TEFNNMGTILYDL-LHSYHEGVPFAVE  632
                 Y + +     ++ +   V + RI      ++ ++    L +  L S  EG+ F ++
Sbjct  709   YPRHYIYSLADDDDDIKLKKEVEKERILLHVTASDKDDGDNALIEYRLESGGEGL-FQLD  767

Query  633   EKSGTITVVDD--LNKFNRENYDFEAFVNNEGDLSLVTNVTIHVVDPKDEKTILMKTGTT  690
              +SG I++  D   +   + +Y       + G      +  + +V     K  +++ G  
Sbjct  768   ARSGAISLRGDAPASMHWKPHYKLLVSARDAGQRRSQQDAIVEIV--LKSKLEMLECGQA  825

Query  691   PI---EFHVKEN-------EPNILIGKLGFK-TNGTNN--LKFTIANQKDVTDHISI-TS  736
                  EF + E+       +PN  +G +  K TNG  N  +++ I  Q D   +  I T 
Sbjct  826   QAGGYEFQMVEDHEQQRNSQPNREVGIVQVKSTNGKANSHIEYDII-QGDRAQNFRIDTR  884

Query  737   DGTLYTQKPLDRETRDIYRLTIIAEYNKGSVLGT-----GIYQVNVIVDDENDNKPLF--  789
              G + T +PLDRE +  YRLTI+A  +  S         G   VN+ + D NDN P+F  
Sbjct  885   SGRITTARPLDREEQANYRLTILASSSSSSSAAASSVSYGQCIVNIAIIDLNDNAPVFAL  944

Query  790   ERESYEG-KITENSKSGTEVDLNYPIHVSDSDVGHNGQFTVTIFGNGSEYFRLDRNLGKI  848
             +RES     + EN+  G E+   Y   V D D G N + + ++  N ++ FR+    G +
Sbjct  945   DRESEPTISLPENAAVGQEI---YLSRVRDRDAGVNSRISYSLTNNPNQQFRIGPVTGVL  1001

Query  849   QFTGANTPLDRETTSVYNLRLVATDEG--GLTSEAKLTIQVEDENDNSPLF---------  897
                    P+  E  S+ ++ L+ATD G   L+S+  L++ + D ND++P+F         
Sbjct  1002  YL---QRPIRAEPGSLIHVELMATDAGSPPLSSKLSLSVLIADVNDHTPVFDHTSYETSL  1058

Query  898   -------VQFYLYPDKGIEVLQYDSTGSRVGHFEEASNSTPGLF-VLTQNFLRIRKP---  946
                     +F+      I++        R+  +E    +T  +F V    +L +R P   
Sbjct  1059  PETTKVNTRFFALAATDIDL----GDNGRIS-YEIIEGNTERMFGVFPDGYLFVRAPLDR  1113

Query  947   -------------------KEKISPLV--------------------SLPEDIAVGSSVI  967
                                +  + P+V                    S+PE+    + V 
Sbjct  1114  EERDYYALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQFTNSTFTFSIPENAPADTFVG  1173

Query  968   KAIAEDKDDGENSVIKYEMVSET----------YIPNELSSAPF---HIIQYFMVQPTTG  1014
             K  A D+D G N+ + + + S+T          +I    +  PF    +++       +G
Sbjct  1174  KLTAVDRDIGRNAELSFTLSSQTQDFTIDTRNGFIK---TLRPFDREALVKVSRNAEASG  1230

Query  1015  EVVIARALPAESEFRLNISATDKG--GFKDHLSVRITVRDVNDHPPVFKKSWYNFDAEEA  1072
             E    R   A +   L  + +D G    +D + V++ V DVND+ P F ++ Y+    E 
Sbjct  1231  EDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEG  1290

Query  1073  SYTRNTLGRIEATDADFGSNANITYSI-KNNSTVPFSISPTTGALRVDGLLDRETQDKYS  1131
             +     +  +   DAD G N ++ YS+ K N    F++   TG L +   LDRE+Q+ + 
Sbjct  1291  ASEGTHITHVFTQDADEGLNGDVYYSLAKGNEAGQFNLDSATGQLSLGRRLDRESQEIHH  1350

Query  1132  FVVVAKDNPKSGKSLSSSVNVEVNVLDINDNPPVFYGYDDLIPNPEANNFSNHNYQQKIP  1191
              +VVAKD       LSS+ ++ + VLD NDN P F      +                  
Sbjct  1351  LIVVAKDAALK-HPLSSNASITIVVLDENDNAPEFTQSSSEV------------------  1391

Query  1192  VYYATAAENSPMGTPITRVFANDSDFTGNGNGLILFDIPYRKSRQNLFAIDSKEGIVTTI  1251
                 +  E SP GT + R  A+D+D     N  ++F I    +R++ F IDS  G +   
Sbjct  1392  ----SVLETSPTGTELMRFRASDAD--QGVNSQVVFSIS-AGNRRDTFHIDSITGSLYLH  1444

Query  1252  GKLDYESEKSHNITILASDLGSPSLSSTAILIVNIIDVPEDIKSIERPVFAHRYYEVEVE  1311
               LDYE   S+ + I ASD G+PSLS+T +  V ++D  ++      P+F       +++
Sbjct  1445  KPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDN-----PPIFPSTAIVRQIK  1499

Query  1312  ENVPVPLRVLTLNVTEPYR--SHKLRYSIVAENSSDVK-RTFRIDPRNGSLYIIESPDRE  1368
             E +P+   ++T+   +P    + K+ Y+I  +     + R F I+   G ++ +   DRE
Sbjct  1500  EGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGINTETGVIHTLREIDRE  1559

Query  1369  QKALYEL-IIRLDQYKVGRDMTVMIYPVTNERLGNLGLNEVKVIVRVTDVNDNAPKFTVT  1427
                 + L ++  D+ +           ++ E+L         V V V D+NDNAP F   
Sbjct  1560  SIDTFRLTVVATDRAQPSERQ------LSTEKL---------VTVIVEDINDNAPVFVSM  1604

Query  1428  GRPMI-AAIPTTANYGYNVIRLQATDPDLGLNGEVRYQILSRADE  1471
                ++     T+      V+++ A D D   NG V Y+I+S   E
Sbjct  1605  NAAILPPKFSTSKGSSTAVMQVHAKDADSSSNGLVTYEIVSGPQE  1649


 Score = 218 bits (555),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 358/1497 (24%), Positives = 594/1497 (40%), Gaps = 243/1497 (16%)

Query  116   TSSLSVTVYVEDINDHAPVFEGAPYHIDVDELTPVGLTVFRGIRAADHDKPNTPNSDVQY  175
             T  + V + V D+ND++P F      I   E    G  +     A D D      +D QY
Sbjct  137   TYPIEVRIKVLDVNDNSPEFPEPSIAISFSESATSGTRLLLDA-ATDADVGENGVTD-QY  194

Query  176   AIVAGNERGKFAL-----ESSHQAFLILRKSLDYDSGDR-DFLLTITASDRGTPPKSTNA  229
              IVAGN   KF L      S   ++L L  + + D   R  + L I+A D G+PP+    
Sbjct  195   EIVAGNVDNKFRLVTTANPSGDTSYLHLETTGNLDRESRGSYQLNISARDGGSPPRFGYL  254

Query  230   TVRIKVNDNDDLPPKFTKGVYRTKIKEFYPITGARIHQRLKFNP--SIHAFDQDLAIDSP  287
              V + + D +D PP F    Y   + E            L   P  ++ A D DL  +S 
Sbjct  255   QVNVTILDVNDNPPIFDHSDYNVSLNE----------TALPGTPVVTVMASDNDLGDNSK  304

Query  288   IRYDIIAGNERHLFSLDHVNGSLFLEREIDL----DAERSLPGNTFVLQIQASQMDNPLK  343
             I Y +      H F+++   G +     ++     + + S    + V  + A    +P +
Sbjct  305   ITYYL--AETEHQFTVNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSPRQ  362

Query  344   TGVARVEVEIMDLNDNLPEFEVDFYN-----ISIVENLPNGFSVLQIIATDQDQGDNAEF  398
              G   V V ++D ND+ P     F+       ++ EN  NG  V  +   D D G N   
Sbjct  363   DGRTYVTVNLLDTNDHDPIISFRFFPDGGKVATVDENAVNGTVVAAVAVKDSDSGLNGRT  422

Query  399   SYQL--EDKSGAFTLDSRTGWLTVRDQTVLDREKRSTISMRVYAKEK-VPSVVTSQLGAS  455
             S ++   ++ G F L+       VR   VLDRE+    ++ V A ++  P+  T      
Sbjct  423   SVRIVSGNELGHFRLEEAADLHIVRVNGVLDREEIGKYNLTVVAMDQGTPARTT------  476

Query  456   SVNIEVTLLDANDNNPTFIPNNLYEFIITTKAKKGDLVGQLHAIDPDLGRNGFVTYSIQK  515
             + ++ + + D ND+ P F   + Y  +++  A  G  V  + A D D G N  V Y I  
Sbjct  477   TAHLIIDVNDVNDHEPVF-EKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDILS  535

Query  516   APNSSIPFEVDTKSGQIMVTQD-DLQASEHL-LFVEASDQPVNPSEKRSALAVVTVDIRD  573
               N    F +D  +G I+ T   D +  + + L + A D   NP    + L V+ +D  D
Sbjct  536   G-NELKWFSMDPLTGLIVTTGPLDREIRDTVELSISARDGGPNPKFAYTQLKVIILDEND  594

Query  574   QNENREPDFIGAPYEFWVGGNVDIGTSVGQIRITEFNNM--GTILYDLLHSYHEGVP--F  629
             +     P F        +G +    T V  +  T+ +    G++ + L  S     P  F
Sbjct  595   E----APQFSQREQNVTLGEDAPPQTIVALMTATDHDQGTNGSVTFALAPSVERLYPLQF  650

Query  630   AVEEKSGTITVVDDLNKFNRENYDFEAFVNNEGD---LSLVTNVTIHVVDPKDE------  680
             A++  +G +T    L++     Y+      ++G     S    V ++V D  D       
Sbjct  651   ALDALTGQLTTRRPLDREKMSQYEISVIARDQGAPTPQSATATVWLNVADVNDNDPQFYP  710

Query  681   KTILMKTGTTPIEFHVK---ENEPNILIGKLGFKTNGTNNL-KFTIANQKDVTDHISITS  736
             +  +        +  +K   E E  +L      K +G N L ++ + +  +    +   S
Sbjct  711   RHYIYSLADDDDDIKLKKEVEKERILLHVTASDKDDGDNALIEYRLESGGEGLFQLDARS  770

Query  737   DG-TLYTQKPLDRETRDIYRLTIIAEYNKGSVLGTGIYQVNVIVDDENDNKPLFERES--  793
                +L    P     +  Y+L +++  + G         V +++  + +     + ++  
Sbjct  771   GAISLRGDAPASMHWKPHYKL-LVSARDAGQRRSQQDAIVEIVLKSKLEMLECGQAQAGG  829

Query  794   YEGKITE------NSKSGTEVDLNYPIHVSDSDVGHNGQFTVTIF-GNGSEYFRLDRNLG  846
             YE ++ E      NS+   EV +   + V  ++   N      I  G+ ++ FR+D   G
Sbjct  830   YEFQMVEDHEQQRNSQPNREVGI---VQVKSTNGKANSHIEYDIIQGDRAQNFRIDTRSG  886

Query  847   KIQFTGANTPLDRETTSVYNLRLVATDEGGLT--------SEAKLTIQVEDENDNSPLFV  898
             +I       PLDRE  + Y L ++A+     +         +  + I + D NDN+P+F 
Sbjct  887   RIT---TARPLDREEQANYRLTILASSSSSSSAAASSVSYGQCIVNIAIIDLNDNAPVF-  942

Query  899   QFYLYPDKGIEVLQYDSTGSRVGHFEEASNSTPGLFVLTQNFLRIRKPKEKISPLVSLPE  958
                         L  +S                                    P +SLPE
Sbjct  943   -----------ALDRES-----------------------------------EPTISLPE  956

Query  959   DIAVGSSVIKAIAEDKDDGENSVIKYEMVSETYIPNELSSAPFHIIQYFMVQPTTGEVVI  1018
             + AVG  +  +   D+D G NS I Y + +    PN          Q F + P TG + +
Sbjct  957   NAAVGQEIYLSRVRDRDAGVNSRISYSLTNN---PN----------QQFRIGPVTGVLYL  1003

Query  1019  ARALPAE--SEFRLNISATDKG--GFKDHLSVRITVRDVNDHPPVFKKSWYNFDAEEASY  1074
              R + AE  S   + + ATD G       LS+ + + DVNDH PVF  + Y     E + 
Sbjct  1004  QRPIRAEPGSLIHVELMATDAGSPPLSSKLSLSVLIADVNDHTPVFDHTSYETSLPETTK  1063

Query  1075  TRNTLGRIEATDADFGSNANITYS-IKNNSTVPFSISPTTGALRVDGLLDRETQDKYSFV  1133
                    + ATD D G N  I+Y  I+ N+   F + P  G L V   LDRE +D Y+  
Sbjct  1064  VNTRFFALAATDIDLGDNGRISYEIIEGNTERMFGVFP-DGYLFVRAPLDREERDYYALT  1122

Query  1134  VVAKDNPKSGKSLSSSVNVEVNVLDINDNPPVFYGYDDLIPNPEANNFSNHNYQQKIPVY  1193
             V  +D  +   S SS V V ++V+D NDN P                F+N  +   IP  
Sbjct  1123  VSCRDAGQ--PSRSSVVPVVIHVIDENDNAP---------------QFTNSTFTFSIP--  1163

Query  1194  YATAAENSPMGTPITRVFANDSDFTGNGNGLILFDIPYRKSRQNLFAIDSKEGIVTTIGK  1253
                  EN+P  T + ++ A D D   N    + F +    S+   F ID++ G + T+  
Sbjct  1164  -----ENAPADTFVGKLTAVDRDIGRNAE--LSFTL---SSQTQDFTIDTRNGFIKTLRP  1213

Query  1254  LDYES-------------------EKSHNITIL---ASDLGSPSLSSTAILIVNIIDVPE  1291
              D E+                     + N  +L    SD G P L     + V + DV +
Sbjct  1214  FDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVND  1273

Query  1292  DIKSIERPVFAHRYYEVEVEENVPVP---LRVLTLNVTEPYRSHKLRYSIVAENSSDVKR  1348
             +      P F    Y V + E          V T +  E      + YS+   N +    
Sbjct  1274  NA-----PEFLRAPYHVTISEGASEGTHITHVFTQDADEGLNG-DVYYSLAKGNEAG---  1324

Query  1349  TFRIDPRNGSLYIIESPDREQKALYELIIRLDQYKVGRDMTVMIYPVTNERLGNLGLNEV  1408
              F +D   G L +    DRE + ++ LI+      V +D   + +P++         +  
Sbjct  1325  QFNLDSATGQLSLGRRLDRESQEIHHLIV------VAKD-AALKHPLS---------SNA  1368

Query  1409  KVIVRVTDVNDNAPKFTVTGRPMIAAIPTTANYGYNVIRLQATDPDLGLNGEVRYQILSR  1468
              + + V D NDNAP+FT +   +  ++  T+  G  ++R +A+D D G+N +V + I + 
Sbjct  1369  SITIVVLDENDNAPEFTQSSSEV--SVLETSPTGTELMRFRASDADQGVNSQVVFSISA-  1425

Query  1469  ADEASRR--FAIDPVTGQVRGISTFTKEAGKVFGFDVKATDRSGADDGKSSIANVFV  1523
                 +RR  F ID +TG +        E    +  ++ A+D        + + NV V
Sbjct  1426  ---GNRRDTFHIDSITGSLYLHKPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLV  1479


 Score = 208 bits (530),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 353/1443 (24%), Positives = 607/1443 (42%), Gaps = 203/1443 (14%)

Query  109   DDGEDTITSSLSVTVYVEDINDHAPVFEGAPYHIDVDELTPVGLTVFRGIRAADHDKPNT  168
             D G   +T +  V V V+DIND+ PVFE   YH  V E  P G  V    RA D D+   
Sbjct  2465  DTGSPPLTGTGIVRVEVQDINDNDPVFELQSYHATVRENLPSGTHVLTP-RATDKDE--G  2521

Query  169   PNSDVQYAIVAGNERGKFALESSHQAFLILRKSLDYDSGDRDFLLTITASDRG-TPPKST  227
              N+ +++ ++ G    +F ++S     +    +LD +     + LT+ A D   T P+++
Sbjct  2522  LNAKLRFNLL-GEHMHRFHIDS-ETGEISTATTLDREETSV-YHLTLMAQDSSITEPRAS  2578

Query  228   NATVRIKVNDNDDLPPKFTKGVYRTKIKEFYPITGARIHQRLKFNPSIHAFDQDLAIDSP  287
             +  + I V+D +D  PKF    Y   + E       RI  + +F     A D D   ++ 
Sbjct  2579  SVNLTISVSDVNDNIPKFDSTTYNVAVPE-------RI-SKGEFVFGARALDLDDGENAV  2630

Query  288   IRYDIIAGNERHLFSLDHVNGSLFLEREIDLDAERSLPGNTFVLQIQASQMDNPLKTGVA  347
             + Y  I+G ++H F ++   G +  + E+     +S    T+ + I A  MD   ++  +
Sbjct  2631  VHY-TISGRDQHYFDINTKTGVVSTKLELKTKT-KSHDDLTYTIVISA--MDQGEQSLSS  2686

Query  348   RVEVE-IMDLNDNLPEFE-VDFYNISIVENLPNGFSVLQIIATDQDQGDNAEFSYQLED-  404
             + E+  I+   +  P F  +   + ++ E++  G  + ++ AT   +G   +  Y +   
Sbjct  2687  KAELTVILRPPELFPTFAYMANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAIAGG  2746

Query  405   -KSGAFTLDSRTGWLTVRDQTVLDREKRSTISMRVYAKE-KVPSVVTSQLGASSVNIEVT  462
                 +  +D  +G L+V  Q  LD E      + + A +   PS+ +  L      I + 
Sbjct  2747  IMGDSLRVDPNSGLLSV-GQDGLDYELTHLYEIWIEAADGDTPSLRSVTL------ITLN  2799

Query  463   LLDANDNNPTFIPNNLYEFIITTKAKKGDLVGQLHAIDPDLGRNGFVTYSIQKAPNSSIP  522
             + DANDN P  +   +Y   +  +     L+  + A D D G NG V Y +Q   + +  
Sbjct  2800  VTDANDNAPV-MEQLIYNAEVLEEESPPQLIAVVKASDRDSGDNGNVIYRLQNDFDGT--  2856

Query  523   FEVDTKSGQIMVTQ--DDLQASEHLLFVEASDQPVNPSEKRSALAVVTVDIRDQNENREP  580
             FE+ T+SG+I      D  +  ++   VEA DQ V      +  A V + + D+N+N  P
Sbjct  2857  FEI-TESGEIYTRMRLDREEIGDYAFVVEAVDQGV---PHMTGTASVLLHLLDKNDN-PP  2911

Query  581   DFIGAPYEFWVGGNVDIGTSVGQIRITEFNNMGTILYDLLHSYHEGVPFAVEEKSGTITV  640
              F    +   V  N +IG+ V ++  ++ +           S + G  F +E +SG ITV
Sbjct  2912  KFTRL-FSLNVTENAEIGSFVIRVTSSDLDLGANANASYSFSENPGEKFRIEPQSGNITV  2970

Query  641   VDDLNKFNRENYDFEAFVNNEGDLSLVTNVTIHVVDPKDEKTILMKTGTTPIEFHVKENE  700
                L++  ++ Y  +  V ++G     T +TI + D  D       +  +   F   E +
Sbjct  2971  AGHLDREQQDEYILKV-VASDGAWRAETPITITIQDQNDNAPEFEHSFYS---FSFPELQ  3026

Query  701   PNI-LIGKL---GFKTNGTNNLKFTIANQKDVTDHISITSDGTLYTQKPLD-------RE  749
              +I L+G++        G N++      Q      I   + G ++++K +        R 
Sbjct  3027  QSIALVGQIIATDRDKQGPNSVISYSLQQPSPMFSIDPAT-GEVFSKKAVRFKHSQYVRS  3085

Query  750   TRDIYRLTIIAEYNKGSVLGTGIYQVNVIVDDENDNKPLFERESYEGKITENSKSGTEVD  809
               ++Y LT++A  N    L +    VN+ + D ++N P FE+  Y   + +++  G  + 
Sbjct  3086  PENMYALTVLATDNGKPPLYSECL-VNINIVDAHNNPPKFEQAEYLAPLPQDAVRGQRI-  3143

Query  810   LNYPIHVSD-SDVGHNGQFTVTIFGNGSEYFRLDRNLGKIQFTGANTPLDRETTSVYNLR  868
                 +H +D  D+G N      +  N S  F + R+ G I       P+     + Y L 
Sbjct  3144  --VRVHANDKQDLGTNEMDYSLMTFNLSSIFSVGRHDGWITLV---KPIQVPPNTRYELV  3198

Query  869   LVATDEGGLTSEAKLTIQVEDENDNSPLFVQFYLYPDKGIEVLQYDSTGSRVGHFEEASN  928
             + AT                                D+G+                  S+
Sbjct  3199  VRAT--------------------------------DRGVP---------------PQSD  3211

Query  929   STPGLFVLTQNFLRIRKPKEKI-SPLVSLPEDIAVGSSVIKAIAEDKDDGENSVIKYEMV  987
              T  + V+T     +  P+  + S  V +PE+  VGS+++   A D D G N +++Y + 
Sbjct  3212  ETRVVIVVTGE--NMDTPRFSVNSYQVIVPENEPVGSTILTVGATDDDTGPNGMLRYSIS  3269

Query  988   SETYIPNELSSAPFHIIQYFMVQPTTGEVVIARALPAE--SEFRLNISATDKG--GFKDH  1043
                   NE         Q F V   TG +VI + L  +   E+ LNI+  D G       
Sbjct  3270  GG----NER--------QDFSVDERTGGIVIQQQLDYDLIQEYHLNITVQDLGYHPLSSV  3317

Query  1044  LSVRITVRDVNDHPPVFKKSWYNFDAEEASYTRNTLGRIEATDADFGSNANITYSIKNNS  1103
               + I + DVND+PPVF    Y+    E       + +  A D D   NA I Y+   + 
Sbjct  3318  AMLTIILTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSG  3377

Query  1104  TVP----FSISPTTGALRVDGLLDRETQDKYSFVVVAKDNPKSGKSLSSSVNVEVNVLDI  1159
               P    F ++ + G +      D E +  Y+  + AK NP S  S+ S  N+ V+VL +
Sbjct  3378  --PDRHFFIMNQSNGTISSAVSFDYEERRIYTLQIKAK-NPDS--SMESYANLYVHVLGV  3432

Query  1160  NDNPPVFYGYDDLIPNPEANNFSNHNYQQKIPVYYATAAENSPMGTPITRVFANDSDFTG  1219
             N+  P F                        PV++   +E S +GT +  V A D D   
Sbjct  3433  NEFYPQFLQ----------------------PVFHFDVSETSAVGTRVGAVQATDKDSGE  3470

Query  1220  NGNGLILFDIPYRKSRQNLFAIDSKEGIVTTIGKLDYESEKSHNITILASDLGSPSLSST  1279
             +G    L       S    F ID+  G++     LD E++    +T++A + GS   + T
Sbjct  3471  DGRVYYLL---VGSSNDKGFRIDTNTGLIYVARHLDRETQNRVVLTVMAKNYGSIRGNDT  3527

Query  1280  --AILIVNIIDVPEDIKSIERPVFAHRYYEVEVEENVPVPLRVLTLNVTEP---YRSHKL  1334
               A +I++I D        + P F   YY   + E  PV  +V T+   +     ++++ 
Sbjct  3528  DEAQVIISIQD------GNDPPEFIKHYYTSTISEAAPVGTKVTTVKAIDKDVRTQNNQF  3581

Query  1335  RYSIVAENSSDVKRTFRIDPRNGSLYIIESPDREQKALYELIIRLDQYKVGRDMTVMIYP  1394
              YSI+  N   +K++F+ID + G +      DRE+ + Y L+I          +   + P
Sbjct  3582  SYSIINGN---LKQSFKIDVQTGEISTASRLDREETSTYNLVIGA--------IDTGLPP  3630

Query  1395  VTNERLGNLGLNEVKVIVRVTDVNDNAPKFTVTGRPMIAAIPTTANYGYNVIRLQATDPD  1454
              T             V + + DVNDN P FT  G  +   I      G +++ L A+DPD
Sbjct  3631  QTGS---------ATVHIELEDVNDNGPTFTPEG--LNGYISENEPAGTSIMTLIASDPD  3679

Query  1455  LGLN-GEVRYQILSRADEASRRFAIDPVTGQVRGISTFTKEAGKVFGFDVKATDRSGADD  1513
             L  N G   YQ++    ++    ++D  +G VR  ++F +E   +    ++  D SG   
Sbjct  3680  LPRNGGPFTYQLIGGKHKS--WLSVDRNSGVVRSTTSFDREMTPILEAIIEVED-SGKPK  3736

Query  1514  GKS  1516
              KS
Sbjct  3737  QKS  3739


 Score = 198 bits (503),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 340/1384 (25%), Positives = 575/1384 (42%), Gaps = 190/1384 (14%)

Query  207   GDRDFLLTITASDRGTPPKSTNATVRIKVNDNDDLPPKFTKGVYRTKIKEFYPITGARIH  266
             G RD    +  S + T P      VRIKV D +D  P+F +        E      A   
Sbjct  122   GMRDHYDLVVLSSQPTYP----IEVRIKVLDVNDNSPEFPEPSIAISFSE-----SATSG  172

Query  267   QRLKFNPSIHAFDQDLAIDSPI-RYDIIAGNERHLFSL-DHVNGS-----LFLEREIDLD  319
              RL  +    A D D+  +    +Y+I+AGN  + F L    N S     L LE   +LD
Sbjct  173   TRLLLDA---ATDADVGENGVTDQYEIVAGNVDNKFRLVTTANPSGDTSYLHLETTGNLD  229

Query  320   AERSLPGNTFVLQIQASQMDNPLKTGVARVEVEIMDLNDNLPEFEVDFYNISIVENLPNG  379
              E      ++ L I A    +P + G  +V V I+D+NDN P F+   YN+S+ E    G
Sbjct  230   RESR---GSYQLNISARDGGSPPRFGYLQVNVTILDVNDNPPIFDHSDYNVSLNETALPG  286

Query  380   FSVLQIIATDQDQGDNAEFSYQLEDKSGAFTLDSRTGWLTVRDQTVLDREKRSTISMRVY  439
               V+ ++A+D D GDN++ +Y L +    FT++  TG ++  ++  ++  +++ +     
Sbjct  287   TPVVTVMASDNDLGDNSKITYYLAETEHQFTVNPETGVISTTER--VNCPQQTNVKSSAS  344

Query  440   AKEKVPSVVTSQLGASSVN----IEVTLLDANDNNPT----FIPNNLYEFIITTKAKKGD  491
              K  V +V     G+   +    + V LLD ND++P     F P+      +   A  G 
Sbjct  345   QKSCVFTVFARDHGSPRQDGRTYVTVNLLDTNDHDPIISFRFFPDGGKVATVDENAVNGT  404

Query  492   LVGQLHAIDPDLGRNGFVTYSIQKAPNSSIPFEVDTKSGQIMVTQDDLQASEHL----LF  547
             +V  +   D D G NG  +  I    N    F ++  +   +V  + +   E +    L 
Sbjct  405   VVAAVAVKDSDSGLNGRTSVRIVSG-NELGHFRLEEAADLHIVRVNGVLDREEIGKYNLT  463

Query  548   VEASDQPVNPSEKRSALAVVTVDIRDQNENREPDFIGAPYEFWVGGNVDIGTSVGQIRIT  607
             V A DQ    +  R+  A + +D+ D N++ EP F  + Y   +      G+ V  I  T
Sbjct  464   VVAMDQ---GTPARTTTAHLIIDVNDVNDH-EPVFEKSEYSAVLSELAPTGSFVASITAT  519

Query  608   EFNNM--GTILYDLLHSYHEGVPFAVEEKSGTITVVDDLNKFNRENYDFEAFVNNEGDLS  665
             + +      + YD+L S +E   F+++  +G I     L++  R+  +      + G   
Sbjct  520   DEDTGVNAQVHYDIL-SGNELKWFSMDPLTGLIVTTGPLDREIRDTVELSISARDGGPNP  578

Query  666   --LVTNVTIHVVDPKDEKTILMKTGTTPIEFHVKENEPNILIGKLGFKTN---GTN-NLK  719
                 T + + ++D  DE     +         + E+ P   I  L   T+   GTN ++ 
Sbjct  579   KFAYTQLKVIILDENDEAPQFSQREQN---VTLGEDAPPQTIVALMTATDHDQGTNGSVT  635

Query  720   FTIANQKDVTDHISITSD---GTLYTQKPLDRETRDIYRLTIIAEYNKGSVLGTGIYQVN  776
             F +A   +    +    D   G L T++PLDRE    Y +++IA         +    V 
Sbjct  636   FALAPSVERLYPLQFALDALTGQLTTRRPLDREKMSQYEISVIARDQGAPTPQSATATVW  695

Query  777   VIVDDENDNKPLFERESYEGKITENS---KSGTEVD---LNYPIHVSDSDVGHNGQFTVT  830
             + V D NDN P F    Y   + ++    K   EV+   +   +  SD D G N      
Sbjct  696   LNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKERILLHVTASDKDDGDNALIEYR  755

Query  831   IFGNGSEYFRLDRNLGKIQFTGANTPLDRETTSVYNLRLVATDEGGLTSEAKLTIQVEDE  890
             +   G   F+LD   G I   G + P        Y L + A D G   S+    +++  +
Sbjct  756   LESGGEGLFQLDARSGAISLRG-DAPASMHWKPHYKLLVSARDAGQRRSQQDAIVEIVLK  814

Query  891   NDNSPLFVQFYLYPDKGIEVLQYDSTGSRVGHFEEASNSTPGLFVLTQNFLRIR--KPKE  948
             +                +E+L+     ++ G +E         F + ++  + R  +P  
Sbjct  815   SK---------------LEMLECGQ--AQAGGYE---------FQMVEDHEQQRNSQPNR  848

Query  949   KISPLVSLPEDIAVGSSVIKAIAEDKDDGENSVIKYEMVSETYIPNELSSAPFHIIQYFM  1008
             ++         + V S+  KA         NS I+Y+++      N            F 
Sbjct  849   EVGI-------VQVKSTNGKA---------NSHIEYDIIQGDRAQN------------FR  880

Query  1009  VQPTTGEVVIARALPAESE--FRLNI--------SATDKGGFKDHLSVRITVRDVNDHPP  1058
             +   +G +  AR L  E +  +RL I        SA           V I + D+ND+ P
Sbjct  881   IDTRSGRITTARPLDREEQANYRLTILASSSSSSSAAASSVSYGQCIVNIAIIDLNDNAP  940

Query  1059  VF---KKSWYNFDAEEASYTRNTLGRIEATDADFGSNANITYSIKNNSTVPFSISPTTGA  1115
             VF   ++S       E +     +      D D G N+ I+YS+ NN    F I P TG 
Sbjct  941   VFALDRESEPTISLPENAAVGQEIYLSRVRDRDAGVNSRISYSLTNNPNQQFRIGPVTGV  1000

Query  1116  LRVDGLLDRETQDKYSFVVVAKDNPKSGKSLSSSVNVEVNVLDINDNPPVFYGYDDLIPN  1175
             L +   +  E        ++A D       LSS +++ V + D+ND+ PV          
Sbjct  1001  LYLQRPIRAEPGSLIHVELMATD--AGSPPLSSKLSLSVLIADVNDHTPV----------  1048

Query  1176  PEANNFSNHNYQQKIPVYYATAAENSPMGTPITRVFANDSDFTGNGNGLILFDIPYRKSR  1235
                  F + +Y+  +P       E + + T    + A D D   NG   I ++I    + 
Sbjct  1049  -----FDHTSYETSLP-------ETTKVNTRFFALAATDIDLGDNGR--ISYEI-IEGNT  1093

Query  1236  QNLFAIDSKEGIVTTIGKLDYESEKSHNITILASDLGSPSLSSTAILIVNIIDVPEDIKS  1295
             + +F +   +G +     LD E    + +T+   D G PS SS   +++++ID     ++
Sbjct  1094  ERMFGV-FPDGYLFVRAPLDREERDYYALTVSCRDAGQPSRSSVVPVVIHVID-----EN  1147

Query  1296  IERPVFAHRYYEVEVEENVPVPLRVLTLNVTEP--YRSHKLRYSIVAENSSDVKRTFRID  1353
                P F +  +   + EN P    V  L   +    R+ +L +++ ++      + F ID
Sbjct  1148  DNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRDIGRNAELSFTLSSQT-----QDFTID  1202

Query  1354  PRNGSLYIIESPDREQKALYELIIRLDQYKVGRDMTVMI-----YPVTNERLGNLGL---  1405
              RNG +  +   DRE  AL +  +  +    G D ++       Y +    + + G+   
Sbjct  1203  TRNGFIKTLRPFDRE--ALVK--VSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRL  1258

Query  1406  -NEVKVIVRVTDVNDNAPKFTVTGRPMIAAIPTTANYGYNVIRLQATDPDLGLNGEVRYQ  1464
              ++VKV V VTDVNDNAP+F     P    I   A+ G ++  +   D D GLNG+V Y 
Sbjct  1259  QDKVKVKVIVTDVNDNAPEFLRA--PYHVTISEGASEGTHITHVFTQDADEGLNGDVYYS  1316

Query  1465  ILSRADEASRRFAIDPVTGQVRGISTFTKEAGKVFGFDVKATDRSGADDGKSSIANVFVY  1524
              L++ +EA  +F +D  TGQ+       +E+ ++    V A D +      SS A++ + 
Sbjct  1317  -LAKGNEAG-QFNLDSATGQLSLGRRLDRESQEIHHLIVVAKD-AALKHPLSSNASITIV  1373

Query  1525  VLDE  1528
             VLDE
Sbjct  1374  VLDE  1377


 Score = 194 bits (493),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 310/1298 (24%), Positives = 527/1298 (41%), Gaps = 192/1298 (15%)

Query  32    VRVPENLKVGEEVL---KIEVYPRNNLNLQPVDRDEDVHFFTYRDINRTTVSLLLAKSLE  88
             V VPE +  GE V     +++    N  +       D H+F   DIN  T + +++  LE
Sbjct  2603  VAVPERISKGEFVFGARALDLDDGENAVVHYTISGRDQHYF---DIN--TKTGVVSTKLE  2657

Query  89    DLVDNDSPRNVLKFKVTCDYDDGEDTITSSLSVTVYVEDINDHAPVFEGAPYHIDVDELT  148
                   S  ++    V    D GE +++S   +TV +            A  H  + E  
Sbjct  2658  LKTKTKSHDDLTYTIVISAMDQGEQSLSSKAELTVILRPPELFPTFAYMANSHFAMSEDV  2717

Query  149   PVGLTVFRGIRAADHDKPNTPNSDVQYAIVAGNERGKFALESSHQAFLILRKSLDYDSGD  208
               G  + + + A    K       ++YAI  G       ++ +     + +  LDY+   
Sbjct  2718  RPGKMITK-VSATSPKKGLV--GKIRYAIAGGIMGDSLRVDPNSGLLSVGQDGLDYELTH  2774

Query  209   RDFLLTITASDRGTPPKSTNATVRIKVNDNDDLPPKFTKGVYRTKIKEFYPITGARIHQR  268
               + + I A+D  TP   +   + + V D +D  P   + +Y  ++ E            
Sbjct  2775  L-YEIWIEAADGDTPSLRSVTLITLNVTDANDNAPVMEQLIYNAEVLEE--------ESP  2825

Query  269   LKFNPSIHAFDQDLAIDSPIRYDIIAGNERHLFSLDHVNGSLFLEREIDLDAERSLPGNT  328
              +    + A D+D   +  + Y +   +    F +   +G ++    +D    R   G+ 
Sbjct  2826  PQLIAVVKASDRDSGDNGNVIYRL-QNDFDGTFEITE-SGEIYTRMRLD----REEIGD-  2878

Query  329   FVLQIQASQMDNPLKTGVARVEVEIMDLNDNLPEFEVDFYNISIVENLPNGFSVLQIIAT  388
             +   ++A     P  TG A V + ++D NDN P+F    +++++ EN   G  V+++ ++
Sbjct  2879  YAFVVEAVDQGVPHMTGTASVLLHLLDKNDNPPKF-TRLFSLNVTENAEIGSFVIRVTSS  2937

Query  389   DQDQGDNAEFSYQLEDKSG-AFTLDSRTGWLTVRDQTVLDREKRSTISMRVYAKEKVPSV  447
             D D G NA  SY   +  G  F ++ ++G +TV     LDRE++    ++V A +     
Sbjct  2938  DLDLGANANASYSFSENPGEKFRIEPQSGNITVAGH--LDREQQDEYILKVVASDGAWRA  2995

Query  448   VTSQLGASSVNIEVTLLDANDNNPTFIPNNLYEFIITTKAKKGDLVGQLHAIDPD-LGRN  506
              T         I +T+ D NDN P F  ++ Y F      +   LVGQ+ A D D  G N
Sbjct  2996  ETP--------ITITIQDQNDNAPEF-EHSFYSFSFPELQQSIALVGQIIATDRDKQGPN  3046

Query  507   GFVTYSIQKAPNSSIPFEVDTKSGQIMVTQ-------DDLQASEHL--LFVEASDQPVNP  557
               ++YS+Q+    S  F +D  +G++   +         +++ E++  L V A+D    P
Sbjct  3047  SVISYSLQQP---SPMFSIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPP  3103

Query  558   SEKRSALAVVTVDIRDQNENREPDFIGAPYEFWVGGNVDIGTSVGQIRITEFNNMGTILY  617
                     +V ++I D + N  P F  A Y   +  +   G  + ++   +  ++GT   
Sbjct  3104  LYSE---CLVNINIVDAHNN-PPKFEQAEYLAPLPQDAVRGQRIVRVHANDKQDLGTNEM  3159

Query  618   DL-LHSYHEGVPFAVEEKSGTITVVDDLNKFNRENYDFEAFVNNEGDLSLVTNVTIHVVD  676
             D  L +++    F+V    G IT+V  +       Y+            LV   T   V 
Sbjct  3160  DYSLMTFNLSSIFSVGRHDGWITLVKPIQVPPNTRYE------------LVVRATDRGVP  3207

Query  677   PKDEKT--ILMKTGT---TP------IEFHVKENEP---NIL-IGKLGFKTNGTNNLKFT  721
             P+ ++T  +++ TG    TP       +  V ENEP    IL +G     T     L+++
Sbjct  3208  PQSDETRVVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILTVGATDDDTGPNGMLRYS  3267

Query  722   IANQKDVTDHISITSDGTLYTQKPLDRETRDIYRLTIIAEYNKGSVLGTGIYQVNVIVDD  781
             I+   +  D       G +  Q+ LD +    Y L I  + + G    + +  + +I+ D
Sbjct  3268  ISGGNERQDFSVDERTGGIVIQQQLDYDLIQEYHLNITVQ-DLGYHPLSSVAMLTIILTD  3326

Query  782   ENDNKPLFERESYEGKITENSKSGTEVDLNYPIHVSDSDVGHNGQFTVTIFGNGSE--YF  839
              NDN P+F  + Y   I EN   GT V   +  H +D D   N         +G +  +F
Sbjct  3327  VNDNPPVFNHKEYHCYIPENKPVGTFV---FQAHAADKDSPKNAIIHYAFLPSGPDRHFF  3383

Query  840   RLDRNLGKIQFTGANTPLDRETTSVYNLRLVATD-EGGLTSEAKLTIQVEDENDNSPLFV  898
              ++++ G I    +    D E   +Y L++ A + +  + S A L + V   N+  P F+
Sbjct  3384  IMNQSNGTIS---SAVSFDYEERRIYTLQIKAKNPDSSMESYANLYVHVLGVNEFYPQFL  3440

Query  899   QFYLYPDKGIEVLQYDSTGSRVGHFEEASNSTPGLFVLTQNFLRIRKPKEKISPLVSLPE  958
             Q                    V HF+ +  S                             
Sbjct  3441  Q-------------------PVFHFDVSETS-----------------------------  3452

Query  959   DIAVGSSVIKAIAEDKDDGENSVIKYEMVSETYIPNELSSAPFHIIQYFMVQPTTGEVVI  1018
               AVG+ V    A DKD GE+  + Y +V  +   N+         + F +   TG + +
Sbjct  3453  --AVGTRVGAVQATDKDSGEDGRVYYLLVGSS---ND---------KGFRIDTNTGLIYV  3498

Query  1019  ARALPAESEFR--LNISATDKGGFK----DHLSVRITVRDVNDHPPVFKKSWYNFDAEEA  1072
             AR L  E++ R  L + A + G  +    D   V I+++D ND PP F K +Y     EA
Sbjct  3499  ARHLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGND-PPEFIKHYYTSTISEA  3557

Query  1073  SYTRNTLGRIEATDADFGSNAN-ITYSIKN-NSTVPFSISPTTGALRVDGLLDRETQDKY  1130
             +     +  ++A D D  +  N  +YSI N N    F I   TG +     LDRE    Y
Sbjct  3558  APVGTKVTTVKAIDKDVRTQNNQFSYSIINGNLKQSFKIDVQTGEISTASRLDREETSTY  3617

Query  1131  SFVVVAKDNPKSGKSLSSSVNVEVNVLDINDNPPVFYGYDDLIPNPEANNFSNHNYQQKI  1190
             + V+ A D     ++ S++V++E+   D+NDN P F         PE  N          
Sbjct  3618  NLVIGAIDTGLPPQTGSATVHIELE--DVNDNGPTF--------TPEGLN----------  3657

Query  1191  PVYYATAAENSPMGTPITRVFANDSDFTGNGNGLILFDIPYRKSRQNLFAIDSKEGIVTT  1250
                    +EN P GT I  + A+D D   NG G   + +   K +  L ++D   G+V +
Sbjct  3658  ----GYISENEPAGTSIMTLIASDPDLPRNG-GPFTYQLIGGKHKSWL-SVDRNSGVVRS  3711

Query  1251  IGKLDYESEKSHNITILASDLGSPSLSSTAILIVNIID  1288
                 D E        I   D G P   S  +L + ++D
Sbjct  3712  TTSFDREMTPILEAIIEVEDSGKPKQKSQHLLTITVLD  3749


 Score = 174 bits (440),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 205/802 (26%), Positives = 339/802 (42%), Gaps = 76/802 (9%)

Query  121   VTVYVEDINDHAPVFEGAPYHIDVDELTPVGLTVFRGIRAADHDKPNTPNSDVQYAI---  177
             +T+ ++D ND+AP FE + Y     EL    + +   I A D DK   PNS + Y++   
Sbjct  2999  ITITIQDQNDNAPEFEHSFYSFSFPELQQ-SIALVGQIIATDRDK-QGPNSVISYSLQQP  3056

Query  178   --------VAGNERGKFALESSHQAFLILRKSLDYDSGDRDFLLTITASDRGTPPKSTNA  229
                       G    K A+   H  ++         S +  + LT+ A+D G PP  +  
Sbjct  3057  SPMFSIDPATGEVFSKKAVRFKHSQYV--------RSPENMYALTVLATDNGKPPLYSEC  3108

Query  230   TVRIKVNDNDDLPPKFTKGVYRTKIKEFYPITGARIHQRLKFNPSIHAFD-QDLAIDSPI  288
              V I + D  + PPKF +  Y   + +   + G RI +       +HA D QDL  +  +
Sbjct  3109  LVNINIVDAHNNPPKFEQAEYLAPLPQ-DAVRGQRIVR-------VHANDKQDLGTNE-M  3159

Query  289   RYDIIAGNERHLFSLDHVNGSLFLEREIDLDAERSLPGNTFVLQIQASQMDNPLKTGVAR  348
              Y ++  N   +FS+   +G + L + I +      P   + L ++A+    P ++   R
Sbjct  3160  DYSLMTFNLSSIFSVGRHDGWITLVKPIQVP-----PNTRYELVVRATDRGVPPQSDETR  3214

Query  349   VEVEIMDLNDNLPEFEVDFYNISIVENLPNGFSVLQIIATDQDQGDNAEFSYQLE--DKS  406
             V + +   N + P F V+ Y + + EN P G ++L + ATD D G N    Y +   ++ 
Sbjct  3215  VVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILTVGATDDDTGPNGMLRYSISGGNER  3274

Query  407   GAFTLDSRTGWLTVRDQTVLD--REKRSTISMRVYAKEKVPSVVTSQLGASSVNIEVTLL  464
               F++D RTG + ++ Q   D  +E    I+++      + SV           + + L 
Sbjct  3275  QDFSVDERTGGIVIQQQLDYDLIQEYHLNITVQDLGYHPLSSVAM---------LTIILT  3325

Query  465   DANDNNPTFIPNNLYEFIITTKAKKGDLVGQLHAIDPDLGRNGFVTYSIQKAPNSSIPFE  524
             D NDN P F  +  Y   I      G  V Q HA D D  +N  + Y+   +      F 
Sbjct  3326  DVNDNPPVF-NHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPDRHFFI  3384

Query  525   VDTKSGQI--MVTQDDLQASEHLLFVEASDQPVNPSEKRSALAVVTVDIRDQNENREPDF  582
             ++  +G I   V+ D  +   + L ++A     NP     + A + V +   NE   P F
Sbjct  3385  MNQSNGTISSAVSFDYEERRIYTLQIKAK----NPDSSMESYANLYVHVLGVNEFY-PQF  3439

Query  583   IGAPYEFWVGGNVDIGTSVGQIRITEFNNM--GTILYDLLHSYHEGVPFAVEEKSGTITV  640
             +   + F V     +GT VG ++ T+ ++   G + Y L+ S ++   F ++  +G I V
Sbjct  3440  LQPVFHFDVSETSAVGTRVGAVQATDKDSGEDGRVYYLLVGSSNDK-GFRIDTNTGLIYV  3498

Query  641   VDDLNKFNRENYDFEAFVNNEGDL----SLVTNVTIHVVDPKDEKTILMKTGTTPIEFHV  696
                L++  +          N G +    +    V I + D  D    +    T+ I    
Sbjct  3499  ARHLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGNDPPEFIKHYYTSTISEAA  3558

Query  697   KENEPNILIGKLGFKTNGTNN-LKFTIANQKDVTDHISITSDGTLYTQKPLDRETRDIYR  755
                     +  +       NN   ++I N             G + T   LDRE    Y 
Sbjct  3559  PVGTKVTTVKAIDKDVRTQNNQFSYSIINGNLKQSFKIDVQTGEISTASRLDREETSTYN  3618

Query  756   LTIIAEYNKGSVLGTGIYQVNVIVDDENDNKPLFERESYEGKITENSKSGTEVDLNYPIH  815
             L +I   + G    TG   V++ ++D NDN P F  E   G I+EN  +GT +     + 
Sbjct  3619  L-VIGAIDTGLPPQTGSATVHIELEDVNDNGPTFTPEGLNGYISENEPAGTSI---MTLI  3674

Query  816   VSDSDVGHN-GQFTVTIFGNGSE-YFRLDRNLGKIQFTGANTPLDRETTSVYNLRLVATD  873
              SD D+  N G FT  + G   + +  +DRN G ++ T   T  DRE T +    +   D
Sbjct  3675  ASDPDLPRNGGPFTYQLIGGKHKSWLSVDRNSGVVRST---TSFDREMTPILEAIIEVED  3731

Query  874   EGGLTSEAK--LTIQVEDENDN  893
              G    +++  LTI V D+NDN
Sbjct  3732  SGKPKQKSQHLLTITVLDQNDN  3753


 Score = 140 bits (352),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 296/1206 (25%), Positives = 464/1206 (38%), Gaps = 224/1206 (19%)

Query  397   EFSYQLEDKSGAFTLDSRTGWLTVRDQTVLDREKRSTISMRVYAKEKVPSVVTSQLGASS  456
             +FSY+  +    FTLD  TG   V+   VLDRE      MR    +    VV S      
Sbjct  91    KFSYRFNEPPREFTLDPVTG--EVKTNVVLDRE-----GMR----DHYDLVVLSSQPTYP  139

Query  457   VNIEVTLLDANDNNPTFIPNNLYEFIITTKAKKGDLVGQLHAIDPDLGRNGFVTYSIQKA  516
             + + + +LD NDN+P F P        +  A  G  +    A D D+G NG        A
Sbjct  140   IEVRIKVLDVNDNSPEF-PEPSIAISFSESATSGTRLLLDAATDADVGENGVTDQYEIVA  198

Query  517   PNSSIPFEV--------DTKSGQIMVTQ--DDLQASEHLLFVEASDQPVNPSEKRSALAV  566
              N    F +        DT    +  T   D      + L + A D    P   R     
Sbjct  199   GNVDNKFRLVTTANPSGDTSYLHLETTGNLDRESRGSYQLNISARDGGSPP---RFGYLQ  255

Query  567   VTVDIRDQNENREPDFIGAPYEFWVGGNVDIGTSVGQIRITEFNNMG---TILYDLLHSY  623
             V V I D N+N  P F  + Y   +      GT V  +  ++ N++G    I Y L  + 
Sbjct  256   VNVTILDVNDN-PPIFDHSDYNVSLNETALPGTPVVTVMASD-NDLGDNSKITYYLAETE  313

Query  624   HEGVPFAVEEKSGTITVVDDLNKFNRENYD---------FEAFVNNEGD--LSLVTNVTI  672
             H+   F V  ++G I+  + +N   + N           F  F  + G       T VT+
Sbjct  314   HQ---FTVNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSPRQDGRTYVTV  370

Query  673   HVVDPKDEKTILM--------KTGTTPIEFHVKENEPN-ILIGKLGFK-----TNGTNNL  718
             +++D  D   I+         K  T      V EN  N  ++  +  K      NG  ++
Sbjct  371   NLLDTNDHDPIISFRFFPDGGKVAT------VDENAVNGTVVAAVAVKDSDSGLNGRTSV  424

Query  719   KFTIANQKDVTDHISITSDGTLYTQK---PLDRETRDIYRLTIIAEYNKGSVLGTGIYQV  775
             +    N+     H  +     L+  +    LDRE    Y LT++A  ++G+   T    +
Sbjct  425   RIVSGNE---LGHFRLEEAADLHIVRVNGVLDREEIGKYNLTVVA-MDQGTPARTTTAHL  480

Query  776   NVIVDDENDNKPLFERESYEGKITENSKSGTEVDLNYPIHVSDSDVGHNGQFTVTIF-GN  834
              + V+D ND++P+FE+  Y   ++E + +G+ V     I  +D D G N Q    I  GN
Sbjct  481   IIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFV---ASITATDEDTGVNAQVHYDILSGN  537

Query  835   GSEYFRLDRNLGKIQFTGANTPLDRETTSVYNLRLVATDEGGLTSEA--KLTIQVEDEND  892
               ++F +D   G I  TG   PLDRE      L + A D G     A  +L + + DEND
Sbjct  538   ELKWFSMDPLTGLIVTTG---PLDREIRDTVELSISARDGGPNPKFAYTQLKVIILDEND  594

Query  893   NSPLFVQFYLYPDKGIEVLQYDSTGSRVGHFEEASNSTPGLFVLTQNFLRIRKPKEKISP  952
              +P F Q                                      QN             
Sbjct  595   EAPQFSQ------------------------------------REQN-------------  605

Query  953   LVSLPEDIAVGSSVIKAIAEDKDDGENSVIKYEMVSETYIPNELSSAPFHIIQYFMVQPT  1012
              V+L ED    + V    A D D G N  + + +      P+     P      F +   
Sbjct  606   -VTLGEDAPPQTIVALMTATDHDQGTNGSVTFALA-----PSVERLYPLQ----FALDAL  655

Query  1013  TGEVVIARALPAE--SEFRLNISATDKGGFKDH---LSVRITVRDVNDHPPVFKKSWYNF  1067
             TG++   R L  E  S++ +++ A D+G         +V + V DVND+ P F    Y +
Sbjct  656   TGQLTTRRPLDREKMSQYEISVIARDQGAPTPQSATATVWLNVADVNDNDPQFYPRHYIY  715

Query  1068  D----------AEEASYTRNTLGRIEATDADFGSNANITYSIKNNSTVPFSISPTTGA--  1115
                         +E    R  L  + A+D D G NA I Y +++     F +   +GA  
Sbjct  716   SLADDDDDIKLKKEVEKER-ILLHVTASDKDDGDNALIEYRLESGGEGLFQLDARSGAIS  774

Query  1116  LRVDGLLDRETQDKYSFVVVAKDNPKSGKSLSSSVNV----EVNVLDINDNPPVFYGYDD  1171
             LR D       +  Y  +V A+D  +      + V +    ++ +L+        Y    
Sbjct  775   LRGDAPASMHWKPHYKLLVSARDAGQRRSQQDAIVEIVLKSKLEMLECGQAQAGGY----  830

Query  1172  LIPNPEANNFSNHNYQQKIPVYYATAAENSPMGTPITRVFANDSDFTGNGNGLILFDIPY  1231
                  E     +H  Q+        +  N  +G  I +V + +    G  N  I +DI  
Sbjct  831   -----EFQMVEDHEQQRN-------SQPNREVG--IVQVKSTN----GKANSHIEYDIIQ  872

Query  1232  RKSRQNLFAIDSKEGIVTTIGKLDYESEKSHNITILASDLGSPSLSST------AILIVN  1285
                 QN F ID++ G +TT   LD E + ++ +TILAS   S S +++       I+ + 
Sbjct  873   GDRAQN-FRIDTRSGRITTARPLDREEQANYRLTILASSSSSSSAAASSVSYGQCIVNIA  931

Query  1286  IIDVPEDIKSIERPVFA-HRYYE--VEVEENVPVPLRVLTLNVTEPYRSHKLRYSIVAEN  1342
             IID+ ++      PVFA  R  E  + + EN  V   +    V +  R   +   I    
Sbjct  932   IIDLNDNA-----PVFALDRESEPTISLPENAAVGQEIYLSRVRD--RDAGVNSRISYSL  984

Query  1343  SSDVKRTFRIDPRNGSLYIIESPDREQKALYELIIRLDQYKVGRDMTVMIYPVTNERLGN  1402
             +++  + FRI P  G LY+      E  +L  + + L     G                 
Sbjct  985   TNNPNQQFRIGPVTGVLYLQRPIRAEPGSL--IHVELMATDAGSPPLSS-----------  1031

Query  1403  LGLNEVKVIVRVTDVNDNAPKFTVTGRPMIAAIPTTANYGYNVIRLQATDPDLGLNGEVR  1462
                 ++ + V + DVND+ P F  T      ++P T         L ATD DLG NG + 
Sbjct  1032  ----KLSLSVLIADVNDHTPVFDHTSYE--TSLPETTKVNTRFFALAATDIDLGDNGRIS  1085

Query  1463  YQILSRADEASRRFAIDPVTGQVRGISTFTKEAGKVFGFDVKATDRSGADDGKSSIANVF  1522
             Y+I+    E  R F + P  G +   +   +E    +   V    R      +SS+  V 
Sbjct  1086  YEIIEGNTE--RMFGVFP-DGYLFVRAPLDREERDYYALTVSC--RDAGQPSRSSVVPVV  1140

Query  1523  VYVLDE  1528
             ++V+DE
Sbjct  1141  IHVIDE  1146


 Score = 132 bits (332),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 137/479 (29%), Positives = 229/479 (48%), Gaps = 43/479 (9%)

Query  109   DDGEDTITSSLSVTVYVEDINDHAPVFEGAPYHIDVDELTPVGLTVFRGIRAADHDKPNT  168
             D G   ++S   +T+ + D+ND+ PVF    YH  + E  PVG  VF+   AAD D P  
Sbjct  3308  DLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQA-HAADKDSPK-  3365

Query  169   PNSDVQYAIVAGNERGKFALESSHQAFLILRKSLDYDSGDRDFLLTITASDRGTPPKSTN  228
              N+ + YA +       F + +     +    S DY+   R + L I A +  +  +S  
Sbjct  3366  -NAIIHYAFLPSGPDRHFFIMNQSNGTISSAVSFDYEE-RRIYTLQIKAKNPDSSMESY-  3422

Query  229   ATVRIKVNDNDDLPPKFTKGVYRTKIKEFYPITGARIHQRLKFNPSIHAFDQDLAIDSPI  288
             A + + V   ++  P+F + V+   + E   + G R+        ++ A D+D   D  +
Sbjct  3423  ANLYVHVLGVNEFYPQFLQPVFHFDVSETSAV-GTRVG-------AVQATDKDSGEDGRV  3474

Query  289   RYDIIAGNERHLFSLDHVNGSLFLEREIDLDAERSLPGNTFVLQIQASQMDNPL--KTGV  346
              Y ++  +    F +D   G +++ R +D + +     N  VL + A    +     T  
Sbjct  3475  YYLLVGSSNDKGFRIDTNTGLIYVARHLDRETQ-----NRVVLTVMAKNYGSIRGNDTDE  3529

Query  347   ARVEVEIMDLNDNLPEFEVDFYNISIVENLPNGFSVLQIIATDQD-QGDNAEFSYQLEDK  405
             A+V + I D ND  PEF   +Y  +I E  P G  V  + A D+D +  N +FSY + + 
Sbjct  3530  AQVIISIQDGNDP-PEFIKHYYTSTISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIING  3588

Query  406   S--GAFTLDSRTGWLTVRDQTVLDREKRSTISMRVYAKEKVPSVVTSQLGASSVNIEVTL  463
             +   +F +D +TG ++   +  LDRE+ ST ++ + A   + + +  Q G+++V+IE  L
Sbjct  3589  NLKQSFKIDVQTGEISTASR--LDREETSTYNLVIGA---IDTGLPPQTGSATVHIE--L  3641

Query  464   LDANDNNPTFIPNNLYEFIITTKAKKGDLVGQLHAIDPDLGRNGF-VTYSIQKAPNSSIP  522
              D NDN PTF P  L  + I+     G  +  L A DPDL RNG   TY +    + S  
Sbjct  3642  EDVNDNGPTFTPEGLNGY-ISENEPAGTSIMTLIASDPDLPRNGGPFTYQLIGGKHKSW-  3699

Query  523   FEVDTKSGQIMVTQD-DLQAS---EHLLFVEASDQPVNPSEKRSALAVVTVDIRDQNEN  577
               VD  SG +  T   D + +   E ++ VE S +P     K+ +  ++T+ + DQN+N
Sbjct  3700  LSVDRNSGVVRSTTSFDREMTPILEAIIEVEDSGKP-----KQKSQHLLTITVLDQNDN  3753


 Score = 113 bits (283),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 141/569 (25%), Positives = 229/569 (40%), Gaps = 120/569 (21%)

Query  1007  FMVQPTTGEVVIARALPAESEFRLNISATDKGGFKDH-------------LSVRITVRDV  1053
             F + P TGEV            + N+   D+ G +DH             + VRI V DV
Sbjct  103   FTLDPVTGEV------------KTNV-VLDREGMRDHYDLVVLSSQPTYPIEVRIKVLDV  149

Query  1054  NDHPPVFKKSWYNFDAEEASYTRNTLGRIEATDADFGSN----------ANITYSIKNNS  1103
             ND+ P F +        E++ +   L    ATDAD G N           N+    +  +
Sbjct  150   NDNSPEFPEPSIAISFSESATSGTRLLLDAATDADVGENGVTDQYEIVAGNVDNKFRLVT  209

Query  1104  TVPFSISPTTGALRVDGLLDRETQDKYSFVVVAKDN---PKSGKSLSSSVNVEVNVLDIN  1160
             T   S   +   L   G LDRE++  Y   + A+D    P+ G      + V V +LD+N
Sbjct  210   TANPSGDTSYLHLETTGNLDRESRGSYQLNISARDGGSPPRFGY-----LQVNVTILDVN  264

Query  1161  DNPPVFYGYDDLIPNPEANNFSNHNYQQKIPVYYATAAENSPMGTPITRVFANDSDFTGN  1220
             DNPP+F   D                      Y  +  E +  GTP+  V A+D+D   N
Sbjct  265   DNPPIFDHSD----------------------YNVSLNETALPGTPVVTVMASDNDLGDN  302

Query  1221  GNGLILFDIPYRKSRQNLFAIDSKEGIVTTIGKLDY---------ESEKSHNITILASDL  1271
                 I +   Y    ++ F ++ + G+++T  +++           S+KS   T+ A D 
Sbjct  303   SK--ITY---YLAETEHQFTVNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDH  357

Query  1272  GSPSLSSTAILIVNIIDVPEDIKSIERPVFAHRYYE-----VEVEENVPVPLRVLTLNVT  1326
             GSP       + VN++D  +       P+ + R++        V+EN      V  + V 
Sbjct  358   GSPRQDGRTYVTVNLLDTND-----HDPIISFRFFPDGGKVATVDENAVNGTVVAAVAVK  412

Query  1327  EPYRSHKLRYSIVAENSSDVKRTFRIDPRNGSLYIIESP---DREQKALYEL-IIRLDQY  1382
             +       R S+   + +++   FR++     L+I+      DRE+   Y L ++ +DQ 
Sbjct  413   DSDSGLNGRTSVRIVSGNELGH-FRLE-EAADLHIVRVNGVLDREEIGKYNLTVVAMDQG  470

Query  1383  KVGRDMTVMIYPVTNERLGNLGLNEVKVIVRVTDVNDNAPKFTVTGRPMIAAIPTTANYG  1442
                R  T  +                  I+ V DVND+ P F  +     A +   A  G
Sbjct  471   TPARTTTAHL------------------IIDVNDVNDHEPVFEKS--EYSAVLSELAPTG  510

Query  1443  YNVIRLQATDPDLGLNGEVRYQILSRADEASRRFAIDPVTGQVRGISTFTKEAGKVFGFD  1502
               V  + ATD D G+N +V Y ILS  +   + F++DP+TG +       +E        
Sbjct  511   SFVASITATDEDTGVNAQVHYDILSGNE--LKWFSMDPLTGLIVTTGPLDREIRDTVELS  568

Query  1503  VKATDRSGADDGKSSIANVFVYVLDEQKQ  1531
             + A  R G  + K +   + V +LDE  +
Sbjct  569   ISA--RDGGPNPKFAYTQLKVIILDENDE  595


 Score = 106 bits (265),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 124/471 (26%), Positives = 209/471 (44%), Gaps = 54/471 (11%)

Query  34    VPENLKVGEEVLKIEVY----PRNNL-NLQPVDRDEDVHFFTYRDINRTTVSLLLAKSLE  88
             +PEN  VG  V +        P+N + +   +    D HFF     N  T+S  ++   E
Sbjct  3343  IPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPDRHFFIMNQSN-GTISSAVSFDYE  3401

Query  89    DLVDNDSPRNVLKFKVTCDYDDGEDTITSSLSVTVYVEDINDHAPVFEGAPYHIDVDELT  148
             +       R +   ++     D   ++ S  ++ V+V  +N+  P F    +H DV E +
Sbjct  3402  E-------RRIYTLQIKAKNPDS--SMESYANLYVHVLGVNEFYPQFLQPVFHFDVSETS  3452

Query  149   PVGLTVFRGIRAADHDKPNTPNSDVQYAIVAGNERGKFALESSHQAFLILRKSLDYDSGD  208
              VG  V   ++A D D  +  +  V Y +V  +    F +++ +   + + + LD ++ +
Sbjct  3453  AVGTRV-GAVQATDKD--SGEDGRVYYLLVGSSNDKGFRIDT-NTGLIYVARHLDRETQN  3508

Query  209   RDFLLTITASDRGT--PPKSTNATVRIKVNDNDDLPPKFTKGVYRTKIKEFYPITGARIH  266
             R  +LT+ A + G+     +  A V I + D +D PP+F K  Y + I E  P+ G ++ 
Sbjct  3509  R-VVLTVMAKNYGSIRGNDTDEAQVIISIQDGND-PPEFIKHYYTSTISEAAPV-GTKV-  3564

Query  267   QRLKFNPSIHAFDQDLAI-DSPIRYDIIAGNERHLFSLDHVNGSLFLEREIDLDAERSLP  325
                    ++ A D+D+   ++   Y II GN +  F +D   G +     +D +      
Sbjct  3565  ------TTVKAIDKDVRTQNNQFSYSIINGNLKQSFKIDVQTGEISTASRLDREET----  3614

Query  326   GNTFVLQIQASQMDNPLKTGVARVEVEIMDLNDNLPEFEVDFYNISIVENLPNGFSVLQI  385
              +T+ L I A     P +TG A V +E+ D+NDN P F  +  N  I EN P G S++ +
Sbjct  3615  -STYNLVIGAIDTGLPPQTGSATVHIELEDVNDNGPTFTPEGLNGYISENEPAGTSIMTL  3673

Query  386   IATDQDQGDN-AEFSYQL--EDKSGAFTLDSRTGWLTVRDQTVLDREKRSTISMRVYAKE  442
             IA+D D   N   F+YQL         ++D  +G   VR  T  DRE    +   +  ++
Sbjct  3674  IASDPDLPRNGGPFTYQLIGGKHKSWLSVDRNSG--VVRSTTSFDREMTPILEAIIEVED  3731

Query  443   K-VPSVVTSQLGASSVNIEVTLLDANDNNPTFIPNNLYEFIITTKAKKGDL  492
                P   +  L      + +T+LD NDN     P+      I      GDL
Sbjct  3732  SGKPKQKSQHL------LTITVLDQNDN-----PSTTRSLHIAVSLFNGDL  3771


 Score = 98.2 bits (243),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 87/327 (27%), Positives = 148/327 (45%), Gaps = 32/327 (10%)

Query  109  DDGEDTITSSLSVTVYVEDINDHAPVFEGAPYHIDVDELTPVGLTVFRGIRAADHDKPNT  168
            D G    T++  + + V D+NDH PVFE + Y   + EL P G +    I A D D    
Sbjct  468  DQGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTG-SFVASITATDED--TG  524

Query  169  PNSDVQYAIVAGNERGKFALESSHQAFLILRKSLDYDSGDRDFLLTITASDRGTPPKSTN  228
             N+ V Y I++GNE   F+++      ++    LD +  D    L+I+A D G  PK   
Sbjct  525  VNAQVHYDILSGNELKWFSMD-PLTGLIVTTGPLDREIRDT-VELSISARDGGPNPKFAY  582

Query  229  ATVRIKVNDNDDLPPKFTKGVYRTKIKEFYPITGARIHQRLKFNPSIHAFDQDLAIDSPI  288
              +++ + D +D  P+F++      + E  P               + A D D   +  +
Sbjct  583  TQLKVIILDENDEAPQFSQREQNVTLGEDAPPQ--------TIVALMTATDHDQGTNGSV  634

Query  289  RYDIIAGNERHL---FSLDHVNGSLFLEREIDLDAERSLPGNTFVLQIQASQMDNPL-KT  344
             + +    ER     F+LD + G L   R +D +       + + + + A     P  ++
Sbjct  635  TFALAPSVERLYPLQFALDALTGQLTTRRPLDREKM-----SQYEISVIARDQGAPTPQS  689

Query  345  GVARVEVEIMDLNDNLPEFEVDFY---------NISIVENLPNGFSVLQIIATDQDQGDN  395
              A V + + D+NDN P+F    Y         +I + + +     +L + A+D+D GDN
Sbjct  690  ATATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKERILLHVTASDKDDGDN  749

Query  396  AEFSYQLEDKS-GAFTLDSRTGWLTVR  421
            A   Y+LE    G F LD+R+G +++R
Sbjct  750  ALIEYRLESGGEGLFQLDARSGAISLR  776


>CADN_DROME unnamed protein product
Length=3097

 Score = 254 bits (648),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 398/1612 (25%), Positives = 668/1612 (41%), Gaps = 280/1612 (17%)

Query  12    ALLHSTLACQFY-PQGEYLRFVRVPENLKVGEEVLKIEVYPRNNLNLQPVDRDEDVHFFT  70
             +++    A QFY P  E      +PEN K   +++ I+     +  ++   + +     T
Sbjct  641   SIVGGKRAPQFYMPSYE----AEIPENQKKDSDIISIKAKSFADREIRYTLKAQGQGAGT  696

Query  71    YRDINRTTVSLLLAKSLEDLVDNDSPRNVLKFKVTCDYDDGEDTITSSLSVTVYVEDIND  130
             + +I  T+  + LAK L D  D   P +V    VT   D G    ++S+ +T+ V D+ND
Sbjct  697   F-NIGPTSGIVKLAKEL-DFEDLRQP-HVYSLIVTATEDSG--GFSTSVDLTIRVTDVND  751

Query  131   HAPVFEGAPYHI-DVDELTPVGLTVFRGIRAADHDKPNTPNSDVQYAIVAGNERGKFALE  189
             +AP FE   Y   +VDE  P+G ++ R ++A D D  +  N++++Y +   +    FA++
Sbjct  752   NAPKFELPDYQAHNVDEDIPLGTSILR-VKAMDSDSGS--NAEIEYLVSDDH----FAVD  804

Query  190   SSHQAFLILRKSLDYDSGDRDFLLTITASDRGTPPKSTNATVRIKVNDNDDLPPKFTKGV  249
             S+    ++  K LD D+ +  +   +TA D+G PPKS  ATVR+   + +D  PKF++ V
Sbjct  805   SN--GIIVNNKQLDADNNNAYYEFIVTAKDKGEPPKSGVATVRVYTKNKNDEEPKFSQQV  862

Query  250   YRTKIKE-FYPITGARIHQRLKFNPSIHAFDQDLAIDSPIRYDIIAGN-ERHLFSLDHVN  307
             Y   + E   P T            ++ A D+D      +R+  + G      F ++ + 
Sbjct  863   YTPNVDENAGPNT---------LVTTVVASDKD---GDNVRFGFVGGGTSSGQFVIEDIT  910

Query  308   GSLFLE-REIDLDAERSLPGNTFVLQIQAS-------QMDNPLKTGVARVEVEIMDLNDN  359
             G + L  + I LD ++      + L + A          D  + T  A V V I D+NDN
Sbjct  911   GVIRLHNKAISLDKDK------YELNVTAMDDGSCCVNGDQTIHTSTAVVVVFITDVNDN  964

Query  360   LPEF-EVDFYNISIVENLPNGFSVLQIIATDQDQGDNAEFSY----QLEDKSGAFTLDSR  414
              P F +   Y   + E  PNG  V++++ATD+D+G N +  Y    Q   K   FT+D  
Sbjct  965   KPVFKDCSTYYPKVEEGAPNGSPVIKVVATDEDKGVNGQVKYSIVQQPNQKGTKFTVDEE  1024

Query  415   TGWLTVRDQTVLDREKRST--ISMRVYAKEKV-PSVVTSQLGASSVNIEVTLLDANDNNP  471
             TG   V    V DRE      +S+ V A ++  PS+     G  S  +E+T  D NDN P
Sbjct  1025  TG--EVSTNKVFDREGDDGKFVSVTVKATDQGDPSLE----GVCSFTVEIT--DVNDNPP  1076

Query  472   TFIPNNLYEFIITTKAKKGDLVGQLHAIDPDLGRNGFVTYSIQKA--PNSSIPFEVDTKS  529
              F      E  +   A  G  + ++ A D D   NG + YS+     PN    FE+  +S
Sbjct  1077  LFDRQKYVEN-VKQDASIGTNILRVSASDEDADNNGAIVYSLTAPFNPNDLEYFEIQAES  1135

Query  530   GQIMVTQDDLQASEHLLFVEASDQPVNPSEKRSALAVVTVDIRDQNENREPDFIGAPY-E  588
             G I V +  L    + L   A D+   P    S    V +D+ D+  N  P +    Y  
Sbjct  1136  GWI-VLKKPLDRETYKLEAMAQDKGYPP---LSRTVEVQIDVVDR-ANNPPVWDHTVYGP  1190

Query  589   FWVGGNVDIGTSVGQIRITE-FNNMGTILYDLL-------HSYHEGVPFAVEEKS-----  635
              +V  N+ +G  V  I+ +       T+ Y L+       + +H    F ++++      
Sbjct  1191  IYVKENMPVGGKVVSIKASSGIEGNPTVFYRLMPGSTAQTNKFHT---FYLQQRPDNGDT  1247

Query  636   -GTITVVDDLNKFNRENYDFEAFVNNEGDLSLVTNVTIHVV--DPKDEKTILMKTGTTPI  692
                I V   L+  + + Y+    V N G   L +  T++++  D  DE  +     T   
Sbjct  1248  WADIKVNHPLDYESIKEYNLTIRVENNGAQQLASEATVYIMLEDVNDEIPLF----TERE  1303

Query  693   EFHVKENEPNILIGKLGFKTNG--------TNNLKFTIA----NQKDVTDHISITSDGTL  740
             +  V E EP   IG    + N          N + + I     N+      I++ S G +
Sbjct  1304  QETVLEGEP---IGTKVTQVNAIDKDGTFPNNQVYYYIVDSPRNEGKEFFEINLQS-GEI  1359

Query  741   YTQKPLDRETRDIYRLTIIAEYNKGSVL------GTGIYQVNVIVDDENDNKPLFERESY  794
             +T+   DRE +  Y L + A     S         +    + + + D+NDN P F++  Y
Sbjct  1360  FTKTVFDREKKGAYALEVEARDGAPSARPNSNGPNSVTKFIRIGIADKNDNPPYFDKSLY  1419

Query  795   EGKITENSKSGTEVDLNYPIHVSDSDVGHNGQFTVTIFGNGSEYFRLDRNLGKIQFTGAN  854
             E ++ EN      V     +   D D     ++ +T  GN    F +    G I   GA 
Sbjct  1420  EAEVDENEDIQHTV---LTVTAKDHDESSRIRYEITS-GNIGGAFAVKNMTGAIYVAGA-  1474

Query  855   TPLDRETTSVYNLRLVATDEGGLTSEAKLTIQVEDENDNSPLFVQFYLYPDKGIEVLQYD  914
               LD ET   Y LRL A+D     +   + I V+D NDN P+F                 
Sbjct  1475  --LDYETRRRYELRLAASDNLK-ENYTTVIIHVKDVNDNPPVF-----------------  1514

Query  915   STGSRVGHFEEASNSTPGLFVLTQNFLRIRKPKEKISPLVSLPEDIAVGSSVIKAIAEDK  974
                                           +P  +    ++  +D  +   V++  A D 
Sbjct  1515  -----------------------------ERPTYRTQ--ITEEDDRNLPKRVLQVTATDG  1543

Query  975   DDGENSVIKYEMVSETYIPNELSSAPFHIIQYFMVQPTTGEVVIARALPAES-----EFR  1029
             D      I Y +  +   P+  +++ F I +      TTGE+ + + L  +      ++R
Sbjct  1544  DKDRPQNIVYFLTGQGIDPDNPANSKFDINR------TTGEIFVLKPLDRDQPNGRPQWR  1597

Query  1030  LNISATDKG--GFKDHLSVRITVRDVNDHPPVFKKSWYNFDAEE---ASYTRNTLGRIEA  1084
               + A D+G  G   +  V++ ++D+ND+ P+F +  Y  +  E   A     T+  ++ 
Sbjct  1598  FTVFAQDEGGEGLVGYADVQVNLKDINDNAPIFPQGVYFGNVTENGTAGMVVMTMTAVDY  1657

Query  1085  TDADFGSNANITYSIKNN------STVPFSISPTTGALRVD-GLLDRETQDKYSFVVVAK  1137
              D + GSNA + YSI+ N       +  F I P TG ++     LDRE    YS  VVA 
Sbjct  1658  DDPNEGSNARLVYSIEKNVIEEETGSPIFEIEPDTGVIKTAVCCLDRERTPDYSIQVVAM  1717

Query  1138  DNPKSGKSLSSSVNVEVNVLDINDNPPVFYGYDDLIPNPEANNFSNHNYQQKIPVYYATA  1197
             D    G  L  +    + V DIND PP                F+   +  ++     TA
Sbjct  1718  D----GGGLKGTGTASIRVKDINDMPP---------------QFTKDEWFTEVDETDGTA  1758

Query  1198  AENSPMGTPITRVFANDSDFTGNGNGLILFDIPYRKSRQNLFAIDSKEGIVTTIGKLDYE  1257
                     PI  V  +D D T      ++ +  Y   +  +   +   G +  +  LDYE
Sbjct  1759  LPE----MPILTVTVHDEDETNKFQYKVIDNSGYGADKFTMVRNNDGTGSLKIVQPLDYE  1814

Query  1258  SEKSHN---ITILASDLGSPSLS-----STAILIVNIIDVPEDIKSIERPVFAHRYYEVE  1309
              +   N     I  +D G  + +     + + ++V + D+ ++     +P F     EV 
Sbjct  1815  DQLQSNGFRFRIQVNDKGEDNDNDKYHVAYSWVVVKLRDINDN-----KPHFERANVEVS  1869

Query  1310  VEENVPVPLRVLTLNVTEPYRSHKLRYSIVAENSSDVKRTFRIDPRNGSLYIIESPDREQ  1369
             V E+  V   +     T+P +  K + S   + SSD +R F I+ +NGS+ I  S DRE 
Sbjct  1870  VFEDTKVGTELEKFKATDPDQGGKSKVSYSIDRSSDRQRQFAIN-QNGSVTIQRSLDREV  1928

Query  1370  KALYEL-IIRLDQYKVGRDMTVMIYPVTNERLGNLGLNEVKVIVRVTDVNDNAPKFTVTG  1428
                +++ I+ +D     +  T  +                   V V D+NDNAPKF    
Sbjct  1929  VPRHQVKILAIDDGSPPKTATATL------------------TVIVQDINDNAPKFLKDY  1970

Query  1429  RPMIAA-IPTTANYGYNVIRLQATDPDLGLNGEVRYQILSRADEASRRFAIDPVTGQVRG  1487
             RP++   +P        V+ + ATD D            S+++    +F +DP    +  
Sbjct  1971  RPVLPEHVPPR-----KVVEILATDDD----------DRSKSNGPPFQFRLDPSADDIIR  2015

Query  1488  ISTFTKEAGKVFGFDVKATDRSGADDGKSSIANVFVYVLDEQKQLVMVMGLK  1539
              S           F V+   +    DG + I+++  +  ++QK+ ++ + +K
Sbjct  2016  AS-----------FKVEQDQKGANGDGMAVISSLRSFDREQQKEYMIPIVIK  2056


 Score = 143 bits (361),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 290/1258 (23%), Positives = 503/1258 (40%), Gaps = 241/1258 (19%)

Query  348   RVEVEIMDLNDNLPEF-EVDFYNISIVE-NLPNGFSVLQIIATDQDQGDNAEFSYQLEDK  405
             RV + + D+ND  P F        ++V+ N P    V  + A D D   N  +    +  
Sbjct  528   RVIILVKDVNDEPPYFINRPLPMQAVVQLNAPPNTPVFTLQARDPDTDHNIHYFIVRDRT  587

Query  406   SGAFTLDSRTGWLTVRDQTVLDREKRSTISMRVYAKEKVPSVVTSQLGASSVNIEVTLLD  465
              G F +D R+G +  R   +   +    + ++    E     V  +   S+    ++++ 
Sbjct  588   GGRFEVDERSGVVRTRGTDLFQLDMEYVLYVKA---EDQNGKVDDRRFQSTPEERLSIVG  644

Query  466   ANDNNPTFIPNNLYEFIITTKAKK-GDLVGQLHAIDPDLGRNGFVTYSIQKAPNSSIPFE  524
                    ++P+  YE  I    KK  D++    +I      +  + Y+++     +  F 
Sbjct  645   GKRAPQFYMPS--YEAEIPENQKKDSDII----SIKAKSFADREIRYTLKAQGQGAGTFN  698

Query  525   VDTKSGQIMVTQ----DDL-QASEHLLFVEASDQPVNPSEKRSALAVVTVDIRDQNENRE  579
             +   SG + + +    +DL Q   + L V A++     S   S    +T+ + D N+N  
Sbjct  699   IGPTSGIVKLAKELDFEDLRQPHVYSLIVTATED----SGGFSTSVDLTIRVTDVNDN-A  753

Query  580   PDFIGAPYEFW-VGGNVDIGTSVGQIRITEFNNMGTILYDLLHSYHEGVPFAVEEKSGTI  638
             P F    Y+   V  ++ +GTS+ +++  + ++      + L S      FAV + +G I
Sbjct  754   PKFELPDYQAHNVDEDIPLGTSILRVKAMDSDSGSNAEIEYLVSDDH---FAV-DSNGII  809

Query  639   TVVDDLNKFNREN-YDFEAFVNNEGD--LSLVTNVTIHVVDPKDEKTILMKTGTTPIEFH  695
                  L+  N    Y+F     ++G+   S V  V ++  +  DE+    +   TP   +
Sbjct  810   VNNKQLDADNNNAYYEFIVTAKDKGEPPKSGVATVRVYTKNKNDEEPKFSQQVYTP---N  866

Query  696   VKENE-PNILIG------------KLGFKTNGTNNLKFTIANQKDVTDHISITSDGTLYT  742
             V EN  PN L+             + GF   GT++ +F I   +D+T  I + +      
Sbjct  867   VDENAGPNTLVTTVVASDKDGDNVRFGFVGGGTSSGQFVI---EDITGVIRLHNKAI---  920

Query  743   QKPLDRETRDIYRLTIIAE------YNKGSVLGTGIYQVNVIVDDENDNKPLFERES-YE  795
                LD   +D Y L + A        N    + T    V V + D NDNKP+F+  S Y 
Sbjct  921   --SLD---KDKYELNVTAMDDGSCCVNGDQTIHTSTAVVVVFITDVNDNKPVFKDCSTYY  975

Query  796   GKITENSKSGTEVDLNYPIHVSDSDVGHNGQFTVTIFGNGSE---YFRLDRNLGKIQFTG  852
              K+ E + +G+ V     +  +D D G NGQ   +I    ++    F +D   G++    
Sbjct  976   PKVEEGAPNGSPV---IKVVATDEDKGVNGQVKYSIVQQPNQKGTKFTVDEETGEVS---  1029

Query  853   ANTPLDRET--TSVYNLRLVATDEG--GLTSEAKLTIQVEDENDNSPLFVQFYLYPDKGI  908
              N   DRE       ++ + ATD+G   L      T+++ D NDN PLF           
Sbjct  1030  TNKVFDREGDDGKFVSVTVKATDQGDPSLEGVCSFTVEITDVNDNPPLF-----------  1078

Query  909   EVLQYDSTGSRVGHFEEASNSTPGLFVLTQNFLRIRKPKEKISPLVSLPEDIAVGSSVIK  968
                       R  + E                              ++ +D ++G+++++
Sbjct  1079  ---------DRQKYVE------------------------------NVKQDASIGTNILR  1099

Query  969   AIAEDKDDGENSVIKYEMVSETYIPNELSSAPFHIIQYFMVQPTTGEVVIARALPAESEF  1028
               A D+D   N  I Y + +  + PN+L        +YF +Q  +G +V+ + L  E+ +
Sbjct  1100  VSASDEDADNNGAIVYSLTA-PFNPNDL--------EYFEIQAESGWIVLKKPLDRET-Y  1149

Query  1029  RLNISATDKG--GFKDHLSVRITVRDVNDHPPVFKKSWYNFDAEEASYTRNTL---GRIE  1083
             +L   A DKG       + V+I V D  ++PPV+  + Y        Y +  +   G++ 
Sbjct  1150  KLEAMAQDKGYPPLSRTVEVQIDVVDRANNPPVWDHTVYG-----PIYVKENMPVGGKVV  1204

Query  1084  ATDADFG--SNANITYSIKNNSTVP------FSISP------TTGALRVDGLLDRETQDK  1129
             +  A  G   N  + Y +   ST        F +        T   ++V+  LD E+  +
Sbjct  1205  SIKASSGIEGNPTVFYRLMPGSTAQTNKFHTFYLQQRPDNGDTWADIKVNHPLDYESIKE  1264

Query  1130  YSFVVVAKDNPKSGKSLSSSVNVEVNVLDINDNPPVFYGYDDLIPNPEANNFSNHNYQQK  1189
             Y+  +  ++N    + L+S   V + + D+ND  P+F   +                   
Sbjct  1265  YNLTIRVENN--GAQQLASEATVYIMLEDVNDEIPLFTEREQ------------------  1304

Query  1190  IPVYYATAAENSPMGTPITRVFANDSDFTGNGNGLILF--DIPYRKSRQNLFAIDSKEGI  1247
                   T  E  P+GT +T+V A D D T   N +  +  D P R   +  F I+ + G 
Sbjct  1305  -----ETVLEGEPIGTKVTQVNAIDKDGTFPNNQVYYYIVDSP-RNEGKEFFEINLQSGE  1358

Query  1248  VTTIGKLDYESEKSHNITILASDLGSPSL--------SSTAILIVNIIDVPEDIKSIERP  1299
             + T    D E + ++ + + A D G+PS         S T  + + I D     K+   P
Sbjct  1359  IFTKTVFDREKKGAYALEVEARD-GAPSARPNSNGPNSVTKFIRIGIAD-----KNDNPP  1412

Query  1300  VFAHRYYEVEVEENVPVPLRVLTLNVTEPYRSHKLRYSIVAENSSDVKRTFRIDPRNGSL  1359
              F    YE EV+EN  +   VLT+   +   S ++RY I    S ++   F +    G++
Sbjct  1413  YFDKSLYEAEVDENEDIQHTVLTVTAKDHDESSRIRYEIT---SGNIGGAFAVKNMTGAI  1469

Query  1360  YIIESPDREQKALYELIIRLDQYKVGRDMTVMIYPVTNERLGNLGLNEVKVIVRVTDVND  1419
             Y+  + D E +  YEL +                        NL  N   VI+ V DVND
Sbjct  1470  YVAGALDYETRRRYELRLAASD--------------------NLKENYTTVIIHVKDVND  1509

Query  1420  NAPKFTVTGRPMIAAIPTTA---NYGYNVIRLQATDPDLGLNGEVRY----QILSRADEA  1472
             N P F    RP      T     N    V+++ ATD D      + Y    Q +   + A
Sbjct  1510  NPPVFE---RPTYRTQITEEDDRNLPKRVLQVTATDGDKDRPQNIVYFLTGQGIDPDNPA  1566

Query  1473  SRRFAIDPVTGQVRGISTFTKE---AGKVFGFDVKATDRSGADDGKSSIANVFVYVLD  1527
             + +F I+  TG++  +    ++       + F V A D  G  +G    A+V V + D
Sbjct  1567  NSKFDINRTTGEIFVLKPLDRDQPNGRPQWRFTVFAQDEGG--EGLVGYADVQVNLKD  1622


 Score = 124 bits (312),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 289/1236 (23%), Positives = 486/1236 (39%), Gaps = 242/1236 (20%)

Query  109   DDGEDTITSSLSVTVYVEDINDHAPVFEGAPYHIDVDELTPVGLTVFRGIRAADHDKPNT  168
             D G+ ++    S TV + D+ND+ P+F+   Y  +V +   +G  + R + A+D D  N 
Sbjct  1052  DQGDPSLEGVCSFTVEITDVNDNPPLFDRQKYVENVKQDASIGTNILR-VSASDEDADN-  1109

Query  169   PNSDVQYAIVAG---NERGKFALESSHQAFLILRKSLDYDSGDRDFLLTITASDRGTPPK  225
              N  + Y++ A    N+   F +++    +++L+K LD ++    + L   A D+G PP 
Sbjct  1110  -NGAIVYSLTAPFNPNDLEYFEIQA-ESGWIVLKKPLDRET----YKLEAMAQDKGYPPL  1163

Query  226   STNATVRIKVNDNDDLPPKFTKGVYR-TKIKEFYPITGARIHQR----LKFNPSIHAFDQ  280
             S    V+I V D  + PP +   VY    +KE  P+ G  +  +    ++ NP++     
Sbjct  1164  SRTVEVQIDVVDRANNPPVWDHTVYGPIYVKENMPVGGKVVSIKASSGIEGNPTVF----  1219

Query  281   DLAIDSPIRYDIIAG-----NERHLFSLDHV--NGSLFLEREID--LDAERSLPGNTFVL  331
                      Y ++ G     N+ H F L     NG  + + +++  LD E S+      +
Sbjct  1220  ---------YRLMPGSTAQTNKFHTFYLQQRPDNGDTWADIKVNHPLDYE-SIKEYNLTI  1269

Query  332   QIQ---ASQMDNPLKTGVARVEVEIMDLNDNLPEFEVDFYNISIVENLPNGFSVLQIIAT  388
             +++   A Q+        A V + + D+ND +P F  +    +++E  P G  V Q+ A 
Sbjct  1270  RVENNGAQQL-----ASEATVYIMLEDVNDEIPLF-TEREQETVLEGEPIGTKVTQVNAI  1323

Query  389   DQDQG--DNAEFSYQLEDKSGA----FTLDSRTGWLTVRDQTVLDREKRSTISMRVYAKE  442
             D+D    +N  + Y ++         F ++ ++G +  +  TV DREK+   ++ V A++
Sbjct  1324  DKDGTFPNNQVYYYIVDSPRNEGKEFFEINLQSGEIFTK--TVFDREKKGAYALEVEARD  1381

Query  443   KVPSVVTSQLGASSVN--IEVTLLDANDNNPTFIPNNLYEFIITTKAKKGDLVGQLHAID  500
               PS   +  G +SV   I + + D NDN P F   +LYE  +         V  + A D
Sbjct  1382  GAPSARPNSNGPNSVTKFIRIGIADKNDNPPYF-DKSLYEAEVDENEDIQHTVLTVTAKD  1440

Query  501   PDLGRNGFVTYSIQKAPNSSIPFEVDTKSGQIMVTQ--DDLQASEHLLFVEASDQPVNPS  558
              D   +  + Y I    N    F V   +G I V    D      + L + ASD      
Sbjct  1441  HD--ESSRIRYEITSG-NIGGAFAVKNMTGAIYVAGALDYETRRRYELRLAASDN-----  1492

Query  559   EKRSALAVVTVDIRDQNENREPDFIGAPYEFWVGGNVD--IGTSVGQIRITEFNN--MGT  614
               +     V + ++D N+N  P F    Y   +    D  +   V Q+  T+ +      
Sbjct  1493  -LKENYTTVIIHVKDVNDN-PPVFERPTYRTQITEEDDRNLPKRVLQVTATDGDKDRPQN  1550

Query  615   ILYDLLHSYHEGV--------PFAVEEKSGTITVVDDLNK---FNRENYDFEAFVNNEGD  663
             I+Y L     +G+         F +   +G I V+  L++     R  + F  F  +EG 
Sbjct  1551  IVYFLTG---QGIDPDNPANSKFDINRTTGEIFVLKPLDRDQPNGRPQWRFTVFAQDEGG  1607

Query  664   LSLV--TNVTIHVVDPKDEKTILMKTGTTPIEF-HVKENEPNILIGKLGF----------  710
               LV   +V +++ D  D   I  +     + F +V EN      G  G           
Sbjct  1608  EGLVGYADVQVNLKDINDNAPIFPQG----VYFGNVTEN------GTAGMVVMTMTAVDY  1657

Query  711   -KTNGTNNLKFTIANQKDVTDH------ISITSD-GTLYTQ-KPLDRETRDIYRLTIIAE  761
                N  +N +   + +K+V +         I  D G + T    LDRE    Y + ++A 
Sbjct  1658  DDPNEGSNARLVYSIEKNVIEEETGSPIFEIEPDTGVIKTAVCCLDRERTPDYSIQVVA-  1716

Query  762   YNKGSVLGTGIYQVNVIVDDENDNKPLFERESYEGKITENSKSGTEVDLNYPIHVSDSDV  821
              + G + GTG    ++ V D ND  P F ++ +  ++ E   +         + V D D 
Sbjct  1717  MDGGGLKGTGT--ASIRVKDINDMPPQFTKDEWFTEVDETDGTALPEMPILTVTVHDEDE  1774

Query  822   GHNGQFTVTI-FGNGSEYFRLDRNLGKIQFTGANTPLDRE---TTSVYNLRLVATDEGGL  877
              +  Q+ V    G G++ F + RN           PLD E    ++ +  R+   D+G  
Sbjct  1775  TNKFQYKVIDNSGYGADKFTMVRNNDGTGSLKIVQPLDYEDQLQSNGFRFRIQVNDKG--  1832

Query  878   TSEAKLTIQVEDENDNSPLFVQFYLYPDKGIEVLQYDSTGSRVGHFEEASNSTPGLFVLT  937
                        ++NDN    V +         V++         HFE A+          
Sbjct  1833  -----------EDNDNDKYHVAYSWV------VVKLRDINDNKPHFERANVE--------  1867

Query  938   QNFLRIRKPKEKISPLVSLPEDIAVGSSVIKAIAEDKDDGENSVIKYEMVSETYIPNELS  997
                             VS+ ED  VG+ + K  A D D G  S + Y +   +    +  
Sbjct  1868  ----------------VSVFEDTKVGTELEKFKATDPDQGGKSKVSYSIDRSSDRQRQ--  1909

Query  998   SAPFHIIQYFMVQPTTGEVVIARALPAE--SEFRLNISATDKGGFKDHLSVRIT--VRDV  1053
                F I Q        G V I R+L  E     ++ I A D G      +  +T  V+D+
Sbjct  1910  ---FAINQ-------NGSVTIQRSLDREVVPRHQVKILAIDDGSPPKTATATLTVIVQDI  1959

Query  1054  NDHPPVFKKSWYNFDAEEASYTRNTLGRIEATDADFGSNAN-------ITYSIKNNSTVP  1106
             ND+ P F K +     E     +  +  I ATD D  S +N       +  S  +     
Sbjct  1960  NDNAPKFLKDYRPVLPEHVPPRK--VVEILATDDDDRSKSNGPPFQFRLDPSADDIIRAS  2017

Query  1107  FSISPTTGALRVDGL--------LDRETQDKYSFVVVAKDNPKSGKSLSSSVNVEVNVLD  1158
             F +         DG+         DRE Q +Y   +V KD+     + +S++ V +   D
Sbjct  2018  FKVEQDQKGANGDGMAVISSLRSFDREQQKEYMIPIVIKDHGSPAMTGTSTLTVIIG--D  2075

Query  1159  INDNPPVFYGYDDLIPNPEANNFSNHNYQQKIPVYYATAAENSPMGTPITRVFANDSDFT  1218
             +NDN             P + +   +NYQ + P             TPI RV+  D D  
Sbjct  2076  VNDNK----------MQPGSKDIFVYNYQGQSP------------DTPIGRVYVYDLD--  2111

Query  1219  GNGNGLILFDIPYRK-----SRQNLFAIDSKEGIVT  1249
                     +D+P +K          F +D   G+VT
Sbjct  2112  -------DWDLPDKKFYWEAMEHPRFKLDEDSGMVT  2140


 Score = 107 bits (268),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 163/676 (24%), Positives = 287/676 (42%), Gaps = 85/676 (13%)

Query  51    PRNNLNLQPVDRDED-----VHFFTYR------------DINRTTVSLLLAKSLEDLVDN  93
             P+  L +   D D+D     V+F T +            DINRTT  + + K L    D 
Sbjct  1532  PKRVLQVTATDGDKDRPQNIVYFLTGQGIDPDNPANSKFDINRTTGEIFVLKPL----DR  1587

Query  94    DSPRNVLKFKVTC-DYDDGEDTITSSLSVTVYVEDINDHAPVFEGAPYHIDVDELTPVGL  152
             D P    +++ T    D+G + +     V V ++DIND+AP+F    Y  +V E    G+
Sbjct  1588  DQPNGRPQWRFTVFAQDEGGEGLVGYADVQVNLKDINDNAPIFPQGVYFGNVTENGTAGM  1647

Query  153   TVFRGIRAADHDKPNT-PNSDVQYAI---VAGNERGK--FALESSHQAFLILRKSLDYDS  206
              V   + A D+D PN   N+ + Y+I   V   E G   F +E            LD + 
Sbjct  1648  VVMT-MTAVDYDDPNEGSNARLVYSIEKNVIEEETGSPIFEIEPDTGVIKTAVCCLDRER  1706

Query  207   GDRDFLLTITASDRGTPPKSTNATVRIKVNDNDDLPPKFTKGVYRTKIKEFYPITGARIH  266
                D+ + + A D G    +  A++R+K  D +D+PP+FTK  + T++ E     G  + 
Sbjct  1707  TP-DYSIQVVAMDGGGLKGTGTASIRVK--DINDMPPQFTKDEWFTEVDE---TDGTALP  1760

Query  267   QRLKFNPSIHAFDQDLAIDSPIRYDII--AGNERHLFSLDHVN---GSLFLEREIDLDAE  321
             +      ++H  D+     +  +Y +I  +G     F++   N   GSL + + +D + +
Sbjct  1761  EMPILTVTVHDEDET----NKFQYKVIDNSGYGADKFTMVRNNDGTGSLKIVQPLDYEDQ  1816

Query  322   RSLPGNTFVLQIQASQMDN---PLKTGVARVEVEIMDLNDNLPEFEVDFYNISIVENLPN  378
                 G  F +Q+     DN         + V V++ D+NDN P FE     +S+ E+   
Sbjct  1817  LQSNGFRFRIQVNDKGEDNDNDKYHVAYSWVVVKLRDINDNKPHFERANVEVSVFEDTKV  1876

Query  379   GFSVLQIIATDQDQGDNAEFSYQLE---DKSGAFTLDSRTGWLTVRDQTVLDRE--KRST  433
             G  + +  ATD DQG  ++ SY ++   D+   F ++ + G +T+  Q  LDRE   R  
Sbjct  1877  GTELEKFKATDPDQGGKSKVSYSIDRSSDRQRQFAIN-QNGSVTI--QRSLDREVVPRHQ  1933

Query  434   ISMRVYAKEKVPSVVTSQLGASSVNIEVTLLDANDNNPTFIPNNLYEFIITTKAKKGDLV  493
             + +        P   T+ L        V + D NDN P F+ +  Y  ++        +V
Sbjct  1934  VKILAIDDGSPPKTATATL-------TVIVQDINDNAPKFLKD--YRPVLPEHVPPRKVV  1984

Query  494   GQLHAIDPDLGRNGFVTYSIQKAPN------SSIPFEVDTKS----GQIMVTQ----DDL  539
               L   D D  ++    +  +  P+      +S   E D K     G  +++     D  
Sbjct  1985  EILATDDDDRSKSNGPPFQFRLDPSADDIIRASFKVEQDQKGANGDGMAVISSLRSFDRE  2044

Query  540   QASEHLLFVEASDQPVNPSEKRSALAVVTVDIRDQNENR-EPDFIGAPYEFWVGGNVDIG  598
             Q  E+++ +   D   + S   +  + +TV I D N+N+ +P         + G + D  
Sbjct  2045  QQKEYMIPIVIKD---HGSPAMTGTSTLTVIIGDVNDNKMQPGSKDIFVYNYQGQSPD--  2099

Query  599   TSVGQIRITEFNNMGTILYDLLHSYHEGVPFAVEEKSGTITVVDDLNKFNRENYDFEAFV  658
             T +G++ + + ++             E   F ++E SG +T+     +  R +  F+ + 
Sbjct  2100  TPIGRVYVYDLDDWDLPDKKFYWEAMEHPRFKLDEDSGMVTMRAGTRE-GRYHLRFKVYD  2158

Query  659   NNEGDLSLVTNVTIHV  674
                    +  NVT+ V
Sbjct  2159  RKHTQTDIPANVTVTV  2174


 Score = 104 bits (260),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 212/828 (26%), Positives = 350/828 (42%), Gaps = 94/828 (11%)

Query  116   TSSLSVTVYVEDINDHAPVFEGAPYHID--VDELTPVGLTVFRGIRAADHDKPNTPNSDV  173
             T +  V + V+D+ND  P F   P  +   V    P    VF  ++A D D     + ++
Sbjct  524   TDNQRVIILVKDVNDEPPYFINRPLPMQAVVQLNAPPNTPVFT-LQARDPDT----DHNI  578

Query  174   QYAIVAGNERGKFALESSHQAFLILRKSLDYDSGDRDFLLTITASDRGTPPKSTNATVRI  233
              Y IV     G+F  E   ++ ++  +  D    D +++L + A D+             
Sbjct  579   HYFIVRDRTGGRF--EVDERSGVVRTRGTDLFQLDMEYVLYVKAEDQNG-----------  625

Query  234   KVNDN--DDLPPKFTKGVYRTKIKEFY-PITGARIHQRLKFNPSIHAFDQDLAIDSPIRY  290
             KV+D      P +    V   +  +FY P   A I +  K +  I +       D  IRY
Sbjct  626   KVDDRRFQSTPEERLSIVGGKRAPQFYMPSYEAEIPENQKKDSDIISIKAKSFADREIRY  685

Query  291   DIIA-GNERHLFSLDHVNGSLFLEREIDLDAERSLPGNTFVLQIQASQMDNPLKTGVARV  349
              + A G     F++   +G + L +E+D +  R    + + L + A++      T V  +
Sbjct  686   TLKAQGQGAGTFNIGPTSGIVKLAKELDFEDLRQ--PHVYSLIVTATEDSGGFSTSVD-L  742

Query  350   EVEIMDLNDNLPEFEV-DFYNISIVENLPNGFSVLQIIATDQDQGDNAEFSYQLEDKSGA  408
              + + D+NDN P+FE+ D+   ++ E++P G S+L++ A D D G NAE  Y + D    
Sbjct  743   TIRVTDVNDNAPKFELPDYQAHNVDEDIPLGTSILRVKAMDSDSGSNAEIEYLVSDDH--  800

Query  409   FTLDSRTGWLTVRDQTVLDREKRSTISMRVYAKEKVPSVVTSQLGASSVNIEVTLLDAND  468
             F +DS    + V ++ +      +     V AK+K          +    + V   + ND
Sbjct  801   FAVDSNG--IIVNNKQLDADNNNAYYEFIVTAKDK-----GEPPKSGVATVRVYTKNKND  853

Query  469   NNPTFIPNNLYEFIITTKAKKGDLVGQLHAIDPDLGRNGFVTYSIQKAPNSSIPFEVDTK  528
               P F    +Y   +   A    LV  + A D D G N  V +       SS  F ++  
Sbjct  854   EEPKF-SQQVYTPNVDENAGPNTLVTTVVASDKD-GDN--VRFGFVGGGTSSGQFVIEDI  909

Query  529   SGQIMVTQD--DLQASEHLLFVEASDQ---PVNPSEK-RSALAVVTVDIRDQNENREPDF  582
             +G I +      L   ++ L V A D     VN  +   ++ AVV V I D N+N+    
Sbjct  910   TGVIRLHNKAISLDKDKYELNVTAMDDGSCCVNGDQTIHTSTAVVVVFITDVNDNKPVFK  969

Query  583   IGAPYEFWVGGNVDIGTSVGQIRITEFNNM--GTILYDLLHSYHE-GVPFAVEEKSGTIT  639
               + Y   V      G+ V ++  T+ +    G + Y ++   ++ G  F V+E++G ++
Sbjct  970   DCSTYYPKVEEGAPNGSPVIKVVATDEDKGVNGQVKYSIVQQPNQKGTKFTVDEETGEVS  1029

Query  640   VVDDLNK-FNRENYDFEAFVN------NEGDLSL--VTNVTIHVVDPKDEKTILMKTGTT  690
                  NK F+RE  D + FV+      ++GD SL  V + T+ + D  D   +  +    
Sbjct  1030  T----NKVFDREGDDGK-FVSVTVKATDQGDPSLEGVCSFTVEITDVNDNPPLFDRQKYV  1084

Query  691   PIEFHVKENEP---NIL---IGKLGFKTNGTNNLKFTIANQKDVTDHISITSD-GTLYTQ  743
                 +VK++     NIL           NG      T     +  ++  I ++ G +  +
Sbjct  1085  E---NVKQDASIGTNILRVSASDEDADNNGAIVYSLTAPFNPNDLEYFEIQAESGWIVLK  1141

Query  744   KPLDRETRDIYRLTIIAEYNKGSVLGTGIYQVNVIVDDENDNKPLFERESYEGKI--TEN  801
             KPLDRET   Y+L  +A+ +KG    +   +V + V D  +N P+++   Y G I   EN
Sbjct  1142  KPLDRET---YKLEAMAQ-DKGYPPLSRTVEVQIDVVDRANNPPVWDHTVY-GPIYVKEN  1196

Query  802   SKSGTEVDLNYPIHVSDSDVGHNGQFTVTIFG-----NGSEYFRLDR---NLGKIQFTGA  853
                G +V     I  S    G+   F   + G     N    F L +   N         
Sbjct  1197  MPVGGKV---VSIKASSGIEGNPTVFYRLMPGSTAQTNKFHTFYLQQRPDNGDTWADIKV  1253

Query  854   NTPLDRETTSVYNLRLVATDEGG--LTSEAKLTIQVEDENDNSPLFVQ  899
             N PLD E+   YNL +   + G   L SEA + I +ED ND  PLF +
Sbjct  1254  NHPLDYESIKEYNLTIRVENNGAQQLASEATVYIMLEDVNDEIPLFTE  1301


 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 155/685 (23%), Positives = 266/685 (39%), Gaps = 112/685 (16%)

Query  854   NTPLDRETTSVYNLRLVATDEGGL-TSEAKLTIQVEDENDNSPLFVQFYLYPDKGIEVLQ  912
             N PLDRE  + Y+L + A+D  GL  + +K+ I V DENDN P+F        K ++  +
Sbjct  261   NRPLDREERAHYDLSVEASDVDGLDRTVSKIQITVLDENDNRPIF--------KSLD-YK  311

Query  913   YDSTGSRVGHFEEASNSTPGLFVLTQNFLRIRKPKEKISPLVSLPEDIAVGSSVIKAIAE  972
             +   G +    E  S+ T   F +           +KI+  +  P ++ +       I  
Sbjct  312   FAIAGQKSASMESNSSVTYQRFAIMGKVEATDADGDKIAYRLKSPSNVVIIVPQTGEIML  371

Query  973   DKDDGENSVIKYEMVSETYIPNELSSAPFHIIQYFMVQPTTGEVVIARALPAESEFRLNI  1032
               +   N ++   +  +   P+ +S+ P  ++  F+            A P  S    ++
Sbjct  372   AGEPTSNELLIEVIAHDLRYPSLVSAKPAKVLLEFLA-----------AEPV-SFIMQHL  419

Query  1033  SATDKGGFKDHLSVRITVRDVNDHPPVFKKSWYNFDAEEASYTRNTLGRIEATDADFGSN  1092
                D      H   R   R V    P  +  +   D +    +   L +   TD +    
Sbjct  420   EHDDINNHSHHREKRRVTRAVR---PTKRIEFTEADGDTEGKSVFQLEK--ETDKE----  470

Query  1093  ANITYSIKNNSTVPFSISPTTGALRVDGLLDRETQDKYS----FVVVAKDNPKSGKSLSS  1148
                T+ I++++  P+    T GA+RV    D E          +V++      +G   + 
Sbjct  471   ---TFKIRDDN--PWVTVETNGAVRVKKKWDYEELGPEKTIDFWVIITNMGHNAGIKYTD  525

Query  1149  SVNVEVNVLDINDNPPVFYGYDDLIPNPEANNFSNHNYQQKIPVYYATAAENSPMGTPIT  1208
             +  V + V D+ND PP F                     + +P+  A    N+P  TP+ 
Sbjct  526   NQRVIILVKDVNDEPPYF-------------------INRPLPM-QAVVQLNAPPNTPVF  565

Query  1209  RVFANDSDFTGNGNGLILFDIPYRKSRQNLFAIDSKEGIVTTIGKLDYESEKSHNITILA  1268
              + A D D   N +  I+     R      F +D + G+V T G   ++ +  + + + A
Sbjct  566   TLQARDPDTDHNIHYFIV-----RDRTGGRFEVDERSGVVRTRGTDLFQLDMEYVLYVKA  620

Query  1269  SDLGSPSLSSTAILIVNIIDVPEDIKSI----ERPVFAHRYYEVEVEENVPVPLRVLTLN  1324
              D       +  +        PE+  SI      P F    YE E+ EN      ++++ 
Sbjct  621   ED------QNGKVDDRRFQSTPEERLSIVGGKRAPQFYMPSYEAEIPENQKKDSDIISIK  674

Query  1325  VTEPYRSHKLRYSIVAENSSDVKRTFRIDPRNGSLYIIESPDRE---QKALYELIIRLDQ  1381
               + +   ++RY++ A+       TF I P +G + + +  D E   Q  +Y LI+    
Sbjct  675   A-KSFADREIRYTLKAQGQG--AGTFNIGPTSGIVKLAKELDFEDLRQPHVYSLIV----  727

Query  1382  YKVGRDMTVMIYPVTNERLGNLGLNEVKVIVRVTDVNDNAPKFTVTGRPMIAA--IPTTA  1439
                             E  G    + V + +RVTDVNDNAPKF +   P   A  +    
Sbjct  728   -------------TATEDSGGFSTS-VDLTIRVTDVNDNAPKFEL---PDYQAHNVDEDI  770

Query  1440  NYGYNVIRLQATDPDLGLNGEVRYQILSRADEASRRFAIDPVTGQVRGISTFTKEAGKVF  1499
               G +++R++A D D G N E+ Y +      +   FA+D     V             +
Sbjct  771   PLGTSILRVKAMDSDSGSNAEIEYLV------SDDHFAVDSNGIIVNNKQLDADNNNAYY  824

Query  1500  GFDVKATDRSGADDGKSSIANVFVY  1524
              F V A D+   +  KS +A V VY
Sbjct  825   EFIVTAKDK--GEPPKSGVATVRVY  847


 Score = 58.5 bits (140),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 131/546 (24%), Positives = 227/546 (42%), Gaps = 89/546 (16%)

Query  1016  VVIARALPAE--SEFRLNISATDKGGFKDHLS-VRITVRDVNDHPPVFKKSWYNF---DA  1069
             +V  R L  E  + + L++ A+D  G    +S ++ITV D ND+ P+FK   Y F     
Sbjct  258   LVTNRPLDREERAHYDLSVEASDVDGLDRTVSKIQITVLDENDNRPIFKSLDYKFAIAGQ  317

Query  1070  EEASYTRNT---------LGRIEATDADFGSNANITYSIKNNSTVPFSISPTTGALRVDG  1120
             + AS   N+         +G++EATDAD      I Y +K+ S V   I P TG + + G
Sbjct  318   KSASMESNSSVTYQRFAIMGKVEATDAD---GDKIAYRLKSPSNVVI-IVPQTGEIMLAG  373

Query  1121  LLDRETQDKYSFVVVAKDNPKSGKSLSSSVNVEVNVLDINDNPPVFYGYDDLIPNPEANN  1180
                  T ++    V+A D      SL S+   +V +L+     PV +    L  + + NN
Sbjct  374   ---EPTSNELLIEVIAHD--LRYPSLVSAKPAKV-LLEFLAAEPVSFIMQHL-EHDDINN  426

Query  1181  FSNHNYQQKIPVYYATAAENSPMGTPITRVFANDSDFTGNGNGLILFDIPYRKSRQ----  1236
              S+H  ++++          +    P  R+   ++D  G+  G  +F +     ++    
Sbjct  427   HSHHREKRRV----------TRAVRPTKRIEFTEAD--GDTEGKSVFQLEKETDKETFKI  474

Query  1237  ---NLFAIDSKEGIVTTIGKLDYES---EKSHNITILASDLGSPS---LSSTAILIVNII  1287
                N +      G V    K DYE    EK+ +  ++ +++G  +    +    +I+ + 
Sbjct  475   RDDNPWVTVETNGAVRVKKKWDYEELGPEKTIDFWVIITNMGHNAGIKYTDNQRVIILVK  534

Query  1288  DVPEDIKSIERPVFAHRYYEVE--VEENVPVPLRVLTLNVTEPYRSHKLRYSIVAENSSD  1345
             DV +     E P F +R   ++  V+ N P    V TL   +P   H + Y IV + +  
Sbjct  535   DVND-----EPPYFINRPLPMQAVVQLNAPPNTPVFTLQARDPDTDHNIHYFIVRDRTGG  589

Query  1346  VKRTFRIDPRNGSLYIIESPDREQKALYELIIRL-DQYKVGRDMTVMIYPVTNERLGNLG  1404
                 F +D R+G +    +   +    Y L ++  DQ     D      P   ERL  +G
Sbjct  590   ---RFEVDERSGVVRTRGTDLFQLDMEYVLYVKAEDQNGKVDDRRFQSTP--EERLSIVG  644

Query  1405  LNEVKVIVRVTDVNDNAPKFTVTGRPMIAAIPTTANYGYNVIRLQATDPDLGLNGEVRYQ  1464
                             AP+F +      A IP       ++I ++A       + E+RY 
Sbjct  645   -------------GKRAPQFYMPSYE--AEIPENQKKDSDIISIKAKS---FADREIRYT  686

Query  1465  ILSRADEASRRFAIDPVTGQVRGISTFTKEAGK---VFGFDVKATDRSGADDGKSSIANV  1521
             + ++  + +  F I P +G V+       E  +   V+   V AT+ SG   G S+  ++
Sbjct  687   LKAQG-QGAGTFNIGPTSGIVKLAKELDFEDLRQPHVYSLIVTATEDSG---GFSTSVDL  742

Query  1522  FVYVLD  1527
              + V D
Sbjct  743   TIRVTD  748


 Score = 40.8 bits (94),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 36/68 (53%), Gaps = 2/68 (3%)

Query  740  LYTQKPLDRETRDIYRLTIIAEYNKGSVLGTGIYQVNVIVDDENDNKPLFERESYEGKIT  799
            L T +PLDRE R  Y L++ A    G  L   + ++ + V DENDN+P+F+   Y+  I 
Sbjct  258  LVTNRPLDREERAHYDLSVEASDVDG--LDRTVSKIQITVLDENDNRPIFKSLDYKFAIA  315

Query  800  ENSKSGTE  807
                +  E
Sbjct  316  GQKSASME  323


 Score = 37.7 bits (86),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 81/185 (44%), Gaps = 43/185 (23%)

Query  268  RLKFNPSIHAF-----DQDLAIDSPIRYDIIAGNERHLFSLDH---------------VN  307
            R++  P + AF     D++LA    +RY II GN    F+L                 +N
Sbjct  190  RVRGVPLMQAFSGSILDEELATPKKVRYTIIDGNVDDAFALQERKANKNIQISAKSLVIN  249

Query  308  G----SLFLEREIDLDAERSLPGNTFVLQIQASQMDNPLKTGVARVEVEIMDLNDNLPEF  363
            G     ++L     LD E       + L ++AS +D  L   V+++++ ++D NDN P F
Sbjct  250  GDDESGVWLVTNRPLDREERA---HYDLSVEASDVDG-LDRTVSKIQITVLDENDNRPIF  305

Query  364  EVDFYNISIVENLPNG-----------FSVL-QIIATDQDQGDNAEFSYQLEDKSGAFTL  411
            +   Y  +I                  F+++ ++ ATD D GD  + +Y+L+  S    +
Sbjct  306  KSLDYKFAIAGQKSASMESNSSVTYQRFAIMGKVEATDAD-GD--KIAYRLKSPSNVVII  362

Query  412  DSRTG  416
              +TG
Sbjct  363  VPQTG  367


 Score = 33.9 bits (76),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 77/174 (44%), Gaps = 29/174 (17%)

Query  392  QGDNAEFSYQLEDKSGAFTLDSRTG-WLTVRDQTVLDREKRSTISMRVYAKEKVPSVVTS  450
            Q   A  + Q+  KS     D  +G WL       LDRE+R+   + V A +        
Sbjct  231  QERKANKNIQISAKSLVINGDDESGVWLVT--NRPLDREERAHYDLSVEASD------VD  282

Query  451  QLGASSVNIEVTLLDANDNNPTFIPNNLYEFIITTKA------------KKGDLVGQLHA  498
             L  +   I++T+LD NDN P F   + Y+F I  +             ++  ++G++ A
Sbjct  283  GLDRTVSKIQITVLDENDNRPIFKSLD-YKFAIAGQKSASMESNSSVTYQRFAIMGKVEA  341

Query  499  IDPDLGRNGFVTYSIQKAPNSSIPFEVDTKSGQIMVTQDDLQASEHLLFVEASD  552
             D D  +   + Y ++   N  I   +  ++G+IM+  +   ++E L+ V A D
Sbjct  342  TDADGDK---IAYRLKSPSNVVI---IVPQTGEIMLAGEPT-SNELLIEVIAHD  388


>FAT2_DROME unnamed protein product
Length=4699

 Score = 249 bits (637),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 335/1370 (24%), Positives = 581/1370 (42%), Gaps = 209/1370 (15%)

Query  115   ITSSLSVTVYVEDINDHAPVFEGAPYHIDVDELTPVGLTVFRGIRAADHDKPNTPNSDVQ  174
             + + + ++V + D+ND  P  E   Y++ + E    G  + + I A D+D  +  N+ + 
Sbjct  2321  VYAEVVLSVSIMDVNDCYPEIESDIYNLTIPENASFGTQILK-INATDND--SGANAKLS  2377

Query  175   YAI--VAGNERGKFALESSHQAFLILRKSLDYDSGDRDFLLTITASDRGTPPKSTNATVR  232
             Y I  + G    +          L L+  LDY+      ++ +   D G+P  S+ + V 
Sbjct  2378  YYIESINGQNNSELFYIDVTDGNLYLKTPLDYEQIKYHHIV-VNVKDHGSPSLSSRSNVF  2436

Query  233   IKVNDNDDLPPKFTKGVYRTKIKEFYPITGARIHQRLKFNPSIHAFDQDLAIDSPIRYDI  292
             I V D +D  P F +  Y TK+        +    R +F     A+D+D++    + Y I
Sbjct  2437  ITVKDLNDNAPCFVEPSYFTKV--------SVAAVRGQFVALPKAYDKDISDTDSLEYKI  2488

Query  293   IAGNERHLFSLDHVNGSLFLEREIDLDAERSLPGNTFVLQIQASQMDNPLKTGVARVEVE  352
             + GNE   +S+D + G + L+  ++   + S      VL I  S   + + T  AR+++ 
Sbjct  2489  VYGNELQTYSIDKLTGVISLQNMLNFTDKSST-----VLNISVS---DGVHTAYARLKIS  2540

Query  353   IMDLNDNLPEFEVDFYNISIVENLPNGFSVLQIIATDQDQGDNAEFSYQL--EDKSGAFT  410
             ++  N   P F+   Y   + ENL +G +++ + A+D D G  A   Y++  E+    F 
Sbjct  2541  LLPENVYSPLFDQSTYEAQVPENLLHGHNIITVKASDGDFGTYANLYYEIVSEEMKKIFL  2600

Query  411   LDSRTGWLTVRDQTVLDREKRSTISMRVYAKEKVPSVVTSQLGASSVNIEVTLLDANDNN  470
             +D  TG +T +     DREK+    + +   +        + G +S  ++V ++D NDN 
Sbjct  2601  IDQTTGVITSK--VTFDREKKDEYVVLLKVSDG-----GGKFGFAS--LKVIVVDVNDNV  2651

Query  471   PTFIPNNLYEFIITTKAKKGDLVGQLHAIDPDLGRNGFVTYSI-QKAPNSSIP--FEVDT  527
             P F+    Y+ +++T  +    +  + A D D+  NG V + I QK+ + ++    E++ 
Sbjct  2652  PYFLLKE-YKMVVSTTVEANQTILTVKAKDDDIVDNGSVHFQIVQKSNDKAVKDVIEINE  2710

Query  528   KSGQIMVTQ--DDLQASEHLLFVEASD--QPVNPSEKRSALAVVTVDIRDQNENREPDFI  583
             K+G I+     +    + +  FV ASD  +P   SE   ++ ++  D         P F 
Sbjct  2711  KTGDIVFKSKAESYGVNSYQFFVRASDRGEPQFHSEVPVSIEIIETDAN------IPTFE  2764

Query  584   GAPYEFWVGGNVDIGTSVGQIR-ITEFNNMGTILYDLLHSYHEGVPFAVEEKSGTITVVD  642
              +     +  +   GT + ++  I  +    +I  D  H       F + + SG + +  
Sbjct  2765  KSSVLLKIIESTPPGTVLTKLHMIGNYTFKFSIAADQDH-------FMISD-SGELILQQ  2816

Query  643   DLNKFNRENYDFEAFVNNEGDLSLVTNVTIHVVDPKDEKTILMKTGTTPIEFHVKENEPN  702
              L++  +E+++    V     + +       ++D +DE     K   T     V EN   
Sbjct  2817  TLDREQQESHNL-IVVAETSTVPVFFAYADVLIDVRDENDNYPKFDNTFYSASVAENSEK  2875

Query  703   IL----IGKLGFKTNGTNNLKFTIA----NQKDVTDHISITSDGTLYTQKPLDRETRDIY  754
             ++    +      T    ++++ +     N +++ D I I S G +     LDRE +  Y
Sbjct  2876  VISLVKVSATDADTGPNGDIRYYLESDTENIQNIFD-IDIYS-GWITLLTSLDREVQSEY  2933

Query  755   RLTIIAEYNKGSVLGTGIYQVNVIVDDENDNKPLFERESYEGKITENSKSGTEVDLNYPI  814
                +IA  N G         V + + D NDN P+F+       + EN+  GT V +N  +
Sbjct  2934  NFKVIAADN-GHPKHDAKVPVTIKIVDYNDNAPVFKLPIEGLSVFENALPGT-VLIN--L  2989

Query  815   HVSDSDVGHNGQFTVTIFGNGSEYFRLDRNLGKIQFTGANTPLDRETTSVYNLRLVATDE  874
              + D D+         + G+    F++    GK        PLDRE    YNL ++ATD 
Sbjct  2990  LLIDPDIEKQEMDFFIVSGDKQAQFQI----GKSGELFIAKPLDREQLMFYNLSIIATD-  3044

Query  875   GGLTSEAKLTIQVEDENDNSPLFVQFYLYPDKGIEVLQYDSTGSRVGHFEEASNSTPGLF  934
             G  T++A + I V+D NDN+P  +                                    
Sbjct  3045  GKFTAKANVEIDVKDINDNTPYCL------------------------------------  3068

Query  935   VLTQNFLRIRKPKEKISPLVSLPEDIAVGSSVIKAIAEDKDDGENSVIKYEMVSETYIPN  994
                       KP+  IS      E I++G+++++  A D D        ++     Y+  
Sbjct  3069  ----------KPRYHIST----NESISIGTTLVEVKAIDFD--------FQSKLRFYLSG  3106

Query  995   ELSSAPFHIIQYFMVQPTTGEVVIARALPAES--EFRLNISATDKGGFKDHL--SVRITV  1050
             + +         F +   +G + +A AL  E+  +++L     D   F       + ITV
Sbjct  3107  KGADD-------FSIGKESGILKVASALDRETTPKYKLVAHVQDGKDFTQECFSEIIITV  3159

Query  1051  RDVNDHPPVFKKSWYNFDAEEASYTRNTLGRIEATDADFGSNANITYSIKNNSTVPFSIS  1110
              D+ND+ P+F  + Y     E +     + ++ A D DFG N  I YS+   +   F IS
Sbjct  3160  NDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGENHDYFKIS  3219

Query  1111  PTTGALRVDGLLDRETQDKYSFVVVAKDN--PKSGKSLSSSVNVEVNVLDINDNPPVFYG  1168
              +TG +R+   LDRET   ++  V A+D   PK    L S   V VN+LDINDNPP    
Sbjct  3220  KSTGIIRLHKSLDRETISLFNLTVKAEDCGVPK----LHSIATVAVNILDINDNPP----  3271

Query  1169  YDDLIPNPEANNFSNHNYQQKIPVYYATAAENSPMGTPITRVFANDSDFTGNGNGLILFD  1228
                         FS   Y  KI        EN+  GT + +V+A   D   N       D
Sbjct  3272  -----------EFSMRQYSCKI-------LENATHGTEVCKVYATSIDIGVNA------D  3307

Query  1229  IPY---RKSRQNLFAIDSKEGIVTTIGKLDYESEKSHNITILASDLGSPSLSSTAILIVN  1285
             I Y     + Q  F +DS  G +     LDYE  K + +TI A D G+P LS+ A + ++
Sbjct  3308  IHYFIMSGNEQGKFKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNIS  3367

Query  1286  IIDVPEDIKSIERPVFAHRYYEVEVEENVPVPLRVLTLNVTEPYRSHKLRYSIVAENSSD  1345
             I+D+ ++      P F    Y + V E++ V  ++L +  T+         +   E   +
Sbjct  3368  ILDINDN-----SPTFLQNLYRINVNEDIFVGSKILDVKATDEDSDVNGLVTYNIERGDN  3422

Query  1346  VKRTFRIDPRNGSLYIIESPDREQKALYELIIR-LDQYKVGRDMTVMIYPVTNERLGNLG  1404
             + + F IDP+NG++ +    DRE  + Y L I+  DQ    R                  
Sbjct  3423  IGQ-FSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQR------------------  3463

Query  1405  LNEVKVIVRVTDVNDNAPKFTVTGRPMIAAIPTTANYGYNVIRLQATDPD  1454
              N V + + + D NDNAP F+ +   ++  +      GY  +  + +D D
Sbjct  3464  CNSVPININILDTNDNAPIFSSSNYSVV--LQENRLLGYVFLTFKISDAD  3511


 Score = 232 bits (592),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 341/1335 (26%), Positives = 559/1335 (42%), Gaps = 219/1335 (16%)

Query  242   PPKFTKGVYRTKIKEFYPITGARIHQRLKFNPS---------IHAFDQDLAIDSPIRYDI  292
             P ++ + V+R +   F         Q L  N S         I A D+DL  +  + + I
Sbjct  760   PSRYGQNVHRPEFVNF--------PQELSINESVQLGETVAWIEAKDRDLGYNGKLVFAI  811

Query  293   IAGNERHLFSLDHVNGSLFLEREIDLDAERSLPGNTFVLQIQASQMDNPLKTGVARVEVE  352
               G+   +F +D   G L +     LD ER    N +VL I    + NP K+    + + 
Sbjct  812   SDGDYDSVFRIDPDRGELQIIGY--LDRERQ---NEYVLNITVYDLGNPTKSTSKMLPIT  866

Query  353   IMDLNDNLPEFEVDFYNISIVENLPNGFSVLQIIATDQDQGDNAEFSYQLEDKSGAFTLD  412
             I+D+NDN P  +       + E+   G  V  + ATD D G NA+ +Y L  +   FT++
Sbjct  867   ILDVNDNRPVIQKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYALSVECSDFTVN  926

Query  413   SRTGWLTVRDQTVLDREKRSTISMRVYAKEKVPSVVTSQLGASSVNIEVTLLDANDNNPT  472
             + TG L  R    LDREK+   ++ + AK+    V++S+       + V + D NDN P 
Sbjct  927   ATTGCL--RLNKPLDREKQDNYALHITAKDGGSPVLSSE-----ALVYVLVDDVNDNAPV  979

Query  473   FIPNNLYEFIITTKAKKGDLVGQLHAIDPDLGRNGFVTYSIQKAPNSSIPFEVDTKSGQI  532
             F     Y F +     +G ++  + A+D D+G N  + +S+++       F +D  +G I
Sbjct  980   FGVQE-YIFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLKEETQDEELFRIDKHTGAI  1038

Query  533   MVTQDDLQASE---HLLFVEASDQPVNPSEKRSALAVVTVDIRDQNENR-EPDFIGAPYE  588
               TQ  L       H L V A D   +PS   S +++V + I D NENR  P+F    YE
Sbjct  1039  R-TQGYLDYENKQVHNLIVSAIDGG-DPS-LTSDMSIVIM-IIDVNENRFAPEFDDFVYE  1094

Query  589   FWVGGNVDIGTSVGQIRITEFNNM---GTILYDLLHSYHEGVPFAVEEKSGTITVVDDLN  645
               V  N   GT V  +   + + +     I Y +      G+ FAV ++ G+IT    L+
Sbjct  1095  GKVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGDGLGI-FAVNDQ-GSIT---SLS  1149

Query  646   KFNRENYDFEAFVNNEGDLSLV-----TNVTIHVVDPKDEKTILMKTGTTPIEFHVK---  697
             + + E  +F        D ++V       V I V +  D   +  K    P+ ++V    
Sbjct  1150  QLDAETKNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNIPLTDK----PV-YYVNVTE  1204

Query  698   ---ENEPNILIGKLGFKTNGTNNLKFTIANQKDVTDHISITSDGTLY--TQKPLDRETRD  752
                EN   I +       + T  + + I +  ++  +  I S   +   T++ LDRE + 
Sbjct  1205  ASVENVEIITLKAFDPDIDPTQTITYNIVS-GNLVGYFEIDSKTGVIKTTERKLDRENQA  1263

Query  753   IYRLTIIAEYNKGSVLGTGIYQVNVIVDDENDNKPLFERESYEGKITENSKSGTEVDLNY  812
              + L + A  + GS + +   ++ V V D NDN P F++  Y+ ++  ++     +   +
Sbjct  1264  EHILEV-AISDNGSPVLSSTSRIVVSVLDINDNSPEFDQRVYKVQVPSSATVNQSI---F  1319

Query  813   PIHVSDSDVGHNGQFTVTI-FGNGSEYFRLDRNLGKIQFTGANTPLDRETTSVYNLRLVA  871
              +H  DSD G NG+ T +I  G G   FR+D   G I       PLD +           
Sbjct  1320  QVHAIDSDSGENGRITYSIKSGKGKNKFRIDSQRGHIHIA---KPLDSD-----------  1365

Query  872   TDEGGLTSEAKLTIQVEDENDNSPLFVQFYLYPDKGIEVLQYDSTGSRVGHFEEASNSTP  931
                    +E ++ I+ ED              P K     Q       V      S + P
Sbjct  1366  -------NEFEIHIKAEDNG-----------IPKKS----QTARVNIVVVPVNPNSQNAP  1403

Query  932   GLFVLTQNFLRIRKPKEKISPLVSLPEDIAVGSSVIKAIAEDKDDGENSVIKYEMVSETY  991
                      L +RK  E +   V L E+   G  V + +A D D   N  + Y       
Sbjct  1404  ---------LIVRKTSENV---VDLTENDKPGFLVTQILAVDDD---NDQLWYN------  1442

Query  992   IPNELSSAPFHIIQYFMVQPTTGEVVIARALPAESE--FRLNISATDKGGFKDHLSVRIT  1049
             I N      F+I Q        G +++++ L  E++  + L IS TD G F    ++ + 
Sbjct  1443  ISNGNDDNTFYIGQ------DNGNILLSKYLDYETQQSYNLTISVTD-GTFTAFTNLLVQ  1495

Query  1050  VRDVNDHPPVFKKSWYNFDAEEASYTRNTLGRIEATDADFGSNANITYSIKN----NSTV  1105
             V D+ND+PP F K  Y+ +  E     + + ++ ATD D   +  + Y +      +S  
Sbjct  1496  VIDINDNPPQFAKDVYHVNISENIEEESVIMQLHATDRD--EDKKLFYHLHATQDPSSLA  1553

Query  1106  PFSISPTTGALRVDGLLDRETQDKYSFVVVAKDNPKSGKSLSSSVNVEVNVLDINDNPPV  1165
              F I   +G + V   LD E   ++  +V  KD    GK   +   + VNV D ND+ P 
Sbjct  1554  LFRIDSISGNVIVTQRLDFEKTAQHILIVFVKDQGAPGKR--NYAKIIVNVHDHNDHHP-  1610

Query  1166  FYGYDDLIPNPEANNFSNHNYQQKIPVYYATAAENSPMGTPITRVFANDSDFTGNGNGLI  1225
                            F+    Q K+P       E++ +G+ +  V A D D   N     
Sbjct  1611  --------------EFTAKIIQSKVP-------ESAAIGSKLAEVRAIDRDSGHNA----  1645

Query  1226  LFDIPYRKSRQNL---FAIDSKEGIVTTIGKLDYESEKSHNITILASDLGSPSLSSTAIL  1282
               +I Y     N+   F ID   GI+T  G L+    + + + + A DLG+P LSS  I 
Sbjct  1646  --EIQYSIITGNVGSVFEIDPTFGIITLAGNLNINKIQEYMLQVKAVDLGNPPLSS-QIP  1702

Query  1283  IVNIIDVPEDIKSIERPVFAHRYYEVEVEENVPVPLRVLTLNVTEPYRSHKLRYSIVAEN  1342
             +  I+ + E+    + P F      +E+ EN+P+   V  +       S  + ++I++ N
Sbjct  1703  VHIIVTMSEN----DPPKFPTNNIAIEIFENLPIGTFVTQVTARS---SSSIFFNIISGN  1755

Query  1343  SSDVKRTFRIDPRNGSLYIIESPDREQKALYELIIRLDQYKVGRDMTVMIYPVTNERLGN  1402
                +  +FRI+P  G + I  + D E   ++ L ++      G +M             N
Sbjct  1756  ---INESFRINPSTGVIVINGNIDYESIKVFNLTVK------GTNMA------AESSCQN  1800

Query  1403  LGLNEVKVIVRVTDVNDNAPKFTVTGRPMIAAIPTTANYGYNVIR----------LQATD  1452
                    +I+ + D NDN P F       + A+P +A  G  V++          LQ  D
Sbjct  1801  -------IIIHILDANDNIPYF--VQNEYVGALPESAAIGSYVLKVHDSSKDHLTLQVKD  1851

Query  1453  PDLGLNGEVRYQILSRADEASRRFAIDPVTGQVRGISTFTKEAGKVFGFDVKATDRSGAD  1512
              D+G+NG V Y I+   D A   F ID  TG +  +     E    + FDV  +D     
Sbjct  1852  ADVGVNGMVEYHIVD--DLAKNFFKIDSTTGAIELLRQLDYETNAGYTFDVTVSDMGKPK  1909

Query  1513  DGKSSIANVFVYVLD  1527
                ++ A+V + V++
Sbjct  1910  LHSTTTAHVTIRVIN  1924


 Score = 226 bits (575),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 352/1464 (24%), Positives = 595/1464 (41%), Gaps = 274/1464 (19%)

Query  120   SVTVYVEDINDHAPVFEGAPYHIDVDELTPVGLTVFRGIRAADHDKPNTPNSDVQYAIVA  179
             S+ + V D+ND+ P+F   PY+  V    P G T+   ++A D D  +  N +V+Y +  
Sbjct  2125  SIDISVLDVNDNCPLFVNMPYYATVSIDDPKG-TIIMQVKAIDLD--SAENGEVRYELKK  2181

Query  180   GNERGKFALESSHQAFLILRKSLDYDSGDRDFLLTITASDRGTPPKSTNATVRIKVNDND  239
             GN  G+          L +++ ++    +R++ LT+ A D    P S+ A +++KV D  
Sbjct  2182  GN--GELFKLDRKSGELSIKQHVE--GHNRNYELTVAAYDGAITPCSSEAPLQVKVIDRS  2237

Query  240   DLPPKFTKGVYRTKIKEFYPITGARIHQRLKFNPSIHAFDQDLAIDSPIRYDII--AGNE  297
                P F K  Y   +KE   +  A        + SI A       +SP+   +I    +E
Sbjct  2238  --MPVFEKQFYTVSVKEDVEMYSA-------LSVSIEA-------ESPLGRSLIYTISSE  2281

Query  298   RHLFSLDHVNGSLFLEREIDLDAERSLPGNTFVLQIQASQMDNPLKTGVARVEVEIMDLN  357
                F +D+  GS+F+  E+D +   S       + I+A+   + +   V  + V IMD+N
Sbjct  2282  SQSFEIDYNTGSIFVVNELDYEKISSHD-----VSIRATDSLSGVYAEVV-LSVSIMDVN  2335

Query  358   DNLPEFEVDFYNISIVENLPNGFSVLQIIATDQDQGDNAEFSYQLEDKSGA-----FTLD  412
             D  PE E D YN++I EN   G  +L+I ATD D G NA+ SY +E  +G      F +D
Sbjct  2336  DCYPEIESDIYNLTIPENASFGTQILKINATDNDSGANAKLSYYIESINGQNNSELFYID  2395

Query  413   SRTGWLTVRDQTVLDREKRSTISMRVYAKEK-VPSVVTSQLGASSVNIEVTLLDANDNNP  471
                G L ++  T LD E+     + V  K+   PS+      +S  N+ +T+ D NDN P
Sbjct  2396  VTDGNLYLK--TPLDYEQIKYHHIVVNVKDHGSPSL------SSRSNVFITVKDLNDNAP  2447

Query  472   TFIPNNLYEFIITTKAKKGDLVGQLHAIDPDLGRNGFVTYSIQKAPNSSIPFEVDTKSGQ  531
              F+  + Y   ++  A +G  V    A D D+     + Y I    N    + +D  +G 
Sbjct  2448  CFVEPS-YFTKVSVAAVRGQFVALPKAYDKDISDTDSLEYKIVYG-NELQTYSIDKLTGV  2505

Query  532   IMVTQDDLQASEHLLFVEASDQPVNPSEK---RSALAVVTVDIRDQNENREPDFIGAPYE  588
             I +          L F + S   +N S      +A A + + +  +N    P F  + YE
Sbjct  2506  ISL-------QNMLNFTDKSSTVLNISVSDGVHTAYARLKISLLPENV-YSPLFDQSTYE  2557

Query  589   FWVGGNVDIGTSVGQIRIT--EFNNMGTILYDLLHSYHEGVPFAVEEKSGTITVVDDLNK  646
               V  N+  G ++  ++ +  +F     + Y+++    + + F +++ +G IT       
Sbjct  2558  AQVPENLLHGHNIITVKASDGDFGTYANLYYEIVSEEMKKI-FLIDQTTGVIT---SKVT  2613

Query  647   FNRENYDFEAFVNNEGDLSLVTNVTIHVVDPKDEKTILMKTGTTPIEFHVKE--------  698
             F+RE                           KDE  +L+K      +F            
Sbjct  2614  FDREK--------------------------KDEYVVLLKVSDGGGKFGFASLKVIVVDV  2647

Query  699   --NEPNILIGKLGFKTNGTNNLKFTIANQKDVTDHISITSDGTLY---TQKPLDRETRDI  753
               N P  L+ +     + T     TI   K   D   I  +G+++    QK  D+  +D+
Sbjct  2648  NDNVPYFLLKEYKMVVSTTVEANQTILTVKAKDD--DIVDNGSVHFQIVQKSNDKAVKDV  2705

Query  754   YRLTI----IAEYNKGSVLGTGIYQVNVIVDDEND------------------NKPLFER  791
               +      I   +K    G   YQ  V   D  +                  N P FE+
Sbjct  2706  IEINEKTGDIVFKSKAESYGVNSYQFFVRASDRGEPQFHSEVPVSIEIIETDANIPTFEK  2765

Query  792   ESYEGKITENSKSGTEVDLNYPIHVSDSDVGHNGQFTVTIFGNGSEYFRLDRNLGKIQFT  851
              S   KI E++  GT +     +H+    +G N  F  +I  +   +   D     +Q T
Sbjct  2766  SSVLLKIIESTPPGTVLT---KLHM----IG-NYTFKFSIAADQDHFMISDSGELILQQT  2817

Query  852   GANTPLDRETTSVYNLRLVATDEG--GLTSEAKLTIQVEDENDNSPLFVQFYLYPDKGIE  909
                  LDRE    +NL +VA         + A + I V DENDN P              
Sbjct  2818  -----LDREQQESHNLIVVAETSTVPVFFAYADVLIDVRDENDNYP--------------  2858

Query  910   VLQYDSTGSRVGHFEEASNSTPGLFVLTQNFLRIRKPKEKISPLVSLPEDIAVGSSVIKA  969
               ++D+T      F  AS               + +  EK+  LV             K 
Sbjct  2859  --KFDNT------FYSAS---------------VAENSEKVISLV-------------KV  2882

Query  970   IAEDKDDGENSVIKYEMVSETYIPNELSSAPFHIIQYFMVQPTTGEVVIARALPAE--SE  1027
              A D D G N  I+Y + S+T           +I   F +   +G + +  +L  E  SE
Sbjct  2883  SATDADTGPNGDIRYYLESDTE----------NIQNIFDIDIYSGWITLLTSLDREVQSE  2932

Query  1028  FRLNISATDKGGFKDHLSVRITVR--DVNDHPPVFKKSWYNFDAEEASYTRNTLGRIEAT  1085
             +   + A D G  K    V +T++  D ND+ PVFK         E +     L  +   
Sbjct  2933  YNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLPIEGLSVFENALPGTVLINLLLI  2992

Query  1086  DADFGSNANITYSIKNNSTVPFSISPTTGALRVDGLLDRETQDKYSFVVVAKDNPKSGKS  1145
             D D        + +  +    F I   +G L +   LDRE    Y+  ++A D   + K+
Sbjct  2993  DPDIEKQEMDFFIVSGDKQAQFQIG-KSGELFIAKPLDREQLMFYNLSIIATDGKFTAKA  3051

Query  1146  LSSSVNVEVNVLDINDNPPVFYGYDDLIPNPEANNFSNHNYQQKIPVYYATAAENSPMGT  1205
                  NVE++V DINDN P                     Y  K P Y+ +  E+  +GT
Sbjct  3052  -----NVEIDVKDINDNTP---------------------YCLK-PRYHISTNESISIGT  3084

Query  1206  PITRVFANDSDFTGNGNGLILFDIPYRKSRQNLFAIDSKEGIVTTIGKLDYESEKSHNIT  1265
              +  V A D DF       + F +  + +    F+I  + GI+     LD E+   + + 
Sbjct  3085  TLVEVKAIDFDFQSK----LRFYLSGKGADD--FSIGKESGILKVASALDRETTPKYKLV  3138

Query  1266  ILASDLGSPSLSSTAILIVNIIDVPEDIKSIERPVFAHRYYEVEVEENVPVPLRVLTLNV  1325
                 D    +    + +I+ + D+ +++     P+F+   Y V V E+  +   +  ++ 
Sbjct  3139  AHVQDGKDFTQECFSEIIITVNDINDNM-----PIFSMAQYRVSVPEDAQLNTLITKVHA  3193

Query  1326  TEP--YRSHKLRYSIVAENSSDVKRTFRIDPRNGSLYIIESPDREQKALYELIIRLDQYK  1383
              +     + +++YS++ EN       F+I    G + + +S DRE  +L+ L ++ +   
Sbjct  3194  MDKDFGVNRQIKYSLMGENHD----YFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCG  3249

Query  1384  VGRDMTVMIYPVTNERLGNLGLNEVKVIVRVTDVNDNAPKFTVTGRPMIAAIPTTANYGY  1443
             V +  ++                   V V + D+NDN P+F++  R     I   A +G 
Sbjct  3250  VPKLHSI-----------------ATVAVNILDINDNPPEFSM--RQYSCKILENATHGT  3290

Query  1444  NVIRLQATDPDLGLNGEVRYQILSRADEASRRFAIDPVTGQVRGISTFTKEAGKVFGFDV  1503
              V ++ AT  D+G+N ++ Y I+S  ++   +F +D  TG +   +T   E  K +   +
Sbjct  3291  EVCKVYATSIDIGVNADIHYFIMSGNEQG--KFKMDSTTGDLVLNATLDYEMSKFYFLTI  3348

Query  1504  KATDRSGADDGKSSIANVFVYVLD  1527
             +A D  G     S+ A V + +LD
Sbjct  3349  QAID--GGTPPLSNNAYVNISILD  3370


 Score = 221 bits (562),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 317/1253 (25%), Positives = 524/1253 (42%), Gaps = 200/1253 (16%)

Query  109   DDGEDTITSSLSVTVYVEDINDHAPVFEGAPYHIDVDELTPVGLTVFRGIRAA---DHDK  165
             D G  +++S  +V + V+D+ND+AP F    Y       T V +   RG   A    +DK
Sbjct  2423  DHGSPSLSSRSNVFITVKDLNDNAPCFVEPSY------FTKVSVAAVRGQFVALPKAYDK  2476

Query  166   PNTPNSDVQYAIVAGNERGKFALESSHQAFLILRKSLDYDSGDRDFLLTITASDRGTPPK  225
               +    ++Y IV GNE   ++++      + L+  L++ +     +L I+ SD      
Sbjct  2477  DISDTDSLEYKIVYGNELQTYSIDKL-TGVISLQNMLNF-TDKSSTVLNISVSD---GVH  2531

Query  226   STNATVRIKVNDNDDLPPKFTKGVYRTKIKEFYPITGARIHQRLKFNPSIHAFDQDLAID  285
             +  A ++I +   +   P F +  Y  ++ E   + G  I        ++ A D D    
Sbjct  2532  TAYARLKISLLPENVYSPLFDQSTYEAQVPENL-LHGHNI-------ITVKASDGDFGTY  2583

Query  286   SPIRYDIIAGNERHLFSLDHVNGSLFLEREIDLDAERSLPGNTFVLQIQASQMDNPLKTG  345
             + + Y+I++   + +F +D   G   +  ++  D E+    + +V+ ++ S  D   K G
Sbjct  2584  ANLYYEIVSEEMKKIFLIDQTTG--VITSKVTFDREKK---DEYVVLLKVS--DGGGKFG  2636

Query  346   VARVEVEIMDLNDNLPEFEVDFYNISIVENLPNGFSVLQIIATDQDQGDNAEFSYQLEDK  405
              A ++V ++D+NDN+P F +  Y + +   +    ++L + A D D  DN    +Q+  K
Sbjct  2637  FASLKVIVVDVNDNVPYFLLKEYKMVVSTTVEANQTILTVKAKDDDIVDNGSVHFQIVQK  2696

Query  406   SG------AFTLDSRTGWLTVRDQTVLDREKRSTISMRVYAKEKVPSVVTSQLGA----S  455
             S          ++ +TG +  + +     E     S + + +        S  G     S
Sbjct  2697  SNDKAVKDVIEINEKTGDIVFKSKA----ESYGVNSYQFFVR-------ASDRGEPQFHS  2745

Query  456   SVNIEVTLLDANDNNPTFIPNNLYEFIITTKAKKGDLVGQLHAIDPDLGRNGFVTYSIQK  515
              V + + +++ + N PTF  +++   II +    G ++ +LH I       G  T+    
Sbjct  2746  EVPVSIEIIETDANIPTFEKSSVLLKIIES-TPPGTVLTKLHMI-------GNYTFKFSI  2797

Query  516   APNSSIPFEVDTKSGQIMVTQ--DDLQASEHLLFV--EASDQPVNPSEKRSALAVVTVDI  571
             A +    F + + SG++++ Q  D  Q   H L V  E S  PV       A A V +D+
Sbjct  2798  AADQD-HFMI-SDSGELILQQTLDREQQESHNLIVVAETSTVPV-----FFAYADVLIDV  2850

Query  572   RDQNENREPDFIGAPYEFWVGGNVDIGTSVGQIRITEFNN--MGTILYDLLHSYHEGVP-  628
             RD+N+N  P F    Y   V  N +   S+ ++  T+ +    G I Y  L S  E +  
Sbjct  2851  RDENDNY-PKFDNTFYSASVAENSEKVISLVKVSATDADTGPNGDIRY-YLESDTENIQN  2908

Query  629   -FAVEEKSGTITVVDDLNKFNRENYDFEAFVNNEG--DLSLVTNVTIHVVDPKDEKTILM  685
              F ++  SG IT++  L++  +  Y+F+    + G         VTI +VD  D   +  
Sbjct  2909  IFDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVF-  2967

Query  686   KTGTTPIE-FHVKENE--PNILIGKLGFKTN-GTNNLKFTIANQKDVTDHISITSDGTLY  741
                  PIE   V EN     +LI  L    +     + F I +  D      I   G L+
Sbjct  2968  ---KLPIEGLSVFENALPGTVLINLLLIDPDIEKQEMDFFIVS-GDKQAQFQIGKSGELF  3023

Query  742   TQKPLDRETRDIYRLTIIAEYNKGSVLGTGIYQVNVIVDDENDNKPLFERESYEGKITEN  801
               KPLDRE    Y L+IIA   K     T    V + V D NDN P   +  Y     E+
Sbjct  3024  IAKPLDREQLMFYNLSIIATDGK----FTAKANVEIDVKDINDNTPYCLKPRYHISTNES  3079

Query  802   SKSGTEVDLNYPIHVSDSDVGHNGQFTVTIFGNGSEYFRLDRNLGKIQFTGANTPLDRET  861
                GT +     + V   D     +    + G G++ F + +  G ++   A   LDRET
Sbjct  3080  ISIGTTL-----VEVKAIDFDFQSKLRFYLSGKGADDFSIGKESGILKVASA---LDRET  3131

Query  862   TSVYNLRLVATDEGGLTSE--AKLTIQVEDENDNSPLFVQFYLYPDKGIEVLQYDSTGSR  919
             T  Y L     D    T E  +++ I V D NDN P+F            + QY      
Sbjct  3132  TPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIF-----------SMAQYR-----  3175

Query  920   VGHFEEASNSTPGLFVLTQNFLRIRKPKEKISPLVSLPEDIAVGSSVIKAIAEDKDDGEN  979
                                               VS+PED  + + + K  A DKD G N
Sbjct  3176  ----------------------------------VSVPEDAQLNTLITKVHAMDKDFGVN  3201

Query  980   SVIKYEMVSETYIPNELSSAPFHIIQYFMVQPTTGEVVIARALPAE--SEFRLNISATDK  1037
               IKY ++ E +              YF +  +TG + + ++L  E  S F L + A D 
Sbjct  3202  RQIKYSLMGENH-------------DYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDC  3248

Query  1038  GGFKDH--LSVRITVRDVNDHPPVFKKSWYNFDAEEASYTRNTLGRIEATDADFGSNANI  1095
             G  K H   +V + + D+ND+PP F    Y+    E +     + ++ AT  D G NA+I
Sbjct  3249  GVPKLHSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSIDIGVNADI  3308

Query  1096  TYSI-KNNSTVPFSISPTTGALRVDGLLDRETQDKYSFVVVAKDNPKSGKSLSSSVNVEV  1154
              Y I   N    F +  TTG L ++  LD E    Y   + A D       LS++  V +
Sbjct  3309  HYFIMSGNEQGKFKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDG--GTPPLSNNAYVNI  3366

Query  1155  NVLDINDNPPVFYGYDDLIPNPEANNFSNHNYQQKIPVYYATAAENSPMGTPITRVFAND  1214
             ++LDINDN P F                         +Y     E+  +G+ I  V A D
Sbjct  3367  SILDINDNSPTFLQ----------------------NLYRINVNEDIFVGSKILDVKATD  3404

Query  1215  SDFTGNGNGLILFDIPYRKSRQNLFAIDSKEGIVTTIGKLDYESEKSHNITILASDLGSP  1274
              D   + NGL+ ++I  R      F+ID K G ++    LD E+   + + I A D G P
Sbjct  3405  ED--SDVNGLVTYNIE-RGDNIGQFSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDP  3461

Query  1275  SLSSTAILIVNIIDVPEDIKSIERPVFAHRYYEVEVEENVPVPLRVLTLNVTE  1327
                ++  + +NI+D  ++      P+F+   Y V ++EN  +    LT  +++
Sbjct  3462  QRCNSVPININILDTNDN-----APIFSSSNYSVVLQENRLLGYVFLTFKISD  3509


 Score = 219 bits (559),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 321/1271 (25%), Positives = 539/1271 (42%), Gaps = 179/1271 (14%)

Query  282   LAIDSPIRYDIIAGNERHLFSLDH--VNGSLFLE-----REIDLDAERSLPGNTFVLQIQ  334
             + +++ ++Y II+G++  LF  +   V    FL        + L+ E++     +V++++
Sbjct  94    VGLNAEVKYRIISGDKEKLFKAEEKLVGDFAFLAIRTRTNNVVLNREKT---EEYVIRVK  150

Query  335   ASQMDNPLKTGV----ARVEVEIMDLNDNLPEFEVDFYNISIVENLPNGFSVLQIIATDQ  390
             A    +          A + ++++D ND  P F    Y + I E+ P   S+L++ A D 
Sbjct  151   AHVHLHDRNVSSYETEANIHIKVLDRNDLSPLFYPTQYTVVIPEDTPKYQSILKVTADDA  210

Query  391   DQGDNAEFSYQLEDKSGAFTLDSRTGWLTVRDQTVLDREKRSTISMRVYAKEKVPSVVTS  450
             D G N E  Y L   S  F +   TG +T+  Q  L   + S   + V A ++   V   
Sbjct  211   DLGINGEIYYSLLMDSEYFAIHPTTGEITLLQQ--LQYAENSHFELTVVAYDRGSWVNHQ  268

Query  451   QLGASSVNIEVTLLDANDNNPTFIPNNLYEFIITTKAKKGDLVGQLHAIDPDLGRNGFV-  509
                AS   + +++   N   P         F   T      + G +   D D G NG + 
Sbjct  269   NHQASKTKVSISVKQVNFYAPEIFTKT---FSSVTPTSNPLIYGIVRVNDKDTGINGNIG  325

Query  510   -TYSIQKAPNSSIPFEVDTKSGQIMVTQDDLQASEHL----------LFVEASDQPVNPS  558
                 +   P+ +   +      +  +   +L    HL          L  E    P    
Sbjct  326   RLEIVDGNPDGTFLLKAAETKDEYYI---ELNQFAHLNQQHFIYNLTLLAEDLGTP----  378

Query  559   EKRSALAVVTVDIRDQNENREPDFIGAPYEFWVGGNVDIGTSVGQIRITEFN-NMGTILY  617
              +R A   V + I+ +++N  P F    YE  +     I   V ++++++ +     ++Y
Sbjct  379   -RRFAYKSVPIQIKPESKNI-PIFTQEIYEVSIPETAPINMPVIRLKVSDPDLGKNALVY  436

Query  618   DLLHSYHEGVPFAVEEKSGTITVVDDLNKFNRENYDFEAFVNNEGDLSL----VTNVTIH  673
               +   +EG  F +   SG +     L+   + +Y       ++ ++         V I 
Sbjct  437   LEIVGGNEGDEFRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKIS  496

Query  674   VVDPKDEKTILMKTGTTPIEFHVKENEPNI---LIGKLGFKT--NGTNN-LKFTIANQKD  727
             V D  D   I            +  NE N+    + KL  K   +G N+ + ++IAN   
Sbjct  497   VQDMNDNDPIFENVNKV-----ISINENNLAGSFVVKLTAKDRDSGENSYISYSIANLNA  551

Query  728   V---TDHISITSDGTLYTQKPLDRET-RDIYRLTIIAE-----YNKGSVLGTGIYQVNVI  778
             V    DH S    G + T   LD ET +  Y L I A      Y + + +     +++++
Sbjct  552   VPFEIDHFS----GIVKTTSLLDFETMKRNYELIIRASDWGLPYRRQTEI-----KLSIV  602

Query  779   VDDENDNKPLFERESYEGKITENSKSGTEVDLNYPIHVSDSDVGHNGQFTVTIFGNGSEY  838
             V D NDN+P FER +  GK+T+++  GTEV +   I   D D G    + ++  GN    
Sbjct  603   VKDINDNRPQFERVNCYGKVTKSAPMGTEVFVTSAI---DFDAGDIISYRLSD-GNEDGC  658

Query  839   FRLDRNLGKIQFTGANTPLDRETTSVYN--LRLVATDEGGLTSEAKLTIQV--EDENDNS  894
             F LD   G +  +      D + T++ N  L++ ATD    + +  + + +  ED   +S
Sbjct  659   FNLDPTSGSLSIS-----CDLKKTTLTNRILKVSATDGTHFSDDLIINVHLMPEDLGGDS  713

Query  895   PLFVQFYLYPDKGIEVLQYDSTGSRVGHFEEASNSTPGLFV---LT-----QNFLR---I  943
              +   F  +  +   V +  +    +       +++P +F    LT     QN  R   +
Sbjct  714   SILHGFGSFECRETGVARRLAETLSLAEKNNVKSASPSVFSDLSLTPSRYGQNVHRPEFV  773

Query  944   RKPKEKISPLVSLPEDIAVGSSVIKAIAEDKDDGENSVIKYEMVSETYIPNELSSAPFHI  1003
               P+E     +S+ E + +G +V    A+D+D G N  + + +    Y            
Sbjct  774   NFPQE-----LSINESVQLGETVAWIEAKDRDLGYNGKLVFAISDGDYD-----------  817

Query  1004  IQYFMVQPTTGEVVIARALPAE--SEFRLNISATDKGGFKDHLS--VRITVRDVNDHPPV  1059
                F + P  GE+ I   L  E  +E+ LNI+  D G      S  + IT+ DVND+ PV
Sbjct  818   -SVFRIDPDRGELQIIGYLDRERQNEYVLNITVYDLGNPTKSTSKMLPITILDVNDNRPV  876

Query  1060  FKKSWYNFDAEEASYTRNTLGRIEATDADFGSNANITYSIKNNSTVPFSISPTTGALRVD  1119
              +K+   F   E++     +  + ATDAD G NA +TY++    +  F+++ TTG LR++
Sbjct  877   IQKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYALSVECS-DFTVNATTGCLRLN  935

Query  1120  GLLDRETQDKYSFVVVAKDNPKSGKSLSSSVNVEVNVLDINDNPPVFYGYDDLIPNPEAN  1179
               LDRE QD Y+  + AKD       LSS   V V V D+NDN PVF             
Sbjct  936   KPLDREKQDNYALHITAKDG--GSPVLSSEALVYVLVDDVNDNAPVF-------------  980

Query  1180  NFSNHNYQQKIPVYYATAAENSPMGTPITRVFANDSDFTGNGNGLILFDIPYRKSRQNLF  1239
                       +  Y     E+ P GT +  + A D D   N    I F +      + LF
Sbjct  981   ---------GVQEYIFKVREDLPRGTVLAVIEAVDEDIGPNAE--IQFSLKEETQDEELF  1029

Query  1240  AIDSKEGIVTTIGKLDYESEKSHNITILASDLGSPSLSSTAILIVNIIDVPEDIKSIERP  1299
              ID   G + T G LDYE+++ HN+ + A D G PSL+S   +++ IIDV E+  +   P
Sbjct  1030  RIDKHTGAIRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNENRFA---P  1086

Query  1300  VFAHRYYEVEVEENVPVPLRVLTLNVTEPYR---SHKLRYSIVAENSSDVKRTFRIDPRN  1356
              F    YE +V+EN P    V+ +   +      + K+ YSI      D    F ++ + 
Sbjct  1087  EFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSITG---GDGLGIFAVNDQ-  1142

Query  1357  GSLYIIESPDREQKALYELIIRLDQYKVGRDMTVMIYPVTNERLGNLGLNEVKVIVRVTD  1416
             GS+  +   D E K  Y L +        +D  ++  P++         N V+V ++V +
Sbjct  1143  GSITSLSQLDAETKNFYWLTL------CAQDCAIV--PLS---------NCVEVYIQVEN  1185

Query  1417  VNDNAPKFTVTGRPMIAAIPTTANY-GYNVIRLQATDPDLGLNGEVRYQILSRADEASRR  1475
              NDN P   +T +P+     T A+     +I L+A DPD+     + Y I+S        
Sbjct  1186  ENDNIP---LTDKPVYYVNVTEASVENVEIITLKAFDPDIDPTQTITYNIVS--GNLVGY  1240

Query  1476  FAIDPVTGQVR  1486
             F ID  TG ++
Sbjct  1241  FEIDSKTGVIK  1251


 Score = 208 bits (529),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 381/1501 (25%), Positives = 633/1501 (42%), Gaps = 196/1501 (13%)

Query  108   YDDGEDTITSSLSVTVYVEDINDHAPVFEGAPYHIDVDELTPVGLTVFRGIRAADHDKPN  167
             YD G  T ++S  + + + D+ND+ PV +       + E   +G TV   + A D D  +
Sbjct  850   YDLGNPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTESARIG-TVVHCLHATDAD--S  906

Query  168   TPNSDVQYAIVAGNERGKFALESSHQAFLILRKSLDYDSGDRDFLLTITASDRGTPPKST  227
               N+ V YA+    E   F + ++    L L K LD +  D ++ L ITA D G+P  S+
Sbjct  907   GINAQVTYALSV--ECSDFTVNAT-TGCLRLNKPLDREKQD-NYALHITAKDGGSPVLSS  962

Query  228   NATVRIKVNDNDDLPPKFTKGVYRTKIKEFYPITGARIHQRLKFNPSIHAFDQDLAIDSP  287
              A V + V+D +D  P F    Y  K++E  P        R      I A D+D+  ++ 
Sbjct  963   EALVYVLVDDVNDNAPVFGVQEYIFKVREDLP--------RGTVLAVIEAVDEDIGPNAE  1014

Query  288   IRYDIIA-GNERHLFSLDHVNGSLFLEREIDLDAERSLPGNTFVLQIQASQMDNPLKTGV  346
             I++ +     +  LF +D   G++  +  +D + ++        L + A    +P  T  
Sbjct  1015  IQFSLKEETQDEELFRIDKHTGAIRTQGYLDYENKQ-----VHNLIVSAIDGGDPSLTSD  1069

Query  347   ARVEVEIMDLNDN--LPEFEVDFYNISIVENLPNGFSVLQIIATDQDQGD-NAEFSYQLE  403
               + + I+D+N+N   PEF+   Y   + EN P G  V+ + A D D  D N++ +Y + 
Sbjct  1070  MSIVIMIIDVNENRFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSIT  1129

Query  404   --DKSGAFTLDSRTGWLTVRDQTVLDREKRSTISMRVYAKEK--VPSVVTSQLGASSVNI  459
               D  G F ++ + G +T   Q  LD E ++   + + A++   VP        ++ V +
Sbjct  1130  GGDGLGIFAVNDQ-GSITSLSQ--LDAETKNFYWLTLCAQDCAIVPL-------SNCVEV  1179

Query  460   EVTLLDANDNNPTFIPNNLYEFIITTKAKKGDLVGQLHAIDPDLGRNGFVTYSIQKAPNS  519
              + + + NDN P      +Y   +T  + +   +  L A DPD+     +TY+I    N 
Sbjct  1180  YIQVENENDNIP-LTDKPVYYVNVTEASVENVEIITLKAFDPDIDPTQTITYNIVSG-NL  1237

Query  520   SIPFEVDTKSGQIMVTQDDL---QASEHLLFVEASDQPVNPSEKRSALAVVTVDIRDQNE  576
                FE+D+K+G I  T+  L     +EH+L V  SD   N S   S+ + + V + D N+
Sbjct  1238  VGYFEIDSKTGVIKTTERKLDRENQAEHILEVAISD---NGSPVLSSTSRIVVSVLDIND  1294

Query  577   NREPDFIGAPYEFWVGGNVDIGTSVGQIRITEFNN--MGTILYDLLHSYHEGVPFAVEEK  634
             N  P+F    Y+  V  +  +  S+ Q+   + ++   G I Y +     +   F ++ +
Sbjct  1295  N-SPEFDQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYSIKSGKGKN-KFRIDSQ  1352

Query  635   SGTITVVDDLNKFNRENYDFEAFVNNEGD--------LSLVTNVTIHVVDPKDEKTILMK  686
              G I +   L+  N    +FE  +  E +          +   V     + ++   I+ K
Sbjct  1353  RGHIHIAKPLDSDN----EFEIHIKAEDNGIPKKSQTARVNIVVVPVNPNSQNAPLIVRK  1408

Query  687   TGTTPIEFHVKENEPNILIGKLGFKTNGTNNLKFTIANQKDVTDHISITSDGTLYTQKPL  746
             T    ++   + ++P  L+ ++    +  + L + I+N  D         +G +   K L
Sbjct  1409  TSENVVDL-TENDKPGFLVTQILAVDDDNDQLWYNISNGNDDNTFYIGQDNGNILLSKYL  1467

Query  747   DRETRDIYRLTIIAEYNKGSVLGTGIYQVNVIVDDENDNKPLFERESYEGKITENSKSGT  806
             D ET+  Y LTI      G+   T    + V V D NDN P F ++ Y   I+EN +   
Sbjct  1468  DYETQQSYNLTI--SVTDGTF--TAFTNLLVQVIDINDNPPQFAKDVYHVNISENIE---  1520

Query  807   EVDLNYPIHVSDSDVGHNGQFTVTIFGNGSEY--FRLDRNLGKIQFTGANTPLDRETTSV  864
             E  +   +H +D D      + +    + S    FR+D   G +  T     LD E T+ 
Sbjct  1521  EESVIMQLHATDRDEDKKLFYHLHATQDPSSLALFRIDSISGNVIVTQR---LDFEKTAQ  1577

Query  865   YNLRLVATDEG--GLTSEAKLTIQVEDENDNSPLFVQFYLYP---------DKGIEV---  910
             + L +   D+G  G  + AK+ + V D ND+ P F    +            K  EV   
Sbjct  1578  HILIVFVKDQGAPGKRNYAKIIVNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAI  1637

Query  911   ---------LQYDSTGSRVGHFEEASNSTPGLFVLTQNFLRIRKPKE-----KISPLVSL  956
                      +QY      VG   E  + T G+  L  N L I K +E     K   L + 
Sbjct  1638  DRDSGHNAEIQYSIITGNVGSVFEI-DPTFGIITLAGN-LNINKIQEYMLQVKAVDLGNP  1695

Query  957   PEDIAVGSSVIKAIAE-DKDDGENSVIKYEMVSE----TYI----PNELSSAPFHII---  1004
             P    +   +I  ++E D      + I  E+       T++        SS  F+II   
Sbjct  1696  PLSSQIPVHIIVTMSENDPPKFPTNNIAIEIFENLPIGTFVTQVTARSSSSIFFNIISGN  1755

Query  1005  --QYFMVQPTTGEVVIARALPAES--EFRLNISATDKGGFKDHLSVRITVRDVNDHPPVF  1060
               + F + P+TG +VI   +  ES   F L +  T+        ++ I + D ND+ P F
Sbjct  1756  INESFRINPSTGVIVINGNIDYESIKVFNLTVKGTNMAAESSCQNIIIHILDANDNIPYF  1815

Query  1061  KKSWYNFDAEEASYTRNTLGRI----------EATDADFGSNANITYSIKNN-STVPFSI  1109
              ++ Y     E++   + + ++          +  DAD G N  + Y I ++ +   F I
Sbjct  1816  VQNEYVGALPESAAIGSYVLKVHDSSKDHLTLQVKDADVGVNGMVEYHIVDDLAKNFFKI  1875

Query  1110  SPTTGALRVDGLLDRETQDKYSFVVVAKDNPKSGKSLSSSVNVEVNVLDINDNPPVFYGY  1169
               TTGA+ +   LD ET   Y+F V   D  K     +++ +V + V+++ND PPVF   
Sbjct  1876  DSTTGAIELLRQLDYETNAGYTFDVTVSDMGKPKLHSTTTAHVTIRVINVNDCPPVF---  1932

Query  1170  DDLIPNPEANNFSNHNYQQKIPVYYATAAENSPMGTPITRVFANDSDFTGNGNGLILFDI  1229
                       N    N    +P +     EN      + +V A D+D     N  + FDI
Sbjct  1933  ----------NERELNVTLFLPTF-----EN----VFVRQVSAKDAD-----NDTLRFDI  1968

Query  1230  PYRKSRQNLFAIDSKEGIVTT--IGKLDYESEKSHNITILASDLGSPSLSSTAILIVNII  1287
                 + +  F I+   GI+TT     L+ E+++ + + + ASD G  S    AILIV  I
Sbjct  1969  VDGNTNE-CFQIEKYTGIITTRNFEILNNENDRDYALHVRASD-GIFS----AILIVK-I  2021

Query  1288  DVPEDIKSIERPVFAHRYYEVEVEENVPVPLRVLTLNVTEPYRSHKLRYSIVAENSSDVK  1347
              V   I S     F    Y     EN      +  +NV        + Y I+     +  
Sbjct  2022  KVLSAIDS--NFAFQRESYRFSAFENNTKVATIGLVNVIGNTLDENVEYRIL-----NPT  2074

Query  1348  RTFRIDPRNGSLYIIESP-DREQKALYELIIRLDQYKVGRDMTVMIYPVTNERLGNLGLN  1406
             + F I   +G+L       DRE K LY L +         +   M+Y   N    N+   
Sbjct  2075  QLFDIGISSGALKTTGVIFDREVKDLYRLFV---------EAKSMLYDGMN---SNVRRA  2122

Query  1407  EVKVIVRVTDVNDNAPKFTVTGRPMIAAIPTTANYGYNVIRLQATDPDLGLNGEVRYQIL  1466
                + + V DVNDN P F     P  A +      G  +++++A D D   NGEVRY++ 
Sbjct  2123  VTSIDISVLDVNDNCPLF--VNMPYYATVSIDDPKGTIIMQVKAIDLDSAENGEVRYELK  2180

Query  1467  SRADEASRRFAIDPVTGQVRGISTFTKEAGKVFGFDVKATDRSGADDGKSSIANVFVYVL  1526
                 E    F +D  +G++  I    +   + +   V A D  GA    SS A + V V+
Sbjct  2181  KGNGEL---FKLDRKSGEL-SIKQHVEGHNRNYELTVAAYD--GAITPCSSEAPLQVKVI  2234

Query  1527  D  1527
             D
Sbjct  2235  D  2235


 Score = 200 bits (509),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 370/1504 (25%), Positives = 613/1504 (41%), Gaps = 244/1504 (16%)

Query  54    NLNLQPVDRDED---VHFFTYRDINRTTVSLLLAKSLEDLVDNDSPRNVLKFKVTCDYDD  110
             N++L P D   D   +H F   +   T V+  LA++L  L + ++ ++            
Sbjct  701   NVHLMPEDLGGDSSILHGFGSFECRETGVARRLAETLS-LAEKNNVKS------------  747

Query  111   GEDTITSSLSVTVYVEDINDHAPVFEGAPYHIDVDELTPVGLTVFRGIRAADHDKPNTPN  170
                ++ S LS+T      N H P F   P  + ++E   +G TV   I A D D     N
Sbjct  748   ASPSVFSDLSLTPSRYGQNVHRPEFVNFPQELSINESVQLGETV-AWIEAKDRDLGY--N  804

Query  171   SDVQYAIVAGNERGKFALESSHQAFLILRKSLDYDSGDRDFLLTITASDRGTPPKSTNAT  230
               + +AI  G+    F ++       I+   LD +  + +++L IT  D G P KST+  
Sbjct  805   GKLVFAISDGDYDSVFRIDPDRGELQII-GYLDRERQN-EYVLNITVYDLGNPTKSTSKM  862

Query  231   VRIKVNDNDDLPPKFTKGVYRTKIKEFYPITGARIHQRLKFNPSIHAFDQDLAIDSPIRY  290
             + I + D +D  P   K +   ++ E   I G  +H        +HA D D  I++ + Y
Sbjct  863   LPITILDVNDNRPVIQKTLATFRLTESARI-GTVVH-------CLHATDADSGINAQVTY  914

Query  291   DIIAGNERHLFSLDHVNGSLFLEREIDLDAERSLPGNTFVLQIQASQMDNPLKTGVARVE  350
              +    E   F+++   G L L + +D + +     + + L I A    +P+ +  A V 
Sbjct  915   ALSV--ECSDFTVNATTGCLRLNKPLDREKQ-----DNYALHITAKDGGSPVLSSEALVY  967

Query  351   VEIMDLNDNLPEFEVDFYNISIVENLPNGFSVLQIIATDQDQGDNAEFSYQLEDKSG---  407
             V + D+NDN P F V  Y   + E+LP G  +  I A D+D G NAE  + L++++    
Sbjct  968   VLVDDVNDNAPVFGVQEYIFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLKEETQDEE  1027

Query  408   AFTLDSRTGWLTVRDQTVLDREKRSTISMRVYAKEKVPSVVTSQLGASSVNIEVTLLDAN  467
              F +D  TG   +R Q  LD E +   ++ V A +     +TS +     +I + ++D N
Sbjct  1028  LFRIDKHTG--AIRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDM-----SIVIMIIDVN  1080

Query  468   DNN--PTFIPNNLYEFIITTKAKKGDLVGQLHAIDPD-LGRNGFVTYSIQKAPNSSIPFE  524
             +N   P F  + +YE  +     KG  V  + A D D +  N  +TYSI       I F 
Sbjct  1081  ENRFAPEF-DDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGDGLGI-FA  1138

Query  525   VDTKSGQIMVTQDDLQASE-HLLFVEASDQPVNPSEKRSALAVVTVDIRDQNENREPDFI  583
             V+ +     ++Q D +    + L + A D  + P         V V I+ +NEN      
Sbjct  1139  VNDQGSITSLSQLDAETKNFYWLTLCAQDCAIVPLSN-----CVEVYIQVENENDNIPLT  1193

Query  584   GAPYEFWVGGNVDIGTSVGQIRITEF----NNMGTILYDLLHSYHEGVPFAVEEKSGTIT  639
               P  ++V        +V  I +  F    +   TI Y+++     G  F ++ K+G I 
Sbjct  1194  DKPV-YYVNVTEASVENVEIITLKAFDPDIDPTQTITYNIVSGNLVGY-FEIDSKTGVIK  1251

Query  640   VVD-DLNKFNRENYDFEAFVNNEGD--LSLVTNVTIHVVDPKDEKTIL-MKTGTTPIEFH  695
               +  L++ N+  +  E  +++ G   LS  + + + V+D  D       +     +   
Sbjct  1252  TTERKLDRENQAEHILEVAISDNGSPVLSSTSRIVVSVLDINDNSPEFDQRVYKVQVPSS  1311

Query  696   VKENEPNILIGKLGFKTNGTNNLKFTIANQKDVTDHISITSDGTLYTQKPLDRETRDIYR  755
                N+    +  +   +     + ++I + K        +  G ++  KPLD +    + 
Sbjct  1312  ATVNQSIFQVHAIDSDSGENGRITYSIKSGKGKNKFRIDSQRGHIHIAKPLDSDNE--FE  1369

Query  756   LTIIAEYN---KGSVLGTGIYQVNVIVDDENDNKPLFERESYEG--KITENSKSGTEVDL  810
             + I AE N   K S        V V V+  + N PL  R++ E    +TEN K G  V  
Sbjct  1370  IHIKAEDNGIPKKSQTARVN-IVVVPVNPNSQNAPLIVRKTSENVVDLTENDKPGFLVT-  1427

Query  811   NYPIHVSDSDVGHNGQFTVTIF-GNGSEYFRLDRNLGKIQFTGANTPLDRETTSVYNLRL  869
                I   D D   N Q    I  GN    F + ++ G I  +     LD ET   YNL +
Sbjct  1428  --QILAVDDD---NDQLWYNISNGNDDNTFYIGQDNGNILLSKY---LDYETQQSYNLTI  1479

Query  870   VATDEGGLTSEAKLTIQVEDENDNSPLFVQFYLYPDKGIEVLQYDSTGSRVGHFEEASNS  929
               TD G  T+   L +QV D NDN P F +                    V H       
Sbjct  1480  SVTD-GTFTAFTNLLVQVIDINDNPPQFAK-------------------DVYH-------  1512

Query  930   TPGLFVLTQNFLRIRKPKEKISPLVSLPEDIAVGSSVIKAIAEDKDDGENSVIKYEMVSE  989
                                     V++ E+I   S +++  A D+D  E+  + Y +   
Sbjct  1513  ------------------------VNISENIEEESVIMQLHATDRD--EDKKLFYHL-HA  1545

Query  990   TYIPNELSSAPFHIIQYFMVQPTTGEVVIARALPAE--SEFRLNISATDKG--GFKDHLS  1045
             T  P+ L+         F +   +G V++ + L  E  ++  L +   D+G  G +++  
Sbjct  1546  TQDPSSLA--------LFRIDSISGNVIVTQRLDFEKTAQHILIVFVKDQGAPGKRNYAK  1597

Query  1046  VRITVRDVNDHPPVFKKSWYNFDAEEASYTRNTLGRIEATDADFGSNANITYS-IKNNST  1104
             + + V D NDH P F          E++   + L  + A D D G NA I YS I  N  
Sbjct  1598  IIVNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAIDRDSGHNAEIQYSIITGNVG  1657

Query  1105  VPFSISPTTGALRVDGLLDRETQDKYSFVVVAKD--NPKSGKSLSSSVNVEVNVLDINDN  1162
               F I PT G + + G L+     +Y   V A D  NP     LSS + V + V    ++
Sbjct  1658  SVFEIDPTFGIITLAGNLNINKIQEYMLQVKAVDLGNPP----LSSQIPVHIIVTMSEND  1713

Query  1163  PPVFYGYDDLIPNPEANNFSNHNYQQKIPVYYATAAENSPMGTPITRVFANDSDFTGNGN  1222
             PP F            NN +       I ++     EN P+GT +T+V       T   +
Sbjct  1714  PPKF----------PTNNIA-------IEIF-----ENLPIGTFVTQV-------TARSS  1744

Query  1223  GLILFDIPYRKSRQNLFAIDSKEGIVTTIGKLDYESEKSHNITILASDLGSPSLSSTAIL  1282
               I F+I      ++ F I+   G++   G +DYES K  N+T+  +++ +   SS   +
Sbjct  1745  SSIFFNIISGNINES-FRINPSTGVIVINGNIDYESIKVFNLTVKGTNMAAE--SSCQNI  1801

Query  1283  IVNIIDVPEDIKSIERPVFAHRYYEVEVEENVPVPLRVLTLNVTEPYRSH----------  1332
             I++I+D  ++I     P F    Y   + E+  +   V  L V +  + H          
Sbjct  1802  IIHILDANDNI-----PYFVQNEYVGALPESAAIGSYV--LKVHDSSKDHLTLQVKDADV  1854

Query  1333  ----KLRYSIVAENSSDVKRTFRIDPRNGSLYIIESPDREQKALYELIIRLDQYKVGRDM  1388
                  + Y IV + +   K  F+ID   G++ ++   D E  A Y               
Sbjct  1855  GVNGMVEYHIVDDLA---KNFFKIDSTTGAIELLRQLDYETNAGY---------------  1896

Query  1389  TVMIYPVTNERLGNLGLNE---VKVIVRVTDVNDNAPKFTVTGRPMIAAIPTTANYGYNV  1445
                 + VT   +G   L+      V +RV +VND  P F      +   +PT  N    V
Sbjct  1897  ---TFDVTVSDMGKPKLHSTTTAHVTIRVINVNDCPPVFNERELNVTLFLPTFENVF--V  1951

Query  1446  IRLQATDPDLGLNGEVRYQILSRADEASRRFAIDPVTGQV--RGISTFTKEAGKVFGFDV  1503
              ++ A D D   N  +R+ I+      +  F I+  TG +  R       E  + +   V
Sbjct  1952  RQVSAKDAD---NDTLRFDIVD--GNTNECFQIEKYTGIITTRNFEILNNENDRDYALHV  2006

Query  1504  KATD  1507
             +A+D
Sbjct  2007  RASD  2010


 Score = 199 bits (507),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 267/1061 (25%), Positives = 446/1061 (42%), Gaps = 153/1061 (14%)

Query  133   PVFEGAPYHIDVDELTPVGLTVFRGIRAADHDKPNTPNSDVQYAIV--AGNERGKFALES  190
             P F    Y + V        T+   ++A D D  +  N  V + IV  + ++  K  +E 
Sbjct  2652  PYFLLKEYKMVVSTTVEANQTILT-VKAKDDDIVD--NGSVHFQIVQKSNDKAVKDVIEI  2708

Query  191   SHQAFLILRKSLDYDSGDRDFLLTITASDRGTPPKSTNATVRIKVNDNDDLPPKFTKGVY  250
             + +   I+ KS     G   +   + ASDRG P   +   V I++ + D   P F K   
Sbjct  2709  NEKTGDIVFKSKAESYGVNSYQFFVRASDRGEPQFHSEVPVSIEIIETDANIPTFEKSSV  2768

Query  251   RTKIKEFYP----ITGARIHQRLKFNPSIHAFDQDLAIDSPIRYDIIAGNERHLFSLDHV  306
               KI E  P    +T   +     F  SI A DQD                 H    D  
Sbjct  2769  LLKIIESTPPGTVLTKLHMIGNYTFKFSIAA-DQD-----------------HFMISD--  2808

Query  307   NGSLFLEREIDLDAERSLPGNTFVLQIQASQMDNPLKTGVARVEVEIMDLNDNLPEFEVD  366
             +G L L++ +D + + S   +  ++  + S +  P+    A V +++ D NDN P+F+  
Sbjct  2809  SGELILQQTLDREQQES---HNLIVVAETSTV--PVFFAYADVLIDVRDENDNYPKFDNT  2863

Query  367   FYNISIVENLPNGFSVLQIIATDQDQGDNAEFSYQLEDKS----GAFTLDSRTGWLTVRD  422
             FY+ S+ EN     S++++ ATD D G N +  Y LE  +      F +D  +GW+T+  
Sbjct  2864  FYSASVAENSEKVISLVKVSATDADTGPNGDIRYYLESDTENIQNIFDIDIYSGWITLL-  2922

Query  423   QTVLDREKRSTISMRVYAKEKVPSVVTSQLGASSVNIEVTLLDANDNNPTF-IPNNLYEF  481
              T LDRE +S  + +V A +            + V + + ++D NDN P F +P  +   
Sbjct  2923  -TSLDREVQSEYNFKVIAADN-----GHPKHDAKVPVTIKIVDYNDNAPVFKLP--IEGL  2974

Query  482   IITTKAKKGDLVGQLHAIDPDLGRNGFVTYSIQKAPNSSIPFEVDTKSGQIMVTQDDLQA  541
              +   A  G ++  L  IDPD+ +     + +  + +    F++  KSG++ + +     
Sbjct  2975  SVFENALPGTVLINLLLIDPDIEKQEMDFFIV--SGDKQAQFQIG-KSGELFIAKP--LD  3029

Query  542   SEHLLFVEASDQPVNPSEKRSALAVVTVDIRDQNENREPDFIGAPYEFWVGGNVDIGTSV  601
              E L+F   S   +    K +A A V +D++D N+N  P  +   Y      ++ IGT++
Sbjct  3030  REQLMFYNLS--IIATDGKFTAKANVEIDVKDINDNT-PYCLKPRYHISTNESISIGTTL  3086

Query  602   GQIRITEFNNMGTILYDLLHSYHEGVPFAVEEKSGTITVVDDLNKFNRENYDFEAFVNNE  661
              +++  +F+    + + L  S      F++ ++SG + V   L++     Y   A V + 
Sbjct  3087  VEVKAIDFDFQSKLRFYL--SGKGADDFSIGKESGILKVASALDRETTPKYKLVAHVQDG  3144

Query  662   GDLS--LVTNVTIHVVDPKDEKTILMKTGTTPIEFHV---KENEPNILIGKLGF--KTNG  714
              D +    + + I V D  D   I      +  ++ V   ++ + N LI K+    K  G
Sbjct  3145  KDFTQECFSEIIITVNDINDNMPIF-----SMAQYRVSVPEDAQLNTLITKVHAMDKDFG  3199

Query  715   TN-NLKFTIANQKDVTDHISIT-SDGTLYTQKPLDRETRDIYRLTIIAEYNKGSVLGTGI  772
              N  +K+++  +    D+  I+ S G +   K LDRET  ++ LT+ AE + G      I
Sbjct  3200  VNRQIKYSLMGENH--DYFKISKSTGIIRLHKSLDRETISLFNLTVKAE-DCGVPKLHSI  3256

Query  773   YQVNVIVDDENDNKPLFERESYEGKITENSKSGTEVDLNYPIHVSDSDVGHNGQFTVTIF  832
               V V + D NDN P F    Y  KI EN+  GTEV     ++ +  D+G N      I 
Sbjct  3257  ATVAVNILDINDNPPEFSMRQYSCKILENATHGTEV---CKVYATSIDIGVNADIHYFIM  3313

Query  833   -GNGSEYFRLDRNLGKIQFTGANTPLDRETTSVYNLRLVATDEGG--LTSEAKLTIQVED  889
              GN    F++D   G +     N  LD E +  Y L + A D G   L++ A + I + D
Sbjct  3314  SGNEQGKFKMDSTTGDLVL---NATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILD  3370

Query  890   ENDNSPLFVQFYLYPDKGIEVLQYDSTGSRVGHFEEASNSTPGLFVLTQNFLRIRKPKEK  949
              NDNSP F+                                       QN  RI      
Sbjct  3371  INDNSPTFL---------------------------------------QNLYRI------  3385

Query  950   ISPLVSLPEDIAVGSSVIKAIAEDKDDGENSVIKYEMVSETYIPNELSSAPFHIIQYFMV  1009
                  ++ EDI VGS ++   A D+D   N ++ Y +     I              F +
Sbjct  3386  -----NVNEDIFVGSKILDVKATDEDSDVNGLVTYNIERGDNIGQ------------FSI  3428

Query  1010  QPTTGEVVIARALPAE--SEFRLNISATDKGGFK--DHLSVRITVRDVNDHPPVFKKSWY  1065
              P  G + ++R L  E  S + L I A D+G  +  + + + I + D ND+ P+F  S Y
Sbjct  3429  DPKNGTISVSRPLDRETISHYTLEIQACDQGDPQRCNSVPININILDTNDNAPIFSSSNY  3488

Query  1066  NFDAEEASYTRNTLGRIEATDADFGSNAN-ITYSIKNNSTVPFSISPTTGALRVDGLLDR  1124
             +   +E           + +DAD   N    T+ I++ +          G+LR     + 
Sbjct  3489  SVVLQENRLLGYVFLTFKISDADETPNTTPYTFDIRSGNEGGLFRLEQDGSLRTASRFNH  3548

Query  1125  ETQDKYSFVVVAKDNPKSGKSLSSSVNVEVNVLDINDNPPV  1165
               QD++   V   DN      L S   V V +++ +  PP+
Sbjct  3549  NLQDEFVIQVRVFDN--GTPPLYSDAWVVVKIIEESQYPPI  3587


 Score = 158 bits (399),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 308/1408 (22%), Positives = 562/1408 (40%), Gaps = 227/1408 (16%)

Query  142   IDVDELTPVGLTVFRGIRAADHDKPNTPNSDVQYAIVAGNERGKFALESSHQAFLILRKS  201
             +D+ E    G  V + I A D D     N  + Y I  GN+   F +       ++L K 
Sbjct  1414  VDLTENDKPGFLVTQ-ILAVDDD-----NDQLWYNISNGNDDNTFYI-GQDNGNILLSKY  1466

Query  202   LDYDSGDRDFLLTITASDRGTPPKSTNATVR-IKVNDNDDLPPKFTKGVYRTKIKEFYPI  260
             LDY++  + + LTI+ +D GT    TN  V+ I +NDN   PP+F K VY   I E   I
Sbjct  1467  LDYET-QQSYNLTISVTD-GTFTAFTNLLVQVIDINDN---PPQFAKDVYHVNISE--NI  1519

Query  261   TGARIHQRLKFNPSIHAFDQDLAIDSPIRYDIIAGNE---RHLFSLDHVNGSLFLEREID  317
                 +  +L      HA D+D   D  + Y + A  +     LF +D ++G++ + + +D
Sbjct  1520  EEESVIMQL------HATDRDE--DKKLFYHLHATQDPSSLALFRIDSISGNVIVTQRLD  1571

Query  318   LDAERSLPGNTFVLQIQASQMDNPLKTGVARVEVEIMDLNDNLPEFEVDFYNISIVENLP  377
              +          +L +       P K   A++ V + D ND+ PEF        + E+  
Sbjct  1572  FEKTAQ-----HILIVFVKDQGAPGKRNYAKIIVNVHDHNDHHPEFTAKIIQSKVPESAA  1626

Query  378   NGFSVLQIIATDQDQGDNAEFSYQL--EDKSGAFTLDSRTGWLTVRDQTVLDREKRSTIS  435
              G  + ++ A D+D G NAE  Y +   +    F +D   G +T+     +++ +   + 
Sbjct  1627  IGSKLAEVRAIDRDSGHNAEIQYSIITGNVGSVFEIDPTFGIITLAGNLNINKIQEYMLQ  1686

Query  436   MRVYAKEKVPSVVTSQLGASSVNIEVTLLDANDNNPTFIPNNLYEFIITTKAKKGDLVGQ  495
             ++       P  ++SQ+    V+I VT+   ++N+P   P N     I      G  V Q
Sbjct  1687  VKAVDLGNPP--LSSQI---PVHIIVTM---SENDPPKFPTNNIAIEIFENLPIGTFVTQ  1738

Query  496   LHAIDPDLGRNGFVTYSIQKAPNSSIPFEVDTKSGQIMVTQD-DLQASEHL-LFVEASDQ  553
             + A      R+    +    + N +  F ++  +G I++  + D ++ +   L V+ ++ 
Sbjct  1739  VTA------RSSSSIFFNIISGNINESFRINPSTGVIVINGNIDYESIKVFNLTVKGTNM  1792

Query  554   PVNPSEKRSALAVVTVDIRDQNENREPDFIGAPYEFWVGGNVDIGTSVGQIRITEFNNM-  612
                     S+   + + I D N+N  P F+   Y   +  +  IG+ V ++  +  +++ 
Sbjct  1793  AA-----ESSCQNIIIHILDANDNI-PYFVQNEYVGALPESAAIGSYVLKVHDSSKDHLT  1846

Query  613   -----------GTILYDLLHSYHEGVPFAVEEKSGTITVVDDLNKFNRENYDFEAFVNNE  661
                        G + Y ++    +   F ++  +G I ++  L+      Y F+  V++ 
Sbjct  1847  LQVKDADVGVNGMVEYHIVDDLAKNF-FKIDSTTGAIELLRQLDYETNAGYTFDVTVSDM  1905

Query  662   GDLSLVTNVTIHVVDPKDEKTI-LMKTGTTPIEFHVKE--------NEPNILIGKLGFKT  712
             G   L +  T HV       TI ++     P  F+ +E           N+ + ++  K 
Sbjct  1906  GKPKLHSTTTAHV-------TIRVINVNDCPPVFNERELNVTLFLPTFENVFVRQVSAKD  1958

Query  713   NGTNNLKFTI--ANQKDVTDHISITSDGTLYTQKPLDRETRDIYRLTIIAEYNKGSVLGT  770
                + L+F I   N  +       T   T    + L+ E    Y L + A       + +
Sbjct  1959  ADNDTLRFDIVDGNTNECFQIEKYTGIITTRNFEILNNENDRDYALHVRA----SDGIFS  2014

Query  771   GIYQVNVIVDDENDNKPLFERESYEGKITENSKSGTEVDLNYPIHVSDSDVGHNGQFTVT  830
              I  V + V    D+   F+RESY     EN+     + L   ++V  + +  N ++ + 
Sbjct  2015  AILIVKIKVLSAIDSNFAFQRESYRFSAFENNTKVATIGL---VNVIGNTLDENVEYRIL  2071

Query  831   IFGNGSEYFRLDRNLGKIQFTGANTPLDRETTSVYNLRLVATDE--GGLTSEAK-----L  883
                N ++ F +  + G ++ TG     DRE   +Y L + A      G+ S  +     +
Sbjct  2072  ---NPTQLFDIGISSGALKTTGV--IFDREVKDLYRLFVEAKSMLYDGMNSNVRRAVTSI  2126

Query  884   TIQVEDENDNSPLFVQFYLYPDKGIEVLQYDSTGSRVGHFEEASNSTPGLFVLTQNFLRI  943
              I V D NDN PLFV    Y                                     + I
Sbjct  2127  DISVLDVNDNCPLFVNMPYYAT-----------------------------------VSI  2151

Query  944   RKPKEKISPLVSLPEDIAVGSSVIKAIAEDKDDGENSVIKYEMVSETYIPNELSSAPFHI  1003
               PK               G+ +++  A D D  EN  ++YE+        EL       
Sbjct  2152  DDPK---------------GTIIMQVKAIDLDSAENGEVRYELKKGN---GEL-------  2186

Query  1004  IQYFMVQPTTGEVVIARALPAESE-FRLNISATDKGGFKDHLSVRITVRDVNDHPPVFKK  1062
                F +   +GE+ I + +   +  + L ++A D           + V+ ++   PVF+K
Sbjct  2187  ---FKLDRKSGELSIKQHVEGHNRNYELTVAAYDGAITPCSSEAPLQVKVIDRSMPVFEK  2243

Query  1063  SWYNFDAEEASYTRNTLGRIEATDADFGSNANITYSIKNNSTVPFSISPTTGALRVDGLL  1122
              +Y    +E     + L      ++  G   ++ Y+I + S   F I   TG++ V   L
Sbjct  2244  QFYTVSVKEDVEMYSALSVSIEAESPLGR--SLIYTISSESQ-SFEIDYNTGSIFVVNEL  2300

Query  1123  DRETQDKYSFVVVAKDNPKSGKSLSSSVNVEVNVLDINDNPPVFYGYDDLIPNPEANNFS  1182
             D E    +   + A D   S   + + V + V+++D+N          D  P  E++   
Sbjct  2301  DYEKISSHDVSIRATD---SLSGVYAEVVLSVSIMDVN----------DCYPEIESD---  2344

Query  1183  NHNYQQKIPVYYATAAENSPMGTPITRVFANDSDFTGNGNGLILFDIPYRKSRQNLFAID  1242
                      +Y  T  EN+  GT I ++ A D+D   N       +    ++   LF ID
Sbjct  2345  ---------IYNLTIPENASFGTQILKINATDNDSGANAKLSYYIESINGQNNSELFYID  2395

Query  1243  SKEGIVTTIGKLDYESEKSHNITILASDLGSPSLSSTAILIVNIIDVPEDIKSIERPVFA  1302
               +G +     LDYE  K H+I +   D GSPSLSS + + + + D+ ++      P + 
Sbjct  2396  VTDGNLYLKTPLDYEQIKYHHIVVNVKDHGSPSLSSRSNVFITVKDLNDNAPCFVEPSYF  2455

Query  1303  HRYYEVEVEENVPVPLRVLTLNVTEPYRSHKLRYSIVAENSSDVKRTFRIDPRNGSLYII  1362
              +     V        +    ++++   +  L Y IV  N     +T+ ID   G +   
Sbjct  2456  TKVSVAAVRGQFVALPKAYDKDISD---TDSLEYKIVYGNE---LQTYSIDKLTGVI---  2506

Query  1363  ESPDREQKALYELIIRLDQYKVGRDMTVMIYPVTNERLGNLGLNEVKVIVRVTDVNDNAP  1422
                     +L  ++   D     +  TV+   V++      G++     ++++ + +N  
Sbjct  2507  --------SLQNMLNFTD-----KSSTVLNISVSD------GVHTAYARLKISLLPENVY  2547

Query  1423  KFTVTGRPMIAAIPTTANYGYNVIRLQATDPDLGLNGEVRYQILSRADEASRRFAIDPVT  1482
                       A +P    +G+N+I ++A+D D G    + Y+I+S  +E  + F ID  T
Sbjct  2548  SPLFDQSTYEAQVPENLLHGHNIITVKASDGDFGTYANLYYEIVS--EEMKKIFLIDQTT  2605

Query  1483  GQVRGISTFTKEAGKVFGFDVKATDRSG  1510
             G +    TF +E    +   +K +D  G
Sbjct  2606  GVITSKVTFDREKKDEYVVLLKVSDGGG  2633


 Score = 145 bits (367),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 343/1556 (22%), Positives = 616/1556 (40%), Gaps = 258/1556 (17%)

Query  22    FYPQGEYLRFVRVPENLKVGEEVLKIEVYPRNNLNLQPVDRDEDVHFFT-----------  70
             ++ Q EY+    +PE+  +G  VLK+    +++L LQ  D D  V+              
Sbjct  1814  YFVQNEYVG--ALPESAAIGSYVLKVHDSSKDHLTLQVKDADVGVNGMVEYHIVDDLAKN  1871

Query  71    YRDINRTTVSLLLAKSLEDLVDNDSPRNV-LKFKVTCDYDDGEDTI--TSSLSVTVYVED  127
             +  I+ TT ++ L + L      D   N    F VT   D G+  +  T++  VT+ V +
Sbjct  1872  FFKIDSTTGAIELLRQL------DYETNAGYTFDVTVS-DMGKPKLHSTTTAHVTIRVIN  1924

Query  128   INDHAPVFEGAPYHIDVDELTPVGLTVF-RGIRAADHDKPNTPNSDVQYAIVAGNERGKF  186
             +ND  PVF      ++V    P    VF R + A D D     N  +++ IV GN    F
Sbjct  1925  VNDCPPVFN--ERELNVTLFLPTFENVFVRQVSAKDAD-----NDTLRFDIVDGNTNECF  1977

Query  187   ALESSHQAFLILRKSLDYDSGDRDFLLTITASDRGTPPKSTNATVRIKVNDNDDLPPKFT  246
              +E            +  +  DRD+ L + ASD      S    V+IKV    D    F 
Sbjct  1978  QIEKYTGIITTRNFEILNNENDRDYALHVRASD---GIFSAILIVKIKVLSAIDSNFAFQ  2034

Query  247   KGVYRTKIKEFYPITGARIHQRLKFNPSIHAFDQDLAIDSPIRYDIIAGNERHLFSLDHV  306
             +  YR    E       ++      N   +  D++      + Y I+  N   LF +   
Sbjct  2035  RESYRFSAFE----NNTKVATIGLVNVIGNTLDEN------VEYRIL--NPTQLFDIGIS  2082

Query  307   NGSL-----FLEREIDLDAERSLPGNTFVLQIQASQ-----MDNPLKTGVARVEVEIMDL  356
             +G+L       +RE+          + + L ++A       M++ ++  V  +++ ++D+
Sbjct  2083  SGALKTTGVIFDREVK---------DLYRLFVEAKSMLYDGMNSNVRRAVTSIDISVLDV  2133

Query  357   NDNLPEFEVDFYNISIVENLPNGFSVLQIIATDQDQGDNAEFSYQLEDKSGA-FTLDSRT  415
             NDN P F    Y  ++  + P G  ++Q+ A D D  +N E  Y+L+  +G  F LD ++
Sbjct  2134  NDNCPLFVNMPYYATVSIDDPKGTIIMQVKAIDLDSAENGEVRYELKKGNGELFKLDRKS  2193

Query  416   GWLTVRDQTVLDREKRSTISMRVYAKEKVPSVVTSQLGASSVNIEVTLLDANDNNPTFIP  475
             G L+++ Q V    +   +++  Y     P        +S   ++V ++D   + P F  
Sbjct  2194  GELSIK-QHVEGHNRNYELTVAAYDGAITPC-------SSEAPLQVKVIDR--SMPVF-E  2242

Query  476   NNLYEFIITTKAKKGDLVGQLHAIDPDLGRNGFVTYSIQKAPNSSIPFEVDTKSGQIMVT  535
                Y   +    +    +      +  LGR+  + Y+I     S   FE+D  +G I V 
Sbjct  2243  KQFYTVSVKEDVEMYSALSVSIEAESPLGRS--LIYTISSESQS---FEIDYNTGSIFVV  2297

Query  536   Q--DDLQASEHLLFVEASDQPVNPSEKRSALAVVTVDIRDQNENREPDFIGAPYEFWVGG  593
                D  + S H + + A+D  ++       L+V  +D+ D     E D     Y   +  
Sbjct  2298  NELDYEKISSHDVSIRATDS-LSGVYAEVVLSVSIMDVNDCYPEIESDI----YNLTIPE  2352

Query  594   NVDIGTSVGQIRITEFNNMG-----TILYDLLHSYHEGVPFAVEEKSGTITVVDDLNKFN  648
             N   GT + +I  T+ N+ G     +   + ++  +    F ++   G + +   L+   
Sbjct  2353  NASFGTQILKINATD-NDSGANAKLSYYIESINGQNNSELFYIDVTDGNLYLKTPLDYEQ  2411

Query  649   RENYDFEAFVNNEGDLSLV--TNVTIHVVDPKDEKTILMKTGT-TPIEFHVKENEPNILI  705
              + +     V + G  SL   +NV I V D  D     ++    T +       +   L 
Sbjct  2412  IKYHHIVVNVKDHGSPSLSSRSNVFITVKDLNDNAPCFVEPSYFTKVSVAAVRGQFVALP  2471

Query  706   GKLGFKTNGTNNLKFTIANQKDVTDHISITSDGTLYTQKPLDRETRDIYRLTIIAEYNKG  765
                    + T++L++ I    ++  +      G +  Q  L+   +    L I    +  
Sbjct  2472  KAYDKDISDTDSLEYKIVYGNELQTYSIDKLTGVISLQNMLNFTDKSSTVLNI----SVS  2527

Query  766   SVLGTGIYQVNVIVDDENDNKPLFERESYEGKITENSKSGTEVDLNYPIHVSDSDVGHNG  825
               + T   ++ + +  EN   PLF++ +YE ++ EN   G  +     +  SD D G   
Sbjct  2528  DGVHTAYARLKISLLPENVYSPLFDQSTYEAQVPENLLHGHNI---ITVKASDGDFGTYA  2584

Query  826   QFTVTIFGNG-SEYFRLDRNLGKIQFTGANTPLDRETTSVYNLRLVATDEGGLTSEAKLT  884
                  I      + F +D+  G I    +    DRE    Y + L  +D GG    A L 
Sbjct  2585  NLYYEIVSEEMKKIFLIDQTTGVIT---SKVTFDREKKDEYVVLLKVSDGGGKFGFASLK  2641

Query  885   IQVEDENDNSPLFVQFYLYPDKGIEVLQYDSTGSRVGHFEEASNSTPGLFVLTQNFLRIR  944
             + V D NDN P F+                                            ++
Sbjct  2642  VIVVDVNDNVPYFL--------------------------------------------LK  2657

Query  945   KPKEKISPLVSLPEDIAVGSSVIKAIAEDKDDGENSVIKYEMVSETYIPNELSSAPFHII  1004
             + K  +S  V          +++   A+D D  +N  + +++V ++        A   +I
Sbjct  2658  EYKMVVSTTVE------ANQTILTVKAKDDDIVDNGSVHFQIVQKSN-----DKAVKDVI  2706

Query  1005  QYFMVQPTTGEVVIARALPAES----EFRLNISATDKG--GFKDHLSVRITVRDVNDHPP  1058
             +   +   TG++V      AES     ++  + A+D+G   F   + V I + + + + P
Sbjct  2707  E---INEKTGDIVFKSK--AESYGVNSYQFFVRASDRGEPQFHSEVPVSIEIIETDANIP  2761

Query  1059  VFKKSWYNFDAEEASYTRNTLGRIEATDADFGSNANITYSIKNNSTVPFSISPTTGALRV  1118
              F+KS       E++     L ++         N    +SI  +    F IS  +G L +
Sbjct  2762  TFEKSSVLLKIIESTPPGTVLTKLHMI-----GNYTFKFSIAADQD-HFMIS-DSGELIL  2814

Query  1119  DGLLDRETQDKYSFVVVAKDNPKSGKSLSSSVNVEVNVLDINDNPPVFYGYDDLIPNPEA  1178
                LDRE Q+ ++ +VVA+         +S+V             PVF+ Y D++ +   
Sbjct  2815  QQTLDREQQESHNLIVVAE---------TSTV-------------PVFFAYADVLIDVRD  2852

Query  1179  NNFSNHNYQQKIPVYY-ATAAENSPMGTPITRVFANDSDFTGNGNGLILFDIPY-----R  1232
                 N NY +    +Y A+ AENS     + +V A D+D   NG      DI Y      
Sbjct  2853  ---ENDNYPKFDNTFYSASVAENSEKVISLVKVSATDADTGPNG------DIRYYLESDT  2903

Query  1233  KSRQNLFAIDSKEGIVTTIGKLDYESEKSHNITILASDLGSPSLSSTAILIVNIIDVPED  1292
             ++ QN+F ID   G +T +  LD E +  +N  ++A+D G P   +   + + I+D  ++
Sbjct  2904  ENIQNIFDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDN  2963

Query  1293  IKSIERPVFAHRYYEVEVEENVPVPLRVLTLNVTEP-YRSHKLRYSIVAENSSDVKRTFR  1351
                   PVF      + V EN      ++ L + +P     ++ + IV   S D +  F+
Sbjct  2964  -----APVFKLPIEGLSVFENALPGTVLINLLLIDPDIEKQEMDFFIV---SGDKQAQFQ  3015

Query  1352  IDPRNGSLYIIESPDREQKALYELIIRLDQYKVGRDMTVMIYPVTNERLGNLGLNEVKVI  1411
             I  ++G L+I +  DREQ   Y L I     K      V I                   
Sbjct  3016  IG-KSGELFIAKPLDREQLMFYNLSIIATDGKFTAKANVEI-------------------  3055

Query  1412  VRVTDVNDNAPKFTVTGRPMIAAIPTTANYGYNVIRLQATDPDLGLNGEVRYQILSRADE  1471
               V D+NDN P + +  R  I+    + + G  ++ ++A D D     ++R+ +   + +
Sbjct  3056  -DVKDINDNTP-YCLKPRYHIST-NESISIGTTLVEVKAIDFD--FQSKLRFYL---SGK  3107

Query  1472  ASRRFAIDPVTGQVRGISTFTKEAGKVFGFDVKATDRSGADDGKSSIANVFVYVLD  1527
              +  F+I   +G ++  S   +E    +       D  G D  +   + + + V D
Sbjct  3108  GADDFSIGKESGILKVASALDRETTPKYKLVAHVQD--GKDFTQECFSEIIITVND  3161


 Score = 138 bits (348),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 167/676 (25%), Positives = 304/676 (45%), Gaps = 66/676 (10%)

Query  116   TSSLSVTVYVEDINDHAPVFEGAPYHIDVDELTPVGLTVFRGIRAADHDKPNTPNSDVQY  175
             T+  +V + V+DIND+ P      YHI  +E   +G T+   ++A D D      S +++
Sbjct  3048  TAKANVEIDVKDINDNTPYCLKPRYHISTNESISIGTTLVE-VKAIDFDF----QSKLRF  3102

Query  176   AIVAGNERGKFALESSHQAFLILRKSLDYDSGDRDFLLTITASDRGTPPKSTNATVRIKV  235
              + +G     F++       L +  +LD ++  + + L     D     +   + + I V
Sbjct  3103  YL-SGKGADDFSI-GKESGILKVASALDRETTPK-YKLVAHVQDGKDFTQECFSEIIITV  3159

Query  236   NDNDDLPPKFTKGVYRTKIKEFYPITGARIHQRLKFNPSIHAFDQDLAIDSPIRYDIIAG  295
             ND +D  P F+   YR  + E      A+++  +     +HA D+D  ++  I+Y ++  
Sbjct  3160  NDINDNMPIFSMAQYRVSVPE-----DAQLNTLIT---KVHAMDKDFGVNRQIKYSLMGE  3211

Query  296   NERHLFSLDHVNGSLFLEREIDLDAERSLPGNTFVLQIQASQMDNPLKTGVARVEVEIMD  355
             N  + F +    G + L + +D +       + F L ++A     P    +A V V I+D
Sbjct  3212  NHDY-FKISKSTGIIRLHKSLDRETI-----SLFNLTVKAEDCGVPKLHSIATVAVNILD  3265

Query  356   LNDNLPEFEVDFYNISIVENLPNGFSVLQIIATDQDQGDNAEFSYQLE--DKSGAFTLDS  413
             +NDN PEF +  Y+  I+EN  +G  V ++ AT  D G NA+  Y +   ++ G F +DS
Sbjct  3266  INDNPPEFSMRQYSCKILENATHGTEVCKVYATSIDIGVNADIHYFIMSGNEQGKFKMDS  3325

Query  414   RTGWLTVRDQTVLDREKRSTISMRVYAKE-KVPSVVTSQLGASSVNIEVTLLDANDNNPT  472
              TG L +     LD E      + + A +   P +      +++  + +++LD NDN+PT
Sbjct  3326  TTGDLVL--NATLDYEMSKFYFLTIQAIDGGTPPL------SNNAYVNISILDINDNSPT  3377

Query  473   FIPNNLYEFIITTKAKKGDLVGQLHAIDPDLGRNGFVTYSIQKAPNSSIPFEVDTKSGQI  532
             F+  NLY   +      G  +  + A D D   NG VTY+I++  N    F +D K+G I
Sbjct  3378  FL-QNLYRINVNEDIFVGSKILDVKATDEDSDVNGLVTYNIERGDNIG-QFSIDPKNGTI  3435

Query  533   MVTQ--DDLQASEHLLFVEASDQPVNPSEKRSALAVVTVDIRDQNENREPDFIGAPYEFW  590
              V++  D    S + L ++A DQ      +R     + ++I D N+N  P F  + Y   
Sbjct  3436  SVSRPLDRETISHYTLEIQACDQ---GDPQRCNSVPININILDTNDN-APIFSSSNYSVV  3491

Query  591   VGGNVDIGTSVGQIRITEFN---NMGTILYDLLHSYHEGVPFAVEEKSGTITVVDDLNKF  647
             +  N  +G      +I++ +   N     +D + S +EG  F +E+  G++      N  
Sbjct  3492  LQENRLLGYVFLTFKISDADETPNTTPYTFD-IRSGNEGGLFRLEQ-DGSLRTASRFNHN  3549

Query  648   NRENYDFEAFVNNEGDLSLVTN--VTIHVVDPKDEKTILMKTGTTPIEFHVKENEPNILI  705
              ++ +  +  V + G   L ++  V + +++      I+     TP+E  +   E +   
Sbjct  3550  LQDEFVIQVRVFDNGTPPLYSDAWVVVKIIEESQYPPIV-----TPLEVTINSFEDDFSG  3604

Query  706   GKLGFKTNGTNNLKFTIANQKDVTDHISITSDGTLYTQKPLDRETRDIYRLTIIAEYNKG  765
               +G K + ++  K+   N   V+    +     L+    +   T  IY +         
Sbjct  3605  AFIG-KVHASDQDKYDELNFSLVSGPDDMYQSSKLFN---ISNNTGKIYAI---------  3651

Query  766   SVLGTGIYQVNVIVDD  781
             S L  G+Y++NV V D
Sbjct  3652  SNLDIGLYKLNVSVSD  3667


 Score = 115 bits (289),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 199/855 (23%), Positives = 341/855 (40%), Gaps = 99/855 (12%)

Query  109   DDGEDTITSSLSVTVYVEDINDHAPVFEGAPYHIDVDELTPVGLTVFRGIRAADHDKPNT  168
             D GE    S + V++ + + + + P FE +   + + E TP G TV   +          
Sbjct  2737  DRGEPQFHSEVPVSIEIIETDANIPTFEKSSVLLKIIESTPPG-TVLTKLHMIG------  2789

Query  169   PNSDVQYAIVAGNERGKFALESSHQAFLILRKSLDYDSGDRDFLLTITASDRGTPPKSTN  228
              N   +++I A  ++  F +  S +  LIL+++LD +  +   L+ + A     P     
Sbjct  2790  -NYTFKFSIAA--DQDHFMISDSGE--LILQQTLDREQQESHNLIVV-AETSTVPVFFAY  2843

Query  229   ATVRIKVNDNDDLPPKFTKGVYRTKIKEFYPITGARIHQRLKFNPSIHAFDQDLAIDSPI  288
             A V I V D +D  PKF    Y   + E       ++   +K    + A D D   +  I
Sbjct  2844  ADVLIDVRDENDNYPKFDNTFYSASVAE----NSEKVISLVK----VSATDADTGPNGDI  2895

Query  289   RYDIIAGNE--RHLFSLDHVNGSLFLEREIDLDAERSLPGNTFVLQIQASQMDNPLKTGV  346
             RY + +  E  +++F +D  +G + L   +D + +       +  ++ A+   +P     
Sbjct  2896  RYYLESDTENIQNIFDIDIYSGWITLLTSLDREVQSE-----YNFKVIAADNGHPKHDAK  2950

Query  347   ARVEVEIMDLNDNLPEFEVDFYNISIVENLPNGFSVLQIIATDQD-QGDNAEFSYQLEDK  405
               V ++I+D NDN P F++    +S+ EN   G  ++ ++  D D +    +F     DK
Sbjct  2951  VPVTIKIVDYNDNAPVFKLPIEGLSVFENALPGTVLINLLLIDPDIEKQEMDFFIVSGDK  3010

Query  406   SGAFTLDSRTGWLTVRDQTVLDREKRSTISMRVYAKEKVPSVVTSQLGASSVNIEVTLLD  465
                F +  ++G L +     LDRE+    ++ + A        T     +  N+E+ + D
Sbjct  3011  QAQFQI-GKSGELFIAKP--LDREQLMFYNLSIIA--------TDGKFTAKANVEIDVKD  3059

Query  466   ANDNNPTFIPNNLYEFIITTKAKKGDLVGQLHAIDPDLGRNGFVTYSIQKAPNSSIPFEV  525
              NDN P +     Y          G  + ++ AID D         S + A +    F +
Sbjct  3060  INDNTP-YCLKPRYHISTNESISIGTTLVEVKAIDFDFQSKLRFYLSGKGADD----FSI  3114

Query  526   DTKSGQIMVTQ--DDLQASEHLLFVEASDQPVNPSEKRSALAVVTVDIRDQNENREPDFI  583
               +SG + V    D     ++ L     D      E  S + +   DI D      P F 
Sbjct  3115  GKESGILKVASALDRETTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDN----MPIFS  3170

Query  584   GAPYEFWVGGNVDIGTSVGQIRITE--FNNMGTILYDLLHSYHEGVPFAVEEKSGTITVV  641
              A Y   V  +  + T + ++   +  F     I Y L+   H+   F + + +G I + 
Sbjct  3171  MAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGENHDY--FKISKSTGIIRLH  3228

Query  642   DDLNKFNRENYDFEAFVNNEG--DLSLVTNVTIHVVDPKDEKTILMKTGTTPIEFHVKEN  699
               L++     ++      + G   L  +  V ++++D  D           P EF +++ 
Sbjct  3229  KSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDIND----------NPPEFSMRQY  3278

Query  700   EPNILIGKLGFKTNGTNNLKFTIANQKDVTDHISI----------------TSDGTLYTQ  743
                IL       T+GT   K   A   D+  +  I                ++ G L   
Sbjct  3279  SCKILENA----THGTEVCK-VYATSIDIGVNADIHYFIMSGNEQGKFKMDSTTGDLVLN  3333

Query  744   KPLDRETRDIYRLTIIAEYNKGSVLGTGIYQVNVIVDDENDNKPLFERESYEGKITENSK  803
               LD E    Y LTI A       L    Y VN+ + D NDN P F +  Y   + E+  
Sbjct  3334  ATLDYEMSKFYFLTIQAIDGGTPPLSNNAY-VNISILDINDNSPTFLQNLYRINVNEDIF  3392

Query  804   SGTEVDLNYPIHVSDSDVGHNGQFTVTI-FGNGSEYFRLDRNLGKIQFTGANTPLDRETT  862
              G+++     +  +D D   NG  T  I  G+    F +D   G I  +    PLDRET 
Sbjct  3393  VGSKI---LDVKATDEDSDVNGLVTYNIERGDNIGQFSIDPKNGTISVS---RPLDRETI  3446

Query  863   SVYNLRLVATDEGG--LTSEAKLTIQVEDENDNSPLFVQF-YLYPDKGIEVLQYDSTGSR  919
             S Y L + A D+G     +   + I + D NDN+P+F    Y    +   +L Y     +
Sbjct  3447  SHYTLEIQACDQGDPQRCNSVPININILDTNDNAPIFSSSNYSVVLQENRLLGYVFLTFK  3506

Query  920   VGHFEEASNSTPGLF  934
             +   +E  N+TP  F
Sbjct  3507  ISDADETPNTTPYTF  3521


 Score = 101 bits (251),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 122/447 (27%), Positives = 205/447 (46%), Gaps = 40/447 (9%)

Query  117  SSLSVTVYVEDINDHAPVFEGAPYHIDVDELTPVGLTVFRGIRAADHDKPNTPNSDV-QY  175
            S   V++ V+ +N +AP      +      +TP    +  GI   + DK    N ++ + 
Sbjct  273  SKTKVSISVKQVNFYAPEIFTKTF----SSVTPTSNPLIYGIVRVN-DKDTGINGNIGRL  327

Query  176  AIVAGNERGKFAL---ESSHQAFLILRKSLDYDSGDRDFLLTITASDRGTPPKSTNATVR  232
             IV GN  G F L   E+  + ++ L +    +     + LT+ A D GTP +    +V 
Sbjct  328  EIVDGNPDGTFLLKAAETKDEYYIELNQFAHLNQQHFIYNLTLLAEDLGTPRRFAYKSVP  387

Query  233  IKVNDNDDLPPKFTKGVYRTKIKEFYPITGARIHQRLKFNPSIHAFDQDLAIDSPIRYDI  292
            I++       P FT+ +Y   I E  PI    I  RLK +      D DL  ++ +  +I
Sbjct  388  IQIKPESKNIPIFTQEIYEVSIPETAPINMPVI--RLKVS------DPDLGKNALVYLEI  439

Query  293  IAGNERHLFSLDHVNGSLFLEREIDLDAERSLPGNTFVLQIQASQMDN--PLKTGVARVE  350
            + GNE   F ++  +G L+  ++  LDAE+    +++ L + A    N    K   A+V+
Sbjct  440  VGGNEGDEFRINPDSGMLYTAKQ--LDAEKK---SSYTLTVSAIDQANVGSRKQSSAKVK  494

Query  351  VEIMDLNDNLPEFEVDFYNISIVENLPNGFSVLQIIATDQDQGDNAEFSYQLEDKSGA-F  409
            + + D+NDN P FE     ISI EN   G  V+++ A D+D G+N+  SY + + +   F
Sbjct  495  ISVQDMNDNDPIFENVNKVISINENNLAGSFVVKLTAKDRDSGENSYISYSIANLNAVPF  554

Query  410  TLDSRTGWLTVRDQTVLDRE--KRSTISMRVYAKEKVPSVVTSQLGASSVNIEVTLLDAN  467
             +D  +G   V+  ++LD E  KR+   +   +   +P    ++     + + + + D N
Sbjct  555  EIDHFSG--IVKTTSLLDFETMKRNYELIIRASDWGLPYRRQTE-----IKLSIVVKDIN  607

Query  468  DNNPTFIPNNLYEFIITTKAKKGDLVGQLHAIDPDLGRNGFVTYSIQKAPNSSIPFEVDT  527
            DN P F   N Y   +T  A  G  V    AID D G    ++Y +    N    F +D 
Sbjct  608  DNRPQFERVNCYG-KVTKSAPMGTEVFVTSAIDFDAG--DIISYRLSDG-NEDGCFNLDP  663

Query  528  KSGQIMVTQD--DLQASEHLLFVEASD  552
             SG + ++ D      +  +L V A+D
Sbjct  664  TSGSLSISCDLKKTTLTNRILKVSATD  690


 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 106/436 (24%), Positives = 191/436 (44%), Gaps = 48/436 (11%)

Query  170  NSDVQYAIVAGNERGKFALES---SHQAFLILRKSLDYDSGDRD----FLLTITAS----  218
            N++V+Y I++G++   F  E       AFL +R   +    +R+    +++ + A     
Sbjct  97   NAEVKYRIISGDKEKLFKAEEKLVGDFAFLAIRTRTNNVVLNREKTEEYVIRVKAHVHLH  156

Query  219  DRGTPPKSTNATVRIKVNDNDDLPPKFTKGVYRTKIKEFYPITGARIHQRLKFNPSIHAF  278
            DR      T A + IKV D +DL P F    Y   I E  P    +    LK    + A 
Sbjct  157  DRNVSSYETEANIHIKVLDRNDLSPLFYPTQYTVVIPEDTP----KYQSILK----VTAD  208

Query  279  DQDLAIDSPIRYDIIAGNERHLFSLDHVNGSLFLEREIDLDAERSLPGNTFVLQIQASQM  338
            D DL I+  I Y ++  +E   F++    G + L +++   AE S    T V   + S +
Sbjct  209  DADLGINGEIYYSLLMDSE--YFAIHPTTGEITLLQQLQY-AENSHFELTVVAYDRGSWV  265

Query  339  DNP-LKTGVARVEVEIMDLNDNLPE-FEVDFYNISIVENLPNGFSVLQIIATDQDQGDNA  396
            ++   +    +V + +  +N   PE F   F +++   N P  + ++++   D+D G N 
Sbjct  266  NHQNHQASKTKVSISVKQVNFYAPEIFTKTFSSVTPTSN-PLIYGIVRV--NDKDTGING  322

Query  397  EFSYQLE----DKSGAFTLDSRTGWLTVRDQTVLDREKRSTISMRVYAKEKVPSVVTSQL  452
                +LE    +  G F L +       +D+  ++  + + ++ + +      +++   L
Sbjct  323  NIG-RLEIVDGNPDGTFLLKAA----ETKDEYYIELNQFAHLNQQHFIYNL--TLLAEDL  375

Query  453  GA----SSVNIEVTLLDANDNNPTFIPNNLYEFIITTKAKKGDLVGQLHAIDPDLGRNGF  508
            G     +  ++ + +   + N P F    +YE  I   A     V +L   DPDLG+N  
Sbjct  376  GTPRRFAYKSVPIQIKPESKNIPIFT-QEIYEVSIPETAPINMPVIRLKVSDPDLGKNAL  434

Query  509  VTYSIQKAPNSSIPFEVDTKSGQIMVTQ--DDLQASEHLLFVEASDQPVNPSEKRSALAV  566
            V   I    N    F ++  SG +   +  D  + S + L V A DQ    S K+S+ A 
Sbjct  435  VYLEIVGG-NEGDEFRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSS-AK  492

Query  567  VTVDIRDQNENREPDF  582
            V + ++D N+N +P F
Sbjct  493  VKISVQDMNDN-DPIF  507


 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 49/102 (48%), Gaps = 6/102 (6%)

Query  1407  EVKVIVRVTDVNDNAPKFTVTGRPMIAAIPTTANYGYNVIRLQATDPDLGLNGEVRYQIL  1466
             E  + ++V D ND +P F  T   ++  IP       +++++ A D DLG+NGE+ Y +L
Sbjct  166   EANIHIKVLDRNDLSPLFYPTQYTVV--IPEDTPKYQSILKVTADDADLGINGEIYYSLL  223

Query  1467  SRADEASRRFAIDPVTGQVRGISTFTKEAGKVFGFDVKATDR  1508
                   S  FAI P TG++  +          F   V A DR
Sbjct  224   MD----SEYFAIHPTTGEITLLQQLQYAENSHFELTVVAYDR  261



Lambda      K        H
   0.321    0.136    0.397 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 566763464


Query= XP_018560770.2 uncharacterized protein LOC108903166 [Anoplophora
glabripennis]

Length=227
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9NBW3_DROME  unnamed protein product                                 27.7    7.5  


>Q9NBW3_DROME unnamed protein product
Length=255

 Score = 27.7 bits (60),  Expect = 7.5, Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 17/30 (57%), Gaps = 0/30 (0%)

Query  62   SLGRATSFNAQNVKVFFEKLAEVMDRYGFT  91
            S G  +  N  +  VF + L EVMD+YG T
Sbjct  179  SEGYLSYRNENHGSVFIQTLCEVMDQYGLT  208



Lambda      K        H
   0.321    0.136    0.397 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 566763464


Query= XP_018560771.1 uncharacterized protein LOC108903167 [Anoplophora
glabripennis]

Length=277
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

C6KT82_PLAF7  unnamed protein product                                 36.2    0.029
SPE9_CAEEL  unnamed protein product                                   30.0    2.4  
O01299_CAEEL  unnamed protein product                                 29.6    3.2  
M9PC41_DROME  unnamed protein product                                 28.9    6.9  
M9PEH5_DROME  unnamed protein product                                 28.9    7.2  


>C6KT82_PLAF7 unnamed protein product
Length=2719

 Score = 36.2 bits (82),  Expect = 0.029, Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 30/60 (50%), Gaps = 13/60 (22%)

Query  228  CLICCEGYSESLPGESWIQCQACREWAHTKCVPGAGV----------TFVCVNCNSDNDD  277
            C +C E + E   G+  IQC+ C++  H +C+   G+           +VC  C +++DD
Sbjct  8    CTLCRENFEE---GDECIQCKQCKKKFHRECLQAEGLMDNEQLKDIKNYVCYQCINEDDD  64


>SPE9_CAEEL unnamed protein product
Length=661

 Score = 30.0 bits (66),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 16/30 (53%), Gaps = 0/30 (0%)

Query  248  QACREWAHTKCVPGAGVTFVCVNCNSDNDD  277
            QAC E    KC PGA     CV C SD DD
Sbjct  460  QACMEINEKKCAPGACGNGRCVPCESDADD  489


>O01299_CAEEL unnamed protein product
Length=762

 Score = 29.6 bits (65),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 33/65 (51%), Gaps = 1/65 (2%)

Query  64   NGFRKTGIFPYNANIFGEDEFSPSFVTDRSEQETI-EPEKDHPEQAVMSSTELNPTPSAS  122
            +G+ ++G  P N+ I  +D  +     D  ++E+  EPE+  P     S     PT S +
Sbjct  182  SGYNESGYCPQNSTILPDDPQNYQHGNDGDDEESFGEPERYEPMSPTFSIHSFAPTTSTN  241

Query  123  TSQAE  127
            T++AE
Sbjct  242  TAEAE  246


>M9PC41_DROME unnamed protein product
Length=22743

 Score = 28.9 bits (63),  Expect = 6.9, Method: Compositional matrix adjust.
 Identities = 20/78 (26%), Positives = 35/78 (45%), Gaps = 4/78 (5%)

Query  133   SNKENETIDLTQVFSPEIVRTYPKASPRKAAKTNRRKRKTAILTDTPEKNALEEQQNKTT  192
             S + +E+  LT   S E  R  P  SPR A +T      T+++T+T +  +    + + T
Sbjct  8011  SERPDESTRLTSEESTETTRPVPTVSPRDALETT----VTSLITETTKTTSGGTPRGQVT  8066

Query  193   KKVKKPKKNMDKKRKKSV  210
             ++  K    +   R   V
Sbjct  8067  ERTTKSVSELTTGRSSDV  8084


>M9PEH5_DROME unnamed protein product
Length=20710

 Score = 28.9 bits (63),  Expect = 7.2, Method: Compositional matrix adjust.
 Identities = 20/78 (26%), Positives = 35/78 (45%), Gaps = 4/78 (5%)

Query  133   SNKENETIDLTQVFSPEIVRTYPKASPRKAAKTNRRKRKTAILTDTPEKNALEEQQNKTT  192
             S + +E+  LT   S E  R  P  SPR A +T      T+++T+T +  +    + + T
Sbjct  8011  SERPDESTRLTSEESTETTRPVPTVSPRDALETT----VTSLITETTKTTSGGTPRGQVT  8066

Query  193   KKVKKPKKNMDKKRKKSV  210
             ++  K    +   R   V
Sbjct  8067  ERTTKSVSELTTGRSSDV  8084



Lambda      K        H
   0.321    0.136    0.397 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 566763464


Query= XP_018560772.1 uncharacterized protein LOC108903168 [Anoplophora
glabripennis]

Length=1001
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ITBL_CAEEL  unnamed protein product                                   36.6    0.11 
WIF1_DROME  unnamed protein product                                   32.7    1.7  
Q86AS3_DICDI  unnamed protein product                                 32.0    3.7  
Q95RQ1_DROME  unnamed protein product                                 30.8    6.4  


>ITBL_CAEEL unnamed protein product
Length=423

 Score = 36.6 bits (83),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 34/81 (42%), Gaps = 17/81 (21%)

Query  707  GYVSCSECSYDSDTCTCVSADKCYCSLGTKNLTKRMT---KC----SGPNCRMEGKCYCN  759
            G++ C +C  D         DKC C L +  ++K      KC    S P C   GKC C 
Sbjct  234  GHLVCGQCVCDQSR----GGDKCECPLASHGVSKASELEDKCRFNSSSPVCSASGKCKCG  289

Query  760  LDN------TLNFCECDTDSC  774
                     T  FC+CD DSC
Sbjct  290  QCQCNKPTVTGKFCQCDNDSC  310


>WIF1_DROME unnamed protein product
Length=456

 Score = 32.7 bits (73),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 32/82 (39%), Gaps = 19/82 (23%)

Query  723  CVSADKCYCSLGTKNLTKRMTKCSGPNCRMEGKC----YCNLDNTL------------NF  766
            C+  DKC CS G   L    +KC  P C+ EG+C     C   N L            + 
Sbjct  357  CIQKDKCQCSKGYYGLRCEYSKCVIP-CKNEGRCIGNNLCRCPNGLRGDHCEIGRKQRSI  415

Query  767  CECDTDSCTESNKCYCSSAPAF  788
            C+C   +C     C C   P F
Sbjct  416  CKCRNGTCVSHKHCKCH--PGF  435


>Q86AS3_DICDI unnamed protein product
Length=1918

 Score = 32.0 bits (71),  Expect = 3.7, Method: Compositional matrix adjust.
 Identities = 17/43 (40%), Positives = 21/43 (49%), Gaps = 4/43 (9%)

Query  729   CYCSLGTKNLTKRMTKCSGPNCRMEGKCYCNLDNTLNFCECDT  771
             C C+LG  N      +C  PNC   G C    D TL  C+CD+
Sbjct  1308  CSCNLGRLNNDCSGIQCGSPNCNGHGTC----DTTLGVCKCDS  1346


>Q95RQ1_DROME unnamed protein product
Length=512

 Score = 30.8 bits (68),  Expect = 6.4, Method: Compositional matrix adjust.
 Identities = 23/68 (34%), Positives = 30/68 (44%), Gaps = 5/68 (7%)

Query  746  SGPNCRMEGKCYCNLDNTLNFCECDTDSC-TE---SNKCYCSSAPAFNHLKQKGFTHHNH  801
            +G NC     C C    T  FCE D D C TE     +C  +    F   +Q GF   + 
Sbjct  338  NGGNCTAPSTCSCPTGFTGRFCEQDVDECQTEKPCDQQCINTHGSYFCRCRQ-GFVLQSD  396

Query  802  KKLCKKSS  809
            ++ CKK S
Sbjct  397  QQSCKKVS  404



Lambda      K        H
   0.321    0.136    0.397 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 566763464


Query= XP_018560773.1 lanC-like protein 2 [Anoplophora glabripennis]

Length=395
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O96164_PLAF7  unnamed protein product                                 30.8    2.6  
Q38A03_TRYB2  unnamed protein product                                 29.6    4.1  
Q4GYR8_TRYB2  unnamed protein product                                 29.6    4.5  
G5EF11_CAEEL  unnamed protein product                                 28.9    7.4  
E9ACF5_LEIMA  unnamed protein product                                 29.3    7.4  


>O96164_PLAF7 unnamed protein product
Length=962

 Score = 30.8 bits (68),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 63/176 (36%), Gaps = 46/176 (26%)

Query  28   SKKCKISCNLSAKWQATLNKCQCLDYNDYSVYTGTSGI-------------ALLKLRKDP  74
            SK   I   L   W       + LDYN+     GT G              + +KL KD 
Sbjct  564  SKVGDICPQLQNDWDNVFENTKVLDYNNGPFSVGTKGYIAYESEAFQKDMHSFVKLVKD-  622

Query  75   DNVEILH--------EAKNLLSLNRLRNRRHTFLCGDAGPLSIGIVVNHK--LGNNEEVK  124
               EI++        +A+N+L    L  ++   LCGD  P  +  +V +   + N  E K
Sbjct  623  ---EIMNKGSVIAYVKAENVLGY-ELNGKKVQNLCGDKTPDHVVNIVGYGNYINNKGEKK  678

Query  125  QLAARLKSLEKDVLHVHSDLPNEYLYGRAGYLFAILYANKNVVPPPFDDNFIRSVI  180
                   S  K              +G  GY    +Y      P   +DNFI +V+
Sbjct  679  SYWIVRNSWGK-------------YWGDDGYFKVDMYG-----PSTCEDNFIHTVV  716


>Q38A03_TRYB2 unnamed protein product
Length=333

 Score = 29.6 bits (65),  Expect = 4.1, Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 16/28 (57%), Gaps = 0/28 (0%)

Query  330  LYQTTKEEKHLYRAIKFAEWCLAYSREH  357
            L  T  EE+    A++FA+WC    R+H
Sbjct  90   LPSTANEEEDEDGAVRFAQWCTPIERKH  117


>Q4GYR8_TRYB2 unnamed protein product
Length=559

 Score = 29.6 bits (65),  Expect = 4.5, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query  55   DYSVYTGTSGIALLKLRKDPDNVEILHEAKNLLSLNRLRN--RRHTFLCG  102
            D    TGT GIAL K  K    +E++  A     LN  RN  R  TF CG
Sbjct  402  DLCCGTGTIGIALAKHVKRVIGIELVESAVRDARLNAERNGVRNATFNCG  451


>G5EF11_CAEEL unnamed protein product
Length=342

 Score = 28.9 bits (63),  Expect = 7.4, Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 40/92 (43%), Gaps = 18/92 (20%)

Query  99   FLCGDAGPLSIGIVVNHKLGNNEEVKQLAARLKSLEKDVLHVHSDLPNE------YLYGR  152
            +L   +GPL   IV NH+L +         R ++      HV +D P+E      Y   R
Sbjct  240  YLKDPSGPLRAAIVSNHELHD------FVQRERAKRPGEEHVDADAPDEMMDDSRYRNRR  293

Query  153  A---GYLFAI---LYANKNVVPPPFDDNFIRS  178
                  +F     + A K++ PPP  D+++ S
Sbjct  294  TINDDEMFGFEQKVPAMKHLEPPPASDDYVYS  325


>E9ACF5_LEIMA unnamed protein product
Length=628

 Score = 29.3 bits (64),  Expect = 7.4, Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 8/53 (15%)

Query  310  LKKGYSICHGVSGNAYCFLELYQTTKEEKHLYRAIKFAEWCLAYSREHEEHPP  362
            L KG  +  GV GNA C  ++ + T +E+         E  +    EHE H P
Sbjct  177  LSKGDVLSWGVPGNAKCRAQVSRITSDEE--------VEVTVPIPAEHEVHTP  221



Lambda      K        H
   0.321    0.136    0.397 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 566763464


Query= XP_018560774.1 merlin [Anoplophora glabripennis]

Length=615
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MERH_DROME  unnamed protein product                                   686     0.0   
G5EES2_CAEEL  unnamed protein product                                 484     3e-165
MOEH_DROME  unnamed protein product                                   482     2e-164
G5EBK3_CAEEL  unnamed protein product                                 480     5e-164
H2KYX3_CAEEL  unnamed protein product                                 418     8e-138


>MERH_DROME unnamed protein product
Length=635

 Score = 686 bits (1770),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/636 (55%), Positives = 459/636 (72%), Gaps = 26/636 (4%)

Query  5    MPPFRRKKSGKSFPVKVCTLDAELEFNLEWRATGRDLFELVCRTIGLRETWYFGLQYEDS  64
            M PF  KK+ +S  V+V T D+ELEF LE RA+G+DLF+LVCRTIGLRE+WYFGLQY D+
Sbjct  1    MSPFGSKKN-RSLSVRVSTFDSELEFKLEPRASGQDLFDLVCRTIGLRESWYFGLQYVDT  59

Query  65   KGFISWLKLDKKVQDQSIQ--KNHQTASFMFLAKFYPEEVAEELVQEVTQHSFFLQVKQA  122
            +  +SWLK++K+V+DQ ++   ++    F F AKF+PE V+EEL+QE+TQH FFLQVKQ+
Sbjct  60   RSNVSWLKMEKRVRDQRVELHASNNVYVFSFYAKFFPENVSEELIQEITQHLFFLQVKQS  119

Query  123  ILSMDVYCPPEASVLLASYAVQAKFGDFDEDTYKPGMLASEDLLPQRVIDQYQMTLEMWE  182
            ILSMD+YC PEASVLLASYAV  ++G +D +TYK GMLA  +LLP+ V DQYQMT EMWE
Sbjct  120  ILSMDIYCRPEASVLLASYAVHVQYGPYDYETYKDGMLAGGELLPKGVTDQYQMTPEMWE  179

Query  183  ERIRVWYADHRGMSRDEAEMEYLKIAQDLDMYGVNYFPIMNKKETDLWLGVTALGLNIYE  242
            ERI+ WY DH  M+RDE EMEYLKIAQDLDMYGVNYFPI NK +T LWLGVT++GLNIY+
Sbjct  180  ERIKTWYMDHEPMTRDEVEMEYLKIAQDLDMYGVNYFPITNKNKTKLWLGVTSVGLNIYD  239

Query  243  KENKLQPKTTFTWSEIRHISFDDKKFIIKPVDKNAPNFVFFSQKVRMNKLILDLCMGNHD  302
            + +KL PKTTF W+EIRH+SFDDKKF I+ VD    NF+F+SQ + +NK+ILDLC GNHD
Sbjct  240  ERDKLTPKTTFQWNEIRHVSFDDKKFTIRLVDAKVSNFIFYSQDLHINKMILDLCKGNHD  299

Query  303  LFMRRRKPDSMELQQMKAAAKEEKQRRQVQRNRLAREKQLREEAERDRANMEQRLLQYQE  362
            L+MRRRKPD+ME+QQMKA AKEEKQRRQ++R +  REK+LRE+AE +R  +E+ +   Q 
Sbjct  300  LYMRRRKPDTMEIQQMKAQAKEEKQRRQIERKKFIREKKLREKAEHERYELEKSMEHLQN  359

Query  363  EIRLANEALRRSEESADLLAEKSRVAEEEARLLSQKAAEAEQEITRLRLTAMRKDEEKVS  422
            E+R+AN+ALRRSEE+ +L  EKSRV EE+ +L   KA   + E+ RLR   M+ + EK  
Sbjct  360  EMRMANDALRRSEETKELYFEKSRVNEEQMQLTECKANHFKTEMDRLRERQMKIEREKHD  419

Query  423  LERKTREAEMLTARLVEESEKRAAEANKLKDELLKARAAEKQAKEKLLDFL---------  473
            LE+K R+A+    +L  E++KR AE  KL+ EL+ A+ AE++A  +LL+FL         
Sbjct  420  LEKKIRDADFYVHQLTVENDKREAETEKLRKELICAKMAEREATARLLEFLNSGRKSSTD  479

Query  474  SRTTSYTGSNTASPISSVTTLYAPP---------LSPGYGADLSILDS----EASTSPDL  520
            S  T+ + S+ A+  SS+  +  P          L    GA+L+   S    +   S  +
Sbjct  480  SLLTASSVSHAANTASSMAAISTPSLITSSSTNDLETAGGAELTTHSSHYLVQGDNSSGI  539

Query  521  NLNLNSYDLI-AHGDADQLSLEIEKERVDYLEKSKHLQNQLRELRSEIAVLKVGDKQNDY  579
            + +    + I    + +Q++ E+E+  +DYL  SK +Q+QL+ LRSEIA  K+ + Q++ 
Sbjct  540  SDDFEPKEFILTDNEMEQITNEMERNHLDYLRNSKQVQSQLQTLRSEIAPHKIEENQSNL  599

Query  580  DQLHEEQVKMGENKYSTLKKSKSGSTKSRVAFFEEL  615
            D L E Q+K GENKYSTLKK KSGSTK+RVAFFEEL
Sbjct  600  DILSEAQIKAGENKYSTLKKLKSGSTKARVAFFEEL  635


>G5EES2_CAEEL unnamed protein product
Length=563

 Score = 484 bits (1245),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 267/603 (44%), Positives = 378/603 (63%), Gaps = 41/603 (7%)

Query  13   SGKSFPVKVCTLDAELEFNLEWRATGRDLFELVCRTIGLRETWYFGLQYEDSKGFISWLK  72
            S K+  V+V ++D+ELEF ++   TG+ LF+ V +TIGLRE WYFGLQY D+KGF +WLK
Sbjct  2    SKKAINVRVTSMDSELEFAIQSSTTGKQLFDQVVKTIGLREIWYFGLQYTDNKGFPTWLK  61

Query  73   LDKKVQDQSIQKNHQTASFMFLAKFYPEEVAEELVQEVTQHSFFLQVKQAILSMDVYCPP  132
            L+KKV  Q ++K+  T  F F AKFYPE+VAEE++Q+VT   F+LQVK  ILS ++YCPP
Sbjct  62   LNKKVLSQDVKKD-PTLVFKFRAKFYPEDVAEEIIQDVTMRLFYLQVKDGILSDEIYCPP  120

Query  133  EASVLLASYAVQAKFGDFDEDTYKPGMLASEDLLPQRVIDQYQMTLEMWEERIRVWYADH  192
            E SVLLASYA+QAK+GD+  +T+  G L ++ LLPQRV+ Q+++  E WE RI  W+ADH
Sbjct  121  ETSVLLASYAMQAKYGDYVPETHVAGCLTADRLLPQRVLGQFKLNSEEWERRIMTWWADH  180

Query  193  RGMSRDEAEMEYLKIAQDLDMYGVNYFPIMNKKETDLWLGVTALGLNIYEKENKLQPKTT  252
            R  +R++A +EYLKIAQDL+MYGVNYF I NKK TDL+LGV ALGLNIY+K ++L PK  
Sbjct  181  RATTREQAMLEYLKIAQDLEMYGVNYFEIRNKKGTDLYLGVDALGLNIYDKADRLSPKVG  240

Query  253  FTWSEIRHISFDDKKFIIKPVDKNAPNFVFFSQKVRMNKLILDLCMGNHDLFMRRRKPDS  312
            F WSEIR+ISF+DKKF+IKP+DK A +FVF++ ++R+NK IL LCMGNH+L+MRRRKPD+
Sbjct  241  FPWSEIRNISFNDKKFVIKPIDKKAHDFVFYAPRLRINKRILALCMGNHELYMRRRKPDT  300

Query  313  MELQQMKAAAKEEKQRRQVQRNRLAREKQLREEAERDRANMEQRLLQYQEEIRLANEALR  372
            +E+QQMK  A+E++  +  ++ +L RE   REEAE+ + + E+R+ Q QE++        
Sbjct  301  IEVQQMKQQAREDRALKIAEQEKLTREMSAREEAEQRQRDAEKRMAQMQEDM--------  352

Query  373  RSEESADLLAEKSRVAEEEARLLSQKAAEAEQEITRLRLTAMRKDEEKVSLERKTREAEM  432
                             E ARL   + AEA   I  L     +    K +LE+K  E   
Sbjct  353  -----------------ERARL---ELAEAHNTIHSLEAQLKQLQLAKQALEQKEYELRE  392

Query  433  LTARLVEESEKRAAEANKLKDELLKARAAEKQAKEKLLDFLSRTTSYTGSNTASPISSVT  492
            LTA+L  E      E   L+D+ + AR  E  +  + ++  +  T    +   S   +  
Sbjct  393  LTAQLQSEKAMSDGERRHLRDQ-VDAREREVFSMREEVERQTTVTRQLQTQIHSQQHTQH  451

Query  493  TLYAPPLSPGYGADLSILDSEASTSPDLNLNLNSYDLIAHGDADQLSLEIEKERVDYLEK  552
               +  +S G+  D +  D E + + +L             DADQ   + E ERV   EK
Sbjct  452  YSNSHHVSNGHAHDETATDDEDNGATELT-----------NDADQNVPQHELERVTAAEK  500

Query  553  SKHLQNQLRELRSEIAVLKVGDKQNDYDQLHEEQVKMGENKYSTLKKSKSGSTKSRVAFF  612
            +  ++N+L  L  E+  +K  +   DYD LH E  K G +KY TL++ + G+TK R+  +
Sbjct  501  NIQIKNKLDMLTRELDSVKDQNAVTDYDVLHMENKKAGRDKYKTLRQIRGGNTKRRIDQY  560

Query  613  EEL  615
            E +
Sbjct  561  ENM  563


>MOEH_DROME unnamed protein product
Length=578

 Score = 482 bits (1240),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 273/612 (45%), Positives = 385/612 (63%), Gaps = 44/612 (7%)

Query  13   SGKSFPVKVCTLDAELEFNLEWRATGRDLFELVCRTIGLRETWYFGLQYEDSKGFISWLK  72
            S K+  V+V T+DAELEF ++   TG+ LF+ V +TIGLRE W+FGLQY DSKG  +W+K
Sbjct  2    SPKALNVRVTTMDAELEFAIQSTTTGKQLFDQVVKTIGLREVWFFGLQYTDSKGDSTWIK  61

Query  73   LDKKVQDQSIQKNHQTASFMFLAKFYPEEVAEELVQEVTQHSFFLQVKQAILSMDVYCPP  132
            L KKV +Q ++K +    F F AKFYPE+VAEEL+Q++T   F+LQVK AIL+ ++YCPP
Sbjct  62   LYKKVMNQDVKKEN-PLQFRFRAKFYPEDVAEELIQDITLRLFYLQVKNAILTDEIYCPP  120

Query  133  EASVLLASYAVQAKFGDFDEDTYKPGMLASEDLLPQRVIDQYQMTLEMWEERIRVWYADH  192
            E SVLLASYAVQA+ GD ++ T+  G LA++ LLPQRVIDQ++M+ + WE+ I  W+ +H
Sbjct  121  ETSVLLASYAVQARHGDHNKTTHTAGFLANDRLLPQRVIDQHKMSKDEWEQSIMTWWQEH  180

Query  193  RGMSRDEAEMEYLKIAQDLDMYGVNYFPIMNKKETDLWLGVTALGLNIYEKENKLQPKTT  252
            R M R++A MEYLKIAQDL+MYGVNYF I NKK TDLWLGV ALGLNIYE++++L PK  
Sbjct  181  RSMLREDAMMEYLKIAQDLEMYGVNYFEIRNKKGTDLWLGVDALGLNIYEQDDRLTPKIG  240

Query  253  FTWSEIRHISFDDKKFIIKPVDKNAPNFVFFSQKVRMNKLILDLCMGNHDLFMRRRKPDS  312
            F WSEIR+ISF +KKFIIKP+DK AP+F+FF+ +VR+NK IL LCMGNH+L+MRRRKPD+
Sbjct  241  FPWSEIRNISFSEKKFIIKPIDKKAPDFMFFAPRVRINKRILALCMGNHELYMRRRKPDT  300

Query  313  MELQQMKAAAKEEKQRRQVQRNRLAREKQLREEAERDRANMEQRLLQYQEEIRLANEALR  372
            +++QQMKA A+EEK  +Q +R +L      RE AE+ +   E RL Q QE+       + 
Sbjct  301  IDVQQMKAQAREEKNAKQQEREKLQLALAARERAEKKQQEYEDRLKQMQED-------ME  353

Query  373  RSEESADLLAEKSRVAEEEARLLSQKAAEAEQEITRLRLTAM--RKDE-------EKVSL  423
            RS+   DLL  +  +   E +L   +AA+ E E+ +  L AM  R +E       EK+ L
Sbjct  354  RSQR--DLLEAQDMIRRLEEQLKQLQAAKDELELRQKELQAMLQRLEEAKNMEAVEKLKL  411

Query  424  ERKTREAEMLTARLVEESEKRAAEANKLKDELLKARAAEKQAKEKLLDFLSRTTSYTGSN  483
            E +    +M   R+ +E   +  E  +L+DE+  AR   KQ             S T  +
Sbjct  412  EEEIMAKQMEVQRIQDEVNAKDEETKRLQDEVEDAR--RKQVIAAEAAAALLAASTTPQH  469

Query  484  TASPISSVTTLYAPPLSPGYGADLSILDSEASTSPDLNLNLNSYDLIAHGDADQLSLEIE  543
                ++         L+ G        D+    S DL+ + +  D I             
Sbjct  470  --HHVAEDENENEEELTNG--------DAGGDVSRDLDTDEHIKDPI-------------  506

Query  544  KERVDYLEKSKHLQNQLRELRSEIAVLKVGDKQNDYDQLHEEQVKMGENKYSTLKKSKSG  603
            ++R    E+++ L +QL+ L+ ++A  +   K+   D++H E V+ G +KY TL++ + G
Sbjct  507  EDRRTLAERNERLHDQLKALKQDLAQSRDETKETANDKIHRENVRQGRDKYKTLREIRKG  566

Query  604  STKSRVAFFEEL  615
            +TK RV  FE +
Sbjct  567  NTKRRVDQFENM  578


>G5EBK3_CAEEL unnamed protein product
Length=564

 Score = 480 bits (1236),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 265/597 (44%), Positives = 375/597 (63%), Gaps = 41/597 (7%)

Query  19   VKVCTLDAELEFNLEWRATGRDLFELVCRTIGLRETWYFGLQYEDSKGFISWLKLDKKVQ  78
            V+V ++D+ELEF ++   TG+ LF+ V +TIGLRE WYFGLQY D+KGF +WLKL+KKV 
Sbjct  9    VRVTSMDSELEFAIQSSTTGKQLFDQVVKTIGLREIWYFGLQYTDNKGFPTWLKLNKKVL  68

Query  79   DQSIQKNHQTASFMFLAKFYPEEVAEELVQEVTQHSFFLQVKQAILSMDVYCPPEASVLL  138
             Q ++K+  T  F F AKFYPE+VAEE++Q+VT   F+LQVK  ILS ++YCPPE SVLL
Sbjct  69   SQDVKKD-PTLVFKFRAKFYPEDVAEEIIQDVTMRLFYLQVKDGILSDEIYCPPETSVLL  127

Query  139  ASYAVQAKFGDFDEDTYKPGMLASEDLLPQRVIDQYQMTLEMWEERIRVWYADHRGMSRD  198
            ASYA+QAK+GD+  +T+  G L ++ LLPQRV+ Q+++  E WE RI  W+ADHR  +R+
Sbjct  128  ASYAMQAKYGDYVPETHVAGCLTADRLLPQRVLGQFKLNSEEWERRIMTWWADHRATTRE  187

Query  199  EAEMEYLKIAQDLDMYGVNYFPIMNKKETDLWLGVTALGLNIYEKENKLQPKTTFTWSEI  258
            +A +EYLKIAQDL+MYGVNYF I NKK TDL+LGV ALGLNIY+K ++L PK  F WSEI
Sbjct  188  QAMLEYLKIAQDLEMYGVNYFEIRNKKGTDLYLGVDALGLNIYDKADRLSPKVGFPWSEI  247

Query  259  RHISFDDKKFIIKPVDKNAPNFVFFSQKVRMNKLILDLCMGNHDLFMRRRKPDSMELQQM  318
            R+ISF+DKKF+IKP+DK A +FVF++ ++R+NK IL LCMGNH+L+MRRRKPD++E+QQM
Sbjct  248  RNISFNDKKFVIKPIDKKAHDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTIEVQQM  307

Query  319  KAAAKEEKQRRQVQRNRLAREKQLREEAERDRANMEQRLLQYQEEIRLANEALRRSEESA  378
            K  A+E++  +  ++ +L RE   REEAE+ + + E+R+ Q QE++              
Sbjct  308  KQQAREDRALKIAEQEKLTREMSAREEAEQRQRDAEKRMAQMQEDM--------------  353

Query  379  DLLAEKSRVAEEEARLLSQKAAEAEQEITRLRLTAMRKDEEKVSLERKTREAEMLTARLV  438
                       E ARL   + AEA   I  L     +    K +LE+K  E   LTA+L 
Sbjct  354  -----------ERARL---ELAEAHNTIHSLEAQLKQLQLAKQALEQKEYELRELTAQLQ  399

Query  439  EESEKRAAEANKLKDELLKARAAEKQAKEKLLDFLSRTTSYTGSNTASPISSVTTLYAPP  498
             E      E   L+D+ + AR  E  +  + ++  +  T    +   S   +     +  
Sbjct  400  SEKAMSDGERRHLRDQ-VDAREREVFSMREEVERQTTVTRQLQTQIHSQQHTQHYSNSHH  458

Query  499  LSPGYGADLSILDSEASTSPDLNLNLNSYDLIAHGDADQLSLEIEKERVDYLEKSKHLQN  558
            +S G+  D +  D E + + +L             DADQ   + E ERV   EK+  ++N
Sbjct  459  VSNGHAHDETATDDEDNGATELT-----------NDADQNVPQHELERVTAAEKNIQIKN  507

Query  559  QLRELRSEIAVLKVGDKQNDYDQLHEEQVKMGENKYSTLKKSKSGSTKSRVAFFEEL  615
            +L  L  E+  +K  +   DYD LH E  K G +KY TL++ + G+TK R+  +E +
Sbjct  508  KLDMLTRELDSVKDQNAVTDYDVLHMENKKAGRDKYKTLRQIRGGNTKRRIDQYENM  564


>H2KYX3_CAEEL unnamed protein product
Length=709

 Score = 418 bits (1074),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 242/649 (37%), Positives = 375/649 (58%), Gaps = 82/649 (13%)

Query  12   KSGKSFPVKVCTLDAELE-FNLEWRATGRDLFELVCRTIGLRETWYFGLQYEDSKGFISW  70
            ++ K    KV T+DA+LE   +E   TGR LFE VCR IGLRETWYFGLQ+ + K    W
Sbjct  9    RNTKPIYAKVSTMDADLEKIVIEKTWTGRHLFEAVCRIIGLRETWYFGLQFTNKKNIPCW  68

Query  71   LKLDKKVQDQSIQKNHQ--TASFMFLAKFYPEEVAEELVQEVTQHSFFLQVKQAILSMDV  128
            L+ DK +  Q IQK+    T +F+FL KFYPE+V  E++ + T+H FFLQ+++AILSM++
Sbjct  69   LQNDKTICGQDIQKDTSDGTFNFLFLVKFYPEDVEPEIILDATRHLFFLQIREAILSMNL  128

Query  129  YCPPEASVLLASYAVQAKFGDFDEDTYKPGMLASEDLLPQRVIDQYQMTLEMWEERIRVW  188
            YC PEASVLLAS+AVQA  GD  E+    G +  +  LP+ VIDQY M+ +MW +RI+ W
Sbjct  129  YCSPEASVLLASFAVQAMHGDCTEEV---GPIDLDKHLPKSVIDQYDMSADMWRDRIKRW  185

Query  189  YADHRGMSRDEAEMEYLKIAQDLDMYGVNYFPIMNKKETDLWLGVTALGLNIYEKENKLQ  248
            ++ + G SR+EAE+EYL++AQDL+MYG+ Y+PI N KETDL LG++A GL IY+  N++ 
Sbjct  186  WSRNAGQSREEAELEYLRVAQDLEMYGILYYPICNNKETDLHLGISAQGLGIYKGVNRIT  245

Query  249  PKTTFTWSEIRHISFDDKKFIIKPVDKNAPNFVFFSQKVRMNKLILDLCMGNHDLFMRRR  308
            P+  F+WSEI++I F ++KF +K VDK+     F S++  ++  ILDLC+G H+L++RRR
Sbjct  246  PRPFFSWSEIKNIQFKNRKFHMKTVDKST--ISFRSRETSIDSSILDLCIGTHNLYLRRR  303

Query  309  KPDSMELQQMKAAAKEEKQRRQVQRNRLAREKQLREEAERDRANMEQRLLQYQEEIRLAN  368
            +PD++E+QQM++ AKE+KQRR  ++ ++A E++ R++ E++   M+Q++     E+  A 
Sbjct  304  QPDTLEVQQMRSQAKEDKQRRAAEQAKVALERKERQQMEKEYKEMKQKVEVMTLELMKAQ  363

Query  369  EALRRSEESADLLAEKSRVAEEEARLLSQKAAEAEQEITRLRLTAMRKDEEKVSLERKTR  428
            E +R++EE+ D LAEK+R +E E  +L ++ +E E E  RL +  M+ +E  + +ERK R
Sbjct  364  ENIRKAEEANDQLAEKARHSEHETLMLYKQKSEVEAECNRLSMNNMKSEEALLRMERKAR  423

Query  429  EAEMLTARLVEESEKRAAEANK-----------LKDELLKARAAEKQAKEKLL-------  470
            EAE+L  ++       + +AN+           + D     + +  Q+    +       
Sbjct  424  EAEILAKQMSMSLADVSLDANRKMTQYSSQSALIIDPNWHQQVSGHQSGHPGMPSTGSFH  483

Query  471  ------------DFLSRTTSYTGSNTASPISSVTTL------------------------  494
                          +SR+ +   S  +SPI S   L                        
Sbjct  484  QLQSLDTHTHPQQMMSRSLNMPSSAFSSPIPSNQPLSHQQPQQMSQNTQAHQQQTQVQNQ  543

Query  495  YAPPLSPGYGADLSILDSEASTSPDLNLNLNSYDLIAHGDADQLSLEIEKERVDYLEKSK  554
              PP   G G  +   D   S   +    L               +E+EK R +Y  +++
Sbjct  544  NQPPYYGGSGMIIPPPDPSISQIFEQQTTL---------------MELEKSRSEYETRAR  588

Query  555  HLQNQLRELRSEIAVLKV-GDKQN----DYDQLHEEQVKMGENKYSTLK  598
              +  L ELR +I  LK  G+ QN    ++D +H + V  G +K++T++
Sbjct  589  IFKEHLEELRGDIDGLKRDGNVQNGQHREHDAVHAQNVAHGFDKFTTMR  637



Lambda      K        H
   0.321    0.136    0.397 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 566763464


Query= XP_018560777.1 uncharacterized protein LOC108903172 [Anoplophora
glabripennis]

Length=599
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

C1P641_CAEEL  unnamed protein product                                 42.7    0.001
EPI1_CAEEL  unnamed protein product                                   42.7    0.001
C1P640_CAEEL  unnamed protein product                                 42.7    0.001
G5EEV6_CAEEL  unnamed protein product                                 42.4    0.001
Q8IDK6_PLAF7  unnamed protein product                                 30.8    4.4  


>C1P641_CAEEL unnamed protein product
Length=3663

 Score = 42.7 bits (99),  Expect = 0.001, Method: Composition-based stats.
 Identities = 50/228 (22%), Positives = 107/228 (47%), Gaps = 24/228 (11%)

Query  237   SSIISINTPEDIFQKFSKNFDKIKDVNSRQRAESKYINDIKYNTINSKLGPKAKIITKSN  296
             ++I +I++   +  + ++N  +  D+N      +K +ND + N+  +  G    I+T S 
Sbjct  2146  TAIANISSATIVGARLARNKKEFNDINEI----TKMLND-EENSFGNVFGDAQDILTNST  2200

Query  297   SIEN-ILDLDQYKSNLVNTNKDNNLKKIWNSAENLLEPPKRPERRKKLKGKAPQPPKMIE  355
              I+N ++    +  N V++ K+  L    N  E L E  KR +R       A Q  + + 
Sbjct  2201  QIQNKLVRTKTHSQNSVSSAKNITL----NGTEFLQEVMKRAQR-------ARQSVRSLA  2249

Query  356   EKQDVLSGQYVRVNVNFDTAKDLDKNRLIIKSSLNEPHPKKLQNFNILSTKPSLASFLKP  415
             E    +      VNV+    K+ ++  + ++++  + +P+K Q      T P     ++ 
Sbjct  2250  EIALAIGSSSKAVNVDPRLLKEAEETLMTLEAASADQYPEKAQ------TVPGKLEEIQK  2303

Query  416   KEKQVVKYEPKKIDTGTLLKYRLPD-SSWTNSVPRMLKKPRSKSETRN  462
             K ++  +   K+ +T    K R  + +++ NS  ++LK+ +SK++  N
Sbjct  2304  KIQEETEKLDKQKETFEAQKKRAEELAAYLNSAQQLLKESKSKADKSN  2351


>EPI1_CAEEL unnamed protein product
Length=3672

 Score = 42.7 bits (99),  Expect = 0.001, Method: Composition-based stats.
 Identities = 50/228 (22%), Positives = 107/228 (47%), Gaps = 24/228 (11%)

Query  237   SSIISINTPEDIFQKFSKNFDKIKDVNSRQRAESKYINDIKYNTINSKLGPKAKIITKSN  296
             ++I +I++   +  + ++N  +  D+N      +K +ND + N+  +  G    I+T S 
Sbjct  2155  TAIANISSATIVGARLARNKKEFNDINEI----TKMLND-EENSFGNVFGDAQDILTNST  2209

Query  297   SIEN-ILDLDQYKSNLVNTNKDNNLKKIWNSAENLLEPPKRPERRKKLKGKAPQPPKMIE  355
              I+N ++    +  N V++ K+  L    N  E L E  KR +R       A Q  + + 
Sbjct  2210  QIQNKLVRTKTHSQNSVSSAKNITL----NGTEFLQEVMKRAQR-------ARQSVRSLA  2258

Query  356   EKQDVLSGQYVRVNVNFDTAKDLDKNRLIIKSSLNEPHPKKLQNFNILSTKPSLASFLKP  415
             E    +      VNV+    K+ ++  + ++++  + +P+K Q      T P     ++ 
Sbjct  2259  EIALAIGSSSKAVNVDPRLLKEAEETLMTLEAASADQYPEKAQ------TVPGKLEEIQK  2312

Query  416   KEKQVVKYEPKKIDTGTLLKYRLPD-SSWTNSVPRMLKKPRSKSETRN  462
             K ++  +   K+ +T    K R  + +++ NS  ++LK+ +SK++  N
Sbjct  2313  KIQEETEKLDKQKETFEAQKKRAEELAAYLNSAQQLLKESKSKADKSN  2360


>C1P640_CAEEL unnamed protein product
Length=3683

 Score = 42.7 bits (99),  Expect = 0.001, Method: Composition-based stats.
 Identities = 50/228 (22%), Positives = 107/228 (47%), Gaps = 24/228 (11%)

Query  237   SSIISINTPEDIFQKFSKNFDKIKDVNSRQRAESKYINDIKYNTINSKLGPKAKIITKSN  296
             ++I +I++   +  + ++N  +  D+N      +K +ND + N+  +  G    I+T S 
Sbjct  2166  TAIANISSATIVGARLARNKKEFNDINEI----TKMLND-EENSFGNVFGDAQDILTNST  2220

Query  297   SIEN-ILDLDQYKSNLVNTNKDNNLKKIWNSAENLLEPPKRPERRKKLKGKAPQPPKMIE  355
              I+N ++    +  N V++ K+  L    N  E L E  KR +R       A Q  + + 
Sbjct  2221  QIQNKLVRTKTHSQNSVSSAKNITL----NGTEFLQEVMKRAQR-------ARQSVRSLA  2269

Query  356   EKQDVLSGQYVRVNVNFDTAKDLDKNRLIIKSSLNEPHPKKLQNFNILSTKPSLASFLKP  415
             E    +      VNV+    K+ ++  + ++++  + +P+K Q      T P     ++ 
Sbjct  2270  EIALAIGSSSKAVNVDPRLLKEAEETLMTLEAASADQYPEKAQ------TVPGKLEEIQK  2323

Query  416   KEKQVVKYEPKKIDTGTLLKYRLPD-SSWTNSVPRMLKKPRSKSETRN  462
             K ++  +   K+ +T    K R  + +++ NS  ++LK+ +SK++  N
Sbjct  2324  KIQEETEKLDKQKETFEAQKKRAEELAAYLNSAQQLLKESKSKADKSN  2371


>G5EEV6_CAEEL unnamed protein product
Length=3704

 Score = 42.4 bits (98),  Expect = 0.001, Method: Composition-based stats.
 Identities = 50/228 (22%), Positives = 107/228 (47%), Gaps = 24/228 (11%)

Query  237   SSIISINTPEDIFQKFSKNFDKIKDVNSRQRAESKYINDIKYNTINSKLGPKAKIITKSN  296
             ++I +I++   +  + ++N  +  D+N      +K +ND + N+  +  G    I+T S 
Sbjct  2155  TAIANISSATIVGARLARNKKEFNDINEI----TKMLND-EENSFGNVFGDAQDILTNST  2209

Query  297   SIEN-ILDLDQYKSNLVNTNKDNNLKKIWNSAENLLEPPKRPERRKKLKGKAPQPPKMIE  355
              I+N ++    +  N V++ K+  L    N  E L E  KR +R       A Q  + + 
Sbjct  2210  QIQNKLVRTKTHSQNSVSSAKNITL----NGTEFLQEVMKRAQR-------ARQSVRSLA  2258

Query  356   EKQDVLSGQYVRVNVNFDTAKDLDKNRLIIKSSLNEPHPKKLQNFNILSTKPSLASFLKP  415
             E    +      VNV+    K+ ++  + ++++  + +P+K Q      T P     ++ 
Sbjct  2259  EIALAIGSSSKAVNVDPRLLKEAEETLMTLEAASADQYPEKAQ------TVPGKLEEIQK  2312

Query  416   KEKQVVKYEPKKIDTGTLLKYRLPD-SSWTNSVPRMLKKPRSKSETRN  462
             K ++  +   K+ +T    K R  + +++ NS  ++LK+ +SK++  N
Sbjct  2313  KIQEETEKLDKQKETFEAQKKRAEELAAYLNSAQQLLKESKSKADKSN  2360


>Q8IDK6_PLAF7 unnamed protein product
Length=1807

 Score = 30.8 bits (68),  Expect = 4.4, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 29/52 (56%), Gaps = 3/52 (6%)

Query  51   KINSTSTDEGFESDIDSLS-IVSSDNDSFTIEKHSES--ASKTTETDSANGS  99
            K N  ST+ G+ S I   S I+ SDND+F ++  SE+   SK  E  S N S
Sbjct  513  KYNEYSTEIGYRSPISVKSVIIMSDNDNFIVQNRSENLDTSKNKEQKSGNNS  564



Lambda      K        H
   0.321    0.136    0.397 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 566763464


Query= XP_018560778.1 trichohyalin-like [Anoplophora glabripennis]

Length=867


***** No hits found *****



Lambda      K        H
   0.321    0.136    0.397 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 566763464


Query= XP_018560779.1 trichohyalin-like [Anoplophora glabripennis]

Length=867


***** No hits found *****



Lambda      K        H
   0.321    0.136    0.397 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 566763464


Query= XP_018560781.1 uncharacterized protein LOC108903177 [Anoplophora
glabripennis]

Length=426
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GILT1_DROME  unnamed protein product                                  125     2e-33
GILT2_DROME  unnamed protein product                                  90.9    5e-21
YVRI_CAEEL  unnamed protein product                                   79.3    2e-16
SDC2_CAEEL  unnamed protein product                                   30.0    5.3  
Q388C0_TRYB2  unnamed protein product                                 29.3    7.7  


>GILT1_DROME unnamed protein product
Length=250

 Score = 125 bits (315),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/203 (32%), Positives = 116/203 (57%), Gaps = 15/203 (7%)

Query  224  LILLQKCVQTVKVSVFYEALCPDSIEFIDKQLFPTYKYIGNDI-KVDLVPFGNAKVTNTS  282
            LI        V +S++YE+LCPDS +FI +Q++P  K    D+ ++  VPFG ++     
Sbjct  15   LIATAYSAAKVPISIYYESLCPDSAKFITEQVYPAVKGELRDVVELTFVPFGKSQFVTQG  74

Query  283  GQLKFVCQHGPSECYGNKIHSCAIRL-----YSIEESTE-----FVYCSMESVD--PSSN  330
             ++ F C HGP+ECYGNK+H+CAI       Y +E + E     F+ C M++    P + 
Sbjct  75   SEVTFTCHHGPNECYGNKVHACAIEHIQANSYQVEYTRESLTMDFINCLMKAGKNFPDNV  134

Query  331  ENLEKCANSSDI-SWASLQTCFQSGQADILLEKNGIRTKNVEPAIKFIPTVIFNDRYNET  389
               ++CA+ + I +W +++TC  S +  +LL K G  T  ++  +  +PT++FN+++++ 
Sbjct  135  YPGQRCASENHINNWENIKTCANSTEGSVLLRKAGESTMRLKEPLTSVPTILFNEQFDKK  194

Query  390  LQNEALEDFMAVVCQFLEYKPAP  412
            + + A  + +  +CQ++   P P
Sbjct  195  VNDRAQVNLVGTICQYVS-APQP  216


 Score = 105 bits (262),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 71/218 (33%), Positives = 108/218 (50%), Gaps = 16/218 (7%)

Query  6    LMFAILCVCGSSAQKIKISVYYETLCSDSVRYLVNQFYPAYQN-LADNMEVDLVAYGKAN  64
            L+ + L     SA K+ IS+YYE+LC DS +++  Q YPA +  L D +E+  V +GK+ 
Sbjct  10   LLMSCLIATAYSAAKVPISIYYESLCPDSAKFITEQVYPAVKGELRDVVELTFVPFGKSQ  69

Query  65   ASNDSGSWEFECQHGELECYENKVHSCAIEL-----YPV-----SQSTEFVICSMNSTDA  114
                     F C HG  ECY NKVH+CAIE      Y V     S + +F+ C M +   
Sbjct  70   FVTQGSEVTFTCHHGPNECYGNKVHACAIEHIQANSYQVEYTRESLTMDFINCLMKAGKN  129

Query  115  SSDA--NNEECATSTNI-SWTVLEECLTSGQADELLAANGRRTDKLIPDIINFVPTIVFN  171
              D     + CA+  +I +W  ++ C  S +   LL   G  T +L  + +  VPTI+FN
Sbjct  130  FPDNVYPGQRCASENHINNWENIKTCANSTEGSVLLRKAGESTMRL-KEPLTSVPTILFN  188

Query  172  DVFSAQLQSISLTNFEDTLVFLLEQIQCGFC-QFNGSN  208
            + F  ++   +  N   T+   +   Q   C Q NG++
Sbjct  189  EQFDKKVNDRAQVNLVGTICQYVSAPQPRICNQHNGAS  226


>GILT2_DROME unnamed protein product
Length=207

 Score = 90.9 bits (224),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 58/190 (31%), Positives = 94/190 (49%), Gaps = 15/190 (8%)

Query  218  LGVSVLLILLQKCVQTVKVSVFYEALCPDSIEFIDKQLFPTYKYIGND----IKVDLVPF  273
            +GV+    L       + ++++YEALCP  +EF+  QL P+   +  D      + LVP+
Sbjct  14   VGVATPRRLRGPQADRLAITLYYEALCPYCMEFVTTQLNPSM--VRQDRLPFTDLTLVPY  71

Query  274  GNAKVTNTSGQLKFVCQHGPSECYGNKIHSCAIRLYSIEESTEFVYCSMESVDPSSNENL  333
            GNA+ TN  G ++  CQHG  EC  N  H+C +  + I +S + + C M          L
Sbjct  72   GNAR-TNDDGNVE--CQHGVMECELNAWHACILEHHDIAQSLKLIACMMR----GKKNRL  124

Query  334  EKCANSSDISWASLQTCFQSGQADILLEKNGIRTKNVEPAIKFIPTVIFNDRYNETLQNE  393
            EKCA+   I    ++ C ++ Q + +L K G  T  V  + + +P V  ++ YN  L   
Sbjct  125  EKCADHYQIDVGDVKNCKKTRQVNDILRKYGKETAKV--SFQGVPAVALDNVYNADLSAN  182

Query  394  ALEDFMAVVC  403
              + F A+ C
Sbjct  183  LTDHFDAIFC  192


 Score = 83.2 bits (204),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 53/178 (30%), Positives = 91/178 (51%), Gaps = 13/178 (7%)

Query  15   GSSAQKIKISVYYETLCSDSVRYLVNQFYPAY--QNLADNMEVDLVAYGKANASNDSGSW  72
            G  A ++ I++YYE LC   + ++  Q  P+   Q+     ++ LV YG A  +ND G+ 
Sbjct  24   GPQADRLAITLYYEALCPYCMEFVTTQLNPSMVRQDRLPFTDLTLVPYGNAR-TNDDGN-  81

Query  73   EFECQHGELECYENKVHSCAIELYPVSQSTEFVICSMNSTDASSDANNEECATSTNISWT  132
              ECQHG +EC  N  H+C +E + ++QS + + C M           E+CA    I   
Sbjct  82   -VECQHGVMECELNAWHACILEHHDIAQSLKLIACMMRGKKNRL----EKCADHYQIDVG  136

Query  133  VLEECLTSGQADELLAANGRRTDKLIPDIINFVPTIVFNDVFSAQLQSISLTNFEDTL  190
             ++ C  + Q +++L   G+ T K+       VP +  ++V++A L S +LT+  D +
Sbjct  137  DVKNCKKTRQVNDILRKYGKETAKV---SFQGVPAVALDNVYNADL-SANLTDHFDAI  190


>YVRI_CAEEL unnamed protein product
Length=277

 Score = 79.3 bits (194),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 76/160 (48%), Gaps = 12/160 (8%)

Query  232  QTVKVSVFYEALCPDSIEFIDKQLFP-TYKYIGNDIKVDLVPFGNAKVTNTSGQLKFVCQ  290
            Q + ++V  EALCPD   F+ KQL+P  +K   N + ++LVPFGNAKV    G +K  CQ
Sbjct  74   QKINITVLIEALCPDCQNFLTKQLYPIVFKNFANYVNIELVPFGNAKVLE-DGTIK--CQ  130

Query  291  HGPSECYGNKIHSCAIRLYSIEESTEFVYCSMESVDP------SSNENLEKCANSSDISW  344
            HG  EC  NK   C I     +     + C  ES+        +  +  EK     DI  
Sbjct  131  HGEEECSINKFEGCFIDSMQDQSPLPTLSCIEESLQKKVEFADAVQQCFEKLQIGGDIQR  190

Query  345  ASLQTCFQSGQADILLEKNGIRTKNVEP-AIKFIPTVIFN  383
             + Q+C  S     L  K    T NV P   KF+P VI N
Sbjct  191  LT-QSCLVSKLGADLQNKAAAATANVWPEQHKFVPWVIIN  229


 Score = 65.9 bits (159),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 52/176 (30%), Positives = 77/176 (44%), Gaps = 19/176 (11%)

Query  19   QKIKISVYYETLCSDSVRYLVNQFYP-AYQNLADNMEVDLVAYGKANASNDSGSWEFECQ  77
            QKI I+V  E LC D   +L  Q YP  ++N A+ + ++LV +G A    D      +CQ
Sbjct  74   QKINITVLIEALCPDCQNFLTKQLYPIVFKNFANYVNIELVPFGNAKVLEDG---TIKCQ  130

Query  78   HGELECYENKVHSCAIELYPVSQSTEFVIC---SMNSTDASSDANNEECATSTNISWTV-  133
            HGE EC  NK   C I+          + C   S+      +DA  ++C     I   + 
Sbjct  131  HGEEECSINKFEGCFIDSMQDQSPLPTLSCIEESLQKKVEFADA-VQQCFEKLQIGGDIQ  189

Query  134  --LEECLTSGQADELLAANGRRTDKLIPDIINFVPTIVFNDVFSAQLQSISLTNFE  187
               + CL S    +L       T  + P+   FVP ++ N V        SLT+F+
Sbjct  190  RLTQSCLVSKLGADLQNKAAAATANVWPEQHKFVPWVIINGV--------SLTSFQ  237


>SDC2_CAEEL unnamed protein product
Length=2962

 Score = 30.0 bits (66),  Expect = 5.3, Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 16/24 (67%), Gaps = 2/24 (8%)

Query  271   VPFGNAKVTNTSGQLKFVCQHGPS  294
             +P G  KVT   G  +FVC+HGPS
Sbjct  2111  LPVGIDKVTRLVG--RFVCEHGPS  2132


>Q388C0_TRYB2 unnamed protein product
Length=713

 Score = 29.3 bits (64),  Expect = 7.7, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 6/50 (12%)

Query  329  SNENLEKCANSSDISWASLQTCFQSGQADI--LLEKN----GIRTKNVEP  372
            S +   K A    ISW++ +  F+ GQAD     EKN    G   KNV+P
Sbjct  317  SEKEFAKIAGRIPISWSTSKGYFEKGQADGTNYWEKNLDYEGWYIKNVDP  366



Lambda      K        H
   0.321    0.136    0.397 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 566763464


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Nov 3, 2023  11:39 AM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_018560782.1 DDB1- and CUL4-associated factor 7 [Anoplophora
glabripennis]

Length=348
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VR53_DROME  unnamed protein product                                 678     0.0   
Q93759_CAEEL  unnamed protein product                                 473     2e-166
Q93758_CAEEL  unnamed protein product                                 375     3e-129
Q95T24_DROME  unnamed protein product                                 312     5e-108
Q38E80_TRYB2  unnamed protein product                                 248     6e-80 


>Q9VR53_DROME unnamed protein product
Length=343

 Score = 678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/340 (94%), Positives = 333/340 (98%), Gaps = 1/340 (0%)

Query  9    AGKRKEIYKYVAPWPLYSMNWSVRPDKRFRLALGSFVEEYNNKVQIVSLDEDSSEFTAKS  68
            AGKRKEIYKY+APWPLYSMNWSVRPDKRFRLALGSF+EEYNNKVQI+SLDED+SEF+AKS
Sbjct  5    AGKRKEIYKYLAPWPLYSMNWSVRPDKRFRLALGSFIEEYNNKVQIISLDEDTSEFSAKS  64

Query  69   TFDHPYPTTKIMWIPDSKGIFPDLLATSGDYLRVWRAGEPDTRLECVLNNNKNSDFCAPL  128
            TFDHPYPTTKIMWIPDSKG++PDLLATSGDYLRVWRAGEPDTRLECVLNNNKNSDFCAPL
Sbjct  65   TFDHPYPTTKIMWIPDSKGVYPDLLATSGDYLRVWRAGEPDTRLECVLNNNKNSDFCAPL  124

Query  129  TSFDWNEVDPNLVGTSSIDTTCTIWGLETGQVINRVSLVSGHVKTQLIAHDKEVYDIAFS  188
            TSFDWNEVDPNLVGTSSIDTTCTIWGLETGQ   RV  V+GHVKTQLIAHDKEVYDIAFS
Sbjct  125  TSFDWNEVDPNLVGTSSIDTTCTIWGLETGQPHARV-YVAGHVKTQLIAHDKEVYDIAFS  183

Query  189  RAGGGRDMFASVGADGSVRMFDLRHLEHSTIIYEDPAHTPLLRLAWNKQDPNYLATIAMD  248
            RAGGGRDMFASVGADGSVRMFDLRHLEHSTIIYEDPAHT LLRLAWNKQDPNYLAT+AMD
Sbjct  184  RAGGGRDMFASVGADGSVRMFDLRHLEHSTIIYEDPAHTALLRLAWNKQDPNYLATVAMD  243

Query  249  ACEVIILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAGDDHQALIWDIQQMPRAI  308
            +CEVIILDVRVPCTPVARL+NHRACVNGIAWAPHSSCHICTAGDDHQALIWDIQQMPRAI
Sbjct  244  SCEVIILDVRVPCTPVARLSNHRACVNGIAWAPHSSCHICTAGDDHQALIWDIQQMPRAI  303

Query  309  EDPILAYTAAEGEVNQIQWGATQPDWIAICYNKSLEILRV  348
            EDPILAYTAAEGEVNQIQWGATQPDWIAICYNK+ EILRV
Sbjct  304  EDPILAYTAAEGEVNQIQWGATQPDWIAICYNKACEILRV  343


>Q93759_CAEEL unnamed protein product
Length=478

 Score = 473 bits (1216),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 223/354 (63%), Positives = 274/354 (77%), Gaps = 9/354 (3%)

Query  1    MAHSGVVPAGKRKEIYKYVAPWPLYSMNWSVR--PDKRFRLALGSFVEEYNNKVQIVSLD  58
            +  S V    +RKEIY Y AP+ L+S  WS    P ++FRLA+ SF+EEY+NK+ IV LD
Sbjct  128  LRRSSVRGDPRRKEIYAYNAPFTLFSHGWSAATDPSRKFRLAVSSFIEEYSNKIHIVQLD  187

Query  59   EDSSEFTAKSTFDHPYPTTKIMWIPDSKGIFPDLLATSGDYLRVWRAGEPDTR-LECVLN  117
            E++ E   +STFDHPYP TKIMWIPD KG FPDLLATSGDYLR+WR G  +   +E +LN
Sbjct  188  EEAGELVHRSTFDHPYPATKIMWIPDQKGTFPDLLATSGDYLRLWRIGTDNNACIESLLN  247

Query  118  NNKNSDFCAPLTSFDWNEVDPNLVGTSSIDTTCTIWGLETGQVINRV---SLVSGHVKTQ  174
             N+ +++CAPLTSFDWNE+D NL+GTSSIDTTCT+W LETGQ I      + + G V+TQ
Sbjct  248  TNRTAEYCAPLTSFDWNELDMNLIGTSSIDTTCTVWQLETGQAIGTTRPTAAIDGTVRTQ  307

Query  175  LIAHDKEVYDIAFSRAGGGRDMFASVGADGSVRMFDLRHLEHSTIIYEDPAHTPLLRLAW  234
            LIAHDKEV+DI+FSR  G   +FASVGADGS+R+FDLR LEHSTI+YEDP   PLLRLAW
Sbjct  308  LIAHDKEVFDISFSR--GSAQIFASVGADGSLRLFDLRRLEHSTIMYEDPQRQPLLRLAW  365

Query  235  NKQDPNYLATIAMDACEVIILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAGDDH  294
            N+ D NY+AT   D+ EV+ILD+R+PCTPVARL NH A +NG++WAPHS  HICTAGDD+
Sbjct  366  NRNDHNYIATFGQDSKEVLILDLRLPCTPVARLRNHEATINGLSWAPHSGSHICTAGDDY  425

Query  295  QALIWDIQQMPRAIEDPILAYTAAEGEVNQIQWGATQPDWIAICYNKSLEILRV  348
            QALIWD+ +MP+ I DPILAY  A+ EVNQI W ++ PDWI+IC +  LEILRV
Sbjct  426  QALIWDVHEMPKPINDPILAYR-AQAEVNQIHWSSSFPDWISICSDNKLEILRV  478


>Q93758_CAEEL unnamed protein product
Length=388

 Score = 375 bits (963),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 182/344 (53%), Positives = 240/344 (70%), Gaps = 7/344 (2%)

Query  11   KRKEIYKYVAPWPLYSMNWSVRPDKRFRLALGSFVEEY-----NNKVQIVSLDEDSSEFT  65
            +R EIYK+ +   LY+  WS + D +FRLA+G+  +        NKV IV L +++ E  
Sbjct  46   RRCEIYKFTSDQQLYASAWSNKNDIKFRLAVGTVSDVSVNPCAANKVSIVQLKDETGELV  105

Query  66   AKSTFDHPYPTTKIMWIPDSKGIFPDLLATSGDYLRVWRAGEPDTRLECVLNNNKNSDFC  125
              ++F   +P   + +IPD   ++PDL+AT+ D LR+WR  +     + V+ NN NS + 
Sbjct  106  ETASFPMEFPANAVGFIPDPDNVYPDLIATTSDCLRLWRVVDGKVHPDAVMINNTNSQYG  165

Query  126  APLTSFDWNEVDPNLVGTSSIDTTCTIWGLETGQVINRVSLVSGH-VKTQLIAHDKEVYD  184
            + LTSFDWNE++P  +G SS+DTTCTI+ +E G  I +    +   +KTQLIAHDK V+D
Sbjct  166  SALTSFDWNELEPRYIGVSSVDTTCTIYDVEVGCAIGQTKPTAPFTLKTQLIAHDKPVHD  225

Query  185  IAFSRAGGGRDMFASVGADGSVRMFDLRHLEHSTIIYEDPAHTPLLRLAWNKQDPNYLAT  244
            I F++  GGRD FA+VGADGS RMFDLRHL HSTI+YEDP    L RL+WNKQ+P ++A 
Sbjct  226  IEFAKINGGRDHFATVGADGSARMFDLRHLNHSTIVYEDPNKEKLQRLSWNKQEPYFMAL  285

Query  245  IAMDACEVIILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAGDDHQALIWDIQQM  304
             A ++ EV ILD+R+PC  + RL NH   VNGIAWAPHS  HICTAGDD QALIWD+QQ+
Sbjct  286  FAENSQEVQILDIRMPCNILCRLRNHTGPVNGIAWAPHSPHHICTAGDDSQALIWDLQQV  345

Query  305  PRAIEDPILAYTAAEGEVNQIQWGATQPDWIAICYNKSLEILRV  348
            PR ++DPILAY+A  GEVNQI WG    +WIAIC+NK+LEILRV
Sbjct  346  PRPVDDPILAYSAG-GEVNQIHWGPVHSNWIAICFNKTLEILRV  388


>Q95T24_DROME unnamed protein product
Length=153

 Score = 312 bits (799),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 147/153 (96%), Positives = 151/153 (99%), Gaps = 0/153 (0%)

Query  196  MFASVGADGSVRMFDLRHLEHSTIIYEDPAHTPLLRLAWNKQDPNYLATIAMDACEVIIL  255
            MFASVGADGSVRMFDLRHLEHSTIIYEDPAHT LLRLAWNKQDPNYLAT+AMD+CEVIIL
Sbjct  1    MFASVGADGSVRMFDLRHLEHSTIIYEDPAHTALLRLAWNKQDPNYLATVAMDSCEVIIL  60

Query  256  DVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAGDDHQALIWDIQQMPRAIEDPILAY  315
            DVRVPCTPVARL+NHRACVNGIAWAPHSSCHICTAGDDHQALIWDIQQMPRAIEDPILAY
Sbjct  61   DVRVPCTPVARLSNHRACVNGIAWAPHSSCHICTAGDDHQALIWDIQQMPRAIEDPILAY  120

Query  316  TAAEGEVNQIQWGATQPDWIAICYNKSLEILRV  348
            TAAEGEVNQIQWGATQPDWIAICYNK+ EILRV
Sbjct  121  TAAEGEVNQIQWGATQPDWIAICYNKACEILRV  153


 Score = 30.8 bits (68),  Expect = 0.82, Method: Compositional matrix adjust.
 Identities = 29/132 (22%), Positives = 55/132 (42%), Gaps = 20/132 (15%)

Query  128  LTSFDWNEVDPNLVGTSSIDTTCTIWGLETGQVINRVSLVSGHVKTQLIAHDKEVYDIAF  187
            L    WN+ DPN + T ++D +C +  L+       V+ +S H           V  IA+
Sbjct  34   LLRLAWNKQDPNYLATVAMD-SCEVIILDVRVPCTPVARLSNHRAC--------VNGIAW  84

Query  188  SRAGGGRDMFASVGADGSVRMFDLRHLEHSTIIYEDP------AHTPLLRLAWNKQDPNY  241
            +          + G D    ++D++ +  +    EDP      A   + ++ W    P++
Sbjct  85   APHSSCH--ICTAGDDHQALIWDIQQMPRAI---EDPILAYTAAEGEVNQIQWGATQPDW  139

Query  242  LATIAMDACEVI  253
            +A     ACE++
Sbjct  140  IAICYNKACEIL  151


>Q38E80_TRYB2 unnamed protein product
Length=362

 Score = 248 bits (634),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 138/369 (37%), Positives = 204/369 (55%), Gaps = 51/369 (14%)

Query  12   RKEIYKYVAPWPLYSMNWSVRPDKRFRLALGSFVEEYNNKVQIVSLDEDSSEFTAKSTFD  71
            R  I  Y   W    ++WS R +  FR A+ S+++E+ N V IV  + D  E   ++T+ 
Sbjct  13   RPSILSYNTGWLANGVSWSTRENAPFRFAVSSYIQEFKNYVDIVQKN-DEGELVCRATWS  71

Query  72   HPYPTTKIMWIPDSKGIFPDLLATSGDYLRVW--RAGEPDT---------------RLEC  114
            H YP TK+M+ P   G   DL+ T+ DY+R+W  + G P++               R+  
Sbjct  72   HSYPPTKVMFAPPKAG--SDLIITTADYMRLWEVKEGPPESNERSDERHREVDDPRRVPS  129

Query  115  VLNN--------------NKNSDFCAPLTSFDWNEVDPNLVGTSSIDTTCTIWGLETGQV  160
             +++               + +D C P+TS DWN  DPN+VG  S+DTT TIW LETG+ 
Sbjct  130  KMDHIDSHVSFKMAFEYGKQPNDLCFPVTSCDWNTDDPNVVGCCSVDTTVTIWDLETGK-  188

Query  161  INRVSLVSGHVKTQLIAHDKEVYDIAFSRAGGGRDMFASVGADGSVRMFDLRHLEHSTII  220
                        T+LIAHDK+VYDIAF++   G   FAS GADGSVR+FDLR +EH TI+
Sbjct  189  -----------NTRLIAHDKDVYDIAFAK---GTHTFASCGADGSVRVFDLREIEHCTIL  234

Query  221  YEDPAHTPLLRLAWNKQDPNYLATIAMDACEVIILDVRVPCTPVARLNN-HRACVNGIAW  279
            YE  +  PLLR+AW+  D  Y++T  ++  EVI++D+R P   VA L + +   +N + W
Sbjct  235  YESSSLFPLLRVAWDNSDRTYISTFGVEGTEVIVIDIRFPAVAVASLKSANPQPINSVCW  294

Query  280  APHSSCHICTAGDDHQALIWDIQQMPRAIEDPILAYTAAEGEVNQIQWGATQPDWIAICY  339
            AP+S  ++C+AG+D  A IWD+ ++P  +E   +     E  +N I W +    WIAI  
Sbjct  295  APNSMINLCSAGEDGTANIWDLNELPN-VEAKCIMSCKVENPINNISWSSQHEQWIAITT  353

Query  340  NKSLEILRV  348
                ++L V
Sbjct  354  GNEAQLLHV  362



Lambda      K        H
   0.320    0.135    0.434 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3573877230


Query= XP_018560785.1 uncharacterized protein LOC108903180 [Anoplophora
glabripennis]

Length=118
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q6IDF5_DROME  unnamed protein product                                 91.3    7e-25
PKS1_DICDI  unnamed protein product                                   29.3    0.79 
Q23664_CAEEL  unnamed protein product                                 28.9    0.88 
Q65ZB3_CAEEL  unnamed protein product                                 28.5    1.2  
Q4GYI3_TRYB2  unnamed protein product                                 27.7    2.7  


>Q6IDF5_DROME unnamed protein product
Length=113

 Score = 91.3 bits (225),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 62/93 (67%), Gaps = 0/93 (0%)

Query  26   LRNYFQKQRTDPFRHASGEGGVVFDPAIQRYIAMQASQFEYFKPSLKNALFGIFAMIVPM  85
            LR  F KQ ++P+RHA+GEGG VFD  + R+ AM+ S +E+FKP+ K+   G+FA+++P+
Sbjct  21   LRQEFLKQSSNPYRHATGEGGTVFDAGLARFQAMRVSNYEHFKPTGKSFRTGLFAVVLPI  80

Query  86   VSFGYLVHKDRSEIERRLRAGDVDYKDRIRKFI  118
              + + +  +R   E + R G V YKDR  KFI
Sbjct  81   ALYAWALKAERDGREEKYRTGQVAYKDRQFKFI  113


>PKS1_DICDI unnamed protein product
Length=3147

 Score = 29.3 bits (64),  Expect = 0.79, Method: Composition-based stats.
 Identities = 13/39 (33%), Positives = 24/39 (62%), Gaps = 1/39 (3%)

Query  3     TNACEENEQTIKILEE-KAKRRKLLRNYFQKQRTDPFRH  40
             ++  E NE+  +I E+ + K R L+R+Y + + +  FRH
Sbjct  2815  SDKAETNEKVKRIFEQSQIKTRHLVRDYTKPENSIKFRH  2853


>Q23664_CAEEL unnamed protein product
Length=253

 Score = 28.9 bits (63),  Expect = 0.88, Method: Compositional matrix adjust.
 Identities = 10/28 (36%), Positives = 20/28 (71%), Gaps = 0/28 (0%)

Query  91   LVHKDRSEIERRLRAGDVDYKDRIRKFI  118
            L+++D+S++ER + A + + KDR  K +
Sbjct  78   LINQDKSDLEREIAAAETEKKDRESKIV  105


>Q65ZB3_CAEEL unnamed protein product
Length=199

 Score = 28.5 bits (62),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 10/28 (36%), Positives = 20/28 (71%), Gaps = 0/28 (0%)

Query  91   LVHKDRSEIERRLRAGDVDYKDRIRKFI  118
            L+++D+S++ER + A + + KDR  K +
Sbjct  54   LINQDKSDLEREIAAAETEKKDRESKIV  81


>Q4GYI3_TRYB2 unnamed protein product
Length=912

 Score = 27.7 bits (60),  Expect = 2.7, Method: Composition-based stats.
 Identities = 11/21 (52%), Positives = 15/21 (71%), Gaps = 0/21 (0%)

Query  17   EEKAKRRKLLRNYFQKQRTDP  37
            +EK+KRR  ++ YF KQR  P
Sbjct  787  KEKSKRRSNVQGYFSKQRRQP  807



Lambda      K        H
   0.320    0.135    0.434 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3573877230


Query= XP_018560787.1 uncharacterized protein LOC108903153 [Anoplophora
glabripennis]

Length=332
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VVL2_DROME  unnamed protein product                                 63.9    5e-11
IR75A_DROSE  unnamed protein product                                  57.8    4e-09
IR75A_DROME  unnamed protein product                                  54.7    5e-08
Q8IPB8_DROME  unnamed protein product                                 50.1    1e-06
M9PCT4_DROME  unnamed protein product                                 50.1    1e-06


>Q9VVL2_DROME unnamed protein product
Length=623

 Score = 63.9 bits (154),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 68/331 (21%), Positives = 130/331 (39%), Gaps = 29/331 (9%)

Query  19   GNVISNITDGSYERISFVLDLSCEKSDVILNESRKNNKFRFVHSWLMVSNSPIKRNDIKN  78
             NV     D    R+   LDL C+K++++ N+S +   +     WL+   +      +  
Sbjct  59   ANVHKEYLDSDLVRLGVFLDLGCDKAELVTNQSSRARLYNQNLHWLLYDEAG-NFTKLTQ  117

Query  79   MFENVTLRMDTDIKLAVPELDNRYSIFEIYHPGLEGDIKINEIGVHAYNKLTYFNKDISF  138
            +FE   L ++ D+     E + R+ + ++Y+ G     K+N I V    +    +  +  
Sbjct  118  LFEGANLSLNADVTYVSREDEERFILHDVYNKGSHLGGKLN-ITVDQTLQCNRSHCQVKE  176

Query  139  YSA----------RKDMSGILIRTGNRVNYSLGTPENYTE--------ALRHRNRFTFGK  180
            Y +          R D+S +  R    V+     P N +E        + R  +  +  +
Sbjct  177  YLSELHLRPRLQHRMDLSSVTFRLAALVSV---LPINSSEEELLEFLNSDRDSHMDSISR  233

Query  181  FHFQLFLHLVYIHEFHYNTTIRAEWFGNSSSGIEAGLSRLLWDNEIDISSAGGILRAPRM  240
               +L +H   I  F  +      W    + G   G   +L +   ++ +   +    R+
Sbjct  234  IGNRLIMHTQEILGFKLHYIWCGTWSVQDAFGGAIG---MLTNESAELCTTPFVPSWNRL  290

Query  241  HYYDYLLPYYQFRTSFFFRNPGNVSPGGEV-LRPFSVTTWYCFLAATIVVSLAIKAAYWI  299
            HY   +    QFR    FR P N      V L PF  + W+ F    I   + +   + +
Sbjct  291  HYLHPMTEQAQFRAVCMFRTPHNAGIKAAVFLEPFMPSVWFAFAGLLIFAGVLLWMIFHL  350

Query  300  ERTFLKSRFDY--SLVTSFVTTISLFAQQGT  328
            ER +++   D+  SL++S + +      QG+
Sbjct  351  ERHWMQRCLDFIPSLLSSCLISFGAACIQGS  381


>IR75A_DROSE unnamed protein product
Length=629

 Score = 57.8 bits (138),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 61/309 (20%), Positives = 135/309 (44%), Gaps = 29/309 (9%)

Query  33   ISFVLDLSCEKSDVILNESRKNNKFRFVHSWLMVSN-SPIKRNDIKNMFENVTLRMDTDI  91
            ++  +D+ C+++  +L E+ +   +   + WL+V N S ++ ND+  +F    + +D D+
Sbjct  77   LAIYVDIKCDQAQDLLEEASREQIYNQHYHWLLVGNQSELEFNDLFALF---NISIDADV  133

Query  92   KLAVPELDNR-----YSIFEIYHPGLEGDIKINEIGVHAYN-------KLTYFN--KDIS  137
                 ++ +      Y+++++Y+ G     ++N  G H  +       +  Y +  +  S
Sbjct  134  SYVKEQIQDNNDSVAYAVYDVYNNGKIIGGQLNVTGSHEMSCDPFKCRRTRYLSSLQKRS  193

Query  138  FYSARKDMSGILIRTGNRVNYSLGTPENYTEALRHRNRF------TFGKFHFQLFLHLVY  191
             Y  R+ ++ +++R    V     T  +  E +R  ++       +  +F F L L L  
Sbjct  194  KYGNREQLTDVVLRVATVVTXRPLTLSD-DELIRFLSQENDTHIDSLARFGFHLTLILRD  252

Query  192  IHEFHYNTTIRAEWFGNSSSGIEAGLSRLLWDNEIDISSAGGILRAPRMHYYDYLLPYYQ  251
            +            W   S S +  G    + D   D++++  +    R+ Y   ++    
Sbjct  253  LLYCKMKFIFSDSW---SKSDVVGGSVGAVVDQTADLTASPSLATEGRLKYLSAIIETGF  309

Query  252  FRTSFFFRNPGNVSPGGEV-LRPFSVTTWYCFLAATIVVSLAIKAAYWIERTFLKSRFDY  310
            FR+   FR P N    G+V L+PFS   WY F     ++ + +   +++E   ++ R+  
Sbjct  310  FRSVCIFRTPHNAGLRGDVFLQPFSPLVWYLFGGVLSLIGVLLWITFYMECKRMQKRWRL  369

Query  311  SLVTSFVTT  319
              + S ++T
Sbjct  370  DYLPSLLST  378


>IR75A_DROME unnamed protein product
Length=629

 Score = 54.7 bits (130),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 59/309 (19%), Positives = 129/309 (42%), Gaps = 29/309 (9%)

Query  33   ISFVLDLSCEKSDVILNESRKNNKFRFVHSWLMVSNSPIKRNDIKNMFENVTLRMDTDIK  92
            ++  +D+ C+++  +L E+ +   +   + WL+V N    + +  ++F    + +D D+ 
Sbjct  77   LAIYVDIKCDQTQDLLEEASREQIYNQHYHWLLVGNQ--SKLEFYDLFGLFNISIDADVS  134

Query  93   LAVPELDNR-----YSIFEIYHPGLEGDIKINEIGVHAYN----------KLTYFNKDIS  137
                ++ +      Y++ ++Y+ G     ++N  G H  +           L+   K  S
Sbjct  135  YVKEQIQDNNDSVAYAVHDVYNNGKIIGGQLNVTGSHEMSCDPFVCRRTRHLSSLQKR-S  193

Query  138  FYSARKDMSGILIRTGNRVNYSLGTPENYTEALRHRNRF------TFGKFHFQLFLHLVY  191
             Y  R+ ++ +++R    V     T  +  E +R  ++       +  +F F L L L  
Sbjct  194  KYGNREQLTDVVLRVATVVTQRPLTLSD-DELIRFLSQENDTHIDSLARFGFHLTLILRD  252

Query  192  IHEFHYNTTIRAEWFGNSSSGIEAGLSRLLWDNEIDISSAGGILRAPRMHYYDYLLPYYQ  251
            +            W   S S +  G    + D   D+++   +    R+ Y   ++    
Sbjct  253  LLHCKMKFIFSDSW---SKSDVVGGSVGAVVDQTADLTATPSLATEGRLKYLSAIIETGF  309

Query  252  FRTSFFFRNPGNVSPGGEV-LRPFSVTTWYCFLAATIVVSLAIKAAYWIERTFLKSRFDY  310
            FR+   FR P N    G+V L+PFS   WY F     ++ + +   +++E   ++ R+  
Sbjct  310  FRSVCIFRTPHNAGLRGDVFLQPFSPLVWYLFGGVLSLIGVLLWITFYMECKRMQKRWRL  369

Query  311  SLVTSFVTT  319
              + S ++T
Sbjct  370  DYLPSLLST  378


>Q8IPB8_DROME unnamed protein product
Length=629

 Score = 50.1 bits (118),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 61/280 (22%), Positives = 121/280 (43%), Gaps = 21/280 (8%)

Query  20   NVISNITDGSYERISFVLDLSCEKSDVILNESRKNNKFRFVHSWLMVSNSPIKRNDIKNM  79
            ++ S +T  +Y R S +++  C  S  +L E+ +N  F   + W +         +++++
Sbjct  75   SLTSILTRENYARTSVMVNARCSGSSELLFEASENRYFNKTYQWFLWGVDL----EVQSL  130

Query  80   FENVTLRMDTDIKLA-VPELDNRYSIFEIYHPG--LEGDIKINEIGVHAYNKLTYFNKDI  136
            F      +  + ++  V E  + Y+ ++I+  G  L+ +++IN I     + L    +DI
Sbjct  131  FPLNLNYVGPNAQITYVNETADGYAYWDIHSKGRHLKSNLEINLIATLINDTLN-IARDI  189

Query  137  SFYSA---RKDMSGILIRTGNRVNYSLGTPENYTEALRHR-----NRFTFGKFHFQLFLH  188
                +   R   +G+ +R  + ++          E++  R         F K+H++L   
Sbjct  190  FHLQSIDFRGQFNGLTLRGASVIDKEDIISNEQIESILSRPTKDAGVAAFIKYHYELLGL  249

Query  189  LVYIHEFHYNTTIRAEWFGN-SSSGIEAGLSRLLWDNEIDISSAGGILRAPRMHYYDYLL  247
            L     F  N      W G   ++    GL  ++  NE DI+++G   R  R   +D + 
Sbjct  250  LRERFNFTVNFRNSRGWAGRLGNTTFRLGLLGIVMRNEADIAASGAFNRINRFAEFDTIH  309

Query  248  PYYQFRTSFFFRNPGNV---SPGGEVLRPFSVTTW-YCFL  283
              ++F T+F +R   ++      G  L PFS   W +C L
Sbjct  310  QSWKFETAFLYRYTSDLDTHGKSGNFLSPFSDRVWLFCLL  349


>M9PCT4_DROME unnamed protein product
Length=648

 Score = 50.1 bits (118),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 61/280 (22%), Positives = 121/280 (43%), Gaps = 21/280 (8%)

Query  20   NVISNITDGSYERISFVLDLSCEKSDVILNESRKNNKFRFVHSWLMVSNSPIKRNDIKNM  79
            ++ S +T  +Y R S +++  C  S  +L E+ +N  F   + W +         +++++
Sbjct  75   SLTSILTRENYARTSVMVNARCSGSSELLFEASENRYFNKTYQWFLWGVDL----EVQSL  130

Query  80   FENVTLRMDTDIKLA-VPELDNRYSIFEIYHPG--LEGDIKINEIGVHAYNKLTYFNKDI  136
            F      +  + ++  V E  + Y+ ++I+  G  L+ +++IN I     + L    +DI
Sbjct  131  FPLNLNYVGPNAQITYVNETADGYAYWDIHSKGRHLKSNLEINLIATLINDTLN-IARDI  189

Query  137  SFYSA---RKDMSGILIRTGNRVNYSLGTPENYTEALRHR-----NRFTFGKFHFQLFLH  188
                +   R   +G+ +R  + ++          E++  R         F K+H++L   
Sbjct  190  FHLQSIDFRGQFNGLTLRGASVIDKEDIISNEQIESILSRPTKDAGVAAFIKYHYELLGL  249

Query  189  LVYIHEFHYNTTIRAEWFGN-SSSGIEAGLSRLLWDNEIDISSAGGILRAPRMHYYDYLL  247
            L     F  N      W G   ++    GL  ++  NE DI+++G   R  R   +D + 
Sbjct  250  LRERFNFTVNFRNSRGWAGRLGNTTFRLGLLGIVMRNEADIAASGAFNRINRFAEFDTIH  309

Query  248  PYYQFRTSFFFRNPGNV---SPGGEVLRPFSVTTW-YCFL  283
              ++F T+F +R   ++      G  L PFS   W +C L
Sbjct  310  QSWKFETAFLYRYTSDLDTHGKSGNFLSPFSDRVWLFCLL  349



Lambda      K        H
   0.320    0.135    0.434 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3573877230


Query= XP_018560788.1 uncharacterized protein LOC108903182 [Anoplophora
glabripennis]

Length=279
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

G39AD_DROME  unnamed protein product                                  37.4    0.010
GR32A_DROME  unnamed protein product                                  34.7    0.072
G39AC_DROME  unnamed protein product                                  33.9    0.12 
G39AA_DROME  unnamed protein product                                  33.1    0.24 
ORCO_AEDAE  unnamed protein product                                   33.1    0.24 


>G39AD_DROME unnamed protein product
Length=371

 Score = 37.4 bits (85),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 87/186 (47%), Gaps = 23/186 (12%)

Query  103  EGTITFPATVISDKTLFGLVEASKILSILFECVDIFNQLFGLVIMFINMSTVLTILTSLN  162
             G I +   +     + GL    +IL +   C    N+ FGL+++ I ++ VL +  S  
Sbjct  190  AGLIHYNQQLCQGDLISGLRGRQQILKL---CGGELNECFGLLMLPI-VALVLLMAPSGP  245

Query  163  TLLVSGETNQLTTEVVLD-CIFEALLFLVWNSS-------ILSASGLLKEESSEIVKICC  214
              L+S     L  +   D C+   L    W++        +L  +G+  EE+++  K+  
Sbjct  246  FFLIS---TVLEGKFRPDECLIMLLTSSTWDTPWMIMLVLMLRTNGI-SEEANKTAKMLT  301

Query  215  KLQHLLPQSSQERKELLN--LAHQIRRKSVTVSASGFFDVDFILILAVFTYVGNYIVVLI  272
            K+    P++      ++   L   +R+K + ++A GFF +D   +  +FT +  Y+V+L+
Sbjct  302  KV----PRTGTGLDRMIEKFLLKNLRQKPI-LTAYGFFALDKSTLFKLFTAIFTYMVILV  356

Query  273  QFSHMD  278
            QF  M+
Sbjct  357  QFKEME  362


>GR32A_DROME unnamed protein product
Length=461

 Score = 34.7 bits (78),  Expect = 0.072, Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 62/126 (49%), Gaps = 8/126 (6%)

Query  156  TILTSLNTLLVSGETNQLTTEVVLDCIFEALLFLVWNSSILSAS-GLLKEESSEIVKICC  214
            T+ T+   L V      + +  +L   F  L   V   ++LS S GL   E++   +I  
Sbjct  329  TVTTNCYNLFVQITGKGMVSPNILQWCFAWLCLHVSLLALLSRSCGLTTTEANATSQILA  388

Query  215  KLQHLLPQSSQERKELLN--LAHQIRRKSVTVSASGFFDVDFILILAVFTYVGNYIVVLI  272
            ++       S+E + +++  L   I+++ V  +A GFF +D   +  +F+ V  Y+V+LI
Sbjct  389  RVY----AKSKEYQNIIDKFLTKSIKQE-VQFTAYGFFAIDNSTLFKIFSAVTTYLVILI  443

Query  273  QFSHMD  278
            QF  ++
Sbjct  444  QFKQLE  449


>G39AC_DROME unnamed protein product
Length=381

 Score = 33.9 bits (76),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 27/101 (27%), Positives = 56/101 (55%), Gaps = 10/101 (10%)

Query  183  FEALLF-LVWNSSILSASGL--LKEESSEIVKICCKLQHLLPQSSQERKELLN--LAHQI  237
            F A+L+ L W   ++ A G   +++E+++  K+  K+    P++      ++   L   +
Sbjct  277  FTAILWSLPWIVLLVLAMGRNDVQKEANKTAKMLTKV----PRTGTGLDRMIEKFLLKNL  332

Query  238  RRKSVTVSASGFFDVDFILILAVFTYVGNYIVVLIQFSHMD  278
            R+K + ++A GFF +D   +  +FT +  Y+V+L+QF  M+
Sbjct  333  RQKPI-LTAYGFFALDKSTLFKLFTAIFTYMVILVQFKEME  372


>G39AA_DROME unnamed protein product
Length=372

 Score = 33.1 bits (74),  Expect = 0.24, Method: Compositional matrix adjust.
 Identities = 16/46 (35%), Positives = 29/46 (63%), Gaps = 1/46 (2%)

Query  233  LAHQIRRKSVTVSASGFFDVDFILILAVFTYVGNYIVVLIQFSHMD  278
            L   +R+K + ++A GFF +D   +  +FT +  Y+V+L+QF  M+
Sbjct  319  LLKNLRQKPI-LTAYGFFALDKSTLFKLFTAIFTYMVILVQFKEME  363


>ORCO_AEDAE unnamed protein product
Length=478

 Score = 33.1 bits (74),  Expect = 0.24, Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 35/70 (50%), Gaps = 2/70 (3%)

Query  204  EESSEIVKICCKLQHLLPQSSQERKELLNLAHQIRRKSVTVSASGFFDVDFILILAVFTY  263
            EESS +++            S+E K  + +  Q  +K++T+S + FF V   L  +V   
Sbjct  409  EESSSVMEAAYSCHWY--DGSEEAKTFVQIVCQQCQKAMTISGAKFFTVSLDLFASVLGA  466

Query  264  VGNYIVVLIQ  273
            V  Y +VL+Q
Sbjct  467  VVTYFMVLVQ  476



Lambda      K        H
   0.320    0.135    0.434 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3573877230


Query= XP_018560789.1 uncharacterized protein LOC108903183 [Anoplophora
glabripennis]

Length=387
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GR64F_DROME  unnamed protein product                                  36.6    0.032
GR28B_DROME  unnamed protein product                                  36.2    0.042
GR64A_DROME  unnamed protein product                                  35.4    0.082
GUR3_CAEEL  unnamed protein product                                   32.3    0.60 
NDST_DROME  unnamed protein product                                   32.0    0.97 


>GR64F_DROME unnamed protein product
Length=469

 Score = 36.6 bits (83),  Expect = 0.032, Method: Compositional matrix adjust.
 Identities = 57/208 (27%), Positives = 93/208 (45%), Gaps = 42/208 (20%)

Query  185  ALRARFRKINNMLIKSNDLHNIIN-NFIPKYAPER---INNLKSIKEVTDYYLLLSELVD  240
             L ++FR++N+      DL N    N  P Y  ER     N+  + +  D  + L  +V 
Sbjct  285  GLASKFRQLND------DLRNFKGMNMAPSYWSERRIQYRNICILCDKMDDAISLITMVS  338

Query  241  MFNKLFGWQIFLMTENIIISLLEVLNSLMLSIDYTQVTTDARHDFRTIMFLASLSLVFIV  300
              N L+          I + LL  LN+ M S+ +      A + + +++FL   +L    
Sbjct  339  FSNNLYF---------ICVQLLRSLNT-MPSVAH------AVYFYFSLIFLIGRTLA---  379

Query  301  FHSRIVLYCEDVNKESRNTLTISY-NLQQTVDPCSE-ERNELVILSDVVNLLNTKTSAAG  358
                + LY   V+ ESR  LT+ Y         C E +R    ++SD V L   K     
Sbjct  380  ----VSLYSSSVHDESR--LTLRYLRCVPKESWCPEVKRFTEEVISDEVALTGMK-----  428

Query  359  FYYISRNLSSRVFGYLFSYSIVLIQFNK  386
            F++++R L   V G + +Y +VLIQF++
Sbjct  429  FFHLTRKLVLSVAGTIVTYELVLIQFHE  456


>GR28B_DROME unnamed protein product
Length=470

 Score = 36.2 bits (82),  Expect = 0.042, Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 73/164 (45%), Gaps = 7/164 (4%)

Query  225  IKEVTDYYLLLSELVDMFNKLFGWQIFLMTENIIISLLEVLNSLMLSIDYTQVTTDARHD  284
            I+E  + + L+ E     NK F +Q+  +   I I+ L ++      ++     +     
Sbjct  285  IQESMEIHHLICEAAATANKYFTYQLLTI---ISIAFLIIVFDAYYVLETLLGKSKRESK  341

Query  285  FRTIMFLASLSLVFIVFHSRIVLYCEDVN---KESRNTLTISYNLQQTVDPCSEERNELV  341
            F+T+ F+   S   I++   I+   E  N   K+S  T  I ++L       +E + +L 
Sbjct  342  FKTVEFVTFFSCQMILYLIAIISIVEGSNRAIKKSEKTGGIVHSLLNKTKS-AEVKEKLQ  400

Query  342  ILSDVVNLLNTKTSAAGFYYISRNLSSRVFGYLFSYSIVLIQFN  385
              S  +  L    +AAG + I R L   + G L +Y I+L+QF 
Sbjct  401  QFSMQLMHLKINFTAAGLFNIDRTLYFTISGALTTYLIILLQFT  444


>GR64A_DROME unnamed protein product
Length=456

 Score = 35.4 bits (80),  Expect = 0.082, Method: Compositional matrix adjust.
 Identities = 40/167 (24%), Positives = 74/167 (44%), Gaps = 29/167 (17%)

Query  227  EVTDYYLLLSELVDMFNKLFGWQIFLMTEN----IIISLLEVLNSLMLSIDYTQVTTDAR  282
            ++ ++Y+ + EL++  +      I L   N    +   LL V N L   I+Y        
Sbjct  300  QIREHYVKMCELLEFVDSAMSSLILLSCVNNLYFVCYQLLNVFNKLRWPINY--------  351

Query  283  HDFRTIMFLASLSLVFIVFHSRIVLYCEDVNKESRNTLTISYNLQQTVDPCSEERNELVI  342
                 I F  SL L  I   + + L   D+N+ES+  L +   +          R+  V 
Sbjct  352  -----IYFWYSL-LYLIGRTAFVFLTAADINEESKRGLGVLRRV--------SSRSWCVE  397

Query  343  LSDVVNLLNTKT---SAAGFYYISRNLSSRVFGYLFSYSIVLIQFNK  386
            +  ++  + T+T   S   FY+++R L   + G + +Y +VL+QF++
Sbjct  398  VERLIFQMTTQTVALSGKKFYFLTRRLLFGMAGTIVTYELVLLQFDE  444


>GUR3_CAEEL unnamed protein product
Length=447

 Score = 32.3 bits (72),  Expect = 0.60, Method: Compositional matrix adjust.
 Identities = 41/191 (21%), Positives = 82/191 (43%), Gaps = 18/191 (9%)

Query  205  NIINNFIPKY---APERINNLKSIKEVTDYYLLLSELVDMFNKLFGWQIFLMTENIIISL  261
             +I   +PK     P    +L+ I +V  +Y  +S       + F + +F  T    I L
Sbjct  247  QLIEEMVPKEKEECPLPEQSLQQIHDVQIHYQEISNAKLYIEQNFSFSLFY-TYGCCIPL  305

Query  262  LEVLNSLMLSIDYTQVTTDARHDFRTIMFLASLSLVFIVFHSRIVLYCEDVNKESRNTLT  321
              +L  +        +  D    F   ++L +  L  ++F     +  E+ +K     LT
Sbjct  306  TCLLGYIAFR---NGIQADMAETFSVAIWLTNTMLALMLFSIPAFMIAEEGDK----LLT  358

Query  322  ISYNLQQTVDPCSEERNELVI-----LSDVVNLLNTKTSAAGFYYISRNLSSRVFGYLFS  376
             S+ +    +   EER+ LV+     LS  ++      +A  F+ ++R +   +F  +F+
Sbjct  359  ASFKMYH--ETLCEERDLLVLSQMSFLSFQMHATKLTLTAGNFFMMNRKIMISLFSAIFT  416

Query  377  YSIVLIQFNKQ  387
            Y ++L+QF+ +
Sbjct  417  YFLILVQFDAE  427


>NDST_DROME unnamed protein product
Length=1048

 Score = 32.0 bits (71),  Expect = 0.97, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 28/49 (57%), Gaps = 1/49 (2%)

Query  36   KWFKYYAVGIMAFIVLGSSSSLYGIIVYFLPLFKATNIVLRTISMIALT  84
            K+ + Y+VGI+ F V  S  +L G  +   PLF  TN+ LR  S+  L+
Sbjct  314  KYCREYSVGIVGF-VSPSEETLVGAQLRDFPLFVNTNLRLRDASLNPLS  361



Lambda      K        H
   0.320    0.135    0.434 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3573877230


Query= XP_018560790.1 uncharacterized protein LOC108903184 [Anoplophora
glabripennis]

Length=158
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

G4SNP8_CAEEL  unnamed protein product                                 29.6    1.3  
Q058V3_DROME  unnamed protein product                                 27.3    6.5  
Q8IIM2_PLAF7  unnamed protein product                                 26.9    7.1  


>G4SNP8_CAEEL unnamed protein product
Length=617

 Score = 29.6 bits (65),  Expect = 1.3, Method: Composition-based stats.
 Identities = 15/49 (31%), Positives = 28/49 (57%), Gaps = 2/49 (4%)

Query  101  RRRRRRKDRLLH--GDIDSFESSKFEEVTEVLDDGLPEPIPGSSHSLSD  147
            +++ R K +LL   G ID+FE  + + +++   DG+  P P    S++D
Sbjct  342  QQKNRSKPQLLQLPGKIDNFEEFRLQCLSDCRSDGVLFPPPAIVASMTD  390


>Q058V3_DROME unnamed protein product
Length=481

 Score = 27.3 bits (59),  Expect = 6.5, Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 27/58 (47%), Gaps = 16/58 (28%)

Query  99   KGRRRRRRKDRLLHGDIDSFESSKFEEVTEVLDDGLPEPIPGSSHSLSDSLAEQDTIL  156
            KG R+RR             + S  +E+T  L+D LPEP    S  L  +LA +  IL
Sbjct  372  KGARKRR-------------DLSAEQELTSKLEDNLPEP---QSIYLEGALAHESQIL  413


>Q8IIM2_PLAF7 unnamed protein product
Length=278

 Score = 26.9 bits (58),  Expect = 7.1, Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 23/48 (48%), Gaps = 0/48 (0%)

Query  64   PMGAVPLIWPHKLWLSYVAAGQLFALAVFHLVLSFKGRRRRRRKDRLL  111
            P+  + LI+PH  W S++    +  L VF + +S K        D LL
Sbjct  39   PIDLLNLIFPHFTWKSFMVVISIIQLIVFIISVSIKPADFLTPSDSLL  86



Lambda      K        H
   0.320    0.135    0.434 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3573877230


Query= XP_018560791.1 zinc finger and SCAN domain-containing protein 2-like
isoform X1 [Anoplophora glabripennis]

Length=468
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q95RQ8_DROME  unnamed protein product                                 165     2e-44
M9PF60_DROME  unnamed protein product                                 139     1e-35
O96395_DROME  unnamed protein product                                 136     1e-34
Q9W1N1_DROME  unnamed protein product                                 130     3e-32
R9PY35_DROME  unnamed protein product                                 125     3e-32


>Q95RQ8_DROME unnamed protein product
Length=683

 Score = 165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 121/453 (27%), Positives = 202/453 (45%), Gaps = 24/453 (5%)

Query  15   EVILDLNELCRLCMGKEEELISIFNNDEPIPLT----LRIMACVALEVFEGDGLPDKICH  70
            E +L    +CR C+  E++L SIF  +  +  T    L+IMA  A+EV+ GDG+P  IC 
Sbjct  9    EAMLTEKRVCRFCLT-EQKLASIFEENPRVKTTANLPLQIMAITAIEVYAGDGMPGHICL  67

Query  71   PCKFQLEKSYNFRKKCESSDMKLRQHLRELREKIGEEENQQFEEEESMEMEIMETSVHAM  130
             C+   E  Y F++ C+ ++  LRQ+       +        E+  +    +    +  +
Sbjct  68   ECRLLFEHCYRFKQMCKRAETLLRQY------PLTGNWPSPLEKPRAPMTMVASKKLLVV  121

Query  131  SQDNSQPGPSTEEDLVGVTKVSYIQPDTEPDNDPESITLPPETDEAIKEACTLKSSDQLK  190
                ++P   T + L+     S  Q   E     ES  + P T            + +LK
Sbjct  122  PAKTAEPS-ETPKKLLNTMAKSSSQVIIEDVQVLESAMVTPRTVAGSSPVPRRSHAYELK  180

Query  191  TEIEETEEADNV-FIIEDTEHQVMDD-NNMNAIADAVKATLASQPGLNLSGQLQLKVNQS  248
             +  +    D+V  ++ED   ++  +  ++   A  VK  + ++  + +  +      + 
Sbjct  181  VDNNQELSMDDVQSMLEDMASELEKEFPDIPQKASPVKPKVLNKSSIRILNKGPAAPVEP  240

Query  249  DGKSTQVEVTTEDGSVIVMELMTEEESDISSIFSPSPAADVNEDGELKIFRCPDCPKSFA  308
               + +V+        IV E++  +            A  V  D    +F CPDC +SF 
Sbjct  241  RLATPKVKRDDSGNVAIVTEVLDSDLPLDDQDDPTKNAEKVATD----VFPCPDCERSFP  296

Query  309  RRIQLRRHASVHMQQRGFSCGICEKWFPTRSALVRHERIHTGERPFQCEVCQKSFAQKEI  368
             +  L  H   H + R F C +CEK F ++  L +H  +HTGERPF+C +C K+F +K +
Sbjct  297  LQQLLEIHRLNHTRSRSFQCLLCEKSFFSKYDLAKHNFVHTGERPFKCAICSKAFTRKAL  356

Query  369  LYRHLMTHTGQKPYSCPHCPKGFTQKEPLRVHIRTHLGNSPSDIQLHYCSLCPKVFCHAS  428
            L+RH  THT    + C +C K F  ++ +  H   H    P       C +C K F    
Sbjct  357  LHRHERTHTDVPKFICVYCEKPFLSRQEMEKHAERHQKKRPFQ-----CGVCTKSFAFKQ  411

Query  429  GLSRHLVTHTGKM-FKCRDCDKSFTDKSSLRRH  460
            GL RH   H+  + F C+ C++SF+  S L RH
Sbjct  412  GLERHETVHSTNLPFPCQHCERSFSTASKLARH  444


 Score = 112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 62/168 (37%), Positives = 84/168 (50%), Gaps = 8/168 (5%)

Query  298  FRCPDCPKSFARRIQLRRHASVHMQQRGFSCGICEKWFPTRSALVRHERIHTGERPFQCE  357
            F+C  C K+F R+  L RH   H     F C  CEK F +R  + +H   H  +RPFQC 
Sbjct  342  FKCAICSKAFTRKALLHRHERTHTDVPKFICVYCEKPFLSRQEMEKHAERHQKKRPFQCG  401

Query  358  VCQKSFAQKEILYRHLMTHTGQKPYSCPHCPKGFTQKEPLRVHIRTHLGNSPSDIQLHYC  417
            VC KSFA K+ L RH   H+   P+ C HC + F+    L  H+  H G      + + C
Sbjct  402  VCTKSFAFKQGLERHETVHSTNLPFPCQHCERSFSTASKLARHLVAHAGK-----RAYPC  456

Query  418  SLCPKVFCHASGLSRHLVTHT---GKMFKCRDCDKSFTDKSSLRRHHL  462
              C K +  +  LSRHL THT      F C +C  S+++ + L  H L
Sbjct  457  KYCHKSYMLSHHLSRHLRTHTQTSDASFVCSECKVSYSNYNDLLDHAL  504


 Score = 111 bits (277),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 56/163 (34%), Positives = 81/163 (50%), Gaps = 3/163 (2%)

Query  298  FRCPDCPKSFARRIQLRRHASVHMQQRGFSCGICEKWFPTRSALVRHERIHTGERPFQCE  357
            F C  C K F  R ++ +HA  H ++R F CG+C K F  +  L RHE +H+   PF C+
Sbjct  370  FICVYCEKPFLSRQEMEKHAERHQKKRPFQCGVCTKSFAFKQGLERHETVHSTNLPFPCQ  429

Query  358  VCQKSFAQKEILYRHLMTHTGQKPYSCPHCPKGFTQKEPLRVHIRTHLGNSPSDIQLHYC  417
             C++SF+    L RHL+ H G++ Y C +C K +     L  H+RTH   S +      C
Sbjct  430  HCERSFSTASKLARHLVAHAGKRAYPCKYCHKSYMLSHHLSRHLRTHTQTSDASF---VC  486

Query  418  SLCPKVFCHASGLSRHLVTHTGKMFKCRDCDKSFTDKSSLRRH  460
            S C   + + + L  H + H     KC  C K   D  S+  H
Sbjct  487  SECKVSYSNYNDLLDHALIHATASLKCPMCRKQIEDIDSVESH  529


 Score = 42.4 bits (98),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 30/133 (23%), Positives = 48/133 (36%), Gaps = 29/133 (22%)

Query  298  FRCPDCPKSFARRIQLRRHASVHMQQRGFSCGICEKWFPTRSALVRHERIHT--------  349
            F C  C +SF+   +L RH   H  +R + C  C K +     L RH R HT        
Sbjct  426  FPCQHCERSFSTASKLARHLVAHAGKRAYPCKYCHKSYMLSHHLSRHLRTHTQTSDASFV  485

Query  350  ---------------------GERPFQCEVCQKSFAQKEILYRHLMTHTGQKPYSCPHCP  388
                                      +C +C+K     + +  H+  H   + ++C  C 
Sbjct  486  CSECKVSYSNYNDLLDHALIHATASLKCPMCRKQIEDIDSVESHMDQHKQSERHACEFCD  545

Query  389  KGFTQKEPLRVHI  401
              F  ++ L+ HI
Sbjct  546  HIFLTQKCLQRHI  558


>M9PF60_DROME unnamed protein product
Length=571

 Score = 139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 127/493 (26%), Positives = 202/493 (41%), Gaps = 42/493 (9%)

Query  7    KKTGEPQDEVILDLNELCRLCMGKEEELISIFNNDEPIPLTLRIMACVALEV--FEGDGL  64
            + +G+ +  V   + + CR C      L+ +F+ +   P    ++  +  E+   + D +
Sbjct  4    RSSGKMERSVDASMGKNCRACAEHSSILVDLFSKEISDPPIWEMLNSILPEICRVKRDEM  63

Query  65   PDKICHPCKFQLEKSYNFRKKCESSDMKLRQ--HLRELREKIGEEENQQFEEEESMEMEI  122
            P KIC  C    + +++FR KCE S     Q   L +    +     ++      +  EI
Sbjct  64   PQKICPTCLVAAQNAFHFRHKCEQSFQFFSQLLQLDKSNSNLSRSHCRRGTMNPLIPFEI  123

Query  123  ------METSVHAMSQDNSQPGPSTEEDLVGVTKVSYIQPDTEPDNDPESI--TLPPETD  174
                  ++T+V  +  D ++P   T+ D     K + +  +     D  SI  T     D
Sbjct  124  VGCEDPLDTNVTKL--DANRPDVKTDIDEPTDGKATNVTMNDIKTEDEVSIQETFEDAFD  181

Query  175  EAIKEACT---LKSSDQLKTEIEETEEADNVFIIEDTEHQVMDDNNMNAIADAVKATLAS  231
            E      T    + SDQ    +  TE+ D  +I      Q +  NN + +      + ++
Sbjct  182  EENDNNNTDSEREDSDQW--TVGSTEDQDEPWIPGGGGRQTVGGNNQSLLCTECGVSYST  239

Query  232  QPGLNLSGQLQLKVNQSDGKSTQVEVTTEDGSVIVMELMTEEESDI------------SS  279
            Q  L  +  +     Q D +   +      G     +L T                  + 
Sbjct  240  QKAL--ARHVAKHKEQGDTQKPHLCDFCGRGFRTNAQLTTHRRRHTGERPFKCPLCPKAY  297

Query  280  IFSPSPAADVNEDGELKIFRCPDCPKSFARRIQLRRHASVHMQQRGFSCGICEKWFPTRS  339
               P+  + ++   E K  +CP C K+F  R  LR H   H  +R + C  C + F   S
Sbjct  298  THGPTLKSHMHTHDEEKGHKCPQCDKTFYTRGNLRAHIQRHTGERPYKCPDCPQTFAKNS  357

Query  340  ALVRHERIHTGERPFQCEVCQKSFAQKEILYRHLMTHTGQKPYSCPHCPKGFTQKEPLRV  399
             L  H R+H  ERPF+CE+C K F Q + L  HL  H G + + CP C K F +K  +  
Sbjct  358  GLKLHSRLHKEERPFKCELCGKGFVQNQHLITHLRVHNGDRQFKCPDCDKSFFEKSNMMK  417

Query  400  HIRTHLGNSPSDIQLHYCSLCPKVFCHASGLSRHLVTHTG-KMFKCRDCDKSFTDKSSLR  458
            H RTH G     I+   C  C + F H   L  HL  HTG K +KC  C K F+   SL 
Sbjct  418  HQRTHSG-----IKPFKCEECGQAFSHNHHLKSHLRIHTGEKPYKCDQCGKGFSANQSLM  472

Query  459  RH---HLQTNHQP  468
            +H   H+  N +P
Sbjct  473  KHTLWHVDNNDRP  485


 Score = 124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 91/166 (55%), Gaps = 8/166 (5%)

Query  298  FRCPDCPKSFARRIQLRRHASVHMQQRGFSCGICEKWFPTRSALVRHERIHTGERPFQCE  357
            ++CPDCP++FA+   L+ H+ +H ++R F C +C K F     L+ H R+H G+R F+C 
Sbjct  344  YKCPDCPQTFAKNSGLKLHSRLHKEERPFKCELCGKGFVQNQHLITHLRVHNGDRQFKCP  403

Query  358  VCQKSFAQKEILYRHLMTHTGQKPYSCPHCPKGFTQKEPLRVHIRTHLGNSPSDIQLHYC  417
             C KSF +K  + +H  TH+G KP+ C  C + F+    L+ H+R H G  P     + C
Sbjct  404  DCDKSFFEKSNMMKHQRTHSGIKPFKCEECGQAFSHNHHLKSHLRIHTGEKP-----YKC  458

Query  418  SLCPKVFCHASGLSRHLVTH---TGKMFKCRDCDKSFTDKSSLRRH  460
              C K F     L +H + H     + FKC  C K++  + SLR H
Sbjct  459  DQCGKGFSANQSLMKHTLWHVDNNDRPFKCSQCPKAYDTQQSLRGH  504


 Score = 109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 87/172 (51%), Gaps = 8/172 (5%)

Query  294  ELKIFRCPDCPKSFARRIQLRRHASVHMQQRGFSCGICEKWFPTRSALVRHERIHTGERP  353
            E + F+C  C K F +   L  H  VH   R F C  C+K F  +S +++H+R H+G +P
Sbjct  368  EERPFKCELCGKGFVQNQHLITHLRVHNGDRQFKCPDCDKSFFEKSNMMKHQRTHSGIKP  427

Query  354  FQCEVCQKSFAQKEILYRHLMTHTGQKPYSCPHCPKGFTQKEPLRVHIRTHLGNSPSDIQ  413
            F+CE C ++F+    L  HL  HTG+KPY C  C KGF+  + L  H   H+ N+    +
Sbjct  428  FKCEECGQAFSHNHHLKSHLRIHTGEKPYKCDQCGKGFSANQSLMKHTLWHVDNNDRPFK  487

Query  414  LHYCSLCPKVFCHASGLSRHLVTHTG-----KMFKCRDCDKSFTDKSSLRRH  460
               CS CPK +     L  H  TH        + +C  CD  F  K +L +H
Sbjct  488  ---CSQCPKAYDTQQSLRGHEKTHKNPDEPKTLHQCPHCDVRFALKKTLDKH  536


 Score = 106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/165 (33%), Positives = 83/165 (50%), Gaps = 3/165 (2%)

Query  298  FRCPDCPKSFARRIQLRRHASVHMQQRGFSCGICEKWFPTRSALVRHERIHTGERPFQCE  357
            F+CPDC KSF  +  + +H   H   + F C  C + F     L  H RIHTGE+P++C+
Sbjct  400  FKCPDCDKSFFEKSNMMKHQRTHSGIKPFKCEECGQAFSHNHHLKSHLRIHTGEKPYKCD  459

Query  358  VCQKSFAQKEILYRHLMTH--TGQKPYSCPHCPKGFTQKEPLRVHIRTHLGNSPSDIQLH  415
             C K F+  + L +H + H     +P+ C  CPK +  ++ LR H +TH  N      LH
Sbjct  460  QCGKGFSANQSLMKHTLWHVDNNDRPFKCSQCPKAYDTQQSLRGHEKTH-KNPDEPKTLH  518

Query  416  YCSLCPKVFCHASGLSRHLVTHTGKMFKCRDCDKSFTDKSSLRRH  460
             C  C   F     L +H+ +H  +   C  C + F  + SL++H
Sbjct  519  QCPHCDVRFALKKTLDKHITSHKIRPHPCPQCPEGFFSQKSLKKH  563


 Score = 68.2 bits (165),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 66/144 (46%), Gaps = 35/144 (24%)

Query  295  LKIFRCPDCPKSFARRIQLRRHASVHMQQRGFSCGICEKWFPTRSALVRHERIH--TGER  352
            +K F+C +C ++F+    L+ H  +H  ++ + C  C K F    +L++H   H    +R
Sbjct  425  IKPFKCEECGQAFSHNHHLKSHLRIHTGEKPYKCDQCGKGFSANQSLMKHTLWHVDNNDR  484

Query  353  PFQCEVCQKS--------------------------------FAQKEILYRHLMTHTGQK  380
            PF+C  C K+                                FA K+ L +H+ +H   +
Sbjct  485  PFKCSQCPKAYDTQQSLRGHEKTHKNPDEPKTLHQCPHCDVRFALKKTLDKHITSHK-IR  543

Query  381  PYSCPHCPKGFTQKEPLRVHIRTH  404
            P+ CP CP+GF  ++ L+ H+R H
Sbjct  544  PHPCPQCPEGFFSQKSLKKHLRLH  567


 Score = 30.8 bits (68),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 30/60 (50%), Gaps = 1/60 (2%)

Query  290  NEDGELKIFRCPDCPKSFARRIQLRRHASVHMQQRGFSCGICEKWFPTRSALVRHERIHT  349
            N D    + +CP C   FA +  L +H + H + R   C  C + F ++ +L +H R+H 
Sbjct  510  NPDEPKTLHQCPHCDVRFALKKTLDKHITSH-KIRPHPCPQCPEGFFSQKSLKKHLRLHN  568


>O96395_DROME unnamed protein product
Length=583

 Score = 136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 126/504 (25%), Positives = 207/504 (41%), Gaps = 52/504 (10%)

Query  7    KKTGEPQDEVILDLNELCRLCMGKEEELISIFNNDEPIPLTLRIMACVALEV--FEGDGL  64
            + +G+ +  V   + + CR C      L+ +F+ +   P    ++  +  E+   + D +
Sbjct  4    RSSGKMERSVDASMGKNCRACAEHSSILVDLFSKEISDPPIWEMLNSILPEICRVKRDEM  63

Query  65   PDKICHPCKFQLEKSYNFRKKCESSDMKLRQ--HLRELREKIGEEENQQFEEEESMEMEI  122
            P KIC  C    + +++FR KCE S     Q   L +    +     ++      +  EI
Sbjct  64   PQKICPTCLVAAQNAFHFRHKCEQSFQFFSQLLQLDKSNSNLSRSHCRRGTMNPLIPFEI  123

Query  123  ------METSVHAMSQDNSQPGPSTEEDLVGVTKVSYIQPDTEPDNDPESITL---PPET  173
                  ++T+V  +  D ++P   T+ D     K +  Q ++EP  +   IT+     E 
Sbjct  124  VGCEDPLDTNVTKL--DANRPDVKTDIDEPTDGKATNGQ-ESEPLQEVFEITMNDIKTED  180

Query  174  DEAIKEA-------------CTLKSSDQLKTEIEETEEADNVFIIEDTEHQVMDDNNMNA  220
            + +I+E                 +  D  +  +  TE+ D  +I      Q +  NN + 
Sbjct  181  EVSIQETFEDAFDEENDNNNTDSEREDSDQWTVGSTEDQDEPWIPGGGGRQTVGGNNQSL  240

Query  221  IADAVKATLASQPGLNLSGQLQLKVNQSDGKSTQVEVTTEDGSVIVMELMTEEESDI---  277
            +      + ++Q  L  +  +     Q D +   +      G     +L T         
Sbjct  241  LCTECGVSYSTQKAL--ARHVAKHKEQGDTQKPHLCDFCGRGFRTNAQLTTHRRRHTGER  298

Query  278  ---------SSIFSPSPAADVNEDGELKIFRCPDCPKSFARRIQLRRHASVHMQQRGFSC  328
                     +    P+  + ++   E K  +CP C K+F  R  LR H   H  +R + C
Sbjct  299  PFKCPLCPKAYTHGPTLKSHMHTHDEEKGHKCPQCDKTFYTRGNLRAHIQRHTGERPYKC  358

Query  329  GICEKWFPTRSALVRHERIHTGERPFQCEVCQKSFAQKEILYRHLMTHTGQKPYSCPHCP  388
              C + F   S L  H R+H  ERPF+CE+C K F Q + L  HL  H G + + CP C 
Sbjct  359  PDCPQTFAKNSGLKLHSRLHKEERPFKCELCGKGFVQNQHLITHLRVHNGDRQFKCPDCD  418

Query  389  KGFTQKEPLRVHIRTHLGNSPSDIQLHYCSLCPKVFCHASGLSRHLVTHTG-KMFKCRDC  447
            K F +K  +  H RTH G     I+   C  C + F H   L  HL  HTG K +KC  C
Sbjct  419  KSFFEKSNMMKHQRTHSG-----IKPFKCEECGQAFSHNHHLKSHLRIHTGEKPYKCDQC  473

Query  448  DKSFTDKSSLRRH---HLQTNHQP  468
             K F+   SL +H   H+  N +P
Sbjct  474  GKGFSANQSLMKHTLWHVDNNDRP  497


 Score = 124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 91/166 (55%), Gaps = 8/166 (5%)

Query  298  FRCPDCPKSFARRIQLRRHASVHMQQRGFSCGICEKWFPTRSALVRHERIHTGERPFQCE  357
            ++CPDCP++FA+   L+ H+ +H ++R F C +C K F     L+ H R+H G+R F+C 
Sbjct  356  YKCPDCPQTFAKNSGLKLHSRLHKEERPFKCELCGKGFVQNQHLITHLRVHNGDRQFKCP  415

Query  358  VCQKSFAQKEILYRHLMTHTGQKPYSCPHCPKGFTQKEPLRVHIRTHLGNSPSDIQLHYC  417
             C KSF +K  + +H  TH+G KP+ C  C + F+    L+ H+R H G  P     + C
Sbjct  416  DCDKSFFEKSNMMKHQRTHSGIKPFKCEECGQAFSHNHHLKSHLRIHTGEKP-----YKC  470

Query  418  SLCPKVFCHASGLSRHLVTH---TGKMFKCRDCDKSFTDKSSLRRH  460
              C K F     L +H + H     + FKC  C K++  + SLR H
Sbjct  471  DQCGKGFSANQSLMKHTLWHVDNNDRPFKCSQCPKAYDTQQSLRGH  516


 Score = 110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 87/172 (51%), Gaps = 8/172 (5%)

Query  294  ELKIFRCPDCPKSFARRIQLRRHASVHMQQRGFSCGICEKWFPTRSALVRHERIHTGERP  353
            E + F+C  C K F +   L  H  VH   R F C  C+K F  +S +++H+R H+G +P
Sbjct  380  EERPFKCELCGKGFVQNQHLITHLRVHNGDRQFKCPDCDKSFFEKSNMMKHQRTHSGIKP  439

Query  354  FQCEVCQKSFAQKEILYRHLMTHTGQKPYSCPHCPKGFTQKEPLRVHIRTHLGNSPSDIQ  413
            F+CE C ++F+    L  HL  HTG+KPY C  C KGF+  + L  H   H+ N+    +
Sbjct  440  FKCEECGQAFSHNHHLKSHLRIHTGEKPYKCDQCGKGFSANQSLMKHTLWHVDNNDRPFK  499

Query  414  LHYCSLCPKVFCHASGLSRHLVTHTG-----KMFKCRDCDKSFTDKSSLRRH  460
               CS CPK +     L  H  TH        + +C  CD  F  K +L +H
Sbjct  500  ---CSQCPKAYDTQQSLRGHEKTHKNPDEPKTLHQCPHCDVRFALKKTLDKH  548


 Score = 106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/165 (33%), Positives = 83/165 (50%), Gaps = 3/165 (2%)

Query  298  FRCPDCPKSFARRIQLRRHASVHMQQRGFSCGICEKWFPTRSALVRHERIHTGERPFQCE  357
            F+CPDC KSF  +  + +H   H   + F C  C + F     L  H RIHTGE+P++C+
Sbjct  412  FKCPDCDKSFFEKSNMMKHQRTHSGIKPFKCEECGQAFSHNHHLKSHLRIHTGEKPYKCD  471

Query  358  VCQKSFAQKEILYRHLMTH--TGQKPYSCPHCPKGFTQKEPLRVHIRTHLGNSPSDIQLH  415
             C K F+  + L +H + H     +P+ C  CPK +  ++ LR H +TH  N      LH
Sbjct  472  QCGKGFSANQSLMKHTLWHVDNNDRPFKCSQCPKAYDTQQSLRGHEKTH-KNPDEPKTLH  530

Query  416  YCSLCPKVFCHASGLSRHLVTHTGKMFKCRDCDKSFTDKSSLRRH  460
             C  C   F     L +H+ +H  +   C  C + F  + SL++H
Sbjct  531  QCPHCDVRFALKKTLDKHITSHKIRPHPCPQCPEGFFSQKSLKKH  575


 Score = 68.2 bits (165),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 66/144 (46%), Gaps = 35/144 (24%)

Query  295  LKIFRCPDCPKSFARRIQLRRHASVHMQQRGFSCGICEKWFPTRSALVRHERIH--TGER  352
            +K F+C +C ++F+    L+ H  +H  ++ + C  C K F    +L++H   H    +R
Sbjct  437  IKPFKCEECGQAFSHNHHLKSHLRIHTGEKPYKCDQCGKGFSANQSLMKHTLWHVDNNDR  496

Query  353  PFQCEVCQKS--------------------------------FAQKEILYRHLMTHTGQK  380
            PF+C  C K+                                FA K+ L +H+ +H   +
Sbjct  497  PFKCSQCPKAYDTQQSLRGHEKTHKNPDEPKTLHQCPHCDVRFALKKTLDKHITSHK-IR  555

Query  381  PYSCPHCPKGFTQKEPLRVHIRTH  404
            P+ CP CP+GF  ++ L+ H+R H
Sbjct  556  PHPCPQCPEGFFSQKSLKKHLRLH  579


 Score = 31.2 bits (69),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 30/60 (50%), Gaps = 1/60 (2%)

Query  290  NEDGELKIFRCPDCPKSFARRIQLRRHASVHMQQRGFSCGICEKWFPTRSALVRHERIHT  349
            N D    + +CP C   FA +  L +H + H + R   C  C + F ++ +L +H R+H 
Sbjct  522  NPDEPKTLHQCPHCDVRFALKKTLDKHITSH-KIRPHPCPQCPEGFFSQKSLKKHLRLHN  580


>Q9W1N1_DROME unnamed protein product
Length=623

 Score = 130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 100/400 (25%), Positives = 171/400 (43%), Gaps = 19/400 (5%)

Query  64   LPDKICHPCKFQLEKSYNFRKKCESSDMKLRQHLRELREKIGEEENQQFEEEESMEMEIM  123
            +P  IC  C+   E  Y F++ C+ ++  LRQ+       +        E+  +    + 
Sbjct  1    MPGHICLECRLLFEHCYRFKQMCKRAETLLRQY------PLTGNWPSPLEKPRAPMTMVA  54

Query  124  ETSVHAMSQDNSQPGPSTEEDLVGVTKVSYIQPDTEPDNDPESITLPPETDEAIKEACTL  183
               +  +    ++P   T + L+     S  Q   E     ES  + P T          
Sbjct  55   SKKLLVVPAKTAEPS-ETPKKLLNTMAKSSSQVIIEDVQVLESAMVTPRTVAGSSPVPRR  113

Query  184  KSSDQLKTEIEETEEADNV-FIIEDTEHQVMDD-NNMNAIADAVKATLASQPGLNLSGQL  241
              + +LK +  +    D+V  ++ED   ++  +  ++   A  VK  + ++  + +  + 
Sbjct  114  SHAYELKVDNNQELSMDDVQSMLEDMASELEKEFPDIPQKASPVKPKVLNKSSIRILNKG  173

Query  242  QLKVNQSDGKSTQVEVTTEDGSVIVMELMTEEESDISSIFSPSPAADVNEDGELKIFRCP  301
                 +    + +V+        IV E++  +            A  V  D    +F CP
Sbjct  174  PAAPVEPRLATPKVKRDDSGNVAIVTEVLDSDLPLDDQDDPTKNAEKVATD----VFPCP  229

Query  302  DCPKSFARRIQLRRHASVHMQQRGFSCGICEKWFPTRSALVRHERIHTGERPFQCEVCQK  361
            DC +SF  +  L  H   H + R F C +CEK F ++  L +H  +HTGERPF+C +C K
Sbjct  230  DCERSFPLQQLLEIHRLNHTRSRSFQCLLCEKSFFSKYDLAKHNFVHTGERPFKCAICSK  289

Query  362  SFAQKEILYRHLMTHTGQKPYSCPHCPKGFTQKEPLRVHIRTHLGNSPSDIQLHYCSLCP  421
            +F +K +L+RH  THT    + C +C K F  ++ +  H   H    P       C +C 
Sbjct  290  AFTRKALLHRHERTHTDVPKFICVYCEKPFLSRQEMEKHAERHQKKRPFQ-----CGVCT  344

Query  422  KVFCHASGLSRHLVTHTGKM-FKCRDCDKSFTDKSSLRRH  460
            K F    GL RH   H+  + F C+ C++SF+  S L RH
Sbjct  345  KSFAFKQGLERHETVHSTNLPFPCQHCERSFSTASKLARH  384


 Score = 112 bits (279),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 62/168 (37%), Positives = 84/168 (50%), Gaps = 8/168 (5%)

Query  298  FRCPDCPKSFARRIQLRRHASVHMQQRGFSCGICEKWFPTRSALVRHERIHTGERPFQCE  357
            F+C  C K+F R+  L RH   H     F C  CEK F +R  + +H   H  +RPFQC 
Sbjct  282  FKCAICSKAFTRKALLHRHERTHTDVPKFICVYCEKPFLSRQEMEKHAERHQKKRPFQCG  341

Query  358  VCQKSFAQKEILYRHLMTHTGQKPYSCPHCPKGFTQKEPLRVHIRTHLGNSPSDIQLHYC  417
            VC KSFA K+ L RH   H+   P+ C HC + F+    L  H+  H G      + + C
Sbjct  342  VCTKSFAFKQGLERHETVHSTNLPFPCQHCERSFSTASKLARHLVAHAGK-----RAYPC  396

Query  418  SLCPKVFCHASGLSRHLVTHT---GKMFKCRDCDKSFTDKSSLRRHHL  462
              C K +  +  LSRHL THT      F C +C  S+++ + L  H L
Sbjct  397  KYCHKSYMLSHHLSRHLRTHTQTSDASFVCSECKVSYSNYNDLLDHAL  444


 Score = 110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/163 (34%), Positives = 81/163 (50%), Gaps = 3/163 (2%)

Query  298  FRCPDCPKSFARRIQLRRHASVHMQQRGFSCGICEKWFPTRSALVRHERIHTGERPFQCE  357
            F C  C K F  R ++ +HA  H ++R F CG+C K F  +  L RHE +H+   PF C+
Sbjct  310  FICVYCEKPFLSRQEMEKHAERHQKKRPFQCGVCTKSFAFKQGLERHETVHSTNLPFPCQ  369

Query  358  VCQKSFAQKEILYRHLMTHTGQKPYSCPHCPKGFTQKEPLRVHIRTHLGNSPSDIQLHYC  417
             C++SF+    L RHL+ H G++ Y C +C K +     L  H+RTH   S +      C
Sbjct  370  HCERSFSTASKLARHLVAHAGKRAYPCKYCHKSYMLSHHLSRHLRTHTQTSDASF---VC  426

Query  418  SLCPKVFCHASGLSRHLVTHTGKMFKCRDCDKSFTDKSSLRRH  460
            S C   + + + L  H + H     KC  C K   D  S+  H
Sbjct  427  SECKVSYSNYNDLLDHALIHATASLKCPMCRKQIEDIDSVESH  469


 Score = 42.4 bits (98),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 30/133 (23%), Positives = 48/133 (36%), Gaps = 29/133 (22%)

Query  298  FRCPDCPKSFARRIQLRRHASVHMQQRGFSCGICEKWFPTRSALVRHERIHT--------  349
            F C  C +SF+   +L RH   H  +R + C  C K +     L RH R HT        
Sbjct  366  FPCQHCERSFSTASKLARHLVAHAGKRAYPCKYCHKSYMLSHHLSRHLRTHTQTSDASFV  425

Query  350  ---------------------GERPFQCEVCQKSFAQKEILYRHLMTHTGQKPYSCPHCP  388
                                      +C +C+K     + +  H+  H   + ++C  C 
Sbjct  426  CSECKVSYSNYNDLLDHALIHATASLKCPMCRKQIEDIDSVESHMDQHKQSERHACEFCD  485

Query  389  KGFTQKEPLRVHI  401
              F  ++ L+ HI
Sbjct  486  HIFLTQKCLQRHI  498


>R9PY35_DROME unnamed protein product
Length=345

 Score = 125 bits (315),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 95/315 (30%), Positives = 145/315 (46%), Gaps = 44/315 (14%)

Query  161  DNDPESITLPPETD--EAIKEACTLKSSDQLKTEIEET---EEADNVFIIE--DTEHQVM  213
            D+ P SI  P   D   A     T + S Q+  E+++T   EE     IIE  D++  ++
Sbjct  45   DSLPHSICPPCVKDAHNAFTIIKTYERSYQVFYEVQDTVLEEELSEDVIIELSDSDEVIL  104

Query  214  DDNNMNAIADAVKATLASQPGLNLSGQLQLKVNQSDGKS-------TQVEVTTEDGSVIV  266
             D       + V  +    P   +S Q + K  QSD  S       TQ  ++     ++ 
Sbjct  105  IDEQ----EEKVHLSENKAPTNEVSTQEESKTAQSDNVSEDKGHICTQCHMSFRRPGLLE  160

Query  267  MELMTEEESDISSIFSPSPAADVNEDGELKIFRCPDCPKSFARRIQLRRHASVHMQQRGF  326
            + ++    +D      P P +  +E                A + +LR  A    +    
Sbjct  161  LHILRHHTTD-----GPRPMSSTSE---------------HAVKEELRTKARQLSRNSTH  200

Query  327  SCGICEKWFPTRSALVRHERIHTGERPFQCEVCQKSFAQKEILYRHLMTHTGQKPYSCPH  386
            +C +C K F ++++ VRH++ HTGE+PF CE+CQK FA    + RHL THTG++P+ C  
Sbjct  201  TCRLCNKTFCSKASCVRHQKTHTGEKPFACEICQKPFADLASVKRHLRTHTGERPFKCLT  260

Query  387  CPKGFTQKEPLRVHIRTHLGNSPSDIQLHYCSLCPKVFCHASGLSRHLVTHTG-KMFKCR  445
            C   F+    LR HIR H G  P     + C +C K F   S   +H+++HT  K FKC 
Sbjct  261  CQSAFSDGSALRQHIRIHTGERP-----YKCDMCDKFFRERSDARKHMMSHTAEKRFKCS  315

Query  446  DCDKSFTDKSSLRRH  460
             C++ F     LRRH
Sbjct  316  QCERRFRQPKGLRRH  330


 Score = 94.7 bits (234),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 63/107 (59%), Gaps = 0/107 (0%)

Query  296  KIFRCPDCPKSFARRIQLRRHASVHMQQRGFSCGICEKWFPTRSALVRHERIHTGERPFQ  355
            K F C  C K FA    ++RH   H  +R F C  C+  F   SAL +H RIHTGERP++
Sbjct  226  KPFACEICQKPFADLASVKRHLRTHTGERPFKCLTCQSAFSDGSALRQHIRIHTGERPYK  285

Query  356  CEVCQKSFAQKEILYRHLMTHTGQKPYSCPHCPKGFTQKEPLRVHIR  402
            C++C K F ++    +H+M+HT +K + C  C + F Q + LR H++
Sbjct  286  CDMCDKFFRERSDARKHMMSHTAEKRFKCSQCERRFRQPKGLRRHVK  332


 Score = 56.2 bits (134),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 65/152 (43%), Gaps = 13/152 (9%)

Query  322  QQRGFSCGICEKWFPTRSALVRH-ERIHT--GERPFQCEVCQKSFAQKEILYRHLMTHTG  378
            + +G  C  C   F     L  H  R HT  G RP          A KE L       + 
Sbjct  140  EDKGHICTQCHMSFRRPGLLELHILRHHTTDGPRPMSS---TSEHAVKEELRTKARQLSR  196

Query  379  QKPYSCPHCPKGFTQKEPLRVHIRTHLGNSPSDIQLHYCSLCPKVFCHASGLSRHLVTHT  438
               ++C  C K F  K     H +TH G  P       C +C K F   + + RHL THT
Sbjct  197  NSTHTCRLCNKTFCSKASCVRHQKTHTGEKP-----FACEICQKPFADLASVKRHLRTHT  251

Query  439  G-KMFKCRDCDKSFTDKSSLRRH-HLQTNHQP  468
            G + FKC  C  +F+D S+LR+H  + T  +P
Sbjct  252  GERPFKCLTCQSAFSDGSALRQHIRIHTGERP  283


 Score = 47.0 bits (110),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/87 (30%), Positives = 43/87 (49%), Gaps = 6/87 (7%)

Query  24   CRLCMGKEEELISIF--NNDEPIPLTLRIMACVALEVFEGDGLPDKICHPCKFQLEKSYN  81
            CR+C+   + +++IF    D P+ +   I+ C   +V +GD LP  IC PC      ++ 
Sbjct  5    CRVCLASSKNMVNIFEERQDLPVSIAHMIIECTGFKVEKGDSLPHSICPPCVKDAHNAFT  64

Query  82   FRKKCESSDMKLRQHLRELREKIGEEE  108
              K  E S     Q   E+++ + EEE
Sbjct  65   IIKTYERS----YQVFYEVQDTVLEEE  87



Lambda      K        H
   0.320    0.135    0.434 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3573877230


Query= XP_018560792.1 zinc finger and SCAN domain-containing protein 2-like
isoform X2 [Anoplophora glabripennis]

Length=378
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

R9PY35_DROME  unnamed protein product                                 125     8e-33
M9PCY3_DROME  unnamed protein product                                 127     8e-32
Q95RQ8_DROME  unnamed protein product                                 127     8e-32
Q9W1N1_DROME  unnamed protein product                                 126     1e-31
Q9VR05_DROME  unnamed protein product                                 122     1e-31


>R9PY35_DROME unnamed protein product
Length=345

 Score = 125 bits (315),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 95/315 (30%), Positives = 145/315 (46%), Gaps = 44/315 (14%)

Query  71   DNDPESITLPPETD--EAIKEACTLKSSDQLKTEIEET---EEADNVFIIE--DTEHQVM  123
            D+ P SI  P   D   A     T + S Q+  E+++T   EE     IIE  D++  ++
Sbjct  45   DSLPHSICPPCVKDAHNAFTIIKTYERSYQVFYEVQDTVLEEELSEDVIIELSDSDEVIL  104

Query  124  DDNNMNAIADAVKATLASQPGLNLSGQLQLKVNQSDGKS-------TQVEVTTEDGSVIV  176
             D       + V  +    P   +S Q + K  QSD  S       TQ  ++     ++ 
Sbjct  105  IDEQ----EEKVHLSENKAPTNEVSTQEESKTAQSDNVSEDKGHICTQCHMSFRRPGLLE  160

Query  177  MELMTEEESDISSIFSPSPAADVNEDGELKIFRCPDCPKSFARRIQLRRHASVHMQQRGF  236
            + ++    +D      P P +  +E                A + +LR  A    +    
Sbjct  161  LHILRHHTTD-----GPRPMSSTSE---------------HAVKEELRTKARQLSRNSTH  200

Query  237  SCGICEKWFPTRSALVRHERIHTGERPFQCEVCQKSFAQKEILYRHLMTHTGQKPYSCPH  296
            +C +C K F ++++ VRH++ HTGE+PF CE+CQK FA    + RHL THTG++P+ C  
Sbjct  201  TCRLCNKTFCSKASCVRHQKTHTGEKPFACEICQKPFADLASVKRHLRTHTGERPFKCLT  260

Query  297  CPKGFTQKEPLRVHIRTHLGNSPSDIQLHYCSLCPKVFCHASGLSRHLVTHTG-KMFKCR  355
            C   F+    LR HIR H G  P     + C +C K F   S   +H+++HT  K FKC 
Sbjct  261  CQSAFSDGSALRQHIRIHTGERP-----YKCDMCDKFFRERSDARKHMMSHTAEKRFKCS  315

Query  356  DCDKSFTDKSSLRRH  370
             C++ F     LRRH
Sbjct  316  QCERRFRQPKGLRRH  330


 Score = 94.7 bits (234),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 63/107 (59%), Gaps = 0/107 (0%)

Query  206  KIFRCPDCPKSFARRIQLRRHASVHMQQRGFSCGICEKWFPTRSALVRHERIHTGERPFQ  265
            K F C  C K FA    ++RH   H  +R F C  C+  F   SAL +H RIHTGERP++
Sbjct  226  KPFACEICQKPFADLASVKRHLRTHTGERPFKCLTCQSAFSDGSALRQHIRIHTGERPYK  285

Query  266  CEVCQKSFAQKEILYRHLMTHTGQKPYSCPHCPKGFTQKEPLRVHIR  312
            C++C K F ++    +H+M+HT +K + C  C + F Q + LR H++
Sbjct  286  CDMCDKFFRERSDARKHMMSHTAEKRFKCSQCERRFRQPKGLRRHVK  332


 Score = 56.2 bits (134),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 46/89 (52%), Gaps = 7/89 (8%)

Query  292  YSCPHCPKGFTQKEPLRVHIRTHLGNSPSDIQLHYCSLCPKVFCHASGLSRHLVTHTG-K  350
            ++C  C K F  K     H +TH G  P       C +C K F   + + RHL THTG +
Sbjct  200  HTCRLCNKTFCSKASCVRHQKTHTGEKP-----FACEICQKPFADLASVKRHLRTHTGER  254

Query  351  MFKCRDCDKSFTDKSSLRRH-HLQTNHQP  378
             FKC  C  +F+D S+LR+H  + T  +P
Sbjct  255  PFKCLTCQSAFSDGSALRQHIRIHTGERP  283


>M9PCY3_DROME unnamed protein product
Length=878

 Score = 127 bits (319),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 93/178 (52%), Gaps = 10/178 (6%)

Query  198  DVNEDGELKI----FRCPDCPKSFARRIQLRRHASVHMQQRGFSCGICEKWFPTRSALVR  253
            D+   G++ I    F C  C   FA    L RH   H   + F+C IC+K F  +  L  
Sbjct  263  DLTRHGKIHIGGPMFTCIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDN  322

Query  254  HERIHTGERPFQCEVCQKSFAQKEILYRHLMTHTGQKPYSCPHCPKGFTQKEPLRVHIRT  313
            H R HTGE PF+C+ C K+F +KE +  H+  HTG+ P+ C  C K FT+KE L  H+R 
Sbjct  323  HFRSHTGETPFRCQYCAKTFTRKEHMVNHVRKHTGETPHRCDFCSKTFTRKEHLLNHVRQ  382

Query  314  HLGNSPSDIQLHYCSLCPKVFCHASGLSRHLVTHTGKM-FKCRDCDKSFTDKSSLRRH  370
            H G SP     H CS C K F     L  H+  HTG+  FKC  C K+FT K  +  H
Sbjct  383  HTGESP-----HRCSYCMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTRKDHMVNH  435


 Score = 122 bits (305),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 86/163 (53%), Gaps = 6/163 (4%)

Query  209  RCPDCPKSFARRIQLRRHASVHMQQRGFSCGICEKWFPTRSALVRHERIHTGERPFQCEV  268
            RC  C K+F R+  L  H   H  +    C  C K F  +  LV H R HTGE PF+C  
Sbjct  362  RCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGETPFKCTY  421

Query  269  CQKSFAQKEILYRHLMTHTGQKPYSCPHCPKGFTQKEPLRVHIRTHLGNSPSDIQLHYCS  328
            C K+F +K+ +  H+  HTG+ P+ C +C K FT+KE L  H+R H G+SP     H CS
Sbjct  422  CTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSP-----HRCS  476

Query  329  LCPKVFCHASGLSRHLVTHTGKM-FKCRDCDKSFTDKSSLRRH  370
             C K F     L+ H+  HTG    KC  C K+FT K  L  H
Sbjct  477  YCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNH  519


 Score = 119 bits (298),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 64/168 (38%), Positives = 90/168 (54%), Gaps = 6/168 (4%)

Query  204  ELKIFRCPDCPKSFARRIQLRRHASVHMQQRGFSCGICEKWFPTRSALVRHERIHTGERP  263
            E K F C  C + F     L RH  +H+    F+C +C   F   ++L RH + H+ ++P
Sbjct  245  ERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTCIVCFNVFANNTSLERHMKRHSTDKP  304

Query  264  FQCEVCQKSFAQKEILYRHLMTHTGQKPYSCPHCPKGFTQKEPLRVHIRTHLGNSPSDIQ  323
            F C +CQK+FA+KE L  H  +HTG+ P+ C +C K FT+KE +  H+R H G +P    
Sbjct  305  FACTICQKTFARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEHMVNHVRKHTGETP----  360

Query  324  LHYCSLCPKVFCHASGLSRHLVTHTGKM-FKCRDCDKSFTDKSSLRRH  370
             H C  C K F     L  H+  HTG+   +C  C K+FT K  L  H
Sbjct  361  -HRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNH  407


 Score = 119 bits (297),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 63/164 (38%), Positives = 85/164 (52%), Gaps = 6/164 (4%)

Query  208  FRCPDCPKSFARRIQLRRHASVHMQQRGFSCGICEKWFPTRSALVRHERIHTGERPFQCE  267
            FRC  C K+F R+  +  H   H  +    C  C K F  +  L+ H R HTGE P +C 
Sbjct  333  FRCQYCAKTFTRKEHMVNHVRKHTGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCS  392

Query  268  VCQKSFAQKEILYRHLMTHTGQKPYSCPHCPKGFTQKEPLRVHIRTHLGNSPSDIQLHYC  327
             C K+F +KE L  H+  HTG+ P+ C +C K FT+K+ +  H+R H G SP     H C
Sbjct  393  YCMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTRKDHMVNHVRQHTGESP-----HKC  447

Query  328  SLCPKVFCHASGLSRHLVTHTGKM-FKCRDCDKSFTDKSSLRRH  370
            + C K F     L+ H+  HTG    +C  C K+FT K  L  H
Sbjct  448  TYCTKTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNH  491


 Score = 107 bits (266),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 62/165 (38%), Positives = 85/165 (52%), Gaps = 7/165 (4%)

Query  208  FRCPDCPKSFARRIQLRRHASVHMQQRGFSCGICEKWFPTRSALVRHERIHTGERPFQCE  267
            F+C  C K+F R+  +  H   H  +    C  C K F  +  L  H R HTG+ P +C 
Sbjct  417  FKCTYCTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPHRCS  476

Query  268  VCQKSFAQKEILYRHLMTHTGQKPYSCPHCPKGFTQKEPLRVHIRTHLGNSPSDIQLHYC  327
             C+K+F +KE L  H+  HTG  P+ C +C K FT+KE L  H+R H  ++P     H C
Sbjct  477  YCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNP-----HCC  531

Query  328  SLCPKVFCHASGLSRHLV-THTG-KMFKCRDCDKSFTDKSSLRRH  370
            ++C K F     L  H+   HTG + F C  C KSF  K +L  H
Sbjct  532  NVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFH  576


 Score = 101 bits (251),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 78/162 (48%), Gaps = 6/162 (4%)

Query  210  CPDCPKSFARRIQLRRHASVHMQQRGFSCGICEKWFPTRSALVRHERIHTGERPFQCEVC  269
            C  C K F  R QL  H   H +++ F C +C + F T   L RH +IH G   F C VC
Sbjct  223  CDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTCIVC  282

Query  270  QKSFAQKEILYRHLMTHTGQKPYSCPHCPKGFTQKEPLRVHIRTHLGNSPSDIQLHYCSL  329
               FA    L RH+  H+  KP++C  C K F +KE L  H R+H G +P       C  
Sbjct  283  FNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFR-----CQY  337

Query  330  CPKVFCHASGLSRHLVTHTGKM-FKCRDCDKSFTDKSSLRRH  370
            C K F     +  H+  HTG+   +C  C K+FT K  L  H
Sbjct  338  CAKTFTRKEHMVNHVRKHTGETPHRCDFCSKTFTRKEHLLNH  379


 Score = 98.6 bits (244),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 64/197 (32%), Positives = 92/197 (47%), Gaps = 30/197 (15%)

Query  209  RCPDCPKSFARRIQLRRHASVHMQQRGFSCGICEKWFPTRSALVRHERIHTGERPFQCEV  268
            +C  C K+F R+  L  H   H       C  C+K F  +  L  H R+HTG+ P +CE 
Sbjct  446  KCTYCTKTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRLHTGDSPHKCEY  505

Query  269  CQKSFAQKEILYRHLMTHTGQKPYSCPHCPKGFTQKEPLRVHI-RTHLGNSP--------  319
            CQK+F +KE L  H+  H+   P+ C  C K FT+KE L  H+ R H G+ P        
Sbjct  506  CQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGK  565

Query  320  -----SDIQLH--------------YCSLCPKVFCHASGLSRHLVTHTG-KMFKCRDCDK  359
                  ++  H               C  CPK F     L  H+ +H+G K   C  C K
Sbjct  566  SFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSK  625

Query  360  SFTDKSSLRRHHLQTNH  376
            +F ++ +L+R H++ NH
Sbjct  626  AFVERGNLKR-HMKMNH  641


 Score = 36.6 bits (83),  Expect = 0.032, Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 0/50 (0%)

Query  208  FRCPDCPKSFARRIQLRRHASVHMQQRGFSCGICEKWFPTRSALVRHERI  257
            F C  CPK+F  +  L  H   H  ++  +C +C K F  R  L RH ++
Sbjct  590  FACEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSKAFVERGNLKRHMKM  639


>Q95RQ8_DROME unnamed protein product
Length=683

 Score = 127 bits (318),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 62/165 (38%), Positives = 89/165 (54%), Gaps = 6/165 (4%)

Query  207  IFRCPDCPKSFARRIQLRRHASVHMQQRGFSCGICEKWFPTRSALVRHERIHTGERPFQC  266
            +F CPDC +SF  +  L  H   H + R F C +CEK F ++  L +H  +HTGERPF+C
Sbjct  285  VFPCPDCERSFPLQQLLEIHRLNHTRSRSFQCLLCEKSFFSKYDLAKHNFVHTGERPFKC  344

Query  267  EVCQKSFAQKEILYRHLMTHTGQKPYSCPHCPKGFTQKEPLRVHIRTHLGNSPSDIQLHY  326
             +C K+F +K +L+RH  THT    + C +C K F  ++ +  H   H    P       
Sbjct  345  AICSKAFTRKALLHRHERTHTDVPKFICVYCEKPFLSRQEMEKHAERHQKKRPFQ-----  399

Query  327  CSLCPKVFCHASGLSRHLVTHTGKM-FKCRDCDKSFTDKSSLRRH  370
            C +C K F    GL RH   H+  + F C+ C++SF+  S L RH
Sbjct  400  CGVCTKSFAFKQGLERHETVHSTNLPFPCQHCERSFSTASKLARH  444


 Score = 112 bits (280),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 62/168 (37%), Positives = 84/168 (50%), Gaps = 8/168 (5%)

Query  208  FRCPDCPKSFARRIQLRRHASVHMQQRGFSCGICEKWFPTRSALVRHERIHTGERPFQCE  267
            F+C  C K+F R+  L RH   H     F C  CEK F +R  + +H   H  +RPFQC 
Sbjct  342  FKCAICSKAFTRKALLHRHERTHTDVPKFICVYCEKPFLSRQEMEKHAERHQKKRPFQCG  401

Query  268  VCQKSFAQKEILYRHLMTHTGQKPYSCPHCPKGFTQKEPLRVHIRTHLGNSPSDIQLHYC  327
            VC KSFA K+ L RH   H+   P+ C HC + F+    L  H+  H G      + + C
Sbjct  402  VCTKSFAFKQGLERHETVHSTNLPFPCQHCERSFSTASKLARHLVAHAGK-----RAYPC  456

Query  328  SLCPKVFCHASGLSRHLVTHT---GKMFKCRDCDKSFTDKSSLRRHHL  372
              C K +  +  LSRHL THT      F C +C  S+++ + L  H L
Sbjct  457  KYCHKSYMLSHHLSRHLRTHTQTSDASFVCSECKVSYSNYNDLLDHAL  504


 Score = 110 bits (276),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/163 (34%), Positives = 81/163 (50%), Gaps = 3/163 (2%)

Query  208  FRCPDCPKSFARRIQLRRHASVHMQQRGFSCGICEKWFPTRSALVRHERIHTGERPFQCE  267
            F C  C K F  R ++ +HA  H ++R F CG+C K F  +  L RHE +H+   PF C+
Sbjct  370  FICVYCEKPFLSRQEMEKHAERHQKKRPFQCGVCTKSFAFKQGLERHETVHSTNLPFPCQ  429

Query  268  VCQKSFAQKEILYRHLMTHTGQKPYSCPHCPKGFTQKEPLRVHIRTHLGNSPSDIQLHYC  327
             C++SF+    L RHL+ H G++ Y C +C K +     L  H+RTH   S +      C
Sbjct  430  HCERSFSTASKLARHLVAHAGKRAYPCKYCHKSYMLSHHLSRHLRTHTQTSDASF---VC  486

Query  328  SLCPKVFCHASGLSRHLVTHTGKMFKCRDCDKSFTDKSSLRRH  370
            S C   + + + L  H + H     KC  C K   D  S+  H
Sbjct  487  SECKVSYSNYNDLLDHALIHATASLKCPMCRKQIEDIDSVESH  529


 Score = 42.0 bits (97),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 30/133 (23%), Positives = 48/133 (36%), Gaps = 29/133 (22%)

Query  208  FRCPDCPKSFARRIQLRRHASVHMQQRGFSCGICEKWFPTRSALVRHERIHT--------  259
            F C  C +SF+   +L RH   H  +R + C  C K +     L RH R HT        
Sbjct  426  FPCQHCERSFSTASKLARHLVAHAGKRAYPCKYCHKSYMLSHHLSRHLRTHTQTSDASFV  485

Query  260  ---------------------GERPFQCEVCQKSFAQKEILYRHLMTHTGQKPYSCPHCP  298
                                      +C +C+K     + +  H+  H   + ++C  C 
Sbjct  486  CSECKVSYSNYNDLLDHALIHATASLKCPMCRKQIEDIDSVESHMDQHKQSERHACEFCD  545

Query  299  KGFTQKEPLRVHI  311
              F  ++ L+ HI
Sbjct  546  HIFLTQKCLQRHI  558


>Q9W1N1_DROME unnamed protein product
Length=623

 Score = 126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/165 (38%), Positives = 89/165 (54%), Gaps = 6/165 (4%)

Query  207  IFRCPDCPKSFARRIQLRRHASVHMQQRGFSCGICEKWFPTRSALVRHERIHTGERPFQC  266
            +F CPDC +SF  +  L  H   H + R F C +CEK F ++  L +H  +HTGERPF+C
Sbjct  225  VFPCPDCERSFPLQQLLEIHRLNHTRSRSFQCLLCEKSFFSKYDLAKHNFVHTGERPFKC  284

Query  267  EVCQKSFAQKEILYRHLMTHTGQKPYSCPHCPKGFTQKEPLRVHIRTHLGNSPSDIQLHY  326
             +C K+F +K +L+RH  THT    + C +C K F  ++ +  H   H    P       
Sbjct  285  AICSKAFTRKALLHRHERTHTDVPKFICVYCEKPFLSRQEMEKHAERHQKKRPFQ-----  339

Query  327  CSLCPKVFCHASGLSRHLVTHTGKM-FKCRDCDKSFTDKSSLRRH  370
            C +C K F    GL RH   H+  + F C+ C++SF+  S L RH
Sbjct  340  CGVCTKSFAFKQGLERHETVHSTNLPFPCQHCERSFSTASKLARH  384


 Score = 111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/168 (37%), Positives = 84/168 (50%), Gaps = 8/168 (5%)

Query  208  FRCPDCPKSFARRIQLRRHASVHMQQRGFSCGICEKWFPTRSALVRHERIHTGERPFQCE  267
            F+C  C K+F R+  L RH   H     F C  CEK F +R  + +H   H  +RPFQC 
Sbjct  282  FKCAICSKAFTRKALLHRHERTHTDVPKFICVYCEKPFLSRQEMEKHAERHQKKRPFQCG  341

Query  268  VCQKSFAQKEILYRHLMTHTGQKPYSCPHCPKGFTQKEPLRVHIRTHLGNSPSDIQLHYC  327
            VC KSFA K+ L RH   H+   P+ C HC + F+    L  H+  H G      + + C
Sbjct  342  VCTKSFAFKQGLERHETVHSTNLPFPCQHCERSFSTASKLARHLVAHAGK-----RAYPC  396

Query  328  SLCPKVFCHASGLSRHLVTHT---GKMFKCRDCDKSFTDKSSLRRHHL  372
              C K +  +  LSRHL THT      F C +C  S+++ + L  H L
Sbjct  397  KYCHKSYMLSHHLSRHLRTHTQTSDASFVCSECKVSYSNYNDLLDHAL  444


 Score = 110 bits (275),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 56/163 (34%), Positives = 81/163 (50%), Gaps = 3/163 (2%)

Query  208  FRCPDCPKSFARRIQLRRHASVHMQQRGFSCGICEKWFPTRSALVRHERIHTGERPFQCE  267
            F C  C K F  R ++ +HA  H ++R F CG+C K F  +  L RHE +H+   PF C+
Sbjct  310  FICVYCEKPFLSRQEMEKHAERHQKKRPFQCGVCTKSFAFKQGLERHETVHSTNLPFPCQ  369

Query  268  VCQKSFAQKEILYRHLMTHTGQKPYSCPHCPKGFTQKEPLRVHIRTHLGNSPSDIQLHYC  327
             C++SF+    L RHL+ H G++ Y C +C K +     L  H+RTH   S +      C
Sbjct  370  HCERSFSTASKLARHLVAHAGKRAYPCKYCHKSYMLSHHLSRHLRTHTQTSDASF---VC  426

Query  328  SLCPKVFCHASGLSRHLVTHTGKMFKCRDCDKSFTDKSSLRRH  370
            S C   + + + L  H + H     KC  C K   D  S+  H
Sbjct  427  SECKVSYSNYNDLLDHALIHATASLKCPMCRKQIEDIDSVESH  469


 Score = 42.0 bits (97),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 30/133 (23%), Positives = 48/133 (36%), Gaps = 29/133 (22%)

Query  208  FRCPDCPKSFARRIQLRRHASVHMQQRGFSCGICEKWFPTRSALVRHERIHT--------  259
            F C  C +SF+   +L RH   H  +R + C  C K +     L RH R HT        
Sbjct  366  FPCQHCERSFSTASKLARHLVAHAGKRAYPCKYCHKSYMLSHHLSRHLRTHTQTSDASFV  425

Query  260  ---------------------GERPFQCEVCQKSFAQKEILYRHLMTHTGQKPYSCPHCP  298
                                      +C +C+K     + +  H+  H   + ++C  C 
Sbjct  426  CSECKVSYSNYNDLLDHALIHATASLKCPMCRKQIEDIDSVESHMDQHKQSERHACEFCD  485

Query  299  KGFTQKEPLRVHI  311
              F  ++ L+ HI
Sbjct  486  HIFLTQKCLQRHI  498


>Q9VR05_DROME unnamed protein product
Length=346

 Score = 122 bits (307),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/180 (38%), Positives = 93/180 (52%), Gaps = 6/180 (3%)

Query  197  ADVNEDGELKIFRCPDCPKSFARRIQLRRHASVHMQQRGFSCGICEKWFPTRSALVRHER  256
            A +      K + C  C K+FA++  L+ H   H  +R F C  C K F   S L RH R
Sbjct  171  AHMKTHNAAKPYECSHCAKTFAQQSTLQSHERTHTGERPFKCSQCSKTFIKSSDLRRHIR  230

Query  257  IHTGERPFQCEVCQKSFAQKEILYRHLMTHTGQKPYSCPHCPKGFTQKEPLRVHIRTHLG  316
             H  ERPF+C  C K+F +K  L  H  +HTG++P+ C HCPK F  K+ L+ H R HL 
Sbjct  231  THGSERPFKCSKCTKTFTRKFHLDNHFRSHTGERPFKCSHCPKAFAMKQHLKQHSRLHLP  290

Query  317  NSPSDIQLHYCSLCPKVFCHASGLSRHLVTHTG-KMFKCRDCDKSFTDKSSLRRHHLQTN  375
            + P       CS CPK F  +S L  H + H   + FKC  C   +  + +L RH L+ +
Sbjct  291  DRPFR-----CSHCPKTFRLSSTLKEHKLVHNAERTFKCPHCASFYKQRKTLARHILEIH  345


 Score = 121 bits (304),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 77/225 (34%), Positives = 108/225 (48%), Gaps = 14/225 (6%)

Query  155  VNQSDGKSTQVEVTTEDGSV--IVMELMTEEESDIS-----SIFSPSPAADVNEDGELKI  207
            + Q+  +S Q      D  +   +  L+ EE+ +IS      I S S A D  +    K+
Sbjct  65   IRQTCEESHQFYCRVRDEGIEDALCALLEEEDWEISEDEDARIDSASAADDDGKSDSKKV  124

Query  208  -FRCPDCPKSFARRIQLRRHASVHMQQRGFSCGICEKWFPTRSALVRHERIHTGERPFQC  266
             F C +C K + R+    RH   HM  + F C  C++ F  R  L  H + H   +P++C
Sbjct  125  AFECRECHKKYQRKGTFLRHMRTHMDGQSFPCPYCKRNFRLRVTLKAHMKTHNAAKPYEC  184

Query  267  EVCQKSFAQKEILYRHLMTHTGQKPYSCPHCPKGFTQKEPLRVHIRTHLGNSPSDIQLHY  326
              C K+FAQ+  L  H  THTG++P+ C  C K F +   LR HIRTH    P       
Sbjct  185  SHCAKTFAQQSTLQSHERTHTGERPFKCSQCSKTFIKSSDLRRHIRTHGSERPFK-----  239

Query  327  CSLCPKVFCHASGLSRHLVTHTG-KMFKCRDCDKSFTDKSSLRRH  370
            CS C K F     L  H  +HTG + FKC  C K+F  K  L++H
Sbjct  240  CSKCTKTFTRKFHLDNHFRSHTGERPFKCSHCPKAFAMKQHLKQH  284


 Score = 120 bits (302),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 66/169 (39%), Positives = 88/169 (52%), Gaps = 6/169 (4%)

Query  208  FRCPDCPKSFARRIQLRRHASVHMQQRGFSCGICEKWFPTRSALVRHERIHTGERPFQCE  267
            F CP C ++F  R+ L+ H   H   + + C  C K F  +S L  HER HTGERPF+C 
Sbjct  154  FPCPYCKRNFRLRVTLKAHMKTHNAAKPYECSHCAKTFAQQSTLQSHERTHTGERPFKCS  213

Query  268  VCQKSFAQKEILYRHLMTHTGQKPYSCPHCPKGFTQKEPLRVHIRTHLGNSPSDIQLHYC  327
             C K+F +   L RH+ TH  ++P+ C  C K FT+K  L  H R+H G  P       C
Sbjct  214  QCSKTFIKSSDLRRHIRTHGSERPFKCSKCTKTFTRKFHLDNHFRSHTGERPFK-----C  268

Query  328  SLCPKVFCHASGLSRHLVTHT-GKMFKCRDCDKSFTDKSSLRRHHLQTN  375
            S CPK F     L +H   H   + F+C  C K+F   S+L+ H L  N
Sbjct  269  SHCPKAFAMKQHLKQHSRLHLPDRPFRCSHCPKTFRLSSTLKEHKLVHN  317



Lambda      K        H
   0.320    0.135    0.434 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3573877230


Query= XP_018560793.1 cathepsin L1-like [Anoplophora glabripennis]

Length=402
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CATL_DROME  unnamed protein product                                   351     3e-119
O45734_CAEEL  unnamed protein product                                 307     2e-102
CRUST_PANBO  unnamed protein product                                  255     2e-82 
H9G333_CAEEL  unnamed protein product                                 247     6e-81 
CYSP2_DICDI  unnamed protein product                                  223     5e-69 


>CATL_DROME unnamed protein product
Length=371

 Score = 351 bits (901),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 165/322 (51%), Positives = 225/322 (70%), Gaps = 6/322 (2%)

Query  84   ELVEEEWKEFKLAFRKVYATEEVEKLRKEIFIENRAKIARFNQDFSQGHKNFVQRINAFG  143
            ++V EEW  FKL  RK Y  E  E+ R +IF EN+ KIA+ NQ F++G  +F   +N + 
Sbjct  53   DVVMEEWHTFKLEHRKNYQDETEERFRLKIFNENKHKIAKHNQRFAEGKVSFKLAVNKYA  112

Query  144  DMLSHEFNANVNGFNRSTVSQQTAAVDTS---STFIPSANVPFPESIDWRQLGAVSSVKN  200
            D+L HEF   +NGFN  T+ +Q  A D S    TFI  A+V  P+S+DWR  GAV++VK+
Sbjct  113  DLLHHEFRQLMNGFNY-TLHKQLRAADESFKGVTFISPAHVTLPKSVDWRTKGAVTAVKD  171

Query  201  QQMCAGCWAYAAAGALEGQQFRKTGKLTEISVQNLLDCTRPYGNEGCEGGLMDPAFQYIK  260
            Q  C  CWA+++ GALEGQ FRK+G L  +S QNL+DC+  YGN GC GGLMD AF+YIK
Sbjct  172  QGHCGSCWAFSSTGALEGQHFRKSGVLVSLSEQNLVDCSTKYGNNGCNGGLMDNAFRYIK  231

Query  261  DNKGVDGEESYPLEGTENKCRFRRDAAVATTTGFVDIAQGDEKGLEIAVATLGPVTAAID  320
            DN G+D E+SYP E  ++ C F +    AT  GF DI QGDEK +  AVAT+GPV+ AID
Sbjct  232  DNGGIDTEKSYPYEAIDDSCHFNKGTVGATDRGFTDIPQGDEKKMAEAVATVGPVSVAID  291

Query  321  ASRDTLQFYSDGVYYDPECGSKPEEMNHAVLIVGYGVEPNGQKYWLVKNSYGSEWGIGGY  380
            AS ++ QFYS+GVY +P+C +  + ++H VL+VG+G + +G+ YWLVKNS+G+ WG  G+
Sbjct  292  ASHESFQFYSEGVYNEPQCDA--QNLDHGVLVVGFGTDESGEDYWLVKNSWGTTWGDKGF  349

Query  381  IKMIKDVGNHCGIATQASFPLV  402
            IKM+++  N CGIA+ +S+PLV
Sbjct  350  IKMLRNKENQCGIASASSYPLV  371


>O45734_CAEEL unnamed protein product
Length=337

 Score = 307 bits (786),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 148/315 (47%), Positives = 201/315 (64%), Gaps = 7/315 (2%)

Query  88   EEWKEFKLAFRKVYATEEVEKLRKEIFIENRAKIARFNQDFSQGHKNFVQRINAFGDMLS  147
            E+W ++K  F K Y+  E E+   E F++N   I   N+D   G K F   +N   D+  
Sbjct  30   EKWDDYKEDFDKEYSESE-EQTYMEAFVKNMIHIENHNRDHRLGRKTFEMGLNHIADLPF  88

Query  148  HEFNANVNGFNRSTVSQQTAAVDTSSTFIPSANVPFPESIDWRQLGAVSSVKNQQMCAGC  207
             ++   +NG+ R     +   +  SS+F+   NV  P+ +DWR    V+ VKNQ MC  C
Sbjct  89   SQYRK-LNGYRRLFGDSR---IKNSSSFLAPFNVQVPDEVDWRDTHLVTDVKNQGMCGSC  144

Query  208  WAYAAAGALEGQQFRKTGKLTEISVQNLLDCTRPYGNEGCEGGLMDPAFQYIKDNKGVDG  267
            WA++A GALEGQ  RK G+L  +S QNL+DC+  YGN GC GGLMD AF+YI+DN GVD 
Sbjct  145  WAFSATGALEGQHARKLGQLVSLSEQNLVDCSTKYGNHGCNGGLMDQAFEYIRDNHGVDT  204

Query  268  EESYPLEGTENKCRFRRDAAVATTTGFVDIAQGDEKGLEIAVATLGPVTAAIDASRDTLQ  327
            EESYP +G + KC F +    A   G+VD  +GDE+ L+IAVAT GP++ AIDA   + Q
Sbjct  205  EESYPYKGRDMKCHFNKKTVGADDKGYVDTPEGDEEQLKIAVATQGPISIAIDAGHRSFQ  264

Query  328  FYSDGVYYDPECGSKPEEMNHAVLIVGYGVEPNGQKYWLVKNSYGSEWGIGGYIKMIKDV  387
             Y  GVYYD EC S  EE++H VL+VGYG +P    YW+VKNS+G+ WG  GYI++ ++ 
Sbjct  265  LYKKGVYYDEECSS--EELDHGVLLVGYGTDPEHGDYWIVKNSWGAGWGEKGYIRIARNR  322

Query  388  GNHCGIATQASFPLV  402
             NHCG+AT+AS+PLV
Sbjct  323  NNHCGVATKASYPLV  337


>CRUST_PANBO unnamed protein product
Length=323

 Score = 255 bits (652),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/314 (41%), Positives = 174/314 (55%), Gaps = 9/314 (3%)

Query  89   EWKEFKLAFRKVYATEEVEKLRKEIFIENRAKIARFNQDFSQGHKNFVQRINAFGDMLSH  148
            EW+ FK  F K YA  E E  R  +F++    I   N+ + +G   +  +IN F D+   
Sbjct  19   EWENFKTKFGKKYANSEEESHRMSVFMDKLKFIQEHNERYDKGEVTYWLKINNFSDLTHE  78

Query  149  EFNANVNGFNRSTVSQQTAAVDTSSTFIPSANVPFPESIDWRQLGAVSSVKNQQMCAGCW  208
            E  A   G  R             +T       P    +DWR  GAV+ VK+Q  C  CW
Sbjct  79   EVLATKTGMTRRRHPLSVLPKSAPTT-------PMAADVDWRNKGAVTPVKDQGQCGSCW  131

Query  209  AYAAAGALEGQQFRKTGKLTEISVQNLLDCTRPYGNEGCEGGLMDPAFQYIKDNKGVDGE  268
            A++A  ALEG  F KTG L  +S QNL+DC+  YGN+GC GG    A+QYI  N+G+D E
Sbjct  132  AFSAVAALEGAHFLKTGDLVSLSEQNLVDCSSSYGNQGCNGGWPYQAYQYIIANRGIDTE  191

Query  269  ESYPLEGTENKCRFRRDAAVATTTGFVDIAQGDEKGLEIAVATLGPVTAAIDASRDTLQF  328
             SYP +  ++ CR+      AT + +V+ A GDE  L+ AV   GPV+  IDA + +   
Sbjct  192  SSYPYKAIDDNCRYDAGNIGATVSSYVEPASGDESALQHAVQNEGPVSVCIDAGQSSFGS  251

Query  329  YSDGVYYDPECGSKPEEMNHAVLIVGYGVEPNGQKYWLVKNSYGSEWGIGGYIKMIKDVG  388
            Y  GVYY+P C S     NHAV  VGYG + NG  YW+VKNS+G+ WG  GYIKM ++  
Sbjct  252  YGGGVYYEPNCDS--WYANHAVTAVGYGTDANGGDYWIVKNSWGAWWGESGYIKMARNRD  309

Query  389  NHCGIATQASFPLV  402
            N+C IAT + +P+V
Sbjct  310  NNCAIATYSVYPVV  323


>H9G333_CAEEL unnamed protein product
Length=198

 Score = 247 bits (630),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 112/200 (56%), Positives = 144/200 (72%), Gaps = 2/200 (1%)

Query  203  MCAGCWAYAAAGALEGQQFRKTGKLTEISVQNLLDCTRPYGNEGCEGGLMDPAFQYIKDN  262
            MC  CWA++A GALEGQ  RK G+L  +S QNL+DC+  YGN GC GGLMD AF+YI+DN
Sbjct  1    MCGSCWAFSATGALEGQHARKLGQLVSLSEQNLVDCSTKYGNHGCNGGLMDQAFEYIRDN  60

Query  263  KGVDGEESYPLEGTENKCRFRRDAAVATTTGFVDIAQGDEKGLEIAVATLGPVTAAIDAS  322
             GVD EESYP +G + KC F +    A   G+VD  +GDE+ L+IAVAT GP++ AIDA 
Sbjct  61   HGVDTEESYPYKGRDMKCHFNKKTVGADDKGYVDTPEGDEEQLKIAVATQGPISIAIDAG  120

Query  323  RDTLQFYSDGVYYDPECGSKPEEMNHAVLIVGYGVEPNGQKYWLVKNSYGSEWGIGGYIK  382
              + Q Y  GVYYD EC S  EE++H VL+VGYG +P    YW+VKNS+G+ WG  GYI+
Sbjct  121  HRSFQLYKKGVYYDEECSS--EELDHGVLLVGYGTDPEHGDYWIVKNSWGAGWGEKGYIR  178

Query  383  MIKDVGNHCGIATQASFPLV  402
            + ++  NHCG+AT+AS+PLV
Sbjct  179  IARNRNNHCGVATKASYPLV  198


>CYSP2_DICDI unnamed protein product
Length=376

 Score = 223 bits (567),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 129/354 (36%), Positives = 180/354 (51%), Gaps = 60/354 (17%)

Query  92   EFKLAFRKVYATEEVEKLRKEIFIENRAKIARFNQDFSQGHKNFVQRINAFGDMLSHEFN  151
            E+ L F + Y++ E    R  IF  N   +  +N   S+G    V  +N F D+ + E+ 
Sbjct  38   EWTLKFNRQYSSSEFSN-RYSIFKSNMDYVDNWN---SKGDSQTVLGLNNFADITNEEYR  93

Query  152  -------ANVNGFNRSTVSQQTAAVDTSSTFIPSANVPFPESIDWRQLGAVSSVKNQQMC  204
                    N + +N     +     D  +          P+SIDWR   AV+ +K+Q  C
Sbjct  94   KTYLGTRVNAHSYNGYDGREVLNVEDLQTN---------PKSIDWRTKNAVTPIKDQGQC  144

Query  205  AGCWAYAAAGALEGQQFRKTGKLTEISVQNLLDCTRPYGNEGCEGGLMDPAFQYIKDNKG  264
              CW+++  G+ EG    KT KL  +S QNL+DC+ P  N GC+GGLM+ AF YI  NKG
Sbjct  145  GSCWSFSTTGSTEGAHALKTKKLVSLSEQNLVDCSGPEENFGCDGGLMNNAFDYIIKNKG  204

Query  265  VDGEESYPLEG-TENKCRFRRDAAVATTTGFVDIAQGDEKGLEIAVATLGPVTAAIDASR  323
            +D E SYP    T + C F +    AT  G+V+I  G E  LE   A  GPV+ AIDAS 
Sbjct  205  IDTESSYPYTAETGSTCLFNKSDIGATIKGYVNITAGSEISLENG-AQHGPVSVAIDASH  263

Query  324  DTLQFYSDGVYYDPECGSKPEEMNHAVLIVGYGVE-------------------------  358
            ++ Q Y+ G+YY+P+C   P E++H VL+VGYGV+                         
Sbjct  264  NSFQLYTSGIYYEPKC--SPTELDHGVLVVGYGVQGKDDEGPVLNRKQTIVIHKNEDNKV  321

Query  359  -----------PNGQKYWLVKNSYGSEWGIGGYIKMIKDVGNHCGIATQASFPL  401
                       P    YW+VKNS+G+ WGI GYI M KD  N+CGIA+ +S+PL
Sbjct  322  ESSDDSSDSVRPKANNYWIVKNSWGTSWGIKGYILMSKDRKNNCGIASVSSYPL  375



Lambda      K        H
   0.320    0.135    0.434 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3573877230


Query= XP_018560794.1 uncharacterized protein LOC108903188 [Anoplophora
glabripennis]

Length=512
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TAF6_DROME  unnamed protein product                                   59.7    3e-09
M9PC25_DROME  unnamed protein product                                 41.6    0.001
Q9VPT4_DROME  unnamed protein product                                 41.6    0.001
CLCN2_DROME  unnamed protein product                                  30.4    4.8  


>TAF6_DROME unnamed protein product
Length=606

 Score = 59.7 bits (143),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 48/181 (27%), Positives = 87/181 (48%), Gaps = 18/181 (10%)

Query  54   AGISSDSICIYAEQSTYYGHLSEEVCNVLAEDINYKLRYIIHDALLKARLSGRDVINSRD  113
            + IS++S+ + AE S   G LS++    LAED++ KL+ I+ DA      + R  ++ RD
Sbjct  19   SSISAESMKVIAE-SIGVGSLSDDAAKELAEDVSIKLKRIVQDAAKFMNHAKRQKLSVRD  77

Query  114  IDETFQNLSIEKVYGATANPNWVPF-----GDQNLLYLDDTKINLIELAEEENTYVQQGN  168
            ID + +  ++E  YG  A  +++PF     G + L + +D +I+L E+    +  +   +
Sbjct  78   IDMSLKVRNVEPQYGFVAK-DFIPFRFASGGGRELHFTEDKEIDLGEITSTNSVKIPL-D  135

Query  169  IILQKSWY------PNLEESEPSPALKHYFTTICKSVVDSDEELRSMALKDISENPQVGA  222
            + L+  W+      P + E+ P  +           V+  D+ L     KD +  P  G 
Sbjct  136  LTLRSHWFVVEGVQPTVPENPPPLSKDSQLLDSVNPVIKMDQGLN----KDAAGKPTTGK  191

Query  223  I  223
            I
Sbjct  192  I  192


>M9PC25_DROME unnamed protein product
Length=714

 Score = 41.6 bits (96),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 34/110 (31%), Positives = 54/110 (49%), Gaps = 5/110 (5%)

Query  51   KQYAGISSDSICIYAEQSTYYG-HLSEEVCNVLAEDINYKLRYIIHDALLKARLSGRDVI  109
            K YAG    SI I+ EQ       LS++VC  LAED +YK+  +I++  + +R SG  V+
Sbjct  120  KSYAGFDPRSIKIFWEQHDQTDVELSQDVCARLAEDASYKVWELINNVKIYSRHSG-GVV  178

Query  110  NSRDIDETFQNLSIEKVYGATANPNWVPFGDQNLLYLDDTKINLIELAEE  159
                ++E  ++  +  + GA  + +W         Y    KI   EL+ E
Sbjct  179  TYDLVNEVLKDADVPPMLGAM-DSDWDRIDYDGSFYFHSDKI--FELSAE  225


>Q9VPT4_DROME unnamed protein product
Length=717

 Score = 41.6 bits (96),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 34/110 (31%), Positives = 54/110 (49%), Gaps = 5/110 (5%)

Query  51   KQYAGISSDSICIYAEQSTYYG-HLSEEVCNVLAEDINYKLRYIIHDALLKARLSGRDVI  109
            K YAG    SI I+ EQ       LS++VC  LAED +YK+  +I++  + +R SG  V+
Sbjct  123  KSYAGFDPRSIKIFWEQHDQTDVELSQDVCARLAEDASYKVWELINNVKIYSRHSG-GVV  181

Query  110  NSRDIDETFQNLSIEKVYGATANPNWVPFGDQNLLYLDDTKINLIELAEE  159
                ++E  ++  +  + GA  + +W         Y    KI   EL+ E
Sbjct  182  TYDLVNEVLKDADVPPMLGAM-DSDWDRIDYDGSFYFHSDKI--FELSAE  228


>CLCN2_DROME unnamed protein product
Length=1193

 Score = 30.4 bits (67),  Expect = 4.8, Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 39/88 (44%), Gaps = 17/88 (19%)

Query  329  LTAIYFLGIDAVREIFLPNIEYFLGKVKTTLDDDPEVINVVLSIYGLICK-ASYNYDFIH  387
            L A++F   D VR +FL N         T    DP+ +  V ++ GL+C     +Y ++H
Sbjct  372  LLAVWFQNADTVRALFLTNF-------TTEFPFDPQEL-FVFALIGLVCGLGGASYVWVH  423

Query  388  SAFHQIFGDILVMFWRPRSFTVKALEKD  415
              +        V+F R      K L+K+
Sbjct  424  RRY--------VLFMRSNKRMNKFLQKN  443



Lambda      K        H
   0.320    0.135    0.434 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3573877230


Query= XP_018560795.1 cathepsin L1-like [Anoplophora glabripennis]

Length=362
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CATL_DROME  unnamed protein product                                   270     3e-88
O45734_CAEEL  unnamed protein product                                 231     2e-73
CRUST_PANBO  unnamed protein product                                  209     4e-65
CATLL_FASHE  unnamed protein product                                  199     3e-61
CYSP2_DICDI  unnamed protein product                                  192     1e-57


>CATL_DROME unnamed protein product
Length=371

 Score = 270 bits (691),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 138/321 (43%), Positives = 207/321 (64%), Gaps = 12/321 (4%)

Query  51   VFLQDWLDFGTKFNKKY-NPVEAPLRKANFLQNIDTITKLA---TDSVLSFGLKINEFAD  106
            V +++W  F  +  K Y +  E   R   F +N   I K      +  +SF L +N++AD
Sbjct  54   VVMEEWHTFKLEHRKNYQDETEERFRLKIFNENKHKIAKHNQRFAEGKVSFKLAVNKYAD  113

Query  107  MLFDEFNELFNGFNR--NGQLRRHSQSSKAETFVPTAGESLPESVDWREKGAVSPVKNQQ  164
            +L  EF +L NGFN   + QLR   +S K  TF+  A  +LP+SVDWR KGAV+ VK+Q 
Sbjct  114  LLHHEFRQLMNGFNYTLHKQLRAADESFKGVTFISPAHVTLPKSVDWRTKGAVTAVKDQG  173

Query  165  QCAGCWAFSVAGCVEGQNARKTGKLEEASVQHLIDCATGRYDNDGCRGGLTETGFDFVED  224
             C  CWAFS  G +EGQ+ RK+G L   S Q+L+DC+T +Y N+GC GGL +  F +++D
Sbjct  174  HCGSCWAFSSTGALEGQHFRKSGVLVSLSEQNLVDCST-KYGNNGCNGGLMDNAFRYIKD  232

Query  225  N-GINSYSDYPYEAVNTSCRSKENTIAKT-QGYIRIPEGDEKALAQALAKFGPISTAIHV  282
            N GI++   YPYEA++ SC   + T+  T +G+  IP+GDEK +A+A+A  GP+S AI  
Sbjct  233  NGGIDTEKSYPYEAIDDSCHFNKGTVGATDRGFTDIPQGDEKKMAEAVATVGPVSVAIDA  292

Query  283  T-KNFQFYGEKIFDDPECRNTPDDLNHALLIVGYGKEADGRKFWLVKNSYGTTWGLDGYF  341
            + ++FQFY E ++++P+C     +L+H +L+VG+G +  G  +WLVKNS+GTTWG  G+ 
Sbjct  293  SHESFQFYSEGVYNEPQC--DAQNLDHGVLVVGFGTDESGEDYWLVKNSWGTTWGDKGFI  350

Query  342  KVAKDEGNKCGIATYARYPKV  362
            K+ +++ N+CGIA+ + YP V
Sbjct  351  KMLRNKENQCGIASASSYPLV  371


>O45734_CAEEL unnamed protein product
Length=337

 Score = 231 bits (589),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/326 (37%), Positives = 192/326 (59%), Gaps = 13/326 (4%)

Query  43   ANLEQLEKVFLQDWLDFGTKFNKKYNPVEAPLRKANFLQNIDTITKLATDSVL---SFGL  99
            A L +  +  ++ W D+   F+K+Y+  E       F++N+  I     D  L   +F +
Sbjct  19   AKLSRQIESAIEKWDDYKEDFDKEYSESEEQTYMEAFVKNMIHIENHNRDHRLGRKTFEM  78

Query  100  KINEFADMLFDEFNELFNGFNRNGQLRRHSQSSKAETFVPTAGESLPESVDWREKGAVSP  159
             +N  AD+ F ++ +L NG+ R   L   S+   + +F+      +P+ VDWR+   V+ 
Sbjct  79   GLNHIADLPFSQYRKL-NGYRR---LFGDSRIKNSSSFLAPFNVQVPDEVDWRDTHLVTD  134

Query  160  VKNQQQCAGCWAFSVAGCVEGQNARKTGKLEEASVQHLIDCATGRYDNDGCRGGLTETGF  219
            VKNQ  C  CWAFS  G +EGQ+ARK G+L   S Q+L+DC+T +Y N GC GGL +  F
Sbjct  135  VKNQGMCGSCWAFSATGALEGQHARKLGQLVSLSEQNLVDCST-KYGNHGCNGGLMDQAF  193

Query  220  DFVEDN-GINSYSDYPYEAVNTSCRSKENTI-AKTQGYIRIPEGDEKALAQALAKFGPIS  277
            +++ DN G+++   YPY+  +  C   + T+ A  +GY+  PEGDE+ L  A+A  GPIS
Sbjct  194  EYIRDNHGVDTEESYPYKGRDMKCHFNKKTVGADDKGYVDTPEGDEEQLKIAVATQGPIS  253

Query  278  TAIHV-TKNFQFYGEKIFDDPECRNTPDDLNHALLIVGYGKEADGRKFWLVKNSYGTTWG  336
             AI    ++FQ Y + ++ D EC  + ++L+H +L+VGYG + +   +W+VKNS+G  WG
Sbjct  254  IAIDAGHRSFQLYKKGVYYDEEC--SSEELDHGVLLVGYGTDPEHGDYWIVKNSWGAGWG  311

Query  337  LDGYFKVAKDEGNKCGIATYARYPKV  362
              GY ++A++  N CG+AT A YP V
Sbjct  312  EKGYIRIARNRNNHCGVATKASYPLV  337


>CRUST_PANBO unnamed protein product
Length=323

 Score = 209 bits (532),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 122/319 (38%), Positives = 175/319 (55%), Gaps = 21/319 (7%)

Query  53   LQDWLDFGTKFNKKY-NPVEAPLRKANFLQNIDTI---TKLATDSVLSFGLKINEFADML  108
            + +W +F TKF KKY N  E   R + F+  +  I    +      +++ LKIN F+D+ 
Sbjct  17   IGEWENFKTKFGKKYANSEEESHRMSVFMDKLKFIQEHNERYDKGEVTYWLKINNFSDLT  76

Query  109  FDEFNELFNGFNRNGQLRRHSQSSKAETFVPTAGESLPES--VDWREKGAVSPVKNQQQC  166
             +E      G  R    RRH  S      +P +  + P +  VDWR KGAV+PVK+Q QC
Sbjct  77   HEEVLATKTGMTR----RRHPLS-----VLPKSAPTTPMAADVDWRNKGAVTPVKDQGQC  127

Query  167  AGCWAFSVAGCVEGQNARKTGKLEEASVQHLIDCATGRYDNDGCRGGLTETGFDFVEDN-  225
              CWAFS    +EG +  KTG L   S Q+L+DC++  Y N GC GG     + ++  N 
Sbjct  128  GSCWAFSAVAALEGAHFLKTGDLVSLSEQNLVDCSS-SYGNQGCNGGWPYQAYQYIIANR  186

Query  226  GINSYSDYPYEAVNTSCRSKENTIAKT-QGYIRIPEGDEKALAQALAKFGPISTAIHVTK  284
            GI++ S YPY+A++ +CR     I  T   Y+    GDE AL  A+   GP+S  I   +
Sbjct  187  GIDTESSYPYKAIDDNCRYDAGNIGATVSSYVEPASGDESALQHAVQNEGPVSVCIDAGQ  246

Query  285  N-FQFYGEKIFDDPECRNTPDDLNHALLIVGYGKEADGRKFWLVKNSYGTTWGLDGYFKV  343
            + F  YG  ++ +P C +     NHA+  VGYG +A+G  +W+VKNS+G  WG  GY K+
Sbjct  247  SSFGSYGGGVYYEPNCDSWY--ANHAVTAVGYGTDANGGDYWIVKNSWGAWWGESGYIKM  304

Query  344  AKDEGNKCGIATYARYPKV  362
            A++  N C IATY+ YP V
Sbjct  305  ARNRDNNCAIATYSVYPVV  323


>CATLL_FASHE unnamed protein product
Length=326

 Score = 199 bits (507),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 109/312 (35%), Positives = 168/312 (54%), Gaps = 15/312 (5%)

Query  56   WLDFGTKFNKKYNPVEAPLRKANFLQNIDTITK--LATD-SVLSFGLKINEFADMLFDEF  112
            W  +   +NK+YN  +   R+  + +N+  I +  L  D  ++++ L +N+F DM F+EF
Sbjct  21   WHQWKRMYNKEYNGADDQHRRNIWEKNVKHIQEHNLRHDLGLVTYTLGLNQFTDMTFEEF  80

Query  113  N-ELFNGFNRNGQLRRHSQSSKAETFVPTAGESLPESVDWREKGAVSPVKNQQQCAGCWA  171
              +     +R   +  H    +A         ++P+ +DWRE G V+ VK+Q  C  CWA
Sbjct  81   KAKYLTEMSRASDILSHGVPYEANN------RAVPDKIDWRESGYVTEVKDQGNCGSCWA  134

Query  172  FSVAGCVEGQNARKTGKLEEASVQHLIDCATGRYDNDGCRGGLTETGFDFVEDNGINSYS  231
            FS  G +EGQ  +        S Q L+DC +G + N+GC GGL E  + +++  G+ + S
Sbjct  135  FSTTGTMEGQYMKNERTSISFSEQQLVDC-SGPWGNNGCSGGLMENAYQYLKQFGLETES  193

Query  232  DYPYEAVNTSCR-SKENTIAKTQGYIRIPEGDEKALAQALAKFGPISTAIHVTKNFQFYG  290
             YPY AV   CR +K+  +AK  GY  +  G E  L   +    P + A+ V  +F  Y 
Sbjct  194  SYPYTAVEGQCRYNKQLGVAKVTGYYTVHSGSEVELKNLVGARRPAAVAVDVESDFMMYR  253

Query  291  EKIFDDPECRNTPDDLNHALLIVGYGKEADGRKFWLVKNSYGTTWGLDGYFKVAKDEGNK  350
              I+    C  +P  +NHA+L VGYG +  G  +W+VKNS+GT WG  GY ++A++ GN 
Sbjct  254  SGIYQSQTC--SPLRVNHAVLAVGYGTQG-GTDYWIVKNSWGTYWGERGYIRMARNRGNM  310

Query  351  CGIATYARYPKV  362
            CGIA+ A  P V
Sbjct  311  CGIASLASLPMV  322


>CYSP2_DICDI unnamed protein product
Length=376

 Score = 192 bits (487),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 120/352 (34%), Positives = 185/352 (53%), Gaps = 46/352 (13%)

Query  49   EKVFLQDWLDFGTKFNKKYNPVEAPLRKANFLQNIDTITKLATDSVLSFGLKINEFADML  108
            E  +   + ++  KFN++Y+  E   R + F  N+D +    +       L +N FAD+ 
Sbjct  29   ESQYRTAFTEWTLKFNRQYSSSEFSNRYSIFKSNMDYVDNWNSKGDSQTVLGLNNFADIT  88

Query  109  FDEFNELFNGFNRNGQLRRHSQSSKAETFVPTAGESLPESVDWREKGAVSPVKNQQQCAG  168
             +E+ + + G   N     ++     E       ++ P+S+DWR K AV+P+K+Q QC  
Sbjct  89   NEEYRKTYLGTRVNAH--SYNGYDGREVLNVEDLQTNPKSIDWRTKNAVTPIKDQGQCGS  146

Query  169  CWAFSVAGCVEGQNARKTGKLEEASVQHLIDCATGRYDNDGCRGGLTETGFDFVEDN-GI  227
            CW+FS  G  EG +A KT KL   S Q+L+DC+ G  +N GC GGL    FD++  N GI
Sbjct  147  CWSFSTTGSTEGAHALKTKKLVSLSEQNLVDCS-GPEENFGCDGGLMNNAFDYIIKNKGI  205

Query  228  NSYSDYPYEA-VNTSCRSKENTIAKT-QGYIRIPEGDEKALAQALAKFGPISTAIHVTKN  285
            ++ S YPY A   ++C   ++ I  T +GY+ I  G E +L    A+ GP+S AI  + N
Sbjct  206  DTESSYPYTAETGSTCLFNKSDIGATIKGYVNITAGSEISLENG-AQHGPVSVAIDASHN  264

Query  286  -FQFYGEKIFDDPECRNTPDDLNHALLIVGY---GKEADG----RK--------------  323
             FQ Y   I+ +P+C  +P +L+H +L+VGY   GK+ +G    RK              
Sbjct  265  SFQLYTSGIYYEPKC--SPTELDHGVLVVGYGVQGKDDEGPVLNRKQTIVIHKNEDNKVE  322

Query  324  ---------------FWLVKNSYGTTWGLDGYFKVAKDEGNKCGIATYARYP  360
                           +W+VKNS+GT+WG+ GY  ++KD  N CGIA+ + YP
Sbjct  323  SSDDSSDSVRPKANNYWIVKNSWGTSWGIKGYILMSKDRKNNCGIASVSSYP  374



Lambda      K        H
   0.320    0.135    0.434 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3573877230


Query= XP_018560796.1 cathepsin L1 [Anoplophora glabripennis]

Length=318
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CATL_DROME  unnamed protein product                                   281     6e-93
CRUST_PANBO  unnamed protein product                                  263     8e-87
CATLL_FASHE  unnamed protein product                                  231     3e-74
O45734_CAEEL  unnamed protein product                                 225     1e-71
CYSP1_DICDI  unnamed protein product                                  195     5e-60


>CATL_DROME unnamed protein product
Length=371

 Score = 281 bits (718),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 150/314 (48%), Positives = 196/314 (62%), Gaps = 17/314 (5%)

Query  22   QWQSFKDNVGRHYRSRLEESSRFQIFKDNVRKVEEHNQRFDRGEVSYKLAVNKFADLTEE  81
            +W +FK    ++Y+   EE  R +IF +N  K+ +HNQRF  G+VS+KLAVNK+ADL   
Sbjct  58   EWHTFKLEHRKNYQDETEERFRLKIFNENKHKIAKHNQRFAEGKVSFKLAVNKYADLLHH  117

Query  82   EFKARLNP---------RPAVEIDHPKVFSNVGYTDVPDELDWRDKGAVTGVKDQRNCSG  132
            EF+  +N          R A E      F +  +  +P  +DWR KGAVT VKDQ +C  
Sbjct  118  EFRQLMNGFNYTLHKQLRAADESFKGVTFISPAHVTLPKSVDWRTKGAVTAVKDQGHCGS  177

Query  133  CWAFGATGVLEGQYFLKTGKLESFSEQFLIDCSMM--NNGCSGGWTLNAYRSVRDIGMV-  189
            CWAF +TG LEGQ+F K+G L S SEQ L+DCS    NNGC+GG   NA+R ++D G + 
Sbjct  178  CWAFSSTGALEGQHFRKSGVLVSLSEQNLVDCSTKYGNNGCNGGLMDNAFRYIKDNGGID  237

Query  190  TDKSYPYEAADKACRAN-GTF-FKDIGIVTIPQ-DENAIKTAVAKIGPVSVSIDASY--L  244
            T+KSYPYEA D +C  N GT    D G   IPQ DE  +  AVA +GPVSV+IDAS+   
Sbjct  238  TEKSYPYEAIDDSCHFNKGTVGATDRGFTDIPQGDEKKMAEAVATVGPVSVAIDASHESF  297

Query  245  HLYGGGVFDNDSCSTTFTNHVVLIVGYGTTSDGIDYWEVKNSWGADWGVEGYVKMSRNKN  304
              Y  GV++   C     +H VL+VG+GT   G DYW VKNSWG  WG +G++KM RNK 
Sbjct  298  QFYSEGVYNEPQCDAQNLDHGVLVVGFGTDESGEDYWLVKNSWGTTWGDKGFIKMLRNKE  357

Query  305  SQCAIASSADYVLI  318
            +QC IAS++ Y L+
Sbjct  358  NQCGIASASSYPLV  371


>CRUST_PANBO unnamed protein product
Length=323

 Score = 263 bits (673),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 143/327 (44%), Positives = 196/327 (60%), Gaps = 22/327 (7%)

Query  7    FFCAILVVNGTSVEVQWQSFKDNVGRHYRSRLEESSRFQIFKDNVRKVEEHNQRFDRGEV  66
             F  +L +   S   +W++FK   G+ Y +  EES R  +F D ++ ++EHN+R+D+GEV
Sbjct  4    LFLILLGLAAVSAIGEWENFKTKFGKKYANSEEESHRMSVFMDKLKFIQEHNERYDKGEV  63

Query  67   SYKLAVNKFADLTEEEFKA-------RLNPRPAVEIDHPKVFSNVGYTDVPDELDWRDKG  119
            +Y L +N F+DLT EE  A       R +P   +    P        T +  ++DWR+KG
Sbjct  64   TYWLKINNFSDLTHEEVLATKTGMTRRRHPLSVLPKSAPT-------TPMAADVDWRNKG  116

Query  120  AVTGVKDQRNCSGCWAFGATGVLEGQYFLKTGKLESFSEQFLIDCSMM--NNGCSGGWTL  177
            AVT VKDQ  C  CWAF A   LEG +FLKTG L S SEQ L+DCS    N GC+GGW  
Sbjct  117  AVTPVKDQGQCGSCWAFSAVAALEGAHFLKTGDLVSLSEQNLVDCSSSYGNQGCNGGWPY  176

Query  178  NAYRSV-RDIGMVTDKSYPYEAADKACRAN-GTFFKDIGIVTIPQ--DENAIKTAVAKIG  233
             AY+ +  + G+ T+ SYPY+A D  CR + G     +     P   DE+A++ AV   G
Sbjct  177  QAYQYIIANRGIDTESSYPYKAIDDNCRYDAGNIGATVSSYVEPASGDESALQHAVQNEG  236

Query  234  PVSVSIDA--SYLHLYGGGVFDNDSCSTTFTNHVVLIVGYGTTSDGIDYWEVKNSWGADW  291
            PVSV IDA  S    YGGGV+   +C + + NH V  VGYGT ++G DYW VKNSWGA W
Sbjct  237  PVSVCIDAGQSSFGSYGGGVYYEPNCDSWYANHAVTAVGYGTDANGGDYWIVKNSWGAWW  296

Query  292  GVEGYVKMSRNKNSQCAIASSADYVLI  318
            G  GY+KM+RN+++ CAIA+ + Y ++
Sbjct  297  GESGYIKMARNRDNNCAIATYSVYPVV  323


>CATLL_FASHE unnamed protein product
Length=326

 Score = 231 bits (590),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 132/330 (40%), Positives = 182/330 (55%), Gaps = 20/330 (6%)

Query  1    MRIFIVFFCAILVVNGTSVEVQWQSFKDNVGRHYRSRLEESSRFQIFKDNVRKVEEHNQR  60
            MR+FI+    + V+   S +  W  +K    + Y    ++  R  I++ NV+ ++EHN R
Sbjct  1    MRLFILAVLTVGVLG--SNDDLWHQWKRMYNKEYNG-ADDQHRRNIWEKNVKHIQEHNLR  57

Query  61   FDRGEVSYKLAVNKFADLTEEEFKARL--NPRPAVEIDHPKVFSNVGYTDVPDELDWRDK  118
             D G V+Y L +N+F D+T EEFKA+       A +I    V        VPD++DWR+ 
Sbjct  58   HDLGLVTYTLGLNQFTDMTFEEFKAKYLTEMSRASDILSHGVPYEANNRAVPDKIDWRES  117

Query  119  GAVTGVKDQRNCSGCWAFGATGVLEGQYFLKTGKLESFSEQFLIDCS--MMNNGCSGGWT  176
            G VT VKDQ NC  CWAF  TG +EGQY        SFSEQ L+DCS    NNGCSGG  
Sbjct  118  GYVTEVKDQGNCGSCWAFSTTGTMEGQYMKNERTSISFSEQQLVDCSGPWGNNGCSGGLM  177

Query  177  LNAYRSVRDIGMVTDKSYPYEAADKACRANGTFFKDIGIVTI-------PQDENAIKTAV  229
             NAY+ ++  G+ T+ SYPY A +  CR N    K +G+  +          E  +K  V
Sbjct  178  ENAYQYLKQFGLETESSYPYTAVEGQCRYN----KQLGVAKVTGYYTVHSGSEVELKNLV  233

Query  230  AKIGPVSVSIDA-SYLHLYGGGVFDNDSCSTTFTNHVVLIVGYGTTSDGIDYWEVKNSWG  288
                P +V++D  S   +Y  G++ + +CS    NH VL VGYGT   G DYW VKNSWG
Sbjct  234  GARRPAAVAVDVESDFMMYRSGIYQSQTCSPLRVNHAVLAVGYGTQG-GTDYWIVKNSWG  292

Query  289  ADWGVEGYVKMSRNKNSQCAIASSADYVLI  318
              WG  GY++M+RN+ + C IAS A   ++
Sbjct  293  TYWGERGYIRMARNRGNMCGIASLASLPMV  322


>O45734_CAEEL unnamed protein product
Length=337

 Score = 225 bits (573),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 125/309 (40%), Positives = 182/309 (59%), Gaps = 14/309 (5%)

Query  22   QWQSFKDNVGRHYRSRLEESSRFQIFKDNVRKVEEHNQRFDRGEVSYKLAVNKFADLTEE  81
            +W  +K++  + Y S  EE +  + F  N+  +E HN+    G  ++++ +N  ADL   
Sbjct  31   KWDDYKEDFDKEY-SESEEQTYMEAFVKNMIHIENHNRDHRLGRKTFEMGLNHIADLPFS  89

Query  82   EFKARLNPRPAV----EIDHPKVFSNVGYTDVPDELDWRDKGAVTGVKDQRNCSGCWAFG  137
            +++ +LN    +     I +   F       VPDE+DWRD   VT VK+Q  C  CWAF 
Sbjct  90   QYR-KLNGYRRLFGDSRIKNSSSFLAPFNVQVPDEVDWRDTHLVTDVKNQGMCGSCWAFS  148

Query  138  ATGVLEGQYFLKTGKLESFSEQFLIDCSMM--NNGCSGGWTLNAYRSVRD-IGMVTDKSY  194
            ATG LEGQ+  K G+L S SEQ L+DCS    N+GC+GG    A+  +RD  G+ T++SY
Sbjct  149  ATGALEGQHARKLGQLVSLSEQNLVDCSTKYGNHGCNGGLMDQAFEYIRDNHGVDTEESY  208

Query  195  PYEAADKACRANGTFF--KDIGIVTIPQ-DENAIKTAVAKIGPVSVSIDASY--LHLYGG  249
            PY+  D  C  N       D G V  P+ DE  +K AVA  GP+S++IDA +    LY  
Sbjct  209  PYKGRDMKCHFNKKTVGADDKGYVDTPEGDEEQLKIAVATQGPISIAIDAGHRSFQLYKK  268

Query  250  GVFDNDSCSTTFTNHVVLIVGYGTTSDGIDYWEVKNSWGADWGVEGYVKMSRNKNSQCAI  309
            GV+ ++ CS+   +H VL+VGYGT  +  DYW VKNSWGA WG +GY++++RN+N+ C +
Sbjct  269  GVYYDEECSSEELDHGVLLVGYGTDPEHGDYWIVKNSWGAGWGEKGYIRIARNRNNHCGV  328

Query  310  ASSADYVLI  318
            A+ A Y L+
Sbjct  329  ATKASYPLV  337


>CYSP1_DICDI unnamed protein product
Length=343

 Score = 195 bits (496),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 126/342 (37%), Positives = 177/342 (52%), Gaps = 37/342 (11%)

Query  1    MRIFIVFFCAILVV----NGTSVEVQWQ--SFKDNVGRHYRSRLEESSRFQIFKDNVRKV  54
            M++ ++F  A+  V     G  +E Q Q   F+D   + Y S  E   RF+IFK N+ K+
Sbjct  1    MKVILLFVLAVFTVFVSSRGIPLEEQSQFLEFQDKFNKKY-SHEEYLERFEIFKSNLGKI  59

Query  55   EEHNQRFDRGEVSYKLAVNKFADLTEEEFKAR-LNPRPAVEIDHPKVFSNVGYTD-----  108
            EE N      +   K  VNKFADL+ +EFK   LN + A+  D   V     Y D     
Sbjct  60   EELNLIAINHKADTKFGVNKFADLSSDEFKNYYLNNKEAIFTDDLPV---ADYLDDEFIN  116

Query  109  -VPDELDWRDKGAVTGVKDQRNCSGCWAFGATGVLEGQYFLKTGKLESFSEQFLIDC---  164
             +P   DWR +GAVT VK+Q  C  CW+F  TG +EGQ+F+   KL S SEQ L+DC   
Sbjct  117  SIPTAFDWRTRGAVTPVKNQGQCGSCWSFSTTGNVEGQHFISQNKLVSLSEQNLVDCDHE  176

Query  165  -------SMMNNGCSGGWTLNAYRS-VRDIGMVTDKSYPYEA-ADKACRANGTFF--KDI  213
                      + GC+GG   NAY   +++ G+ T+ SYPY A     C  N      K  
Sbjct  177  CMEYEGEQACDEGCNGGLQPNAYNYIIKNGGIQTESSYPYTAETGTQCNFNSANIGAKIS  236

Query  214  GIVTIPQDENAIKTAVAKIGPVSVSIDASYLHLYGGGVFDNDSCSTTFTNHVVLIVGYGT  273
                IP++E  +   +   GP++++ DA     Y GGVFD   C+    +H +LIVGY  
Sbjct  237  NFTMIPKNETVMAGYIVSTGPLAIAADAVEWQFYIGGVFD-IPCNPNSLDHGILIVGYSA  295

Query  274  TS----DGIDYWEVKNSWGADWGVEGYVKMSRNKNSQCAIAS  311
             +      + YW VKNSWGADWG +GY+ + R KN+ C +++
Sbjct  296  KNTIFRKNMPYWIVKNSWGADWGEQGYIYLRRGKNT-CGVSN  336



Lambda      K        H
   0.320    0.135    0.434 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3573877230


Query= XP_018560797.1 cathepsin L [Anoplophora glabripennis]

Length=234
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O45734_CAEEL  unnamed protein product                                 167     1e-50
CATL_DROME  unnamed protein product                                   167     8e-50
Q7K5N8_DROME  unnamed protein product                                 159     7e-47
A1ZAU4_DROME  unnamed protein product                                 160     1e-46
CRUST_PANBO  unnamed protein product                                  154     2e-45


>O45734_CAEEL unnamed protein product
Length=337

 Score = 167 bits (424),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/226 (41%), Positives = 127/226 (56%), Gaps = 6/226 (3%)

Query  13   ILGVTSIEVPEQFDWRDKGLVTKVKDQLSCDGSFYFAALDVIASHHYLKTGETLDLSEQY  72
             L   +++VP++ DWRD  LVT VK+Q  C   + F+A   +   H  K G+ + LSEQ 
Sbjct  112  FLAPFNVQVPDEVDWRDTHLVTDVKNQGMCGSCWAFSATGALEGQHARKLGQLVSLSEQN  171

Query  73   VLDCSLGF-NNGCNGGGLLNSIDFVR-MRGVVLEEDYPYSGTAGTCKINSSHSLFRTIGY  130
            ++DCS  + N+GCNGG +  + +++R   GV  EE YPY G    C  N         GY
Sbjct  172  LVDCSTKYGNHGCNGGLMDQAFEYIRDNHGVDTEESYPYKGRDMKCHFNKKTVGADDKGY  231

Query  131  VILAR-DEEVIKTVVGTIGPVGVTFKG--QSLDSYSGGIYNDPDCQLGQSYSGVI-VGYG  186
            V     DEE +K  V T GP+ +      +S   Y  G+Y D +C   +   GV+ VGYG
Sbjct  232  VDTPEGDEEQLKIAVATQGPISIAIDAGHRSFQLYKKGVYYDEECSSEELDHGVLLVGYG  291

Query  187  TSDEGEDYWTVKMSYGASWGEEGFMRLARNTGNQCGVADGAIYPIL  232
            T  E  DYW VK S+GA WGE+G++R+ARN  N CGVA  A YP++
Sbjct  292  TDPEHGDYWIVKNSWGAGWGEKGYIRIARNRNNHCGVATKASYPLV  337


>CATL_DROME unnamed protein product
Length=371

 Score = 167 bits (422),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 84/228 (37%), Positives = 130/228 (57%), Gaps = 6/228 (3%)

Query  11   LLILGVTSIEVPEQFDWRDKGLVTKVKDQLSCDGSFYFAALDVIASHHYLKTGETLDLSE  70
            +  +    + +P+  DWR KG VT VKDQ  C   + F++   +   H+ K+G  + LSE
Sbjct  144  VTFISPAHVTLPKSVDWRTKGAVTAVKDQGHCGSCWAFSSTGALEGQHFRKSGVLVSLSE  203

Query  71   QYVLDCSLGF-NNGCNGGGLLNSIDFVRMRG-VVLEEDYPYSGTAGTCKINSSHSLFRTI  128
            Q ++DCS  + NNGCNGG + N+  +++  G +  E+ YPY     +C  N         
Sbjct  204  QNLVDCSTKYGNNGCNGGLMDNAFRYIKDNGGIDTEKSYPYEAIDDSCHFNKGTVGATDR  263

Query  129  GYVILAR-DEEVIKTVVGTIGPVGVTFKG--QSLDSYSGGIYNDPDCQLGQSYSGV-IVG  184
            G+  + + DE+ +   V T+GPV V      +S   YS G+YN+P C       GV +VG
Sbjct  264  GFTDIPQGDEKKMAEAVATVGPVSVAIDASHESFQFYSEGVYNEPQCDAQNLDHGVLVVG  323

Query  185  YGTSDEGEDYWTVKMSYGASWGEEGFMRLARNTGNQCGVADGAIYPIL  232
            +GT + GEDYW VK S+G +WG++GF+++ RN  NQCG+A  + YP++
Sbjct  324  FGTDESGEDYWLVKNSWGTTWGDKGFIKMLRNKENQCGIASASSYPLV  371


>Q7K5N8_DROME unnamed protein product
Length=390

 Score = 159 bits (403),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 94/234 (40%), Positives = 138/234 (59%), Gaps = 12/234 (5%)

Query  8    AYVLLILGVTSIEVPEQFDWRDKGLVTKVKDQLSCDGSFYFAALDVIASHHYLKTGETLD  67
            A  L ++ + +  +P+ FDWR+ G VT VK Q +C   + FA    I  H + KTG   +
Sbjct  160  AASLKLVNLPAKPIPDAFDWREHGGVTPVKFQGTCGSCWAFATTGAIEGHTFRKTGSLPN  219

Query  68   LSEQYVLDC----SLGFNNGCNGGGLLNSIDFVR--MRGVVLEEDYPYSGTAGTCKINSS  121
            LSEQ ++DC      G N GC+GG    +  F+    +GV  E  YPY    GTCK + S
Sbjct  220  LSEQNLVDCGPVEDFGLN-GCDGGFQEAAFCFIDEVQKGVSQEGAYPYIDNKGTCKYDGS  278

Query  122  HSLFRTIGYV-ILARDEEVIKTVVGTIGPVGVTFKG-QSLDSYSGGIYNDPDCQLGQ-SY  178
             S     G+  I  +DEE +K VV T+GPV  +  G ++L +Y+GGIYND +C  G+ ++
Sbjct  279  KSGATLQGFAAIPPKDEEQLKKVVATLGPVACSVNGLETLKNYAGGIYNDDECNKGEPNH  338

Query  179  SGVIVGYGTSDEGEDYWTVKMSYGASWGEEGFMRLARNTGNQCGVADGAIYPIL  232
            S ++VGYG S++G+DYW VK S+  +WGE+G+ RL R   N C +A+   YP++
Sbjct  339  SILVVGYG-SEKGQDYWIVKNSWDDTWGEKGYFRLPRGK-NYCFIAEECSYPVV  390


>A1ZAU4_DROME unnamed protein product
Length=420

 Score = 160 bits (404),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 94/234 (40%), Positives = 138/234 (59%), Gaps = 12/234 (5%)

Query  8    AYVLLILGVTSIEVPEQFDWRDKGLVTKVKDQLSCDGSFYFAALDVIASHHYLKTGETLD  67
            A  L ++ + +  +P+ FDWR+ G VT VK Q +C   + FA    I  H + KTG   +
Sbjct  190  AASLKLVNLPAKPIPDAFDWREHGGVTPVKFQGTCGSCWAFATTGAIEGHTFRKTGSLPN  249

Query  68   LSEQYVLDC----SLGFNNGCNGGGLLNSIDFVR--MRGVVLEEDYPYSGTAGTCKINSS  121
            LSEQ ++DC      G N GC+GG    +  F+    +GV  E  YPY    GTCK + S
Sbjct  250  LSEQNLVDCGPVEDFGLN-GCDGGFQEAAFCFIDEVQKGVSQEGAYPYIDNKGTCKYDGS  308

Query  122  HSLFRTIGYV-ILARDEEVIKTVVGTIGPVGVTFKG-QSLDSYSGGIYNDPDCQLGQ-SY  178
             S     G+  I  +DEE +K VV T+GPV  +  G ++L +Y+GGIYND +C  G+ ++
Sbjct  309  KSGATLQGFAAIPPKDEEQLKKVVATLGPVACSVNGLETLKNYAGGIYNDDECNKGEPNH  368

Query  179  SGVIVGYGTSDEGEDYWTVKMSYGASWGEEGFMRLARNTGNQCGVADGAIYPIL  232
            S ++VGYG S++G+DYW VK S+  +WGE+G+ RL R   N C +A+   YP++
Sbjct  369  SILVVGYG-SEKGQDYWIVKNSWDDTWGEKGYFRLPRGK-NYCFIAEECSYPVV  420


>CRUST_PANBO unnamed protein product
Length=323

 Score = 154 bits (389),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/228 (38%), Positives = 125/228 (55%), Gaps = 6/228 (3%)

Query  11   LLILGVTSIEVPEQFDWRDKGLVTKVKDQLSCDGSFYFAALDVIASHHYLKTGETLDLSE  70
            +L     +  +    DWR+KG VT VKDQ  C   + F+A+  +   H+LKTG+ + LSE
Sbjct  96   VLPKSAPTTPMAADVDWRNKGAVTPVKDQGQCGSCWAFSAVAALEGAHFLKTGDLVSLSE  155

Query  71   QYVLDCSLGF-NNGCNGGGLLNSIDFV-RMRGVVLEEDYPYSGTAGTCKINSSHSLFRTI  128
            Q ++DCS  + N GCNGG    +  ++   RG+  E  YPY      C+ ++ +      
Sbjct  156  QNLVDCSSSYGNQGCNGGWPYQAYQYIIANRGIDTESSYPYKAIDDNCRYDAGNIGATVS  215

Query  129  GYVILAR-DEEVIKTVVGTIGPVGVTF-KGQS-LDSYSGGIYNDPDCQLGQSYSGVI-VG  184
             YV  A  DE  ++  V   GPV V    GQS   SY GG+Y +P+C    +   V  VG
Sbjct  216  SYVEPASGDESALQHAVQNEGPVSVCIDAGQSSFGSYGGGVYYEPNCDSWYANHAVTAVG  275

Query  185  YGTSDEGEDYWTVKMSYGASWGEEGFMRLARNTGNQCGVADGAIYPIL  232
            YGT   G DYW VK S+GA WGE G++++ARN  N C +A  ++YP++
Sbjct  276  YGTDANGGDYWIVKNSWGAWWGESGYIKMARNRDNNCAIATYSVYPVV  323



Lambda      K        H
   0.320    0.135    0.434 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3573877230


Query= XP_018560798.1 cathepsin L [Anoplophora glabripennis]

Length=234
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O45734_CAEEL  unnamed protein product                                 168     7e-51
CATL_DROME  unnamed protein product                                   168     2e-50
Q7K5N8_DROME  unnamed protein product                                 165     5e-49
A1ZAU4_DROME  unnamed protein product                                 165     1e-48
CRUST_PANBO  unnamed protein product                                  156     2e-46


>O45734_CAEEL unnamed protein product
Length=337

 Score = 168 bits (426),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 93/225 (41%), Positives = 127/225 (56%), Gaps = 6/225 (3%)

Query  14   LGVTSIEVPEQFDWRDKGLVTKVKDQLSCDGSFYFAALDVIASHHYLKTGETLDLSEQYV  73
            L   +++VP++ DWRD  LVT VK+Q  C   + F+A   +   H  K G+ + LSEQ +
Sbjct  113  LAPFNVQVPDEVDWRDTHLVTDVKNQGMCGSCWAFSATGALEGQHARKLGQLVSLSEQNL  172

Query  74   LDCSDGY-NNGCNGGGLLNSIDFVR-TRGVVLEEDYPYSGTAGTCKINGSHSLFRTMGFV  131
            +DCS  Y N+GCNGG +  + +++R   GV  EE YPY G    C  N         G+V
Sbjct  173  VDCSTKYGNHGCNGGLMDQAFEYIRDNHGVDTEESYPYKGRDMKCHFNKKTVGADDKGYV  232

Query  132  ILAR-DEEVIKTVVGTIGPVGVTFKG--QSLDSYSGGIYNDPDCQLGQSYSGVI-VGYGT  187
                 DEE +K  V T GP+ +      +S   Y  G+Y D +C   +   GV+ VGYGT
Sbjct  233  DTPEGDEEQLKIAVATQGPISIAIDAGHRSFQLYKKGVYYDEECSSEELDHGVLLVGYGT  292

Query  188  SDEGEDYWTVKMSYGASWGEEGYMRLARNTGNQCGVADGAIYPIL  232
              E  DYW VK S+GA WGE+GY+R+ARN  N CGVA  A YP++
Sbjct  293  DPEHGDYWIVKNSWGAGWGEKGYIRIARNRNNHCGVATKASYPLV  337


>CATL_DROME unnamed protein product
Length=371

 Score = 168 bits (426),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/220 (39%), Positives = 128/220 (58%), Gaps = 6/220 (3%)

Query  19   IEVPEQFDWRDKGLVTKVKDQLSCDGSFYFAALDVIASHHYLKTGETLDLSEQYVLDCSD  78
            + +P+  DWR KG VT VKDQ  C   + F++   +   H+ K+G  + LSEQ ++DCS 
Sbjct  152  VTLPKSVDWRTKGAVTAVKDQGHCGSCWAFSSTGALEGQHFRKSGVLVSLSEQNLVDCST  211

Query  79   GY-NNGCNGGGLLNSIDFVRTRG-VVLEEDYPYSGTAGTCKINGSHSLFRTMGFVILAR-  135
             Y NNGCNGG + N+  +++  G +  E+ YPY     +C  N         GF  + + 
Sbjct  212  KYGNNGCNGGLMDNAFRYIKDNGGIDTEKSYPYEAIDDSCHFNKGTVGATDRGFTDIPQG  271

Query  136  DEEVIKTVVGTIGPVGVTFKG--QSLDSYSGGIYNDPDCQLGQSYSGV-IVGYGTSDEGE  192
            DE+ +   V T+GPV V      +S   YS G+YN+P C       GV +VG+GT + GE
Sbjct  272  DEKKMAEAVATVGPVSVAIDASHESFQFYSEGVYNEPQCDAQNLDHGVLVVGFGTDESGE  331

Query  193  DYWTVKMSYGASWGEEGYMRLARNTGNQCGVADGAIYPIL  232
            DYW VK S+G +WG++G++++ RN  NQCG+A  + YP++
Sbjct  332  DYWLVKNSWGTTWGDKGFIKMLRNKENQCGIASASSYPLV  371


>Q7K5N8_DROME unnamed protein product
Length=390

 Score = 165 bits (418),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 97/233 (42%), Positives = 139/233 (60%), Gaps = 10/233 (4%)

Query  8    AYVLLVLGVTSIEVPEQFDWRDKGLVTKVKDQLSCDGSFYFAALDVIASHHYLKTGETLD  67
            A  L ++ + +  +P+ FDWR+ G VT VK Q +C   + FA    I  H + KTG   +
Sbjct  160  AASLKLVNLPAKPIPDAFDWREHGGVTPVKFQGTCGSCWAFATTGAIEGHTFRKTGSLPN  219

Query  68   LSEQYVLDC---SDGYNNGCNGGGLLNSIDFVR--TRGVVLEEDYPYSGTAGTCKINGSH  122
            LSEQ ++DC    D   NGC+GG    +  F+    +GV  E  YPY    GTCK +GS 
Sbjct  220  LSEQNLVDCGPVEDFGLNGCDGGFQEAAFCFIDEVQKGVSQEGAYPYIDNKGTCKYDGSK  279

Query  123  SLFRTMGFV-ILARDEEVIKTVVGTIGPVGVTFKG-QSLDSYSGGIYNDPDCQLGQ-SYS  179
            S     GF  I  +DEE +K VV T+GPV  +  G ++L +Y+GGIYND +C  G+ ++S
Sbjct  280  SGATLQGFAAIPPKDEEQLKKVVATLGPVACSVNGLETLKNYAGGIYNDDECNKGEPNHS  339

Query  180  GVIVGYGTSDEGEDYWTVKMSYGASWGEEGYMRLARNTGNQCGVADGAIYPIL  232
             ++VGYG S++G+DYW VK S+  +WGE+GY RL R   N C +A+   YP++
Sbjct  340  ILVVGYG-SEKGQDYWIVKNSWDDTWGEKGYFRLPRGK-NYCFIAEECSYPVV  390


>A1ZAU4_DROME unnamed protein product
Length=420

 Score = 165 bits (417),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 97/233 (42%), Positives = 139/233 (60%), Gaps = 10/233 (4%)

Query  8    AYVLLVLGVTSIEVPEQFDWRDKGLVTKVKDQLSCDGSFYFAALDVIASHHYLKTGETLD  67
            A  L ++ + +  +P+ FDWR+ G VT VK Q +C   + FA    I  H + KTG   +
Sbjct  190  AASLKLVNLPAKPIPDAFDWREHGGVTPVKFQGTCGSCWAFATTGAIEGHTFRKTGSLPN  249

Query  68   LSEQYVLDC---SDGYNNGCNGGGLLNSIDFVR--TRGVVLEEDYPYSGTAGTCKINGSH  122
            LSEQ ++DC    D   NGC+GG    +  F+    +GV  E  YPY    GTCK +GS 
Sbjct  250  LSEQNLVDCGPVEDFGLNGCDGGFQEAAFCFIDEVQKGVSQEGAYPYIDNKGTCKYDGSK  309

Query  123  SLFRTMGFV-ILARDEEVIKTVVGTIGPVGVTFKG-QSLDSYSGGIYNDPDCQLGQ-SYS  179
            S     GF  I  +DEE +K VV T+GPV  +  G ++L +Y+GGIYND +C  G+ ++S
Sbjct  310  SGATLQGFAAIPPKDEEQLKKVVATLGPVACSVNGLETLKNYAGGIYNDDECNKGEPNHS  369

Query  180  GVIVGYGTSDEGEDYWTVKMSYGASWGEEGYMRLARNTGNQCGVADGAIYPIL  232
             ++VGYG S++G+DYW VK S+  +WGE+GY RL R   N C +A+   YP++
Sbjct  370  ILVVGYG-SEKGQDYWIVKNSWDDTWGEKGYFRLPRGK-NYCFIAEECSYPVV  420


>CRUST_PANBO unnamed protein product
Length=323

 Score = 156 bits (395),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 127/232 (55%), Gaps = 8/232 (3%)

Query  9    YVLLVLGVTSIEVP--EQFDWRDKGLVTKVKDQLSCDGSFYFAALDVIASHHYLKTGETL  66
            + L VL  ++   P     DWR+KG VT VKDQ  C   + F+A+  +   H+LKTG+ +
Sbjct  92   HPLSVLPKSAPTTPMAADVDWRNKGAVTPVKDQGQCGSCWAFSAVAALEGAHFLKTGDLV  151

Query  67   DLSEQYVLDCSDGY-NNGCNGGGLLNSIDFV-RTRGVVLEEDYPYSGTAGTCKINGSHSL  124
             LSEQ ++DCS  Y N GCNGG    +  ++   RG+  E  YPY      C+ +  +  
Sbjct  152  SLSEQNLVDCSSSYGNQGCNGGWPYQAYQYIIANRGIDTESSYPYKAIDDNCRYDAGNIG  211

Query  125  FRTMGFVILAR-DEEVIKTVVGTIGPVGVTF-KGQS-LDSYSGGIYNDPDCQLGQSYSGV  181
                 +V  A  DE  ++  V   GPV V    GQS   SY GG+Y +P+C    +   V
Sbjct  212  ATVSSYVEPASGDESALQHAVQNEGPVSVCIDAGQSSFGSYGGGVYYEPNCDSWYANHAV  271

Query  182  I-VGYGTSDEGEDYWTVKMSYGASWGEEGYMRLARNTGNQCGVADGAIYPIL  232
              VGYGT   G DYW VK S+GA WGE GY+++ARN  N C +A  ++YP++
Sbjct  272  TAVGYGTDANGGDYWIVKNSWGAWWGESGYIKMARNRDNNCAIATYSVYPVV  323



Lambda      K        H
   0.320    0.135    0.434 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3573877230


Query= XP_018560799.1 CCR4-NOT transcription complex subunit 6-like
[Anoplophora glabripennis]

Length=547
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VCB6_DROME  unnamed protein product                                 788     0.0  
Q7K112_DROME  unnamed protein product                                 787     0.0  
Q8IMX1_DROME  unnamed protein product                                 787     0.0  
Q8MTZ5_DROME  unnamed protein product                                 774     0.0  
Q9U1P4_CAEEL  unnamed protein product                                 590     0.0  


>Q9VCB6_DROME unnamed protein product
Length=545

 Score = 788 bits (2034),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/546 (69%), Positives = 454/546 (83%), Gaps = 7/546 (1%)

Query  4    KDKFESNASSRRTHTYMSAEDQASGKKSYWTELEITGTIRNLSPNLFQMTHLTALYLKNN  63
            KDK++S  ++RR   ++S ED A+GKK+ W+ LEITG +RN+SP+L++  HLTALYL +N
Sbjct  5    KDKYDS--ANRRQQIFLSQEDIAAGKKTNWSGLEITGCVRNISPSLWEFEHLTALYLNDN  62

Query  64   CLQRLPTDICQLTNLRNLDLSYNKLRSLPAELGELIHLRELHLAHNYLRILPYELGKLFN  123
             L RLP D+  LT+LR LDLS NKLRSLPAELGELI LREL L +N+LR+LPYE+GKLF+
Sbjct  63   QLLRLPADVGMLTSLRTLDLSSNKLRSLPAELGELIQLRELLLNNNFLRVLPYEIGKLFH  122

Query  124  LMILSLMGNPLSKDIMQIYSEPNGTQKLLTFMLDNLQVTTPSPPPRPWIPLARPSTNRPT  183
            L+IL LMGNPL K+ M IY+EPNGTQKLLT+MLDNL  T   PP RPW+PLA+P+  RP 
Sbjct  123  LVILGLMGNPLQKEFMNIYNEPNGTQKLLTYMLDNLSFTVNPPPQRPWLPLAKPNKTRPA  182

Query  184  CIFTVMCYNVLCDKLATRQMYSYCPSWALNWEYRKKGILEEIKHYGADIINLQEVEMEQF  243
            CIFTVMCYNVLCDK ATRQMY YCPSWAL WEYRKK I++EI+HY ADII+LQE+E EQF
Sbjct  183  CIFTVMCYNVLCDKYATRQMYGYCPSWALCWEYRKKSIIDEIRHYAADIISLQEIETEQF  242

Query  244  YNYFLPELKMDGYNGIYSPKSRAKHMAESERKYVDGCAIFYRTSKFTLVKEHLVEFNQLA  303
            Y++FLPELK DGY GI+SPKSRAK M+E ERKYVDGCAIF+R SKFTL+KE L+EFNQLA
Sbjct  243  YHFFLPELKNDGYEGIFSPKSRAKTMSELERKYVDGCAIFFRASKFTLIKESLIEFNQLA  302

Query  304  MANADGLEHMLNRVMPKDNIGLAALLQTTDAAWDNTPPDAPFIHQPLLVCTAHIHWDPEF  363
            MANA+G ++MLNRVMPKDNIGLAALL+  + AW+    +   I QPLLVCTAHIHWDPEF
Sbjct  303  MANAEGSDNMLNRVMPKDNIGLAALLKVKENAWEPM-SEVTQISQPLLVCTAHIHWDPEF  361

Query  364  CDVKLIQTMMLSNELKSILEQSAETLKAHNLHLDPSNIQLVLCGDFNSLPDSGVIEFLGT  423
            CDVKLIQTMMLSNELK+I+++++ + +  + + D + +QL+LCGDFNSLPDSGV+EFLG 
Sbjct  362  CDVKLIQTMMLSNELKTIIDEASHSFRPGHKN-DSNAVQLLLCGDFNSLPDSGVVEFLGK  420

Query  424  GRVSQDHKDFKAFSYKSCLEKILSCDKPNEFTHSFKLASAYNDEIMPFTNYTFDFKGIID  483
            GRVS DH DFK   YKSCL+++LS D  NEFTHSFKLASAYN++IMP TNYTFDFKGIID
Sbjct  421  GRVSMDHLDFKDMGYKSCLQRLLSNDT-NEFTHSFKLASAYNEDIMPHTNYTFDFKGIID  479

Query  484  YIFYAKQTMTPLGLLGPLSQEWLQQNKVIGCPHPHVYSDHFPLLVELEMVPTIT--AAMN  541
            YIFY K  M PLGLLGP+S +WL++NKV+GCPHPH+ SDHFPLLVELE++ T +  A  N
Sbjct  480  YIFYTKTGMVPLGLLGPVSNDWLRENKVVGCPHPHIPSDHFPLLVELELMHTASQQAPPN  539

Query  542  GVVTLR  547
            G++  R
Sbjct  540  GLINRR  545


>Q7K112_DROME unnamed protein product
Length=552

 Score = 787 bits (2033),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/546 (69%), Positives = 454/546 (83%), Gaps = 7/546 (1%)

Query  4    KDKFESNASSRRTHTYMSAEDQASGKKSYWTELEITGTIRNLSPNLFQMTHLTALYLKNN  63
            KDK++S  ++RR   ++S ED A+GKK+ W+ LEITG +RN+SP+L++  HLTALYL +N
Sbjct  12   KDKYDS--ANRRQQIFLSQEDIAAGKKTNWSGLEITGCVRNISPSLWEFEHLTALYLNDN  69

Query  64   CLQRLPTDICQLTNLRNLDLSYNKLRSLPAELGELIHLRELHLAHNYLRILPYELGKLFN  123
             L RLP D+  LT+LR LDLS NKLRSLPAELGELI LREL L +N+LR+LPYE+GKLF+
Sbjct  70   QLLRLPADVGMLTSLRTLDLSSNKLRSLPAELGELIQLRELLLNNNFLRVLPYEIGKLFH  129

Query  124  LMILSLMGNPLSKDIMQIYSEPNGTQKLLTFMLDNLQVTTPSPPPRPWIPLARPSTNRPT  183
            L+IL LMGNPL K+ M IY+EPNGTQKLLT+MLDNL  T   PP RPW+PLA+P+  RP 
Sbjct  130  LVILGLMGNPLQKEFMNIYNEPNGTQKLLTYMLDNLSFTVNPPPQRPWLPLAKPNKTRPA  189

Query  184  CIFTVMCYNVLCDKLATRQMYSYCPSWALNWEYRKKGILEEIKHYGADIINLQEVEMEQF  243
            CIFTVMCYNVLCDK ATRQMY YCPSWAL WEYRKK I++EI+HY ADII+LQE+E EQF
Sbjct  190  CIFTVMCYNVLCDKYATRQMYGYCPSWALCWEYRKKSIIDEIRHYAADIISLQEIETEQF  249

Query  244  YNYFLPELKMDGYNGIYSPKSRAKHMAESERKYVDGCAIFYRTSKFTLVKEHLVEFNQLA  303
            Y++FLPELK DGY GI+SPKSRAK M+E ERKYVDGCAIF+R SKFTL+KE L+EFNQLA
Sbjct  250  YHFFLPELKNDGYEGIFSPKSRAKTMSELERKYVDGCAIFFRASKFTLIKESLIEFNQLA  309

Query  304  MANADGLEHMLNRVMPKDNIGLAALLQTTDAAWDNTPPDAPFIHQPLLVCTAHIHWDPEF  363
            MANA+G ++MLNRVMPKDNIGLAALL+  + AW+    +   I QPLLVCTAHIHWDPEF
Sbjct  310  MANAEGSDNMLNRVMPKDNIGLAALLKVKENAWEPM-SEVTQISQPLLVCTAHIHWDPEF  368

Query  364  CDVKLIQTMMLSNELKSILEQSAETLKAHNLHLDPSNIQLVLCGDFNSLPDSGVIEFLGT  423
            CDVKLIQTMMLSNELK+I+++++ + +  + + D + +QL+LCGDFNSLPDSGV+EFLG 
Sbjct  369  CDVKLIQTMMLSNELKTIIDEASHSFRPGHKN-DSNAVQLLLCGDFNSLPDSGVVEFLGK  427

Query  424  GRVSQDHKDFKAFSYKSCLEKILSCDKPNEFTHSFKLASAYNDEIMPFTNYTFDFKGIID  483
            GRVS DH DFK   YKSCL+++LS D  NEFTHSFKLASAYN++IMP TNYTFDFKGIID
Sbjct  428  GRVSMDHLDFKDMGYKSCLQRLLSNDT-NEFTHSFKLASAYNEDIMPHTNYTFDFKGIID  486

Query  484  YIFYAKQTMTPLGLLGPLSQEWLQQNKVIGCPHPHVYSDHFPLLVELEMVPTIT--AAMN  541
            YIFY K  M PLGLLGP+S +WL++NKV+GCPHPH+ SDHFPLLVELE++ T +  A  N
Sbjct  487  YIFYTKTGMVPLGLLGPVSNDWLRENKVVGCPHPHIPSDHFPLLVELELMHTASQQAPPN  546

Query  542  GVVTLR  547
            G++  R
Sbjct  547  GLINRR  552


>Q8IMX1_DROME unnamed protein product
Length=567

 Score = 787 bits (2032),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/546 (69%), Positives = 454/546 (83%), Gaps = 7/546 (1%)

Query  4    KDKFESNASSRRTHTYMSAEDQASGKKSYWTELEITGTIRNLSPNLFQMTHLTALYLKNN  63
            KDK++S  ++RR   ++S ED A+GKK+ W+ LEITG +RN+SP+L++  HLTALYL +N
Sbjct  27   KDKYDS--ANRRQQIFLSQEDIAAGKKTNWSGLEITGCVRNISPSLWEFEHLTALYLNDN  84

Query  64   CLQRLPTDICQLTNLRNLDLSYNKLRSLPAELGELIHLRELHLAHNYLRILPYELGKLFN  123
             L RLP D+  LT+LR LDLS NKLRSLPAELGELI LREL L +N+LR+LPYE+GKLF+
Sbjct  85   QLLRLPADVGMLTSLRTLDLSSNKLRSLPAELGELIQLRELLLNNNFLRVLPYEIGKLFH  144

Query  124  LMILSLMGNPLSKDIMQIYSEPNGTQKLLTFMLDNLQVTTPSPPPRPWIPLARPSTNRPT  183
            L+IL LMGNPL K+ M IY+EPNGTQKLLT+MLDNL  T   PP RPW+PLA+P+  RP 
Sbjct  145  LVILGLMGNPLQKEFMNIYNEPNGTQKLLTYMLDNLSFTVNPPPQRPWLPLAKPNKTRPA  204

Query  184  CIFTVMCYNVLCDKLATRQMYSYCPSWALNWEYRKKGILEEIKHYGADIINLQEVEMEQF  243
            CIFTVMCYNVLCDK ATRQMY YCPSWAL WEYRKK I++EI+HY ADII+LQE+E EQF
Sbjct  205  CIFTVMCYNVLCDKYATRQMYGYCPSWALCWEYRKKSIIDEIRHYAADIISLQEIETEQF  264

Query  244  YNYFLPELKMDGYNGIYSPKSRAKHMAESERKYVDGCAIFYRTSKFTLVKEHLVEFNQLA  303
            Y++FLPELK DGY GI+SPKSRAK M+E ERKYVDGCAIF+R SKFTL+KE L+EFNQLA
Sbjct  265  YHFFLPELKNDGYEGIFSPKSRAKTMSELERKYVDGCAIFFRASKFTLIKESLIEFNQLA  324

Query  304  MANADGLEHMLNRVMPKDNIGLAALLQTTDAAWDNTPPDAPFIHQPLLVCTAHIHWDPEF  363
            MANA+G ++MLNRVMPKDNIGLAALL+  + AW+    +   I QPLLVCTAHIHWDPEF
Sbjct  325  MANAEGSDNMLNRVMPKDNIGLAALLKVKENAWEPM-SEVTQISQPLLVCTAHIHWDPEF  383

Query  364  CDVKLIQTMMLSNELKSILEQSAETLKAHNLHLDPSNIQLVLCGDFNSLPDSGVIEFLGT  423
            CDVKLIQTMMLSNELK+I+++++ + +  + + D + +QL+LCGDFNSLPDSGV+EFLG 
Sbjct  384  CDVKLIQTMMLSNELKTIIDEASHSFRPGHKN-DSNAVQLLLCGDFNSLPDSGVVEFLGK  442

Query  424  GRVSQDHKDFKAFSYKSCLEKILSCDKPNEFTHSFKLASAYNDEIMPFTNYTFDFKGIID  483
            GRVS DH DFK   YKSCL+++LS D  NEFTHSFKLASAYN++IMP TNYTFDFKGIID
Sbjct  443  GRVSMDHLDFKDMGYKSCLQRLLSNDT-NEFTHSFKLASAYNEDIMPHTNYTFDFKGIID  501

Query  484  YIFYAKQTMTPLGLLGPLSQEWLQQNKVIGCPHPHVYSDHFPLLVELEMVPTIT--AAMN  541
            YIFY K  M PLGLLGP+S +WL++NKV+GCPHPH+ SDHFPLLVELE++ T +  A  N
Sbjct  502  YIFYTKTGMVPLGLLGPVSNDWLRENKVVGCPHPHIPSDHFPLLVELELMHTASQQAPPN  561

Query  542  GVVTLR  547
            G++  R
Sbjct  562  GLINRR  567


>Q8MTZ5_DROME unnamed protein product
Length=566

 Score = 774 bits (1999),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/567 (66%), Positives = 454/567 (80%), Gaps = 28/567 (5%)

Query  4    KDKFESNASSRRTHTYMSAEDQASGKKSYWTELEITG---------------------TI  42
            KDK++S  ++RR   ++S ED A+GKK+ W+ LEITG                      +
Sbjct  5    KDKYDS--ANRRQQIFLSQEDIAAGKKTNWSGLEITGGYHTLNPEKYHINSTIHLFTGCV  62

Query  43   RNLSPNLFQMTHLTALYLKNNCLQRLPTDICQLTNLRNLDLSYNKLRSLPAELGELIHLR  102
            RN+SP+L++  HLTALYL +N L RLP D+  LT+LR LDLS NKLRSLPAELGELI LR
Sbjct  63   RNISPSLWEFEHLTALYLNDNQLLRLPADVGMLTSLRTLDLSSNKLRSLPAELGELIQLR  122

Query  103  ELHLAHNYLRILPYELGKLFNLMILSLMGNPLSKDIMQIYSEPNGTQKLLTFMLDNLQVT  162
            EL L +N+LR+LPYE+GKLF+L+IL LMGNPL K+ M IY+EPNGTQKLLT+MLDNL  T
Sbjct  123  ELLLNNNFLRVLPYEIGKLFHLVILGLMGNPLQKEFMNIYNEPNGTQKLLTYMLDNLSFT  182

Query  163  TPSPPPRPWIPLARPSTNRPTCIFTVMCYNVLCDKLATRQMYSYCPSWALNWEYRKKGIL  222
               PP RPW+PLA+P+  RP CIFTVMCYNVLCDK ATRQMY YCPSWAL WEYRKK I+
Sbjct  183  VNPPPQRPWLPLAKPNKTRPACIFTVMCYNVLCDKYATRQMYGYCPSWALCWEYRKKSII  242

Query  223  EEIKHYGADIINLQEVEMEQFYNYFLPELKMDGYNGIYSPKSRAKHMAESERKYVDGCAI  282
            +EI+HY ADII+LQE+E EQFY++FLPELK DGY GI+SPKSRAK M+E ERKYVDGCAI
Sbjct  243  DEIRHYAADIISLQEIETEQFYHFFLPELKNDGYEGIFSPKSRAKTMSELERKYVDGCAI  302

Query  283  FYRTSKFTLVKEHLVEFNQLAMANADGLEHMLNRVMPKDNIGLAALLQTTDAAWDNTPPD  342
            F+R SKFTL+KE L+EFNQLAMANA+G ++MLNRVMPKDNIGLAALL+  + AW+    +
Sbjct  303  FFRASKFTLIKESLIEFNQLAMANAEGSDNMLNRVMPKDNIGLAALLKVKENAWEPM-SE  361

Query  343  APFIHQPLLVCTAHIHWDPEFCDVKLIQTMMLSNELKSILEQSAETLKAHNLHLDPSNIQ  402
               I QPLLVCTAHIHWDPEFCDVKLIQTMMLSNELK+I+++++ + +  + + D + +Q
Sbjct  362  VTQISQPLLVCTAHIHWDPEFCDVKLIQTMMLSNELKTIIDEASHSFRPGHKN-DSNAVQ  420

Query  403  LVLCGDFNSLPDSGVIEFLGTGRVSQDHKDFKAFSYKSCLEKILSCDKPNEFTHSFKLAS  462
            L+LCGDFNSLPDSGV+EFLG GRVS DH DFK   YKSCL+++LS D  NEFTHSFKLAS
Sbjct  421  LLLCGDFNSLPDSGVVEFLGKGRVSMDHLDFKDMGYKSCLQRLLSNDT-NEFTHSFKLAS  479

Query  463  AYNDEIMPFTNYTFDFKGIIDYIFYAKQTMTPLGLLGPLSQEWLQQNKVIGCPHPHVYSD  522
            AYN++IMP TNYTFDFKGIIDYIFY K  M PLGLLGP+S +WL++NKV+GCPHPH+ SD
Sbjct  480  AYNEDIMPHTNYTFDFKGIIDYIFYTKTGMVPLGLLGPVSNDWLRENKVVGCPHPHIPSD  539

Query  523  HFPLLVELEMVPTIT--AAMNGVVTLR  547
            HFPLLVELE++ T +  A  NG++  R
Sbjct  540  HFPLLVELELMHTASQQAPPNGLINRR  566


>Q9U1P4_CAEEL unnamed protein product
Length=613

 Score = 590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/528 (53%), Positives = 370/528 (70%), Gaps = 12/528 (2%)

Query  15   RTHTYMSAEDQASGKKSYWTELEITGTIRNLSPNLFQMTHLTALYLKNNCLQRLPTDICQ  74
            R H  ++ ++ ASG+ + WTELEI G ++NLSP+L+Q+THL+AL+L NN L RLP +I Q
Sbjct  56   RVHRVLTEDEIASGRSTRWTELEIHGRVKNLSPSLWQLTHLSALFLNNNGLTRLPPEIAQ  115

Query  75   LTNLRNLDLSYNKLRSLPAELGELIHLRELHLAHNYLRILPYELGKLFNLMILSLMGNPL  134
            LTNL  LD+S NKLRSLP ELG++I L  L+L +N LR+LPYELGKLF +  L L GNPL
Sbjct  116  LTNLTMLDISNNKLRSLPTELGDMISLCHLYLNNNQLRVLPYELGKLFRIQTLGLQGNPL  175

Query  135  SKDIMQIYSEPNGTQKLLTFMLDNLQVTTPSPPPRPWIPLARPSTNRPTCIFTVMCYNVL  194
            S +I +IY E NG QK+L F+LD+L + T  PP R W+ +      RP   FTV+CYNVL
Sbjct  176  SPEISKIYHETNGAQKILQFLLDHLTINTHPPPERNWVMIRHADPERPIATFTVLCYNVL  235

Query  195  CDKLATRQMYSYCPSWALNWEYRKKGILEEIKHYGADIINLQEVEMEQFYNYFLPELKMD  254
            CDK AT   YSYCPSWALNWEYRK  I++EI+ Y AD+I LQEVE EQF   F PELK  
Sbjct  236  CDKYATVNQYSYCPSWALNWEYRKGLIIKEIRTYEADVITLQEVETEQFRTLFQPELKQL  295

Query  255  GYNGIYSPKSRAKHMAESERKYVDGCAIFYRTSKFTLVKEHLVEFNQLAMANADGLEHML  314
            GY GI+  KSRAK M E ERKYVDGCAIF++  KF + K++L EF+ +AM  A   E+ML
Sbjct  296  GYAGIFEAKSRAKTMGEEERKYVDGCAIFWKVDKFDMDKQYLFEFSSVAMKKASTSENML  355

Query  315  NRVMPKDNIGLAALLQTTDAAWDN-------TPPDAPFIHQPLLVCTAHIHWDPEFCDVK  367
            NRVMP+DNIGL A+L+  ++ + N        P +   +  PL+V TAHIHWDPEFCDVK
Sbjct  356  NRVMPRDNIGLCAVLKIKESVYANKFLGRMQIPMNDNVVGNPLVVATAHIHWDPEFCDVK  415

Query  368  LIQTMMLSNELKSILEQSAETLKAHNLHLDPSNIQLVLCGDFNSLPDSGVIEFLGTGRVS  427
            L+Q+MML++E+  +LE+ ++  +     +    + +++CGDFNSLPDSGV E+L  G+++
Sbjct  416  LVQSMMLTHEVSRVLEEVSKKYQ-----ITQQQVPVLICGDFNSLPDSGVFEYLSKGQIT  470

Query  428  QDHKDFKAFSYKSCLEKILSCDKPNEFTHSFKLASAYNDEIMPFTNYTFDFKGIIDYIFY  487
            + H D K+F   SCLEK  +    N  +H  +L SA +   +PFTNYT DFKG+IDYIF 
Sbjct  471  RRHMDLKSFRDDSCLEKFTNSTDKNVISHPLRLDSACDINSIPFTNYTLDFKGMIDYIFA  530

Query  488  AKQTMTPLGLLGPLSQEWLQQNKVIGCPHPHVYSDHFPLLVELEMVPT  535
              Q++  LG+LGP   +W+Q NK++G PHPHV SDH P++ +  ++PT
Sbjct  531  TPQSLARLGILGPFDPQWVQSNKILGFPHPHVASDHIPIMAQYAIIPT  578



Lambda      K        H
   0.320    0.135    0.434 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3573877230


Query= XP_018560800.1 CCR4-NOT transcription complex subunit 6-like
[Anoplophora glabripennis]

Length=547
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VCB6_DROME  unnamed protein product                                 788     0.0  
Q7K112_DROME  unnamed protein product                                 787     0.0  
Q8IMX1_DROME  unnamed protein product                                 787     0.0  
Q8MTZ5_DROME  unnamed protein product                                 774     0.0  
Q9U1P4_CAEEL  unnamed protein product                                 590     0.0  


>Q9VCB6_DROME unnamed protein product
Length=545

 Score = 788 bits (2034),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/546 (69%), Positives = 454/546 (83%), Gaps = 7/546 (1%)

Query  4    KDKFESNASSRRTHTYMSAEDQASGKKSYWTELEITGTIRNLSPNLFQMTHLTALYLKNN  63
            KDK++S  ++RR   ++S ED A+GKK+ W+ LEITG +RN+SP+L++  HLTALYL +N
Sbjct  5    KDKYDS--ANRRQQIFLSQEDIAAGKKTNWSGLEITGCVRNISPSLWEFEHLTALYLNDN  62

Query  64   CLQRLPTDICQLTNLRNLDLSYNKLRSLPAELGELIHLRELHLAHNYLRILPYELGKLFN  123
             L RLP D+  LT+LR LDLS NKLRSLPAELGELI LREL L +N+LR+LPYE+GKLF+
Sbjct  63   QLLRLPADVGMLTSLRTLDLSSNKLRSLPAELGELIQLRELLLNNNFLRVLPYEIGKLFH  122

Query  124  LMILSLMGNPLSKDIMQIYSEPNGTQKLLTFMLDNLQVTTPSPPPRPWIPLARPSTNRPT  183
            L+IL LMGNPL K+ M IY+EPNGTQKLLT+MLDNL  T   PP RPW+PLA+P+  RP 
Sbjct  123  LVILGLMGNPLQKEFMNIYNEPNGTQKLLTYMLDNLSFTVNPPPQRPWLPLAKPNKTRPA  182

Query  184  CIFTVMCYNVLCDKLATRQMYSYCPSWALNWEYRKKGILEEIKHYGADIINLQEVEMEQF  243
            CIFTVMCYNVLCDK ATRQMY YCPSWAL WEYRKK I++EI+HY ADII+LQE+E EQF
Sbjct  183  CIFTVMCYNVLCDKYATRQMYGYCPSWALCWEYRKKSIIDEIRHYAADIISLQEIETEQF  242

Query  244  YNYFLPELKMDGYNGIYSPKSRAKHMAESERKYVDGCAIFYRTSKFTLVKEHLVEFNQLA  303
            Y++FLPELK DGY GI+SPKSRAK M+E ERKYVDGCAIF+R SKFTL+KE L+EFNQLA
Sbjct  243  YHFFLPELKNDGYEGIFSPKSRAKTMSELERKYVDGCAIFFRASKFTLIKESLIEFNQLA  302

Query  304  MANADGLEHMLNRVMPKDNIGLAALLQTTDAAWDNTPPDAPFIHQPLLVCTAHIHWDPEF  363
            MANA+G ++MLNRVMPKDNIGLAALL+  + AW+    +   I QPLLVCTAHIHWDPEF
Sbjct  303  MANAEGSDNMLNRVMPKDNIGLAALLKVKENAWEPM-SEVTQISQPLLVCTAHIHWDPEF  361

Query  364  CDVKLIQTMMLSNELKSILEQSAETLKAHNLHLDPSNIQLVLCGDFNSLPDSGVIEFLGT  423
            CDVKLIQTMMLSNELK+I+++++ + +  + + D + +QL+LCGDFNSLPDSGV+EFLG 
Sbjct  362  CDVKLIQTMMLSNELKTIIDEASHSFRPGHKN-DSNAVQLLLCGDFNSLPDSGVVEFLGK  420

Query  424  GRVSQDHKDFKAFSYKSCLEKILSCDKPNEFTHSFKLASAYNDEIMPFTNYTFDFKGIID  483
            GRVS DH DFK   YKSCL+++LS D  NEFTHSFKLASAYN++IMP TNYTFDFKGIID
Sbjct  421  GRVSMDHLDFKDMGYKSCLQRLLSNDT-NEFTHSFKLASAYNEDIMPHTNYTFDFKGIID  479

Query  484  YIFYAKQTMTPLGLLGPLSQEWLQQNKVIGCPHPHVYSDHFPLLVELEMVPTIT--AAMN  541
            YIFY K  M PLGLLGP+S +WL++NKV+GCPHPH+ SDHFPLLVELE++ T +  A  N
Sbjct  480  YIFYTKTGMVPLGLLGPVSNDWLRENKVVGCPHPHIPSDHFPLLVELELMHTASQQAPPN  539

Query  542  GVVTLR  547
            G++  R
Sbjct  540  GLINRR  545


>Q7K112_DROME unnamed protein product
Length=552

 Score = 787 bits (2033),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/546 (69%), Positives = 454/546 (83%), Gaps = 7/546 (1%)

Query  4    KDKFESNASSRRTHTYMSAEDQASGKKSYWTELEITGTIRNLSPNLFQMTHLTALYLKNN  63
            KDK++S  ++RR   ++S ED A+GKK+ W+ LEITG +RN+SP+L++  HLTALYL +N
Sbjct  12   KDKYDS--ANRRQQIFLSQEDIAAGKKTNWSGLEITGCVRNISPSLWEFEHLTALYLNDN  69

Query  64   CLQRLPTDICQLTNLRNLDLSYNKLRSLPAELGELIHLRELHLAHNYLRILPYELGKLFN  123
             L RLP D+  LT+LR LDLS NKLRSLPAELGELI LREL L +N+LR+LPYE+GKLF+
Sbjct  70   QLLRLPADVGMLTSLRTLDLSSNKLRSLPAELGELIQLRELLLNNNFLRVLPYEIGKLFH  129

Query  124  LMILSLMGNPLSKDIMQIYSEPNGTQKLLTFMLDNLQVTTPSPPPRPWIPLARPSTNRPT  183
            L+IL LMGNPL K+ M IY+EPNGTQKLLT+MLDNL  T   PP RPW+PLA+P+  RP 
Sbjct  130  LVILGLMGNPLQKEFMNIYNEPNGTQKLLTYMLDNLSFTVNPPPQRPWLPLAKPNKTRPA  189

Query  184  CIFTVMCYNVLCDKLATRQMYSYCPSWALNWEYRKKGILEEIKHYGADIINLQEVEMEQF  243
            CIFTVMCYNVLCDK ATRQMY YCPSWAL WEYRKK I++EI+HY ADII+LQE+E EQF
Sbjct  190  CIFTVMCYNVLCDKYATRQMYGYCPSWALCWEYRKKSIIDEIRHYAADIISLQEIETEQF  249

Query  244  YNYFLPELKMDGYNGIYSPKSRAKHMAESERKYVDGCAIFYRTSKFTLVKEHLVEFNQLA  303
            Y++FLPELK DGY GI+SPKSRAK M+E ERKYVDGCAIF+R SKFTL+KE L+EFNQLA
Sbjct  250  YHFFLPELKNDGYEGIFSPKSRAKTMSELERKYVDGCAIFFRASKFTLIKESLIEFNQLA  309

Query  304  MANADGLEHMLNRVMPKDNIGLAALLQTTDAAWDNTPPDAPFIHQPLLVCTAHIHWDPEF  363
            MANA+G ++MLNRVMPKDNIGLAALL+  + AW+    +   I QPLLVCTAHIHWDPEF
Sbjct  310  MANAEGSDNMLNRVMPKDNIGLAALLKVKENAWEPM-SEVTQISQPLLVCTAHIHWDPEF  368

Query  364  CDVKLIQTMMLSNELKSILEQSAETLKAHNLHLDPSNIQLVLCGDFNSLPDSGVIEFLGT  423
            CDVKLIQTMMLSNELK+I+++++ + +  + + D + +QL+LCGDFNSLPDSGV+EFLG 
Sbjct  369  CDVKLIQTMMLSNELKTIIDEASHSFRPGHKN-DSNAVQLLLCGDFNSLPDSGVVEFLGK  427

Query  424  GRVSQDHKDFKAFSYKSCLEKILSCDKPNEFTHSFKLASAYNDEIMPFTNYTFDFKGIID  483
            GRVS DH DFK   YKSCL+++LS D  NEFTHSFKLASAYN++IMP TNYTFDFKGIID
Sbjct  428  GRVSMDHLDFKDMGYKSCLQRLLSNDT-NEFTHSFKLASAYNEDIMPHTNYTFDFKGIID  486

Query  484  YIFYAKQTMTPLGLLGPLSQEWLQQNKVIGCPHPHVYSDHFPLLVELEMVPTIT--AAMN  541
            YIFY K  M PLGLLGP+S +WL++NKV+GCPHPH+ SDHFPLLVELE++ T +  A  N
Sbjct  487  YIFYTKTGMVPLGLLGPVSNDWLRENKVVGCPHPHIPSDHFPLLVELELMHTASQQAPPN  546

Query  542  GVVTLR  547
            G++  R
Sbjct  547  GLINRR  552


>Q8IMX1_DROME unnamed protein product
Length=567

 Score = 787 bits (2032),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/546 (69%), Positives = 454/546 (83%), Gaps = 7/546 (1%)

Query  4    KDKFESNASSRRTHTYMSAEDQASGKKSYWTELEITGTIRNLSPNLFQMTHLTALYLKNN  63
            KDK++S  ++RR   ++S ED A+GKK+ W+ LEITG +RN+SP+L++  HLTALYL +N
Sbjct  27   KDKYDS--ANRRQQIFLSQEDIAAGKKTNWSGLEITGCVRNISPSLWEFEHLTALYLNDN  84

Query  64   CLQRLPTDICQLTNLRNLDLSYNKLRSLPAELGELIHLRELHLAHNYLRILPYELGKLFN  123
             L RLP D+  LT+LR LDLS NKLRSLPAELGELI LREL L +N+LR+LPYE+GKLF+
Sbjct  85   QLLRLPADVGMLTSLRTLDLSSNKLRSLPAELGELIQLRELLLNNNFLRVLPYEIGKLFH  144

Query  124  LMILSLMGNPLSKDIMQIYSEPNGTQKLLTFMLDNLQVTTPSPPPRPWIPLARPSTNRPT  183
            L+IL LMGNPL K+ M IY+EPNGTQKLLT+MLDNL  T   PP RPW+PLA+P+  RP 
Sbjct  145  LVILGLMGNPLQKEFMNIYNEPNGTQKLLTYMLDNLSFTVNPPPQRPWLPLAKPNKTRPA  204

Query  184  CIFTVMCYNVLCDKLATRQMYSYCPSWALNWEYRKKGILEEIKHYGADIINLQEVEMEQF  243
            CIFTVMCYNVLCDK ATRQMY YCPSWAL WEYRKK I++EI+HY ADII+LQE+E EQF
Sbjct  205  CIFTVMCYNVLCDKYATRQMYGYCPSWALCWEYRKKSIIDEIRHYAADIISLQEIETEQF  264

Query  244  YNYFLPELKMDGYNGIYSPKSRAKHMAESERKYVDGCAIFYRTSKFTLVKEHLVEFNQLA  303
            Y++FLPELK DGY GI+SPKSRAK M+E ERKYVDGCAIF+R SKFTL+KE L+EFNQLA
Sbjct  265  YHFFLPELKNDGYEGIFSPKSRAKTMSELERKYVDGCAIFFRASKFTLIKESLIEFNQLA  324

Query  304  MANADGLEHMLNRVMPKDNIGLAALLQTTDAAWDNTPPDAPFIHQPLLVCTAHIHWDPEF  363
            MANA+G ++MLNRVMPKDNIGLAALL+  + AW+    +   I QPLLVCTAHIHWDPEF
Sbjct  325  MANAEGSDNMLNRVMPKDNIGLAALLKVKENAWEPM-SEVTQISQPLLVCTAHIHWDPEF  383

Query  364  CDVKLIQTMMLSNELKSILEQSAETLKAHNLHLDPSNIQLVLCGDFNSLPDSGVIEFLGT  423
            CDVKLIQTMMLSNELK+I+++++ + +  + + D + +QL+LCGDFNSLPDSGV+EFLG 
Sbjct  384  CDVKLIQTMMLSNELKTIIDEASHSFRPGHKN-DSNAVQLLLCGDFNSLPDSGVVEFLGK  442

Query  424  GRVSQDHKDFKAFSYKSCLEKILSCDKPNEFTHSFKLASAYNDEIMPFTNYTFDFKGIID  483
            GRVS DH DFK   YKSCL+++LS D  NEFTHSFKLASAYN++IMP TNYTFDFKGIID
Sbjct  443  GRVSMDHLDFKDMGYKSCLQRLLSNDT-NEFTHSFKLASAYNEDIMPHTNYTFDFKGIID  501

Query  484  YIFYAKQTMTPLGLLGPLSQEWLQQNKVIGCPHPHVYSDHFPLLVELEMVPTIT--AAMN  541
            YIFY K  M PLGLLGP+S +WL++NKV+GCPHPH+ SDHFPLLVELE++ T +  A  N
Sbjct  502  YIFYTKTGMVPLGLLGPVSNDWLRENKVVGCPHPHIPSDHFPLLVELELMHTASQQAPPN  561

Query  542  GVVTLR  547
            G++  R
Sbjct  562  GLINRR  567


>Q8MTZ5_DROME unnamed protein product
Length=566

 Score = 774 bits (1999),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/567 (66%), Positives = 454/567 (80%), Gaps = 28/567 (5%)

Query  4    KDKFESNASSRRTHTYMSAEDQASGKKSYWTELEITG---------------------TI  42
            KDK++S  ++RR   ++S ED A+GKK+ W+ LEITG                      +
Sbjct  5    KDKYDS--ANRRQQIFLSQEDIAAGKKTNWSGLEITGGYHTLNPEKYHINSTIHLFTGCV  62

Query  43   RNLSPNLFQMTHLTALYLKNNCLQRLPTDICQLTNLRNLDLSYNKLRSLPAELGELIHLR  102
            RN+SP+L++  HLTALYL +N L RLP D+  LT+LR LDLS NKLRSLPAELGELI LR
Sbjct  63   RNISPSLWEFEHLTALYLNDNQLLRLPADVGMLTSLRTLDLSSNKLRSLPAELGELIQLR  122

Query  103  ELHLAHNYLRILPYELGKLFNLMILSLMGNPLSKDIMQIYSEPNGTQKLLTFMLDNLQVT  162
            EL L +N+LR+LPYE+GKLF+L+IL LMGNPL K+ M IY+EPNGTQKLLT+MLDNL  T
Sbjct  123  ELLLNNNFLRVLPYEIGKLFHLVILGLMGNPLQKEFMNIYNEPNGTQKLLTYMLDNLSFT  182

Query  163  TPSPPPRPWIPLARPSTNRPTCIFTVMCYNVLCDKLATRQMYSYCPSWALNWEYRKKGIL  222
               PP RPW+PLA+P+  RP CIFTVMCYNVLCDK ATRQMY YCPSWAL WEYRKK I+
Sbjct  183  VNPPPQRPWLPLAKPNKTRPACIFTVMCYNVLCDKYATRQMYGYCPSWALCWEYRKKSII  242

Query  223  EEIKHYGADIINLQEVEMEQFYNYFLPELKMDGYNGIYSPKSRAKHMAESERKYVDGCAI  282
            +EI+HY ADII+LQE+E EQFY++FLPELK DGY GI+SPKSRAK M+E ERKYVDGCAI
Sbjct  243  DEIRHYAADIISLQEIETEQFYHFFLPELKNDGYEGIFSPKSRAKTMSELERKYVDGCAI  302

Query  283  FYRTSKFTLVKEHLVEFNQLAMANADGLEHMLNRVMPKDNIGLAALLQTTDAAWDNTPPD  342
            F+R SKFTL+KE L+EFNQLAMANA+G ++MLNRVMPKDNIGLAALL+  + AW+    +
Sbjct  303  FFRASKFTLIKESLIEFNQLAMANAEGSDNMLNRVMPKDNIGLAALLKVKENAWEPM-SE  361

Query  343  APFIHQPLLVCTAHIHWDPEFCDVKLIQTMMLSNELKSILEQSAETLKAHNLHLDPSNIQ  402
               I QPLLVCTAHIHWDPEFCDVKLIQTMMLSNELK+I+++++ + +  + + D + +Q
Sbjct  362  VTQISQPLLVCTAHIHWDPEFCDVKLIQTMMLSNELKTIIDEASHSFRPGHKN-DSNAVQ  420

Query  403  LVLCGDFNSLPDSGVIEFLGTGRVSQDHKDFKAFSYKSCLEKILSCDKPNEFTHSFKLAS  462
            L+LCGDFNSLPDSGV+EFLG GRVS DH DFK   YKSCL+++LS D  NEFTHSFKLAS
Sbjct  421  LLLCGDFNSLPDSGVVEFLGKGRVSMDHLDFKDMGYKSCLQRLLSNDT-NEFTHSFKLAS  479

Query  463  AYNDEIMPFTNYTFDFKGIIDYIFYAKQTMTPLGLLGPLSQEWLQQNKVIGCPHPHVYSD  522
            AYN++IMP TNYTFDFKGIIDYIFY K  M PLGLLGP+S +WL++NKV+GCPHPH+ SD
Sbjct  480  AYNEDIMPHTNYTFDFKGIIDYIFYTKTGMVPLGLLGPVSNDWLRENKVVGCPHPHIPSD  539

Query  523  HFPLLVELEMVPTIT--AAMNGVVTLR  547
            HFPLLVELE++ T +  A  NG++  R
Sbjct  540  HFPLLVELELMHTASQQAPPNGLINRR  566


>Q9U1P4_CAEEL unnamed protein product
Length=613

 Score = 590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/528 (53%), Positives = 370/528 (70%), Gaps = 12/528 (2%)

Query  15   RTHTYMSAEDQASGKKSYWTELEITGTIRNLSPNLFQMTHLTALYLKNNCLQRLPTDICQ  74
            R H  ++ ++ ASG+ + WTELEI G ++NLSP+L+Q+THL+AL+L NN L RLP +I Q
Sbjct  56   RVHRVLTEDEIASGRSTRWTELEIHGRVKNLSPSLWQLTHLSALFLNNNGLTRLPPEIAQ  115

Query  75   LTNLRNLDLSYNKLRSLPAELGELIHLRELHLAHNYLRILPYELGKLFNLMILSLMGNPL  134
            LTNL  LD+S NKLRSLP ELG++I L  L+L +N LR+LPYELGKLF +  L L GNPL
Sbjct  116  LTNLTMLDISNNKLRSLPTELGDMISLCHLYLNNNQLRVLPYELGKLFRIQTLGLQGNPL  175

Query  135  SKDIMQIYSEPNGTQKLLTFMLDNLQVTTPSPPPRPWIPLARPSTNRPTCIFTVMCYNVL  194
            S +I +IY E NG QK+L F+LD+L + T  PP R W+ +      RP   FTV+CYNVL
Sbjct  176  SPEISKIYHETNGAQKILQFLLDHLTINTHPPPERNWVMIRHADPERPIATFTVLCYNVL  235

Query  195  CDKLATRQMYSYCPSWALNWEYRKKGILEEIKHYGADIINLQEVEMEQFYNYFLPELKMD  254
            CDK AT   YSYCPSWALNWEYRK  I++EI+ Y AD+I LQEVE EQF   F PELK  
Sbjct  236  CDKYATVNQYSYCPSWALNWEYRKGLIIKEIRTYEADVITLQEVETEQFRTLFQPELKQL  295

Query  255  GYNGIYSPKSRAKHMAESERKYVDGCAIFYRTSKFTLVKEHLVEFNQLAMANADGLEHML  314
            GY GI+  KSRAK M E ERKYVDGCAIF++  KF + K++L EF+ +AM  A   E+ML
Sbjct  296  GYAGIFEAKSRAKTMGEEERKYVDGCAIFWKVDKFDMDKQYLFEFSSVAMKKASTSENML  355

Query  315  NRVMPKDNIGLAALLQTTDAAWDN-------TPPDAPFIHQPLLVCTAHIHWDPEFCDVK  367
            NRVMP+DNIGL A+L+  ++ + N        P +   +  PL+V TAHIHWDPEFCDVK
Sbjct  356  NRVMPRDNIGLCAVLKIKESVYANKFLGRMQIPMNDNVVGNPLVVATAHIHWDPEFCDVK  415

Query  368  LIQTMMLSNELKSILEQSAETLKAHNLHLDPSNIQLVLCGDFNSLPDSGVIEFLGTGRVS  427
            L+Q+MML++E+  +LE+ ++  +     +    + +++CGDFNSLPDSGV E+L  G+++
Sbjct  416  LVQSMMLTHEVSRVLEEVSKKYQ-----ITQQQVPVLICGDFNSLPDSGVFEYLSKGQIT  470

Query  428  QDHKDFKAFSYKSCLEKILSCDKPNEFTHSFKLASAYNDEIMPFTNYTFDFKGIIDYIFY  487
            + H D K+F   SCLEK  +    N  +H  +L SA +   +PFTNYT DFKG+IDYIF 
Sbjct  471  RRHMDLKSFRDDSCLEKFTNSTDKNVISHPLRLDSACDINSIPFTNYTLDFKGMIDYIFA  530

Query  488  AKQTMTPLGLLGPLSQEWLQQNKVIGCPHPHVYSDHFPLLVELEMVPT  535
              Q++  LG+LGP   +W+Q NK++G PHPHV SDH P++ +  ++PT
Sbjct  531  TPQSLARLGILGPFDPQWVQSNKILGFPHPHVASDHIPIMAQYAIIPT  578



Lambda      K        H
   0.320    0.135    0.434 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3573877230


Query= XP_018560801.1 uncharacterized protein LOC108903195 [Anoplophora
glabripennis]

Length=445
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9N3Y4_CAEEL  unnamed protein product                                 30.0    4.3  


>Q9N3Y4_CAEEL unnamed protein product
Length=563

 Score = 30.0 bits (66),  Expect = 4.3, Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 31/64 (48%), Gaps = 4/64 (6%)

Query  135  ASTKVFENSNNKKPNKCQEQQ---NSSGAGVDAVSVTSDESSGSANSENCLPRIIKPRKR  191
             S K+ E +N+K PN  +EQQ   N     V A+     +      +E C   IIK ++R
Sbjct  388  VSKKIAEGANDK-PNSAKEQQLRKNIRLYAVQALQGLIGQMESLPTAEECSNLIIKRKER  446

Query  192  RKKD  195
            R KD
Sbjct  447  RAKD  450



Lambda      K        H
   0.320    0.135    0.434 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3573877230


Query= XP_018560802.1 moesin/ezrin/radixin homolog 1 isoform X1
[Anoplophora glabripennis]

Length=569
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MOEH_DROME  unnamed protein product                                   964     0.0   
G5EES2_CAEEL  unnamed protein product                                 706     0.0   
G5EBK3_CAEEL  unnamed protein product                                 706     0.0   
MERH_DROME  unnamed protein product                                   437     6e-147
H2KYX3_CAEEL  unnamed protein product                                 340     1e-108


>MOEH_DROME unnamed protein product
Length=578

 Score = 964 bits (2493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 478/578 (83%), Positives = 522/578 (90%), Gaps = 10/578 (2%)

Query  2    VSSKLMNVRVTTMDAELEFAIQQTTSGKQLFDQVVKTIGLREVWFFGLQYTDSKGDLTWV  61
            +S K +NVRVTTMDAELEFAIQ TT+GKQLFDQVVKTIGLREVWFFGLQYTDSKGD TW+
Sbjct  1    MSPKALNVRVTTMDAELEFAIQSTTTGKQLFDQVVKTIGLREVWFFGLQYTDSKGDSTWI  60

Query  62   KLYRKVMSQDVKKENPLQFKFRAKFYPEDVAEELIQDITLRLFYLQVKNAILSDEIYCPP  121
            KLY+KVM+QDVKKENPLQF+FRAKFYPEDVAEELIQDITLRLFYLQVKNAIL+DEIYCPP
Sbjct  61   KLYKKVMNQDVKKENPLQFRFRAKFYPEDVAEELIQDITLRLFYLQVKNAILTDEIYCPP  120

Query  122  ETSVLLASYAVQARHGDYQKGMHNAGFLANDRLLPQRVMDQHKMSKEEWENSIMTWWKEH  181
            ETSVLLASYAVQARHGD+ K  H AGFLANDRLLPQRV+DQHKMSK+EWE SIMTWW+EH
Sbjct  121  ETSVLLASYAVQARHGDHNKTTHTAGFLANDRLLPQRVIDQHKMSKDEWEQSIMTWWQEH  180

Query  182  RGMLREDAMMEYLKIAQDLEMYGVNYFEIRNKKGTELYLGVDALGLNIYEKDDQLTPKIG  241
            R MLREDAMMEYLKIAQDLEMYGVNYFEIRNKKGT+L+LGVDALGLNIYE+DD+LTPKIG
Sbjct  181  RSMLREDAMMEYLKIAQDLEMYGVNYFEIRNKKGTDLWLGVDALGLNIYEQDDRLTPKIG  240

Query  242  FPWSEIRNISFNDRKFIIKPIDKKAPDFVFFAPRVRINKRILALCMGNHELYMRRRKPDT  301
            FPWSEIRNISF+++KFIIKPIDKKAPDF+FFAPRVRINKRILALCMGNHELYMRRRKPDT
Sbjct  241  FPWSEIRNISFSEKKFIIKPIDKKAPDFMFFAPRVRINKRILALCMGNHELYMRRRKPDT  300

Query  302  IDVQQMKAQAREEKLAKQQQREKLQFEIAARERAEKKQQEYEDRIKAMQEEMERSQANLQ  361
            IDVQQMKAQAREEK AKQQ+REKLQ  +AARERAEKKQQEYEDR+K MQE+MERSQ +L 
Sbjct  301  IDVQQMKAQAREEKNAKQQEREKLQLALAARERAEKKQQEYEDRLKQMQEDMERSQRDLL  360

Query  362  EAQEMIRRLEEQLKQLQAAKEELEKRQNELQAMMERLEESKNMEAAERQKLEDEIRAKQM  421
            EAQ+MIRRLEEQLKQLQAAK+ELE RQ ELQAM++RLEE+KNMEA E+ KLE+EI AKQM
Sbjct  361  EAQDMIRRLEEQLKQLQAAKDELELRQKELQAMLQRLEEAKNMEAVEKLKLEEEIMAKQM  420

Query  422  EVQRIQEEVEAKDNETKRLQDEVEAARRKE------EELKQQQIANATKGHLEENDHNED  475
            EVQRIQ+EV AKD ETKRLQDEVE ARRK+                    H+ E+++  +
Sbjct  421  EVQRIQDEVNAKDEETKRLQDEVEDARRKQVIAAEAAAALLAASTTPQHHHVAEDENENE  480

Query  476  DELVN----GDVSKDLSTDENIVDPIEDRRTLAERNERLQDQLQALKKDLAQSRDETKET  531
            +EL N    GDVS+DL TDE+I DPIEDRRTLAERNERL DQL+ALK+DLAQSRDETKET
Sbjct  481  EELTNGDAGGDVSRDLDTDEHIKDPIEDRRTLAERNERLHDQLKALKQDLAQSRDETKET  540

Query  532  AMDKIHRENVRQGRDKYKTLREIRKGNTKRRVDQFENM  569
            A DKIHRENVRQGRDKYKTLREIRKGNTKRRVDQFENM
Sbjct  541  ANDKIHRENVRQGRDKYKTLREIRKGNTKRRVDQFENM  578


>G5EES2_CAEEL unnamed protein product
Length=563

 Score = 706 bits (1823),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/568 (61%), Positives = 440/568 (77%), Gaps = 5/568 (1%)

Query  2    VSSKLMNVRVTTMDAELEFAIQQTTSGKQLFDQVVKTIGLREVWFFGLQYTDSKGDLTWV  61
            +S K +NVRVT+MD+ELEFAIQ +T+GKQLFDQVVKTIGLRE+W+FGLQYTD+KG  TW+
Sbjct  1    MSKKAINVRVTSMDSELEFAIQSSTTGKQLFDQVVKTIGLREIWYFGLQYTDNKGFPTWL  60

Query  62   KLYRKVMSQDVKKENPLQFKFRAKFYPEDVAEELIQDITLRLFYLQVKNAILSDEIYCPP  121
            KL +KV+SQDVKK+  L FKFRAKFYPEDVAEE+IQD+T+RLFYLQVK+ ILSDEIYCPP
Sbjct  61   KLNKKVLSQDVKKDPTLVFKFRAKFYPEDVAEEIIQDVTMRLFYLQVKDGILSDEIYCPP  120

Query  122  ETSVLLASYAVQARHGDYQKGMHNAGFLANDRLLPQRVMDQHKMSKEEWENSIMTWWKEH  181
            ETSVLLASYA+QA++GDY    H AG L  DRLLPQRV+ Q K++ EEWE  IMTWW +H
Sbjct  121  ETSVLLASYAMQAKYGDYVPETHVAGCLTADRLLPQRVLGQFKLNSEEWERRIMTWWADH  180

Query  182  RGMLREDAMMEYLKIAQDLEMYGVNYFEIRNKKGTELYLGVDALGLNIYEKDDQLTPKIG  241
            R   RE AM+EYLKIAQDLEMYGVNYFEIRNKKGT+LYLGVDALGLNIY+K D+L+PK+G
Sbjct  181  RATTREQAMLEYLKIAQDLEMYGVNYFEIRNKKGTDLYLGVDALGLNIYDKADRLSPKVG  240

Query  242  FPWSEIRNISFNDRKFIIKPIDKKAPDFVFFAPRVRINKRILALCMGNHELYMRRRKPDT  301
            FPWSEIRNISFND+KF+IKPIDKKA DFVF+APR+RINKRILALCMGNHELYMRRRKPDT
Sbjct  241  FPWSEIRNISFNDKKFVIKPIDKKAHDFVFYAPRLRINKRILALCMGNHELYMRRRKPDT  300

Query  302  IDVQQMKAQAREEKLAKQQQREKLQFEIAARERAEKKQQEYEDRIKAMQEEMERSQANLQ  361
            I+VQQMK QARE++  K  ++EKL  E++ARE AE++Q++ E R+  MQE+MER++  L 
Sbjct  301  IEVQQMKQQAREDRALKIAEQEKLTREMSAREEAEQRQRDAEKRMAQMQEDMERARLELA  360

Query  362  EAQEMIRRLEEQLKQLQAAKEELEKRQNELQAMMERLEESKNMEAAERQKLEDEIRAKQM  421
            EA   I  LE QLKQLQ AK+ LE+++ EL+ +  +L+  K M   ER+ L D++ A++ 
Sbjct  361  EAHNTIHSLEAQLKQLQLAKQALEQKEYELRELTAQLQSEKAMSDGERRHLRDQVDARER  420

Query  422  EVQRIQEEVEAKDNETKRLQDEVEAARRKEEELKQQQIANATKGHLEENDHNEDDELVNG  481
            EV  ++EEVE +   T++LQ ++ + +  +       ++N   GH  +    +D++  NG
Sbjct  421  EVFSMREEVERQTTVTRQLQTQIHSQQHTQHYSNSHHVSN---GHAHDETATDDED--NG  475

Query  482  DVSKDLSTDENIVDPIEDRRTLAERNERLQDQLQALKKDLAQSRDETKETAMDKIHRENV  541
                    D+N+     +R T AE+N +++++L  L ++L   +D+   T  D +H EN 
Sbjct  476  ATELTNDADQNVPQHELERVTAAEKNIQIKNKLDMLTRELDSVKDQNAVTDYDVLHMENK  535

Query  542  RQGRDKYKTLREIRKGNTKRRVDQFENM  569
            + GRDKYKTLR+IR GNTKRR+DQ+ENM
Sbjct  536  KAGRDKYKTLRQIRGGNTKRRIDQYENM  563


>G5EBK3_CAEEL unnamed protein product
Length=564

 Score = 706 bits (1823),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/569 (60%), Positives = 441/569 (78%), Gaps = 5/569 (1%)

Query  1    MVSSKLMNVRVTTMDAELEFAIQQTTSGKQLFDQVVKTIGLREVWFFGLQYTDSKGDLTW  60
            MV++  +NVRVT+MD+ELEFAIQ +T+GKQLFDQVVKTIGLRE+W+FGLQYTD+KG  TW
Sbjct  1    MVAAGDINVRVTSMDSELEFAIQSSTTGKQLFDQVVKTIGLREIWYFGLQYTDNKGFPTW  60

Query  61   VKLYRKVMSQDVKKENPLQFKFRAKFYPEDVAEELIQDITLRLFYLQVKNAILSDEIYCP  120
            +KL +KV+SQDVKK+  L FKFRAKFYPEDVAEE+IQD+T+RLFYLQVK+ ILSDEIYCP
Sbjct  61   LKLNKKVLSQDVKKDPTLVFKFRAKFYPEDVAEEIIQDVTMRLFYLQVKDGILSDEIYCP  120

Query  121  PETSVLLASYAVQARHGDYQKGMHNAGFLANDRLLPQRVMDQHKMSKEEWENSIMTWWKE  180
            PETSVLLASYA+QA++GDY    H AG L  DRLLPQRV+ Q K++ EEWE  IMTWW +
Sbjct  121  PETSVLLASYAMQAKYGDYVPETHVAGCLTADRLLPQRVLGQFKLNSEEWERRIMTWWAD  180

Query  181  HRGMLREDAMMEYLKIAQDLEMYGVNYFEIRNKKGTELYLGVDALGLNIYEKDDQLTPKI  240
            HR   RE AM+EYLKIAQDLEMYGVNYFEIRNKKGT+LYLGVDALGLNIY+K D+L+PK+
Sbjct  181  HRATTREQAMLEYLKIAQDLEMYGVNYFEIRNKKGTDLYLGVDALGLNIYDKADRLSPKV  240

Query  241  GFPWSEIRNISFNDRKFIIKPIDKKAPDFVFFAPRVRINKRILALCMGNHELYMRRRKPD  300
            GFPWSEIRNISFND+KF+IKPIDKKA DFVF+APR+RINKRILALCMGNHELYMRRRKPD
Sbjct  241  GFPWSEIRNISFNDKKFVIKPIDKKAHDFVFYAPRLRINKRILALCMGNHELYMRRRKPD  300

Query  301  TIDVQQMKAQAREEKLAKQQQREKLQFEIAARERAEKKQQEYEDRIKAMQEEMERSQANL  360
            TI+VQQMK QARE++  K  ++EKL  E++ARE AE++Q++ E R+  MQE+MER++  L
Sbjct  301  TIEVQQMKQQAREDRALKIAEQEKLTREMSAREEAEQRQRDAEKRMAQMQEDMERARLEL  360

Query  361  QEAQEMIRRLEEQLKQLQAAKEELEKRQNELQAMMERLEESKNMEAAERQKLEDEIRAKQ  420
             EA   I  LE QLKQLQ AK+ LE+++ EL+ +  +L+  K M   ER+ L D++ A++
Sbjct  361  AEAHNTIHSLEAQLKQLQLAKQALEQKEYELRELTAQLQSEKAMSDGERRHLRDQVDARE  420

Query  421  MEVQRIQEEVEAKDNETKRLQDEVEAARRKEEELKQQQIANATKGHLEENDHNEDDELVN  480
             EV  ++EEVE +   T++LQ ++ + +  +       ++N   GH  +    +D++  N
Sbjct  421  REVFSMREEVERQTTVTRQLQTQIHSQQHTQHYSNSHHVSN---GHAHDETATDDED--N  475

Query  481  GDVSKDLSTDENIVDPIEDRRTLAERNERLQDQLQALKKDLAQSRDETKETAMDKIHREN  540
            G        D+N+     +R T AE+N +++++L  L ++L   +D+   T  D +H EN
Sbjct  476  GATELTNDADQNVPQHELERVTAAEKNIQIKNKLDMLTRELDSVKDQNAVTDYDVLHMEN  535

Query  541  VRQGRDKYKTLREIRKGNTKRRVDQFENM  569
             + GRDKYKTLR+IR GNTKRR+DQ+ENM
Sbjct  536  KKAGRDKYKTLRQIRGGNTKRRIDQYENM  564


>MERH_DROME unnamed protein product
Length=635

 Score = 437 bits (1125),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 247/625 (40%), Positives = 368/625 (59%), Gaps = 63/625 (10%)

Query  7    MNVRVTTMDAELEFAIQQTTSGKQLFDQVVKTIGLREVWFFGLQYTDSKGDLTWVKLYRK  66
            ++VRV+T D+ELEF ++   SG+ LFD V +TIGLRE W+FGLQY D++ +++W+K+ ++
Sbjct  12   LSVRVSTFDSELEFKLEPRASGQDLFDLVCRTIGLRESWYFGLQYVDTRSNVSWLKMEKR  71

Query  67   VMSQDVK---KENPLQFKFRAKFYPEDVAEELIQDITLRLFYLQVKNAILSDEIYCPPET  123
            V  Q V+     N   F F AKF+PE+V+EELIQ+IT  LF+LQVK +ILS +IYC PE 
Sbjct  72   VRDQRVELHASNNVYVFSFYAKFFPENVSEELIQEITQHLFFLQVKQSILSMDIYCRPEA  131

Query  124  SVLLASYAVQARHGDYQKGMHNAGFLANDRLLPQRVMDQHKMSKEEWENSIMTWWKEHRG  183
            SVLLASYAV  ++G Y    +  G LA   LLP+ V DQ++M+ E WE  I TW+ +H  
Sbjct  132  SVLLASYAVHVQYGPYDYETYKDGMLAGGELLPKGVTDQYQMTPEMWEERIKTWYMDHEP  191

Query  184  MLREDAMMEYLKIAQDLEMYGVNYFEIRNKKGTELYLGVDALGLNIYEKDDQLTPKIGFP  243
            M R++  MEYLKIAQDL+MYGVNYF I NK  T+L+LGV ++GLNIY++ D+LTPK  F 
Sbjct  192  MTRDEVEMEYLKIAQDLDMYGVNYFPITNKNKTKLWLGVTSVGLNIYDERDKLTPKTTFQ  251

Query  244  WSEIRNISFNDRKFIIKPIDKKAPDFVFFAPRVRINKRILALCMGNHELYMRRRKPDTID  303
            W+EIR++SF+D+KF I+ +D K  +F+F++  + INK IL LC GNH+LYMRRRKPDT++
Sbjct  252  WNEIRHVSFDDKKFTIRLVDAKVSNFIFYSQDLHINKMILDLCKGNHDLYMRRRKPDTME  311

Query  304  VQQMKAQAREEKLAKQQQREKLQFEIAARERAEKKQQEYEDRIKAMQEEMERSQANLQEA  363
            +QQMKAQA+EEK  +Q +R+K   E   RE+AE ++ E E  ++ +Q EM  +   L+ +
Sbjct  312  IQQMKAQAKEEKQRRQIERKKFIREKKLREKAEHERYELEKSMEHLQNEMRMANDALRRS  371

Query  364  QEMIRRLEEQLKQLQAAKEELEKRQNELQAMMERLEESKNMEAAERQKLEDEIRAKQMEV  423
            +E      E+ +  +   +  E + N  +  M+RL E +     E+  LE +IR     V
Sbjct  372  EETKELYFEKSRVNEEQMQLTECKANHFKTEMDRLRERQMKIEREKHDLEKKIRDADFYV  431

Query  424  QRIQEEVEAKDNETKRLQDEVEAARRKEEE--------------------LKQQQIANA-  462
             ++  E + ++ ET++L+ E+  A+  E E                    L    +++A 
Sbjct  432  HQLTVENDKREAETEKLRKELICAKMAEREATARLLEFLNSGRKSSTDSLLTASSVSHAA  491

Query  463  ------------------------TKGHLEENDHNEDDELVNGDVSKDLSTD--------  490
                                    T G  E   H+    LV GD S  +S D        
Sbjct  492  NTASSMAAISTPSLITSSSTNDLETAGGAELTTHS-SHYLVQGDNSSGISDDFEPKEFIL  550

Query  491  -----ENIVDPIEDRRTLAERNER-LQDQLQALKKDLAQSRDETKETAMDKIHRENVRQG  544
                 E I + +E       RN + +Q QLQ L+ ++A  + E  ++ +D +    ++ G
Sbjct  551  TDNEMEQITNEMERNHLDYLRNSKQVQSQLQTLRSEIAPHKIEENQSNLDILSEAQIKAG  610

Query  545  RDKYKTLREIRKGNTKRRVDQFENM  569
             +KY TL++++ G+TK RV  FE +
Sbjct  611  ENKYSTLKKLKSGSTKARVAFFEEL  635


>H2KYX3_CAEEL unnamed protein product
Length=709

 Score = 340 bits (873),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 180/431 (42%), Positives = 279/431 (65%), Gaps = 16/431 (4%)

Query  3    SSKLMNVRVTTMDAELE-FAIQQTTSGKQLFDQVVKTIGLREVWFFGLQYTDSKGDLTWV  61
            ++K +  +V+TMDA+LE   I++T +G+ LF+ V + IGLRE W+FGLQ+T+ K    W+
Sbjct  10   NTKPIYAKVSTMDADLEKIVIEKTWTGRHLFEAVCRIIGLRETWYFGLQFTNKKNIPCWL  69

Query  62   KLYRKVMSQDVKKENP---LQFKFRAKFYPEDVAEELIQDITLRLFYLQVKNAILSDEIY  118
            +  + +  QD++K+       F F  KFYPEDV  E+I D T  LF+LQ++ AILS  +Y
Sbjct  70   QNDKTICGQDIQKDTSDGTFNFLFLVKFYPEDVEPEIILDATRHLFFLQIREAILSMNLY  129

Query  119  CPPETSVLLASYAVQARHGDYQKGMHNAGFLANDRLLPQRVMDQHKMSKEEWENSIMTWW  178
            C PE SVLLAS+AVQA HGD  +     G +  D+ LP+ V+DQ+ MS + W + I  WW
Sbjct  130  CSPEASVLLASFAVQAMHGDCTE---EVGPIDLDKHLPKSVIDQYDMSADMWRDRIKRWW  186

Query  179  KEHRGMLREDAMMEYLKIAQDLEMYGVNYFEIRNKKGTELYLGVDALGLNIYEKDDQLTP  238
              + G  RE+A +EYL++AQDLEMYG+ Y+ I N K T+L+LG+ A GL IY+  +++TP
Sbjct  187  SRNAGQSREEAELEYLRVAQDLEMYGILYYPICNNKETDLHLGISAQGLGIYKGVNRITP  246

Query  239  KIGFPWSEIRNISFNDRKFIIKPIDKKAPDFVFFAPRVRINKRILALCMGNHELYMRRRK  298
            +  F WSEI+NI F +RKF +K +DK      F +    I+  IL LC+G H LY+RRR+
Sbjct  247  RPFFSWSEIKNIQFKNRKFHMKTVDKST--ISFRSRETSIDSSILDLCIGTHNLYLRRRQ  304

Query  299  PDTIDVQQMKAQAREEKLAKQQQREKLQFEIAARERAEKKQQEYEDRIKAMQEEMERSQA  358
            PDT++VQQM++QA+E+K  +  ++ K+  E   R++ EK+ +E + +++ M  E+ ++Q 
Sbjct  305  PDTLEVQQMRSQAKEDKQRRAAEQAKVALERKERQQMEKEYKEMKQKVEVMTLELMKAQE  364

Query  359  NLQEAQEMIRRLEEQLKQLQAAKEELEKRQNELQAMMERLEESKNMEA------AERQKL  412
            N+++A+E   +L E+ +  +     L K+++E++A   RL  + NM++       ER+  
Sbjct  365  NIRKAEEANDQLAEKARHSEHETLMLYKQKSEVEAECNRLSMN-NMKSEEALLRMERKAR  423

Query  413  EDEIRAKQMEV  423
            E EI AKQM +
Sbjct  424  EAEILAKQMSM  434


 Score = 30.4 bits (67),  Expect = 5.5, Method: Compositional matrix adjust.
 Identities = 17/52 (33%), Positives = 26/52 (50%), Gaps = 2/52 (4%)

Query  501  RTLAERNERLQDQLQALKKDLAQSRDETKETAMDKIHRENVRQGRDKYKTLR  552
            R   E  E L+  +  LK+D      + +E   D +H +NV  G DK+ T+R
Sbjct  588  RIFKEHLEELRGDIDGLKRDGNVQNGQHREH--DAVHAQNVAHGFDKFTTMR  637



Lambda      K        H
   0.320    0.135    0.434 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3573877230


Query= XP_018560803.1 moesin/ezrin/radixin homolog 1 isoform X2
[Anoplophora glabripennis]

Length=567
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MOEH_DROME  unnamed protein product                                   965     0.0   
G5EES2_CAEEL  unnamed protein product                                 704     0.0   
G5EBK3_CAEEL  unnamed protein product                                 703     0.0   
MERH_DROME  unnamed protein product                                   438     4e-147
H2KYX3_CAEEL  unnamed protein product                                 340     2e-108


>MOEH_DROME unnamed protein product
Length=578

 Score = 965 bits (2495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 478/576 (83%), Positives = 521/576 (90%), Gaps = 10/576 (2%)

Query  2    PKQMNVRVTTMDAELEFAIQQTTSGKQLFDQVVKTIGLREVWFFGLQYTDSKGDLTWVKL  61
            PK +NVRVTTMDAELEFAIQ TT+GKQLFDQVVKTIGLREVWFFGLQYTDSKGD TW+KL
Sbjct  3    PKALNVRVTTMDAELEFAIQSTTTGKQLFDQVVKTIGLREVWFFGLQYTDSKGDSTWIKL  62

Query  62   YRKVMSQDVKKENPLQFKFRAKFYPEDVAEELIQDITLRLFYLQVKNAILSDEIYCPPET  121
            Y+KVM+QDVKKENPLQF+FRAKFYPEDVAEELIQDITLRLFYLQVKNAIL+DEIYCPPET
Sbjct  63   YKKVMNQDVKKENPLQFRFRAKFYPEDVAEELIQDITLRLFYLQVKNAILTDEIYCPPET  122

Query  122  SVLLASYAVQARHGDYQKGMHNAGFLANDRLLPQRVMDQHKMSKEEWENSIMTWWKEHRG  181
            SVLLASYAVQARHGD+ K  H AGFLANDRLLPQRV+DQHKMSK+EWE SIMTWW+EHR 
Sbjct  123  SVLLASYAVQARHGDHNKTTHTAGFLANDRLLPQRVIDQHKMSKDEWEQSIMTWWQEHRS  182

Query  182  MLREDAMMEYLKIAQDLEMYGVNYFEIRNKKGTELYLGVDALGLNIYEKDDQLTPKIGFP  241
            MLREDAMMEYLKIAQDLEMYGVNYFEIRNKKGT+L+LGVDALGLNIYE+DD+LTPKIGFP
Sbjct  183  MLREDAMMEYLKIAQDLEMYGVNYFEIRNKKGTDLWLGVDALGLNIYEQDDRLTPKIGFP  242

Query  242  WSEIRNISFNDRKFIIKPIDKKAPDFVFFAPRVRINKRILALCMGNHELYMRRRKPDTID  301
            WSEIRNISF+++KFIIKPIDKKAPDF+FFAPRVRINKRILALCMGNHELYMRRRKPDTID
Sbjct  243  WSEIRNISFSEKKFIIKPIDKKAPDFMFFAPRVRINKRILALCMGNHELYMRRRKPDTID  302

Query  302  VQQMKAQAREEKLAKQQQREKLQFEIAARERAEKKQQEYEDRIKAMQEEMERSQANLQEA  361
            VQQMKAQAREEK AKQQ+REKLQ  +AARERAEKKQQEYEDR+K MQE+MERSQ +L EA
Sbjct  303  VQQMKAQAREEKNAKQQEREKLQLALAARERAEKKQQEYEDRLKQMQEDMERSQRDLLEA  362

Query  362  QEMIRRLEEQLKQLQAAKEELEKRQNELQAMMERLEESKNMEAAERQKLEDEIRAKQMEV  421
            Q+MIRRLEEQLKQLQAAK+ELE RQ ELQAM++RLEE+KNMEA E+ KLE+EI AKQMEV
Sbjct  363  QDMIRRLEEQLKQLQAAKDELELRQKELQAMLQRLEEAKNMEAVEKLKLEEEIMAKQMEV  422

Query  422  QRIQEEVEAKDNETKRLQDEVEAARRKE------EELKQQQIANATKGHLEENDHNEDDE  475
            QRIQ+EV AKD ETKRLQDEVE ARRK+                    H+ E+++  ++E
Sbjct  423  QRIQDEVNAKDEETKRLQDEVEDARRKQVIAAEAAAALLAASTTPQHHHVAEDENENEEE  482

Query  476  LVN----GDVSKDLSTDENIVDPIEDRRTLAERNERLQDQLQALKKDLAQSRDETKETAM  531
            L N    GDVS+DL TDE+I DPIEDRRTLAERNERL DQL+ALK+DLAQSRDETKETA 
Sbjct  483  LTNGDAGGDVSRDLDTDEHIKDPIEDRRTLAERNERLHDQLKALKQDLAQSRDETKETAN  542

Query  532  DKIHRENVRQGRDKYKTLREIRKGNTKRRVDQFENM  567
            DKIHRENVRQGRDKYKTLREIRKGNTKRRVDQFENM
Sbjct  543  DKIHRENVRQGRDKYKTLREIRKGNTKRRVDQFENM  578


>G5EES2_CAEEL unnamed protein product
Length=563

 Score = 704 bits (1818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/565 (61%), Positives = 438/565 (78%), Gaps = 5/565 (1%)

Query  3    KQMNVRVTTMDAELEFAIQQTTSGKQLFDQVVKTIGLREVWFFGLQYTDSKGDLTWVKLY  62
            K +NVRVT+MD+ELEFAIQ +T+GKQLFDQVVKTIGLRE+W+FGLQYTD+KG  TW+KL 
Sbjct  4    KAINVRVTSMDSELEFAIQSSTTGKQLFDQVVKTIGLREIWYFGLQYTDNKGFPTWLKLN  63

Query  63   RKVMSQDVKKENPLQFKFRAKFYPEDVAEELIQDITLRLFYLQVKNAILSDEIYCPPETS  122
            +KV+SQDVKK+  L FKFRAKFYPEDVAEE+IQD+T+RLFYLQVK+ ILSDEIYCPPETS
Sbjct  64   KKVLSQDVKKDPTLVFKFRAKFYPEDVAEEIIQDVTMRLFYLQVKDGILSDEIYCPPETS  123

Query  123  VLLASYAVQARHGDYQKGMHNAGFLANDRLLPQRVMDQHKMSKEEWENSIMTWWKEHRGM  182
            VLLASYA+QA++GDY    H AG L  DRLLPQRV+ Q K++ EEWE  IMTWW +HR  
Sbjct  124  VLLASYAMQAKYGDYVPETHVAGCLTADRLLPQRVLGQFKLNSEEWERRIMTWWADHRAT  183

Query  183  LREDAMMEYLKIAQDLEMYGVNYFEIRNKKGTELYLGVDALGLNIYEKDDQLTPKIGFPW  242
             RE AM+EYLKIAQDLEMYGVNYFEIRNKKGT+LYLGVDALGLNIY+K D+L+PK+GFPW
Sbjct  184  TREQAMLEYLKIAQDLEMYGVNYFEIRNKKGTDLYLGVDALGLNIYDKADRLSPKVGFPW  243

Query  243  SEIRNISFNDRKFIIKPIDKKAPDFVFFAPRVRINKRILALCMGNHELYMRRRKPDTIDV  302
            SEIRNISFND+KF+IKPIDKKA DFVF+APR+RINKRILALCMGNHELYMRRRKPDTI+V
Sbjct  244  SEIRNISFNDKKFVIKPIDKKAHDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTIEV  303

Query  303  QQMKAQAREEKLAKQQQREKLQFEIAARERAEKKQQEYEDRIKAMQEEMERSQANLQEAQ  362
            QQMK QARE++  K  ++EKL  E++ARE AE++Q++ E R+  MQE+MER++  L EA 
Sbjct  304  QQMKQQAREDRALKIAEQEKLTREMSAREEAEQRQRDAEKRMAQMQEDMERARLELAEAH  363

Query  363  EMIRRLEEQLKQLQAAKEELEKRQNELQAMMERLEESKNMEAAERQKLEDEIRAKQMEVQ  422
              I  LE QLKQLQ AK+ LE+++ EL+ +  +L+  K M   ER+ L D++ A++ EV 
Sbjct  364  NTIHSLEAQLKQLQLAKQALEQKEYELRELTAQLQSEKAMSDGERRHLRDQVDAREREVF  423

Query  423  RIQEEVEAKDNETKRLQDEVEAARRKEEELKQQQIANATKGHLEENDHNEDDELVNGDVS  482
             ++EEVE +   T++LQ ++ + +  +       ++N   GH  +    +D++  NG   
Sbjct  424  SMREEVERQTTVTRQLQTQIHSQQHTQHYSNSHHVSN---GHAHDETATDDED--NGATE  478

Query  483  KDLSTDENIVDPIEDRRTLAERNERLQDQLQALKKDLAQSRDETKETAMDKIHRENVRQG  542
                 D+N+     +R T AE+N +++++L  L ++L   +D+   T  D +H EN + G
Sbjct  479  LTNDADQNVPQHELERVTAAEKNIQIKNKLDMLTRELDSVKDQNAVTDYDVLHMENKKAG  538

Query  543  RDKYKTLREIRKGNTKRRVDQFENM  567
            RDKYKTLR+IR GNTKRR+DQ+ENM
Sbjct  539  RDKYKTLRQIRGGNTKRRIDQYENM  563


>G5EBK3_CAEEL unnamed protein product
Length=564

 Score = 703 bits (1814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/563 (61%), Positives = 437/563 (78%), Gaps = 5/563 (1%)

Query  5    MNVRVTTMDAELEFAIQQTTSGKQLFDQVVKTIGLREVWFFGLQYTDSKGDLTWVKLYRK  64
            +NVRVT+MD+ELEFAIQ +T+GKQLFDQVVKTIGLRE+W+FGLQYTD+KG  TW+KL +K
Sbjct  7    INVRVTSMDSELEFAIQSSTTGKQLFDQVVKTIGLREIWYFGLQYTDNKGFPTWLKLNKK  66

Query  65   VMSQDVKKENPLQFKFRAKFYPEDVAEELIQDITLRLFYLQVKNAILSDEIYCPPETSVL  124
            V+SQDVKK+  L FKFRAKFYPEDVAEE+IQD+T+RLFYLQVK+ ILSDEIYCPPETSVL
Sbjct  67   VLSQDVKKDPTLVFKFRAKFYPEDVAEEIIQDVTMRLFYLQVKDGILSDEIYCPPETSVL  126

Query  125  LASYAVQARHGDYQKGMHNAGFLANDRLLPQRVMDQHKMSKEEWENSIMTWWKEHRGMLR  184
            LASYA+QA++GDY    H AG L  DRLLPQRV+ Q K++ EEWE  IMTWW +HR   R
Sbjct  127  LASYAMQAKYGDYVPETHVAGCLTADRLLPQRVLGQFKLNSEEWERRIMTWWADHRATTR  186

Query  185  EDAMMEYLKIAQDLEMYGVNYFEIRNKKGTELYLGVDALGLNIYEKDDQLTPKIGFPWSE  244
            E AM+EYLKIAQDLEMYGVNYFEIRNKKGT+LYLGVDALGLNIY+K D+L+PK+GFPWSE
Sbjct  187  EQAMLEYLKIAQDLEMYGVNYFEIRNKKGTDLYLGVDALGLNIYDKADRLSPKVGFPWSE  246

Query  245  IRNISFNDRKFIIKPIDKKAPDFVFFAPRVRINKRILALCMGNHELYMRRRKPDTIDVQQ  304
            IRNISFND+KF+IKPIDKKA DFVF+APR+RINKRILALCMGNHELYMRRRKPDTI+VQQ
Sbjct  247  IRNISFNDKKFVIKPIDKKAHDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTIEVQQ  306

Query  305  MKAQAREEKLAKQQQREKLQFEIAARERAEKKQQEYEDRIKAMQEEMERSQANLQEAQEM  364
            MK QARE++  K  ++EKL  E++ARE AE++Q++ E R+  MQE+MER++  L EA   
Sbjct  307  MKQQAREDRALKIAEQEKLTREMSAREEAEQRQRDAEKRMAQMQEDMERARLELAEAHNT  366

Query  365  IRRLEEQLKQLQAAKEELEKRQNELQAMMERLEESKNMEAAERQKLEDEIRAKQMEVQRI  424
            I  LE QLKQLQ AK+ LE+++ EL+ +  +L+  K M   ER+ L D++ A++ EV  +
Sbjct  367  IHSLEAQLKQLQLAKQALEQKEYELRELTAQLQSEKAMSDGERRHLRDQVDAREREVFSM  426

Query  425  QEEVEAKDNETKRLQDEVEAARRKEEELKQQQIANATKGHLEENDHNEDDELVNGDVSKD  484
            +EEVE +   T++LQ ++ + +  +       ++N   GH  +    +D++  NG     
Sbjct  427  REEVERQTTVTRQLQTQIHSQQHTQHYSNSHHVSN---GHAHDETATDDED--NGATELT  481

Query  485  LSTDENIVDPIEDRRTLAERNERLQDQLQALKKDLAQSRDETKETAMDKIHRENVRQGRD  544
               D+N+     +R T AE+N +++++L  L ++L   +D+   T  D +H EN + GRD
Sbjct  482  NDADQNVPQHELERVTAAEKNIQIKNKLDMLTRELDSVKDQNAVTDYDVLHMENKKAGRD  541

Query  545  KYKTLREIRKGNTKRRVDQFENM  567
            KYKTLR+IR GNTKRR+DQ+ENM
Sbjct  542  KYKTLRQIRGGNTKRRIDQYENM  564


>MERH_DROME unnamed protein product
Length=635

 Score = 438 bits (1126),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 247/627 (39%), Positives = 369/627 (59%), Gaps = 63/627 (10%)

Query  3    KQMNVRVTTMDAELEFAIQQTTSGKQLFDQVVKTIGLREVWFFGLQYTDSKGDLTWVKLY  62
            + ++VRV+T D+ELEF ++   SG+ LFD V +TIGLRE W+FGLQY D++ +++W+K+ 
Sbjct  10   RSLSVRVSTFDSELEFKLEPRASGQDLFDLVCRTIGLRESWYFGLQYVDTRSNVSWLKME  69

Query  63   RKVMSQDVK---KENPLQFKFRAKFYPEDVAEELIQDITLRLFYLQVKNAILSDEIYCPP  119
            ++V  Q V+     N   F F AKF+PE+V+EELIQ+IT  LF+LQVK +ILS +IYC P
Sbjct  70   KRVRDQRVELHASNNVYVFSFYAKFFPENVSEELIQEITQHLFFLQVKQSILSMDIYCRP  129

Query  120  ETSVLLASYAVQARHGDYQKGMHNAGFLANDRLLPQRVMDQHKMSKEEWENSIMTWWKEH  179
            E SVLLASYAV  ++G Y    +  G LA   LLP+ V DQ++M+ E WE  I TW+ +H
Sbjct  130  EASVLLASYAVHVQYGPYDYETYKDGMLAGGELLPKGVTDQYQMTPEMWEERIKTWYMDH  189

Query  180  RGMLREDAMMEYLKIAQDLEMYGVNYFEIRNKKGTELYLGVDALGLNIYEKDDQLTPKIG  239
              M R++  MEYLKIAQDL+MYGVNYF I NK  T+L+LGV ++GLNIY++ D+LTPK  
Sbjct  190  EPMTRDEVEMEYLKIAQDLDMYGVNYFPITNKNKTKLWLGVTSVGLNIYDERDKLTPKTT  249

Query  240  FPWSEIRNISFNDRKFIIKPIDKKAPDFVFFAPRVRINKRILALCMGNHELYMRRRKPDT  299
            F W+EIR++SF+D+KF I+ +D K  +F+F++  + INK IL LC GNH+LYMRRRKPDT
Sbjct  250  FQWNEIRHVSFDDKKFTIRLVDAKVSNFIFYSQDLHINKMILDLCKGNHDLYMRRRKPDT  309

Query  300  IDVQQMKAQAREEKLAKQQQREKLQFEIAARERAEKKQQEYEDRIKAMQEEMERSQANLQ  359
            +++QQMKAQA+EEK  +Q +R+K   E   RE+AE ++ E E  ++ +Q EM  +   L+
Sbjct  310  MEIQQMKAQAKEEKQRRQIERKKFIREKKLREKAEHERYELEKSMEHLQNEMRMANDALR  369

Query  360  EAQEMIRRLEEQLKQLQAAKEELEKRQNELQAMMERLEESKNMEAAERQKLEDEIRAKQM  419
             ++E      E+ +  +   +  E + N  +  M+RL E +     E+  LE +IR    
Sbjct  370  RSEETKELYFEKSRVNEEQMQLTECKANHFKTEMDRLRERQMKIEREKHDLEKKIRDADF  429

Query  420  EVQRIQEEVEAKDNETKRLQDEVEAARRKEEE--------------------LKQQQIAN  459
             V ++  E + ++ ET++L+ E+  A+  E E                    L    +++
Sbjct  430  YVHQLTVENDKREAETEKLRKELICAKMAEREATARLLEFLNSGRKSSTDSLLTASSVSH  489

Query  460  A-------------------------TKGHLEENDHNEDDELVNGDVSKDLSTD------  488
            A                         T G  E   H+    LV GD S  +S D      
Sbjct  490  AANTASSMAAISTPSLITSSSTNDLETAGGAELTTHS-SHYLVQGDNSSGISDDFEPKEF  548

Query  489  -------ENIVDPIEDRRTLAERNER-LQDQLQALKKDLAQSRDETKETAMDKIHRENVR  540
                   E I + +E       RN + +Q QLQ L+ ++A  + E  ++ +D +    ++
Sbjct  549  ILTDNEMEQITNEMERNHLDYLRNSKQVQSQLQTLRSEIAPHKIEENQSNLDILSEAQIK  608

Query  541  QGRDKYKTLREIRKGNTKRRVDQFENM  567
             G +KY TL++++ G+TK RV  FE +
Sbjct  609  AGENKYSTLKKLKSGSTKARVAFFEEL  635


>H2KYX3_CAEEL unnamed protein product
Length=709

 Score = 340 bits (873),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 180/429 (42%), Positives = 277/429 (65%), Gaps = 16/429 (4%)

Query  3    KQMNVRVTTMDAELE-FAIQQTTSGKQLFDQVVKTIGLREVWFFGLQYTDSKGDLTWVKL  61
            K +  +V+TMDA+LE   I++T +G+ LF+ V + IGLRE W+FGLQ+T+ K    W++ 
Sbjct  12   KPIYAKVSTMDADLEKIVIEKTWTGRHLFEAVCRIIGLRETWYFGLQFTNKKNIPCWLQN  71

Query  62   YRKVMSQDVKKENP---LQFKFRAKFYPEDVAEELIQDITLRLFYLQVKNAILSDEIYCP  118
             + +  QD++K+       F F  KFYPEDV  E+I D T  LF+LQ++ AILS  +YC 
Sbjct  72   DKTICGQDIQKDTSDGTFNFLFLVKFYPEDVEPEIILDATRHLFFLQIREAILSMNLYCS  131

Query  119  PETSVLLASYAVQARHGDYQKGMHNAGFLANDRLLPQRVMDQHKMSKEEWENSIMTWWKE  178
            PE SVLLAS+AVQA HGD  +     G +  D+ LP+ V+DQ+ MS + W + I  WW  
Sbjct  132  PEASVLLASFAVQAMHGDCTE---EVGPIDLDKHLPKSVIDQYDMSADMWRDRIKRWWSR  188

Query  179  HRGMLREDAMMEYLKIAQDLEMYGVNYFEIRNKKGTELYLGVDALGLNIYEKDDQLTPKI  238
            + G  RE+A +EYL++AQDLEMYG+ Y+ I N K T+L+LG+ A GL IY+  +++TP+ 
Sbjct  189  NAGQSREEAELEYLRVAQDLEMYGILYYPICNNKETDLHLGISAQGLGIYKGVNRITPRP  248

Query  239  GFPWSEIRNISFNDRKFIIKPIDKKAPDFVFFAPRVRINKRILALCMGNHELYMRRRKPD  298
             F WSEI+NI F +RKF +K +DK      F +    I+  IL LC+G H LY+RRR+PD
Sbjct  249  FFSWSEIKNIQFKNRKFHMKTVDKST--ISFRSRETSIDSSILDLCIGTHNLYLRRRQPD  306

Query  299  TIDVQQMKAQAREEKLAKQQQREKLQFEIAARERAEKKQQEYEDRIKAMQEEMERSQANL  358
            T++VQQM++QA+E+K  +  ++ K+  E   R++ EK+ +E + +++ M  E+ ++Q N+
Sbjct  307  TLEVQQMRSQAKEDKQRRAAEQAKVALERKERQQMEKEYKEMKQKVEVMTLELMKAQENI  366

Query  359  QEAQEMIRRLEEQLKQLQAAKEELEKRQNELQAMMERLEESKNMEA------AERQKLED  412
            ++A+E   +L E+ +  +     L K+++E++A   RL  + NM++       ER+  E 
Sbjct  367  RKAEEANDQLAEKARHSEHETLMLYKQKSEVEAECNRLSMN-NMKSEEALLRMERKAREA  425

Query  413  EIRAKQMEV  421
            EI AKQM +
Sbjct  426  EILAKQMSM  434


 Score = 30.4 bits (67),  Expect = 5.3, Method: Compositional matrix adjust.
 Identities = 17/52 (33%), Positives = 26/52 (50%), Gaps = 2/52 (4%)

Query  499  RTLAERNERLQDQLQALKKDLAQSRDETKETAMDKIHRENVRQGRDKYKTLR  550
            R   E  E L+  +  LK+D      + +E   D +H +NV  G DK+ T+R
Sbjct  588  RIFKEHLEELRGDIDGLKRDGNVQNGQHREH--DAVHAQNVAHGFDKFTTMR  637



Lambda      K        H
   0.320    0.135    0.434 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3573877230


Query= XP_018560804.1 probable E3 ubiquitin-protein ligase HERC4 isoform X1
[Anoplophora glabripennis]

Length=1050
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

E8NHA2_DROME  unnamed protein product                                 1188    0.0  
Q9VTH1_DROME  unnamed protein product                                 275     1e-77
SMUF1_DROME  unnamed protein product                                  220     8e-59
U4PBY0_CAEEL  unnamed protein product                                 194     6e-50
NEDD4_DROME  unnamed protein product                                  192     7e-50


>E8NHA2_DROME unnamed protein product
Length=1062

 Score = 1188 bits (3073),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 586/1061 (55%), Positives = 770/1061 (73%), Gaps = 16/1061 (2%)

Query  1     MFAWGSTIHGELGLGGIEDEHILTPRALDWYLANTVIYAALGENHTLFLTKEGKVYSCGS  60
             ++ WGST HG+LGLGGIEDE ILTP  + W     V   A G  HTLFLT  GKVY+CGS
Sbjct  7     LYCWGSTSHGQLGLGGIEDEQILTPSQIPWTPDTAVQQVACGHRHTLFLTATGKVYACGS  66

Query  61    NDYGQLGHDQPRKRPRMSLFKPVTGLDAHVITHVACGSMHSMALNQWGQVYSWGSDYHGQ  120
             NDY QLGHD P KRPRMS F  +  L  +VI  + CGS HS+AL+ WGQV SWG +  GQ
Sbjct  67    NDYSQLGHDLPTKRPRMSPFLLIPELQDYVIIQICCGSRHSLALSDWGQVLSWGDNDCGQ  126

Query  121   LGLDIGENIQATPKFVRALGTYHILQICCGQRHSLALANSGEILAWGANNFGQLGLG--N  178
             LG    + I   PK VR L T  ++QI CG  HSLAL + GE+ +WG+N +GQLG+   N
Sbjct  127   LGHATDKEIVQLPKVVRQLVTKTVVQIACGNNHSLALTSCGELYSWGSNIYGQLGVNSPN  186

Query  179   LSSSEVKPKVIHSLTGIPVAFIACGANHSFAISKSGAVYGWGKNTRGQLGLNDTNNKMFP  238
               +    P  + +L GIP+A IACG NHSF ISKSGAV+GWG+N  GQLGLND  N+ +P
Sbjct  187   DLTHCNYPLRLTTLLGIPLAAIACGGNHSFLISKSGAVFGWGRNNCGQLGLNDETNRSYP  246

Query  239   TQLRTLRNIRVRYIACGEEFSTFLTMDGGVFTCGAGMFGQLGHGSNTNEILPRQVVELMG  298
             TQL+TLR + VR++ACG+EFS FLT +GGVFTCGAG +GQLGHG ++NE+LPR V+ELMG
Sbjct  247   TQLKTLRTLGVRFVACGDEFSVFLTNEGGVFTCGAGAYGQLGHGFSSNEMLPRMVMELMG  306

Query  299   STITQIASGRQHSLALVPSRGRVYSFGIGGSGQLGLRKPTSSMTPQVVLGPWVSPSGISL  358
             STITQ+A G +H+LALVPSRGRVY+FG+G SGQLG R   S M PQVV+GPWVSPSG +L
Sbjct  307   STITQVACGNRHTLALVPSRGRVYAFGLGSSGQLGTRSTKSLMLPQVVIGPWVSPSGSAL  366

Query  359   VPTPGNNQNFVIHRIFSGGDHCFVSVVKQNSDIPPYDCREYNPQTQILHLTQDYVKNLLR  418
             + +  +  + VI +IFSGGD   V+       +PP D R YNP++QIL LT +  K   +
Sbjct  367   LQSNDSQVSLVIRQIFSGGDQSIVTTTLFVDKVPPEDFRNYNPKSQILTLTAEVTKQCAQ  426

Query  419   TPGNVQVEQEVLSFLETVFKSLSCLNGSFLLNDEKHYYCSSRHHGVNLEEAEGTFSLIGK  478
                 +Q + ++LS +E +F+S +C NGSFLL+ ++H+ CS R+HG++L+ A+  F  +  
Sbjct  427   CKQGLQSDMDLLSSIELIFRSQACWNGSFLLDHDRHFGCSVRNHGLDLKAAQLAFDNLRA  486

Query  479   IENNSIKDLIWNCITENIVSQLSPSPPDVEALRIYLTLPLYHEFNNPKQHLRLQKPFVKA  538
             +EN SI+ +IW+ IT+ +V  L  SP DVE++R+YL LPLYHEF N K +  LQ PF  A
Sbjct  487   VENESIRQVIWDNITKELVGSLVCSPADVESMRLYLLLPLYHEFVNSKHYKSLQVPFANA  546

Query  539   LLGLKQPANKVVGSWYSMTSCDYFERLINVFKSVAVYILSNQ-----KIPQG----QTAF  589
             +  L +   KV+  W + T  +YFE L+  F  V ++I+S +       P      Q   
Sbjct  547   IFKLAENPRKVLNKWLAQTPAEYFEHLVQNFLHVVIHIISFKMGLAAASPSAERRQQLLP  606

Query  590   YDPSLVAMLDILAYLNKLNHSVDGLRVPYDTFHIIELSEFMDVRVDYVYWLSDPGTGKLF  649
             Y+  L  +L ++  L ++N+     R+ Y  F+  +LS++ DV+ +YV W+         
Sbjct  607   YNTELEIILKLMKTLCQINNERHD-RLNYQIFYWPDLSDYADVQQEYVKWIMADTARDFN  665

Query  650   LCNYPFVFDAHAKLQLLETDQSIQMQKAMSDAAQQAFLSMLISPQGMHAINQFLVLNVTR  709
             +CNY F+FD  AK  LL+ DQ++QM  AM++AA  AF        GM  I+QF+VLNVTR
Sbjct  666   ICNYSFIFDQSAKTALLQADQALQMHSAMANAATMAFSFF---NYGM-PISQFIVLNVTR  721

Query  710   DHIVDDALRELSHVNPSDLKKPLKVKFCGEEAEDAGGVTKEFFLLLLREILDPKYGMFKE  769
             +++V D+LREL H + SDLKKPLK+KF GEEAEDAGGV KEFF+LLL+++LDPKYGMFKE
Sbjct  722   ENLVQDSLRELQHYSQSDLKKPLKIKFHGEEAEDAGGVRKEFFMLLLKDLLDPKYGMFKE  781

Query  770   YEETRTIWFAENSFEDNDVYFLIGMILGLAIYNFTIIDIPFPLALYKKLLSEPIGLSDLK  829
             YE++R +WFA+ +FE  ++YFLIG++ GLAIYNFTII++PFPLAL+KKLL +P+ LSDL+
Sbjct  782   YEQSRLLWFADLTFETENMYFLIGVLCGLAIYNFTIINLPFPLALFKKLLGKPVDLSDLR  841

Query  830   GLSPMMANSLQSLLDYEGNDMQDVFSLSFDISRDMFGEAVTIPLKPNGSNVPVTQENKQE  889
              LSP  ANS+QSLLDY+G+D ++VF L+F+ISRD+FGEA T  LKPNG+ + VT EN+QE
Sbjct  842   QLSPPEANSMQSLLDYQGDDFKEVFDLTFEISRDVFGEAETKCLKPNGNEIAVTLENRQE  901

Query  890   YVNLYINYIFNESVKHQYEAFHKGFMKVCGGRVLQLFHSHELMAVVIGNENYDWHALEEA  949
             +V+LY++++FN+SV+  Y AFHKGFMKVC GRV+ +F   ELMAVV+GNE+YDW AL++ 
Sbjct  902   FVDLYVDFVFNKSVELHYNAFHKGFMKVCSGRVIHIFQPEELMAVVVGNEDYDWQALQDN  961

Query  950   AEYKNGYKSSDQTIRWFWEVLHEMSLTDKKKFLVYLTGSYRIPIQGMKAIKIVVQPTNDD  1009
              EY+ GY S D TI+WFWEV+H+MS  +KK FL++LTGS RIPIQGMKA+K+ +QPT D+
Sbjct  962   CEYREGYTSVDDTIKWFWEVIHDMSEAEKKSFLLFLTGSDRIPIQGMKALKLTIQPTPDE  1021

Query  1010  KFLPVAHTCFNLLDLPRYKTKERLRYKLMQAIQQTEGFSLV  1050
             +FLPVAHTCFNLLDLPRYKTKERL+YKL+QAIQQT+GFSLV
Sbjct  1022  RFLPVAHTCFNLLDLPRYKTKERLKYKLLQAIQQTQGFSLV  1062


 Score = 101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 67/186 (36%), Positives = 96/186 (52%), Gaps = 6/186 (3%)

Query  157  LANSGEILAWGANNFGQLGLGNLSSSEV-KPKVIHSLTGIPVAFIACGANHSFAISKSGA  215
            +A+  E+  WG+ + GQLGLG +   ++  P  I       V  +ACG  H+  ++ +G 
Sbjct  1    MASGKELYCWGSTSHGQLGLGGIEDEQILTPSQIPWTPDTAVQQVACGHRHTLFLTATGK  60

Query  216  VYGWGKNTRGQLG--LNDTNNKMFPTQL-RTLRNIRVRYIACGEEFSTFLTMDGGVFTCG  272
            VY  G N   QLG  L     +M P  L   L++  +  I CG   S  L+  G V + G
Sbjct  61   VYACGSNDYSQLGHDLPTKRPRMSPFLLIPELQDYVIIQICCGSRHSLALSDWGQVLSWG  120

Query  273  AGMFGQLGHGSNTNEI-LPRQVVELMGSTITQIASGRQHSLALVPSRGRVYSFGIGGSGQ  331
                GQLGH ++   + LP+ V +L+  T+ QIA G  HSLAL  S G +YS+G    GQ
Sbjct  121  DNDCGQLGHATDKEIVQLPKVVRQLVTKTVVQIACGNNHSLALT-SCGELYSWGSNIYGQ  179

Query  332  LGLRKP  337
            LG+  P
Sbjct  180  LGVNSP  185


>Q9VTH1_DROME unnamed protein product
Length=973

 Score = 275 bits (702),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 150/354 (42%), Positives = 224/354 (63%), Gaps = 6/354 (2%)

Query  703   LVLNVTRDHIVDDALRELSHV---NPSDLKKPLKVKFCGEEAEDAGGVTKEFFLLLLREI  759
             L L V RD +++DAL  L  V   NP DLKK L V+F GE+  D GGV+KEFF L++ EI
Sbjct  620   LKLTVRRDQLINDALIGLEMVAMSNPKDLKKQLVVEFVGEQGIDEGGVSKEFFQLIVEEI  679

Query  760   LDPKYGMFKEYEETRTIWFAENSFEDNDVYFLIGMILGLAIYNFTIIDIPFPLALYKKLL  819
              +P +GMF + EET  +WF    FE+   + LIG+I+GLAIYN   + + FP+ +Y+KL+
Sbjct  680   FNPAFGMFIQQEETNNMWFNATPFENGAQFTLIGIIIGLAIYNNVTLAVNFPMVVYRKLI  739

Query  820   SEPIGLSDLKGLSPMMANSLQSLLDYEGNDMQDVFSLSFDIS-RDMFGEAVTIPLKPNGS  878
                   +DL   SP +  SL+S+LDY+G DM++VF  +F IS  D+FG+ V   L PNG 
Sbjct  740   GYCGTFADLSDWSPALYKSLKSMLDYQGQDMEEVFEQTFKISYSDVFGDVVQHELVPNGQ  799

Query  879   NVPVTQENKQEYVNLYINYIFNESVKHQYEAFHKGFMKVCGGRVLQ-LFHSHELMAVVIG  937
             +V V Q NK+ +VNLY +++ N +++ Q+ AF KGF  V     L+ LF   E+  +V G
Sbjct  800   DVLVGQHNKELFVNLYSDFLLNTNIEQQFNAFRKGFEMVTDESPLKLLFRPEEIEMLVCG  859

Query  938   NENYDWHALEEAAEYKNGYKSSDQTIRWFWEVLHEMSLTDKKKFLVYLTGSYRIPIQGMK  997
             +  +D+  LE +  Y+ GY    Q I+ FW ++H M   DK K L + TGS R+P+ G+K
Sbjct  860   SREFDFVELENSTVYEGGYTEKSQYIQDFWSIVHAMPSEDKHKLLEFTTGSARVPVGGLK  919

Query  998   AIKIVV-QPTNDDKFLPVAHTCFNLLDLPRYKTKERLRYKLMQAIQQTEGFSLV  1050
              +++++ +   D   LP +HTCFN+L LP Y ++E+L  +LM+AI  ++GF ++
Sbjct  920   CLRLLITRHGPDSDRLPTSHTCFNVLLLPEYSSREKLEERLMKAINYSKGFGML  973


>SMUF1_DROME unnamed protein product
Length=1061

 Score = 220 bits (560),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 127/372 (34%), Positives = 211/372 (57%), Gaps = 20/372 (5%)

Query  694   QGMHAINQFLVLNVTRDHIVDDALRELSHVNPSDLKKPLKVKFCGEEAEDAGGVTKEFFL  753
             Q M   +    L V+R+ I +++ R +  +   D++K L VKF GEE  D GGV +E+  
Sbjct  693   QTMQPQSGHCRLEVSRNEIFEESYRLIMKMRAKDMRKRLMVKFKGEEGLDYGGVAREWLH  752

Query  754   LLLREILDPKYGMFK-EYEETRTIWFAENSFEDND--VYF-LIGMILGLAIYNFTIIDIP  809
             LL RE+L+P+YG+F+   ++  T+    +S  + D   YF  +G  LG+A+++   +D  
Sbjct  753   LLSREMLNPQYGLFQYSRDDHYTLQINPDSGVNPDHLSYFHFVGRTLGIAVFHGHCLDGG  812

Query  810   FPLALYKKLLSEPIGLSDLKGLSPMMANSLQSLLDYEGNDMQDVFSLSFDISRDMFGEAV  869
             F    YK+LL++PI L D++G+ P +  SL  +L+   +++  +   +F +  + FG  V
Sbjct  813   FTTPFYKQLLNKPITLGDIEGVDPDLHRSLTWMLE---SNISGIIESTFSVENNSFGALV  869

Query  870   TIPLKPNGSNVPVTQENKQEYVNLYINYIFNESVKHQYEAFHKGFMKVCGGRVLQLFHSH  929
                LKP G+++PVT+ENK+EYV LY+NY F   ++ Q+ A  KGF ++    +L+ F   
Sbjct  870   VHELKPGGASIPVTEENKREYVKLYVNYRFMRGIEQQFLALQKGFCELIPSHLLRPFDER  929

Query  930   ELMAVVIGNENYDWHALEEAAEYKNGYKSSDQTIRWFWEVLHEMSLTDKKKFLVYLTGSY  989
             EL  V+ G  + D +        K+    + Q + WFW+V+   S   + + L ++TGS 
Sbjct  930   ELELVIGGISSIDVNDWRNNTRLKHCTNETTQVL-WFWQVVESYSSEMRARLLQFVTGSS  988

Query  990   RIPIQGMKAIK----------IVVQPTND--DKFLPVAHTCFNLLDLPRYKTKERLRYKL  1037
             R+P+QG +A++            +  T D   + LP AHTCFN +DLP Y+T + L  KL
Sbjct  989   RVPLQGFRALQGSTGAVGPRLFTIHLTADVPTQNLPKAHTCFNRIDLPPYETYQLLCDKL  1048

Query  1038  MQAIQQTEGFSL  1049
              QA+++T GF++
Sbjct  1049  TQAVEETCGFAV  1060


>U4PBY0_CAEEL unnamed protein product
Length=4185

 Score = 194 bits (493),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 115/357 (32%), Positives = 186/357 (52%), Gaps = 18/357 (5%)

Query  705   LNVTRDHIVDDALRELSHVNPSDLKKPLKVKFCGEEAEDAGGVTKEFFLLLLREILDPKY  764
             + V+R+ +  D+ REL  + PS+ K    + F GEE +DAGG+ +E+F ++ REI +P Y
Sbjct  3830  VQVSRNRVFSDSFRELFRLRPSEWKNRFYIIFQGEEGQDAGGLLREWFSVITREIFNPNY  3889

Query  765   GMFKEYE-ETRTIWFAENSF---EDNDVYFLIGMILGLAIYNFTIIDIPFPLALYKKLLS  820
              +F     +  T    + S+   E  D +  +G ++  +++    +D  F  A YK +L+
Sbjct  3890  ALFITAPGDMVTYMINKASYINPEHLDYFKFVGRLIAKSVFEHKYLDCYFTRAFYKHILN  3949

Query  821   EPIGLSDLKGLSPMMANSLQSLLDYEGNDMQDVFSLSFDISRDMFGEAVTIPLKPNGSNV  880
              P+   DL+   P    SL  LL    +D+     L+F    + FG      LKPNG  +
Sbjct  3950  LPVRYQDLESEDPAFFKSLDFLLQNPIDDL--ALDLTFSTEVEEFGVRSVRDLKPNGRKI  4007

Query  881   PVTQENKQEYVNLYINYIFNESVKHQYEAFHKGFMKVCGGRVLQLFHSHELMAVVIGNEN  940
              V   NK EYV L        S++ Q +AF  GF ++    ++ +F+  EL  ++ G   
Sbjct  4008  EVNDANKDEYVKLVCQMKMTGSIRKQLDAFLTGFYEIIPKDLISMFNEQELELLISGLPT  4067

Query  941   YDWHALEEAAEYKNGYKSSDQTIRWFWEVLHEMSLTDKKKFLVYLTGSYRIPIQGMKAIK  1000
              D   +    +YK G++ +   I+WFW  L      DK KFL ++TG+ ++P+QG  +++
Sbjct  4068  VDIDDMAANTDYK-GFQKTSTHIQWFWRALRSFEKEDKAKFLQFVTGTSKVPLQGFASLE  4126

Query  1001  ---------IVVQPTNDDKFLPVAHTCFNLLDLPRYKTKERLRYKLMQAIQQ-TEGF  1047
                      I +     D+ LP AHTCFN LDLP+Y++ E+LR  L+ AI++ TEGF
Sbjct  4127  GMNGVQKFSIHMDSRGGDR-LPAAHTCFNQLDLPQYESYEKLRQSLLLAIRECTEGF  4182


>NEDD4_DROME unnamed protein product
Length=1007

 Score = 192 bits (488),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 123/365 (34%), Positives = 195/365 (53%), Gaps = 20/365 (5%)

Query  700   NQFLVLNVTRDHIVDDALRELSHVNPSDL-KKPLKVKFCGEEAEDAGGVTKEFFLLLLRE  758
             N+F +  + R  I++D+ R +S V  +DL K  L V+F GE   D GG+ +E+F LL +E
Sbjct  648   NKFEI-RIRRTSILEDSYRIISSVTKTDLLKTKLWVEFEGETGLDYGGLAREWFYLLSKE  706

Query  759   ILDPKYGMFKEYEETRTIWFAENS-----FEDNDVYF-LIGMILGLAIYNFTIIDIPFPL  812
             + +P YG+F EY          N+      E++  YF  IG I G+A+Y+  ++D  F  
Sbjct  707   MFNPYYGLF-EYSAMDNYTLQINNGSGLCNEEHLSYFKFIGRIAGMAVYHGKLLDAFFIR  765

Query  813   ALYKKLLSEPIGLSDLKGLSPMMANSLQSLLDYEGNDMQDVFSLSFDISRDMFGEAVTIP  872
               YK +L +PI L D++ +     NSL  + +   ND + +  L+F +  D+FG+     
Sbjct  766   PFYKMMLQKPIDLKDMESVDTEYYNSLMWIKE---NDPR-ILELTFCLDEDVFGQKSQHE  821

Query  873   LKPNGSNVPVTQENKQEYVNLYINYIFNESVKHQYEAFHKGFMKVCGGRVLQLFHSHELM  932
             LKP G+N+ VT ENK EY+ L I + F   VK Q  +F  GF  +    ++++F  HEL 
Sbjct  822   LKPGGANIDVTNENKDEYIKLVIEWRFVARVKEQMSSFLDGFGSIIPLNLIKIFDEHELE  881

Query  933   AVVIGNENYDWHALEEAAEYKNGYKSSDQTIRWFWEVLHEMSLTDKKKFLVYLTGSYRIP  992
              ++ G +N D     E   YK  Y  +   I+WFW  +   S   + + L ++TG+ R+P
Sbjct  882   LLMCGIQNIDVKDWRENTLYKGDYHMNHIIIQWFWRAVLSFSNEMRSRLLQFVTGTSRVP  941

Query  993   IQGMKAI-------KIVVQPTNDDKFLPVAHTCFNLLDLPRYKTKERLRYKLMQAIQQTE  1045
             + G K +          ++        P AHTCFN LDLP Y+   +L+ KL++AI+ ++
Sbjct  942   MNGFKELYGSNGPQMFTIEKWGTPNNFPRAHTCFNRLDLPPYEGYLQLKDKLIKAIEGSQ  1001

Query  1046  GFSLV  1050
             GF+ V
Sbjct  1002  GFAGV  1006



Lambda      K        H
   0.320    0.135    0.434 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3573877230


Query= XP_018560805.1 probable E3 ubiquitin-protein ligase HERC4 isoform X1
[Anoplophora glabripennis]

Length=1050
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

E8NHA2_DROME  unnamed protein product                                 1188    0.0  
Q9VTH1_DROME  unnamed protein product                                 275     1e-77
SMUF1_DROME  unnamed protein product                                  220     8e-59
U4PBY0_CAEEL  unnamed protein product                                 194     6e-50
NEDD4_DROME  unnamed protein product                                  192     7e-50


>E8NHA2_DROME unnamed protein product
Length=1062

 Score = 1188 bits (3073),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 586/1061 (55%), Positives = 770/1061 (73%), Gaps = 16/1061 (2%)

Query  1     MFAWGSTIHGELGLGGIEDEHILTPRALDWYLANTVIYAALGENHTLFLTKEGKVYSCGS  60
             ++ WGST HG+LGLGGIEDE ILTP  + W     V   A G  HTLFLT  GKVY+CGS
Sbjct  7     LYCWGSTSHGQLGLGGIEDEQILTPSQIPWTPDTAVQQVACGHRHTLFLTATGKVYACGS  66

Query  61    NDYGQLGHDQPRKRPRMSLFKPVTGLDAHVITHVACGSMHSMALNQWGQVYSWGSDYHGQ  120
             NDY QLGHD P KRPRMS F  +  L  +VI  + CGS HS+AL+ WGQV SWG +  GQ
Sbjct  67    NDYSQLGHDLPTKRPRMSPFLLIPELQDYVIIQICCGSRHSLALSDWGQVLSWGDNDCGQ  126

Query  121   LGLDIGENIQATPKFVRALGTYHILQICCGQRHSLALANSGEILAWGANNFGQLGLG--N  178
             LG    + I   PK VR L T  ++QI CG  HSLAL + GE+ +WG+N +GQLG+   N
Sbjct  127   LGHATDKEIVQLPKVVRQLVTKTVVQIACGNNHSLALTSCGELYSWGSNIYGQLGVNSPN  186

Query  179   LSSSEVKPKVIHSLTGIPVAFIACGANHSFAISKSGAVYGWGKNTRGQLGLNDTNNKMFP  238
               +    P  + +L GIP+A IACG NHSF ISKSGAV+GWG+N  GQLGLND  N+ +P
Sbjct  187   DLTHCNYPLRLTTLLGIPLAAIACGGNHSFLISKSGAVFGWGRNNCGQLGLNDETNRSYP  246

Query  239   TQLRTLRNIRVRYIACGEEFSTFLTMDGGVFTCGAGMFGQLGHGSNTNEILPRQVVELMG  298
             TQL+TLR + VR++ACG+EFS FLT +GGVFTCGAG +GQLGHG ++NE+LPR V+ELMG
Sbjct  247   TQLKTLRTLGVRFVACGDEFSVFLTNEGGVFTCGAGAYGQLGHGFSSNEMLPRMVMELMG  306

Query  299   STITQIASGRQHSLALVPSRGRVYSFGIGGSGQLGLRKPTSSMTPQVVLGPWVSPSGISL  358
             STITQ+A G +H+LALVPSRGRVY+FG+G SGQLG R   S M PQVV+GPWVSPSG +L
Sbjct  307   STITQVACGNRHTLALVPSRGRVYAFGLGSSGQLGTRSTKSLMLPQVVIGPWVSPSGSAL  366

Query  359   VPTPGNNQNFVIHRIFSGGDHCFVSVVKQNSDIPPYDCREYNPQTQILHLTQDYVKNLLR  418
             + +  +  + VI +IFSGGD   V+       +PP D R YNP++QIL LT +  K   +
Sbjct  367   LQSNDSQVSLVIRQIFSGGDQSIVTTTLFVDKVPPEDFRNYNPKSQILTLTAEVTKQCAQ  426

Query  419   TPGNVQVEQEVLSFLETVFKSLSCLNGSFLLNDEKHYYCSSRHHGVNLEEAEGTFSLIGK  478
                 +Q + ++LS +E +F+S +C NGSFLL+ ++H+ CS R+HG++L+ A+  F  +  
Sbjct  427   CKQGLQSDMDLLSSIELIFRSQACWNGSFLLDHDRHFGCSVRNHGLDLKAAQLAFDNLRA  486

Query  479   IENNSIKDLIWNCITENIVSQLSPSPPDVEALRIYLTLPLYHEFNNPKQHLRLQKPFVKA  538
             +EN SI+ +IW+ IT+ +V  L  SP DVE++R+YL LPLYHEF N K +  LQ PF  A
Sbjct  487   VENESIRQVIWDNITKELVGSLVCSPADVESMRLYLLLPLYHEFVNSKHYKSLQVPFANA  546

Query  539   LLGLKQPANKVVGSWYSMTSCDYFERLINVFKSVAVYILSNQ-----KIPQG----QTAF  589
             +  L +   KV+  W + T  +YFE L+  F  V ++I+S +       P      Q   
Sbjct  547   IFKLAENPRKVLNKWLAQTPAEYFEHLVQNFLHVVIHIISFKMGLAAASPSAERRQQLLP  606

Query  590   YDPSLVAMLDILAYLNKLNHSVDGLRVPYDTFHIIELSEFMDVRVDYVYWLSDPGTGKLF  649
             Y+  L  +L ++  L ++N+     R+ Y  F+  +LS++ DV+ +YV W+         
Sbjct  607   YNTELEIILKLMKTLCQINNERHD-RLNYQIFYWPDLSDYADVQQEYVKWIMADTARDFN  665

Query  650   LCNYPFVFDAHAKLQLLETDQSIQMQKAMSDAAQQAFLSMLISPQGMHAINQFLVLNVTR  709
             +CNY F+FD  AK  LL+ DQ++QM  AM++AA  AF        GM  I+QF+VLNVTR
Sbjct  666   ICNYSFIFDQSAKTALLQADQALQMHSAMANAATMAFSFF---NYGM-PISQFIVLNVTR  721

Query  710   DHIVDDALRELSHVNPSDLKKPLKVKFCGEEAEDAGGVTKEFFLLLLREILDPKYGMFKE  769
             +++V D+LREL H + SDLKKPLK+KF GEEAEDAGGV KEFF+LLL+++LDPKYGMFKE
Sbjct  722   ENLVQDSLRELQHYSQSDLKKPLKIKFHGEEAEDAGGVRKEFFMLLLKDLLDPKYGMFKE  781

Query  770   YEETRTIWFAENSFEDNDVYFLIGMILGLAIYNFTIIDIPFPLALYKKLLSEPIGLSDLK  829
             YE++R +WFA+ +FE  ++YFLIG++ GLAIYNFTII++PFPLAL+KKLL +P+ LSDL+
Sbjct  782   YEQSRLLWFADLTFETENMYFLIGVLCGLAIYNFTIINLPFPLALFKKLLGKPVDLSDLR  841

Query  830   GLSPMMANSLQSLLDYEGNDMQDVFSLSFDISRDMFGEAVTIPLKPNGSNVPVTQENKQE  889
              LSP  ANS+QSLLDY+G+D ++VF L+F+ISRD+FGEA T  LKPNG+ + VT EN+QE
Sbjct  842   QLSPPEANSMQSLLDYQGDDFKEVFDLTFEISRDVFGEAETKCLKPNGNEIAVTLENRQE  901

Query  890   YVNLYINYIFNESVKHQYEAFHKGFMKVCGGRVLQLFHSHELMAVVIGNENYDWHALEEA  949
             +V+LY++++FN+SV+  Y AFHKGFMKVC GRV+ +F   ELMAVV+GNE+YDW AL++ 
Sbjct  902   FVDLYVDFVFNKSVELHYNAFHKGFMKVCSGRVIHIFQPEELMAVVVGNEDYDWQALQDN  961

Query  950   AEYKNGYKSSDQTIRWFWEVLHEMSLTDKKKFLVYLTGSYRIPIQGMKAIKIVVQPTNDD  1009
              EY+ GY S D TI+WFWEV+H+MS  +KK FL++LTGS RIPIQGMKA+K+ +QPT D+
Sbjct  962   CEYREGYTSVDDTIKWFWEVIHDMSEAEKKSFLLFLTGSDRIPIQGMKALKLTIQPTPDE  1021

Query  1010  KFLPVAHTCFNLLDLPRYKTKERLRYKLMQAIQQTEGFSLV  1050
             +FLPVAHTCFNLLDLPRYKTKERL+YKL+QAIQQT+GFSLV
Sbjct  1022  RFLPVAHTCFNLLDLPRYKTKERLKYKLLQAIQQTQGFSLV  1062


 Score = 101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 67/186 (36%), Positives = 96/186 (52%), Gaps = 6/186 (3%)

Query  157  LANSGEILAWGANNFGQLGLGNLSSSEV-KPKVIHSLTGIPVAFIACGANHSFAISKSGA  215
            +A+  E+  WG+ + GQLGLG +   ++  P  I       V  +ACG  H+  ++ +G 
Sbjct  1    MASGKELYCWGSTSHGQLGLGGIEDEQILTPSQIPWTPDTAVQQVACGHRHTLFLTATGK  60

Query  216  VYGWGKNTRGQLG--LNDTNNKMFPTQL-RTLRNIRVRYIACGEEFSTFLTMDGGVFTCG  272
            VY  G N   QLG  L     +M P  L   L++  +  I CG   S  L+  G V + G
Sbjct  61   VYACGSNDYSQLGHDLPTKRPRMSPFLLIPELQDYVIIQICCGSRHSLALSDWGQVLSWG  120

Query  273  AGMFGQLGHGSNTNEI-LPRQVVELMGSTITQIASGRQHSLALVPSRGRVYSFGIGGSGQ  331
                GQLGH ++   + LP+ V +L+  T+ QIA G  HSLAL  S G +YS+G    GQ
Sbjct  121  DNDCGQLGHATDKEIVQLPKVVRQLVTKTVVQIACGNNHSLALT-SCGELYSWGSNIYGQ  179

Query  332  LGLRKP  337
            LG+  P
Sbjct  180  LGVNSP  185


>Q9VTH1_DROME unnamed protein product
Length=973

 Score = 275 bits (702),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 150/354 (42%), Positives = 224/354 (63%), Gaps = 6/354 (2%)

Query  703   LVLNVTRDHIVDDALRELSHV---NPSDLKKPLKVKFCGEEAEDAGGVTKEFFLLLLREI  759
             L L V RD +++DAL  L  V   NP DLKK L V+F GE+  D GGV+KEFF L++ EI
Sbjct  620   LKLTVRRDQLINDALIGLEMVAMSNPKDLKKQLVVEFVGEQGIDEGGVSKEFFQLIVEEI  679

Query  760   LDPKYGMFKEYEETRTIWFAENSFEDNDVYFLIGMILGLAIYNFTIIDIPFPLALYKKLL  819
              +P +GMF + EET  +WF    FE+   + LIG+I+GLAIYN   + + FP+ +Y+KL+
Sbjct  680   FNPAFGMFIQQEETNNMWFNATPFENGAQFTLIGIIIGLAIYNNVTLAVNFPMVVYRKLI  739

Query  820   SEPIGLSDLKGLSPMMANSLQSLLDYEGNDMQDVFSLSFDIS-RDMFGEAVTIPLKPNGS  878
                   +DL   SP +  SL+S+LDY+G DM++VF  +F IS  D+FG+ V   L PNG 
Sbjct  740   GYCGTFADLSDWSPALYKSLKSMLDYQGQDMEEVFEQTFKISYSDVFGDVVQHELVPNGQ  799

Query  879   NVPVTQENKQEYVNLYINYIFNESVKHQYEAFHKGFMKVCGGRVLQ-LFHSHELMAVVIG  937
             +V V Q NK+ +VNLY +++ N +++ Q+ AF KGF  V     L+ LF   E+  +V G
Sbjct  800   DVLVGQHNKELFVNLYSDFLLNTNIEQQFNAFRKGFEMVTDESPLKLLFRPEEIEMLVCG  859

Query  938   NENYDWHALEEAAEYKNGYKSSDQTIRWFWEVLHEMSLTDKKKFLVYLTGSYRIPIQGMK  997
             +  +D+  LE +  Y+ GY    Q I+ FW ++H M   DK K L + TGS R+P+ G+K
Sbjct  860   SREFDFVELENSTVYEGGYTEKSQYIQDFWSIVHAMPSEDKHKLLEFTTGSARVPVGGLK  919

Query  998   AIKIVV-QPTNDDKFLPVAHTCFNLLDLPRYKTKERLRYKLMQAIQQTEGFSLV  1050
              +++++ +   D   LP +HTCFN+L LP Y ++E+L  +LM+AI  ++GF ++
Sbjct  920   CLRLLITRHGPDSDRLPTSHTCFNVLLLPEYSSREKLEERLMKAINYSKGFGML  973


>SMUF1_DROME unnamed protein product
Length=1061

 Score = 220 bits (560),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 127/372 (34%), Positives = 211/372 (57%), Gaps = 20/372 (5%)

Query  694   QGMHAINQFLVLNVTRDHIVDDALRELSHVNPSDLKKPLKVKFCGEEAEDAGGVTKEFFL  753
             Q M   +    L V+R+ I +++ R +  +   D++K L VKF GEE  D GGV +E+  
Sbjct  693   QTMQPQSGHCRLEVSRNEIFEESYRLIMKMRAKDMRKRLMVKFKGEEGLDYGGVAREWLH  752

Query  754   LLLREILDPKYGMFK-EYEETRTIWFAENSFEDND--VYF-LIGMILGLAIYNFTIIDIP  809
             LL RE+L+P+YG+F+   ++  T+    +S  + D   YF  +G  LG+A+++   +D  
Sbjct  753   LLSREMLNPQYGLFQYSRDDHYTLQINPDSGVNPDHLSYFHFVGRTLGIAVFHGHCLDGG  812

Query  810   FPLALYKKLLSEPIGLSDLKGLSPMMANSLQSLLDYEGNDMQDVFSLSFDISRDMFGEAV  869
             F    YK+LL++PI L D++G+ P +  SL  +L+   +++  +   +F +  + FG  V
Sbjct  813   FTTPFYKQLLNKPITLGDIEGVDPDLHRSLTWMLE---SNISGIIESTFSVENNSFGALV  869

Query  870   TIPLKPNGSNVPVTQENKQEYVNLYINYIFNESVKHQYEAFHKGFMKVCGGRVLQLFHSH  929
                LKP G+++PVT+ENK+EYV LY+NY F   ++ Q+ A  KGF ++    +L+ F   
Sbjct  870   VHELKPGGASIPVTEENKREYVKLYVNYRFMRGIEQQFLALQKGFCELIPSHLLRPFDER  929

Query  930   ELMAVVIGNENYDWHALEEAAEYKNGYKSSDQTIRWFWEVLHEMSLTDKKKFLVYLTGSY  989
             EL  V+ G  + D +        K+    + Q + WFW+V+   S   + + L ++TGS 
Sbjct  930   ELELVIGGISSIDVNDWRNNTRLKHCTNETTQVL-WFWQVVESYSSEMRARLLQFVTGSS  988

Query  990   RIPIQGMKAIK----------IVVQPTND--DKFLPVAHTCFNLLDLPRYKTKERLRYKL  1037
             R+P+QG +A++            +  T D   + LP AHTCFN +DLP Y+T + L  KL
Sbjct  989   RVPLQGFRALQGSTGAVGPRLFTIHLTADVPTQNLPKAHTCFNRIDLPPYETYQLLCDKL  1048

Query  1038  MQAIQQTEGFSL  1049
              QA+++T GF++
Sbjct  1049  TQAVEETCGFAV  1060


>U4PBY0_CAEEL unnamed protein product
Length=4185

 Score = 194 bits (493),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 115/357 (32%), Positives = 186/357 (52%), Gaps = 18/357 (5%)

Query  705   LNVTRDHIVDDALRELSHVNPSDLKKPLKVKFCGEEAEDAGGVTKEFFLLLLREILDPKY  764
             + V+R+ +  D+ REL  + PS+ K    + F GEE +DAGG+ +E+F ++ REI +P Y
Sbjct  3830  VQVSRNRVFSDSFRELFRLRPSEWKNRFYIIFQGEEGQDAGGLLREWFSVITREIFNPNY  3889

Query  765   GMFKEYE-ETRTIWFAENSF---EDNDVYFLIGMILGLAIYNFTIIDIPFPLALYKKLLS  820
              +F     +  T    + S+   E  D +  +G ++  +++    +D  F  A YK +L+
Sbjct  3890  ALFITAPGDMVTYMINKASYINPEHLDYFKFVGRLIAKSVFEHKYLDCYFTRAFYKHILN  3949

Query  821   EPIGLSDLKGLSPMMANSLQSLLDYEGNDMQDVFSLSFDISRDMFGEAVTIPLKPNGSNV  880
              P+   DL+   P    SL  LL    +D+     L+F    + FG      LKPNG  +
Sbjct  3950  LPVRYQDLESEDPAFFKSLDFLLQNPIDDL--ALDLTFSTEVEEFGVRSVRDLKPNGRKI  4007

Query  881   PVTQENKQEYVNLYINYIFNESVKHQYEAFHKGFMKVCGGRVLQLFHSHELMAVVIGNEN  940
              V   NK EYV L        S++ Q +AF  GF ++    ++ +F+  EL  ++ G   
Sbjct  4008  EVNDANKDEYVKLVCQMKMTGSIRKQLDAFLTGFYEIIPKDLISMFNEQELELLISGLPT  4067

Query  941   YDWHALEEAAEYKNGYKSSDQTIRWFWEVLHEMSLTDKKKFLVYLTGSYRIPIQGMKAIK  1000
              D   +    +YK G++ +   I+WFW  L      DK KFL ++TG+ ++P+QG  +++
Sbjct  4068  VDIDDMAANTDYK-GFQKTSTHIQWFWRALRSFEKEDKAKFLQFVTGTSKVPLQGFASLE  4126

Query  1001  ---------IVVQPTNDDKFLPVAHTCFNLLDLPRYKTKERLRYKLMQAIQQ-TEGF  1047
                      I +     D+ LP AHTCFN LDLP+Y++ E+LR  L+ AI++ TEGF
Sbjct  4127  GMNGVQKFSIHMDSRGGDR-LPAAHTCFNQLDLPQYESYEKLRQSLLLAIRECTEGF  4182


>NEDD4_DROME unnamed protein product
Length=1007

 Score = 192 bits (488),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 123/365 (34%), Positives = 195/365 (53%), Gaps = 20/365 (5%)

Query  700   NQFLVLNVTRDHIVDDALRELSHVNPSDL-KKPLKVKFCGEEAEDAGGVTKEFFLLLLRE  758
             N+F +  + R  I++D+ R +S V  +DL K  L V+F GE   D GG+ +E+F LL +E
Sbjct  648   NKFEI-RIRRTSILEDSYRIISSVTKTDLLKTKLWVEFEGETGLDYGGLAREWFYLLSKE  706

Query  759   ILDPKYGMFKEYEETRTIWFAENS-----FEDNDVYF-LIGMILGLAIYNFTIIDIPFPL  812
             + +P YG+F EY          N+      E++  YF  IG I G+A+Y+  ++D  F  
Sbjct  707   MFNPYYGLF-EYSAMDNYTLQINNGSGLCNEEHLSYFKFIGRIAGMAVYHGKLLDAFFIR  765

Query  813   ALYKKLLSEPIGLSDLKGLSPMMANSLQSLLDYEGNDMQDVFSLSFDISRDMFGEAVTIP  872
               YK +L +PI L D++ +     NSL  + +   ND + +  L+F +  D+FG+     
Sbjct  766   PFYKMMLQKPIDLKDMESVDTEYYNSLMWIKE---NDPR-ILELTFCLDEDVFGQKSQHE  821

Query  873   LKPNGSNVPVTQENKQEYVNLYINYIFNESVKHQYEAFHKGFMKVCGGRVLQLFHSHELM  932
             LKP G+N+ VT ENK EY+ L I + F   VK Q  +F  GF  +    ++++F  HEL 
Sbjct  822   LKPGGANIDVTNENKDEYIKLVIEWRFVARVKEQMSSFLDGFGSIIPLNLIKIFDEHELE  881

Query  933   AVVIGNENYDWHALEEAAEYKNGYKSSDQTIRWFWEVLHEMSLTDKKKFLVYLTGSYRIP  992
              ++ G +N D     E   YK  Y  +   I+WFW  +   S   + + L ++TG+ R+P
Sbjct  882   LLMCGIQNIDVKDWRENTLYKGDYHMNHIIIQWFWRAVLSFSNEMRSRLLQFVTGTSRVP  941

Query  993   IQGMKAI-------KIVVQPTNDDKFLPVAHTCFNLLDLPRYKTKERLRYKLMQAIQQTE  1045
             + G K +          ++        P AHTCFN LDLP Y+   +L+ KL++AI+ ++
Sbjct  942   MNGFKELYGSNGPQMFTIEKWGTPNNFPRAHTCFNRLDLPPYEGYLQLKDKLIKAIEGSQ  1001

Query  1046  GFSLV  1050
             GF+ V
Sbjct  1002  GFAGV  1006



Lambda      K        H
   0.320    0.135    0.434 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3573877230


Query= XP_018560806.1 probable E3 ubiquitin-protein ligase HERC4 isoform X2
[Anoplophora glabripennis]

Length=1045
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

E8NHA2_DROME  unnamed protein product                                 1176    0.0  
Q9VTH1_DROME  unnamed protein product                                 275     2e-77
SMUF1_DROME  unnamed protein product                                  220     7e-59
Q9GUP2_CAEEL  unnamed protein product                                 194     5e-50
U4PBY0_CAEEL  unnamed protein product                                 194     5e-50


>E8NHA2_DROME unnamed protein product
Length=1062

 Score = 1176 bits (3042),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 582/1061 (55%), Positives = 767/1061 (72%), Gaps = 21/1061 (2%)

Query  1     MFAWGSTIHGELGLGGIEDEHILTPRALDWYLANTVIYAALGENHTLFLTKEGKVYSCGS  60
             ++ WGST HG+LGLGGIEDE ILTP  + W     V   A G  HTLFLT  GKVY+CGS
Sbjct  7     LYCWGSTSHGQLGLGGIEDEQILTPSQIPWTPDTAVQQVACGHRHTLFLTATGKVYACGS  66

Query  61    NDYGQLGHDQPRKRPQP-----VTGLDAHVITHVACGSMHSMALNQWGQVYSWGSDYHGQ  115
             NDY QLGHD P KRP+      +  L  +VI  + CGS HS+AL+ WGQV SWG +  GQ
Sbjct  67    NDYSQLGHDLPTKRPRMSPFLLIPELQDYVIIQICCGSRHSLALSDWGQVLSWGDNDCGQ  126

Query  116   LGLDIGENIQATPKFVRALGTYHILQICCGQRHSLALANSGEILAWGANNFGQLGLG--N  173
             LG    + I   PK VR L T  ++QI CG  HSLAL + GE+ +WG+N +GQLG+   N
Sbjct  127   LGHATDKEIVQLPKVVRQLVTKTVVQIACGNNHSLALTSCGELYSWGSNIYGQLGVNSPN  186

Query  174   LSSSEVKPKVIHSLTGIPVAFIACGANHSFAISKSGAVYGWGKNTRGQLGLNDTNNKMFP  233
               +    P  + +L GIP+A IACG NHSF ISKSGAV+GWG+N  GQLGLND  N+ +P
Sbjct  187   DLTHCNYPLRLTTLLGIPLAAIACGGNHSFLISKSGAVFGWGRNNCGQLGLNDETNRSYP  246

Query  234   TQLRTLRNIRVRYIACGEEFSTFLTMDGGVFTCGAGMFGQLGHGSNTNEILPRQVVELMG  293
             TQL+TLR + VR++ACG+EFS FLT +GGVFTCGAG +GQLGHG ++NE+LPR V+ELMG
Sbjct  247   TQLKTLRTLGVRFVACGDEFSVFLTNEGGVFTCGAGAYGQLGHGFSSNEMLPRMVMELMG  306

Query  294   STITQIASGRQHSLALVPSRGRVYSFGIGGSGQLGLRKPTSSMTPQVVLGPWVSPSGISL  353
             STITQ+A G +H+LALVPSRGRVY+FG+G SGQLG R   S M PQVV+GPWVSPSG +L
Sbjct  307   STITQVACGNRHTLALVPSRGRVYAFGLGSSGQLGTRSTKSLMLPQVVIGPWVSPSGSAL  366

Query  354   VPTPGNNQNFVIHRIFSGGDHCFVSVVKQNSDIPPYDCREYNPQTQILHLTQDYVKNLLR  413
             + +  +  + VI +IFSGGD   V+       +PP D R YNP++QIL LT +  K   +
Sbjct  367   LQSNDSQVSLVIRQIFSGGDQSIVTTTLFVDKVPPEDFRNYNPKSQILTLTAEVTKQCAQ  426

Query  414   TPGNVQVEQEVLSFLETVFKSLSCLNGSFLLNDEKHYYCSSRHHGVNLEEAEGTFSLIGK  473
                 +Q + ++LS +E +F+S +C NGSFLL+ ++H+ CS R+HG++L+ A+  F  +  
Sbjct  427   CKQGLQSDMDLLSSIELIFRSQACWNGSFLLDHDRHFGCSVRNHGLDLKAAQLAFDNLRA  486

Query  474   IENNSIKDLIWNCITENIVSQLSPSPPDVEALRIYLTLPLYHEFNNPKQHLRLQKPFVKA  533
             +EN SI+ +IW+ IT+ +V  L  SP DVE++R+YL LPLYHEF N K +  LQ PF  A
Sbjct  487   VENESIRQVIWDNITKELVGSLVCSPADVESMRLYLLLPLYHEFVNSKHYKSLQVPFANA  546

Query  534   LLGLKQPANKVVGSWYSMTSCDYFERLINVFKSVAVYILSNQ-----KIPQG----QTAF  584
             +  L +   KV+  W + T  +YFE L+  F  V ++I+S +       P      Q   
Sbjct  547   IFKLAENPRKVLNKWLAQTPAEYFEHLVQNFLHVVIHIISFKMGLAAASPSAERRQQLLP  606

Query  585   YDPSLVAMLDILAYLNKLNHSVDGLRVPYDTFHIIELSEFMDVRVDYVYWLSDPGTGKLF  644
             Y+  L  +L ++  L ++N+     R+ Y  F+  +LS++ DV+ +YV W+         
Sbjct  607   YNTELEIILKLMKTLCQINNERHD-RLNYQIFYWPDLSDYADVQQEYVKWIMADTARDFN  665

Query  645   LCNYPFVFDAHAKLQLLETDQSIQMQKAMSDAAQQAFLSMLISPQGMHAINQFLVLNVTR  704
             +CNY F+FD  AK  LL+ DQ++QM  AM++AA  AF        GM  I+QF+VLNVTR
Sbjct  666   ICNYSFIFDQSAKTALLQADQALQMHSAMANAATMAFSFF---NYGM-PISQFIVLNVTR  721

Query  705   DHIVDDALRELSHVNPSDLKKPLKVKFCGEEAEDAGGVTKEFFLLLLREILDPKYGMFKE  764
             +++V D+LREL H + SDLKKPLK+KF GEEAEDAGGV KEFF+LLL+++LDPKYGMFKE
Sbjct  722   ENLVQDSLRELQHYSQSDLKKPLKIKFHGEEAEDAGGVRKEFFMLLLKDLLDPKYGMFKE  781

Query  765   YEETRTIWFAENSFEDNDVYFLIGMILGLAIYNFTIIDIPFPLALYKKLLSEPIGLSDLK  824
             YE++R +WFA+ +FE  ++YFLIG++ GLAIYNFTII++PFPLAL+KKLL +P+ LSDL+
Sbjct  782   YEQSRLLWFADLTFETENMYFLIGVLCGLAIYNFTIINLPFPLALFKKLLGKPVDLSDLR  841

Query  825   GLSPMMANSLQSLLDYEGNDMQDVFSLSFDISRDMFGEAVTIPLKPNGSNVPVTQENKQE  884
              LSP  ANS+QSLLDY+G+D ++VF L+F+ISRD+FGEA T  LKPNG+ + VT EN+QE
Sbjct  842   QLSPPEANSMQSLLDYQGDDFKEVFDLTFEISRDVFGEAETKCLKPNGNEIAVTLENRQE  901

Query  885   YVNLYINYIFNESVKHQYEAFHKGFMKVCGGRVLQLFHSHELMAVVIGNENYDWHALEEA  944
             +V+LY++++FN+SV+  Y AFHKGFMKVC GRV+ +F   ELMAVV+GNE+YDW AL++ 
Sbjct  902   FVDLYVDFVFNKSVELHYNAFHKGFMKVCSGRVIHIFQPEELMAVVVGNEDYDWQALQDN  961

Query  945   AEYKNGYKSSDQTIRWFWEVLHEMSLTDKKKFLVYLTGSYRIPIQGMKAIKIVVQPTNDD  1004
              EY+ GY S D TI+WFWEV+H+MS  +KK FL++LTGS RIPIQGMKA+K+ +QPT D+
Sbjct  962   CEYREGYTSVDDTIKWFWEVIHDMSEAEKKSFLLFLTGSDRIPIQGMKALKLTIQPTPDE  1021

Query  1005  KFLPVAHTCFNLLDLPRYKTKERLRYKLMQAIQQTEGFSLV  1045
             +FLPVAHTCFNLLDLPRYKTKERL+YKL+QAIQQT+GFSLV
Sbjct  1022  RFLPVAHTCFNLLDLPRYKTKERLKYKLLQAIQQTQGFSLV  1062


 Score = 101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 67/186 (36%), Positives = 96/186 (52%), Gaps = 6/186 (3%)

Query  152  LANSGEILAWGANNFGQLGLGNLSSSEV-KPKVIHSLTGIPVAFIACGANHSFAISKSGA  210
            +A+  E+  WG+ + GQLGLG +   ++  P  I       V  +ACG  H+  ++ +G 
Sbjct  1    MASGKELYCWGSTSHGQLGLGGIEDEQILTPSQIPWTPDTAVQQVACGHRHTLFLTATGK  60

Query  211  VYGWGKNTRGQLG--LNDTNNKMFPTQL-RTLRNIRVRYIACGEEFSTFLTMDGGVFTCG  267
            VY  G N   QLG  L     +M P  L   L++  +  I CG   S  L+  G V + G
Sbjct  61   VYACGSNDYSQLGHDLPTKRPRMSPFLLIPELQDYVIIQICCGSRHSLALSDWGQVLSWG  120

Query  268  AGMFGQLGHGSNTNEI-LPRQVVELMGSTITQIASGRQHSLALVPSRGRVYSFGIGGSGQ  326
                GQLGH ++   + LP+ V +L+  T+ QIA G  HSLAL  S G +YS+G    GQ
Sbjct  121  DNDCGQLGHATDKEIVQLPKVVRQLVTKTVVQIACGNNHSLALT-SCGELYSWGSNIYGQ  179

Query  327  LGLRKP  332
            LG+  P
Sbjct  180  LGVNSP  185


>Q9VTH1_DROME unnamed protein product
Length=973

 Score = 275 bits (702),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 150/354 (42%), Positives = 224/354 (63%), Gaps = 6/354 (2%)

Query  698   LVLNVTRDHIVDDALRELSHV---NPSDLKKPLKVKFCGEEAEDAGGVTKEFFLLLLREI  754
             L L V RD +++DAL  L  V   NP DLKK L V+F GE+  D GGV+KEFF L++ EI
Sbjct  620   LKLTVRRDQLINDALIGLEMVAMSNPKDLKKQLVVEFVGEQGIDEGGVSKEFFQLIVEEI  679

Query  755   LDPKYGMFKEYEETRTIWFAENSFEDNDVYFLIGMILGLAIYNFTIIDIPFPLALYKKLL  814
              +P +GMF + EET  +WF    FE+   + LIG+I+GLAIYN   + + FP+ +Y+KL+
Sbjct  680   FNPAFGMFIQQEETNNMWFNATPFENGAQFTLIGIIIGLAIYNNVTLAVNFPMVVYRKLI  739

Query  815   SEPIGLSDLKGLSPMMANSLQSLLDYEGNDMQDVFSLSFDIS-RDMFGEAVTIPLKPNGS  873
                   +DL   SP +  SL+S+LDY+G DM++VF  +F IS  D+FG+ V   L PNG 
Sbjct  740   GYCGTFADLSDWSPALYKSLKSMLDYQGQDMEEVFEQTFKISYSDVFGDVVQHELVPNGQ  799

Query  874   NVPVTQENKQEYVNLYINYIFNESVKHQYEAFHKGFMKVCGGRVLQ-LFHSHELMAVVIG  932
             +V V Q NK+ +VNLY +++ N +++ Q+ AF KGF  V     L+ LF   E+  +V G
Sbjct  800   DVLVGQHNKELFVNLYSDFLLNTNIEQQFNAFRKGFEMVTDESPLKLLFRPEEIEMLVCG  859

Query  933   NENYDWHALEEAAEYKNGYKSSDQTIRWFWEVLHEMSLTDKKKFLVYLTGSYRIPIQGMK  992
             +  +D+  LE +  Y+ GY    Q I+ FW ++H M   DK K L + TGS R+P+ G+K
Sbjct  860   SREFDFVELENSTVYEGGYTEKSQYIQDFWSIVHAMPSEDKHKLLEFTTGSARVPVGGLK  919

Query  993   AIKIVV-QPTNDDKFLPVAHTCFNLLDLPRYKTKERLRYKLMQAIQQTEGFSLV  1045
              +++++ +   D   LP +HTCFN+L LP Y ++E+L  +LM+AI  ++GF ++
Sbjct  920   CLRLLITRHGPDSDRLPTSHTCFNVLLLPEYSSREKLEERLMKAINYSKGFGML  973


>SMUF1_DROME unnamed protein product
Length=1061

 Score = 220 bits (561),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 127/372 (34%), Positives = 211/372 (57%), Gaps = 20/372 (5%)

Query  689   QGMHAINQFLVLNVTRDHIVDDALRELSHVNPSDLKKPLKVKFCGEEAEDAGGVTKEFFL  748
             Q M   +    L V+R+ I +++ R +  +   D++K L VKF GEE  D GGV +E+  
Sbjct  693   QTMQPQSGHCRLEVSRNEIFEESYRLIMKMRAKDMRKRLMVKFKGEEGLDYGGVAREWLH  752

Query  749   LLLREILDPKYGMFK-EYEETRTIWFAENSFEDND--VYF-LIGMILGLAIYNFTIIDIP  804
             LL RE+L+P+YG+F+   ++  T+    +S  + D   YF  +G  LG+A+++   +D  
Sbjct  753   LLSREMLNPQYGLFQYSRDDHYTLQINPDSGVNPDHLSYFHFVGRTLGIAVFHGHCLDGG  812

Query  805   FPLALYKKLLSEPIGLSDLKGLSPMMANSLQSLLDYEGNDMQDVFSLSFDISRDMFGEAV  864
             F    YK+LL++PI L D++G+ P +  SL  +L+   +++  +   +F +  + FG  V
Sbjct  813   FTTPFYKQLLNKPITLGDIEGVDPDLHRSLTWMLE---SNISGIIESTFSVENNSFGALV  869

Query  865   TIPLKPNGSNVPVTQENKQEYVNLYINYIFNESVKHQYEAFHKGFMKVCGGRVLQLFHSH  924
                LKP G+++PVT+ENK+EYV LY+NY F   ++ Q+ A  KGF ++    +L+ F   
Sbjct  870   VHELKPGGASIPVTEENKREYVKLYVNYRFMRGIEQQFLALQKGFCELIPSHLLRPFDER  929

Query  925   ELMAVVIGNENYDWHALEEAAEYKNGYKSSDQTIRWFWEVLHEMSLTDKKKFLVYLTGSY  984
             EL  V+ G  + D +        K+    + Q + WFW+V+   S   + + L ++TGS 
Sbjct  930   ELELVIGGISSIDVNDWRNNTRLKHCTNETTQVL-WFWQVVESYSSEMRARLLQFVTGSS  988

Query  985   RIPIQGMKAIK----------IVVQPTND--DKFLPVAHTCFNLLDLPRYKTKERLRYKL  1032
             R+P+QG +A++            +  T D   + LP AHTCFN +DLP Y+T + L  KL
Sbjct  989   RVPLQGFRALQGSTGAVGPRLFTIHLTADVPTQNLPKAHTCFNRIDLPPYETYQLLCDKL  1048

Query  1033  MQAIQQTEGFSL  1044
              QA+++T GF++
Sbjct  1049  TQAVEETCGFAV  1060


>Q9GUP2_CAEEL unnamed protein product
Length=4177

 Score = 194 bits (493),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 115/357 (32%), Positives = 186/357 (52%), Gaps = 18/357 (5%)

Query  700   LNVTRDHIVDDALRELSHVNPSDLKKPLKVKFCGEEAEDAGGVTKEFFLLLLREILDPKY  759
             + V+R+ +  D+ REL  + PS+ K    + F GEE +DAGG+ +E+F ++ REI +P Y
Sbjct  3822  VQVSRNRVFSDSFRELFRLRPSEWKNRFYIIFQGEEGQDAGGLLREWFSVITREIFNPNY  3881

Query  760   GMFKEYE-ETRTIWFAENSF---EDNDVYFLIGMILGLAIYNFTIIDIPFPLALYKKLLS  815
              +F     +  T    + S+   E  D +  +G ++  +++    +D  F  A YK +L+
Sbjct  3882  ALFITAPGDMVTYMINKASYINPEHLDYFKFVGRLIAKSVFEHKYLDCYFTRAFYKHILN  3941

Query  816   EPIGLSDLKGLSPMMANSLQSLLDYEGNDMQDVFSLSFDISRDMFGEAVTIPLKPNGSNV  875
              P+   DL+   P    SL  LL    +D+     L+F    + FG      LKPNG  +
Sbjct  3942  LPVRYQDLESEDPAFFKSLDFLLQNPIDDL--ALDLTFSTEVEEFGVRSVRDLKPNGRKI  3999

Query  876   PVTQENKQEYVNLYINYIFNESVKHQYEAFHKGFMKVCGGRVLQLFHSHELMAVVIGNEN  935
              V   NK EYV L        S++ Q +AF  GF ++    ++ +F+  EL  ++ G   
Sbjct  4000  EVNDANKDEYVKLVCQMKMTGSIRKQLDAFLTGFYEIIPKDLISMFNEQELELLISGLPT  4059

Query  936   YDWHALEEAAEYKNGYKSSDQTIRWFWEVLHEMSLTDKKKFLVYLTGSYRIPIQGMKAIK  995
              D   +    +YK G++ +   I+WFW  L      DK KFL ++TG+ ++P+QG  +++
Sbjct  4060  VDIDDMAANTDYK-GFQKTSTHIQWFWRALRSFEKEDKAKFLQFVTGTSKVPLQGFASLE  4118

Query  996   ---------IVVQPTNDDKFLPVAHTCFNLLDLPRYKTKERLRYKLMQAIQQ-TEGF  1042
                      I +     D+ LP AHTCFN LDLP+Y++ E+LR  L+ AI++ TEGF
Sbjct  4119  GMNGVQKFSIHMDSRGGDR-LPAAHTCFNQLDLPQYESYEKLRQSLLLAIRECTEGF  4174


>U4PBY0_CAEEL unnamed protein product
Length=4185

 Score = 194 bits (493),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 115/357 (32%), Positives = 186/357 (52%), Gaps = 18/357 (5%)

Query  700   LNVTRDHIVDDALRELSHVNPSDLKKPLKVKFCGEEAEDAGGVTKEFFLLLLREILDPKY  759
             + V+R+ +  D+ REL  + PS+ K    + F GEE +DAGG+ +E+F ++ REI +P Y
Sbjct  3830  VQVSRNRVFSDSFRELFRLRPSEWKNRFYIIFQGEEGQDAGGLLREWFSVITREIFNPNY  3889

Query  760   GMFKEYE-ETRTIWFAENSF---EDNDVYFLIGMILGLAIYNFTIIDIPFPLALYKKLLS  815
              +F     +  T    + S+   E  D +  +G ++  +++    +D  F  A YK +L+
Sbjct  3890  ALFITAPGDMVTYMINKASYINPEHLDYFKFVGRLIAKSVFEHKYLDCYFTRAFYKHILN  3949

Query  816   EPIGLSDLKGLSPMMANSLQSLLDYEGNDMQDVFSLSFDISRDMFGEAVTIPLKPNGSNV  875
              P+   DL+   P    SL  LL    +D+     L+F    + FG      LKPNG  +
Sbjct  3950  LPVRYQDLESEDPAFFKSLDFLLQNPIDDL--ALDLTFSTEVEEFGVRSVRDLKPNGRKI  4007

Query  876   PVTQENKQEYVNLYINYIFNESVKHQYEAFHKGFMKVCGGRVLQLFHSHELMAVVIGNEN  935
              V   NK EYV L        S++ Q +AF  GF ++    ++ +F+  EL  ++ G   
Sbjct  4008  EVNDANKDEYVKLVCQMKMTGSIRKQLDAFLTGFYEIIPKDLISMFNEQELELLISGLPT  4067

Query  936   YDWHALEEAAEYKNGYKSSDQTIRWFWEVLHEMSLTDKKKFLVYLTGSYRIPIQGMKAIK  995
              D   +    +YK G++ +   I+WFW  L      DK KFL ++TG+ ++P+QG  +++
Sbjct  4068  VDIDDMAANTDYK-GFQKTSTHIQWFWRALRSFEKEDKAKFLQFVTGTSKVPLQGFASLE  4126

Query  996   ---------IVVQPTNDDKFLPVAHTCFNLLDLPRYKTKERLRYKLMQAIQQ-TEGF  1042
                      I +     D+ LP AHTCFN LDLP+Y++ E+LR  L+ AI++ TEGF
Sbjct  4127  GMNGVQKFSIHMDSRGGDR-LPAAHTCFNQLDLPQYESYEKLRQSLLLAIRECTEGF  4182



Lambda      K        H
   0.320    0.135    0.434 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3573877230


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Nov 3, 2023  11:39 AM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_018560807.1 transcriptional regulator DEF1 isoform X1
[Anoplophora glabripennis]

Length=627
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q86LF6_DROME  unnamed protein product                                 102     2e-24
M9PC30_DROME  unnamed protein product                                 102     8e-24
Q8IGH4_DROME  unnamed protein product                                 102     1e-23
Q7KUD8_DROME  unnamed protein product                                 102     2e-23
Q867T3_DROME  unnamed protein product                                 102     2e-23


>Q86LF6_DROME unnamed protein product
Length=206

 Score = 102 bits (253),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 70/134 (52%), Gaps = 36/134 (27%)

Query  489  PTTITLRPKAPVSQAPPPLVTSQPATATLKVSKKNLRGDIKWPPEDVKRKIAEENLDSND  548
            P  ITLR +APVSQ P P+ TSQPA                                   
Sbjct  105  PGIITLRKEAPVSQKPAPVYTSQPAA----------------------------------  130

Query  549  SFLSIQGGKHLRGDLKWPPECVRQQFAEEDRLRLELAQGPACRPLRPHKDYSEFFNQHAL  608
              +S QGG  LRGDLKWPP   ++  A E+  R +LA GP CRP R ++DY+ FF +H L
Sbjct  131  --VSYQGGSKLRGDLKWPPPEYKEAAARENEERRQLALGPVCRPRRVNRDYTPFFAKHQL  188

Query  609  NSTYPGYKIPPGTQ  622
            N+ YP YK+PPGTQ
Sbjct  189  NNGYPSYKVPPGTQ  202


>M9PC30_DROME unnamed protein product
Length=299

 Score = 102 bits (254),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 70/134 (52%), Gaps = 36/134 (27%)

Query  489  PTTITLRPKAPVSQAPPPLVTSQPATATLKVSKKNLRGDIKWPPEDVKRKIAEENLDSND  548
            P  ITLR +APVSQ P P+ TSQPA                                   
Sbjct  198  PGIITLRKEAPVSQKPAPVYTSQPAA----------------------------------  223

Query  549  SFLSIQGGKHLRGDLKWPPECVRQQFAEEDRLRLELAQGPACRPLRPHKDYSEFFNQHAL  608
              +S QGG  LRGDLKWPP   ++  A E+  R +LA GP CRP R ++DY+ FF +H L
Sbjct  224  --VSYQGGSKLRGDLKWPPPEYKEAAARENEERRQLALGPVCRPRRVNRDYTPFFAKHQL  281

Query  609  NSTYPGYKIPPGTQ  622
            N+ YP YK+PPGTQ
Sbjct  282  NNGYPSYKVPPGTQ  295


>Q8IGH4_DROME unnamed protein product
Length=315

 Score = 102 bits (254),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 70/136 (51%), Gaps = 36/136 (26%)

Query  489  PTTITLRPKAPVSQAPPPLVTSQPATATLKVSKKNLRGDIKWPPEDVKRKIAEENLDSND  548
            P  ITLR +APVSQ P P+ TSQPA                                   
Sbjct  214  PGIITLRKEAPVSQKPAPVYTSQPAA----------------------------------  239

Query  549  SFLSIQGGKHLRGDLKWPPECVRQQFAEEDRLRLELAQGPACRPLRPHKDYSEFFNQHAL  608
              +S QGG  LRGDLKWPP   ++  A E+  R +LA GP CRP R ++DY+ FF +H L
Sbjct  240  --VSYQGGSKLRGDLKWPPPEYKEAAARENEERRQLALGPVCRPRRVNRDYTPFFAKHQL  297

Query  609  NSTYPGYKIPPGTQFF  624
            N+ YP YK+PPGTQ  
Sbjct  298  NNGYPSYKVPPGTQHI  313


 Score = 35.4 bits (80),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 12/46 (26%)

Query  49  VGKPANLKNSAVLRMLEEEENRQRNGIGPGNYNTAKPLRENITWPP  94
           + KP NL NSAVLR +EEEE + + G             + + WPP
Sbjct  8   ITKPLNLANSAVLRAVEEEEQQAKCGY------------KRVAWPP  41


>Q7KUD8_DROME unnamed protein product
Length=354

 Score = 102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 70/134 (52%), Gaps = 36/134 (27%)

Query  489  PTTITLRPKAPVSQAPPPLVTSQPATATLKVSKKNLRGDIKWPPEDVKRKIAEENLDSND  548
            P  ITLR +APVSQ P P+ TSQPA                                   
Sbjct  253  PGIITLRKEAPVSQKPAPVYTSQPAA----------------------------------  278

Query  549  SFLSIQGGKHLRGDLKWPPECVRQQFAEEDRLRLELAQGPACRPLRPHKDYSEFFNQHAL  608
              +S QGG  LRGDLKWPP   ++  A E+  R +LA GP CRP R ++DY+ FF +H L
Sbjct  279  --VSYQGGSKLRGDLKWPPPEYKEAAARENEERRQLALGPVCRPRRVNRDYTPFFAKHQL  336

Query  609  NSTYPGYKIPPGTQ  622
            N+ YP YK+PPGTQ
Sbjct  337  NNGYPSYKVPPGTQ  350


 Score = 70.5 bits (171),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 53/89 (60%), Gaps = 15/89 (17%)

Query  6   KLVNKQFNSPIGLYSPQNIQEVLERETQILANGAVGINFNNPNVGKPANLKNSAVLRMLE  65
           KLV+KQFNSP+GLYS +N++  L RE +  A G  GI  ++  + KP NL NSAVLR +E
Sbjct  7   KLVHKQFNSPMGLYSQENVKATLNRELK--AFGGEGIEVDD-QITKPLNLANSAVLRAVE  63

Query  66  EEENRQRNGIGPGNYNTAKPLRENITWPP  94
           EEE + + G             + + WPP
Sbjct  64  EEEQQAKCGY------------KRVAWPP  80


>Q867T3_DROME unnamed protein product
Length=355

 Score = 102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 70/134 (52%), Gaps = 36/134 (27%)

Query  489  PTTITLRPKAPVSQAPPPLVTSQPATATLKVSKKNLRGDIKWPPEDVKRKIAEENLDSND  548
            P  ITLR +APVSQ P P+ TSQPA                                   
Sbjct  254  PGIITLRKEAPVSQKPAPVYTSQPAA----------------------------------  279

Query  549  SFLSIQGGKHLRGDLKWPPECVRQQFAEEDRLRLELAQGPACRPLRPHKDYSEFFNQHAL  608
              +S QGG  LRGDLKWPP   ++  A E+  R +LA GP CRP R ++DY+ FF +H L
Sbjct  280  --VSYQGGSKLRGDLKWPPPEYKEAAARENEERRQLALGPVCRPRRVNRDYTPFFAKHQL  337

Query  609  NSTYPGYKIPPGTQ  622
            N+ YP YK+PPGTQ
Sbjct  338  NNGYPSYKVPPGTQ  351


 Score = 70.5 bits (171),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 53/89 (60%), Gaps = 15/89 (17%)

Query  6   KLVNKQFNSPIGLYSPQNIQEVLERETQILANGAVGINFNNPNVGKPANLKNSAVLRMLE  65
           KLV+KQFNSP+GLYS +N++  L RE +  A G  GI  ++  + KP NL NSAVLR +E
Sbjct  7   KLVHKQFNSPMGLYSQENVKATLNRELK--AFGGEGIEVDD-QITKPLNLANSAVLRAVE  63

Query  66  EEENRQRNGIGPGNYNTAKPLRENITWPP  94
           EEE + + G             + + WPP
Sbjct  64  EEEQQAKCGY------------KRVAWPP  80



Lambda      K        H
   0.308    0.123    0.363 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7477882188


Query= XP_018560808.1 transcriptional regulator DEF1 isoform X2
[Anoplophora glabripennis]

Length=592
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q86LF6_DROME  unnamed protein product                                 102     2e-24
M9PC30_DROME  unnamed protein product                                 102     6e-24
Q8IGH4_DROME  unnamed protein product                                 102     1e-23
M9PER6_DROME  unnamed protein product                                 103     1e-23
Q7KUD8_DROME  unnamed protein product                                 102     2e-23


>Q86LF6_DROME unnamed protein product
Length=206

 Score = 102 bits (253),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 70/134 (52%), Gaps = 36/134 (27%)

Query  454  PTTITLRPKAPVSQAPPPLVTSQPATATLKVSKKNLRGDIKWPPEDVKRKIAEENLDSND  513
            P  ITLR +APVSQ P P+ TSQPA                                   
Sbjct  105  PGIITLRKEAPVSQKPAPVYTSQPAA----------------------------------  130

Query  514  SFLSIQGGKHLRGDLKWPPECVRQQFAEEDRLRLELAQGPACRPLRPHKDYSEFFNQHAL  573
              +S QGG  LRGDLKWPP   ++  A E+  R +LA GP CRP R ++DY+ FF +H L
Sbjct  131  --VSYQGGSKLRGDLKWPPPEYKEAAARENEERRQLALGPVCRPRRVNRDYTPFFAKHQL  188

Query  574  NSTYPGYKIPPGTQ  587
            N+ YP YK+PPGTQ
Sbjct  189  NNGYPSYKVPPGTQ  202


>M9PC30_DROME unnamed protein product
Length=299

 Score = 102 bits (254),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 70/134 (52%), Gaps = 36/134 (27%)

Query  454  PTTITLRPKAPVSQAPPPLVTSQPATATLKVSKKNLRGDIKWPPEDVKRKIAEENLDSND  513
            P  ITLR +APVSQ P P+ TSQPA                                   
Sbjct  198  PGIITLRKEAPVSQKPAPVYTSQPAA----------------------------------  223

Query  514  SFLSIQGGKHLRGDLKWPPECVRQQFAEEDRLRLELAQGPACRPLRPHKDYSEFFNQHAL  573
              +S QGG  LRGDLKWPP   ++  A E+  R +LA GP CRP R ++DY+ FF +H L
Sbjct  224  --VSYQGGSKLRGDLKWPPPEYKEAAARENEERRQLALGPVCRPRRVNRDYTPFFAKHQL  281

Query  574  NSTYPGYKIPPGTQ  587
            N+ YP YK+PPGTQ
Sbjct  282  NNGYPSYKVPPGTQ  295


>Q8IGH4_DROME unnamed protein product
Length=315

 Score = 102 bits (254),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 70/136 (51%), Gaps = 36/136 (26%)

Query  454  PTTITLRPKAPVSQAPPPLVTSQPATATLKVSKKNLRGDIKWPPEDVKRKIAEENLDSND  513
            P  ITLR +APVSQ P P+ TSQPA                                   
Sbjct  214  PGIITLRKEAPVSQKPAPVYTSQPAA----------------------------------  239

Query  514  SFLSIQGGKHLRGDLKWPPECVRQQFAEEDRLRLELAQGPACRPLRPHKDYSEFFNQHAL  573
              +S QGG  LRGDLKWPP   ++  A E+  R +LA GP CRP R ++DY+ FF +H L
Sbjct  240  --VSYQGGSKLRGDLKWPPPEYKEAAARENEERRQLALGPVCRPRRVNRDYTPFFAKHQL  297

Query  574  NSTYPGYKIPPGTQFF  589
            N+ YP YK+PPGTQ  
Sbjct  298  NNGYPSYKVPPGTQHI  313


 Score = 35.8 bits (81),  Expect = 0.093, Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 12/46 (26%)

Query  14  VGKPANLKNSAVLRMLEEEENRQRNGIGPGNYNTAKPLRENITWPP  59
           + KP NL NSAVLR +EEEE + + G             + + WPP
Sbjct  8   ITKPLNLANSAVLRAVEEEEQQAKCGY------------KRVAWPP  41


>M9PER6_DROME unnamed protein product
Length=446

 Score = 103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 70/134 (52%), Gaps = 36/134 (27%)

Query  454  PTTITLRPKAPVSQAPPPLVTSQPATATLKVSKKNLRGDIKWPPEDVKRKIAEENLDSND  513
            P  ITLR +APVSQ P P+ TSQPA                                   
Sbjct  345  PGIITLRKEAPVSQKPAPVYTSQPAA----------------------------------  370

Query  514  SFLSIQGGKHLRGDLKWPPECVRQQFAEEDRLRLELAQGPACRPLRPHKDYSEFFNQHAL  573
              +S QGG  LRGDLKWPP   ++  A E+  R +LA GP CRP R ++DY+ FF +H L
Sbjct  371  --VSYQGGSKLRGDLKWPPPEYKEAAARENEERRQLALGPVCRPRRVNRDYTPFFAKHQL  428

Query  574  NSTYPGYKIPPGTQ  587
            N+ YP YK+PPGTQ
Sbjct  429  NNGYPSYKVPPGTQ  442


>Q7KUD8_DROME unnamed protein product
Length=354

 Score = 102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 70/134 (52%), Gaps = 36/134 (27%)

Query  454  PTTITLRPKAPVSQAPPPLVTSQPATATLKVSKKNLRGDIKWPPEDVKRKIAEENLDSND  513
            P  ITLR +APVSQ P P+ TSQPA                                   
Sbjct  253  PGIITLRKEAPVSQKPAPVYTSQPAA----------------------------------  278

Query  514  SFLSIQGGKHLRGDLKWPPECVRQQFAEEDRLRLELAQGPACRPLRPHKDYSEFFNQHAL  573
              +S QGG  LRGDLKWPP   ++  A E+  R +LA GP CRP R ++DY+ FF +H L
Sbjct  279  --VSYQGGSKLRGDLKWPPPEYKEAAARENEERRQLALGPVCRPRRVNRDYTPFFAKHQL  336

Query  574  NSTYPGYKIPPGTQ  587
            N+ YP YK+PPGTQ
Sbjct  337  NNGYPSYKVPPGTQ  350


 Score = 35.4 bits (80),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 12/46 (26%)

Query  14  VGKPANLKNSAVLRMLEEEENRQRNGIGPGNYNTAKPLRENITWPP  59
           + KP NL NSAVLR +EEEE + + G             + + WPP
Sbjct  47  ITKPLNLANSAVLRAVEEEEQQAKCGY------------KRVAWPP  80



Lambda      K        H
   0.308    0.123    0.363 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7477882188


Query= XP_018560809.1 transcriptional regulator DEF1 isoform X3
[Anoplophora glabripennis]

Length=591
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q86LF6_DROME  unnamed protein product                                 116     8e-30
Q86BH9_DROME  unnamed protein product                                 119     2e-28
M9PER0_DROME  unnamed protein product                                 119     3e-28
Q8IGP1_DROME  unnamed protein product                                 119     3e-28
M9PC24_DROME  unnamed protein product                                 119     3e-28


>Q86LF6_DROME unnamed protein product
Length=206

 Score = 116 bits (291),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 69/98 (70%), Gaps = 0/98 (0%)

Query  489  PTTITLRPKAPVSQAPPPLVTSQPATATLKGGKHLRGDLKWPPECVRQQFAEEDRLRLEL  548
            P  ITLR +APVSQ P P+ TSQPA  + +GG  LRGDLKWPP   ++  A E+  R +L
Sbjct  105  PGIITLRKEAPVSQKPAPVYTSQPAAVSYQGGSKLRGDLKWPPPEYKEAAARENEERRQL  164

Query  549  AQGPACRPLRPHKDYSEFFNQHALNSTYPGYKIPPGTQ  586
            A GP CRP R ++DY+ FF +H LN+ YP YK+PPGTQ
Sbjct  165  ALGPVCRPRRVNRDYTPFFAKHQLNNGYPSYKVPPGTQ  202


>Q86BH9_DROME unnamed protein product
Length=462

 Score = 119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 69/100 (69%), Gaps = 0/100 (0%)

Query  489  PTTITLRPKAPVSQAPPPLVTSQPATATLKGGKHLRGDLKWPPECVRQQFAEEDRLRLEL  548
            P  ITLR +APVSQ P P+ TSQPA  + +GG  LRGDLKWPP   ++  A E+  R +L
Sbjct  361  PGIITLRKEAPVSQKPAPVYTSQPAAVSYQGGSKLRGDLKWPPPEYKEAAARENEERRQL  420

Query  549  AQGPACRPLRPHKDYSEFFNQHALNSTYPGYKIPPGTQFF  588
            A GP CRP R ++DY+ FF +H LN+ YP YK+PPGTQ  
Sbjct  421  ALGPVCRPRRVNRDYTPFFAKHQLNNGYPSYKVPPGTQHI  460


 Score = 36.2 bits (82),  Expect = 0.071, Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 12/46 (26%)

Query  49  VGKPANLKNSAVLRMLEEEENRQRNGIGPGNYNTAKPLRENITWPP  94
           + KP NL NSAVLR +EEEE + + G             + + WPP
Sbjct  8   ITKPLNLANSAVLRAVEEEEQQAKCGY------------KRVAWPP  41


>M9PER0_DROME unnamed protein product
Length=500

 Score = 119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 69/98 (70%), Gaps = 0/98 (0%)

Query  489  PTTITLRPKAPVSQAPPPLVTSQPATATLKGGKHLRGDLKWPPECVRQQFAEEDRLRLEL  548
            P  ITLR +APVSQ P P+ TSQPA  + +GG  LRGDLKWPP   ++  A E+  R +L
Sbjct  399  PGIITLRKEAPVSQKPAPVYTSQPAAVSYQGGSKLRGDLKWPPPEYKEAAARENEERRQL  458

Query  549  AQGPACRPLRPHKDYSEFFNQHALNSTYPGYKIPPGTQ  586
            A GP CRP R ++DY+ FF +H LN+ YP YK+PPGTQ
Sbjct  459  ALGPVCRPRRVNRDYTPFFAKHQLNNGYPSYKVPPGTQ  496


 Score = 71.6 bits (174),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 53/89 (60%), Gaps = 15/89 (17%)

Query  6   KLVNKQFNSPIGLYSPQNIQEVLERETQILANGAVGINFNNPNVGKPANLKNSAVLRMLE  65
           KLV+KQFNSP+GLYS +N++  L RE  + A G  GI  ++  + KP NL NSAVLR +E
Sbjct  7   KLVHKQFNSPMGLYSQENVKATLNRE--LKAFGGEGIEVDD-QITKPLNLANSAVLRAVE  63

Query  66  EEENRQRNGIGPGNYNTAKPLRENITWPP  94
           EEE + + G             + + WPP
Sbjct  64  EEEQQAKCGY------------KRVAWPP  80


>Q8IGP1_DROME unnamed protein product
Length=501

 Score = 119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 69/98 (70%), Gaps = 0/98 (0%)

Query  489  PTTITLRPKAPVSQAPPPLVTSQPATATLKGGKHLRGDLKWPPECVRQQFAEEDRLRLEL  548
            P  ITLR +APVSQ P P+ TSQPA  + +GG  LRGDLKWPP   ++  A E+  R +L
Sbjct  400  PGIITLRKEAPVSQKPAPVYTSQPAAVSYQGGSKLRGDLKWPPPEYKEAAARENEERRQL  459

Query  549  AQGPACRPLRPHKDYSEFFNQHALNSTYPGYKIPPGTQ  586
            A GP CRP R ++DY+ FF +H LN+ YP YK+PPGTQ
Sbjct  460  ALGPVCRPRRVNRDYTPFFAKHQLNNGYPSYKVPPGTQ  497


 Score = 71.6 bits (174),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 53/89 (60%), Gaps = 15/89 (17%)

Query  6   KLVNKQFNSPIGLYSPQNIQEVLERETQILANGAVGINFNNPNVGKPANLKNSAVLRMLE  65
           KLV+KQFNSP+GLYS +N++  L RE  + A G  GI  ++  + KP NL NSAVLR +E
Sbjct  7   KLVHKQFNSPMGLYSQENVKATLNRE--LKAFGGEGIEVDD-QITKPLNLANSAVLRAVE  63

Query  66  EEENRQRNGIGPGNYNTAKPLRENITWPP  94
           EEE + + G             + + WPP
Sbjct  64  EEEQQAKCGY------------KRVAWPP  80


>M9PC24_DROME unnamed protein product
Length=502

 Score = 119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 69/98 (70%), Gaps = 0/98 (0%)

Query  489  PTTITLRPKAPVSQAPPPLVTSQPATATLKGGKHLRGDLKWPPECVRQQFAEEDRLRLEL  548
            P  ITLR +APVSQ P P+ TSQPA  + +GG  LRGDLKWPP   ++  A E+  R +L
Sbjct  401  PGIITLRKEAPVSQKPAPVYTSQPAAVSYQGGSKLRGDLKWPPPEYKEAAARENEERRQL  460

Query  549  AQGPACRPLRPHKDYSEFFNQHALNSTYPGYKIPPGTQ  586
            A GP CRP R ++DY+ FF +H LN+ YP YK+PPGTQ
Sbjct  461  ALGPVCRPRRVNRDYTPFFAKHQLNNGYPSYKVPPGTQ  498


 Score = 71.6 bits (174),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 53/89 (60%), Gaps = 15/89 (17%)

Query  6   KLVNKQFNSPIGLYSPQNIQEVLERETQILANGAVGINFNNPNVGKPANLKNSAVLRMLE  65
           KLV+KQFNSP+GLYS +N++  L RE  + A G  GI  ++  + KP NL NSAVLR +E
Sbjct  7   KLVHKQFNSPMGLYSQENVKATLNRE--LKAFGGEGIEVDD-QITKPLNLANSAVLRAVE  63

Query  66  EEENRQRNGIGPGNYNTAKPLRENITWPP  94
           EEE + + G             + + WPP
Sbjct  64  EEEQQAKCGY------------KRVAWPP  80



Lambda      K        H
   0.308    0.123    0.363 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7477882188


Query= XP_018560810.1 ataxin-2 homolog isoform X4 [Anoplophora
glabripennis]

Length=591
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q86LF6_DROME  unnamed protein product                                 102     1e-24
M9PC30_DROME  unnamed protein product                                 102     6e-24
Q8IGH4_DROME  unnamed protein product                                 102     9e-24
Q7KUD8_DROME  unnamed protein product                                 102     1e-23
Q867T3_DROME  unnamed protein product                                 102     1e-23


>Q86LF6_DROME unnamed protein product
Length=206

 Score = 102 bits (253),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 70/134 (52%), Gaps = 36/134 (27%)

Query  453  PTTITLRPKAPVSQAPPPLVTSQPATATLKVSKKNLRGDIKWPPEDVKRKIAEENLDSND  512
            P  ITLR +APVSQ P P+ TSQPA                                   
Sbjct  105  PGIITLRKEAPVSQKPAPVYTSQPAA----------------------------------  130

Query  513  SFLSIQGGKHLRGDLKWPPECVRQQFAEEDRLRLELAQGPACRPLRPHKDYSEFFNQHAL  572
              +S QGG  LRGDLKWPP   ++  A E+  R +LA GP CRP R ++DY+ FF +H L
Sbjct  131  --VSYQGGSKLRGDLKWPPPEYKEAAARENEERRQLALGPVCRPRRVNRDYTPFFAKHQL  188

Query  573  NSTYPGYKIPPGTQ  586
            N+ YP YK+PPGTQ
Sbjct  189  NNGYPSYKVPPGTQ  202


>M9PC30_DROME unnamed protein product
Length=299

 Score = 102 bits (254),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 70/134 (52%), Gaps = 36/134 (27%)

Query  453  PTTITLRPKAPVSQAPPPLVTSQPATATLKVSKKNLRGDIKWPPEDVKRKIAEENLDSND  512
            P  ITLR +APVSQ P P+ TSQPA                                   
Sbjct  198  PGIITLRKEAPVSQKPAPVYTSQPAA----------------------------------  223

Query  513  SFLSIQGGKHLRGDLKWPPECVRQQFAEEDRLRLELAQGPACRPLRPHKDYSEFFNQHAL  572
              +S QGG  LRGDLKWPP   ++  A E+  R +LA GP CRP R ++DY+ FF +H L
Sbjct  224  --VSYQGGSKLRGDLKWPPPEYKEAAARENEERRQLALGPVCRPRRVNRDYTPFFAKHQL  281

Query  573  NSTYPGYKIPPGTQ  586
            N+ YP YK+PPGTQ
Sbjct  282  NNGYPSYKVPPGTQ  295


>Q8IGH4_DROME unnamed protein product
Length=315

 Score = 102 bits (254),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 70/136 (51%), Gaps = 36/136 (26%)

Query  453  PTTITLRPKAPVSQAPPPLVTSQPATATLKVSKKNLRGDIKWPPEDVKRKIAEENLDSND  512
            P  ITLR +APVSQ P P+ TSQPA                                   
Sbjct  214  PGIITLRKEAPVSQKPAPVYTSQPAA----------------------------------  239

Query  513  SFLSIQGGKHLRGDLKWPPECVRQQFAEEDRLRLELAQGPACRPLRPHKDYSEFFNQHAL  572
              +S QGG  LRGDLKWPP   ++  A E+  R +LA GP CRP R ++DY+ FF +H L
Sbjct  240  --VSYQGGSKLRGDLKWPPPEYKEAAARENEERRQLALGPVCRPRRVNRDYTPFFAKHQL  297

Query  573  NSTYPGYKIPPGTQFF  588
            N+ YP YK+PPGTQ  
Sbjct  298  NNGYPSYKVPPGTQHI  313


 Score = 47.4 bits (111),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 28/41 (68%), Gaps = 4/41 (10%)

Query  49  VGKPANLKNSAVLRMLEEEENRQRNGIGPGAKRVAWPPPSE  89
           + KP NL NSAVLR +EEEE + + G     KRVAWPP SE
Sbjct  8   ITKPLNLANSAVLRAVEEEEQQAKCGY----KRVAWPPASE  44


>Q7KUD8_DROME unnamed protein product
Length=354

 Score = 102 bits (255),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 70/134 (52%), Gaps = 36/134 (27%)

Query  453  PTTITLRPKAPVSQAPPPLVTSQPATATLKVSKKNLRGDIKWPPEDVKRKIAEENLDSND  512
            P  ITLR +APVSQ P P+ TSQPA                                   
Sbjct  253  PGIITLRKEAPVSQKPAPVYTSQPAA----------------------------------  278

Query  513  SFLSIQGGKHLRGDLKWPPECVRQQFAEEDRLRLELAQGPACRPLRPHKDYSEFFNQHAL  572
              +S QGG  LRGDLKWPP   ++  A E+  R +LA GP CRP R ++DY+ FF +H L
Sbjct  279  --VSYQGGSKLRGDLKWPPPEYKEAAARENEERRQLALGPVCRPRRVNRDYTPFFAKHQL  336

Query  573  NSTYPGYKIPPGTQ  586
            N+ YP YK+PPGTQ
Sbjct  337  NNGYPSYKVPPGTQ  350


 Score = 82.4 bits (202),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 57/84 (68%), Gaps = 7/84 (8%)

Query  6   KLVNKQFNSPIGLYSPQNIQEVLERETQILANGAVGINFNNPNVGKPANLKNSAVLRMLE  65
           KLV+KQFNSP+GLYS +N++  L RE +  A G  GI  ++  + KP NL NSAVLR +E
Sbjct  7   KLVHKQFNSPMGLYSQENVKATLNRELK--AFGGEGIEVDD-QITKPLNLANSAVLRAVE  63

Query  66  EEENRQRNGIGPGAKRVAWPPPSE  89
           EEE + + G     KRVAWPP SE
Sbjct  64  EEEQQAKCGY----KRVAWPPASE  83


>Q867T3_DROME unnamed protein product
Length=355

 Score = 102 bits (255),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 70/134 (52%), Gaps = 36/134 (27%)

Query  453  PTTITLRPKAPVSQAPPPLVTSQPATATLKVSKKNLRGDIKWPPEDVKRKIAEENLDSND  512
            P  ITLR +APVSQ P P+ TSQPA                                   
Sbjct  254  PGIITLRKEAPVSQKPAPVYTSQPAA----------------------------------  279

Query  513  SFLSIQGGKHLRGDLKWPPECVRQQFAEEDRLRLELAQGPACRPLRPHKDYSEFFNQHAL  572
              +S QGG  LRGDLKWPP   ++  A E+  R +LA GP CRP R ++DY+ FF +H L
Sbjct  280  --VSYQGGSKLRGDLKWPPPEYKEAAARENEERRQLALGPVCRPRRVNRDYTPFFAKHQL  337

Query  573  NSTYPGYKIPPGTQ  586
            N+ YP YK+PPGTQ
Sbjct  338  NNGYPSYKVPPGTQ  351


 Score = 82.4 bits (202),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 57/84 (68%), Gaps = 7/84 (8%)

Query  6   KLVNKQFNSPIGLYSPQNIQEVLERETQILANGAVGINFNNPNVGKPANLKNSAVLRMLE  65
           KLV+KQFNSP+GLYS +N++  L RE +  A G  GI  ++  + KP NL NSAVLR +E
Sbjct  7   KLVHKQFNSPMGLYSQENVKATLNRELK--AFGGEGIEVDD-QITKPLNLANSAVLRAVE  63

Query  66  EEENRQRNGIGPGAKRVAWPPPSE  89
           EEE + + G     KRVAWPP SE
Sbjct  64  EEEQQAKCGY----KRVAWPPASE  83



Lambda      K        H
   0.308    0.123    0.363 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7477882188


Query= XP_018560811.1 mediator of RNA polymerase II transcription subunit
15 isoform X5 [Anoplophora glabripennis]

Length=555
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q86LF6_DROME  unnamed protein product                                 117     6e-30
M9PER0_DROME  unnamed protein product                                 119     2e-28
M9PC24_DROME  unnamed protein product                                 119     2e-28
Q9VT55_DROME  unnamed protein product                                 118     2e-27
M9PF57_DROME  unnamed protein product                                 118     2e-27


>Q86LF6_DROME unnamed protein product
Length=206

 Score = 117 bits (292),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 69/98 (70%), Gaps = 0/98 (0%)

Query  453  PTTITLRPKAPVSQAPPPLVTSQPATATLKGGKHLRGDLKWPPECVRQQFAEEDRLRLEL  512
            P  ITLR +APVSQ P P+ TSQPA  + +GG  LRGDLKWPP   ++  A E+  R +L
Sbjct  105  PGIITLRKEAPVSQKPAPVYTSQPAAVSYQGGSKLRGDLKWPPPEYKEAAARENEERRQL  164

Query  513  AQGPACRPLRPHKDYSEFFNQHALNSTYPGYKIPPGTQ  550
            A GP CRP R ++DY+ FF +H LN+ YP YK+PPGTQ
Sbjct  165  ALGPVCRPRRVNRDYTPFFAKHQLNNGYPSYKVPPGTQ  202


>M9PER0_DROME unnamed protein product
Length=500

 Score = 119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 69/98 (70%), Gaps = 0/98 (0%)

Query  453  PTTITLRPKAPVSQAPPPLVTSQPATATLKGGKHLRGDLKWPPECVRQQFAEEDRLRLEL  512
            P  ITLR +APVSQ P P+ TSQPA  + +GG  LRGDLKWPP   ++  A E+  R +L
Sbjct  399  PGIITLRKEAPVSQKPAPVYTSQPAAVSYQGGSKLRGDLKWPPPEYKEAAARENEERRQL  458

Query  513  AQGPACRPLRPHKDYSEFFNQHALNSTYPGYKIPPGTQ  550
            A GP CRP R ++DY+ FF +H LN+ YP YK+PPGTQ
Sbjct  459  ALGPVCRPRRVNRDYTPFFAKHQLNNGYPSYKVPPGTQ  496


 Score = 83.6 bits (205),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 57/84 (68%), Gaps = 7/84 (8%)

Query  6   KLVNKQFNSPIGLYSPQNIQEVLERETQILANGAVGINFNNPNVGKPANLKNSAVLRMLE  65
           KLV+KQFNSP+GLYS +N++  L RE  + A G  GI  ++  + KP NL NSAVLR +E
Sbjct  7   KLVHKQFNSPMGLYSQENVKATLNRE--LKAFGGEGIEVDD-QITKPLNLANSAVLRAVE  63

Query  66  EEENRQRNGIGPGAKRVAWPPPSE  89
           EEE + + G     KRVAWPP SE
Sbjct  64  EEEQQAKCGY----KRVAWPPASE  83


>M9PC24_DROME unnamed protein product
Length=502

 Score = 119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 69/98 (70%), Gaps = 0/98 (0%)

Query  453  PTTITLRPKAPVSQAPPPLVTSQPATATLKGGKHLRGDLKWPPECVRQQFAEEDRLRLEL  512
            P  ITLR +APVSQ P P+ TSQPA  + +GG  LRGDLKWPP   ++  A E+  R +L
Sbjct  401  PGIITLRKEAPVSQKPAPVYTSQPAAVSYQGGSKLRGDLKWPPPEYKEAAARENEERRQL  460

Query  513  AQGPACRPLRPHKDYSEFFNQHALNSTYPGYKIPPGTQ  550
            A GP CRP R ++DY+ FF +H LN+ YP YK+PPGTQ
Sbjct  461  ALGPVCRPRRVNRDYTPFFAKHQLNNGYPSYKVPPGTQ  498


 Score = 83.6 bits (205),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 57/84 (68%), Gaps = 7/84 (8%)

Query  6   KLVNKQFNSPIGLYSPQNIQEVLERETQILANGAVGINFNNPNVGKPANLKNSAVLRMLE  65
           KLV+KQFNSP+GLYS +N++  L RE  + A G  GI  ++  + KP NL NSAVLR +E
Sbjct  7   KLVHKQFNSPMGLYSQENVKATLNRE--LKAFGGEGIEVDD-QITKPLNLANSAVLRAVE  63

Query  66  EEENRQRNGIGPGAKRVAWPPPSE  89
           EEE + + G     KRVAWPP SE
Sbjct  64  EEEQQAKCGY----KRVAWPPASE  83


>Q9VT55_DROME unnamed protein product
Length=1339

 Score = 118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 69/100 (69%), Gaps = 0/100 (0%)

Query  453   PTTITLRPKAPVSQAPPPLVTSQPATATLKGGKHLRGDLKWPPECVRQQFAEEDRLRLEL  512
             P  ITLR +APVSQ P P+ TSQPA  + +GG  LRGDLKWPP   ++  A E+  R +L
Sbjct  1238  PGIITLRKEAPVSQKPAPVYTSQPAAVSYQGGSKLRGDLKWPPPEYKEAAARENEERRQL  1297

Query  513   AQGPACRPLRPHKDYSEFFNQHALNSTYPGYKIPPGTQFF  552
             A GP CRP R ++DY+ FF +H LN+ YP YK+PPGTQ  
Sbjct  1298  ALGPVCRPRRVNRDYTPFFAKHQLNNGYPSYKVPPGTQHI  1337


 Score = 33.1 bits (74),  Expect = 0.69, Method: Compositional matrix adjust.
 Identities = 14/20 (70%), Positives = 16/20 (80%), Gaps = 0/20 (0%)

Query  49  VGKPANLKNSAVLRMLEEEE  68
           + KP NL NSAVLR +EEEE
Sbjct  8   ITKPLNLANSAVLRAVEEEE  27


>M9PF57_DROME unnamed protein product
Length=1385

 Score = 118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 69/100 (69%), Gaps = 0/100 (0%)

Query  453   PTTITLRPKAPVSQAPPPLVTSQPATATLKGGKHLRGDLKWPPECVRQQFAEEDRLRLEL  512
             P  ITLR +APVSQ P P+ TSQPA  + +GG  LRGDLKWPP   ++  A E+  R +L
Sbjct  1284  PGIITLRKEAPVSQKPAPVYTSQPAAVSYQGGSKLRGDLKWPPPEYKEAAARENEERRQL  1343

Query  513   AQGPACRPLRPHKDYSEFFNQHALNSTYPGYKIPPGTQFF  552
             A GP CRP R ++DY+ FF +H LN+ YP YK+PPGTQ  
Sbjct  1344  ALGPVCRPRRVNRDYTPFFAKHQLNNGYPSYKVPPGTQHI  1383


 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 49/72 (68%), Gaps = 3/72 (4%)

Query  6   KLVNKQFNSPIGLYSPQNIQEVLERETQILANGAVGINFNNPNVGKPANLKNSAVLRMLE  65
           KLV+KQFNSP+GLYS +N++  L RE +  A G  GI  ++  + KP NL NSAVLR +E
Sbjct  7   KLVHKQFNSPMGLYSQENVKATLNRELK--AFGGEGIEVDD-QITKPLNLANSAVLRAVE  63

Query  66  EEENRQRNGIGP  77
           EEE + + G  P
Sbjct  64  EEEQQAKCGDFP  75



Lambda      K        H
   0.308    0.123    0.363 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7477882188


Query= XP_018560812.1 putative aldehyde dehydrogenase family 7 member A1
homolog isoform X1 [Anoplophora glabripennis]

Length=541
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

AL7A1_DICDI  unnamed protein product                                  593     0.0  
Q9VLC5_DROME  unnamed protein product                                 184     9e-52
Q9VBP6_DROME  unnamed protein product                                 178     1e-49
MMSA_CAEEL  unnamed protein product                                   146     6e-38
Q38BS5_TRYB2  unnamed protein product                                 97.4    3e-21


>AL7A1_DICDI unnamed protein product
Length=509

 Score = 593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/507 (55%), Positives = 385/507 (76%), Gaps = 6/507 (1%)

Query  37   SKYSFLKELGLQ-ETNLGVFDGTWKGSGKVVQSICPSNGKVIAEVKQGDVSDYESCVQSS  95
            ++Y FL ELG++ E N GVF+G W G+G++++ + P+N KVIA V+     +YE+C+Q+ 
Sbjct  5    NEYPFLAELGIKAENNDGVFNGKWGGAGEIIKCLNPTNNKVIATVRGAAPEEYETCIQAM  64

Query  96   TSAWNVWADLPAPKRGEIVRQIGDALRSKLIPLGKLVSIEMGKILPEGIGEVQEYVDICD  155
             +A   WA  PAP+RGEIVR IG A+R K+ PL KL+S+EMGKI  E  GEVQE++D+CD
Sbjct  65   LAAKVKWALTPAPRRGEIVRLIGQAMREKIEPLSKLISLEMGKIYIEAKGEVQEFIDVCD  124

Query  156  YAVGLSRTLAGAIYPSERPGHVLLEKWNPLGLIGVISAFNFPIAVYGWNSAVAMVCGDTI  215
            YA GLSR++ G + PSERP H+L+E WNPLGL+G+I+AFNFP AV GWN+A++M+CG+  
Sbjct  125  YATGLSRSINGQVMPSERPNHILMETWNPLGLVGIITAFNFPCAVLGWNAAISMICGNVQ  184

Query  216  LWKGAETTPLVSVATTKIVANVLQNNGLPGAVAALCCG-GADIGKAMAADKRIKLLSFTG  274
            LWKGA TT L+++A +KI+  VL  N +  AV  +  G G  +G+ M  DKR  L+SFTG
Sbjct  185  LWKGASTTSLITLAVSKIIEKVLVENDVDPAVCCVLIGPGRTVGEQMIQDKRFGLISFTG  244

Query  275  STHVGQQVGVDVQKRFGKHLLELGGNNAIIVADDADLNMVVQATLFACVGTAGQRCTSTR  334
            ST VG+++   V   FGK +LELGGNNAI+VA+DAD+ +V++A LFA VGT GQRCT+ R
Sbjct  245  STEVGRRISSTVHGYFGKTILELGGNNAIVVAEDADIELVLRAVLFASVGTTGQRCTTCR  304

Query  335  RLIFHENVYNEVLGRLTQAYKQVVNRIGDALDDSTLIGPLHSKQSLEKYKETVAEIQKQG  394
            RL  HE++Y+ +L RLT+AYK +  +IG+ L++  L+GPLH++ +++++ E + EI+KQG
Sbjct  305  RLFVHESLYDTILERLTKAYKTI--KIGNPLEEGVLVGPLHTQSAVKEFTEGLEEIKKQG  362

Query  395  GKIEFGGKVLE-RPGYFVEPTIVTGLKHNNPLVHNECFAPIVYVLKAESVPEAISCNNEV  453
            GK+  GG  L+   G FVEPT+V  ++H+ P+V  E F PI+Y++K +++ +A + NNEV
Sbjct  363  GKVVIGGNKLDISGGNFVEPTVV-AIEHDAPIVKTELFVPILYIMKFKNLDDAFAWNNEV  421

Query  454  PQGLSSSIFTQNIGNIFEWIGPKGSDCGIVNVNIPTSGAEIGGAFGGEKATGGGRESGSD  513
            PQGLSSS+FT N  NIF+W+GP GSDCGIVNVN+ T+GAEIGGAFGGEK TGGGRESGSD
Sbjct  422  PQGLSSSLFTNNQKNIFKWLGPTGSDCGIVNVNVATNGAEIGGAFGGEKETGGGRESGSD  481

Query  514  AWKQYMRRSTITINHSKDLPLAQGIKF  540
            +WKQY RRST TIN+   +PL+QGI F
Sbjct  482  SWKQYCRRSTNTINYGNTMPLSQGINF  508


>Q9VLC5_DROME unnamed protein product
Length=520

 Score = 184 bits (468),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 134/490 (27%), Positives = 234/490 (48%), Gaps = 33/490 (7%)

Query  53   GVF-DGTWKGS--GKVVQSICPSNGKVIAEVKQGDVSDYESCVQSSTSAWNV---WADLP  106
            GVF +  W  S  GK+ ++I P+  +VIAE++  D  D +  VQ++ +A+ +   W  + 
Sbjct  41   GVFINNEWHKSKSGKIFETINPTTAEVIAEIQCADKEDIDIAVQAARNAFKLGSPWRRMD  100

Query  107  APKRGEIVRQIGDALRSKLIPLGKLVSIEMGKI--------LPEGIGEVQEYVDICDYAV  158
            A +RG ++ ++ D +    + L  L +++ GK         LP  I  ++ +    D   
Sbjct  101  ASERGRLLYRLADLMERDQVYLASLETLDNGKPYSMSYNVDLPTAIKNLRYFAGWADKNH  160

Query  159  GLSRTLAGAIYPSERPGHVLLEKWNPLGLIGVISAFNFPIAVYGWNSAVAMVCGDTILWK  218
            G +  + G  +   R          P+G+ G I  +NFPI +  W    A+  G+TI+ K
Sbjct  161  GKTIPMDGDFFTYTR--------HEPVGVCGQIIPWNFPILMMAWKLGPALATGNTIVLK  212

Query  219  GAETTPLVSVATTKIVANVLQNNGLPGAVAALCCGGADIGKAMAADKRIKLLSFTGSTHV  278
             AE T L ++     +A +++  G P  V  +  G    G A+A    +  ++FTGST V
Sbjct  213  PAEQTSLTAL----YIAQLVKEAGFPEGVVNVVPGFGTAGAALANHCDVDKVAFTGSTDV  268

Query  279  GQQVGVDV-QKRFGKHLLELGGNNAIIVADDADLNMVVQATLFACVGTAGQRCTSTRRLI  337
            G+ + +        +  LELGG +  I+  D D++  V+   F      GQ C +  R  
Sbjct  269  GKLIQLASGNTNLKRVTLELGGKSPNIILSDTDMDYAVETAHFGLFFNMGQCCCAGSRTF  328

Query  338  FHENVYNEVLGRLTQAYKQVVNRIGDALDDSTLIGPLHSKQSLEKYKETVAEIQKQGGKI  397
              + +Y+E + R  +  K+    +G+  D +T  GP  +++ +EK    +   +KQG K+
Sbjct  329  VEDKIYDEFVERSAERAKK--RTVGNPFDLNTEQGPQVNEEQMEKILGMIKTGKKQGAKL  386

Query  398  EFGGKVLE-RPGYFVEPTIVTGLKHNNPLVHNECFAPIVYVLKAESVPEAISCNNEVPQG  456
              GG   E  PGYFV+PT+   ++ +  +   E F P+  +++ + + E I   N    G
Sbjct  387  VAGGSRPEGLPGYFVQPTVFADVQDDMTIAREEIFGPVQQLIRFKKLDEVIERANNSEYG  446

Query  457  LSSSIFTQNIGNIFEWIGPKGSDCGIVNVNIPTSGAEIGGAFGGEKATGGGRESGSDAWK  516
            L++++FT+++      +G  G   G V VN     A     FGG K +G GRE+G  A  
Sbjct  447  LAAAVFTKDLDKANYIVG--GLRAGTVWVNTYNVLAA-QAPFGGYKMSGHGRENGEYALS  503

Query  517  QYMRRSTITI  526
             Y    ++ +
Sbjct  504  NYTEVKSVIV  513


>Q9VBP6_DROME unnamed protein product
Length=509

 Score = 178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 133/484 (27%), Positives = 224/484 (46%), Gaps = 19/484 (4%)

Query  56   DGTWKGSGKVVQSI---CPSNGKVIAEVKQGDVSDYESCVQSSTSAWNV--WADLPAPKR  110
            DG W  S     +     P+NG VI +V    V+D +  + ++  A+    W  L A  R
Sbjct  34   DGAWVDSSNAKATFEVRNPANGAVIGKVPNMTVADAQKAIDAAKQAYESKEWRSLTAKDR  93

Query  111  GEIVRQIGDALRSKLIPLGKLVSIEMGKILPEGIGEVQEYVDICDYAVGLSRTLAGAIYP  170
              ++++    +      + ++++ E GK + E  GEV       ++    +R + G I P
Sbjct  94   SNLLKKWHKLIEQHSQEIAEIMTAESGKPINESKGEVAYGNAFVEWFAEEARRIYGEIVP  153

Query  171  SERPGHVLLEKWNPLGLIGVISAFNFPIAVYGWNSAVAMVCGDTILWKGAETTPLVSVAT  230
            S  P   ++    P+G+  +I+ +NFP+A+    +  A+  G T++ K +E TPL ++A 
Sbjct  154  SASPNREIIVMKQPIGVAALITPWNFPMAMITRKAGAALAAGCTVVVKPSEDTPLTALAV  213

Query  231  TKIVANVLQNNGLPGAVAALCC--GGADIGKAMAADKRIKLLSFTGSTHVGQQVGVDVQK  288
             K+  +     G+P  V  +      A IG        ++ +SFTGST VG+ +  +   
Sbjct  214  AKLAVDA----GIPKGVINVVTTNKAAPIGDLFCKSPDVRGISFTGSTEVGKLLFRNSAD  269

Query  289  RFGKHLLELGGNNAIIVADDADLNMVVQATLFACVGTAGQRCTSTRRLIFHENVYNEVLG  348
               +  LELGGN   IV D AD+   V   + +     GQ C S  R    ++VY++ +G
Sbjct  270  GIKRICLELGGNAPFIVFDSADIEKAVDGAMASKFRNCGQTCVSANRFFVQDSVYDKFVG  329

Query  349  RLTQAYKQVVNRIGDALDDSTLIGPLHSKQSLEKYKETVAEIQKQGGKIEFGGKVLERPG  408
            +L +  + +  +IGD       IGPL ++    K    V + + +   I  GG+ L   G
Sbjct  330  QLKKRVEAL--KIGDGQGCDVQIGPLINEMQFNKVSGFVEDARSKKANIILGGQPLPDKG  387

Query  409  -YFVEPTIVTGLKHNNPLVHNECFAPIVYVLKAESVPEAISCNNEVPQGLSSSIFTQNIG  467
              F  PTIVT +  +  L   E F P+V +++     EA+   N+  +GL+   +++N+ 
Sbjct  388  SLFYAPTIVTDVPPSAQLYSEEVFGPVVSIIRFRDEEEAVKKANDTRRGLAGYFYSENLQ  447

Query  468  NIFEWIGPKGSDCGIVNVNIP-TSGAEIGGAFGGEKATGGGRESGSDAWKQYMRRSTITI  526
             +F     K  + G+V VN    S AE    FGG K +G GRE        Y+    I +
Sbjct  448  QVFRV--AKRLEVGMVGVNEGIISAAE--APFGGVKESGVGREGSKHGIDDYVDIKYICM  503

Query  527  NHSK  530
             + K
Sbjct  504  GNLK  507


>MMSA_CAEEL unnamed protein product
Length=523

 Score = 146 bits (369),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 106/428 (25%), Positives = 192/428 (45%), Gaps = 15/428 (4%)

Query  66   VQSICPSNGKVIAEVKQGDVSDYESCVQSSTSAWNVWADLPAPKRGEIVRQIGDALRSKL  125
            V+   P+  +VIA V     ++ ++ V S+ +A+N W +     R + + ++   ++  +
Sbjct  47   VELTNPATNEVIAMVPNATQAEMQAAVDSAKNAFNTWKNTSPLTRQQCMFKLQALIKRDM  106

Query  126  IPLGKLVSIEMGKILPEGIGEVQEYVDICDYAVGLSRTLAGAIYPSERPGHVLLEKWNPL  185
              L + ++IE GK LP+  G+V   + + ++A  +   + G   P+            PL
Sbjct  107  KKLAESITIEQGKTLPDAEGDVSRGLQVVEHACSVPSLMMGETLPNVSRDMDTHSYRIPL  166

Query  186  GLIGVISAFNFPIAVYGWNSAVAMVCGDTILWKGAETTPLVSVATTKIVANVLQNNGLPG  245
            G+   I  FNFP  +  W   VA+  G+T++ K +E  P       +++  + +  G+P 
Sbjct  167  GVTAGICPFNFPAMIPLWMFPVALATGNTMVIKPSEQDP----GAAQLLVELAKEAGVPD  222

Query  246  AVAALCCGGADIGKAMAADKRIKLLSFTGSTHVGQQVGVDVQKRFGKHLLELGGNNAIIV  305
                +  G       +  +  IK +SF G    G+ +     K   +    +G  N  ++
Sbjct  223  GCVNIIHGQHSAVNFICDNPDIKAISFVGGDAAGKHIYERGAKNGKRVQSNMGAKNHGVI  282

Query  306  ADDADLNMVVQATLFACVGTAGQRCTSTRRLIFHENVYNEVLGRLTQAYKQVVN-RIGDA  364
              DA+    +     A  G AGQRC +    +    +  E    L +  ++  N ++   
Sbjct  283  MADANKEQTLNQLTAAAFGAAGQRCMALTTAV----LVGEARAWLPELVEKAKNLKVNAG  338

Query  365  LDDSTLIGPLHSKQSLEKYKETVAEIQKQGGKIEFGGKVLERPGY----FVEPTIVTGLK  420
                T IGPL SKQS  +    +   +K+G ++   G  +  PG+    FV PTI+ G+K
Sbjct  339  WKPDTDIGPLISKQSKARVLRLIESAKKEGAQVPLDGSNITVPGFENGNFVGPTILAGVK  398

Query  421  HNNPLVHNECFAPIVYVLKAESVPEAISCNNEVPQGLSSSIFTQNIGNIFEWIGPKGSDC  480
             N      E F P++ V++AE++ EAI   N  P G  ++IFT N     ++      D 
Sbjct  399  PNMTCYREEIFGPVLVVMEAENLNEAIEIINNNPYGNGTAIFTSNGATARKFT--NEVDV  456

Query  481  GIVNVNIP  488
            G + +N+P
Sbjct  457  GQIGINVP  464


>Q38BS5_TRYB2 unnamed protein product
Length=561

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 102/451 (23%), Positives = 191/451 (42%), Gaps = 40/451 (9%)

Query  89   ESCVQSSTSAWNVWADLPAPKRGEIVRQIGDALRSKLIPLGKLVSIEMGKILPEGIGEVQ  148
            +  + ++  A   W+ +P   R  I       + +K         +    +L +     Q
Sbjct  89   QKAIDTALGAAKEWSQMPFKDRAAIFLHAAHLISTKY-----RHELRAATMLGQSKNPFQ  143

Query  149  EYVDI----CDYAVGLSRTLAGAIYPSERPGHVLLEKWNPL------GLIGVISAFNFPI  198
              +D+    CD+ +  S   A  +Y  +         WN L      G + VI+ FNF  
Sbjct  144  AEIDVIAESCDF-LRFSVKYAEELYNQQPISPASGPVWNALDYRPLEGFVSVIAPFNFS-  201

Query  199  AVYGWNSAVAMVCGDTILWKGAETTPLVSVATTKIVANVLQNNGLP-GAVAALCCGGADI  257
            A+     A   + G+ ILWK +      +V +  ++  V +  GLP G V  + C    +
Sbjct  202  AIAANLVACPALMGNVILWKPSPN----AVLSNYLLYKVFEEAGLPAGVVNFMPCEPKVM  257

Query  258  GKAMAADKRIKLLSFTGSTHVGQQVGVDVQKRFGKHLL------ELGGNNAIIVADDADL  311
             + + +   +  ++FTGST+V   +   +  R  ++        E GG +  ++   AD+
Sbjct  258  TEVVNSHPELAGVAFTGSTNVFLSINKQIYSRLEEYRNIPRISGETGGKDFHLIHPTADM  317

Query  312  NMVVQATLFACVGTAGQRCTSTRRLIFHENVYNEVLGRLTQAYKQVVNRIGDALDDSTLI  371
             M    T+       GQ+C++T R+   ++ + E+ G L + + ++  ++G   D  + +
Sbjct  318  KMTAALTVRGAFEYQGQKCSATSRIYVPQSRWEELKGYLLELHGKL--KMGQPDDFQSFM  375

Query  372  GPLHSKQSLEKYKE--TVAEIQKQGGKIEFGGKVLERPGYFVEPTIVTGLKHNNPLVHNE  429
              +  + + ++ K+   +A+       I  GG   +  G+F++PTI+     N  L+  E
Sbjct  376  CAVIDETAFDRNKKYIDIAKADSSAYTIIAGGGCDKSEGWFIQPTIIVAKDPNAQLLREE  435

Query  430  CFAPIVYV-LKAESVPEAIS-----CNNEVPQGLSSSIFTQNIGNIFEWIGPK-GSDCGI  482
             F PI+ V +  +S P+  S      NN     L+ SIF Q+   I +          G 
Sbjct  436  IFGPILTVHVYDDSKPDFWSEACNLVNNATKYALTGSIFAQDRKAIRDATEKHLRYAAGN  495

Query  483  VNVNIPTSGAEIG-GAFGGEKATGGGRESGS  512
              +N   +GA +G   FGG +A+G   + GS
Sbjct  496  YYINDKCTGAVVGQQPFGGARASGSNDKPGS  526



Lambda      K        H
   0.308    0.123    0.363 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7477882188


Query= XP_018560813.1 alpha-aminoadipic semialdehyde dehydrogenase isoform
X3 [Anoplophora glabripennis]

Length=517
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

AL7A1_DICDI  unnamed protein product                                  592     0.0  
Q9VLC5_DROME  unnamed protein product                                 185     5e-52
Q9VBP6_DROME  unnamed protein product                                 178     9e-50
MMSA_CAEEL  unnamed protein product                                   146     6e-38
Q38BS5_TRYB2  unnamed protein product                                 97.4    3e-21


>AL7A1_DICDI unnamed protein product
Length=509

 Score = 592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/507 (55%), Positives = 385/507 (76%), Gaps = 6/507 (1%)

Query  13   SKYSFLKELGLQ-ETNLGVFDGTWKGSGKVVQSICPSNGKVIAEVKQGDVSDYESCVQSS  71
            ++Y FL ELG++ E N GVF+G W G+G++++ + P+N KVIA V+     +YE+C+Q+ 
Sbjct  5    NEYPFLAELGIKAENNDGVFNGKWGGAGEIIKCLNPTNNKVIATVRGAAPEEYETCIQAM  64

Query  72   TSAWNVWADLPAPKRGEIVRQIGDALRSKLIPLGKLVSIEMGKILPEGIGEVQEYVDICD  131
             +A   WA  PAP+RGEIVR IG A+R K+ PL KL+S+EMGKI  E  GEVQE++D+CD
Sbjct  65   LAAKVKWALTPAPRRGEIVRLIGQAMREKIEPLSKLISLEMGKIYIEAKGEVQEFIDVCD  124

Query  132  YAVGLSRTLAGAIYPSERPGHVLLEKWNPLGLIGVISAFNFPIAVYGWNSAVAMVCGDTI  191
            YA GLSR++ G + PSERP H+L+E WNPLGL+G+I+AFNFP AV GWN+A++M+CG+  
Sbjct  125  YATGLSRSINGQVMPSERPNHILMETWNPLGLVGIITAFNFPCAVLGWNAAISMICGNVQ  184

Query  192  LWKGAETTPLVSVATTKIVANVLQNNGLPGAVAALCCG-GADIGKAMAADKRIKLLSFTG  250
            LWKGA TT L+++A +KI+  VL  N +  AV  +  G G  +G+ M  DKR  L+SFTG
Sbjct  185  LWKGASTTSLITLAVSKIIEKVLVENDVDPAVCCVLIGPGRTVGEQMIQDKRFGLISFTG  244

Query  251  STHVGQQVGVDVQKRFGKHLLELGGNNAIIVADDADLNMVVQATLFACVGTAGQRCTSTR  310
            ST VG+++   V   FGK +LELGGNNAI+VA+DAD+ +V++A LFA VGT GQRCT+ R
Sbjct  245  STEVGRRISSTVHGYFGKTILELGGNNAIVVAEDADIELVLRAVLFASVGTTGQRCTTCR  304

Query  311  RLIFHENVYNEVLGRLTQAYKQVVNRIGDALDDSTLIGPLHSKQSLEKYKETVAEIQKQG  370
            RL  HE++Y+ +L RLT+AYK +  +IG+ L++  L+GPLH++ +++++ E + EI+KQG
Sbjct  305  RLFVHESLYDTILERLTKAYKTI--KIGNPLEEGVLVGPLHTQSAVKEFTEGLEEIKKQG  362

Query  371  GKIEFGGKVLE-RPGYFVEPTIVTGLKHNNPLVHNECFAPIVYVLKAESVPEAISCNNEV  429
            GK+  GG  L+   G FVEPT+V  ++H+ P+V  E F PI+Y++K +++ +A + NNEV
Sbjct  363  GKVVIGGNKLDISGGNFVEPTVV-AIEHDAPIVKTELFVPILYIMKFKNLDDAFAWNNEV  421

Query  430  PQGLSSSIFTQNIGNIFEWIGPKGSDCGIVNVNIPTSGAEIGGAFGGEKATGGGRESGSD  489
            PQGLSSS+FT N  NIF+W+GP GSDCGIVNVN+ T+GAEIGGAFGGEK TGGGRESGSD
Sbjct  422  PQGLSSSLFTNNQKNIFKWLGPTGSDCGIVNVNVATNGAEIGGAFGGEKETGGGRESGSD  481

Query  490  AWKQYMRRSTITINHSKDLPLAQGIKF  516
            +WKQY RRST TIN+   +PL+QGI F
Sbjct  482  SWKQYCRRSTNTINYGNTMPLSQGINF  508


>Q9VLC5_DROME unnamed protein product
Length=520

 Score = 185 bits (469),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 134/490 (27%), Positives = 234/490 (48%), Gaps = 33/490 (7%)

Query  29   GVF-DGTWKGS--GKVVQSICPSNGKVIAEVKQGDVSDYESCVQSSTSAWNV---WADLP  82
            GVF +  W  S  GK+ ++I P+  +VIAE++  D  D +  VQ++ +A+ +   W  + 
Sbjct  41   GVFINNEWHKSKSGKIFETINPTTAEVIAEIQCADKEDIDIAVQAARNAFKLGSPWRRMD  100

Query  83   APKRGEIVRQIGDALRSKLIPLGKLVSIEMGKI--------LPEGIGEVQEYVDICDYAV  134
            A +RG ++ ++ D +    + L  L +++ GK         LP  I  ++ +    D   
Sbjct  101  ASERGRLLYRLADLMERDQVYLASLETLDNGKPYSMSYNVDLPTAIKNLRYFAGWADKNH  160

Query  135  GLSRTLAGAIYPSERPGHVLLEKWNPLGLIGVISAFNFPIAVYGWNSAVAMVCGDTILWK  194
            G +  + G  +   R          P+G+ G I  +NFPI +  W    A+  G+TI+ K
Sbjct  161  GKTIPMDGDFFTYTR--------HEPVGVCGQIIPWNFPILMMAWKLGPALATGNTIVLK  212

Query  195  GAETTPLVSVATTKIVANVLQNNGLPGAVAALCCGGADIGKAMAADKRIKLLSFTGSTHV  254
             AE T L ++     +A +++  G P  V  +  G    G A+A    +  ++FTGST V
Sbjct  213  PAEQTSLTAL----YIAQLVKEAGFPEGVVNVVPGFGTAGAALANHCDVDKVAFTGSTDV  268

Query  255  GQQVGVDV-QKRFGKHLLELGGNNAIIVADDADLNMVVQATLFACVGTAGQRCTSTRRLI  313
            G+ + +        +  LELGG +  I+  D D++  V+   F      GQ C +  R  
Sbjct  269  GKLIQLASGNTNLKRVTLELGGKSPNIILSDTDMDYAVETAHFGLFFNMGQCCCAGSRTF  328

Query  314  FHENVYNEVLGRLTQAYKQVVNRIGDALDDSTLIGPLHSKQSLEKYKETVAEIQKQGGKI  373
              + +Y+E + R  +  K+    +G+  D +T  GP  +++ +EK    +   +KQG K+
Sbjct  329  VEDKIYDEFVERSAERAKK--RTVGNPFDLNTEQGPQVNEEQMEKILGMIKTGKKQGAKL  386

Query  374  EFGGKVLE-RPGYFVEPTIVTGLKHNNPLVHNECFAPIVYVLKAESVPEAISCNNEVPQG  432
              GG   E  PGYFV+PT+   ++ +  +   E F P+  +++ + + E I   N    G
Sbjct  387  VAGGSRPEGLPGYFVQPTVFADVQDDMTIAREEIFGPVQQLIRFKKLDEVIERANNSEYG  446

Query  433  LSSSIFTQNIGNIFEWIGPKGSDCGIVNVNIPTSGAEIGGAFGGEKATGGGRESGSDAWK  492
            L++++FT+++      +G  G   G V VN     A     FGG K +G GRE+G  A  
Sbjct  447  LAAAVFTKDLDKANYIVG--GLRAGTVWVNTYNVLAA-QAPFGGYKMSGHGRENGEYALS  503

Query  493  QYMRRSTITI  502
             Y    ++ +
Sbjct  504  NYTEVKSVIV  513


>Q9VBP6_DROME unnamed protein product
Length=509

 Score = 178 bits (452),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 133/487 (27%), Positives = 225/487 (46%), Gaps = 19/487 (4%)

Query  29   GVFDGTWKGSGKVVQSI---CPSNGKVIAEVKQGDVSDYESCVQSSTSAWNV--WADLPA  83
             + DG W  S     +     P+NG VI +V    V+D +  + ++  A+    W  L A
Sbjct  31   ALVDGAWVDSSNAKATFEVRNPANGAVIGKVPNMTVADAQKAIDAAKQAYESKEWRSLTA  90

Query  84   PKRGEIVRQIGDALRSKLIPLGKLVSIEMGKILPEGIGEVQEYVDICDYAVGLSRTLAGA  143
              R  ++++    +      + ++++ E GK + E  GEV       ++    +R + G 
Sbjct  91   KDRSNLLKKWHKLIEQHSQEIAEIMTAESGKPINESKGEVAYGNAFVEWFAEEARRIYGE  150

Query  144  IYPSERPGHVLLEKWNPLGLIGVISAFNFPIAVYGWNSAVAMVCGDTILWKGAETTPLVS  203
            I PS  P   ++    P+G+  +I+ +NFP+A+    +  A+  G T++ K +E TPL +
Sbjct  151  IVPSASPNREIIVMKQPIGVAALITPWNFPMAMITRKAGAALAAGCTVVVKPSEDTPLTA  210

Query  204  VATTKIVANVLQNNGLPGAVAALCC--GGADIGKAMAADKRIKLLSFTGSTHVGQQVGVD  261
            +A  K+  +     G+P  V  +      A IG        ++ +SFTGST VG+ +  +
Sbjct  211  LAVAKLAVDA----GIPKGVINVVTTNKAAPIGDLFCKSPDVRGISFTGSTEVGKLLFRN  266

Query  262  VQKRFGKHLLELGGNNAIIVADDADLNMVVQATLFACVGTAGQRCTSTRRLIFHENVYNE  321
                  +  LELGGN   IV D AD+   V   + +     GQ C S  R    ++VY++
Sbjct  267  SADGIKRICLELGGNAPFIVFDSADIEKAVDGAMASKFRNCGQTCVSANRFFVQDSVYDK  326

Query  322  VLGRLTQAYKQVVNRIGDALDDSTLIGPLHSKQSLEKYKETVAEIQKQGGKIEFGGKVLE  381
             +G+L +  + +  +IGD       IGPL ++    K    V + + +   I  GG+ L 
Sbjct  327  FVGQLKKRVEAL--KIGDGQGCDVQIGPLINEMQFNKVSGFVEDARSKKANIILGGQPLP  384

Query  382  RPG-YFVEPTIVTGLKHNNPLVHNECFAPIVYVLKAESVPEAISCNNEVPQGLSSSIFTQ  440
              G  F  PTIVT +  +  L   E F P+V +++     EA+   N+  +GL+   +++
Sbjct  385  DKGSLFYAPTIVTDVPPSAQLYSEEVFGPVVSIIRFRDEEEAVKKANDTRRGLAGYFYSE  444

Query  441  NIGNIFEWIGPKGSDCGIVNVNIP-TSGAEIGGAFGGEKATGGGRESGSDAWKQYMRRST  499
            N+  +F     K  + G+V VN    S AE    FGG K +G GRE        Y+    
Sbjct  445  NLQQVFRV--AKRLEVGMVGVNEGIISAAE--APFGGVKESGVGREGSKHGIDDYVDIKY  500

Query  500  ITINHSK  506
            I + + K
Sbjct  501  ICMGNLK  507


>MMSA_CAEEL unnamed protein product
Length=523

 Score = 146 bits (368),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 106/428 (25%), Positives = 192/428 (45%), Gaps = 15/428 (4%)

Query  42   VQSICPSNGKVIAEVKQGDVSDYESCVQSSTSAWNVWADLPAPKRGEIVRQIGDALRSKL  101
            V+   P+  +VIA V     ++ ++ V S+ +A+N W +     R + + ++   ++  +
Sbjct  47   VELTNPATNEVIAMVPNATQAEMQAAVDSAKNAFNTWKNTSPLTRQQCMFKLQALIKRDM  106

Query  102  IPLGKLVSIEMGKILPEGIGEVQEYVDICDYAVGLSRTLAGAIYPSERPGHVLLEKWNPL  161
              L + ++IE GK LP+  G+V   + + ++A  +   + G   P+            PL
Sbjct  107  KKLAESITIEQGKTLPDAEGDVSRGLQVVEHACSVPSLMMGETLPNVSRDMDTHSYRIPL  166

Query  162  GLIGVISAFNFPIAVYGWNSAVAMVCGDTILWKGAETTPLVSVATTKIVANVLQNNGLPG  221
            G+   I  FNFP  +  W   VA+  G+T++ K +E  P       +++  + +  G+P 
Sbjct  167  GVTAGICPFNFPAMIPLWMFPVALATGNTMVIKPSEQDP----GAAQLLVELAKEAGVPD  222

Query  222  AVAALCCGGADIGKAMAADKRIKLLSFTGSTHVGQQVGVDVQKRFGKHLLELGGNNAIIV  281
                +  G       +  +  IK +SF G    G+ +     K   +    +G  N  ++
Sbjct  223  GCVNIIHGQHSAVNFICDNPDIKAISFVGGDAAGKHIYERGAKNGKRVQSNMGAKNHGVI  282

Query  282  ADDADLNMVVQATLFACVGTAGQRCTSTRRLIFHENVYNEVLGRLTQAYKQVVN-RIGDA  340
              DA+    +     A  G AGQRC +    +    +  E    L +  ++  N ++   
Sbjct  283  MADANKEQTLNQLTAAAFGAAGQRCMALTTAV----LVGEARAWLPELVEKAKNLKVNAG  338

Query  341  LDDSTLIGPLHSKQSLEKYKETVAEIQKQGGKIEFGGKVLERPGY----FVEPTIVTGLK  396
                T IGPL SKQS  +    +   +K+G ++   G  +  PG+    FV PTI+ G+K
Sbjct  339  WKPDTDIGPLISKQSKARVLRLIESAKKEGAQVPLDGSNITVPGFENGNFVGPTILAGVK  398

Query  397  HNNPLVHNECFAPIVYVLKAESVPEAISCNNEVPQGLSSSIFTQNIGNIFEWIGPKGSDC  456
             N      E F P++ V++AE++ EAI   N  P G  ++IFT N     ++      D 
Sbjct  399  PNMTCYREEIFGPVLVVMEAENLNEAIEIINNNPYGNGTAIFTSNGATARKFT--NEVDV  456

Query  457  GIVNVNIP  464
            G + +N+P
Sbjct  457  GQIGINVP  464


>Q38BS5_TRYB2 unnamed protein product
Length=561

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 102/451 (23%), Positives = 191/451 (42%), Gaps = 40/451 (9%)

Query  65   ESCVQSSTSAWNVWADLPAPKRGEIVRQIGDALRSKLIPLGKLVSIEMGKILPEGIGEVQ  124
            +  + ++  A   W+ +P   R  I       + +K         +    +L +     Q
Sbjct  89   QKAIDTALGAAKEWSQMPFKDRAAIFLHAAHLISTKY-----RHELRAATMLGQSKNPFQ  143

Query  125  EYVDI----CDYAVGLSRTLAGAIYPSERPGHVLLEKWNPL------GLIGVISAFNFPI  174
              +D+    CD+ +  S   A  +Y  +         WN L      G + VI+ FNF  
Sbjct  144  AEIDVIAESCDF-LRFSVKYAEELYNQQPISPASGPVWNALDYRPLEGFVSVIAPFNFS-  201

Query  175  AVYGWNSAVAMVCGDTILWKGAETTPLVSVATTKIVANVLQNNGLP-GAVAALCCGGADI  233
            A+     A   + G+ ILWK +      +V +  ++  V +  GLP G V  + C    +
Sbjct  202  AIAANLVACPALMGNVILWKPSPN----AVLSNYLLYKVFEEAGLPAGVVNFMPCEPKVM  257

Query  234  GKAMAADKRIKLLSFTGSTHVGQQVGVDVQKRFGKHLL------ELGGNNAIIVADDADL  287
             + + +   +  ++FTGST+V   +   +  R  ++        E GG +  ++   AD+
Sbjct  258  TEVVNSHPELAGVAFTGSTNVFLSINKQIYSRLEEYRNIPRISGETGGKDFHLIHPTADM  317

Query  288  NMVVQATLFACVGTAGQRCTSTRRLIFHENVYNEVLGRLTQAYKQVVNRIGDALDDSTLI  347
             M    T+       GQ+C++T R+   ++ + E+ G L + + ++  ++G   D  + +
Sbjct  318  KMTAALTVRGAFEYQGQKCSATSRIYVPQSRWEELKGYLLELHGKL--KMGQPDDFQSFM  375

Query  348  GPLHSKQSLEKYKE--TVAEIQKQGGKIEFGGKVLERPGYFVEPTIVTGLKHNNPLVHNE  405
              +  + + ++ K+   +A+       I  GG   +  G+F++PTI+     N  L+  E
Sbjct  376  CAVIDETAFDRNKKYIDIAKADSSAYTIIAGGGCDKSEGWFIQPTIIVAKDPNAQLLREE  435

Query  406  CFAPIVYV-LKAESVPEAIS-----CNNEVPQGLSSSIFTQNIGNIFEWIGPK-GSDCGI  458
             F PI+ V +  +S P+  S      NN     L+ SIF Q+   I +          G 
Sbjct  436  IFGPILTVHVYDDSKPDFWSEACNLVNNATKYALTGSIFAQDRKAIRDATEKHLRYAAGN  495

Query  459  VNVNIPTSGAEIG-GAFGGEKATGGGRESGS  488
              +N   +GA +G   FGG +A+G   + GS
Sbjct  496  YYINDKCTGAVVGQQPFGGARASGSNDKPGS  526



Lambda      K        H
   0.308    0.123    0.363 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7477882188


Query= XP_018560814.1 alpha-aminoadipic semialdehyde dehydrogenase isoform
X3 [Anoplophora glabripennis]

Length=517
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

AL7A1_DICDI  unnamed protein product                                  592     0.0  
Q9VLC5_DROME  unnamed protein product                                 185     5e-52
Q9VBP6_DROME  unnamed protein product                                 178     9e-50
MMSA_CAEEL  unnamed protein product                                   146     6e-38
Q38BS5_TRYB2  unnamed protein product                                 97.4    3e-21


>AL7A1_DICDI unnamed protein product
Length=509

 Score = 592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/507 (55%), Positives = 385/507 (76%), Gaps = 6/507 (1%)

Query  13   SKYSFLKELGLQ-ETNLGVFDGTWKGSGKVVQSICPSNGKVIAEVKQGDVSDYESCVQSS  71
            ++Y FL ELG++ E N GVF+G W G+G++++ + P+N KVIA V+     +YE+C+Q+ 
Sbjct  5    NEYPFLAELGIKAENNDGVFNGKWGGAGEIIKCLNPTNNKVIATVRGAAPEEYETCIQAM  64

Query  72   TSAWNVWADLPAPKRGEIVRQIGDALRSKLIPLGKLVSIEMGKILPEGIGEVQEYVDICD  131
             +A   WA  PAP+RGEIVR IG A+R K+ PL KL+S+EMGKI  E  GEVQE++D+CD
Sbjct  65   LAAKVKWALTPAPRRGEIVRLIGQAMREKIEPLSKLISLEMGKIYIEAKGEVQEFIDVCD  124

Query  132  YAVGLSRTLAGAIYPSERPGHVLLEKWNPLGLIGVISAFNFPIAVYGWNSAVAMVCGDTI  191
            YA GLSR++ G + PSERP H+L+E WNPLGL+G+I+AFNFP AV GWN+A++M+CG+  
Sbjct  125  YATGLSRSINGQVMPSERPNHILMETWNPLGLVGIITAFNFPCAVLGWNAAISMICGNVQ  184

Query  192  LWKGAETTPLVSVATTKIVANVLQNNGLPGAVAALCCG-GADIGKAMAADKRIKLLSFTG  250
            LWKGA TT L+++A +KI+  VL  N +  AV  +  G G  +G+ M  DKR  L+SFTG
Sbjct  185  LWKGASTTSLITLAVSKIIEKVLVENDVDPAVCCVLIGPGRTVGEQMIQDKRFGLISFTG  244

Query  251  STHVGQQVGVDVQKRFGKHLLELGGNNAIIVADDADLNMVVQATLFACVGTAGQRCTSTR  310
            ST VG+++   V   FGK +LELGGNNAI+VA+DAD+ +V++A LFA VGT GQRCT+ R
Sbjct  245  STEVGRRISSTVHGYFGKTILELGGNNAIVVAEDADIELVLRAVLFASVGTTGQRCTTCR  304

Query  311  RLIFHENVYNEVLGRLTQAYKQVVNRIGDALDDSTLIGPLHSKQSLEKYKETVAEIQKQG  370
            RL  HE++Y+ +L RLT+AYK +  +IG+ L++  L+GPLH++ +++++ E + EI+KQG
Sbjct  305  RLFVHESLYDTILERLTKAYKTI--KIGNPLEEGVLVGPLHTQSAVKEFTEGLEEIKKQG  362

Query  371  GKIEFGGKVLE-RPGYFVEPTIVTGLKHNNPLVHNECFAPIVYVLKAESVPEAISCNNEV  429
            GK+  GG  L+   G FVEPT+V  ++H+ P+V  E F PI+Y++K +++ +A + NNEV
Sbjct  363  GKVVIGGNKLDISGGNFVEPTVV-AIEHDAPIVKTELFVPILYIMKFKNLDDAFAWNNEV  421

Query  430  PQGLSSSIFTQNIGNIFEWIGPKGSDCGIVNVNIPTSGAEIGGAFGGEKATGGGRESGSD  489
            PQGLSSS+FT N  NIF+W+GP GSDCGIVNVN+ T+GAEIGGAFGGEK TGGGRESGSD
Sbjct  422  PQGLSSSLFTNNQKNIFKWLGPTGSDCGIVNVNVATNGAEIGGAFGGEKETGGGRESGSD  481

Query  490  AWKQYMRRSTITINHSKDLPLAQGIKF  516
            +WKQY RRST TIN+   +PL+QGI F
Sbjct  482  SWKQYCRRSTNTINYGNTMPLSQGINF  508


>Q9VLC5_DROME unnamed protein product
Length=520

 Score = 185 bits (469),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 134/490 (27%), Positives = 234/490 (48%), Gaps = 33/490 (7%)

Query  29   GVF-DGTWKGS--GKVVQSICPSNGKVIAEVKQGDVSDYESCVQSSTSAWNV---WADLP  82
            GVF +  W  S  GK+ ++I P+  +VIAE++  D  D +  VQ++ +A+ +   W  + 
Sbjct  41   GVFINNEWHKSKSGKIFETINPTTAEVIAEIQCADKEDIDIAVQAARNAFKLGSPWRRMD  100

Query  83   APKRGEIVRQIGDALRSKLIPLGKLVSIEMGKI--------LPEGIGEVQEYVDICDYAV  134
            A +RG ++ ++ D +    + L  L +++ GK         LP  I  ++ +    D   
Sbjct  101  ASERGRLLYRLADLMERDQVYLASLETLDNGKPYSMSYNVDLPTAIKNLRYFAGWADKNH  160

Query  135  GLSRTLAGAIYPSERPGHVLLEKWNPLGLIGVISAFNFPIAVYGWNSAVAMVCGDTILWK  194
            G +  + G  +   R          P+G+ G I  +NFPI +  W    A+  G+TI+ K
Sbjct  161  GKTIPMDGDFFTYTR--------HEPVGVCGQIIPWNFPILMMAWKLGPALATGNTIVLK  212

Query  195  GAETTPLVSVATTKIVANVLQNNGLPGAVAALCCGGADIGKAMAADKRIKLLSFTGSTHV  254
             AE T L ++     +A +++  G P  V  +  G    G A+A    +  ++FTGST V
Sbjct  213  PAEQTSLTAL----YIAQLVKEAGFPEGVVNVVPGFGTAGAALANHCDVDKVAFTGSTDV  268

Query  255  GQQVGVDV-QKRFGKHLLELGGNNAIIVADDADLNMVVQATLFACVGTAGQRCTSTRRLI  313
            G+ + +        +  LELGG +  I+  D D++  V+   F      GQ C +  R  
Sbjct  269  GKLIQLASGNTNLKRVTLELGGKSPNIILSDTDMDYAVETAHFGLFFNMGQCCCAGSRTF  328

Query  314  FHENVYNEVLGRLTQAYKQVVNRIGDALDDSTLIGPLHSKQSLEKYKETVAEIQKQGGKI  373
              + +Y+E + R  +  K+    +G+  D +T  GP  +++ +EK    +   +KQG K+
Sbjct  329  VEDKIYDEFVERSAERAKK--RTVGNPFDLNTEQGPQVNEEQMEKILGMIKTGKKQGAKL  386

Query  374  EFGGKVLE-RPGYFVEPTIVTGLKHNNPLVHNECFAPIVYVLKAESVPEAISCNNEVPQG  432
              GG   E  PGYFV+PT+   ++ +  +   E F P+  +++ + + E I   N    G
Sbjct  387  VAGGSRPEGLPGYFVQPTVFADVQDDMTIAREEIFGPVQQLIRFKKLDEVIERANNSEYG  446

Query  433  LSSSIFTQNIGNIFEWIGPKGSDCGIVNVNIPTSGAEIGGAFGGEKATGGGRESGSDAWK  492
            L++++FT+++      +G  G   G V VN     A     FGG K +G GRE+G  A  
Sbjct  447  LAAAVFTKDLDKANYIVG--GLRAGTVWVNTYNVLAA-QAPFGGYKMSGHGRENGEYALS  503

Query  493  QYMRRSTITI  502
             Y    ++ +
Sbjct  504  NYTEVKSVIV  513


>Q9VBP6_DROME unnamed protein product
Length=509

 Score = 178 bits (452),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 133/487 (27%), Positives = 225/487 (46%), Gaps = 19/487 (4%)

Query  29   GVFDGTWKGSGKVVQSI---CPSNGKVIAEVKQGDVSDYESCVQSSTSAWNV--WADLPA  83
             + DG W  S     +     P+NG VI +V    V+D +  + ++  A+    W  L A
Sbjct  31   ALVDGAWVDSSNAKATFEVRNPANGAVIGKVPNMTVADAQKAIDAAKQAYESKEWRSLTA  90

Query  84   PKRGEIVRQIGDALRSKLIPLGKLVSIEMGKILPEGIGEVQEYVDICDYAVGLSRTLAGA  143
              R  ++++    +      + ++++ E GK + E  GEV       ++    +R + G 
Sbjct  91   KDRSNLLKKWHKLIEQHSQEIAEIMTAESGKPINESKGEVAYGNAFVEWFAEEARRIYGE  150

Query  144  IYPSERPGHVLLEKWNPLGLIGVISAFNFPIAVYGWNSAVAMVCGDTILWKGAETTPLVS  203
            I PS  P   ++    P+G+  +I+ +NFP+A+    +  A+  G T++ K +E TPL +
Sbjct  151  IVPSASPNREIIVMKQPIGVAALITPWNFPMAMITRKAGAALAAGCTVVVKPSEDTPLTA  210

Query  204  VATTKIVANVLQNNGLPGAVAALCC--GGADIGKAMAADKRIKLLSFTGSTHVGQQVGVD  261
            +A  K+  +     G+P  V  +      A IG        ++ +SFTGST VG+ +  +
Sbjct  211  LAVAKLAVDA----GIPKGVINVVTTNKAAPIGDLFCKSPDVRGISFTGSTEVGKLLFRN  266

Query  262  VQKRFGKHLLELGGNNAIIVADDADLNMVVQATLFACVGTAGQRCTSTRRLIFHENVYNE  321
                  +  LELGGN   IV D AD+   V   + +     GQ C S  R    ++VY++
Sbjct  267  SADGIKRICLELGGNAPFIVFDSADIEKAVDGAMASKFRNCGQTCVSANRFFVQDSVYDK  326

Query  322  VLGRLTQAYKQVVNRIGDALDDSTLIGPLHSKQSLEKYKETVAEIQKQGGKIEFGGKVLE  381
             +G+L +  + +  +IGD       IGPL ++    K    V + + +   I  GG+ L 
Sbjct  327  FVGQLKKRVEAL--KIGDGQGCDVQIGPLINEMQFNKVSGFVEDARSKKANIILGGQPLP  384

Query  382  RPG-YFVEPTIVTGLKHNNPLVHNECFAPIVYVLKAESVPEAISCNNEVPQGLSSSIFTQ  440
              G  F  PTIVT +  +  L   E F P+V +++     EA+   N+  +GL+   +++
Sbjct  385  DKGSLFYAPTIVTDVPPSAQLYSEEVFGPVVSIIRFRDEEEAVKKANDTRRGLAGYFYSE  444

Query  441  NIGNIFEWIGPKGSDCGIVNVNIP-TSGAEIGGAFGGEKATGGGRESGSDAWKQYMRRST  499
            N+  +F     K  + G+V VN    S AE    FGG K +G GRE        Y+    
Sbjct  445  NLQQVFRV--AKRLEVGMVGVNEGIISAAE--APFGGVKESGVGREGSKHGIDDYVDIKY  500

Query  500  ITINHSK  506
            I + + K
Sbjct  501  ICMGNLK  507


>MMSA_CAEEL unnamed protein product
Length=523

 Score = 146 bits (368),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 106/428 (25%), Positives = 192/428 (45%), Gaps = 15/428 (4%)

Query  42   VQSICPSNGKVIAEVKQGDVSDYESCVQSSTSAWNVWADLPAPKRGEIVRQIGDALRSKL  101
            V+   P+  +VIA V     ++ ++ V S+ +A+N W +     R + + ++   ++  +
Sbjct  47   VELTNPATNEVIAMVPNATQAEMQAAVDSAKNAFNTWKNTSPLTRQQCMFKLQALIKRDM  106

Query  102  IPLGKLVSIEMGKILPEGIGEVQEYVDICDYAVGLSRTLAGAIYPSERPGHVLLEKWNPL  161
              L + ++IE GK LP+  G+V   + + ++A  +   + G   P+            PL
Sbjct  107  KKLAESITIEQGKTLPDAEGDVSRGLQVVEHACSVPSLMMGETLPNVSRDMDTHSYRIPL  166

Query  162  GLIGVISAFNFPIAVYGWNSAVAMVCGDTILWKGAETTPLVSVATTKIVANVLQNNGLPG  221
            G+   I  FNFP  +  W   VA+  G+T++ K +E  P       +++  + +  G+P 
Sbjct  167  GVTAGICPFNFPAMIPLWMFPVALATGNTMVIKPSEQDP----GAAQLLVELAKEAGVPD  222

Query  222  AVAALCCGGADIGKAMAADKRIKLLSFTGSTHVGQQVGVDVQKRFGKHLLELGGNNAIIV  281
                +  G       +  +  IK +SF G    G+ +     K   +    +G  N  ++
Sbjct  223  GCVNIIHGQHSAVNFICDNPDIKAISFVGGDAAGKHIYERGAKNGKRVQSNMGAKNHGVI  282

Query  282  ADDADLNMVVQATLFACVGTAGQRCTSTRRLIFHENVYNEVLGRLTQAYKQVVN-RIGDA  340
              DA+    +     A  G AGQRC +    +    +  E    L +  ++  N ++   
Sbjct  283  MADANKEQTLNQLTAAAFGAAGQRCMALTTAV----LVGEARAWLPELVEKAKNLKVNAG  338

Query  341  LDDSTLIGPLHSKQSLEKYKETVAEIQKQGGKIEFGGKVLERPGY----FVEPTIVTGLK  396
                T IGPL SKQS  +    +   +K+G ++   G  +  PG+    FV PTI+ G+K
Sbjct  339  WKPDTDIGPLISKQSKARVLRLIESAKKEGAQVPLDGSNITVPGFENGNFVGPTILAGVK  398

Query  397  HNNPLVHNECFAPIVYVLKAESVPEAISCNNEVPQGLSSSIFTQNIGNIFEWIGPKGSDC  456
             N      E F P++ V++AE++ EAI   N  P G  ++IFT N     ++      D 
Sbjct  399  PNMTCYREEIFGPVLVVMEAENLNEAIEIINNNPYGNGTAIFTSNGATARKFT--NEVDV  456

Query  457  GIVNVNIP  464
            G + +N+P
Sbjct  457  GQIGINVP  464


>Q38BS5_TRYB2 unnamed protein product
Length=561

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 102/451 (23%), Positives = 191/451 (42%), Gaps = 40/451 (9%)

Query  65   ESCVQSSTSAWNVWADLPAPKRGEIVRQIGDALRSKLIPLGKLVSIEMGKILPEGIGEVQ  124
            +  + ++  A   W+ +P   R  I       + +K         +    +L +     Q
Sbjct  89   QKAIDTALGAAKEWSQMPFKDRAAIFLHAAHLISTKY-----RHELRAATMLGQSKNPFQ  143

Query  125  EYVDI----CDYAVGLSRTLAGAIYPSERPGHVLLEKWNPL------GLIGVISAFNFPI  174
              +D+    CD+ +  S   A  +Y  +         WN L      G + VI+ FNF  
Sbjct  144  AEIDVIAESCDF-LRFSVKYAEELYNQQPISPASGPVWNALDYRPLEGFVSVIAPFNFS-  201

Query  175  AVYGWNSAVAMVCGDTILWKGAETTPLVSVATTKIVANVLQNNGLP-GAVAALCCGGADI  233
            A+     A   + G+ ILWK +      +V +  ++  V +  GLP G V  + C    +
Sbjct  202  AIAANLVACPALMGNVILWKPSPN----AVLSNYLLYKVFEEAGLPAGVVNFMPCEPKVM  257

Query  234  GKAMAADKRIKLLSFTGSTHVGQQVGVDVQKRFGKHLL------ELGGNNAIIVADDADL  287
             + + +   +  ++FTGST+V   +   +  R  ++        E GG +  ++   AD+
Sbjct  258  TEVVNSHPELAGVAFTGSTNVFLSINKQIYSRLEEYRNIPRISGETGGKDFHLIHPTADM  317

Query  288  NMVVQATLFACVGTAGQRCTSTRRLIFHENVYNEVLGRLTQAYKQVVNRIGDALDDSTLI  347
             M    T+       GQ+C++T R+   ++ + E+ G L + + ++  ++G   D  + +
Sbjct  318  KMTAALTVRGAFEYQGQKCSATSRIYVPQSRWEELKGYLLELHGKL--KMGQPDDFQSFM  375

Query  348  GPLHSKQSLEKYKE--TVAEIQKQGGKIEFGGKVLERPGYFVEPTIVTGLKHNNPLVHNE  405
              +  + + ++ K+   +A+       I  GG   +  G+F++PTI+     N  L+  E
Sbjct  376  CAVIDETAFDRNKKYIDIAKADSSAYTIIAGGGCDKSEGWFIQPTIIVAKDPNAQLLREE  435

Query  406  CFAPIVYV-LKAESVPEAIS-----CNNEVPQGLSSSIFTQNIGNIFEWIGPK-GSDCGI  458
             F PI+ V +  +S P+  S      NN     L+ SIF Q+   I +          G 
Sbjct  436  IFGPILTVHVYDDSKPDFWSEACNLVNNATKYALTGSIFAQDRKAIRDATEKHLRYAAGN  495

Query  459  VNVNIPTSGAEIG-GAFGGEKATGGGRESGS  488
              +N   +GA +G   FGG +A+G   + GS
Sbjct  496  YYINDKCTGAVVGQQPFGGARASGSNDKPGS  526



Lambda      K        H
   0.308    0.123    0.363 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7477882188


Query= XP_018560815.1 quinone oxidoreductase-like protein 2 homolog
[Anoplophora glabripennis]

Length=346
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8MR70_DROME  unnamed protein product                                 67.0    7e-12
M9PB21_DROME  unnamed protein product                                 67.0    8e-12
Q9VQL6_DROME  unnamed protein product                                 66.6    1e-11
Q38A19_TRYB2  unnamed protein product                                 64.7    2e-11
Q9VQL7_DROME  unnamed protein product                                 65.1    3e-11


>Q8MR70_DROME unnamed protein product
Length=1529

 Score = 67.0 bits (162),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 65/251 (26%), Positives = 108/251 (43%), Gaps = 19/251 (8%)

Query  105  GDRVAGLSLEKFGGLAEQCVLDVDDVWRLPADLDKQDAAVIAYGHSTAVYAFSKLATPKE  164
            G RV  +   K   LA  C+ + + +W +P+    + A+ +   ++T  YA       KE
Sbjct  637  GRRVMAMVTAK--SLATNCLANRNLLWEVPSKWTMEQASTVPCVYATVYYALVVRGQMKE  694

Query  165  NERIMISAGSAGLGLAAVDVAANIYKAKVLGLVDTEARGELVRQRGAFETLHFND-----  219
             ERI+I AGS G+G AA+ VA   +   V   V ++ + E + +R  F  L   +     
Sbjct  695  GERILIHAGSGGVGQAAISVAL-AHGLTVFTTVGSKEKREFLLKR--FPKLKAKNIGNSR  751

Query  220  --KFTKQCMKITENKGVSIVYDAVGDNMMETIGTCVSVGGKVLYAAPFFYQ------MIP  271
               F +  M  T   GV +V +++ +  ++    C+++ G+ L    F         M  
Sbjct  752  DTSFEQLIMSETHGNGVELVLNSLSEEKLQASIRCLALNGRFLEIGKFDLSNNTPLGMSV  811

Query  272  APKPHSFSTILSLKELRRQNKHLYKTVVSDTLELANEGLIGAHISAKFTLKEINKAIKFI  331
              K  SF  IL L  +    + +   V     E    G +    +  F  +EI KA +F+
Sbjct  812  FLKNTSFHGIL-LDSVMEGEEEMQLMVAKLVAEGIKSGAVQPLPTTVFAEQEIEKAFRFM  870

Query  332  EDKKCTGKVLI  342
               K  GKV+I
Sbjct  871  ASGKHIGKVVI  881


>M9PB21_DROME unnamed protein product
Length=2410

 Score = 67.0 bits (162),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 65/251 (26%), Positives = 108/251 (43%), Gaps = 19/251 (8%)

Query  105   GDRVAGLSLEKFGGLAEQCVLDVDDVWRLPADLDKQDAAVIAYGHSTAVYAFSKLATPKE  164
             G RV  +   K   LA  C+ + + +W +P+    + A+ +   ++T  YA       KE
Sbjct  1517  GRRVMAMVTAK--SLATNCLANRNLLWEVPSKWTMEQASTVPCVYATVYYALVVRGQMKE  1574

Query  165   NERIMISAGSAGLGLAAVDVAANIYKAKVLGLVDTEARGELVRQRGAFETLHFND-----  219
              ERI+I AGS G+G AA+ VA   +   V   V ++ + E + +R  F  L   +     
Sbjct  1575  GERILIHAGSGGVGQAAISVAL-AHGLTVFTTVGSKEKREFLLKR--FPKLKAKNIGNSR  1631

Query  220   --KFTKQCMKITENKGVSIVYDAVGDNMMETIGTCVSVGGKVLYAAPFFYQ------MIP  271
                F +  M  T   GV +V +++ +  ++    C+++ G+ L    F         M  
Sbjct  1632  DTSFEQLIMSETHGNGVELVLNSLSEEKLQASIRCLALNGRFLEIGKFDLSNNTPLGMSV  1691

Query  272   APKPHSFSTILSLKELRRQNKHLYKTVVSDTLELANEGLIGAHISAKFTLKEINKAIKFI  331
               K  SF  IL L  +    + +   V     E    G +    +  F  +EI KA +F+
Sbjct  1692  FLKNTSFHGIL-LDSVMEGEEEMQLMVAKLVAEGIKSGAVQPLPTTVFAEQEIEKAFRFM  1750

Query  332   EDKKCTGKVLI  342
                K  GKV+I
Sbjct  1751  ASGKHIGKVVI  1761


>Q9VQL6_DROME unnamed protein product
Length=2409

 Score = 66.6 bits (161),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 65/251 (26%), Positives = 108/251 (43%), Gaps = 19/251 (8%)

Query  105   GDRVAGLSLEKFGGLAEQCVLDVDDVWRLPADLDKQDAAVIAYGHSTAVYAFSKLATPKE  164
             G RV  +   K   LA  C+ + + +W +P+    + A+ +   ++T  YA       KE
Sbjct  1517  GRRVMAMVTAK--SLATNCLANRNLLWEVPSKWTMEQASTVPCVYATVYYALVVRGQMKE  1574

Query  165   NERIMISAGSAGLGLAAVDVAANIYKAKVLGLVDTEARGELVRQRGAFETLHFND-----  219
              ERI+I AGS G+G AA+ VA   +   V   V ++ + E + +R  F  L   +     
Sbjct  1575  GERILIHAGSGGVGQAAISVAL-AHGLTVFTTVGSKEKREFLLKR--FPKLKAKNIGNSR  1631

Query  220   --KFTKQCMKITENKGVSIVYDAVGDNMMETIGTCVSVGGKVLYAAPFFYQ------MIP  271
                F +  M  T   GV +V +++ +  ++    C+++ G+ L    F         M  
Sbjct  1632  DTSFEQLIMSETHGNGVELVLNSLSEEKLQASIRCLALNGRFLEIGKFDLSNNTPLGMSV  1691

Query  272   APKPHSFSTILSLKELRRQNKHLYKTVVSDTLELANEGLIGAHISAKFTLKEINKAIKFI  331
               K  SF  IL L  +    + +   V     E    G +    +  F  +EI KA +F+
Sbjct  1692  FLKNTSFHGIL-LDSVMEGEEEMQLMVAKLVAEGIKSGAVQPLPTTVFAEQEIEKAFRFM  1750

Query  332   EDKKCTGKVLI  342
                K  GKV+I
Sbjct  1751  ASGKHIGKVVI  1761


>Q38A19_TRYB2 unnamed protein product
Length=334

 Score = 64.7 bits (156),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 76/348 (22%), Positives = 152/348 (44%), Gaps = 47/348 (14%)

Query  22   RLESSFKAAVIKEVGKPLEIEERKTESLKPNQVRVQVVYCSVNKVDVYKFKQG----GGD  77
            RL S+F+ A  + +  P+    + TE L  N+      +  +N  D+  F  G    G  
Sbjct  9    RLSSNFREAT-EVLSSPIPSYLKSTELLVKNR------FVGINASDI-NFTSGKYLPGTV  60

Query  78   LPFIPGYELSGEVIEKGSKVSNEQIIVGDRVAGLSLEKFGGLAEQCVLDVDDVWRLPADL  137
             PF  G+E  GEV+  G  +  +Q   GD V     + FG   E  V+      ++P  L
Sbjct  61   PPFDCGFEALGEVVAVGDGI--KQFCAGDVVV---TQAFGAFCEYQVVPSRSAKKVP--L  113

Query  138  DKQDAAVIAYGHSTAVYAFSKLATPKENERIMISAGSAGLGLAAVDVAANIYKAKVLGLV  197
             K +   +    +TA  +  ++  P   E  +++A   G G  AV +   +Y   V+G+ 
Sbjct  114  LKCEYLPLDLSGTTASISIGEILKPLRGELAVVTAAGGGTGQFAVQILKKVYDCTVVGVT  173

Query  198  DTEARGELVRQRGAFETLHFNDKFTKQCMKITENKGVSIVYDAVGDNMMETI-------G  250
             + ++  ++++ G    +    +   + MK     GV++ Y++VG +M++ +       G
Sbjct  174  SSCSKENMLKELGCDHVIVGERESVGEAMKQLMPTGVNVAYESVGGDMLDVVVDNISLRG  233

Query  251  TCVSVGGKVLYA------------APFFYQMIPAPKPHSFSTILSLKELRRQNKHLYKTV  298
              +S+GG   Y+            AP   +++   K  S +T      ++    H     
Sbjct  234  RVLSIGGISGYSNGGSWDYSEKGKAPLPMRLL--SKSASLNTFFLPHYIKYAKLHF----  287

Query  299  VSDTLELANEGLIGAHI-SAKFT-LKEINKAIKFIEDKKCTGKVLIHL  344
             S   ++  +G + + I  +KF  L+ +  A++++ +++  GKV++ +
Sbjct  288  -SRLCQMYEQGTLQSCIDPSKFKGLEAVADAVEYMYERRNKGKVIVEI  334


>Q9VQL7_DROME unnamed protein product
Length=2438

 Score = 65.1 bits (157),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 63/251 (25%), Positives = 112/251 (45%), Gaps = 19/251 (8%)

Query  105   GDRVAGLSLEKFGGLAEQCVLDVDDVWRLPADLDKQDAAVIAYGHSTAVYAFSKLATPKE  164
             G RV  +   K   LA  CV     +W++P     ++A+ +   +ST  YA       K+
Sbjct  1537  GRRVMAMVPAK--SLATTCVASKRMMWQIPEKWTMEEASTVPCVYSTVYYALVVRGQMKK  1594

Query  165   NERIMISAGSAGLGLAAVDVAANIYKAKVLGLVDTEARGELVRQRGAFETLH-------F  217
              E+I+I AGS G+G AA+ VA   +   V   V ++ + E + +R  F  L         
Sbjct  1595  GEKILIHAGSGGVGQAAISVAL-AHGLTVFTTVGSKEKREFLLKR--FPKLQERNIGNSR  1651

Query  218   NDKFTKQCMKITENKGVSIVYDAVGDNMMETIGTCVSVGGKVLYAAPFFYQ------MIP  271
             +  F +  ++ T+ +GV +V +++ +  ++    C+ + G+ L    F         M  
Sbjct  1652  DTSFEQLVLRETKGRGVDLVLNSLSEEKLQASIRCLGLNGRFLEIGKFDLSNNSPLGMSV  1711

Query  272   APKPHSFSTILSLKELRRQNKHLYKTVVSDTLELANEGLIGAHISAKFTLKEINKAIKFI  331
               K  SF  IL L  +    + +   VVS   E    G +    ++ F  +++ +A +F+
Sbjct  1712  FLKNTSFHGIL-LDSVMEGEEEMQNQVVSLVAEGIKTGAVVPLPTSVFNDQQVEQAFRFM  1770

Query  332   EDKKCTGKVLI  342
                K  GKV+I
Sbjct  1771  ASGKHIGKVVI  1781



Lambda      K        H
   0.308    0.123    0.363 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7477882188


Query= XP_018560816.1 trafficking protein particle complex subunit 5
[Anoplophora glabripennis]

Length=187
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9NA81_CAEEL  unnamed protein product                                 231     4e-78
Q38DI4_TRYB2  unnamed protein product                                 74.7    1e-16
H1ZUX1_CAEEL  unnamed protein product                                 32.0    0.33 
TEN1_CAEEL  unnamed protein product                                   32.0    0.34 
Q8I7J1_CAEEL  unnamed protein product                                 32.0    0.34 


>Q9NA81_CAEEL unnamed protein product
Length=185

 Score = 231 bits (589),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 104/174 (60%), Positives = 137/174 (79%), Gaps = 0/174 (0%)

Query  11   ILDKPLSRGKGEVSLSCFALLFSEVVQYCQNKSQTVPELQNRLHELGRKVGIKLIDLYFV  70
            ILDK LSRGK E++LS FA+LFSE+V Y QN+S+TV ++ +++   G++VG+++ D+  +
Sbjct  7    ILDKSLSRGKTEINLSTFAVLFSEMVLYAQNRSETVTDIHDKIASYGKQVGLRMFDIITL  66

Query  71   REKNGKREIKLLNILLFVKSTLWKALFGREADKLEHSNDDENTYYLMEKDPLVNRFISVP  130
            REK  KRE KLL +L+F+KST+WK LFG+EADKLE SNDD  TY L+EKDP+VN +ISVP
Sbjct  67   REKGYKRETKLLGMLMFIKSTVWKNLFGKEADKLERSNDDHCTYLLIEKDPMVNTYISVP  126

Query  131  RDKSSLNCAVFIAGIVEAVLTGTGFTAKVTAHWHKGTTYMVKFDEAVVARDKQL  184
            RDK  LNCA F AGIVEA+L    F  KVTAHWH GT Y+++FDE+V+AR+  L
Sbjct  127  RDKGVLNCAAFAAGIVEAILESASFKCKVTAHWHNGTAYVIQFDESVIARENSL  180


>Q38DI4_TRYB2 unnamed protein product
Length=202

 Score = 74.7 bits (182),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 101/200 (51%), Gaps = 21/200 (11%)

Query  4    TSRNRLSILDKPLSRGKGEVSLSCFALLFSEVVQYCQN---KSQTVPELQNRLHELGRKV  60
            T  NR S+    L+  +G+VSLS F+ LFSE+     +   K++ + E++ RL  LG  V
Sbjct  7    TRSNRSSVR---LTSDEGKVSLSAFSFLFSELCTRAHSTPTKARDIEEIEQRLTSLGAIV  63

Query  61   GIKLIDLYFVRE--KNGKREIKLLNILLFVKSTLWKALFGREADKLEHSNDDENTYYLME  118
            G KL+ L  +++  +  +R   +   L  ++   W   FG+ A+ L+   +    Y+L++
Sbjct  64   GAKLMMLSSLKDPLELQRRPTTIDEALKLLQEKFWTRWFGKAANDLQQEGE-STRYFLVD  122

Query  119  KDPLVNRFISVPRD------KSSLNCAVFIAGIVEAVLTGTGFTAKVTAHWH------KG  166
             +P+V + +    +      + S+N A F+ GIVE  L   GF A V  + H      + 
Sbjct  123  SNPMVLQHVYPSPEYMDSEGQWSINYASFMGGIVEGALRAVGFDADVLTYHHPEPDKPQQ  182

Query  167  TTYMVKFDEAVVARDKQLEE  186
            + + + F + V  R++++ +
Sbjct  183  SIFAISFAQHVHDRERRIRD  202


>H1ZUX1_CAEEL unnamed protein product
Length=2763

 Score = 32.0 bits (71),  Expect = 0.33, Method: Compositional matrix adjust.
 Identities = 14/37 (38%), Positives = 19/37 (51%), Gaps = 0/37 (0%)

Query  97    FGREADKLEHSNDDENTYYLMEKDPLVNRFISVPRDK  133
               RE   LE +  DEN Y+L  KDP+  R   +  D+
Sbjct  2039  LSREGKVLESTTPDENHYWLERKDPITGRTTEILNDE  2075


>TEN1_CAEEL unnamed protein product
Length=2684

 Score = 32.0 bits (71),  Expect = 0.34, Method: Compositional matrix adjust.
 Identities = 14/37 (38%), Positives = 19/37 (51%), Gaps = 0/37 (0%)

Query  97    FGREADKLEHSNDDENTYYLMEKDPLVNRFISVPRDK  133
               RE   LE +  DEN Y+L  KDP+  R   +  D+
Sbjct  1960  LSREGKVLESTTPDENHYWLERKDPITGRTTEILNDE  1996


>Q8I7J1_CAEEL unnamed protein product
Length=860

 Score = 32.0 bits (71),  Expect = 0.34, Method: Compositional matrix adjust.
 Identities = 14/39 (36%), Positives = 20/39 (51%), Gaps = 0/39 (0%)

Query  97   FGREADKLEHSNDDENTYYLMEKDPLVNRFISVPRDKSS  135
              RE   LE +  DEN Y+L  KDP+  R   +  D+ +
Sbjct  165  LSREGKVLESTTPDENHYWLERKDPITGRTTEILNDEET  203



Lambda      K        H
   0.308    0.123    0.363 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7477882188


Query= XP_018560817.1 uncharacterized protein LOC108903202 [Anoplophora
glabripennis]

Length=153
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VH33_DROME  unnamed protein product                                 42.0    4e-05
H2L2A7_CAEEL  unnamed protein product                                 30.8    0.55 
GON1_CAEEL  unnamed protein product                                   30.4    0.55 
Q9W097_DROME  unnamed protein product                                 28.5    2.9  
Q9Y133_DROME  unnamed protein product                                 28.1    3.4  


>Q9VH33_DROME unnamed protein product
Length=168

 Score = 42.0 bits (97),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 74/157 (47%), Gaps = 17/157 (11%)

Query  1    MKVLASLVL-LALVNYAYSTDVQSCQDLLLPEVTVTIDGTECTTGPCVVGLGSNYSILIS  59
            ++++ +L L LA VN   +T+VQ C++   P   + ++  +C   PCVV  G+   + + 
Sbjct  2    LRIVVTLALILATVN---ATNVQQCKNKPFP---LDVNIKDCEEPPCVVYKGTIAVMEVH  55

Query  60   FDTPVKLERIKAKSVSTGSD--GVSVTVVFEDDTCDGIQN----TVCPVAAGGHVDYLYA  113
            F        IK+ + +T +   G+++     D+  D  +N     +CP+     V Y + 
Sbjct  56   FLG--NNNNIKSITATTTAKVLGMNLPYALPDEVSDVCRNLLYGAICPIDKDEDVTYQFN  113

Query  114  SVLAEEYSELNATMVVTLLDVDNDDTAVLCFSVDLTI  150
              +   + E+ A + VTL D  N+   + CF V   I
Sbjct  114  FYVEPSFPEITADVTVTLNDAQNE--PITCFVVSCKI  148


>H2L2A7_CAEEL unnamed protein product
Length=2165

 Score = 30.8 bits (68),  Expect = 0.55, Method: Composition-based stats.
 Identities = 29/98 (30%), Positives = 35/98 (36%), Gaps = 36/98 (37%)

Query  18    STDVQSCQDLLLPEVTVTIDGTECTT------GPCVVGLGSNYSILISFDTPVKLERIKA  71
             S D   C D  +PE + T     CT+       PC V  GS                I+ 
Sbjct  1273  SVDASFCGDTKMPETSQTCHLLPCTSWKPSHWSPCSVTCGSG---------------IQT  1317

Query  72    KSVST--GSDGVSVTVVF-------------EDDTCDG  94
             +SVS   GS+G  V   F             E DTCDG
Sbjct  1318  RSVSCTRGSEGTIVDEYFCDRNTRPRLKKTCEKDTCDG  1355


>GON1_CAEEL unnamed protein product
Length=2150

 Score = 30.4 bits (67),  Expect = 0.55, Method: Composition-based stats.
 Identities = 29/98 (30%), Positives = 35/98 (36%), Gaps = 36/98 (37%)

Query  18    STDVQSCQDLLLPEVTVTIDGTECTT------GPCVVGLGSNYSILISFDTPVKLERIKA  71
             S D   C D  +PE + T     CT+       PC V  GS                I+ 
Sbjct  1258  SVDASFCGDTKMPETSQTCHLLPCTSWKPSHWSPCSVTCGSG---------------IQT  1302

Query  72    KSVST--GSDGVSVTVVF-------------EDDTCDG  94
             +SVS   GS+G  V   F             E DTCDG
Sbjct  1303  RSVSCTRGSEGTIVDEYFCDRNTRPRLKKTCEKDTCDG  1340


>Q9W097_DROME unnamed protein product
Length=1205

 Score = 28.5 bits (62),  Expect = 2.9, Method: Composition-based stats.
 Identities = 20/73 (27%), Positives = 31/73 (42%), Gaps = 0/73 (0%)

Query  4    LASLVLLALVNYAYSTDVQSCQDLLLPEVTVTIDGTECTTGPCVVGLGSNYSILISFDTP  63
            +  + L  L N +   D +  Q LL   +  T+D       PC VG+ S+Y  + S +  
Sbjct  407  IKEIALSTLENRSNPADDRVYQLLLCNSIGTTVDSKYTDIRPCFVGINSSYVAIASQEEI  466

Query  64   VKLERIKAKSVST  76
            +       KS ST
Sbjct  467  LIWHYHTPKSAST  479


>Q9Y133_DROME unnamed protein product
Length=1221

 Score = 28.1 bits (61),  Expect = 3.4, Method: Composition-based stats.
 Identities = 27/88 (31%), Positives = 40/88 (45%), Gaps = 11/88 (13%)

Query  20   DVQSCQDLLLPEVTVTIDGTECTTGPCVVGLGSNYSILISFDT------PVKLERIKAKS  73
            ++Q+    L PE    IDG  CT G  V   GS    +++ D       PV+ E      
Sbjct  769  ELQALIRKLGPEARKWIDGVTCTGGSNV---GSELEPILNDDIVRLSAPPVRREMPSTTE  825

Query  74   VS--TGSDGVSVTVVFEDDTCDGIQNTV  99
            V+  T  D V+ T V  D++   +Q+TV
Sbjct  826  VTEMTSVDSVTSTHVEMDNSFVSVQSTV  853



Lambda      K        H
   0.308    0.123    0.363 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7477882188


Query= XP_018560818.1 uncharacterized protein LOC108903203 [Anoplophora
glabripennis]

Length=153
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VH33_DROME  unnamed protein product                                 38.9    5e-04
Q9W097_DROME  unnamed protein product                                 30.4    0.54 
GON1_CAEEL  unnamed protein product                                   28.5    2.5  
H2L2A7_CAEEL  unnamed protein product                                 28.5    2.6  
Q386N4_TRYB2  unnamed protein product                                 27.7    4.6  


>Q9VH33_DROME unnamed protein product
Length=168

 Score = 38.9 bits (89),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 71/157 (45%), Gaps = 17/157 (11%)

Query  1    MKVLASLVL-LALVNYAYSTDVQSCQDLLLPEVTVTIDGTVCTTGPCVVGLGSSFSVLIS  59
            ++++ +L L LA VN   +T+VQ C++   P   + ++   C   PCVV  G+   + + 
Sbjct  2    LRIVVTLALILATVN---ATNVQQCKNKPFP---LDVNIKDCEEPPCVVYKGTIAVMEVH  55

Query  60   FDTPVKLERIKAKSVSTGST--GGSVTVVFEDDTCDGIQN----TVCPVAAGGHVDYLYA  113
            F        IK+ + +T +   G ++     D+  D  +N     +CP+     V Y + 
Sbjct  56   FLG--NNNNIKSITATTTAKVLGMNLPYALPDEVSDVCRNLLYGAICPIDKDEDVTYQFN  113

Query  114  SVLAEEYSEVNATMVVTLLDVDNNDTAVLCFSVDLTI  150
              +   + E+ A + VTL D  N    + CF V   I
Sbjct  114  FYVEPSFPEITADVTVTLNDAQNE--PITCFVVSCKI  148


>Q9W097_DROME unnamed protein product
Length=1205

 Score = 30.4 bits (67),  Expect = 0.54, Method: Composition-based stats.
 Identities = 45/203 (22%), Positives = 68/203 (33%), Gaps = 68/203 (33%)

Query  4    LASLVLLALVNYAYSTDVQSCQDLLLPEVTVTIDGTVCTTGPCVVGLGSSFSVLISF---  60
            +  + L  L N +   D +  Q LL   +  T+D       PC VG+ SS+  + S    
Sbjct  407  IKEIALSTLENRSNPADDRVYQLLLCNSIGTTVDSKYTDIRPCFVGINSSYVAIASQEEI  466

Query  61   ----------------------------DTPVKLERIKAKSVSTGSTGGSVTVVFEDDTC  92
                                        DTP  +E  K   +S+ S  G         T 
Sbjct  467  LIWHYHTPKSASTLHNVKARKEKRFHIDDTPTGVEMAKDLMLSSSSGDGH-------STQ  519

Query  93   DGIQNTVCPVA-----------AGGHVDYLYASVLAEEYSEVNATM--------------  127
             GI + +C +A           +G   +Y  A+V       +NA +              
Sbjct  520  RGISDPICALALSEKLLLVARESGAINEYSIANVALRNRHLMNAKVYKMAINCNSTRAAI  579

Query  128  -----VVTLLDVDNNDTAVLCFS  145
                 V+TLLD+D+N    L FS
Sbjct  580  IDHMGVMTLLDLDDNRETQLNFS  602


>GON1_CAEEL unnamed protein product
Length=2150

 Score = 28.5 bits (62),  Expect = 2.5, Method: Composition-based stats.
 Identities = 26/96 (27%), Positives = 33/96 (34%), Gaps = 32/96 (33%)

Query  18    STDVQSCQDLLLPEVTVTIDGTVCTT------GPCVVGLGSSFSVLISFDTPVKLERIKA  71
             S D   C D  +PE + T     CT+       PC V  GS               + ++
Sbjct  1258  SVDASFCGDTKMPETSQTCHLLPCTSWKPSHWSPCSVTCGSGI-------------QTRS  1304

Query  72    KSVSTGSTGGSVTVVF-------------EDDTCDG  94
              S + GS G  V   F             E DTCDG
Sbjct  1305  VSCTRGSEGTIVDEYFCDRNTRPRLKKTCEKDTCDG  1340


>H2L2A7_CAEEL unnamed protein product
Length=2165

 Score = 28.5 bits (62),  Expect = 2.6, Method: Composition-based stats.
 Identities = 26/96 (27%), Positives = 33/96 (34%), Gaps = 32/96 (33%)

Query  18    STDVQSCQDLLLPEVTVTIDGTVCTT------GPCVVGLGSSFSVLISFDTPVKLERIKA  71
             S D   C D  +PE + T     CT+       PC V  GS               + ++
Sbjct  1273  SVDASFCGDTKMPETSQTCHLLPCTSWKPSHWSPCSVTCGSGI-------------QTRS  1319

Query  72    KSVSTGSTGGSVTVVF-------------EDDTCDG  94
              S + GS G  V   F             E DTCDG
Sbjct  1320  VSCTRGSEGTIVDEYFCDRNTRPRLKKTCEKDTCDG  1355


>Q386N4_TRYB2 unnamed protein product
Length=396

 Score = 27.7 bits (60),  Expect = 4.6, Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 26/56 (46%), Gaps = 6/56 (11%)

Query  16   AYSTDVQSCQDLLLPEVTVTIDGTVCTTGPCVVGLGSSFSVLISFDTPVKLERIKA  71
            A    +Q  + +L      T+ GTV ++GP  VG G    V      P KL+R+ A
Sbjct  157  AREERLQHVEGMLHEHEATTVTGTVSSSGP--VGTGKRVEV----RDPHKLKRVTA  206



Lambda      K        H
   0.308    0.123    0.363 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7477882188


Query= XP_018560819.1 transcription initiation factor TFIID subunit 3
[Anoplophora glabripennis]

Length=881
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8MSB9_DROME  unnamed protein product                                 151     1e-39
Q9XZU7_DROME  unnamed protein product                                 152     2e-37
Q9V4D4_DROME  unnamed protein product                                 152     3e-37
Q9U1I0_DROME  unnamed protein product                                 151     3e-37
Q8T9I5_DROME  unnamed protein product                                 108     3e-25


>Q8MSB9_DROME unnamed protein product
Length=370

 Score = 151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 93/225 (41%), Positives = 127/225 (56%), Gaps = 10/225 (4%)

Query  1    MSAQYARDNCKIAVAKILQTIGWHSINSTPLEVLTDILARYVHQISKTTNNYASEFGQTE  60
            M+ +YA D   + VA+I QTIG+    S PLE+L DIL ++V + ++  + +     + E
Sbjct  2    MADRYASDLALVVVAQITQTIGYSCTLSAPLELLQDILQKFVQEFARDMHRHMEHANRIE  61

Query  61   PNLDHLGLAFHEMGINLQELEEYVTYVNFAPGPAPVPKFPIPKENNLNFLKPGSKEVVTR  120
            PNL    L+   + IN+QEL +Y+  V        VP+FPI K  N+NFLKPGS E +TR
Sbjct  62   PNLKDARLSIKNLSINVQELLDYIGNVEPVGFIRDVPQFPIGKSVNMNFLKPGSAETLTR  121

Query  121  PVYIHEHLPPMYP--LLEGTDNETETVAVKQEV---AEEETTDGAQQF-KKPADVSSP--  172
            PVYI E+LPPM    L E   +  +  + KQE    AE  +T+ A +   K  D  SP  
Sbjct  122  PVYIFEYLPPMQDPELREIPADVQKEFSEKQEFCSKAEYSSTNAADKLGAKHIDSISPNT  181

Query  173  --EFKRPKREEEGSRPTREISSVMMTTSGFLSPAREGKLPEARTP  215
               F+    E +     RE+SSV+MTT GF+SPA EGKLPE   P
Sbjct  182  VINFRSNAFELDVGSSVREMSSVVMTTGGFISPAIEGKLPEDIIP  226


>Q9XZU7_DROME unnamed protein product
Length=1408

 Score = 152 bits (384),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 93/225 (41%), Positives = 127/225 (56%), Gaps = 10/225 (4%)

Query  1    MSAQYARDNCKIAVAKILQTIGWHSINSTPLEVLTDILARYVHQISKTTNNYASEFGQTE  60
            M+ +YA D   + VA+I QTIG+    S PLE+L DIL ++V + ++  + +     + E
Sbjct  2    MADRYASDLALVVVAQITQTIGYSCTLSAPLELLQDILQKFVQEFARNMHRHMEHANRIE  61

Query  61   PNLDHLGLAFHEMGINLQELEEYVTYVNFAPGPAPVPKFPIPKENNLNFLKPGSKEVVTR  120
            PNL    L+   + IN+QEL +Y+  V        VP+FPI K  N+NFLKPGS E +TR
Sbjct  62   PNLKDARLSIKNLSINVQELLDYIGNVAPVGFIRDVPQFPIGKSVNMNFLKPGSAETLTR  121

Query  121  PVYIHEHLPPMYP--LLEGTDNETETVAVKQEV---AEEETTDGAQQF-KKPADVSSP--  172
            PVYI E+LPPM    L E   +  +  + KQE    AE  +T+ A +   K  D  SP  
Sbjct  122  PVYIFEYLPPMQDPELREIPADVQKEFSEKQEFCSKAEYSSTNAADKLGAKHIDSISPNT  181

Query  173  --EFKRPKREEEGSRPTREISSVMMTTSGFLSPAREGKLPEARTP  215
               F+    E +     RE+SSV+MTT GF+SPA EGKLPE   P
Sbjct  182  VINFRSNAFELDVGSSVREMSSVVMTTGGFISPAIEGKLPEDIIP  226


 Score = 112 bits (281),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 46/59 (78%), Gaps = 0/59 (0%)

Query  803   MDEHGNEVWICPACSQQDDGRPMIGCDGCDAWYHWVCVGIQVPPDENENWYCKPCLCRK  861
             +D  GN +WICPAC + D+G  MIGCDGCDAWYHW+CVGI   P +N++W+C+ C+ +K
Sbjct  1335  VDTEGNRIWICPACGKVDEGSAMIGCDGCDAWYHWICVGITFAPKDNDDWFCRVCVTKK  1393


>Q9V4D4_DROME unnamed protein product
Length=1406

 Score = 152 bits (383),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 93/225 (41%), Positives = 127/225 (56%), Gaps = 10/225 (4%)

Query  1    MSAQYARDNCKIAVAKILQTIGWHSINSTPLEVLTDILARYVHQISKTTNNYASEFGQTE  60
            M+ +YA D   + VA+I QTIG+    S PLE+L DIL ++V + ++  + +     + E
Sbjct  2    MADRYASDLALVVVAQITQTIGYSCTLSAPLELLQDILQKFVQEFARDMHRHMEHANRIE  61

Query  61   PNLDHLGLAFHEMGINLQELEEYVTYVNFAPGPAPVPKFPIPKENNLNFLKPGSKEVVTR  120
            PNL    L+   + IN+QEL +Y+  V        VP+FPI K  N+NFLKPGS E +TR
Sbjct  62   PNLKDARLSIKNLSINVQELLDYIGNVEPVGFIRDVPQFPIGKSVNMNFLKPGSAETLTR  121

Query  121  PVYIHEHLPPMYP--LLEGTDNETETVAVKQEV---AEEETTDGAQQF-KKPADVSSP--  172
            PVYI E+LPPM    L E   +  +  + KQE    AE  +T+ A +   K  D  SP  
Sbjct  122  PVYIFEYLPPMQDPELREIPADVQKEFSEKQEFCSKAEYSSTNAADKLGAKHIDSISPNT  181

Query  173  --EFKRPKREEEGSRPTREISSVMMTTSGFLSPAREGKLPEARTP  215
               F+    E +     RE+SSV+MTT GF+SPA EGKLPE   P
Sbjct  182  VINFRSNAFELDVGSSVREMSSVVMTTGGFISPAIEGKLPEDIIP  226


 Score = 114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 46/59 (78%), Gaps = 0/59 (0%)

Query  803   MDEHGNEVWICPACSQQDDGRPMIGCDGCDAWYHWVCVGIQVPPDENENWYCKPCLCRK  861
             +D  GN +WICPAC + DDG  MIGCDGCDAWYHW+CVGI   P +N++W+C+ C+ +K
Sbjct  1333  VDAEGNRIWICPACGKVDDGSAMIGCDGCDAWYHWICVGITFAPKDNDDWFCRVCVTKK  1391


>Q9U1I0_DROME unnamed protein product
Length=1406

 Score = 151 bits (382),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 93/225 (41%), Positives = 127/225 (56%), Gaps = 10/225 (4%)

Query  1    MSAQYARDNCKIAVAKILQTIGWHSINSTPLEVLTDILARYVHQISKTTNNYASEFGQTE  60
            M+ +YA D   + VA+I QTIG+    S PLE+L DIL ++V + ++  + +     + E
Sbjct  2    MADRYASDLALVVVAQITQTIGYSCTLSAPLELLQDILQKFVQEFARDMHRHMEHANRIE  61

Query  61   PNLDHLGLAFHEMGINLQELEEYVTYVNFAPGPAPVPKFPIPKENNLNFLKPGSKEVVTR  120
            PNL    L+   + IN+QEL +Y+  V        VP+FPI K  N+NFLKPGS E +TR
Sbjct  62   PNLKDARLSIKNLSINVQELLDYIGNVAPVGFIRDVPQFPIGKSVNMNFLKPGSAETLTR  121

Query  121  PVYIHEHLPPMYP--LLEGTDNETETVAVKQEV---AEEETTDGAQQF-KKPADVSSP--  172
            PVYI E+LPPM    L E   +  +  + KQE    AE  +T+ A +   K  D  SP  
Sbjct  122  PVYIFEYLPPMQDPELREIPADVQKEFSEKQEFCSKAEYSSTNAADKLGAKHIDSISPNT  181

Query  173  --EFKRPKREEEGSRPTREISSVMMTTSGFLSPAREGKLPEARTP  215
               F+    E +     RE+SSV+MTT GF+SPA EGKLPE   P
Sbjct  182  VINFRSNAFELDVGSSVREMSSVVMTTGGFISPAIEGKLPEDIIP  226


 Score = 112 bits (281),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 46/59 (78%), Gaps = 0/59 (0%)

Query  803   MDEHGNEVWICPACSQQDDGRPMIGCDGCDAWYHWVCVGIQVPPDENENWYCKPCLCRK  861
             +D  GN +WICPAC + D+G  MIGCDGCDAWYHW+CVGI   P +N++W+C+ C+ +K
Sbjct  1333  VDAEGNRIWICPACGKVDEGSAMIGCDGCDAWYHWICVGITFAPKDNDDWFCRVCVTKK  1391


>Q8T9I5_DROME unnamed protein product
Length=363

 Score = 108 bits (271),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 46/59 (78%), Gaps = 0/59 (0%)

Query  803  MDEHGNEVWICPACSQQDDGRPMIGCDGCDAWYHWVCVGIQVPPDENENWYCKPCLCRK  861
            +D  GN +WICPAC + DDG  MIGCDGCDAWYHW+CVGI   P +N++W+C+ C+ +K
Sbjct  290  VDAEGNRIWICPACGKVDDGSAMIGCDGCDAWYHWICVGITFAPKDNDDWFCRVCVTKK  348



Lambda      K        H
   0.308    0.123    0.363 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7477882188


Query= XP_018560821.1 GILT-like protein 1 isoform X1 [Anoplophora
glabripennis]

Length=220
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GILT1_DROME  unnamed protein product                                  114     4e-31
GILT2_DROME  unnamed protein product                                  92.8    4e-23
YVRI_CAEEL  unnamed protein product                                   74.7    7e-16
Q8IBB0_PLAF7  unnamed protein product                                 30.8    0.93 
DCAF1_DROME  unnamed protein product                                  29.3    3.6  


>GILT1_DROME unnamed protein product
Length=250

 Score = 114 bits (286),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 65/222 (29%), Positives = 114/222 (51%), Gaps = 20/222 (9%)

Query  1    MSAASMFSAAVILAVFSVTHAVNVSVYYESLCPDSVEFIARQLAPHY-SEISKYVDLELV  59
            ++A  +  + +I   +S    V +S+YYESLCPDS +FI  Q+ P    E+   V+L  V
Sbjct  5    IAAVCLLMSCLIATAYSAA-KVPISIYYESLCPDSAKFITEQVYPAVKGELRDVVELTFV  63

Query  60   PYGKAAHSKTNGVWQFSCQHGPNECKGNKYQSCALSQKAGSETDVS---------FVNCV  110
            P+GK+          F+C HGPNEC GNK  +CA+     +   V          F+NC+
Sbjct  64   PFGKSQFVTQGSEVTFTCHHGPNECYGNKVHACAIEHIQANSYQVEYTRESLTMDFINCL  123

Query  111  MRSRSASHISRTEYSQFFSQCARRYNL-DVQKINSCATSAEGDQLLAANGDKT----PSI  165
            M  ++  +     Y     +CA   ++ + + I +CA S EG  LL   G+ T      +
Sbjct  124  M--KAGKNFPDNVYPG--QRCASENHINNWENIKTCANSTEGSVLLRKAGESTMRLKEPL  179

Query  166  AFVPTVVYDGVFDQQTQEQSLIDFVAVVCSKINETKPSVCDK  207
              VPT++++  FD++  +++ ++ V  +C  ++  +P +C++
Sbjct  180  TSVPTILFNEQFDKKVNDRAQVNLVGTICQYVSAPQPRICNQ  221


>GILT2_DROME unnamed protein product
Length=207

 Score = 92.8 bits (229),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/180 (31%), Positives = 90/180 (50%), Gaps = 18/180 (10%)

Query  24   VSVYYESLCPDSVEFIARQLAPHYSEISK--YVDLELVPYGKAAHSKTNGVWQFSCQHGP  81
            +++YYE+LCP  +EF+  QL P      +  + DL LVPYG A   +TN      CQHG 
Sbjct  32   ITLYYEALCPYCMEFVTTQLNPSMVRQDRLPFTDLTLVPYGNA---RTNDDGNVECQHGV  88

Query  82   NECKGNKYQSCALSQKAGSETDVSFVNCVMRSRSASHISRTEYSQFFSQCARRYNLDVQK  141
             EC+ N + +C L     +++ +  + C+MR +     +R E      +CA  Y +DV  
Sbjct  89   MECELNAWHACILEHHDIAQS-LKLIACMMRGKK----NRLE------KCADHYQIDVGD  137

Query  142  INSCATSAEGDQLLAANGDKTPSIAF--VPTVVYDGVFDQQTQEQSLIDFVAVVCSKINE  199
            + +C  + + + +L   G +T  ++F  VP V  D V++          F A+ C+K  E
Sbjct  138  VKNCKKTRQVNDILRKYGKETAKVSFQGVPAVALDNVYNADLSANLTDHFDAIFCAKYKE  197


>YVRI_CAEEL unnamed protein product
Length=277

 Score = 74.7 bits (182),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 47/164 (29%), Positives = 81/164 (49%), Gaps = 17/164 (10%)

Query  22   VNVSVYYESLCPDSVEFIARQLAPH-YSEISKYVDLELVPYGKAAHSKTNGVWQFSCQHG  80
            +N++V  E+LCPD   F+ +QL P  +   + YV++ELVP+G A   +   +    CQHG
Sbjct  76   INITVLIEALCPDCQNFLTKQLYPIVFKNFANYVNIELVPFGNAKVLEDGTI---KCQHG  132

Query  81   PNECKGNKYQSCALSQKAGSETDVSFVNCVMRSRSASHISRTEYSQFFSQCARRYNL--D  138
              EC  NK++ C +      ++ +  ++C+  S       + E++    QC  +  +  D
Sbjct  133  EEECSINKFEGCFID-SMQDQSPLPTLSCIEESLQ----KKVEFADAVQQCFEKLQIGGD  187

Query  139  VQKIN-SCATSAEGDQLLAANGDKTPSI-----AFVPTVVYDGV  176
            +Q++  SC  S  G  L       T ++      FVP V+ +GV
Sbjct  188  IQRLTQSCLVSKLGADLQNKAAAATANVWPEQHKFVPWVIINGV  231


>Q8IBB0_PLAF7 unnamed protein product
Length=2399

 Score = 30.8 bits (68),  Expect = 0.93, Method: Composition-based stats.
 Identities = 21/68 (31%), Positives = 32/68 (47%), Gaps = 11/68 (16%)

Query  22    VNVSVYYESLCPDSVEFIARQLAPHYSEISKYVDLELVPYGKAA-HSKTNGVWQFSCQHG  80
             VN ++++  L P ++  +    APH     +YVDL +  Y K   H KTN ++       
Sbjct  2161  VNKTIFFSRLPPYNLLPLCSGCAPHNYNKKEYVDLYINGYCKGIRHKKTNRIY-------  2213

Query  81    PNECKGNK  88
                C GNK
Sbjct  2214  ---CDGNK  2218


>DCAF1_DROME unnamed protein product
Length=1544

 Score = 29.3 bits (64),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 21/35 (60%), Gaps = 0/35 (0%)

Query  19   THAVNVSVYYESLCPDSVEFIARQLAPHYSEISKY  53
            T  V++++YY + C D++E I     P  SE+ +Y
Sbjct  472  TTGVSIAIYYLAYCEDAMERICSMQRPLISELVRY  506



Lambda      K        H
   0.308    0.123    0.363 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7477882188


Query= XP_018560822.1 GILT-like protein 1 isoform X2 [Anoplophora
glabripennis]

Length=214
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GILT1_DROME  unnamed protein product                                  117     3e-32
GILT2_DROME  unnamed protein product                                  97.8    3e-25
YVRI_CAEEL  unnamed protein product                                   70.5    2e-14
Q8IBB0_PLAF7  unnamed protein product                                 30.8    0.94 
Q580L4_TRYB2  unnamed protein product                                 30.4    1.3  


>GILT1_DROME unnamed protein product
Length=250

 Score = 117 bits (293),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/218 (29%), Positives = 114/218 (52%), Gaps = 18/218 (8%)

Query  1    MSAASMFSAAVILAVFSVTHAVNVSVYYESLCPDSVEFIARQLAPHY-SEISKYVDLELV  59
            ++A  +  + +I   +S    V +S+YYESLCPDS +FI  Q+ P    E+   V+L  V
Sbjct  5    IAAVCLLMSCLIATAYSAA-KVPISIYYESLCPDSAKFITEQVYPAVKGELRDVVELTFV  63

Query  60   PYGKAAHSKTNGVWQFSCQHGPNECKGNKYQSCALSQKAGSETDVS---------FVNCV  110
            P+GK+          F+C HGPNEC GNK  +CA+     +   V          F+NC+
Sbjct  64   PFGKSQFVTQGSEVTFTCHHGPNECYGNKVHACAIEHIQANSYQVEYTRESLTMDFINCL  123

Query  111  MRSRS--ASHISRTEYCARRYNL-DVQKINSCATSAEGDQLLAANGDKT----PSIAFVP  163
            M++      ++   + CA   ++ + + I +CA S EG  LL   G+ T      +  VP
Sbjct  124  MKAGKNFPDNVYPGQRCASENHINNWENIKTCANSTEGSVLLRKAGESTMRLKEPLTSVP  183

Query  164  TVVYDGVFDQQTQEQSLIDFVAVVCSKINETKPSVCDK  201
            T++++  FD++  +++ ++ V  +C  ++  +P +C++
Sbjct  184  TILFNEQFDKKVNDRAQVNLVGTICQYVSAPQPRICNQ  221


>GILT2_DROME unnamed protein product
Length=207

 Score = 97.8 bits (242),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 55/174 (32%), Positives = 89/174 (51%), Gaps = 12/174 (7%)

Query  24   VSVYYESLCPDSVEFIARQLAPHYSEISK--YVDLELVPYGKAAHSKTNGVWQFSCQHGP  81
            +++YYE+LCP  +EF+  QL P      +  + DL LVPYG A   +TN      CQHG 
Sbjct  32   ITLYYEALCPYCMEFVTTQLNPSMVRQDRLPFTDLTLVPYGNA---RTNDDGNVECQHGV  88

Query  82   NECKGNKYQSCALSQKAGSETDVSFVNCVMRSRSASHISRTEYCARRYNLDVQKINSCAT  141
             EC+ N + +C L     +++ +  + C+MR +     +R E CA  Y +DV  + +C  
Sbjct  89   MECELNAWHACILEHHDIAQS-LKLIACMMRGKK----NRLEKCADHYQIDVGDVKNCKK  143

Query  142  SAEGDQLLAANGDKTPSIAF--VPTVVYDGVFDQQTQEQSLIDFVAVVCSKINE  193
            + + + +L   G +T  ++F  VP V  D V++          F A+ C+K  E
Sbjct  144  TRQVNDILRKYGKETAKVSFQGVPAVALDNVYNADLSANLTDHFDAIFCAKYKE  197


>YVRI_CAEEL unnamed protein product
Length=277

 Score = 70.5 bits (171),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 78/160 (49%), Gaps = 15/160 (9%)

Query  22   VNVSVYYESLCPDSVEFIARQLAPH-YSEISKYVDLELVPYGKAAHSKTNGVWQFSCQHG  80
            +N++V  E+LCPD   F+ +QL P  +   + YV++ELVP+G A   +   +    CQHG
Sbjct  76   INITVLIEALCPDCQNFLTKQLYPIVFKNFANYVNIELVPFGNAKVLEDGTI---KCQHG  132

Query  81   PNECKGNKYQSCALSQKAGSETDVSFVNCVMRS--RSASHISRTEYCARRYNL--DVQKI  136
              EC  NK++ C +      ++ +  ++C+  S  +        + C  +  +  D+Q++
Sbjct  133  EEECSINKFEGCFID-SMQDQSPLPTLSCIEESLQKKVEFADAVQQCFEKLQIGGDIQRL  191

Query  137  N-SCATSAEGDQLLAANGDKTPSI-----AFVPTVVYDGV  170
              SC  S  G  L       T ++      FVP V+ +GV
Sbjct  192  TQSCLVSKLGADLQNKAAAATANVWPEQHKFVPWVIINGV  231


>Q8IBB0_PLAF7 unnamed protein product
Length=2399

 Score = 30.8 bits (68),  Expect = 0.94, Method: Composition-based stats.
 Identities = 21/68 (31%), Positives = 32/68 (47%), Gaps = 11/68 (16%)

Query  22    VNVSVYYESLCPDSVEFIARQLAPHYSEISKYVDLELVPYGKAA-HSKTNGVWQFSCQHG  80
             VN ++++  L P ++  +    APH     +YVDL +  Y K   H KTN ++       
Sbjct  2161  VNKTIFFSRLPPYNLLPLCSGCAPHNYNKKEYVDLYINGYCKGIRHKKTNRIY-------  2213

Query  81    PNECKGNK  88
                C GNK
Sbjct  2214  ---CDGNK  2218


>Q580L4_TRYB2 unnamed protein product
Length=732

 Score = 30.4 bits (67),  Expect = 1.3, Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 38/92 (41%), Gaps = 0/92 (0%)

Query  61   YGKAAHSKTNGVWQFSCQHGPNECKGNKYQSCALSQKAGSETDVSFVNCVMRSRSASHIS  120
            Y   AH+    +  F   H P+ C+GN+  + A+ +   S  +       M  R  S   
Sbjct  515  YVPCAHAAIGLIDTFVALHTPSACRGNEDLTFAVKELHSSFGNELASMSRMLQRCGSRCR  574

Query  121  RTEYCARRYNLDVQKINSCATSAEGDQLLAAN  152
             ++  A R  L + +      S +G  LLAA+
Sbjct  575  ESDEGAARMLLVIDEFGKGTLSVDGAALLAAS  606



Lambda      K        H
   0.308    0.123    0.363 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7477882188


Query= XP_018560823.2 uncharacterized protein LOC108903207 [Anoplophora
glabripennis]

Length=208
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

OR49B_DROME  unnamed protein product                                  56.6    2e-09
OR56A_DROME  unnamed protein product                                  54.7    1e-08
OR67A_DROME  unnamed protein product                                  49.3    5e-07
OR43A_DROME  unnamed protein product                                  47.0    4e-06
OR49A_DROME  unnamed protein product                                  46.6    4e-06


>OR49B_DROME unnamed protein product
Length=375

 Score = 56.6 bits (135),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/189 (27%), Positives = 94/189 (50%), Gaps = 23/189 (12%)

Query  26   AVQFRLLNLKIKALNCEDVQNEHYFDRYVRDLK----SVIQYQQNLMRYIKVLNELLHVP  81
            A+Q RL  + +K           Y DR  R+L+    + I+YQQ+++ Y+  +NEL  + 
Sbjct  201  ALQHRLRQVALK---------HPYGDRDPRELREEIIACIRYQQSIIEYMDHINELTTMM  251

Query  82   VALLMITSVFLMCLNMYALTTSKGSMVDNGRIMISC---STLIVEFFMVYGLPAQLLMDE  138
                ++    L+C  ++ L    G+     +++I C   + ++ +   +Y   A  L ++
Sbjct  252  FLFELMAFSALLCALLFMLIIVSGT----SQLIIVCMYINMILAQILALYWY-ANELREQ  306

Query  139  SEATADMVYFECKWYLPNLRPLRKHFLNMMTRSQKGVCIRAGNYHIINNRTILIMMKTAY  198
            + A A   Y E +W+  ++ PLRK+ L MM R+Q+   I  GN   I       ++ T Y
Sbjct  307  NLAVATAAY-ETEWFTFDV-PLRKNILFMMMRAQRPAAILLGNIRPITLELFQNLLNTTY  364

Query  199  SFYTFLQKV  207
            +F+T L++V
Sbjct  365  TFFTVLKRV  373


>OR56A_DROME unnamed protein product
Length=419

 Score = 54.7 bits (130),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/215 (24%), Positives = 98/215 (46%), Gaps = 15/215 (7%)

Query  2    YTLTVATSAFLSWNVFVCFLIILVAVQFRLLNLKIKALNCEDVQNEHYFDRYVRD-----  56
            Y L +  +A   W+ F+  L+  V ++ ++LN +++ ++   + ++    R         
Sbjct  206  YALGLGITAIPLWHTFITCLMKYVNLKLQILNKRVEEMDITRLNSKLVIGRLTASELTFW  265

Query  57   ----LKSVIQYQQNLMRYIKVLNELLHVPVALLMITSVFLMCLNMYALTTSKGSMVDNGR  112
                 K  ++ Q  + ++++ L  L+ VPV    I    L+C   +ALT    S +D   
Sbjct  266  QMQLFKEFVKEQLRIRKFVQELQYLICVPVMADFIIFSVLICFLFFALTVGVPSKMDYFF  325

Query  113  IMISCSTLIVEFFMVYGLPAQLLMDESEATADMVYFECKWYLPNLR-PLRKHFLNMMTRS  171
            + I    +      +Y   A L++ E      + YF C WY  N   PL+K  + MM  +
Sbjct  326  MFIYLFVM-AGILWIYHWHATLIV-ECHDELSLAYFSCGWY--NFEMPLQKMLVFMMMHA  381

Query  172  QKGVCIRAGNYHIINNRTILIMMKTAYSFYTFLQK  206
            Q+ + +RA     +N RT + + + AYS++  L+ 
Sbjct  382  QRPMKMRALLVD-LNLRTFIDIGRGAYSYFNLLRS  415


>OR67A_DROME unnamed protein product
Length=407

 Score = 49.3 bits (116),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 44/171 (26%), Positives = 82/171 (48%), Gaps = 9/171 (5%)

Query  31   LLNLKIKALNCEDVQNEHYFDRYVRDLKSVIQYQQNLMRYIKVLNELLHVPVALLMITSV  90
            L   KI+A N  +   E      +R L+S++    +++R   ++NE+  +P+ L  I S 
Sbjct  238  LREFKIQAHNAPNGAKED-----IRKLQSLVANHIDILRLTDLMNEVFGIPLLLNFIASA  292

Query  91   FLMCLNMYALTTSKGSMVDNGRIMISCSTLIVEFFMVYGLPAQLLMDESEATADMVYFEC  150
             L+CL    LT +        +++   S L+ E +++    +Q L+D SE      Y + 
Sbjct  293  LLVCLVGVQLTIALSPEYFCKQMLFLISVLL-EVYLLCSF-SQRLIDASENVGHAAY-DM  349

Query  151  KWYLPNLRPLRKHFLNMMTRSQKGVCIRAGNYHIINNRTILIMMKTAYSFY  201
             W   + R  +K  + +  RSQK VC++A     ++  T+ I +  +Y F+
Sbjct  350  DWLGSDKR-FKKILIFISMRSQKPVCLKATVVLDLSMPTMSIFLGMSYKFF  399


>OR43A_DROME unnamed protein product
Length=376

 Score = 47.0 bits (110),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 87/192 (45%), Gaps = 18/192 (9%)

Query  21   LIILVAVQFRLLNLKIKALNCEDVQNEHYFDRYVRDLKSVIQYQQNLMRYIKVLNELLH-  79
            L I      ++L  ++  +  E+   E  F R    L S I Y   +MRY+  LN+L+  
Sbjct  195  LAIFGKAMLQILVHRLGQIGGEEQSEEERFQR----LASCIAYHTQVMRYVWQLNKLVAN  250

Query  80   -VPVALLMITSV---FLMCLNMYALTTSKGSMVDNGRIMISCSTLIVEFFMVYGLPAQLL  135
             V V  ++  S+    L CLN   + TS   ++    I++   T++   F  Y    ++ 
Sbjct  251  IVAVEAIIFGSIICSLLFCLN---IITSPTQVIS---IVMYILTMLYVLFTYYNRANEIC  304

Query  136  MDESEATADMVYFECKWYLPNLRPLRKHFLNMMTRSQKGVCIRAGNYHIINNRTILIMMK  195
            + E+   A+ VY    WY    R  RK  L  + ++Q  + IR GN + +       ++ 
Sbjct  305  L-ENNRVAEAVY-NVPWYEAGTR-FRKTLLIFLMQTQHPMEIRVGNVYPMTLAMFQSLLN  361

Query  196  TAYSFYTFLQKV  207
             +YS++T L+ V
Sbjct  362  ASYSYFTMLRGV  373


>OR49A_DROME unnamed protein product
Length=396

 Score = 46.6 bits (109),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 77/151 (51%), Gaps = 6/151 (4%)

Query  57   LKSVIQYQQNLMRYIKVLNELLHVPVAL-LMITSVFLMCLNMYALTTSKGSMVDNGRIMI  115
            L S+I+  Q ++R  K +N +  + +A  L  TS  L C+  Y  T  +G   +    M+
Sbjct  247  LASIIKRHQLMIRLQKDVNYVFGLLLASNLFTTSCLLCCMAYY--TVVEGFNWEGISYMM  304

Query  116  SCSTLIVEFFMVYGLPAQLLMDESEATADMVYFECKWYLPNLRPLRKHFLNMMTRSQKGV  175
              +++  +F++V     Q+L+D S   A    FE KWY  +LR  +K  L +M ++Q+ +
Sbjct  305  LFASVAAQFYVVSS-HGQMLIDLSTNLAKAA-FESKWYEGSLR-YKKEILILMAQAQRPL  361

Query  176  CIRAGNYHIINNRTILIMMKTAYSFYTFLQK  206
             I A    II+  T  I+M   Y F+  +++
Sbjct  362  EISARGVIIISLDTFKILMTITYRFFAVIRQ  392



Lambda      K        H
   0.308    0.123    0.363 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7477882188


Query= XP_018560825.1 uncharacterized protein LOC108903210 [Anoplophora
glabripennis]

Length=434
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

BSH_DROME  unnamed protein product                                    33.1    0.50 
G5EGN9_CAEEL  unnamed protein product                                 30.0    4.5  
DDRA_CAEEL  unnamed protein product                                   29.3    7.3  
YL_DROME  unnamed protein product                                     29.6    7.4  
MDR65_DROME  unnamed protein product                                  29.3    7.5  


>BSH_DROME unnamed protein product
Length=429

 Score = 33.1 bits (74),  Expect = 0.50, Method: Compositional matrix adjust.
 Identities = 19/71 (27%), Positives = 32/71 (45%), Gaps = 0/71 (0%)

Query  63   LRTPESTSIARACGFNRPQVQRFFENLKTAREKHNLELDNIYNVDETGIQTSAKRPPKVI  122
            L TPE   +A A G +  QV+ +F+N +   +K     DN     +       K+P +  
Sbjct  299  LSTPERVELATALGLSETQVKTWFQNRRMKHKKQLRRRDNANEPVDFSRSEPGKQPGEAT  358

Query  123  STKGKKQVGSI  133
            S+ G  + G +
Sbjct  359  SSSGDSKHGKL  369


>G5EGN9_CAEEL unnamed protein product
Length=432

 Score = 30.0 bits (66),  Expect = 4.5, Method: Compositional matrix adjust.
 Identities = 30/122 (25%), Positives = 51/122 (42%), Gaps = 8/122 (7%)

Query  188  VNSDIFLQWLKFFVKSVRPTPEQKCLLVLDNHVSHRTLELIDYASENNVVILSVPPHCTH  247
            ++SDIF   L+  + S  PT  ++ L +L+  ++   L L   A    V++     H  +
Sbjct  138  MDSDIFFISLQE-IPSTAPTFHEEALRILEPVLNGHRLYLSHRAWSQMVIVFIRQKHLRY  196

Query  248  KLQP-LDVAVYGPLGKYFERSVDKWQKQHPAQHITLYELGEIFASAYLQSATPQNAINGF  306
             +QP +     G + K          K   A  + LY+   +    +L  ATPQ  I  +
Sbjct  197  AIQPQVSFIASGAMAKPVR------TKGAIAVCLRLYQRFIVLIGCHLSHATPQQRIQDY  250

Query  307  KK  308
             K
Sbjct  251  AK  252


>DDRA_CAEEL unnamed protein product
Length=766

 Score = 29.3 bits (64),  Expect = 7.3, Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query  338  QQVHNYSDVPIASCSKESDNPNTSSDKKQKTPPLFNK--SLETKHINRSS  385
            ++VHN++DV +A+     D  +    +  KT PLF++  S E + +N +S
Sbjct  264  EEVHNFTDVVLATFGNRIDGIDVIFSQDGKTFPLFSQISSSERQSLNNTS  313


>YL_DROME unnamed protein product
Length=1984

 Score = 29.6 bits (65),  Expect = 7.4, Method: Compositional matrix adjust.
 Identities = 15/40 (38%), Positives = 23/40 (58%), Gaps = 2/40 (5%)

Query  191   DIFLQWLKFFVKSVRPTPEQKCLLVLDNHVSHRTLELIDY  230
             D+ LQ  + F+ ++   P Q+ L  +D H+  RTLE I Y
Sbjct  1618  DMLLQRSESFMTALTTDPHQQLLYFVDQHM--RTLERISY  1655


>MDR65_DROME unnamed protein product
Length=1302

 Score = 29.3 bits (64),  Expect = 7.5, Method: Compositional matrix adjust.
 Identities = 24/86 (28%), Positives = 37/86 (43%), Gaps = 8/86 (9%)

Query  331  DKLQDNEQQVHNYSDVPIASCSKESDNPNTSSDKKQKTPPLFNKSLETKHIN-----RSS  385
            D L   E   +N       +   E +  ++  D KQK+  LF KS ET  +N     ++S
Sbjct  626  DDLMALEGAYYNMVRAGDINMPDEVEKEDSIEDTKQKSLALFEKSFETSPLNFEKGQKNS  685

Query  386  VDHHTPGSPIILCPNEKSKSRSVEQP  411
            V       PII    + + ++S E P
Sbjct  686  VQFE---EPIIKALIKDTNAQSAEAP  708



Lambda      K        H
   0.308    0.123    0.363 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7477882188


Query= XP_018560826.1 sodium/hydrogen exchanger 9B1 [Anoplophora
glabripennis]

Length=619
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VM74_DROME  unnamed protein product                                 503     8e-171
Q7KTL6_DROME  unnamed protein product                                 503     9e-171
Q95U27_DROME  unnamed protein product                                 495     6e-170
Q9VCS7_DROME  unnamed protein product                                 238     2e-70 
A0A0B4K6G5_DROME  unnamed protein product                             241     2e-70 


>Q9VM74_DROME unnamed protein product
Length=715

 Score = 503 bits (1296),  Expect = 8e-171, Method: Compositional matrix adjust.
 Identities = 263/588 (45%), Positives = 363/588 (62%), Gaps = 13/588 (2%)

Query  2    PNTQQKALRKVSINEDIGHDNLGFENHHFRKISSISHGTPEERIRKKNIIHESNGPNSSS  61
            P  +Q   RK+S      H ++G          +  H    +R+   +  +E+   N+  
Sbjct  98   PAYEQNPRRKISQTSTHSHTDIGPARRKSILKDTAPHDNESDRVSTHS--YENYRQNALD  155

Query  62   NLNDNRDSKIHKVSVTNSVFSRTDTIKEEDEDGDKGWFYNFCLKCHTKDDVPSWEPNFWP  121
             LN   +      +   S     + ++E        W YNFCLKC  ++   SWEP FW 
Sbjct  156  VLNAKYNGHQMGHNGGGSSNGGANYVEES-------WMYNFCLKCRGEEPSASWEPPFWQ  208

Query  122  KLCPHPYFLRYRKFSRIVSLTLICVLAYIILYAIVGDIAAPPDGMLYQLILLTICSYFGG  181
            K+ P+P    +R  SR++S+ LI VL ++  + I+GD AAP  G L+ L++LT+ + FGG
Sbjct  209  KIFPYPLCPTFRTVSRLISIILIGVLIWVTAFVIIGDSAAP-GGQLFGLVVLTVAANFGG  267

Query  182  WLMSLTTFPPLVGMLFTGMLLQNVNIVDIDEDFAEIKSEVGHLALVIILTRAGLDVDPVA  241
            +L+SLTT P L+GML  G+L QNV   DID DF+++ + +   AL IILTRAGL+++P A
Sbjct  268  YLISLTTLPRLIGMLLVGILFQNVGWADIDGDFSKVTAHLRKFALTIILTRAGLEMEPEA  327

Query  242  LKRLTIPVLKLSLIPFTVEMCSIMVLSKFFLDLSWTYALLLGSIIAAVSPAVVVPCLMRL  301
             K++   +LKL +IP+ VE   + V+S F LDL W +A LLGSIIAAVSPAVVVPCL RL
Sbjct  328  FKKVYKTILKLGIIPWCVEAVVMAVMSHFLLDLPWIWAFLLGSIIAAVSPAVVVPCLFRL  387

Query  302  REKSYGVAKGIPTLIIAVASIDDAASVAVFGVIKSILFSDASFATNIIFGLLSIAGGIAF  361
            R K YGVAKGIPTL++AVA +DDA SVA+FG+I +++FSD   A  I    + I GG+ F
Sbjct  388  RTKGYGVAKGIPTLVVAVAGVDDALSVAIFGIISTVMFSDKGLAYQIAQAPVCILGGLGF  447

Query  362  GVAWGVICNYFPERHDPFMAPLRILLLLAGGTASVLGSELIGYGGAGPLACVTAAFVAIA  421
            GV WG +   FPE+ D ++ PLR LLL  GG  ++ GSE +G+ GAGPLA V +AFV+  
Sbjct  448  GVVWGSLARIFPEKGDAYVVPLRTLLLFTGGLMAIYGSEELGFEGAGPLAVVFSAFVSNL  507

Query  422  FWSRQNWEVDENPAATAFEIFWLVIQPILFGITGSRIKFNELDMSVVGASVGIIVASVCL  481
            FW +  W+V++NP +TAFEIFW++ +PILFG+TG+ IK  ELD   V      I     L
Sbjct  508  FWCKDGWDVEDNPVSTAFEIFWMIFEPILFGLTGATIKIRELDSHTVSIGAACIFTGAIL  567

Query  482  KILSTVLAGFGCNLNLKEKVFVSIPWMCKAIVQAALGPIALEYV--EPGTEEYTYAEKIV  539
            +IL+T    FG  LN KEK FV + WM KA VQAALGP+AL+++  +   EE  +A  + 
Sbjct  568  RILTTAGIAFGDRLNTKEKFFVGLSWMAKATVQAALGPVALKHLGDDATEEERNWANIVQ  627

Query  540  TTCILSIVVTAPIGALLTTFLGPHLLTKAKMPPLAEVRKRKKSRLSIR  587
            T C+ SIV+TAP+GA++ +  G  LLTK K P       R+  R SIR
Sbjct  628  TICVFSIVLTAPLGAIMISVTGTKLLTKTKQPQDLS-GWRRSHRPSIR  674


>Q7KTL6_DROME unnamed protein product
Length=708

 Score = 503 bits (1295),  Expect = 9e-171, Method: Compositional matrix adjust.
 Identities = 263/588 (45%), Positives = 363/588 (62%), Gaps = 13/588 (2%)

Query  2    PNTQQKALRKVSINEDIGHDNLGFENHHFRKISSISHGTPEERIRKKNIIHESNGPNSSS  61
            P  +Q   RK+S      H ++G          +  H    +R+   +  +E+   N+  
Sbjct  91   PAYEQNPRRKISQTSTHSHTDIGPARRKSILKDTAPHDNESDRVSTHS--YENYRQNALD  148

Query  62   NLNDNRDSKIHKVSVTNSVFSRTDTIKEEDEDGDKGWFYNFCLKCHTKDDVPSWEPNFWP  121
             LN   +      +   S     + ++E        W YNFCLKC  ++   SWEP FW 
Sbjct  149  VLNAKYNGHQMGHNGGGSSNGGANYVEES-------WMYNFCLKCRGEEPSASWEPPFWQ  201

Query  122  KLCPHPYFLRYRKFSRIVSLTLICVLAYIILYAIVGDIAAPPDGMLYQLILLTICSYFGG  181
            K+ P+P    +R  SR++S+ LI VL ++  + I+GD AAP  G L+ L++LT+ + FGG
Sbjct  202  KIFPYPLCPTFRTVSRLISIILIGVLIWVTAFVIIGDSAAP-GGQLFGLVVLTVAANFGG  260

Query  182  WLMSLTTFPPLVGMLFTGMLLQNVNIVDIDEDFAEIKSEVGHLALVIILTRAGLDVDPVA  241
            +L+SLTT P L+GML  G+L QNV   DID DF+++ + +   AL IILTRAGL+++P A
Sbjct  261  YLISLTTLPRLIGMLLVGILFQNVGWADIDGDFSKVTAHLRKFALTIILTRAGLEMEPEA  320

Query  242  LKRLTIPVLKLSLIPFTVEMCSIMVLSKFFLDLSWTYALLLGSIIAAVSPAVVVPCLMRL  301
             K++   +LKL +IP+ VE   + V+S F LDL W +A LLGSIIAAVSPAVVVPCL RL
Sbjct  321  FKKVYKTILKLGIIPWCVEAVVMAVMSHFLLDLPWIWAFLLGSIIAAVSPAVVVPCLFRL  380

Query  302  REKSYGVAKGIPTLIIAVASIDDAASVAVFGVIKSILFSDASFATNIIFGLLSIAGGIAF  361
            R K YGVAKGIPTL++AVA +DDA SVA+FG+I +++FSD   A  I    + I GG+ F
Sbjct  381  RTKGYGVAKGIPTLVVAVAGVDDALSVAIFGIISTVMFSDKGLAYQIAQAPVCILGGLGF  440

Query  362  GVAWGVICNYFPERHDPFMAPLRILLLLAGGTASVLGSELIGYGGAGPLACVTAAFVAIA  421
            GV WG +   FPE+ D ++ PLR LLL  GG  ++ GSE +G+ GAGPLA V +AFV+  
Sbjct  441  GVVWGSLARIFPEKGDAYVVPLRTLLLFTGGLMAIYGSEELGFEGAGPLAVVFSAFVSNL  500

Query  422  FWSRQNWEVDENPAATAFEIFWLVIQPILFGITGSRIKFNELDMSVVGASVGIIVASVCL  481
            FW +  W+V++NP +TAFEIFW++ +PILFG+TG+ IK  ELD   V      I     L
Sbjct  501  FWCKDGWDVEDNPVSTAFEIFWMIFEPILFGLTGATIKIRELDSHTVSIGAACIFTGAIL  560

Query  482  KILSTVLAGFGCNLNLKEKVFVSIPWMCKAIVQAALGPIALEYV--EPGTEEYTYAEKIV  539
            +IL+T    FG  LN KEK FV + WM KA VQAALGP+AL+++  +   EE  +A  + 
Sbjct  561  RILTTAGIAFGDRLNTKEKFFVGLSWMAKATVQAALGPVALKHLGDDATEEERNWANIVQ  620

Query  540  TTCILSIVVTAPIGALLTTFLGPHLLTKAKMPPLAEVRKRKKSRLSIR  587
            T C+ SIV+TAP+GA++ +  G  LLTK K P       R+  R SIR
Sbjct  621  TICVFSIVLTAPLGAIMISVTGTKLLTKTKQPQDLS-GWRRSHRPSIR  667


>Q95U27_DROME unnamed protein product
Length=550

 Score = 495 bits (1274),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 256/527 (49%), Positives = 351/527 (67%), Gaps = 4/527 (1%)

Query  95   DKGWFYNFCLKCHTKDDVPSWEPNFWPKLCPHPYFLRYRKFSRIVSLTLICVLAYIILYA  154
            ++ W YNFCLKC  ++   SWEP FW K+ P+P    +R  SR++S+ LI VL ++  + 
Sbjct  17   EESWMYNFCLKCRGEEPSASWEPPFWQKIFPYPLCPTFRTVSRLISIILIGVLIWVTAFV  76

Query  155  IVGDIAAPPDGMLYQLILLTICSYFGGWLMSLTTFPPLVGMLFTGMLLQNVNIVDIDEDF  214
            I+GD AAP  G L+ L++LT+ + FGG+L+SLTT P L+GML  G+L QNV   DID DF
Sbjct  77   IIGDSAAP-GGQLFGLVVLTVAANFGGYLISLTTLPRLIGMLLVGILFQNVGWADIDGDF  135

Query  215  AEIKSEVGHLALVIILTRAGLDVDPVALKRLTIPVLKLSLIPFTVEMCSIMVLSKFFLDL  274
            +++ + +   AL IILTRAGL+++P A K++   +LKL +IP+ VE   + V+S F LDL
Sbjct  136  SKVTAHLRKFALTIILTRAGLEMEPEAFKKVYKTILKLGIIPWCVEAVVMAVMSHFLLDL  195

Query  275  SWTYALLLGSIIAAVSPAVVVPCLMRLREKSYGVAKGIPTLIIAVASIDDAASVAVFGVI  334
             W +A LLGSIIAAVSPAVVVPCL RLR K YGVAKGIPTL++AVA +DDA SVA+FG+I
Sbjct  196  PWIWAFLLGSIIAAVSPAVVVPCLFRLRTKGYGVAKGIPTLVVAVAGVDDALSVAIFGII  255

Query  335  KSILFSDASFATNIIFGLLSIAGGIAFGVAWGVICNYFPERHDPFMAPLRILLLLAGGTA  394
             +++FSD   A  I    + I GG+ FGV WG +   FPE+ D ++ PLR LLL  GG  
Sbjct  256  STVMFSDKGLAYQIAQAPVCILGGLGFGVVWGSLARIFPEKGDAYVVPLRTLLLFTGGLM  315

Query  395  SVLGSELIGYGGAGPLACVTAAFVAIAFWSRQNWEVDENPAATAFEIFWLVIQPILFGIT  454
            ++ GSE +G+ GAGPLA V +AFV+  FW +  W+V++NP +TAFEIFW++ +PILFG+T
Sbjct  316  AIYGSEELGFEGAGPLAVVFSAFVSNLFWCKDGWDVEDNPVSTAFEIFWMIFEPILFGLT  375

Query  455  GSRIKFNELDMSVVGASVGIIVASVCLKILSTVLAGFGCNLNLKEKVFVSIPWMCKAIVQ  514
            G+ IK  ELD   V      I     L+IL+T    FG  LN KEK FV + WM KA VQ
Sbjct  376  GATIKIRELDSHTVSIGAACIFTGAILRILTTAGIAFGDRLNTKEKFFVGLSWMAKATVQ  435

Query  515  AALGPIALEYV--EPGTEEYTYAEKIVTTCILSIVVTAPIGALLTTFLGPHLLTKAKMPP  572
            AALGP+AL+++  +   EE  +A  + T C+ SIV+TAP+GA++ +  G  LLTK K P 
Sbjct  436  AALGPVALKHLGDDATEEERNWANIVQTICVFSIVLTAPLGAIMISVTGTKLLTKTKQPQ  495

Query  573  LAEVRKRKKSRLSIRDLSIADDSEFSQAYERHVNHGLNESNKNDIHV  619
                  R+  R SIRD+SI D+ E  +  E   +   +++  N+ H+
Sbjct  496  DLS-GWRRSHRPSIRDISIIDEEEEREDPEIPEDKETHDNTLNNAHI  541


>Q9VCS7_DROME unnamed protein product
Length=584

 Score = 238 bits (608),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 144/461 (31%), Positives = 252/461 (55%), Gaps = 19/461 (4%)

Query  117  PNFWPKLCPHPYFLRYRKFSRIVSLTLICVLAYIILYAIVGDIAAPPDGMLYQLILLTIC  176
            P +W  +  H     +   S +V+L  I +  + + + ++ + + PP  ++ ++  L + 
Sbjct  102  PKWWLYIRSH-----WVNTSELVALLAIFLGLWAMGWVLLPEYSQPPT-VIMRIAFLFVG  155

Query  177  SYFGGWLMSLTTFPPLVGMLFTGMLLQNVNIVDIDEDFAEIKSEVGHLALVIILTRAGLD  236
            +   G L++    P ++GMLF G+L  N+ + +  E + + +  +  +AL+ I+  AGL 
Sbjct  156  AQISGILVTFVHLPDMLGMLFFGVLYANLGLANF-EGYQKFELFLREMALINIMLLAGLG  214

Query  237  VDPVALKRLTIPVLKLSLIPFTVEMCSIMVLSKFFLDLSWTYALLLGSIIAAVSPAVVVP  296
            +D  A KRL   +L+L+L+P  VE+ +I  L+   L + W + + LG +I AVSP VVV 
Sbjct  215  LDGDAFKRLWFMILRLTLLPTIVEVAAIAGLANLTLSMPWLWGIALGLVITAVSPNVVVT  274

Query  297  CLMRLREKSYGVAKGIPTLIIAVASIDDAASVAVFGVIKSILFSDASFATNIIFGLLSIA  356
             +++L+E   G+  GI TLI A+ + +D  ++ +FGVI S++FS  S    ++ G + I 
Sbjct  275  VMLKLKEDRLGLNSGIHTLIYAMTTCNDVVAIFMFGVIISVIFSTTSLTQQVLQGPIGIG  334

Query  357  GGIAFGVAWGVICNYFPERHDPFMAPLRILLLLAGGTASVLGSELIGYGGAGPLACVTAA  416
             G+ FG  +G +  Y P R+  +   LR +L + GGT +V+GS +IGY  AG L CVT A
Sbjct  335  IGLVFGYLYGSMLQYLPSRNATYANGLRFVLTILGGTIAVMGSRVIGYTSAGALGCVTTA  394

Query  417  FVAIAFWSRQN-----WEVDENPAATA---FEIFWLVIQPILFGITGSRIKFNELDMSVV  468
            F+A   W R+       ++     A+     ++ W  ++P+ F + G  I FN L   V+
Sbjct  395  FIARIGWRREETRLTPQQLQAQQIASVPKRLDLMWKFLKPVSFALIGKEINFNVLQGHVI  454

Query  469  GASVGIIVASVCLKILSTVLAGFGCNLNLKEKVFVSIPWMCKAIVQAALGPIALEYVEPG  528
            G    +++     ++    L+ +G NL+ KE+ +++I    KA VQAALGP+AL+     
Sbjct  455  GYGALLVLVGSLFRLAFAYLSTYGGNLSRKERAYITISGFPKATVQAALGPVALDMARAA  514

Query  529  T----EEYTYAEKIVTTCILSIVVTAPIGALLTTFLGPHLL  565
            +    E+   A  ++   +L+I+ TAP+GA+L   L P+ L
Sbjct  515  SVASPEQLALAGNLLIISVLAIIFTAPLGAILMLRLAPYWL  555


>A0A0B4K6G5_DROME unnamed protein product
Length=714

 Score = 241 bits (615),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 143/461 (31%), Positives = 249/461 (54%), Gaps = 19/461 (4%)

Query  117  PNFWPKLCPHPYFLRYRKFSRIVSLTLICVLAYIILYAIVGDIAAPPDGMLYQLILLTIC  176
            P +W  +  H     +   S +V+L  I +  + + + ++ + + PP  ++ ++  L + 
Sbjct  232  PKWWLYIRSH-----WVNTSELVALLAIFLGLWAMGWVLLPEYSQPPT-VIMRIAFLFVG  285

Query  177  SYFGGWLMSLTTFPPLVGMLFTGMLLQNVNIVDIDEDFAEIKSEVGHLALVIILTRAGLD  236
            +   G L++    P ++GMLF G+L  N+ + +  E + + +  +  +AL+ I+  AGL 
Sbjct  286  AQISGILVTFVHLPDMLGMLFFGVLYANLGLANF-EGYQKFELFLREMALINIMLLAGLG  344

Query  237  VDPVALKRLTIPVLKLSLIPFTVEMCSIMVLSKFFLDLSWTYALLLGSIIAAVSPAVVVP  296
            +D  A KRL   +L+L+L+P  VE+ +I  L+   L + W + + LG +I AVSP VVV 
Sbjct  345  LDGDAFKRLWFMILRLTLLPTIVEVAAIAGLANLTLSMPWLWGIALGLVITAVSPNVVVT  404

Query  297  CLMRLREKSYGVAKGIPTLIIAVASIDDAASVAVFGVIKSILFSDASFATNIIFGLLSIA  356
             +++L+E   G+  GI TLI A+ + +D  ++ +FGVI S++FS  S    ++ G + I 
Sbjct  405  VMLKLKEDRLGLNSGIHTLIYAMTTCNDVVAIFMFGVIISVIFSTTSLTQQVLQGPIGIG  464

Query  357  GGIAFGVAWGVICNYFPERHDPFMAPLRILLLLAGGTASVLGSELIGYGGAGPLACVTAA  416
             G+ FG  +G +  Y P R+  +   LR +L + GGT +V+GS +IGY  AG L CVT A
Sbjct  465  IGLVFGYLYGSMLQYLPSRNATYANGLRFVLTILGGTIAVMGSRVIGYTSAGALGCVTTA  524

Query  417  FVAIAFWSRQNWEVDENPAATA--------FEIFWLVIQPILFGITGSRIKFNELDMSVV  468
            F+A   W R+   +                 ++ W  ++P+ F + G  I FN L   V+
Sbjct  525  FIARIGWRREETRLTPQQLQAQQIASVPKRLDLMWKFLKPVSFALIGKEINFNVLQGHVI  584

Query  469  GASVGIIVASVCLKILSTVLAGFGCNLNLKEKVFVSIPWMCKAIVQAALGPIALEYVEPG  528
            G    +++     ++    L+ +G NL+ KE+ +++I    KA VQAALGP+AL+     
Sbjct  585  GYGALLVLVGSLFRLAFAYLSTYGGNLSRKERAYITISGFPKATVQAALGPVALDMARAA  644

Query  529  T----EEYTYAEKIVTTCILSIVVTAPIGALLTTFLGPHLL  565
            +    E+   A  ++   +L+I+ TAP+GA+L   L P+ L
Sbjct  645  SVASPEQLALAGNLLIISVLAIIFTAPLGAILMLRLAPYWL  685



Lambda      K        H
   0.308    0.123    0.363 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7477882188


Query= XP_018560827.2 odorant receptor 49b-like [Anoplophora glabripennis]

Length=188
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

OR49B_DROME  unnamed protein product                                  55.8    2e-09
OR49A_DROME  unnamed protein product                                  52.4    4e-08
OR56A_DROME  unnamed protein product                                  49.3    4e-07
OR2_ANOGA  unnamed protein product                                    47.0    2e-06
OR43A_DROME  unnamed protein product                                  43.1    5e-05


>OR49B_DROME unnamed protein product
Length=375

 Score = 55.8 bits (133),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 80/165 (48%), Gaps = 10/165 (6%)

Query  26   NDHDLRVYKVNLKSIIKYQQFLIRFVDDLNKLLTVPIALLMVSSVTMICSSLYVRTTHQG  85
             D D R  +  + + I+YQQ +I ++D +N+L T+     +++   ++C+ L++     G
Sbjct  216  GDRDPRELREEIIACIRYQQSIIEYMDHINELTTMMFLFELMAFSALLCALLFMLIIVSG  275

Query  86   SVFEEGRFFII---IFIVTAEFFLIYGLPAQLLMNESEATADTLYSECKWYSPQLRSLRK  142
            +     +  I+   I ++ A+   +Y    +L   E      T   E +W++  +  LRK
Sbjct  276  T----SQLIIVCMYINMILAQILALYWYANEL--REQNLAVATAAYETEWFTFDV-PLRK  328

Query  143  NFLIMMIRSQKSICIRAGHYHVINNRTILLMMKTAYTFHTFLQEV  187
            N L MM+R+Q+   I  G+   I       ++ T YTF T L+ V
Sbjct  329  NILFMMMRAQRPAAILLGNIRPITLELFQNLLNTTYTFFTVLKRV  373


>OR49A_DROME unnamed protein product
Length=396

 Score = 52.4 bits (124),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 77/150 (51%), Gaps = 4/150 (3%)

Query  37   LKSIIKYQQFLIRFVDDLNKLLTVPIALLMVSSVTMICSSLYVRTTHQGSVFEEGRFFII  96
            L SIIK  Q +IR   D+N +  + +A  + ++  ++C   Y  T  +G  +E   + ++
Sbjct  247  LASIIKRHQLMIRLQKDVNYVFGLLLASNLFTTSCLLCCMAYY-TVVEGFNWEGISYMML  305

Query  97   IFIVTAEFFLIYGLPAQLLMNESEATADTLYSECKWYSPQLRSLRKNFLIMMIRSQKSIC  156
               V A+F+++     Q+L++ S   A   + E KWY   LR  +K  LI+M ++Q+ + 
Sbjct  306  FASVAAQFYVV-SSHGQMLIDLSTNLAKAAF-ESKWYEGSLR-YKKEILILMAQAQRPLE  362

Query  157  IRAGHYHVINNRTILLMMKTAYTFHTFLQE  186
            I A    +I+  T  ++M   Y F   +++
Sbjct  363  ISARGVIIISLDTFKILMTITYRFFAVIRQ  392


>OR56A_DROME unnamed protein product
Length=419

 Score = 49.3 bits (116),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 88/193 (46%), Gaps = 20/193 (10%)

Query  10   RLVNLKIEDLNARKIEND---------------HDLRVYKVNL-KSIIKYQQFLIRFVDD  53
            + VNLK++ LN R  E D                +L  +++ L K  +K Q  + +FV +
Sbjct  227  KYVNLKLQILNKRVEEMDITRLNSKLVIGRLTASELTFWQMQLFKEFVKEQLRIRKFVQE  286

Query  54   LNKLLTVPIALLMVSSVTMICSSLYVRTTHQGSVFEEGRFFIIIFIVTAEFFLIYGLPAQ  113
            L  L+ VP+    +    +IC   +  T    S  +    FI +F V A    IY   A 
Sbjct  287  LQYLICVPVMADFIIFSVLICFLFFALTVGVPSKMDYFFMFIYLF-VMAGILWIYHWHAT  345

Query  114  LLMNESEATADTLYSECKWYSPQLRSLRKNFLIMMIRSQKSICIRAGHYHVINNRTILLM  173
            L++ E        Y  C WY+ ++  L+K  + MM+ +Q+ + +RA     +N RT + +
Sbjct  346  LIV-ECHDELSLAYFSCGWYNFEM-PLQKMLVFMMMHAQRPMKMRALLVD-LNLRTFIDI  402

Query  174  MKTAYTFHTFLQE  186
             + AY++   L+ 
Sbjct  403  GRGAYSYFNLLRS  415


>OR2_ANOGA unnamed protein product
Length=378

 Score = 47.0 bits (110),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/166 (23%), Positives = 79/166 (48%), Gaps = 10/166 (6%)

Query  25   ENDHDLRVYKVNLKSIIKYQQFLIRFVDDLNKLLTVPIALLMVSSVTMICSSLYVRTTHQ  84
               H        LK  +KY + +I++V DLN L+T    L  +S   M+C+ L++ +   
Sbjct  218  STGHSAGTLFAELKECLKYHKQIIQYVHDLNSLVTHLCLLEFLSFGMMLCALLFLLSISN  277

Query  85   --GSVFEEGRFFIIIFIVTAEFFLIYGLPAQLLMNESEATADTLYSECKWYSPQL-RSLR  141
                +   G +   IF++ ++ F  Y   A  ++ +S    D +Y+   W  P     +R
Sbjct  278  QLAQMIMIGSY---IFMILSQMFAFY-WHANEVLEQSLGIGDAIYNG-AW--PDFEEPIR  330

Query  142  KNFLIMMIRSQKSICIRAGHYHVINNRTILLMMKTAYTFHTFLQEV  187
            K  ++++ R+Q+ + I+ G+ + +       ++  +Y++ T L+ V
Sbjct  331  KRLILIIARAQRPMVIKVGNVYPMTLEMFQKLLNVSYSYFTLLRRV  376


>OR43A_DROME unnamed protein product
Length=376

 Score = 43.1 bits (100),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 42/155 (27%), Positives = 76/155 (49%), Gaps = 10/155 (6%)

Query  37   LKSIIKYQQFLIRFVDDLNKLLTVPIALLMVSSVTMICSSLYVRT--THQGSVFEEGRFF  94
            L S I Y   ++R+V  LNKL+   +A+  +   ++ICS L+     T    V       
Sbjct  227  LASCIAYHTQVMRYVWQLNKLVANIVAVEAIIFGSIICSLLFCLNIITSPTQVIS-----  281

Query  95   IIIFIVTAEFFLI-YGLPAQLLMNESEATADTLYSECKWYSPQLRSLRKNFLIMMIRSQK  153
            I+++I+T  + L  Y   A  +  E+   A+ +Y+   WY    R  RK  LI ++++Q 
Sbjct  282  IVMYILTMLYVLFTYYNRANEICLENNRVAEAVYN-VPWYEAGTR-FRKTLLIFLMQTQH  339

Query  154  SICIRAGHYHVINNRTILLMMKTAYTFHTFLQEVT  188
             + IR G+ + +       ++  +Y++ T L+ VT
Sbjct  340  PMEIRVGNVYPMTLAMFQSLLNASYSYFTMLRGVT  374



Lambda      K        H
   0.308    0.123    0.363 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7477882188


Query= XP_018560828.1 uncharacterized protein LOC108903213, partial
[Anoplophora glabripennis]

Length=90
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8SYZ6_DROME  unnamed protein product                                 31.2    0.068
Q9VJ72_DROME  unnamed protein product                                 31.2    0.070


>Q8SYZ6_DROME unnamed protein product
Length=416

 Score = 31.2 bits (69),  Expect = 0.068, Method: Composition-based stats.
 Identities = 17/55 (31%), Positives = 27/55 (49%), Gaps = 1/55 (2%)

Query  17   ALVGGAGGGGGSVGGS-LPRRALVHASLATTAAVGRRGRHLTGTFCLTGDTMEGI  70
            A +GG  G GG+ GG+ LP + L      + +  GR  R    +F ++ D  E +
Sbjct  141  AAMGGRMGSGGARGGAKLPHQKLTLPMRGSASGAGRSKRQDDQSFIMSADKWEDL  195


>Q9VJ72_DROME unnamed protein product
Length=416

 Score = 31.2 bits (69),  Expect = 0.070, Method: Composition-based stats.
 Identities = 17/55 (31%), Positives = 27/55 (49%), Gaps = 1/55 (2%)

Query  17   ALVGGAGGGGGSVGGS-LPRRALVHASLATTAAVGRRGRHLTGTFCLTGDTMEGI  70
            A +GG  G GG+ GG+ LP + L      + +  GR  R    +F ++ D  E +
Sbjct  141  AAMGGRMGSGGARGGAKLPHQKLTLPMRGSASGAGRSKRQDDQSFIMSADKWEDL  195



Lambda      K        H
   0.308    0.123    0.363 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7477882188


Query= XP_018560829.1 uncharacterized protein LOC108903214 [Anoplophora
glabripennis]

Length=511
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

AP1G_DICDI  unnamed protein product                                   33.1    0.66 
Q76NM3_PLAF7  unnamed protein product                                 29.6    5.3  
RYR_DROME  unnamed protein product                                    30.0    6.1  
Q8MZI0_DROME  unnamed protein product                                 29.3    8.5  
Q385E8_TRYB2  unnamed protein product                                 29.3    8.5  


>AP1G_DICDI unnamed protein product
Length=895

 Score = 33.1 bits (74),  Expect = 0.66, Method: Compositional matrix adjust.
 Identities = 23/112 (21%), Positives = 52/112 (46%), Gaps = 14/112 (13%)

Query  119  IKEIVYLTNKYT---EWEETDAAIKMFEKTGVKFRQFVPNNQEKIEINFKDIETNSIREN  175
            + ++  +T KY     W+  D  +++    G      VP+N  ++  +  ++ + ++++ 
Sbjct  399  VAKLCIVTEKYAPNKRWQ-IDTILRVMSIAGNFIPDEVPSNLIQLISSTPELSSYAVQKL  457

Query  176  YMDREDFFMAIAFLASQRSKDPITQVGACIVNEHGVVVSVGHNQMPKDSDDF  227
            Y+           L    ++ P+TQVG   + E+G ++    +Q+PKD D  
Sbjct  458  YLA----------LKQDITQQPLTQVGLWCIGEYGDLLVADKSQLPKDEDGL  499


>Q76NM3_PLAF7 unnamed protein product
Length=316

 Score = 29.6 bits (65),  Expect = 5.3, Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 59/148 (40%), Gaps = 41/148 (28%)

Query  359  VIVGIGYNGMPKGCNDDEFPWSKDCSDPLDNKSFYVCHAEVNAILNKNCADVKNCTLYVA  418
            VIV  G+   P G +D E  W++D   PL+NK       E+   + KNC    N  + V 
Sbjct  76   VIVTAGFTKAP-GKSDKE--WNRDDLLPLNNKIMI----EIGGHIKKNCP---NAFIIVV  125

Query  419  LFPCNECAKVIIQS---------GIKEVV-------YMSDK-------------HAHKNH  449
              P +   +++ Q          G+  V+       Y+S K              AH N 
Sbjct  126  TNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNK  185

Query  450  TVASKRMFDAVGIKYRQFIPKNKKIVID  477
             V  KR     GI  ++FI  N K++ D
Sbjct  186  MVLLKRYITVGGIPLQEFI--NNKLISD  211


>RYR_DROME unnamed protein product
Length=5127

 Score = 30.0 bits (66),  Expect = 6.1, Method: Compositional matrix adjust.
 Identities = 19/85 (22%), Positives = 39/85 (46%), Gaps = 11/85 (13%)

Query  269   LFPSSETAKIISQAGIKEVVYLSDKYESYEDTEIAKY-----------IFKMTGVMCRGR  317
             +F  S   + + +  + + V + D  +++ED+E +K            + ++    CRG 
Sbjct  3781  IFARSYYEQWLQEENVGQEVMVEDLTQTFEDSEKSKKEGEETDSKPDPLTQLVTTFCRGA  3840

Query  318   NAKREGYLDWQEYFMATAFLAAKRS  342
               +R G L     +M+ A +AAK +
Sbjct  3841  MTERSGALQEDLLYMSYAQIAAKST  3865


>Q8MZI0_DROME unnamed protein product
Length=688

 Score = 29.3 bits (64),  Expect = 8.5, Method: Compositional matrix adjust.
 Identities = 20/72 (28%), Positives = 30/72 (42%), Gaps = 8/72 (11%)

Query  322  EGYLDWQEYFMATAFLAAKRSKDPVTQVGACIVNEYNVIVGIGYNGMPKGCND-------  374
            E YL   +  +ATA   +K +K      G C +    V++    N   K  +        
Sbjct  615  EEYLSNDDKILATAMAVSKTAKTEQCTDGKCFIQTELVLITTDRNLRAKALSRNLAVSAL  674

Query  375  DEF-PWSKDCSD  385
            DEF  W+KDC +
Sbjct  675  DEFLQWAKDCRE  686


>Q385E8_TRYB2 unnamed protein product
Length=481

 Score = 29.3 bits (64),  Expect = 8.5, Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 29/55 (53%), Gaps = 6/55 (11%)

Query  463  KYRQFIPKNKKIVIDFMEINWD------NMSQLPDTPIKNGSSSDINGDDVKRKL  511
            K++ F+P  +  V  FM  NWD      N+ +   T I N +   + G+D++++L
Sbjct  138  KFQNFVPAIQHEVRKFMAANWDKDEGEINLLEDCSTMIINTACQCLFGEDLRKRL  192



Lambda      K        H
   0.308    0.123    0.363 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7477882188


Query= XP_018560830.1 filaggrin-like [Anoplophora glabripennis]

Length=754
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8IK84_PLAF7  unnamed protein product                                 32.0    2.5  
Q4GZD0_TRYB2  unnamed protein product                                 31.2    4.6  


>Q8IK84_PLAF7 unnamed protein product
Length=5906

 Score = 32.0 bits (71),  Expect = 2.5, Method: Composition-based stats.
 Identities = 16/53 (30%), Positives = 31/53 (58%), Gaps = 0/53 (0%)

Query  324   NKGEYGQVGEKKYSGYHHHEKGEKGHKDKDDHINEYEENIGQKNGHHEEDGYE  376
             N  + G++G KK     + ++GE GHK +D+  ++ E+N   +N  +++D  E
Sbjct  1389  NDKKEGEIGYKKEGEIGYKKEGEIGHKKEDELGDKKEDNNEDQNQDNKQDKIE  1441


>Q4GZD0_TRYB2 unnamed protein product
Length=4600

 Score = 31.2 bits (69),  Expect = 4.6, Method: Composition-based stats.
 Identities = 28/94 (30%), Positives = 46/94 (49%), Gaps = 9/94 (10%)

Query  216   VQPSVEFHKSDNQKSE-DSKDGDHEGNANNHHYNHHHNEDQSDDLGGKGEATETHEEHNA  274
             VQ      K  N+ ++ DS DG   GNA++   +   NE++S D G +G+     E  N 
Sbjct  3840  VQERKRMKKETNEGNDLDSDDG---GNADDVPEDELANEEESID-GNEGD----QETANF  3891

Query  275   ESHQSGHQSATEEGQKEEVQASASNHGGGGDGGH  308
             E+ ++  + A E+ Q E+   +A    GG +  H
Sbjct  3892  ENREAAIREAEEQQQGEDHDLAADVLEGGENDSH  3925



Lambda      K        H
   0.308    0.123    0.363 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7477882188


Query= XP_018560831.1 dopamine D2-like receptor [Anoplophora glabripennis]

Length=155
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DRD2L_DROME  unnamed protein product                                  121     2e-32
G5EBI6_CAEEL  unnamed protein product                                 80.1    5e-18
H2L2G2_CAEEL  unnamed protein product                                 79.7    6e-18
E7EM37_CAEEL  unnamed protein product                                 79.7    6e-18
G5EEM7_CAEEL  unnamed protein product                                 79.7    6e-18


>DRD2L_DROME unnamed protein product
Length=905

 Score = 121 bits (304),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 66/99 (67%), Positives = 77/99 (78%), Gaps = 4/99 (4%)

Query  47   NLSNDSTDQQVSNC-NYVINTTNITCAEVVPLETHHNYWALILILFPIFTLFGNVLVILS  105
            NL+    D    NC N  +N T+ +C E+  ++  HNYWALILILFPI TLFGN+LVILS
Sbjct  343  NLTGLYLDGYRLNCTNETLNLTD-SCGELRVVD--HNYWALILILFPILTLFGNILVILS  399

Query  106  VYRERTLQTATNYFIVSLALADLLVAVVVMPFAVYVLVS  144
            V RER+LQT TNYFIVSLA+ADLLVAVVVMPFAVY LV+
Sbjct  400  VCRERSLQTVTNYFIVSLAIADLLVAVVVMPFAVYFLVN  438


>G5EBI6_CAEEL unnamed protein product
Length=840

 Score = 80.1 bits (196),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 56/82 (68%), Gaps = 4/82 (5%)

Query  63   VINTTNITCAEVVPLETHHNYWALILILFPIFTLFGNVLVILSVYRERTLQTATNYFIVS  122
            +  T +      +PL    NY  L LI+ P+ TL GN+LVI+SV R R LQ+A N+ I+ 
Sbjct  23   ITQTPSTIVGSGIPL----NYAGLSLIVIPLITLLGNLLVIISVLRYRALQSAINFLILG  78

Query  123  LALADLLVAVVVMPFAVYVLVS  144
            LA+ADLLVA++VMP+AVYV V+
Sbjct  79   LAVADLLVAIIVMPYAVYVYVT  100


>H2L2G2_CAEEL unnamed protein product
Length=734

 Score = 79.7 bits (195),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 56/82 (68%), Gaps = 4/82 (5%)

Query  63   VINTTNITCAEVVPLETHHNYWALILILFPIFTLFGNVLVILSVYRERTLQTATNYFIVS  122
            +  T +      +PL    NY  L LI+ P+ TL GN+LVI+SV R R LQ+A N+ I+ 
Sbjct  23   ITQTPSTIVGSGIPL----NYAGLSLIVIPLITLLGNLLVIISVLRYRALQSAINFLILG  78

Query  123  LALADLLVAVVVMPFAVYVLVS  144
            LA+ADLLVA++VMP+AVYV V+
Sbjct  79   LAVADLLVAIIVMPYAVYVYVT  100


>E7EM37_CAEEL unnamed protein product
Length=849

 Score = 79.7 bits (195),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 56/82 (68%), Gaps = 4/82 (5%)

Query  63   VINTTNITCAEVVPLETHHNYWALILILFPIFTLFGNVLVILSVYRERTLQTATNYFIVS  122
            +  T +      +PL    NY  L LI+ P+ TL GN+LVI+SV R R LQ+A N+ I+ 
Sbjct  23   ITQTPSTIVGSGIPL----NYAGLSLIVIPLITLLGNLLVIISVLRYRALQSAINFLILG  78

Query  123  LALADLLVAVVVMPFAVYVLVS  144
            LA+ADLLVA++VMP+AVYV V+
Sbjct  79   LAVADLLVAIIVMPYAVYVYVT  100


>G5EEM7_CAEEL unnamed protein product
Length=705

 Score = 79.7 bits (195),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 56/82 (68%), Gaps = 4/82 (5%)

Query  63   VINTTNITCAEVVPLETHHNYWALILILFPIFTLFGNVLVILSVYRERTLQTATNYFIVS  122
            +  T +      +PL    NY  L LI+ P+ TL GN+LVI+SV R R LQ+A N+ I+ 
Sbjct  23   ITQTPSTIVGSGIPL----NYAGLSLIVIPLITLLGNLLVIISVLRYRALQSAINFLILG  78

Query  123  LALADLLVAVVVMPFAVYVLVS  144
            LA+ADLLVA++VMP+AVYV V+
Sbjct  79   LAVADLLVAIIVMPYAVYVYVT  100



Lambda      K        H
   0.308    0.123    0.363 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7477882188


Query= XP_018560834.2 dopamine receptor 1 [Anoplophora glabripennis]

Length=410
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DOPR1_DROME  unnamed protein product                                  576     0.0  
Q86ME5_CAEEL  unnamed protein product                                 265     4e-85
Q86ME4_CAEEL  unnamed protein product                                 264     1e-84
Q86ME6_CAEEL  unnamed protein product                                 231     4e-71
OCTB2_DROME  unnamed protein product                                  222     5e-67


>DOPR1_DROME unnamed protein product
Length=511

 Score = 576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/375 (73%), Positives = 313/375 (83%), Gaps = 1/375 (0%)

Query  9    EEQDPITVMSVLIVGTFLSLLIFLSVAGNILVCVAIYTDRGLRRIGNLFLASLAIADLFV  68
            EE +P++++S+++VG FLS+LIFLSVAGNILVC+AIYT+R LRRIGNLFLASLAIADLFV
Sbjct  133  EEPEPLSLVSIVVVGIFLSVLIFLSVAGNILVCLAIYTERSLRRIGNLFLASLAIADLFV  192

Query  69   ASLVMTFAGVNDILGYWIFGAQFCDTWVAFDVMCSTASILNLCAISLDRYIHIKDPLRYG  128
            ASLVMTFAGVND+LGYWIFGAQFCDTWVAFDVMCSTASILNLCAIS+DRYIHIKDPLRYG
Sbjct  193  ASLVMTFAGVNDLLGYWIFGAQFCDTWVAFDVMCSTASILNLCAISMDRYIHIKDPLRYG  252

Query  129  RWVTRRVALGTIATIWLLAALISFVPISLGLHRPPQPLVYNAGGQNYPTCALDLTPTYAV  188
            RWVTRRVA+ TIA IWLLAA +SFVPISLG+HRP QPL++   G+ YPTCALDLTPTYAV
Sbjct  253  RWVTRRVAVITIAAIWLLAAFVSFVPISLGIHRPDQPLIFEDNGKKYPTCALDLTPTYAV  312

Query  189  VSSCISFYVPCIVMIGIYCRLYCYAQKHVKNIRAITRPIDLPDSNTISKKKSTKQKNKAL  248
            VSSCISFY PC+VMIGIYCRLYCYAQKHVK+I+A+TRP ++ +       +  K + K  
Sbjct  313  VSSCISFYFPCVVMIGIYCRLYCYAQKHVKSIKAVTRPGEVAEKQRYKSIRRPKNQPKKF  372

Query  249  HIHLHNHHSSPYHVSDHKAAVTVGIIMGVFLICWVPFFCINIVAAFCKTCIPDITFKILT  308
             +   + HSSPYHVSDHKAAVTVG+IMGVFLICWVPFFC+NI AAFCKTCI   TFKILT
Sbjct  373  KVRNLHTHSSPYHVSDHKAAVTVGVIMGVFLICWVPFFCVNITAAFCKTCIGGQTFKILT  432

Query  309  WLGYSNSAFNPIIYSIFNTEFREAFKRILTAHYPACCKCGYQSV-SLNNDKFITDYGTKT  367
            WLGYSNSAFNPIIYSIFN EFR+AFKRILT   P CC     ++   N+D+FITDY  K 
Sbjct  433  WLGYSNSAFNPIIYSIFNKEFRDAFKRILTMRNPWCCAQDVGNIHPRNSDRFITDYAAKN  492

Query  368  LVVARRNGSFGEFSS  382
            +VV     S  E   
Sbjct  493  VVVMNSGRSSAELEQ  507


>Q86ME5_CAEEL unnamed protein product
Length=402

 Score = 265 bits (677),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 162/396 (41%), Positives = 229/396 (58%), Gaps = 33/396 (8%)

Query  21   IVGTFLSLLIFLSVAGNILVCVAIYTDRGLRRI-GNLFLASLAIADLFVASLVMTFAGVN  79
            ++G F S+LI L++ GN+LVC AI  DR LR+   NLFL SLA++DL V+ LVM FA VN
Sbjct  8    LLGLF-SVLIILALFGNLLVCAAILWDRSLRKQPENLFLVSLAVSDLLVSVLVMLFAAVN  66

Query  80   DILGYWIFGAQFCDTWVAFDVMCSTASILNLCAISLDRYIHIKDPLRYGRWVTRRVALGT  139
            DILGYW FG  +C  W++FD+   TASILNLCAISLDRY HI  P+ Y R+  RR     
Sbjct  67   DILGYWPFGQFYCQFWISFDITTCTASILNLCAISLDRYWHISRPMVYIRYCNRRRINYV  126

Query  140  IATIWLLAALISFVPISLGLHRPPQPLVYNAGGQNYPTCALDLTPTYAVVSSCISFYVPC  199
            I  +WL++A I   P+  G     +  + N  G   P C + L   YA+ SS +SF++P 
Sbjct  127  IVLVWLISAGIGAAPLGFGFGS--KVTINNLTG--LPVCEMRLPLPYAIGSSMVSFFLPA  182

Query  200  IVMIGIYCRLYCYAQKHVKNIR-----AITRPIDLPDSNTISKKKS-----------TKQ  243
            +VM+ +Y +LY YA+KHV++I+     A +  I    S  I + ++           T+ 
Sbjct  183  MVMVILYTKLYLYARKHVRSIKTQLQQATSFLIMQLASEKIREIRTSIFSKLNFLCPTRF  242

Query  244  KNKALHIHLHN---HHSSPYHVSDHKAAVTVGIIMGVFLICWVPFFCINIVAAFCKTCIP  300
            KN+      H    H+ S  ++SD KA +T+G+IMG FL+CW+PFF +NI+ A+      
Sbjct  243  KNQRSPQDPHTPAAHNRS--NISDQKARLTLGVIMGTFLVCWLPFFTVNILRAWLPEIFS  300

Query  301  DITFKILTWLGYSNSAFNPIIYSIFNTEFREAFKRILTAHYPACCKCGYQSVSLNNDKFI  360
              T   +TWLGY+NS+ NP+IYSIFN +FR AFK+I+   +  CC   ++   LN  K I
Sbjct  301  SKTIMAVTWLGYANSSANPLIYSIFNRDFRRAFKKIIVRVF-GCC---WEEPDLN--KSI  354

Query  361  TDYGTKTLVVARRNGSFGEFSSEHLSCDSVRQTRIN  396
            +        + RR        S H + +    TR+N
Sbjct  355  SSRYAAPDNIERRRSCTRSSESAHDNNNDANATRLN  390


>Q86ME4_CAEEL unnamed protein product
Length=399

 Score = 264 bits (674),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 160/396 (40%), Positives = 227/396 (57%), Gaps = 36/396 (9%)

Query  21   IVGTFLSLLIFLSVAGNILVCVAIYTDRGLRRI-GNLFLASLAIADLFVASLVMTFAGVN  79
            ++G F S+LI L++ GN+LVC AI  DR LR+   NLFL SLA++DL V+ LVM FA VN
Sbjct  8    LLGLF-SVLIILALFGNLLVCAAILWDRSLRKQPENLFLVSLAVSDLLVSVLVMLFAAVN  66

Query  80   DILGYWIFGAQFCDTWVAFDVMCSTASILNLCAISLDRYIHIKDPLRYGRWVTRRVALGT  139
            DILGYW FG  +C  W++FD+   TASILNLCAISLDRY HI  P+ Y R+  RR     
Sbjct  67   DILGYWPFGQFYCQFWISFDITTCTASILNLCAISLDRYWHISRPMVYIRYCNRRRINYV  126

Query  140  IATIWLLAALISFVPISLGLHRPPQPLVYNAGGQNYPTCALDLTPTYAVVSSCISFYVPC  199
            I  +WL++A I   P+  G     +  + N  G   P C + L   YA+ SS +SF++P 
Sbjct  127  IVLVWLISAGIGAAPLGFGFGS--KVTINNLTG--LPVCEMRLPLPYAIGSSMVSFFLPA  182

Query  200  IVMIGIYCRLYCYAQKHVKNIR-----AITRPIDLPDSNTISKKKS-----------TKQ  243
            +VM+ +Y +LY YA+KHV++I+     A +  I    S  I + ++           T+ 
Sbjct  183  MVMVILYTKLYLYARKHVRSIKTQLQQATSFLIMQLASEKIREIRTSIFSKLNFLCPTRF  242

Query  244  KNKALHIHLHN---HHSSPYHVSDHKAAVTVGIIMGVFLICWVPFFCINIVAAFCKTCIP  300
            KN+      H    H+ S  ++SD KA +T+G+IMG FL+CW+PFF +NI+ A+      
Sbjct  243  KNQRSPQDPHTPAAHNRS--NISDQKARLTLGVIMGTFLVCWLPFFTVNILRAWLPEIFS  300

Query  301  DITFKILTWLGYSNSAFNPIIYSIFNTEFREAFKRILTAHYPACCKCGYQSVSLNNDKFI  360
              T   +TWLGY+NS+ NP+IYSIFN +FR AFK+I+   +  CC   ++   LN   + 
Sbjct  301  SKTIMAVTWLGYANSSANPLIYSIFNRDFRRAFKKIIVRVF-GCC---WEEPDLNKSIYA  356

Query  361  TDYGTKTLVVARRNGSFGEFSSEHLSCDSVRQTRIN  396
                     + RR        S H + +    TR+N
Sbjct  357  APDN-----IERRRSCTRSSESAHDNNNDANATRLN  387


>Q86ME6_CAEEL unnamed protein product
Length=460

 Score = 231 bits (588),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 159/452 (35%), Positives = 224/452 (50%), Gaps = 87/452 (19%)

Query  21   IVGTFLSLLIFLSVAGNILVCVAIYTDRGLRRI-GNLFLASLAIADLFVASLVMTFAGVN  79
            ++G F S+LI L++ GN+LVC AI  DR LR+   NLFL SLA++DL V+ LVM FA VN
Sbjct  8    LLGLF-SVLIILALFGNLLVCAAILWDRSLRKQPENLFLVSLAVSDLLVSVLVMLFAAVN  66

Query  80   DILGYWIFGAQFCDTWVAFDVMCSTASILNLCAISLDRYIHIKDPLRYGRWVTRRVALGT  139
            DILGYW FG  +C  W++FD+   TASILNLCAISLDRY HI  P+ Y R+  RR     
Sbjct  67   DILGYWPFGQFYCQFWISFDITTCTASILNLCAISLDRYWHISRPMVYIRYCNRRRINYV  126

Query  140  IATIWLLAALISFVPISLGLHRPPQPLVYNAGGQNYPTCALDLTPTYAVVSSCISFYVPC  199
            I  +WL++A I   P+  G     +  + N  G   P C + L   YA+ SS +SF++P 
Sbjct  127  IVLVWLISAGIGAAPLGFGFGS--KVTINNLTG--LPVCEMRLPLPYAIGSSMVSFFLPA  182

Query  200  IVMIGIYCRLYCYAQKHVKN--------------------IRAITR---------PIDLP  230
            +VM+ +Y +LY YA+KHV++                    IR +T          P D P
Sbjct  183  MVMVILYTKLYLYARKHVRSIKTQLQQATSFLIMQLASEKIREVTAATLKGEALLPPDSP  242

Query  231  DSN----TISK------------------KKSTKQKNKALHI--------------HLHN  254
             +     T+S+                   K T  +NK   I                 N
Sbjct  243  ATERTTMTVSRHYSRRSTTTTTTATPRRGDKKTSSQNKVESIRTSIFSKLNFLCPTRFKN  302

Query  255  HHS--SPYHVSDHKAA----VTVGIIMGVFL----ICWVPFFCINIVAAFCKTCIPDITF  304
              S   P+  + H  +        + +GV +    +CW+PFF +NI+ A+        T 
Sbjct  303  QRSPQDPHTPAAHNRSNISDQKARLTLGVIMGTFLVCWLPFFTVNILRAWLPEIFSSKTI  362

Query  305  KILTWLGYSNSAFNPIIYSIFNTEFREAFKRILTAHYPACCKCGYQSVSLNNDKFITDYG  364
              +TWLGY+NS+ NP+IYSIFN +FR AFK+I+   +  CC   ++   LN  K I+   
Sbjct  363  MAVTWLGYANSSANPLIYSIFNRDFRRAFKKIIVRVF-GCC---WEEPDLN--KSISSRY  416

Query  365  TKTLVVARRNGSFGEFSSEHLSCDSVRQTRIN  396
                 + RR        S H + +    TR+N
Sbjct  417  AAPDNIERRRSCTRSSESAHDNNNDANATRLN  448


>OCTB2_DROME unnamed protein product
Length=536

 Score = 222 bits (565),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 132/335 (39%), Positives = 188/335 (56%), Gaps = 22/335 (7%)

Query  19   VLIVGTFLSLLIFLS-VAGNILVCVAIYTDRGLRRIGNLFLASLAIADLFVASLVMTFAG  77
            V +   F+ LLI ++ + GN+LV +++   R LR I N F+ SLA+AD+ VA + MTF  
Sbjct  152  VWVFKAFVMLLIIIAAICGNLLVIISVMRVRKLRVITNYFVVSLAMADIMVAIMAMTFNF  211

Query  78   VNDILGYWIFGAQFCDTWVAFDVMCSTASILNLCAISLDRYIHIKDPLRYGRWVTRRVAL  137
               + G W F    CD W + DV  STASIL+LC IS+DRY  I  PL+Y   +T+RV  
Sbjct  212  SVQVTGRWNFSPFLCDLWNSLDVYFSTASILHLCCISVDRYYAIVKPLKYPISMTKRVVG  271

Query  138  GTIATIWLLAALISFVPISLGLHRPPQPLVYNAGGQNYPTCALDLTPTYAVVSSCISFYV  197
              +   W+  AL+SF+PI +G +  PQ   +    QN   C+  +   YAV+SS ISF++
Sbjct  272  IMLLNTWISPALLSFLPIFIGWYTTPQHQQFVI--QNPTQCSFVVNKYYAVISSSISFWI  329

Query  198  PCIVMIGIYCRLYCYAQKHVK-------NIRAITRPIDLPDSNTISKKKSTKQKNKALHI  250
            PC +MI  Y  ++  A +  K       N   + RP   P    +S   S+    K L +
Sbjct  330  PCTIMIFTYLAIFREANRQEKQLMMRHGNAMLMHRPSMQPSGEALSGSGSS----KTLTL  385

Query  251  HLHNHHSSP---YHV----SDHKAAVTVGIIMGVFLICWVPFFCINIVAAFCKTC-IPDI  302
            H      +P    H+     +HKAA T+GIIMG F++CW+PFF    ++  C+ C +PDI
Sbjct  386  HEVEQEHTPTKDKHLIKMKREHKAARTLGIIMGTFILCWLPFFLWYTLSMTCEECQVPDI  445

Query  303  TFKILTWLGYSNSAFNPIIYSIFNTEFREAFKRIL  337
               IL W+GY NS  NP+IY+ FN +FREAF+  L
Sbjct  446  VVSILFWIGYFNSTLNPLIYAYFNRDFREAFRNTL  480



Lambda      K        H
   0.308    0.123    0.363 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7477882188


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Nov 3, 2023  11:39 AM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_018560835.2 odorant receptor 49b-like [Anoplophora glabripennis]

Length=401
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

OR43A_DROME  unnamed protein product                                  89.7    1e-19
OR1_ANOGA  unnamed protein product                                    89.7    2e-19
OR49B_DROME  unnamed protein product                                  84.3    8e-18
OR83A_DROME  unnamed protein product                                  73.9    4e-14
OR46B_DROME  unnamed protein product                                  72.4    9e-14


>OR43A_DROME unnamed protein product
Length=376

 Score = 89.7 bits (221),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/162 (28%), Positives = 90/162 (56%), Gaps = 6/162 (4%)

Query  239  RKDEERFSEAMTKNLVVCIEHHRQIMRVTKNIEQICGTSIFILFIGGTLILCSSLFQLSV  298
            + +EERF     + L  CI +H Q+MR    + ++    + +  I    I+CS LF L++
Sbjct  218  QSEEERF-----QRLASCIAYHTQVMRYVWQLNKLVANIVAVEAIIFGSIICSLLFCLNI  272

Query  299  VKVGSVESVMLLLYLICMIVDQLCYSWFGNEVICKSSLILQSAYKTPWVDCNIKFRKILL  358
            +     + + +++Y++ M+     Y    NE+  +++ + ++ Y  PW +   +FRK LL
Sbjct  273  I-TSPTQVISIVMYILTMLYVLFTYYNRANEICLENNRVAEAVYNVPWYEAGTRFRKTLL  331

Query  359  QFMTQTCQPISILTGGLFTMSVQVFVSIMRTAYSYFTLLKNI  400
             F+ QT  P+ I  G ++ M++ +F S++  +YSYFT+L+ +
Sbjct  332  IFLMQTQHPMEIRVGNVYPMTLAMFQSLLNASYSYFTMLRGV  373


>OR1_ANOGA unnamed protein product
Length=417

 Score = 89.7 bits (221),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 88/413 (21%), Positives = 181/413 (44%), Gaps = 26/413 (6%)

Query  5    YDFYGYFTSNIMIYKIVGFWRP-DEDMKFKKLYNCYT-AFCTLAWMAFLLSEIIYITNNR  62
            YD    F   ++  K +G W P D D   +  Y  Y  A   +    + L++ +Y   + 
Sbjct  13   YDRRDSFWLQLLCLKYLGLWPPEDTDQATRNRYIAYGWALRIMFLHLYALTQALYF-KDV  71

Query  63   KNVQEITAALYVTGTFTIDFIQMIFTYK------NMNHLKILMKEMNRTLFQVKCREHYR  116
            K++ +I  AL+V  T      Q+   YK      N+  ++  ++++N TL+  K RE + 
Sbjct  72   KDINDIANALFVLMT------QVTLIYKLEKFNYNIARIQACLRKLNCTLYHPKQREEFS  125

Query  117  IAENTKRTYNVLFKSCLYLALLTAVFVMIVPLVGKERATSIKGWFPYDWTKP-LYFALTY  175
                +      L    +++A+ T +  ++ P    ER   +  WFP D+    + + + +
Sbjct  126  PVLQSMSGVFWLMIFLMFVAIFTIIMWVMSPAFDNERRLPVPAWFPVDYHHSDIVYGVLF  185

Query  176  IFQNLVFIWNALICSNFATFT--SALLMQVGLQCDLLCCTLDSLDDFYTEDDVLYEISLE  233
            ++Q +  + +A    NF+T T  S L++ +  Q   L   +  L      +  L     E
Sbjct  186  LYQTIGIVMSA--TYNFSTDTMFSGLMLHINGQIVRLGSMVKKLGHDVPPERQLVATDAE  243

Query  234  NKKKLRKDEERFSE---AMTKNLVVCIEHHRQIMRVTKNIEQICGTSIFILFIGGTLILC  290
              K++RK  +  S+    M   +  C+  H+ I+     ++ I   SIF       +I+C
Sbjct  244  -WKEMRKRIDHHSKVYGTMYAKVTECVLFHKDILSFGDEVQDIFQGSIFAQVCASVIIIC  302

Query  291  SSLFQLSVVKVGSVESVMLLLYLICMIVDQLCYSWFGNEVICKSSLILQSAYKTPWVDCN  350
             +L Q +   V   + +    YL+ M      + + GNE+   +    +    + +   +
Sbjct  303  MTLLQATGDDVTMADLLGCGFYLLVMTSQVFIFCYVGNEISYTTDKFTEFVGFSNYFKFD  362

Query  351  IKFRKILLQFMTQTCQPISILTGGLF--TMSVQVFVSIMRTAYSYFTLLKNIQ  401
             +  + ++ F+  T + + I  G +   T+++  F+ IM+ +YSY  +L++++
Sbjct  363  KRTSQAMIFFLQMTLKDVHIKVGSVLKVTLNLHTFLQIMKLSYSYLAVLQSME  415


>OR49B_DROME unnamed protein product
Length=375

 Score = 84.3 bits (207),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 62/290 (21%), Positives = 138/290 (48%), Gaps = 28/290 (10%)

Query  116  RIAENTKRTYNVLFKSCLYLALLTAVFVMIVPLVGKERATSIKGWFP--YDWTKPLYFAL  173
             I +   +   ++ +  L+  +LT++   + PL   ER        P   ++  P Y+ +
Sbjct  107  EILDQVNKVGKLMARGNLFFGMLTSMGFGLYPLSSSERVLPFGSKIPGLNEYESP-YYEM  165

Query  174  TYIFQNLVFIWNALICSNFATFTS---ALLMQVGLQCDLLCCTLDSLDDFYTEDDVLYEI  230
             YIFQ L+     + C  +  +TS    L+M   ++C  L                L ++
Sbjct  166  WYIFQMLI---TPMGCCMYIPYTSLIVGLIMFGIVRCKAL-------------QHRLRQV  209

Query  231  SLENKKKLRKDEERFSEAMTKNLVVCIEHHRQIMRVTKNIEQICGTSIFILFIGGTLILC  290
            +L++    R   E     + + ++ CI + + I+    +I ++         +  + +LC
Sbjct  210  ALKHPYGDRDPRE-----LREEIIACIRYQQSIIEYMDHINELTTMMFLFELMAFSALLC  264

Query  291  SSLFQLSVVKVGSVESVMLLLYLICMIVDQLCYSWFGNEVICKSSLILQSAYKTPWVDCN  350
            + LF L +V  G+ + +++ +Y+  ++   L   W+ NE+  ++  +  +AY+T W   +
Sbjct  265  ALLFMLIIVS-GTSQLIIVCMYINMILAQILALYWYANELREQNLAVATAAYETEWFTFD  323

Query  351  IKFRKILLQFMTQTCQPISILTGGLFTMSVQVFVSIMRTAYSYFTLLKNI  400
            +  RK +L  M +  +P +IL G +  +++++F +++ T Y++FT+LK +
Sbjct  324  VPLRKNILFMMMRAQRPAAILLGNIRPITLELFQNLLNTTYTFFTVLKRV  373


>OR83A_DROME unnamed protein product
Length=453

 Score = 73.9 bits (180),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 65/311 (21%), Positives = 132/311 (42%), Gaps = 32/311 (10%)

Query  120  NTKRTYNVLFKSCLYLALLTAVFVMIVPLVGKERATSIKGWFPYDWTKPLYFALTYIFQN  179
             + R   +  K+ +Y   +  +F + +P+  ++R+  +  W+P+D+T+P  + + ++ Q 
Sbjct  141  GSYRMSKLWIKTYVYCCYIGTIFWLALPIAYRDRSLPLACWYPFDYTQPGVYEVVFLLQA  200

Query  180  LVFIWNALICSNFATFTSALLMQVGLQCDLLCCTLDS---------------LDDFYTED  224
            +  I  A   ++ +     L + +  Q D+L C+L +               L+    E 
Sbjct  201  MGQIQVAASFASSSGLHMVLCVLISGQYDVLFCSLKNVLASSYVLMGANMTELNQLQAEQ  260

Query  225  DVL------YEISLENKKKLRK-----DEERFSEAMTKNLVVCIEHHRQIMRVTKNIEQI  273
                     Y  S+E +  L++         FS A   + V CI+HHR I+   K IE  
Sbjct  261  SAADVEPGQYAYSVEEETPLQELLKVGSSMDFSSAFRLSFVRCIQHHRYIVAALKKIESF  320

Query  274  CGTSIFILFIGGTLILCSSLFQLSVVKVGSVESVMLLL----YLICMIVDQLCYSWFGNE  329
                 F+     T ++C  L      K  +  S M ++    YL+ ++ +     +F + 
Sbjct  321  YSPIWFVKIGEVTFLMC--LVAFVSTKSTAANSFMRMVSLGQYLLLVLYELFIICYFADI  378

Query  330  VICKSSLILQSAYKTPWVDCNIKFRKILLQFMTQTCQPISILTGGLFTMSVQVFVSIMRT  389
            V   S    ++ +++PW       R   + FM  + +   +  G +  ++V  F   + T
Sbjct  379  VFQNSQRCGEALWRSPWQRHLKDVRSDYMFFMLNSRRQFQLTAGKISNLNVDRFRGTITT  438

Query  390  AYSYFTLLKNI  400
            A+S+ TLL+ +
Sbjct  439  AFSFLTLLQKM  449


>OR46B_DROME unnamed protein product
Length=384

 Score = 72.4 bits (176),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 89/414 (21%), Positives = 171/414 (41%), Gaps = 55/414 (13%)

Query  6    DFYGYFTSNIMIYKIVGFWR-----PDEDMKFKKLYNCYTAFCTLAWMAFLLSEIIYITN  60
            DFY Y    +  ++I+G W+      D   +F+ +      F  +     LL     + N
Sbjct  5    DFYKY---QVWYFQILGVWQLPTWAADHQRRFQSMR---FGFILVILFIMLLLFSFEMLN  58

Query  61   NRKNVQEITAALYVTGTFTIDFIQMIFTYKNMNHLKILMKEMNRTLFQVKCREHYRIAEN  120
            N   V+EI    ++  T      +++        L  L+  M    F VK  +  ++ E 
Sbjct  59   NISQVREILKVFFMFATEISCMAKLLHLKLKSRKLAGLVDAMLSPEFGVKSEQEMQMLEL  118

Query  121  TKRTYNVLFKSCLYLALLTAVFVMIVPL--------VGKERATSIKGWFPYDWTKPLYFA  172
             +     +  S   ++L  A  ++IVP         +      SI+GW  Y W++     
Sbjct  119  DRVAVVRMRNSYGIMSLGAASLILIVPCFDNFGELPLAMLEVCSIEGWICY-WSQ-----  172

Query  173  LTYIFQNLVFIWNALICSNFATFTSALLMQVGLQCDLLCCTLDSLDDFYTEDDVLYEISL  232
              Y+F ++  +   ++   + +   +LL  + +Q  +L   L+ L       D       
Sbjct  173  --YLFHSICLLPTCVLNITYDSVAYSLLCFLKVQLQMLVLRLEKLGPVIEPQD-------  223

Query  233  ENKKKLRKDEERFSEAMTKNLVVCIEHHRQIMRVTKNIEQICGTSIFILFIGGTLILCSS  292
                         +E +   L  C  ++ +I+R    +E        +  +   L+L S+
Sbjct  224  -------------NEKIAMELRECAAYYNRIVRFKDLVELFIKGPGSVQLMCSVLVLVSN  270

Query  293  LFQLSVVKVGSVESVMLL---LYLICMI--VDQLCYSWFGNEVICKSSLILQSAYKTPWV  347
            L+ +S + + + +++ +L   +Y + M+  +  +CY+   NEV  +SS +  S Y + W 
Sbjct  271  LYDMSTMSIANGDAIFMLKTCIYQLVMLWQIFIICYA--SNEVTVQSSRLCHSIYSSQWT  328

Query  348  DCNIKFRKILLQFMTQTCQPISILT-GGLFTMSVQVFVSIMRTAYSYFTLLKNI  400
              N   R+I+L  M +   P+ + T    F  S++ F SI+  +YSYF LLK +
Sbjct  329  GWNRANRRIVLLMMQRFNSPMLLSTFNPTFAFSLEAFGSIVNCSYSYFALLKRV  382



Lambda      K        H
   0.330    0.140    0.436 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4302909968


Query= XP_018560842.1 D site-binding protein-like [Anoplophora
glabripennis]

Length=231
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CES2_CAEEL  unnamed protein product                                   63.9    3e-12
GIANT_DROME  unnamed protein product                                  60.8    1e-10
Q8IQ99_DROME  unnamed protein product                                 52.4    8e-08
Q24217_DROME  unnamed protein product                                 51.6    9e-08
Q8SZT1_DROME  unnamed protein product                                 52.4    9e-08


>CES2_CAEEL unnamed protein product
Length=211

 Score = 63.9 bits (154),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 50/68 (74%), Gaps = 0/68 (0%)

Query  164  ERHADPSYLERRKKNNEAAKKSREARKAREDEITIRCAFLEQENIRLKANLASVEMDVER  223
            E   D +Y ERR+KNN+AAK+SR+AR+ +E++I  +   LE+EN++L+  ++S+E +  +
Sbjct  112  EEKKDSAYFERRRKNNDAAKRSRDARRQKEEQIASKAHALERENMQLRGKVSSLEQEAAQ  171

Query  224  LKSLIFRR  231
            L+ L+F +
Sbjct  172  LRFLLFSK  179


>GIANT_DROME unnamed protein product
Length=448

 Score = 60.8 bits (146),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 42/59 (71%), Gaps = 0/59 (0%)

Query  168  DPSYLERRKKNNEAAKKSREARKAREDEITIRCAFLEQENIRLKANLASVEMDVERLKS  226
            D +Y ERR+KNN AAKKSR+ R+ +EDEI IR A+LE++NI L   + ++++ +    S
Sbjct  384  DAAYYERRRKNNAAAKKSRDRRRIKEDEIAIRAAYLERQNIELLCQIDALKVQLAAFTS  442


>Q8IQ99_DROME unnamed protein product
Length=633

 Score = 52.4 bits (124),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 40/58 (69%), Gaps = 7/58 (12%)

Query  168  DPSYLERRKKNNEAAKKSREARKAREDEITIRCAFLEQENIRLKANLASVEMDVERLK  225
            D  Y  RR+KNN AAK+SR+AR+ +E++I +R  +LE+EN       A++  +VE+LK
Sbjct  567  DDKYWARRRKNNIAAKRSRDARRQKENQIAMRARYLEKEN-------ATLHQEVEQLK  617


>Q24217_DROME unnamed protein product
Length=232

 Score = 51.6 bits (122),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 40/58 (69%), Gaps = 7/58 (12%)

Query  168  DPSYLERRKKNNEAAKKSREARKAREDEITIRCAFLEQENIRLKANLASVEMDVERLK  225
            D  Y  RR+KNN AAK+SR+AR+ +E++I +R  +LE+EN       A++  +VE+LK
Sbjct  166  DDKYWARRRKNNIAAKRSRDARRQKENQIAMRARYLEKEN-------ATLHQEVEQLK  216


>Q8SZT1_DROME unnamed protein product
Length=647

 Score = 52.4 bits (124),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 40/58 (69%), Gaps = 7/58 (12%)

Query  168  DPSYLERRKKNNEAAKKSREARKAREDEITIRCAFLEQENIRLKANLASVEMDVERLK  225
            D  Y  RR+KNN AAK+SR+AR+ +E++I +R  +LE+EN       A++  +VE+LK
Sbjct  581  DDKYWARRRKNNIAAKRSRDARRQKENQIAMRARYLEKEN-------ATLHQEVEQLK  631



Lambda      K        H
   0.330    0.140    0.436 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4302909968


Query= XP_018560843.1 cell death specification protein 2-like [Anoplophora
glabripennis]

Length=242
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CES2_CAEEL  unnamed protein product                                   57.4    8e-10
GIANT_DROME  unnamed protein product                                  56.6    3e-09
Q8SZT1_DROME  unnamed protein product                                 54.7    2e-08
Q8IQ99_DROME  unnamed protein product                                 54.3    2e-08
M9PEX4_DROME  unnamed protein product                                 53.5    4e-08


>CES2_CAEEL unnamed protein product
Length=211

 Score = 57.4 bits (137),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 38/51 (75%), Gaps = 0/51 (0%)

Query  185  KRRKNNEAARKSREARRVMEDEIAIRCAFLERENDQIRAKLVDLEMEAKTL  235
            +RRKNN+AA++SR+ARR  E++IA +   LEREN Q+R K+  LE EA  L
Sbjct  122  RRRKNNDAAKRSRDARRQKEEQIASKAHALERENMQLRGKVSSLEQEAAQL  172


>GIANT_DROME unnamed protein product
Length=448

 Score = 56.6 bits (135),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 38/47 (81%), Gaps = 0/47 (0%)

Query  185  KRRKNNEAARKSREARRVMEDEIAIRCAFLERENDQIRAKLVDLEME  231
            +RRKNN AA+KSR+ RR+ EDEIAIR A+LER+N ++  ++  L+++
Sbjct  390  RRRKNNAAAKKSRDRRRIKEDEIAIRAAYLERQNIELLCQIDALKVQ  436


>Q8SZT1_DROME unnamed protein product
Length=647

 Score = 54.7 bits (130),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 42/62 (68%), Gaps = 0/62 (0%)

Query  178  EDDKKDLKRRKNNEAARKSREARRVMEDEIAIRCAFLERENDQIRAKLVDLEMEAKTLER  237
            +DDK   +RRKNN AA++SR+ARR  E++IA+R  +LE+EN  +  ++  L+ E   L  
Sbjct  580  KDDKYWARRRKNNIAAKRSRDARRQKENQIAMRARYLEKENATLHQEVEQLKQENMDLRA  639

Query  238  QL  239
            +L
Sbjct  640  RL  641


>Q8IQ99_DROME unnamed protein product
Length=633

 Score = 54.3 bits (129),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 42/62 (68%), Gaps = 0/62 (0%)

Query  178  EDDKKDLKRRKNNEAARKSREARRVMEDEIAIRCAFLERENDQIRAKLVDLEMEAKTLER  237
            +DDK   +RRKNN AA++SR+ARR  E++IA+R  +LE+EN  +  ++  L+ E   L  
Sbjct  566  KDDKYWARRRKNNIAAKRSRDARRQKENQIAMRARYLEKENATLHQEVEQLKQENMDLRA  625

Query  238  QL  239
            +L
Sbjct  626  RL  627


>M9PEX4_DROME unnamed protein product
Length=581

 Score = 53.5 bits (127),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 42/62 (68%), Gaps = 0/62 (0%)

Query  178  EDDKKDLKRRKNNEAARKSREARRVMEDEIAIRCAFLERENDQIRAKLVDLEMEAKTLER  237
            +DDK   +RRKNN AA++SR+ARR  E++IA+R  +LE+EN  +  ++  L+ E   L  
Sbjct  514  KDDKYWARRRKNNIAAKRSRDARRQKENQIAMRARYLEKENATLHQEVEQLKQENMDLRA  573

Query  238  QL  239
            +L
Sbjct  574  RL  575



Lambda      K        H
   0.330    0.140    0.436 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4302909968


Query= XP_018560846.1 testis-specific serine/threonine-protein kinase
1-like [Anoplophora glabripennis]

Length=362
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

E1JGM9_DROME  unnamed protein product                                 176     9e-49
Q963E6_DROME  unnamed protein product                                 176     1e-48
Q6NPA6_DROME  unnamed protein product                                 175     1e-48
A1ZBL7_DROME  unnamed protein product                                 176     1e-48
A1ZBL9_DROME  unnamed protein product                                 176     1e-48


>E1JGM9_DROME unnamed protein product
Length=827

 Score = 176 bits (445),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 102/271 (38%), Positives = 162/271 (60%), Gaps = 19/271 (7%)

Query  27   YKLLNKLGEGSYASVYLAELIGTTDDNEKPKTLACKILDVSKAPKDFVKKFLPRELDILV  86
            YKL+  +G+G++A V LA+ + T       K +A KI+D ++     ++K   RE+ I+ 
Sbjct  253  YKLIKTIGKGNFAKVKLAKHLPTG------KEVAIKIIDKTQLNPGSLQKLF-REVRIMK  305

Query  87   RINHPHIIHIHSIFQRKTKYFIFMRNAENGDLLEYVLKKGPISEPQARVWFRQLALAVQY  146
             ++HP+I+ +  + + +   ++ M  A  G++ +Y++  G + E +ARV FRQ+  AVQY
Sbjct  306  MLDHPNIVKLFQVIETEKTLYLIMEYASGGEVFDYLVLHGRMKEKEARVKFRQIVSAVQY  365

Query  147  LHNMDIAHRDLKCENALITSNFNIKLADFGFARFVTDARGRRVTSSTYCGSLSYAAPEVL  206
             H   I HRDLK EN L+ S  NIK+ADFGF+   T   G ++   T+CGS  YAAPE+ 
Sbjct  366  CHQKRIIHRDLKAENLLLDSELNIKIADFGFSNEFTP--GSKL--DTFCGSPPYAAPELF  421

Query  207  RGMPYHPKIADIWSLGVILYIMINKAMPFDDTNVRQLHEQQMNRRWKFRSKVVDYL-TDQ  265
            +G  Y     D+WSLGVILY +++ ++PFD + +R+L E+ +  R K+R  +  Y+ TD 
Sbjct  422  QGKKYDGPEVDVWSLGVILYTLVSGSLPFDGSTLRELRERVL--RGKYR--IPFYMSTDC  477

Query  266  VKLLTA-LLLEPDVTKRWRVEQIVKCEWLGM  295
              LL   L+L P   KR  +E I+  +W+ M
Sbjct  478  ENLLRKFLVLNP--AKRASLETIMGDKWMNM  506


>Q963E6_DROME unnamed protein product
Length=832

 Score = 176 bits (445),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 102/271 (38%), Positives = 162/271 (60%), Gaps = 19/271 (7%)

Query  27   YKLLNKLGEGSYASVYLAELIGTTDDNEKPKTLACKILDVSKAPKDFVKKFLPRELDILV  86
            YKL+  +G+G++A V LA+ + T       K +A KI+D ++     ++K   RE+ I+ 
Sbjct  253  YKLIKTIGKGNFAKVKLAKHLPTG------KEVAIKIIDKTQLNPGSLQKLF-REVRIMK  305

Query  87   RINHPHIIHIHSIFQRKTKYFIFMRNAENGDLLEYVLKKGPISEPQARVWFRQLALAVQY  146
             ++HP+I+ +  + + +   ++ M  A  G++ +Y++  G + E +ARV FRQ+  AVQY
Sbjct  306  MLDHPNIVKLFQVIETEKTLYLIMEYASGGEVFDYLVLHGRMKEKEARVKFRQIVSAVQY  365

Query  147  LHNMDIAHRDLKCENALITSNFNIKLADFGFARFVTDARGRRVTSSTYCGSLSYAAPEVL  206
             H   I HRDLK EN L+ S  NIK+ADFGF+   T   G ++   T+CGS  YAAPE+ 
Sbjct  366  CHQKRIIHRDLKAENLLLDSELNIKIADFGFSNEFTP--GSKL--DTFCGSPPYAAPELF  421

Query  207  RGMPYHPKIADIWSLGVILYIMINKAMPFDDTNVRQLHEQQMNRRWKFRSKVVDYL-TDQ  265
            +G  Y     D+WSLGVILY +++ ++PFD + +R+L E+ +  R K+R  +  Y+ TD 
Sbjct  422  QGKKYDGPEVDVWSLGVILYTLVSGSLPFDGSTLRELRERVL--RGKYR--IPFYMSTDC  477

Query  266  VKLLTA-LLLEPDVTKRWRVEQIVKCEWLGM  295
              LL   L+L P   KR  +E I+  +W+ M
Sbjct  478  ENLLRKFLVLNP--AKRASLETIMGDKWMNM  506


>Q6NPA6_DROME unnamed protein product
Length=833

 Score = 175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 97/269 (36%), Positives = 159/269 (59%), Gaps = 15/269 (6%)

Query  27   YKLLNKLGEGSYASVYLAELIGTTDDNEKPKTLACKILDVSKAPKDFVKKFLPRELDILV  86
            YKL+  +G+G++A V LA+ + T       K +A KI+D ++     ++K   RE+ I+ 
Sbjct  253  YKLIKTIGKGNFAKVKLAKHLPTG------KEVAIKIIDKTQLNPGSLQKLF-REVRIMK  305

Query  87   RINHPHIIHIHSIFQRKTKYFIFMRNAENGDLLEYVLKKGPISEPQARVWFRQLALAVQY  146
             ++HP+I+ +  + + +   ++ M  A  G++ +Y++  G + E +ARV FRQ+  AVQY
Sbjct  306  MLDHPNIVKLFQVIETEKTLYLIMEYASGGEVFDYLVLHGRMKEKEARVKFRQIVSAVQY  365

Query  147  LHNMDIAHRDLKCENALITSNFNIKLADFGFARFVTDARGRRVTSSTYCGSLSYAAPEVL  206
             H   I HRDLK EN L+ S  NIK+ADFGF+   T   G ++   T+CGS  YAAPE+ 
Sbjct  366  CHQKRIIHRDLKAENLLLDSELNIKIADFGFSNEFTP--GSKL--DTFCGSPPYAAPELF  421

Query  207  RGMPYHPKIADIWSLGVILYIMINKAMPFDDTNVRQLHEQQMNRRWKFRSKVVDYLTDQV  266
            +G  Y     D+WSLGVILY +++ ++PFD + +R+L E+ +  R K+R  +  Y++   
Sbjct  422  QGKKYDGPEVDVWSLGVILYTLVSGSLPFDGSTLRELRERVL--RGKYR--IPFYMSTDC  477

Query  267  KLLTALLLEPDVTKRWRVEQIVKCEWLGM  295
            + L    L  +  KR  +E I+  +W+ M
Sbjct  478  ENLLRKFLVLNPAKRASLETIMGDKWMNM  506


>A1ZBL7_DROME unnamed protein product
Length=993

 Score = 176 bits (445),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 97/269 (36%), Positives = 159/269 (59%), Gaps = 15/269 (6%)

Query  27   YKLLNKLGEGSYASVYLAELIGTTDDNEKPKTLACKILDVSKAPKDFVKKFLPRELDILV  86
            YKL+  +G+G++A V LA+ + T       K +A KI+D ++     ++K   RE+ I+ 
Sbjct  376  YKLIKTIGKGNFAKVKLAKHLPTG------KEVAIKIIDKTQLNPGSLQKLF-REVRIMK  428

Query  87   RINHPHIIHIHSIFQRKTKYFIFMRNAENGDLLEYVLKKGPISEPQARVWFRQLALAVQY  146
             ++HP+I+ +  + + +   ++ M  A  G++ +Y++  G + E +ARV FRQ+  AVQY
Sbjct  429  MLDHPNIVKLFQVIETEKTLYLIMEYASGGEVFDYLVLHGRMKEKEARVKFRQIVSAVQY  488

Query  147  LHNMDIAHRDLKCENALITSNFNIKLADFGFARFVTDARGRRVTSSTYCGSLSYAAPEVL  206
             H   I HRDLK EN L+ S  NIK+ADFGF+   T   G ++   T+CGS  YAAPE+ 
Sbjct  489  CHQKRIIHRDLKAENLLLDSELNIKIADFGFSNEFTP--GSKL--DTFCGSPPYAAPELF  544

Query  207  RGMPYHPKIADIWSLGVILYIMINKAMPFDDTNVRQLHEQQMNRRWKFRSKVVDYLTDQV  266
            +G  Y     D+WSLGVILY +++ ++PFD + +R+L E+ +  R K+R  +  Y++   
Sbjct  545  QGKKYDGPEVDVWSLGVILYTLVSGSLPFDGSTLRELRERVL--RGKYR--IPFYMSTDC  600

Query  267  KLLTALLLEPDVTKRWRVEQIVKCEWLGM  295
            + L    L  +  KR  +E I+  +W+ M
Sbjct  601  ENLLRKFLVLNPAKRASLETIMGDKWMNM  629


>A1ZBL9_DROME unnamed protein product
Length=1170

 Score = 176 bits (446),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 97/269 (36%), Positives = 159/269 (59%), Gaps = 15/269 (6%)

Query  27   YKLLNKLGEGSYASVYLAELIGTTDDNEKPKTLACKILDVSKAPKDFVKKFLPRELDILV  86
            YKL+  +G+G++A V LA+ + T       K +A KI+D ++     ++K   RE+ I+ 
Sbjct  253  YKLIKTIGKGNFAKVKLAKHLPTG------KEVAIKIIDKTQLNPGSLQKLF-REVRIMK  305

Query  87   RINHPHIIHIHSIFQRKTKYFIFMRNAENGDLLEYVLKKGPISEPQARVWFRQLALAVQY  146
             ++HP+I+ +  + + +   ++ M  A  G++ +Y++  G + E +ARV FRQ+  AVQY
Sbjct  306  MLDHPNIVKLFQVIETEKTLYLIMEYASGGEVFDYLVLHGRMKEKEARVKFRQIVSAVQY  365

Query  147  LHNMDIAHRDLKCENALITSNFNIKLADFGFARFVTDARGRRVTSSTYCGSLSYAAPEVL  206
             H   I HRDLK EN L+ S  NIK+ADFGF+   T   G ++   T+CGS  YAAPE+ 
Sbjct  366  CHQKRIIHRDLKAENLLLDSELNIKIADFGFSNEFTP--GSKL--DTFCGSPPYAAPELF  421

Query  207  RGMPYHPKIADIWSLGVILYIMINKAMPFDDTNVRQLHEQQMNRRWKFRSKVVDYLTDQV  266
            +G  Y     D+WSLGVILY +++ ++PFD + +R+L E+ +  R K+R  +  Y++   
Sbjct  422  QGKKYDGPEVDVWSLGVILYTLVSGSLPFDGSTLRELRERVL--RGKYR--IPFYMSTDC  477

Query  267  KLLTALLLEPDVTKRWRVEQIVKCEWLGM  295
            + L    L  +  KR  +E I+  +W+ M
Sbjct  478  ENLLRKFLVLNPAKRASLETIMGDKWMNM  506



Lambda      K        H
   0.330    0.140    0.436 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4302909968


Query= XP_018560847.1 probable RNA-binding protein EIF1AD [Anoplophora
glabripennis]

Length=166
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

EIF1A_CAEEL  unnamed protein product                                  59.3    2e-11
SWS_DROME  unnamed protein product                                    27.3    7.3  


>EIF1A_CAEEL unnamed protein product
Length=175

 Score = 59.3 bits (142),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 66/141 (47%), Gaps = 11/141 (8%)

Query  1    MSVSTLKNPVFNNLPRDDSPPAENQKIARVVRVRAMNLFEVETPEKSVLLMTVPNRFREA  60
            MS +T K  + N +  +     +   IA+V + R  NL EV        ++++P +FR++
Sbjct  1    MSAATKKRYITNKVGSEFYELVDEDIIAQVRQSRGNNLHEVLDQNGDSYVVSMPTKFRKS  60

Query  61   IWVRIGNFVVVEPIKEGNKVKVEMVKLLTVEQIWIYKMDNTWPKEFNICLNYLCVNTNRL  120
            +W+R   FVVV PI EG+KVK E+  +L  + +   +    WP          C   N L
Sbjct  61   VWLRRDQFVVVRPITEGDKVKGEIEYILDQDNVLYIRELGKWP---------TCFEENAL  111

Query  121  RINLSRSNDVASNSDSEDDSD  141
            +  ++R       SD   D D
Sbjct  112  K--MTREAKRGQTSDKMIDDD  130


>SWS_DROME unnamed protein product
Length=1425

 Score = 27.3 bits (59),  Expect = 7.3, Method: Compositional matrix adjust.
 Identities = 15/37 (41%), Positives = 23/37 (62%), Gaps = 4/37 (11%)

Query  109   CLNYLC----VNTNRLRINLSRSNDVASNSDSEDDSD  141
             C  Y+     +NT+R RI +SR+ +  S S++E DSD
Sbjct  1287  CDGYISEPTTLNTDRRRIQVSRAGNSLSFSETEMDSD  1323



Lambda      K        H
   0.330    0.140    0.436 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4302909968


Query= XP_018560848.1 probable RNA-binding protein EIF1AD [Anoplophora
glabripennis]

Length=121
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

EIF1A_CAEEL  unnamed protein product                                  55.5    2e-10
Q9BPN3_CAEEL  unnamed protein product                                 26.6    6.6  
SOX15_DROME  unnamed protein product                                  26.6    7.4  
DHX16_CAEEL  unnamed protein product                                  26.2    9.5  


>EIF1A_CAEEL unnamed protein product
Length=175

 Score = 55.5 bits (132),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 33/54 (61%), Gaps = 0/54 (0%)

Query  1    MPKRFRGGVWVKKGDFVLVEPIEEGNKVKAEIVKILSTDQIKYYKMNNVWPGEF  54
            MP +FR  VW+++  FV+V PI EG+KVK EI  IL  D + Y +    WP  F
Sbjct  53   MPTKFRKSVWLRRDQFVVVRPITEGDKVKGEIEYILDQDNVLYIRELGKWPTCF  106


>Q9BPN3_CAEEL unnamed protein product
Length=812

 Score = 26.6 bits (57),  Expect = 6.6, Method: Composition-based stats.
 Identities = 15/61 (25%), Positives = 28/61 (46%), Gaps = 0/61 (0%)

Query  56   VDTDDKKKHEGDSDDGLFVNPNRPTFSDSGSSDSDSSIDSEGEDCDKRVASRCSDSGSVT  115
            +  + KK+    + DG+     +   +D G + S  SI S   +  KR  S+ +   ++T
Sbjct  437  LKAEQKKQRRPSTSDGIVETERKKEIADVGVNTSQRSIKSADSNAPKRKYSKSTSVTNLT  496

Query  116  E  116
            E
Sbjct  497  E  497


>SOX15_DROME unnamed protein product
Length=784

 Score = 26.6 bits (57),  Expect = 7.4, Method: Composition-based stats.
 Identities = 15/56 (27%), Positives = 27/56 (48%), Gaps = 5/56 (9%)

Query  62   KKHEGDSDDGLFVNPNRPTFSDS-----GSSDSDSSIDSEGEDCDKRVASRCSDSG  112
            + H   +  GL+  P +PT+S S      ++DS   I+S   +C   + +  S +G
Sbjct  348  QNHGQSTPGGLYEQPLKPTYSPSSVDCYSNADSTEQIESLAANCPPALLNESSPTG  403


>DHX16_CAEEL unnamed protein product
Length=1008

 Score = 26.2 bits (56),  Expect = 9.5, Method: Composition-based stats.
 Identities = 15/63 (24%), Positives = 32/63 (51%), Gaps = 2/63 (3%)

Query  61   KKKHEGDSDDGLFVNPNRP--TFSDSGSSDSDSSIDSEGEDCDKRVASRCSDSGSVTEEK  118
            K+K     DD   +  ++P  +   S S DS+S I++     D  +A R + +  + +++
Sbjct  113  KRKESSSEDDEAPIKASKPGKSVKPSKSDDSESDIEAMEAKLDADIAERDALAARINKKE  172

Query  119  RNK  121
            ++K
Sbjct  173  KDK  175



Lambda      K        H
   0.330    0.140    0.436 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4302909968


Query= XP_018560849.1 cingulin [Anoplophora glabripennis]

Length=1067
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q582C1_TRYB2  unnamed protein product                                 77.4    5e-14
Q383B5_TRYB2  unnamed protein product                                 73.2    8e-13
KIF12_DICDI  unnamed protein product                                  40.0    0.011
Q381P0_TRYB2  unnamed protein product                                 31.2    5.9  
MYS2_DICDI  unnamed protein product                                   31.2    7.1  


>Q582C1_TRYB2 unnamed protein product
Length=1177

 Score = 77.4 bits (189),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 58/100 (58%), Gaps = 1/100 (1%)

Query  1    MSIICEEVFDEVSHPSEDEIRDYATKIGIDPDSEPQLLPLAAEGLMKALPPGWKPCYDDK  60
            +S++  +  D    P+E+E+ +YA  IGID   E  LL +A EGL   LP  WK C    
Sbjct  18   ISVVLPDTCDPDHEPTEEELHEYAEFIGIDVKEEKHLLWIAREGLQTPLPEEWKACRTGD  77

Query  61   SKSYYYYNNLTKKTQWEHPLDDVYRGLVKKARTESQSISL  100
             +  YY+N  T ++ W+HPLDD++R  V   RT++ + +L
Sbjct  78   EEP-YYFNFRTGESSWDHPLDDMFRQKVDLERTKANASAL  116


>Q383B5_TRYB2 unnamed protein product
Length=1006

 Score = 73.2 bits (178),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 61/102 (60%), Gaps = 5/102 (5%)

Query  1    MSIICEEVFDEVSHPSEDEIRDYATKIGIDPDSEPQLLPLAAEGLMKALPPGWKPCY--D  58
            +S++  +  DE   P+++EI  +A  +G++   + + L +A EGL   LP  W+PC   D
Sbjct  22   VSVVLADTVDEDYVPTQEEIEGFAEWMGMNLPEDNEFLHIAVEGLKAPLPKNWRPCRTED  81

Query  59   DKSKSYYYYNNLTKKTQWEHPLDDVYRGLVKKARTESQSISL  100
            D+    YY+N  T ++ W HP+D+V+R   +KA+ + Q++ +
Sbjct  82   DE---VYYFNFKTGESTWCHPMDEVHRERFRKAKEQKQNLGV  120


>KIF12_DICDI unnamed protein product
Length=1499

 Score = 40.0 bits (92),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 46/172 (27%), Positives = 80/172 (47%), Gaps = 26/172 (15%)

Query  431  ILIEEKTKHENNIKNELENLRKEMD-ARTTGTLKEERLKLEFTAEKLKTEQEEILKEEEE  489
            I I E     +NI+N+L ++  E+D  R       ER++ +FT   L+TEQ EI +E   
Sbjct  788  IEITEVQTERDNIQNKLNSILFELDEQRQHNQFSLERIQ-QFT---LQTEQLEIERENLL  843

Query  490  KLKESLDKRKEELEKYYEEKLAEIEKELAEKVERSRDELVFNHNANIEQL-------KQN  542
               ES+  + +EL K  E ++ ++++ +    ++ R+ L   HN     L       +Q 
Sbjct  844  TEIESMQSKGQELIKLRELEMMQLKESMNSDAQKDRENLEIQHNFETSNLNNQLQMERQE  903

Query  543  HTVIIDELKREFKLEEQTLRRNHQGQMTDLKTKMQNELEQEKNKSVCDERTY  594
               II+E+ R  KLE Q  + N               +EQ++N ++   + Y
Sbjct  904  KLQIIEEM-RMLKLELQQFKSNQ-------------SIEQQRNNNLIKNQYY  941


>Q381P0_TRYB2 unnamed protein product
Length=2293

 Score = 31.2 bits (69),  Expect = 5.9, Method: Compositional matrix adjust.
 Identities = 61/250 (24%), Positives = 121/250 (48%), Gaps = 36/250 (14%)

Query  363   INNVETFFDSDNSVSSPSDKIA-EKSKKLEDRAEKKITILKQTIWEEK---NEEIVKFKS  418
             + ++ T   ++      S+K+A E  + +E    ++++ L+  + E++     E+   ++
Sbjct  1657  VESLRTELQNERERVQASEKVAQENHEGMEKLHREQLSTLEIAMEEQRVRYTHEVESLRT  1716

Query  419   NLHNSHKAELERILIEEKTKHENNIKNELENLRKEMDARTTGTLKEERLKLEFTAEKLKT  478
              L N    E ER+   EK   EN+    +E L +E        ++E+R++     E L+T
Sbjct  1717  ELQN----ERERVQASEKVAQENH--EGMEKLHREQLLALEIAMEEQRVRYTHEVESLRT  1770

Query  479   EQEEILKEEEEKLKES---LDKRKEELEKYYEEKLAEIEKELAEK-------VERSRDEL  528
             E    L+ E E+++ S   + +  E +EK + E+L  +E  + E+       VE  R EL
Sbjct  1771  E----LQNERERVQASEKVVQENHEGMEKLHREQLLTLEIAMEEQRVRYTHEVESLRTEL  1826

Query  529   VFNH---NANIEQLKQNHTVIIDELKRE------FKLEEQTLRRNHQGQMTDLKTKMQNE  579
                     A+ + +++NH  + ++L RE        +EEQ +R  H+  +  L+T++QNE
Sbjct  1827  QNERERVQASEKVVQENHEGM-EKLHREQLSTLEIAMEEQRVRYTHE--VESLRTELQNE  1883

Query  580   LEQEKNKSVC  589
              E+ +   +C
Sbjct  1884  RERVQASEMC  1893


>MYS2_DICDI unnamed protein product
Length=2116

 Score = 31.2 bits (69),  Expect = 7.1, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 63/116 (54%), Gaps = 26/116 (22%)

Query  441   NNIKNELENLRKEMDARTTGTLKEERLKLEFTAEKLKTEQEEILKEEEEKLKESLDKRKE  500
             NN+K ELE  +K   A     L+++RL LE    +LK   E++  EEE+K KES +KRK 
Sbjct  1265  NNLKLELEAEQKAKQA-----LEKKRLGLE---SELKHVNEQL--EEEKKQKESNEKRKV  1314

Query  501   ELEKYYEEKLAEIEKELAEK----------------VERSRDELVFNHNANIEQLK  540
             +LEK   E   +IE+E+A K                ++R   ++V + + ++EQLK
Sbjct  1315  DLEKEVSELKDQIEEEVASKKAVTEAKNKKESELDEIKRQYADVVSSRDKSVEQLK  1370



Lambda      K        H
   0.330    0.140    0.436 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4302909968


Query= XP_018560850.1 ecdysone receptor isoform X1 [Anoplophora
glabripennis]

Length=570
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ECR_DROME  unnamed protein product                                    555     0.0   
ECR_HELVI  unnamed protein product                                    517     5e-179
HR38_DROME  unnamed protein product                                   162     8e-42 
E75BC_DROME  unnamed protein product                                  154     3e-39 
E75BB_DROME  unnamed protein product                                  153     7e-39 


>ECR_DROME unnamed protein product
Length=878

 Score = 555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/426 (65%), Positives = 323/426 (76%), Gaps = 28/426 (7%)

Query  169  GREDLSPPSSLNGYSA-DSCDAKK-KKGPTPRQQEELCLVCGDRASGYHYNALTCEGCKG  226
            GR+DLSP SSLNGYSA +SCDAKK KKGP PR QEELCLVCGDRASGYHYNALTCEGCKG
Sbjct  227  GRDDLSPSSSLNGYSANESCDAKKSKKGPAPRVQEELCLVCGDRASGYHYNALTCEGCKG  286

Query  227  FFRRSITKNAVYQCKYGNNCEIDMYMRRKCQECRLKKCLSVGMRPECVVPEVQCAVKRKE  286
            FFRRS+TK+AVY CK+G  CE+DMYMRRKCQECRLKKCL+VGMRPECVVPE QCA+KR+E
Sbjct  287  FFRRSVTKSAVYCCKFGRACEMDMYMRRKCQECRLKKCLAVGMRPECVVPENQCAMKRRE  346

Query  287  KKAQKEKDK----PNS--------TTNGSPEMIKLE---------PEMFFLQLSDSE---  322
            KKAQKEKDK    P+S         + G  + +K E         P+   + L   E   
Sbjct  347  KKAQKEKDKMTTSPSSQHGGNGSLASGGGQDFVKKEILDLMTCEPPQHATIPLLPDEILA  406

Query  323  KTLTNGVKPISPEQEELIHRLVYFQNEYEHPSEEDVKRIINQPMEGEDQCDIRFRHITEI  382
            K     +  ++  Q  +I++L+++Q+ YE PSEED++RI++QP E E Q D+ FRHITEI
Sbjct  407  KCQARNIPSLTYNQLAVIYKLIWYQDGYEQPSEEDLRRIMSQPDENESQTDVSFRHITEI  466

Query  383  TILTVQLIVEFAKRLPGFDKLLREDQIALLKACSSEVMMFRMARRYDVQSDSILFVNNQP  442
            TILTVQLIVEFAK LP F K+ +EDQI LLKACSSEVMM RMARRYD  SDSI F NN+ 
Sbjct  467  TILTVQLIVEFAKGLPAFTKIPQEDQITLLKACSSEVMMLRMARRYDHSSDSIFFANNRS  526

Query  443  YSRDSYNLAGMGETIEDLLHFCRTMYSMKVDNAEYALLTAIVIFSERPALIEGWKVEKIQ  502
            Y+RDSY +AGM + IEDLLHFCR M+SMKVDN EYALLTAIVIFS+RP L +   VE IQ
Sbjct  527  YTRDSYKMAGMADNIEDLLHFCRQMFSMKVDNVEYALLTAIVIFSDRPGLEKAQLVEAIQ  586

Query  503  EIYLEALRAYVDNRR--KPRPGTIFAKLLSVLTELRTLGNQNSEMCFSLKLKNKKLPPFL  560
              Y++ LR Y+ NR          +AKLLS+LTELRTLGNQN+EMCFSLKLKN+KLP FL
Sbjct  587  SYYIDTLRIYILNRHCGDSMSLVFYAKLLSILTELRTLGNQNAEMCFSLKLKNRKLPKFL  646

Query  561  AEIWDV  566
             EIWDV
Sbjct  647  EEIWDV  652


>ECR_HELVI unnamed protein product
Length=576

 Score = 517 bits (1332),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 265/420 (63%), Positives = 312/420 (74%), Gaps = 23/420 (5%)

Query  169  GREDLSPPSSLNGYSADSCDAKKKKGPTPRQQEELCLVCGDRASGYHYNALTCEGCKGFF  228
            GRE+LSP SS+NG S D    ++KKGP PRQQEELCLVCGDRASGYHYNALTCEGCKGFF
Sbjct  128  GREELSPASSVNGCSTDGEARRQKKGPAPRQQEELCLVCGDRASGYHYNALTCEGCKGFF  187

Query  229  RRSITKNAVYQCKYGNNCEIDMYMRRKCQECRLKKCLSVGMRPECVVPEVQCAVKRKEKK  288
            RRS+TKNAVY CK+G+ CE+D+YMRRKCQECRLKKCL+VGMRPECVVPE QCA+KRKEKK
Sbjct  188  RRSVTKNAVYICKFGHACEMDIYMRRKCQECRLKKCLAVGMRPECVVPENQCAMKRKEKK  247

Query  289  AQKEKDK-PNSTT---NGSPEMIKLEP--------------EMF--FLQLSDSEKTLTNG  328
            AQ+EKDK P STT   +  P +++ +P              E+   FL     E+     
Sbjct  248  AQREKDKLPVSTTTVDDHMPPIMQCDPPPPEAARILECVQHEVVPRFLNEKLMEQNRLKN  307

Query  329  VKPISPEQEELIHRLVYFQNEYEHPSEEDVKRIINQPMEGEDQCDIRFRHITEITILTVQ  388
            V P++  Q+ LI RLV++Q  YE PSEED+KR + Q  E ++  D+ FR ITE+TILTVQ
Sbjct  308  VPPLTANQKSLIARLVWYQEGYEQPSEEDLKR-VTQSDEDDEDSDMPFRQITEMTILTVQ  366

Query  389  LIVEFAKRLPGFDKLLREDQIALLKACSSEVMMFRMARRYDVQSDSILFVNNQPYSRDSY  448
            LIVEFAK LPGF K+ + DQI LLKACSSEVMM R+ARRYD  +DS+LF NNQ Y+RD+Y
Sbjct  367  LIVEFAKGLPGFAKISQSDQITLLKACSSEVMMLRVARRYDAATDSVLFANNQAYTRDNY  426

Query  449  NLAGMGETIEDLLHFCRTMYSMKVDNAEYALLTAIVIFSERPALIEGWKVEKIQEIYLEA  508
              AGM   IEDLLHFCR MYSM +DN  YALLTAIVIFS+RP L +   VE+IQ  YL  
Sbjct  427  RKAGMAYVIEDLLHFCRCMYSMMMDNVHYALLTAIVIFSDRPGLEQPLLVEEIQRYYLNT  486

Query  509  LRAYV--DNRRKPRPGTIFAKLLSVLTELRTLGNQNSEMCFSLKLKNKKLPPFLAEIWDV  566
            LR Y+   N   PR   IF ++L +LTE+RTLG QNS MC SLKLKN+KLPPFL EIWDV
Sbjct  487  LRVYILNQNSASPRGAVIFGEILGILTEIRTLGMQNSNMCISLKLKNRKLPPFLEEIWDV  546


>HR38_DROME unnamed protein product
Length=1073

 Score = 162 bits (409),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 111/362 (31%), Positives = 174/362 (48%), Gaps = 40/362 (11%)

Query  202   ELCLVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYQCKYGNNCEIDMYMRRKCQECRL  261
             +LC VCGD A+  HY   TCEGCKGFF+R++ K + Y C    NC +D   R +CQ CR 
Sbjct  742   QLCAVCGDTAACQHYGVRTCEGCKGFFKRTVQKGSKYVCLADKNCPVDKRRRNRCQFCRF  801

Query  262   KKCLSVGMRPECVVPEVQCAVKRKEKKAQKEKDKPNSTTNGSPEMIKLEPEMFFLQLSDS  321
             +KCL VGM  E V         R+ +   K K    S  +    +I              
Sbjct  802   QKCLVVGMVKEVV--RTDSLKGRRGRLPSKPKSPQESPPSPPISLI--------------  845

Query  322   EKTLTNGVKPISPEQEELIHRLVYFQNEYEHPSEEDVKRIINQPMEGEDQCDIRFRHITE  381
                L       +P+   L         +Y H  E        Q M   D+    ++ +T 
Sbjct  846   -TALVRSHVDTTPDPSCL---------DYSHYEE--------QSMSEADKVQQFYQLLTS  887

Query  382   ITILTVQLIVEFAKRLPGFDKLLREDQIALLKACSSEVMMFRMARRYDVQSDSILFVNNQ  441
                 +V +I +FA+++PG+  LL EDQ  L ++ S E+ + R+A R  +    ++F N  
Sbjct  888   ----SVDVIKQFAEKIPGYFDLLPEDQELLFQSASLELFVLRLAYRARIDDTKLIFCNGT  943

Query  442   PYSRDSYNLAGMGETIEDLLHFCRTMYSMKVDNAEYALLTAIVIFSERPALIEGWKVEKI  501
                R +  L   GE + D++ F R+++++++D + +A L A+ + +ER  L E  KVE++
Sbjct  944   VLHR-TQCLRSFGEWLNDIMEFSRSLHNLEIDISAFACLCALTLITERHGLREPKKVEQL  1002

Query  502   QEIYLEALRAYVD-NRRKPRPGTIFAKLLSVLTELRTLGNQNSEMCFSLKLKNKKLPPFL  560
             Q   + +LR +V  N    +    F++LL  L ELR+L  Q  +  F LKL++    P L
Sbjct  1003  QMKIIGSLRDHVTYNAEAQKKQHYFSRLLGKLPELRSLSVQGLQRIFYLKLEDLVPAPAL  1062

Query  561   AE  562
              E
Sbjct  1063  IE  1064


>E75BC_DROME unnamed protein product
Length=1199

 Score = 154 bits (388),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 110/380 (29%), Positives = 181/380 (48%), Gaps = 41/380 (11%)

Query  203  LCLVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYQ-CKYGNNCEIDMYMRRKCQECRL  261
            LC VCGD+ASG+HY   +CEGCKGFFRRSI +   Y+ C     C I    R +CQ CRL
Sbjct  244  LCRVCGDKASGFHYGVHSCEGCKGFFRRSIQQKIQYRPCTKNQQCSILRINRNRCQYCRL  303

Query  262  KKCLSVGMRPECV----VPEVQCAVKRKEKKAQKEKDKPNSTTNGSPEMIKLEPEMFFLQ  317
            KKC++VGM  + V    VP        K +KA+       ST N      + +      +
Sbjct  304  KKCIAVGMSRDAVRFGRVP--------KREKARILAAMQQSTQN------RGQQRALATE  349

Query  318  LSDSEKTLTNGVKP------ISPEQEELIHRLVYFQNEYEHPSEEDVKRIINQPMEGEDQ  371
            L D  + L   ++        + E+   + +       Y  P+           ++ E +
Sbjct  350  LDDQPRLLAAVLRAHLETCEFTKEKVSAMRQRARDCPSYSMPTLLACPLNPAPELQSEQE  409

Query  372  CDIRFRHITEITILTVQLIVEFAKRLPGFDKLLREDQIALLKACSSEVMMFRMARRYDVQ  431
               RF H+       ++ +++FA  +PGF  L ++D+  LLKA   + +  R+   +D  
Sbjct  410  FSQRFAHV-------IRGVIDFAGMIPGFQLLTQDDKFTLLKAGLFDALFVRLICMFDSS  462

Query  432  SDSILFVNNQPYSRDSY-NLAGMGETIEDLLHFCRTMYSMKVDNAEYALLTAIVIFS-ER  489
             +SI+ +N Q   RD+  N A     ++   +F   M SM + +AE  L  AIV+ + +R
Sbjct  463  INSIICLNGQVMRRDAIQNGANARFLVDSTFNFAERMNSMNLTDAEIGLFCAIVLITPDR  522

Query  490  PALIEGWKVEKIQEIY--LEALRAYVDNRRKPRPGTIFAKLLSVLTELRTLGNQNSEMCF  547
            P L     +E I+++Y  L+    Y+  + +P      AKLL  + +LRTL   ++E   
Sbjct  523  PGL---RNLELIEKMYSRLKGCLQYIVAQNRPDQPEFLAKLLETMPDLRTLSTLHTEKLV  579

Query  548  SLKLKNKKLPPFLAEIWDVD  567
              + ++K+L     ++W ++
Sbjct  580  VFRTEHKEL--LRQQMWSME  597


>E75BB_DROME unnamed protein product
Length=1412

 Score = 153 bits (386),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 110/380 (29%), Positives = 181/380 (48%), Gaps = 41/380 (11%)

Query  203  LCLVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYQ-CKYGNNCEIDMYMRRKCQECRL  261
            LC VCGD+ASG+HY   +CEGCKGFFRRSI +   Y+ C     C I    R +CQ CRL
Sbjct  457  LCRVCGDKASGFHYGVHSCEGCKGFFRRSIQQKIQYRPCTKNQQCSILRINRNRCQYCRL  516

Query  262  KKCLSVGMRPECV----VPEVQCAVKRKEKKAQKEKDKPNSTTNGSPEMIKLEPEMFFLQ  317
            KKC++VGM  + V    VP        K +KA+       ST N      + +      +
Sbjct  517  KKCIAVGMSRDAVRFGRVP--------KREKARILAAMQQSTQN------RGQQRALATE  562

Query  318  LSDSEKTLTNGVKP------ISPEQEELIHRLVYFQNEYEHPSEEDVKRIINQPMEGEDQ  371
            L D  + L   ++        + E+   + +       Y  P+           ++ E +
Sbjct  563  LDDQPRLLAAVLRAHLETCEFTKEKVSAMRQRARDCPSYSMPTLLACPLNPAPELQSEQE  622

Query  372  CDIRFRHITEITILTVQLIVEFAKRLPGFDKLLREDQIALLKACSSEVMMFRMARRYDVQ  431
               RF H+       ++ +++FA  +PGF  L ++D+  LLKA   + +  R+   +D  
Sbjct  623  FSQRFAHV-------IRGVIDFAGMIPGFQLLTQDDKFTLLKAGLFDALFVRLICMFDSS  675

Query  432  SDSILFVNNQPYSRDSY-NLAGMGETIEDLLHFCRTMYSMKVDNAEYALLTAIVIFS-ER  489
             +SI+ +N Q   RD+  N A     ++   +F   M SM + +AE  L  AIV+ + +R
Sbjct  676  INSIICLNGQVMRRDAIQNGANARFLVDSTFNFAERMNSMNLTDAEIGLFCAIVLITPDR  735

Query  490  PALIEGWKVEKIQEIY--LEALRAYVDNRRKPRPGTIFAKLLSVLTELRTLGNQNSEMCF  547
            P L     +E I+++Y  L+    Y+  + +P      AKLL  + +LRTL   ++E   
Sbjct  736  PGL---RNLELIEKMYSRLKGCLQYIVAQNRPDQPEFLAKLLETMPDLRTLSTLHTEKLV  792

Query  548  SLKLKNKKLPPFLAEIWDVD  567
              + ++K+L     ++W ++
Sbjct  793  VFRTEHKEL--LRQQMWSME  810



Lambda      K        H
   0.330    0.140    0.436 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4302909968


Query= XP_018560851.1 translation initiation factor eIF-2B subunit delta
[Anoplophora glabripennis]

Length=537
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q4FKA6_TRYB2  unnamed protein product                                 103     5e-23
Q9VAD4_DROME  unnamed protein product                                 95.5    1e-21
Q9GQ89_DROME  unnamed protein product                                 95.1    2e-21
G5EFF9_CAEEL  unnamed protein product                                 90.9    4e-19
G5EG28_CAEEL  unnamed protein product                                 90.1    6e-19


>Q4FKA6_TRYB2 unnamed protein product
Length=628

 Score = 103 bits (256),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 111/428 (26%), Positives = 174/428 (41%), Gaps = 95/428 (22%)

Query  194  QHLYGSGLKSECKVLAVYKD-----VHPAFIKLGVQYSNKTILGSNSRCLGLLNALRHLV  248
            +H+  S   S C +++   D     VH    +L +   +  ++G N+R   ++ A + L+
Sbjct  192  EHIDRSVTGSPCAIVSPRNDIDCEGVHYQVAELALMMESMMVVGGNARTFAMIEAFKALL  251

Query  249  DDLQTP--------PKQEFCRYLESVLKNCTSYLQNCRPFAVSMTNA----LRHFKLQLT  296
                T         P +EF    ES++K    +L   R  +  MTNA    +R     L+
Sbjct  252  KSSPTLSGSTVNHFPSKEF----ESLIKVNFDFLCRSRAPSAGMTNAKDSLVRRVVALLS  307

Query  297  QID------SNLKDNEKRAKLQD-----------------VIDIYINDDIRKAGDAISMK  333
            Q +       +L  + + A+L+                   +DI   D   K   AI  +
Sbjct  308  QREKARFSADDLFASLRSARLESSMCVQSTAVGRDRNETCFLDISPRDLALKVLGAIERE  367

Query  334  VNEKIKN------------GDIILTYGCSSLIRKILLEAHKD---GKKFEVVVIDGRPLF  378
            +   IK+             D IL +G SS +  ILL A  +     K +V+V+D  PL+
Sbjct  368  LQLSIKSIVEDRAEPHLSSNDTILVFGRSSTVELILLAAANNPRLASKPKVIVVDSAPLY  427

Query  379  EGREMARRLVEAGIKCTYVLINAVSYIMSSVTKVLLGAHALLTNGYVMSRIGTAQVALVA  438
            EGR +A RL  +G+  TY LI     +M   T+V +GA A+L NG V SR GTA V   A
Sbjct  428  EGRALATRLSCSGLDVTYGLITTCCTLMPRCTRVFIGAAAVLQNGDVFSRCGTAVVVSSA  487

Query  439  QAYNKPVLVCCETYKFSERVQTDSFVYN--------------EIDDPDKLSVM--GSSEK  482
            + + KPVL   E+ KF   V   +   N               I  P   S +  GS E 
Sbjct  488  KQFRKPVLCFSESIKFVPEVWLGNLGQNTRLTDMRQPHRGELRIRSPGNWSPLSHGSREL  547

Query  483  PSPLNNW--------------KDNSKLTPLN------LLYDVTPPDLVTAVVTEIAILPC  522
                  W              ++ S+L   +       LYD+TP   +  ++ E+  L  
Sbjct  548  MDVKKGWGQCNSGGLSGRGTNEEPSRLLQTDAPPSSGYLYDLTPAAYIDMIICEMGCLHT  607

Query  523  TSVPVVLR  530
            +++   LR
Sbjct  608  SAILAALR  615


>Q9VAD4_DROME unnamed protein product
Length=306

 Score = 95.5 bits (236),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 66/196 (34%), Positives = 101/196 (52%), Gaps = 16/196 (8%)

Query  330  ISMKVNEKIKNGDIILTYGCSSLIRKILLEAHKDGKKFEVVVIDGRPLFEGREMARRLVE  389
            I+ +    I +G  ILT+  S ++ K L+ A ++ K F V V  G     G EM + L  
Sbjct  118  IAQQAQRFITDGCRILTHSRSRVVLKALITASQNKKSFHVYVTQGGTGNSGEEMVKDLHA  177

Query  390  AGIKCTYVLINAVSYIMSSVTKVLLGAHALLTNGYVMSRIGTAQVALVAQAYNKPVLVCC  449
            AGI CT +L +A  Y+M SV  VL+GA A++ +G +++RIGT  + L A+   KP  V  
Sbjct  178  AGIDCTLILDSATGYVMESVDFVLVGAEAVVESGGIINRIGTYTMGLCAREMKKPFYVLA  237

Query  450  ETYKFSERVQTDSFVYNEIDDPDKLSVMGSSEKPSPLNNWKDNSKLTPLNLLYDVTPPDL  509
            E++KFS       +  N+ D P+        E      +  D SK+ P   L D TPP  
Sbjct  238  ESFKFSRL-----YPLNQRDLPN--------EYKYSRKHLNDVSKVHP---LVDYTPPVY  281

Query  510  VTAVVTEIAILPCTSV  525
            +T + T++  L  ++V
Sbjct  282  ITLLFTDLGRLTPSAV  297


>Q9GQ89_DROME unnamed protein product
Length=300

 Score = 95.1 bits (235),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 66/196 (34%), Positives = 101/196 (52%), Gaps = 16/196 (8%)

Query  330  ISMKVNEKIKNGDIILTYGCSSLIRKILLEAHKDGKKFEVVVIDGRPLFEGREMARRLVE  389
            I+ +    I +G  ILT+  S ++ K L+ A ++ K F V V  G     G EM + L  
Sbjct  112  IAQQAQRFITDGCRILTHSRSRVVLKALITASQNKKSFHVYVTQGGTGNSGEEMVKDLHA  171

Query  390  AGIKCTYVLINAVSYIMSSVTKVLLGAHALLTNGYVMSRIGTAQVALVAQAYNKPVLVCC  449
            AGI CT +L +A  Y+M SV  VL+GA A++ +G +++RIGT  + L A+   KP  V  
Sbjct  172  AGIDCTLILDSATGYVMESVDFVLVGAEAVVESGGIINRIGTYTMGLCAREMKKPFYVLA  231

Query  450  ETYKFSERVQTDSFVYNEIDDPDKLSVMGSSEKPSPLNNWKDNSKLTPLNLLYDVTPPDL  509
            E++KFS       +  N+ D P+        E      +  D SK+ P   L D TPP  
Sbjct  232  ESFKFSRL-----YPLNQRDLPN--------EYKYSRKHLNDVSKVHP---LVDYTPPVY  275

Query  510  VTAVVTEIAILPCTSV  525
            +T + T++  L  ++V
Sbjct  276  ITLLFTDLGRLTPSAV  291


>G5EFF9_CAEEL unnamed protein product
Length=529

 Score = 90.9 bits (224),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 81/334 (24%), Positives = 146/334 (44%), Gaps = 45/334 (13%)

Query  211  YKDVHPAFIKLGVQYSNKTILGSNSRCLGLLNALRHLVDDLQTPPKQE------FCRYLE  264
            +  +HPAF+ L  +   + I    + C+  + A +  + D     ++       F   L+
Sbjct  225  FVHIHPAFLTLMAKAELEKIPDVETVCIQFIAAFKEFLRDWTVEREKNNINASTFGHDLD  284

Query  265  SVLKNCTSYL-QNCR-PFAVSMTNALRHFKLQLTQID--SNLK-DNEKRAKLQDVIDIYI  319
              ++   +++ QN   P   ++ N +R  K  + +++  +N+K + E +  L+D + I  
Sbjct  285  LAIRPQLAHMTQNGHWPLPFALGNTVRLLKRTIKRLEESTNMKCEEELQVYLEDTLAI--  342

Query  320  NDDIRKAGDAISMKVNEKIKNGDIILTYGCSSLIRKILLEAHKDGKKFEVVVIDGRPLFE  379
              +   A  AIS  +  KI+    ++ +    ++  +LLEA +     ++ VID      
Sbjct  343  --NFCHAYKAISQLLVRKIQQFKKVVVFDWCPVVNHVLLEAKQQIPDMQLSVIDANSNGR  400

Query  380  GREMARRLVEAGIKCTYVLINAVSYIMSSVTKVLLGAHALLTNGYVMSRIGTAQVALVAQ  439
            G    +  V+ G    YV +   S+   +   ++LG  A+  NG V +R G   V L A 
Sbjct  401  GTRHVKSFVDQGYNVKYVTMKGASWASLASGVLILGCSAIFANGAVAARKGALAVVLCAN  460

Query  440  AYNKPVLVCCETYKFSERVQTDSFVYNEIDDPDKLSVMGSSEKPSPLNNWKDNSKLTPLN  499
             YN PV+V  E +KF ++ Q    VY       +++++G                     
Sbjct  461  HYNIPVIVVAEHFKFIDKGQ----VYQ------RVALLGRQN------------------  492

Query  500  LLYDVTPPDLVTAVVTEIAILPCTSVPVVLRINA  533
               +    DLVTAVVT++ IL  TS P VL+  A
Sbjct  493  --IECIQSDLVTAVVTDLRILGPTSAPAVLKAKA  524


>G5EG28_CAEEL unnamed protein product
Length=497

 Score = 90.1 bits (222),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 81/334 (24%), Positives = 146/334 (44%), Gaps = 45/334 (13%)

Query  211  YKDVHPAFIKLGVQYSNKTILGSNSRCLGLLNALRHLVDDLQTPPKQE------FCRYLE  264
            +  +HPAF+ L  +   + I    + C+  + A +  + D     ++       F   L+
Sbjct  193  FVHIHPAFLTLMAKAELEKIPDVETVCIQFIAAFKEFLRDWTVEREKNNINASTFGHDLD  252

Query  265  SVLKNCTSYL-QNCR-PFAVSMTNALRHFKLQLTQID--SNLK-DNEKRAKLQDVIDIYI  319
              ++   +++ QN   P   ++ N +R  K  + +++  +N+K + E +  L+D + I  
Sbjct  253  LAIRPQLAHMTQNGHWPLPFALGNTVRLLKRTIKRLEESTNMKCEEELQVYLEDTLAI--  310

Query  320  NDDIRKAGDAISMKVNEKIKNGDIILTYGCSSLIRKILLEAHKDGKKFEVVVIDGRPLFE  379
              +   A  AIS  +  KI+    ++ +    ++  +LLEA +     ++ VID      
Sbjct  311  --NFCHAYKAISQLLVRKIQQFKKVVVFDWCPVVNHVLLEAKQQIPDMQLSVIDANSNGR  368

Query  380  GREMARRLVEAGIKCTYVLINAVSYIMSSVTKVLLGAHALLTNGYVMSRIGTAQVALVAQ  439
            G    +  V+ G    YV +   S+   +   ++LG  A+  NG V +R G   V L A 
Sbjct  369  GTRHVKSFVDQGYNVKYVTMKGASWASLASGVLILGCSAIFANGAVAARKGALAVVLCAN  428

Query  440  AYNKPVLVCCETYKFSERVQTDSFVYNEIDDPDKLSVMGSSEKPSPLNNWKDNSKLTPLN  499
             YN PV+V  E +KF ++ Q    VY       +++++G                     
Sbjct  429  HYNIPVIVVAEHFKFIDKGQ----VYQ------RVALLGRQN------------------  460

Query  500  LLYDVTPPDLVTAVVTEIAILPCTSVPVVLRINA  533
               +    DLVTAVVT++ IL  TS P VL+  A
Sbjct  461  --IECIQSDLVTAVVTDLRILGPTSAPAVLKAKA  492



Lambda      K        H
   0.330    0.140    0.436 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4302909968


Query= XP_018560852.1 tRNA pseudouridine synthase A [Anoplophora
glabripennis]

Length=442
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q38BX3_TRYB2  unnamed protein product                                 54.3    9e-08
Q387U9_TRYB2  unnamed protein product                                 34.7    0.14 


>Q38BX3_TRYB2 unnamed protein product
Length=401

 Score = 54.3 bits (129),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 43/77 (56%), Gaps = 4/77 (5%)

Query  279  RNEVEFTVLKVQ--GQSFMMHQIRKMVGCLIAVVKGLASVDIIKDSF--QMEKVNVPRAP  334
            RN V   V++++  GQSF+ +QIRKM+G + ++       D ++D F  +  +   P  P
Sbjct  257  RNRVGLEVVRIELSGQSFLFNQIRKMIGTVASMCAAGLPPDYLRDHFLNKAVRCGTPMVP  316

Query  335  GLGLVLDYVHYDRYNNR  351
              GL L Y+ + RYN R
Sbjct  317  ANGLFLTYLDFQRYNYR  333


 Score = 46.6 bits (109),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 30/52 (58%), Gaps = 0/52 (0%)

Query  227  YRLGEEKLNTVNTILQNFVGTKNFHNYTSKKKPNDPSANRYIKLFDCEKPFV  278
            YR+  ++L     I + F GT ++HN+T   K +DPS+ RYI      +PFV
Sbjct  134  YRVTPQRLEHARNIFKLFEGTHSYHNFTPGGKASDPSSARYITSVTVSEPFV  185


>Q387U9_TRYB2 unnamed protein product
Length=579

 Score = 34.7 bits (78),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 41/85 (48%), Gaps = 11/85 (13%)

Query  278  VRNEVEFTVLKVQGQSFMMHQIRKMVGCLIAVVKGLASVDIIKDSFQ---------MEKV  328
            VR + E  +  V G+SF+ HQIR MV  L A   GL +   ++ + Q          ++ 
Sbjct  478  VRQDDEVLIWFV-GRSFLRHQIRNMVSVLKAAGHGLWNDLELQQALQSGFEPSRHRFKRE  536

Query  329  NVPRAPGLGLVLDYVHY-DRYNNRY  352
              P AP  GL L  V Y D++ + Y
Sbjct  537  RFPTAPAYGLTLWDVEYPDQHRDDY  561



Lambda      K        H
   0.330    0.140    0.436 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4302909968


Query= XP_018560853.1 zinc finger protein 622 [Anoplophora glabripennis]

Length=376
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q584Z4_TRYB2  unnamed protein product                                 115     8e-29
Q9VEF0_DROME  unnamed protein product                                 33.5    0.26 
Q585P3_TRYB2  unnamed protein product                                 33.1    0.35 
HAM_DROME  unnamed protein product                                    32.3    0.66 
VMS1_CAEEL  unnamed protein product                                   32.3    0.76 


>Q584Z4_TRYB2 unnamed protein product
Length=366

 Score = 115 bits (288),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 81/253 (32%), Positives = 116/253 (46%), Gaps = 22/253 (9%)

Query  13   CITCRVAFKDADLQRQHYKTDWHRYNLKRKVAELPPVTSEEFQKRVYNQRNADEISKQDK  72
            C  C VAF   +  R+HY++D+H +N++ +V    PVT++E+ K +      D  +    
Sbjct  8    CGACGVAFDSIEASRKHYQSDFHVHNVRMRVEGKRPVTAQEY-KHMRIAEGIDVDNDGGP  66

Query  73   SVYCSSCHKSFGNQNAFDNHLNSKKH---KENEKHNKSEDGNS-----------VSSYII  118
            S  C  C K+F        H+ S  H   KE     +  D  S           V  +  
Sbjct  67   SFACKLCKKTFHCVQTLQAHVRSTAHLIKKEQRILARDSDAASALTSTSLGSAAVGLHRR  126

Query  119  ENTPQKPEISEGESDVEEVDSDEWDDATENPINNNDCLFCMHHSHNFIKNLEHMTIVHSF  178
             N  +   +SEG    +EV     +   E  ++   C  C   S N   NLEH+  VH F
Sbjct  127  HNAKRPKALSEGTKKTKEVKVQPEE--REEDVSEVRCFACGALSDNVEANLEHLFNVHEF  184

Query  179  FIPDIEYCTDLNGLLRYLGEKISEGFMCLWCNEKGKTFHSAEAARQHMLDKGHCKMIHEG  238
             IP  E CTD+ GLL Y+  K + G +CL C EK ++F S EA R HM +K H ++I   
Sbjct  185  TIPLQEKCTDVAGLLSYVARK-TNGLLCLVCGEKTRSFASLEALRAHMREKNHDRII---  240

Query  239  LALAEYADFYDYS  251
                EY +FY  S
Sbjct  241  -LGPEYDEFYSIS  252


>Q9VEF0_DROME unnamed protein product
Length=430

 Score = 33.5 bits (75),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 4/50 (8%)

Query  9    DSFTCITCRVAFKDADLQRQHYKTDWHRYNLKRKVAELPPVTSEEFQKRV  58
            D   C+TC   FK+A    +HY T +HR    ++V  L     EEFQ  V
Sbjct  320  DVHICLTCNKEFKEAQFLHRHYSTKYHR----KRVNLLVNGPKEEFQSEV  365


>Q585P3_TRYB2 unnamed protein product
Length=557

 Score = 33.1 bits (74),  Expect = 0.35, Method: Compositional matrix adjust.
 Identities = 14/37 (38%), Positives = 19/37 (51%), Gaps = 0/37 (0%)

Query  69   KQDKSVYCSSCHKSFGNQNAFDNHLNSKKHKENEKHN  105
            K   S  C+ C K+F +  A D H NSK  ++ E  N
Sbjct  362  KTVSSFVCTVCQKAFASAAALDGHFNSKHAEQGEAQN  398


>HAM_DROME unnamed protein product
Length=990

 Score = 32.3 bits (72),  Expect = 0.66, Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 44/100 (44%), Gaps = 11/100 (11%)

Query  7    VKDSFTCITCRVAF-KDADLQRQHYKTDWHRYNLKRKVAELPPVTSEEFQKRVYNQRNAD  65
             KD ++C  C   F + A+L R H +T         K  +     S   Q+ V N     
Sbjct  813  TKDRYSCKFCGKVFPRSANLTR-HLRTHTGEQPYPCKYCDRAFSISSNLQRHVRN-----  866

Query  66   EISKQDKSVYCSSCHKSFGNQNAFDNHLNSKKHKENEKHN  105
             I  +++   C  C +SFG Q   D H+  KKH E+E +N
Sbjct  867  -IHNKERPFRCELCDRSFGQQTNLDRHV--KKH-ESEGNN  902


>VMS1_CAEEL unnamed protein product
Length=618

 Score = 32.3 bits (72),  Expect = 0.76, Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query  8    KDSFTCITCR--VAFKDADLQRQHYKTDWHRYNLKRKVAELPPVTSEEFQ  55
            +DS  C TC   V F D  +  +HY++ +HR N  RK   +   T E+F+
Sbjct  56   EDSDQCTTCNCPVDFGDRAVLLEHYQSLFHRTNTLRKARNMTVYTEEDFE  105



Lambda      K        H
   0.330    0.140    0.436 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4302909968


Query= XP_018560854.1 G patch domain-containing protein 2 isoform X1
[Anoplophora glabripennis]

Length=373
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

NIPB_DROME  unnamed protein product                                   30.8    2.1  
Q586P1_TRYB2  unnamed protein product                                 30.0    3.6  
Q384L0_TRYB2  unnamed protein product                                 29.6    4.3  
HM23_CAEEL  unnamed protein product                                   29.6    4.5  
TNKS1_CAEEL  unnamed protein product                                  28.9    9.6  


>NIPB_DROME unnamed protein product
Length=2077

 Score = 30.8 bits (68),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 25/74 (34%), Positives = 34/74 (46%), Gaps = 10/74 (14%)

Query  25    NGGKWGMRRRTRSAGNLHLYLNR--PGDHHSDESSSSNSEMRTDKHRNKLVSFHQSDSDD  82
             N GK G+  R     N     NR   GD+     S S  E  TD ++ ++   H  DS+D
Sbjct  1011  NDGKKGLAFRKSKIRN-----NRRTNGDYLDTSDSGSCDESDTDTNKKRI---HCVDSND  1062

Query  83    MSLSIAVAKALNQR  96
               L+I + KAL  R
Sbjct  1063  FELNINIYKALEAR  1076


>Q586P1_TRYB2 unnamed protein product
Length=851

 Score = 30.0 bits (66),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 20/69 (29%), Positives = 32/69 (46%), Gaps = 6/69 (9%)

Query  206  GLAPDDPNSMETQSIDDNCDIASESS-ISWSGGEGHEGDDELTDWAPSMDNPSIIDQSPW  264
             + P DP++  T S+D    + S +S +S    EGHE      D+ P  D P ++  +  
Sbjct  148  AMNPKDPSTFATASLDCTVKVWSLNSPVSNFQLEGHEDGVNCVDYYPGGDKPYLLSGA--  205

Query  265  NDTDPREIR  273
               D R +R
Sbjct  206  ---DDRTVR  211


>Q384L0_TRYB2 unnamed protein product
Length=303

 Score = 29.6 bits (65),  Expect = 4.3, Method: Compositional matrix adjust.
 Identities = 28/88 (32%), Positives = 39/88 (44%), Gaps = 14/88 (16%)

Query  166  KRKRSQRLEIVDNGRSIRHTTKIKPLHQSIVDKIEKFCHPGLAPDDPNSMETQSIDDNCD  225
            KR+ + RL      +    T    P+   I DKI   CH GL+PD  +  + + I+  CD
Sbjct  137  KRRYNIRL-----WKVFTDTFNCLPVACIIDDKIFC-CHGGLSPDLQSMEQIKKIERPCD  190

Query  226  IASESSIS---WSGGEGHEGDDELTDWA  250
            +A    I    WS  E  EG   L+ W 
Sbjct  191  VADTGLICDLLWSDPE--EG---LSGWG  213


>HM23_CAEEL unnamed protein product
Length=305

 Score = 29.6 bits (65),  Expect = 4.5, Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 2/35 (6%)

Query  300  LQDTTKSELRIYGAEREKLGQLAAL--YSLDLWFE  332
            L+D  K ++ + GAERE L Q   L    + +WF+
Sbjct  226  LEDMFKGQMYVVGAERENLAQRLGLSPSQVRIWFQ  260


>TNKS1_CAEEL unnamed protein product
Length=2276

 Score = 28.9 bits (63),  Expect = 9.6, Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 1/47 (2%)

Query  169   RSQRLEIVD-NGRSIRHTTKIKPLHQSIVDKIEKFCHPGLAPDDPNS  214
             R +++EI D NG +I H   IK     ++  I K CH  L   D N+
Sbjct  1161  RPEQIEIADVNGNTILHLAAIKNSTICLMTLIRKKCHVDLKNKDGNT  1207



Lambda      K        H
   0.330    0.140    0.436 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4302909968


Query= XP_018560855.1 G patch domain-containing protein 2 isoform X2
[Anoplophora glabripennis]

Length=359
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

NIPB_DROME  unnamed protein product                                   30.8    2.1  
Q586P1_TRYB2  unnamed protein product                                 30.0    3.3  
HM23_CAEEL  unnamed protein product                                   29.6    4.2  
Q384L0_TRYB2  unnamed protein product                                 29.3    5.0  
ELYS_DROME  unnamed protein product                                   29.3    7.1  


>NIPB_DROME unnamed protein product
Length=2077

 Score = 30.8 bits (68),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 25/74 (34%), Positives = 34/74 (46%), Gaps = 10/74 (14%)

Query  25    NGGKWGMRRRTRSAGNLHLYLNR--PGDHHSDESSSSNSEMRTDKHRNKLVSFHQSDSDD  82
             N GK G+  R     N     NR   GD+     S S  E  TD ++ ++   H  DS+D
Sbjct  1011  NDGKKGLAFRKSKIRN-----NRRTNGDYLDTSDSGSCDESDTDTNKKRI---HCVDSND  1062

Query  83    MSLSIAVAKALNQR  96
               L+I + KAL  R
Sbjct  1063  FELNINIYKALEAR  1076


>Q586P1_TRYB2 unnamed protein product
Length=851

 Score = 30.0 bits (66),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 20/69 (29%), Positives = 32/69 (46%), Gaps = 6/69 (9%)

Query  192  GLAPDDPNSMETQSIDDNCDIASESS-ISWSGGEGHEGDDELTDWAPSMDNPSIIDQSPW  250
             + P DP++  T S+D    + S +S +S    EGHE      D+ P  D P ++  +  
Sbjct  148  AMNPKDPSTFATASLDCTVKVWSLNSPVSNFQLEGHEDGVNCVDYYPGGDKPYLLSGA--  205

Query  251  NDTDPREIR  259
               D R +R
Sbjct  206  ---DDRTVR  211


>HM23_CAEEL unnamed protein product
Length=305

 Score = 29.6 bits (65),  Expect = 4.2, Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 2/35 (6%)

Query  286  LQDTTKSELRIYGAEREKLGQLAAL--YSLDLWFE  318
            L+D  K ++ + GAERE L Q   L    + +WF+
Sbjct  226  LEDMFKGQMYVVGAERENLAQRLGLSPSQVRIWFQ  260


>Q384L0_TRYB2 unnamed protein product
Length=303

 Score = 29.3 bits (64),  Expect = 5.0, Method: Compositional matrix adjust.
 Identities = 28/88 (32%), Positives = 39/88 (44%), Gaps = 14/88 (16%)

Query  152  KRKRSQRLEIVDNGRSIRHTTKIKPLHQSIVDKIEKFCHPGLAPDDPNSMETQSIDDNCD  211
            KR+ + RL      +    T    P+   I DKI   CH GL+PD  +  + + I+  CD
Sbjct  137  KRRYNIRL-----WKVFTDTFNCLPVACIIDDKIFC-CHGGLSPDLQSMEQIKKIERPCD  190

Query  212  IASESSIS---WSGGEGHEGDDELTDWA  236
            +A    I    WS  E  EG   L+ W 
Sbjct  191  VADTGLICDLLWSDPE--EG---LSGWG  213


>ELYS_DROME unnamed protein product
Length=2111

 Score = 29.3 bits (64),  Expect = 7.1, Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 21/34 (62%), Gaps = 0/34 (0%)

Query  110   RGVSHSLESDSVNEHSPARPNLRRKRKLKRMSID  143
             RG+ H    + ++EHSP+  +L R R   R+S+D
Sbjct  1919  RGLQHKYLLEVIDEHSPSDLSLPRTRSRTRLSVD  1952



Lambda      K        H
   0.330    0.140    0.436 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4302909968


Query= XP_018560856.1 probable DNA-directed RNA polymerases I and III
subunit RPAC2 [Anoplophora glabripennis]

Length=99
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RPAC2_DROME  unnamed protein product                                  120     5e-37
Q384D9_TRYB2  unnamed protein product                                 75.5    9e-19
Q386T9_TRYB2  unnamed protein product                                 56.6    2e-11
RUXG_DROME  unnamed protein product                                   27.7    0.63 
O02053_CAEEL  unnamed protein product                                 28.5    0.84 


>RPAC2_DROME unnamed protein product
Length=105

 Score = 120 bits (302),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 72/94 (77%), Gaps = 2/94 (2%)

Query  3   IAQFAETESSSDSSKSKTFVFKDEGHTLGNALRCVISNYPDVQFCGYTVPHPAESKMHFR  62
           +A+ A  E + + S+  TFVF +EGHTLGNAL+ +I+ YP+V FCGYT+PHP E K+HFR
Sbjct  4   LAELAGDEKNGEGSR--TFVFTNEGHTLGNALKTIIARYPEVDFCGYTIPHPTEQKLHFR  61

Query  63  IQMHKGKAVDALKRGLEDLVNVCDNTLEKFEEEL  96
           IQ  + +A+D LKRGLEDL  +CD+T+  FE+E+
Sbjct  62  IQSRRDRAIDILKRGLEDLEGLCDHTIVTFEKEM  95


>Q384D9_TRYB2 unnamed protein product
Length=134

 Score = 75.5 bits (184),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 47/80 (59%), Gaps = 1/80 (1%)

Query  13   SDSSKSKTFVFKDEGHTLGNALRCVISNYPDVQFCGYTVPHPAESKMHFRIQMHKGKAVD  72
            +DS  + T  F  E HTLGN LR VI   P V   GY +PHP E+KM   +Q  +  AV+
Sbjct  41   ADSESAATVTFSHEDHTLGNPLRHVIMEDPSVTSAGYAIPHPLEAKMQLHVQSSE-YAVE  99

Query  73   ALKRGLEDLVNVCDNTLEKF  92
             + +GLE L  +CD TL+ F
Sbjct  100  TVAKGLERLAAICDETLKSF  119


>Q386T9_TRYB2 unnamed protein product
Length=132

 Score = 56.6 bits (135),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 40/87 (46%), Gaps = 3/87 (3%)

Query  10   ESSSDSSKSKTFVFKDEGHTLGNALRCVISNYPDVQFCGYTVPHPAESKMHFRIQMHK--  67
            E SS    S  F    E HTL N LR  +   P V   GY VPHP + ++  R+Q     
Sbjct  31   EVSSKMPNSSLFKLDREDHTLANLLRMRLHENPLVHIAGYRVPHPTQHRVELRVQTSSDG  90

Query  68   -GKAVDALKRGLEDLVNVCDNTLEKFE  93
             GK +   K  L + V  C   LE+FE
Sbjct  91   TGKPIPTPKEALLEAVGSCMKDLEEFE  117


>RUXG_DROME unnamed protein product
Length=76

 Score = 27.7 bits (60),  Expect = 0.63, Method: Compositional matrix adjust.
 Identities = 15/52 (29%), Positives = 30/52 (58%), Gaps = 5/52 (10%)

Query  53  HPAESKMHF----RIQMHKGKAVDALKRGLEDLVNVC-DNTLEKFEEELQNQ  99
           HP E K +      ++++ G+AV  + RG +  +NV  D+T+E+ ++  +N 
Sbjct  5   HPPEVKKYMDKRMMLKLNGGRAVTGILRGFDPFMNVVLDDTVEECKDNTKNN  56


>O02053_CAEEL unnamed protein product
Length=390

 Score = 28.5 bits (62),  Expect = 0.84, Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 22/35 (63%), Gaps = 2/35 (6%)

Query  66  HKGKAVDALKRGLEDLVN--VCDNTLEKFEEELQN  98
            +G+ +DALKR +E++V        L++  EELQN
Sbjct  33  RRGRKIDALKRNVEEVVTEETARLKLDQLLEELQN  67



Lambda      K        H
   0.330    0.140    0.436 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4302909968


Query= XP_018560857.1 cytochrome b-c1 complex subunit 8 [Anoplophora
glabripennis]

Length=82
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ABCGO_DICDI  unnamed protein product                                  29.6    0.20 
C6KT66_PLAF7  unnamed protein product                                 29.3    0.29 
Q9W499_DROME  unnamed protein product                                 25.4    4.9  
Q9VDL7_DROME  unnamed protein product                                 25.8    4.9  
Q8IN53_DROME  unnamed protein product                                 25.0    7.6  


>ABCGO_DICDI unnamed protein product
Length=1159

 Score = 29.6 bits (65),  Expect = 0.20, Method: Composition-based stats.
 Identities = 10/17 (59%), Positives = 15/17 (88%), Gaps = 0/17 (0%)

Query  62   QIEKEHYRLMLKNPADF  78
            + E+++YR+ LKNPADF
Sbjct  708  EFEQQNYRMHLKNPADF  724


>C6KT66_PLAF7 unnamed protein product
Length=527

 Score = 29.3 bits (64),  Expect = 0.29, Method: Composition-based stats.
 Identities = 11/26 (42%), Positives = 18/26 (69%), Gaps = 0/26 (0%)

Query  51   PPIAIGYLVYDQIEKEHYRLMLKNPA  76
            PPI IG  ++D++E E  +++L  PA
Sbjct  309  PPIGIGEPIFDKLEAELAKMILSIPA  334


>Q9W499_DROME unnamed protein product
Length=123

 Score = 25.4 bits (54),  Expect = 4.9, Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 25/56 (45%), Gaps = 8/56 (14%)

Query  31  ITHGVPNTIRRIGESILYVVPPIAIGYLVYDQIEKEHYRLMLKN----PADFENDK  82
           +T G P+ +      I  V   IA  Y+V  Q +KE+ R + KN    P D    K
Sbjct  36  VTGGAPSKL----SKIRVVRKAIARVYIVMHQKQKENLRKVFKNKKYKPLDLRKKK  87


>Q9VDL7_DROME unnamed protein product
Length=365

 Score = 25.8 bits (55),  Expect = 4.9, Method: Composition-based stats.
 Identities = 16/70 (23%), Positives = 34/70 (49%), Gaps = 3/70 (4%)

Query  8    LFKLRGIITYRLSPFE--QKAFAGIITHGVPNTI-RRIGESILYVVPPIAIGYLVYDQIE  64
            L + R  +T R + +   ++ F  I     P T+ R    ++L V+P     +  Y+ ++
Sbjct  191  LARARMAVTDRYTGYRTLRQVFTKIWVEEGPRTLFRGYWATVLGVIPYAGTSFFTYETLK  250

Query  65   KEHYRLMLKN  74
            +E+Y ++  N
Sbjct  251  REYYEVVGNN  260


>Q8IN53_DROME unnamed protein product
Length=290

 Score = 25.0 bits (53),  Expect = 7.6, Method: Composition-based stats.
 Identities = 16/70 (23%), Positives = 34/70 (49%), Gaps = 3/70 (4%)

Query  8    LFKLRGIITYRLSPFE--QKAFAGIITHGVPNTI-RRIGESILYVVPPIAIGYLVYDQIE  64
            L + R  +T R + +   ++ F  I     P T+ R    ++L V+P     +  Y+ ++
Sbjct  116  LARARMAVTDRYTGYRTLRQVFTKIWVEEGPRTLFRGYWATVLGVIPYAGTSFFTYETLK  175

Query  65   KEHYRLMLKN  74
            +E+Y ++  N
Sbjct  176  REYYEVVGNN  185



Lambda      K        H
   0.330    0.140    0.436 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4302909968


Query= XP_018560858.1 ecdysone receptor isoform X2 [Anoplophora
glabripennis]

Length=565
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ECR_DROME  unnamed protein product                                    554     0.0   
ECR_HELVI  unnamed protein product                                    515     4e-178
HR38_DROME  unnamed protein product                                   164     1e-42 
E75BC_DROME  unnamed protein product                                  158     1e-40 
E75BB_DROME  unnamed protein product                                  157     4e-40 


>ECR_DROME unnamed protein product
Length=878

 Score = 554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/426 (65%), Positives = 321/426 (75%), Gaps = 33/426 (8%)

Query  169  GREDLSPPSSLNGYSA-DSCDAKK-KKGPTPRQQEELCLVCGDRASGYHYNALTCEGCKG  226
            GR+DLSP SSLNGYSA +SCDAKK KKGP PR QEELCLVCGDRASGYHYNALTCEGCKG
Sbjct  227  GRDDLSPSSSLNGYSANESCDAKKSKKGPAPRVQEELCLVCGDRASGYHYNALTCEGCKG  286

Query  227  FFRRSITKNAVYQCKYGNNCEIDMYMRRKCQECRLKKCLSVGMRPECVVPEVQCAVKRKE  286
            FFRRS+TK+AVY CK+G  CE+DMYMRRKCQECRLKKCL+VGMRPECVVPE QCA+KR+E
Sbjct  287  FFRRSVTKSAVYCCKFGRACEMDMYMRRKCQECRLKKCLAVGMRPECVVPENQCAMKRRE  346

Query  287  KKAQKEKDK----PNS--------TTNGSPEMIKLE---------------PELSDS--E  317
            KKAQKEKDK    P+S         + G  + +K E               P L D    
Sbjct  347  KKAQKEKDKMTTSPSSQHGGNGSLASGGGQDFVKKEILDLMTCEPPQHATIPLLPDEILA  406

Query  318  KTLTNGVKPISPEQEELIHRLVYFQNEYEHPSEEDVKRIINQPMEGEDQCDIRFRHITEI  377
            K     +  ++  Q  +I++L+++Q+ YE PSEED++RI++QP E E Q D+ FRHITEI
Sbjct  407  KCQARNIPSLTYNQLAVIYKLIWYQDGYEQPSEEDLRRIMSQPDENESQTDVSFRHITEI  466

Query  378  TILTVQLIVEFAKRLPGFDKLLREDQIALLKACSSEVMMFRMARRYDVQSDSILFVNNQP  437
            TILTVQLIVEFAK LP F K+ +EDQI LLKACSSEVMM RMARRYD  SDSI F NN+ 
Sbjct  467  TILTVQLIVEFAKGLPAFTKIPQEDQITLLKACSSEVMMLRMARRYDHSSDSIFFANNRS  526

Query  438  YSRDSYNLAGMGETIEDLLHFCRTMYSMKVDNAEYALLTAIVIFSERPALIEGWKVEKIQ  497
            Y+RDSY +AGM + IEDLLHFCR M+SMKVDN EYALLTAIVIFS+RP L +   VE IQ
Sbjct  527  YTRDSYKMAGMADNIEDLLHFCRQMFSMKVDNVEYALLTAIVIFSDRPGLEKAQLVEAIQ  586

Query  498  EIYLEALRAYVDNRR--KPRPGTIFAKLLSVLTELRTLGNQNSEMCFSLKLKNKKLPPFL  555
              Y++ LR Y+ NR          +AKLLS+LTELRTLGNQN+EMCFSLKLKN+KLP FL
Sbjct  587  SYYIDTLRIYILNRHCGDSMSLVFYAKLLSILTELRTLGNQNAEMCFSLKLKNRKLPKFL  646

Query  556  AEIWDV  561
             EIWDV
Sbjct  647  EEIWDV  652


>ECR_HELVI unnamed protein product
Length=576

 Score = 515 bits (1326),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 262/420 (62%), Positives = 310/420 (74%), Gaps = 28/420 (7%)

Query  169  GREDLSPPSSLNGYSADSCDAKKKKGPTPRQQEELCLVCGDRASGYHYNALTCEGCKGFF  228
            GRE+LSP SS+NG S D    ++KKGP PRQQEELCLVCGDRASGYHYNALTCEGCKGFF
Sbjct  128  GREELSPASSVNGCSTDGEARRQKKGPAPRQQEELCLVCGDRASGYHYNALTCEGCKGFF  187

Query  229  RRSITKNAVYQCKYGNNCEIDMYMRRKCQECRLKKCLSVGMRPECVVPEVQCAVKRKEKK  288
            RRS+TKNAVY CK+G+ CE+D+YMRRKCQECRLKKCL+VGMRPECVVPE QCA+KRKEKK
Sbjct  188  RRSVTKNAVYICKFGHACEMDIYMRRKCQECRLKKCLAVGMRPECVVPENQCAMKRKEKK  247

Query  289  AQKEKDK-PNSTT---NGSPEMIKLEPELSDSEKTL---------------------TNG  323
            AQ+EKDK P STT   +  P +++ +P   ++ + L                        
Sbjct  248  AQREKDKLPVSTTTVDDHMPPIMQCDPPPPEAARILECVQHEVVPRFLNEKLMEQNRLKN  307

Query  324  VKPISPEQEELIHRLVYFQNEYEHPSEEDVKRIINQPMEGEDQCDIRFRHITEITILTVQ  383
            V P++  Q+ LI RLV++Q  YE PSEED+KR + Q  E ++  D+ FR ITE+TILTVQ
Sbjct  308  VPPLTANQKSLIARLVWYQEGYEQPSEEDLKR-VTQSDEDDEDSDMPFRQITEMTILTVQ  366

Query  384  LIVEFAKRLPGFDKLLREDQIALLKACSSEVMMFRMARRYDVQSDSILFVNNQPYSRDSY  443
            LIVEFAK LPGF K+ + DQI LLKACSSEVMM R+ARRYD  +DS+LF NNQ Y+RD+Y
Sbjct  367  LIVEFAKGLPGFAKISQSDQITLLKACSSEVMMLRVARRYDAATDSVLFANNQAYTRDNY  426

Query  444  NLAGMGETIEDLLHFCRTMYSMKVDNAEYALLTAIVIFSERPALIEGWKVEKIQEIYLEA  503
              AGM   IEDLLHFCR MYSM +DN  YALLTAIVIFS+RP L +   VE+IQ  YL  
Sbjct  427  RKAGMAYVIEDLLHFCRCMYSMMMDNVHYALLTAIVIFSDRPGLEQPLLVEEIQRYYLNT  486

Query  504  LRAYV--DNRRKPRPGTIFAKLLSVLTELRTLGNQNSEMCFSLKLKNKKLPPFLAEIWDV  561
            LR Y+   N   PR   IF ++L +LTE+RTLG QNS MC SLKLKN+KLPPFL EIWDV
Sbjct  487  LRVYILNQNSASPRGAVIFGEILGILTEIRTLGMQNSNMCISLKLKNRKLPPFLEEIWDV  546


>HR38_DROME unnamed protein product
Length=1073

 Score = 164 bits (414),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 110/357 (31%), Positives = 172/357 (48%), Gaps = 35/357 (10%)

Query  202   ELCLVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYQCKYGNNCEIDMYMRRKCQECRL  261
             +LC VCGD A+  HY   TCEGCKGFF+R++ K + Y C    NC +D   R +CQ CR 
Sbjct  742   QLCAVCGDTAACQHYGVRTCEGCKGFFKRTVQKGSKYVCLADKNCPVDKRRRNRCQFCRF  801

Query  262   KKCLSVGMRPECVVPEVQCAVKRKEKKAQKEKDKPNSTTNGSPEMIKLEPELSDSEKTLT  321
             +KCL VGM  E V         R+ +   K K    S  +    +I            L 
Sbjct  802   QKCLVVGMVKEVV--RTDSLKGRRGRLPSKPKSPQESPPSPPISLI----------TALV  849

Query  322   NGVKPISPEQEELIHRLVYFQNEYEHPSEEDVKRIINQPMEGEDQCDIRFRHITEITILT  381
                   +P+                 PS  D      Q M   D+    ++ +T     +
Sbjct  850   RSHVDTTPD-----------------PSCLDYSHYEEQSMSEADKVQQFYQLLTS----S  888

Query  382   VQLIVEFAKRLPGFDKLLREDQIALLKACSSEVMMFRMARRYDVQSDSILFVNNQPYSRD  441
             V +I +FA+++PG+  LL EDQ  L ++ S E+ + R+A R  +    ++F N     R 
Sbjct  889   VDVIKQFAEKIPGYFDLLPEDQELLFQSASLELFVLRLAYRARIDDTKLIFCNGTVLHR-  947

Query  442   SYNLAGMGETIEDLLHFCRTMYSMKVDNAEYALLTAIVIFSERPALIEGWKVEKIQEIYL  501
             +  L   GE + D++ F R+++++++D + +A L A+ + +ER  L E  KVE++Q   +
Sbjct  948   TQCLRSFGEWLNDIMEFSRSLHNLEIDISAFACLCALTLITERHGLREPKKVEQLQMKII  1007

Query  502   EALRAYVD-NRRKPRPGTIFAKLLSVLTELRTLGNQNSEMCFSLKLKNKKLPPFLAE  557
              +LR +V  N    +    F++LL  L ELR+L  Q  +  F LKL++    P L E
Sbjct  1008  GSLRDHVTYNAEAQKKQHYFSRLLGKLPELRSLSVQGLQRIFYLKLEDLVPAPALIE  1064


>E75BC_DROME unnamed protein product
Length=1199

 Score = 158 bits (399),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 112/375 (30%), Positives = 181/375 (48%), Gaps = 36/375 (10%)

Query  203  LCLVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYQ-CKYGNNCEIDMYMRRKCQECRL  261
            LC VCGD+ASG+HY   +CEGCKGFFRRSI +   Y+ C     C I    R +CQ CRL
Sbjct  244  LCRVCGDKASGFHYGVHSCEGCKGFFRRSIQQKIQYRPCTKNQQCSILRINRNRCQYCRL  303

Query  262  KKCLSVGMRPECV----VPEVQCAVKRKEKKAQKEKDKPNSTTNGSPEMIKLEPELSDSE  317
            KKC++VGM  + V    VP        K +KA+       ST N   +   L  EL D  
Sbjct  304  KKCIAVGMSRDAVRFGRVP--------KREKARILAAMQQSTQNRG-QQRALATELDDQP  354

Query  318  KTLTNGVKP------ISPEQEELIHRLVYFQNEYEHPSEEDVKRIINQPMEGEDQCDIRF  371
            + L   ++        + E+   + +       Y  P+           ++ E +   RF
Sbjct  355  RLLAAVLRAHLETCEFTKEKVSAMRQRARDCPSYSMPTLLACPLNPAPELQSEQEFSQRF  414

Query  372  RHITEITILTVQLIVEFAKRLPGFDKLLREDQIALLKACSSEVMMFRMARRYDVQSDSIL  431
             H+       ++ +++FA  +PGF  L ++D+  LLKA   + +  R+   +D   +SI+
Sbjct  415  AHV-------IRGVIDFAGMIPGFQLLTQDDKFTLLKAGLFDALFVRLICMFDSSINSII  467

Query  432  FVNNQPYSRDSY-NLAGMGETIEDLLHFCRTMYSMKVDNAEYALLTAIVIFS-ERPALIE  489
             +N Q   RD+  N A     ++   +F   M SM + +AE  L  AIV+ + +RP L  
Sbjct  468  CLNGQVMRRDAIQNGANARFLVDSTFNFAERMNSMNLTDAEIGLFCAIVLITPDRPGL--  525

Query  490  GWKVEKIQEIY--LEALRAYVDNRRKPRPGTIFAKLLSVLTELRTLGNQNSEMCFSLKLK  547
               +E I+++Y  L+    Y+  + +P      AKLL  + +LRTL   ++E     + +
Sbjct  526  -RNLELIEKMYSRLKGCLQYIVAQNRPDQPEFLAKLLETMPDLRTLSTLHTEKLVVFRTE  584

Query  548  NKKLPPFLAEIWDVD  562
            +K+L     ++W ++
Sbjct  585  HKEL--LRQQMWSME  597


>E75BB_DROME unnamed protein product
Length=1412

 Score = 157 bits (396),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 112/375 (30%), Positives = 181/375 (48%), Gaps = 36/375 (10%)

Query  203  LCLVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYQ-CKYGNNCEIDMYMRRKCQECRL  261
            LC VCGD+ASG+HY   +CEGCKGFFRRSI +   Y+ C     C I    R +CQ CRL
Sbjct  457  LCRVCGDKASGFHYGVHSCEGCKGFFRRSIQQKIQYRPCTKNQQCSILRINRNRCQYCRL  516

Query  262  KKCLSVGMRPECV----VPEVQCAVKRKEKKAQKEKDKPNSTTNGSPEMIKLEPELSDSE  317
            KKC++VGM  + V    VP        K +KA+       ST N   +   L  EL D  
Sbjct  517  KKCIAVGMSRDAVRFGRVP--------KREKARILAAMQQSTQNRG-QQRALATELDDQP  567

Query  318  KTLTNGVKP------ISPEQEELIHRLVYFQNEYEHPSEEDVKRIINQPMEGEDQCDIRF  371
            + L   ++        + E+   + +       Y  P+           ++ E +   RF
Sbjct  568  RLLAAVLRAHLETCEFTKEKVSAMRQRARDCPSYSMPTLLACPLNPAPELQSEQEFSQRF  627

Query  372  RHITEITILTVQLIVEFAKRLPGFDKLLREDQIALLKACSSEVMMFRMARRYDVQSDSIL  431
             H+       ++ +++FA  +PGF  L ++D+  LLKA   + +  R+   +D   +SI+
Sbjct  628  AHV-------IRGVIDFAGMIPGFQLLTQDDKFTLLKAGLFDALFVRLICMFDSSINSII  680

Query  432  FVNNQPYSRDSY-NLAGMGETIEDLLHFCRTMYSMKVDNAEYALLTAIVIFS-ERPALIE  489
             +N Q   RD+  N A     ++   +F   M SM + +AE  L  AIV+ + +RP L  
Sbjct  681  CLNGQVMRRDAIQNGANARFLVDSTFNFAERMNSMNLTDAEIGLFCAIVLITPDRPGL--  738

Query  490  GWKVEKIQEIY--LEALRAYVDNRRKPRPGTIFAKLLSVLTELRTLGNQNSEMCFSLKLK  547
               +E I+++Y  L+    Y+  + +P      AKLL  + +LRTL   ++E     + +
Sbjct  739  -RNLELIEKMYSRLKGCLQYIVAQNRPDQPEFLAKLLETMPDLRTLSTLHTEKLVVFRTE  797

Query  548  NKKLPPFLAEIWDVD  562
            +K+L     ++W ++
Sbjct  798  HKEL--LRQQMWSME  810



Lambda      K        H
   0.330    0.140    0.436 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4302909968


Query= XP_018560859.1 post-GPI attachment to proteins factor 2-like
[Anoplophora glabripennis]

Length=253
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A7T1N0_NEMVE  unnamed protein product                                 33.9    0.15 


>A7T1N0_NEMVE unnamed protein product
Length=1551

 Score = 33.9 bits (76),  Expect = 0.15, Method: Composition-based stats.
 Identities = 38/130 (29%), Positives = 50/130 (38%), Gaps = 25/130 (19%)

Query  19   YFRIPFEKFALITVCFPLLAFVFCIGYSVLFNFESATYTHCQVYNMLPSISAA--IGNFS  76
            ++  PF KF    V +  LAF+F   Y VLFNF              P    A  +G   
Sbjct  833  FYSAPFSKFVGNVVGY--LAFIFLYAYVVLFNF--------------PRFDPAKTLGGIH  876

Query  77   PQREI---WQGAIAIHAAPRFYIA-VEYLHHHFSVLFPQDIWIGQIAFFLNVVENIALIT  132
            P   +   W   I I    +      +Y+    SV F  D W     F L V   I  I 
Sbjct  877  PTEIVLYFWVFTILIEEIRQLAAKPPKYIKDKVSVYF-SDTWNFVDIFSLTVF--IIAII  933

Query  133  LSFFTSSKFY  142
            L FFT+S+ +
Sbjct  934  LRFFTNSRIF  943



Lambda      K        H
   0.330    0.140    0.436 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4302909968


Query= XP_018560860.1 40S ribosomal protein S19 [Anoplophora glabripennis]

Length=154
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RS19A_DROME  unnamed protein product                                  217     2e-73
Q8IFP2_PLAF7  unnamed protein product                                 110     5e-31
G5ECZ8_CAEEL  unnamed protein product                                 31.6    0.23 
Q9NH88_DROME  unnamed protein product                                 29.3    1.7  
Q9NFR7_DROME  unnamed protein product                                 29.3    1.7  


>RS19A_DROME unnamed protein product
Length=156

 Score = 217 bits (552),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 124/154 (81%), Gaps = 0/154 (0%)

Query  1    MPSVTLKDVDQHKFVKAFAIFLKKSGKLRVPEWIDIVKTSRAKELAPYDPDWYYVRCAAI  60
            MP VT+KD+DQH   KA A+FLKK+GKL+VP+ +DIVKT++ KELAPYDPDW+YVRCA+I
Sbjct  1    MPGVTVKDIDQHAVTKAVAVFLKKTGKLKVPDQMDIVKTAKFKELAPYDPDWFYVRCASI  60

Query  61   ARHIYIRSPVGVGSVTKIFGSRKRNGTKPSHFCRSAGSIARKSLQSLEALKLIEKSPDGG  120
             RH+Y RSP GVGS+TKI+G RKRNG  PSHFCR+A   ARK+LQ+LE  +L+EK PDGG
Sbjct  61   LRHLYHRSPAGVGSITKIYGGRKRNGVHPSHFCRAADGAARKALQALEHARLVEKHPDGG  120

Query  121  RKLTQQGRRDLDRIAAQVKAKERKALKASAILTL  154
            RKL+  G+RDLDRIA Q+  K+R A K +  + +
Sbjct  121  RKLSSIGQRDLDRIANQIVFKQRDAAKQTGPIVI  154


>Q8IFP2_PLAF7 unnamed protein product
Length=170

 Score = 110 bits (274),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 83/137 (61%), Gaps = 1/137 (1%)

Query  6    LKDVDQHKFVKAFAIFLKKSGKLRVPEWIDIVKTSRAKELAPYDPDWYYVRCAAIARHIY  65
            +KDVD   F++++A  LK   K+  P+W   VKT + ++LAP + DWY++R ++I R +Y
Sbjct  29   IKDVDADLFIRSYATHLKLHNKITYPKWCTFVKTGKGRKLAPLNEDWYFIRASSILRRLY  88

Query  66   IRSPVGVGSVTKIFGSRKRNGTKPSHFCRSAGSIARKSLQSLEALKLIEKSP-DGGRKLT  124
            +   +GVG + + F S++R G  P+H   ++G I R  LQ LE L  +E++P   GR+LT
Sbjct  89   LHPDIGVGFLRRQFSSKQRRGVAPNHTSLASGKILRSILQQLENLGYVEQNPKKKGRRLT  148

Query  125  QQGRRDLDRIAAQVKAK  141
             +G   ++  A  +  K
Sbjct  149  TKGENAINNFARYINKK  165


>G5ECZ8_CAEEL unnamed protein product
Length=2491

 Score = 31.6 bits (70),  Expect = 0.23, Method: Compositional matrix adjust.
 Identities = 19/52 (37%), Positives = 28/52 (54%), Gaps = 1/52 (2%)

Query  83    KRNGTKPSHFCRSAGSIARKSLQSLEALKLIE-KSPDGGRKLTQQGRRDLDR  133
             K +G +PS F  +AG I RK       L L+  + PDGG  ++  G +D D+
Sbjct  1870  KNDGEEPSKFFYTAGKIERKYDSDGGELVLVACERPDGGLGISLAGNKDRDK  1921


>Q9NH88_DROME unnamed protein product
Length=658

 Score = 29.3 bits (64),  Expect = 1.7, Method: Composition-based stats.
 Identities = 16/41 (39%), Positives = 22/41 (54%), Gaps = 0/41 (0%)

Query  95   SAGSIARKSLQSLEALKLIEKSPDGGRKLTQQGRRDLDRIA  135
            S G + R   QS+E L LI+ +PDG R   ++ R    R A
Sbjct  425  SQGRMVRVRRQSMEQLDLIKITPDGKRMQEEKLRAQATRKA  465


>Q9NFR7_DROME unnamed protein product
Length=658

 Score = 29.3 bits (64),  Expect = 1.7, Method: Composition-based stats.
 Identities = 16/41 (39%), Positives = 22/41 (54%), Gaps = 0/41 (0%)

Query  95   SAGSIARKSLQSLEALKLIEKSPDGGRKLTQQGRRDLDRIA  135
            S G + R   QS+E L LI+ +PDG R   ++ R    R A
Sbjct  425  SQGRMVRVRRQSMEQLDLIKITPDGKRMQEEKLRAQATRKA  465



Lambda      K        H
   0.330    0.140    0.436 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4302909968


Query= XP_018560861.1 peflin [Anoplophora glabripennis]

Length=192
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7K2L7_DROME  unnamed protein product                                 238     1e-80
A8Y589_DROME  unnamed protein product                                 123     1e-35
Q8SYT2_DROME  unnamed protein product                                 99.4    8e-26
PEFA_DICDI  unnamed protein product                                   80.1    8e-19
CANB_DROME  unnamed protein product                                   80.9    7e-18


>Q7K2L7_DROME unnamed protein product
Length=199

 Score = 238 bits (608),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 113/173 (65%), Positives = 131/173 (76%), Gaps = 0/173 (0%)

Query  18   PTQTPIGPEVQQWFQAVDRDHSGQINWEELQSALVNGQGENFSSQACKLMIGMFDVDKSG  77
            P    + P+ QQWF  VDRD SG+IN  ELQ+ALVNG+G++FS  ACKLMI MFD D SG
Sbjct  26   PQNAQVSPQAQQWFSMVDRDRSGKINASELQAALVNGRGDHFSDNACKLMISMFDNDASG  85

Query  78   TIGINEFQLLYNYINQWLTVFKNYDSNRSGSIEEQELNLAFQQMGFRFSSDFIKFLISRS  137
            TI I EF+ LYNYINQWL VFK YD + SG IEEQEL  AF QMGFRFS +FI FL+ +S
Sbjct  86   TIDIYEFEKLYNYINQWLQVFKTYDQDSSGHIEEQELTQAFTQMGFRFSPEFINFLVKKS  145

Query  138  DLKNHQLISVDQFIVLCVQIQRLTEAFRVRDKEMKGVINIAFEDFLTVAINCT  190
            D + H+ +SVDQFIVLCVQ+QR TEAFR RD +  G I I FEDFLTVAI C+
Sbjct  146  DPQGHKEVSVDQFIVLCVQVQRFTEAFRQRDTQQNGTITIGFEDFLTVAIGCS  198


>A8Y589_DROME unnamed protein product
Length=178

 Score = 123 bits (308),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 60/158 (38%), Positives = 90/158 (57%), Gaps = 0/158 (0%)

Query  31   FQAVDRDHSGQINWEELQSALVNGQGENFSSQACKLMIGMFDVDKSGTIGINEFQLLYNY  90
            FQ VD+D SG I+ +ELQ AL NG    F+ +  +LMIGMFD +  GT+   +F  L+ Y
Sbjct  18   FQRVDKDRSGHISADELQVALSNGTWSAFNPETIRLMIGMFDRENKGTVSFKDFGALWKY  77

Query  91   INQWLTVFKNYDSNRSGSIEEQELNLAFQQMGFRFSSDFIKFLISRSDLKNHQLISVDQF  150
            +  W   F+++D + SG+I++ EL  A    G+R S   I  L+ + D      I  D F
Sbjct  78   VTDWQNCFRSFDRDNSGNIDKTELKTALTSFGYRLSDHLIDVLLRKFDRFGRGTILFDDF  137

Query  151  IVLCVQIQRLTEAFRVRDKEMKGVINIAFEDFLTVAIN  188
            I  C+ +  LT AFR  D ++ G+I I +E FL++  +
Sbjct  138  IQCCIVLYTLTTAFRQHDTDLDGIITIHYEQFLSMVFS  175


 Score = 45.1 bits (105),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 58/121 (48%), Gaps = 6/121 (5%)

Query  1    MFGNPGYGGGSYPGFGAPTQTPIGPEVQQWFQAVDRDHSGQINWEELQSALVNGQGENFS  60
            MF     G  S+  FGA  +     + Q  F++ DRD+SG I+  EL++AL +  G   S
Sbjct  57   MFDRENKGTVSFKDFGALWKYV--TDWQNCFRSFDRDNSGNIDKTELKTALTSF-GYRLS  113

Query  61   SQACKLMIGMFDVDKSGTIGINEFQLLYNYINQWLTVFKNYDSNRSGSIE---EQELNLA  117
                 +++  FD    GTI  ++F      +    T F+ +D++  G I    EQ L++ 
Sbjct  114  DHLIDVLLRKFDRFGRGTILFDDFIQCCIVLYTLTTAFRQHDTDLDGIITIHYEQFLSMV  173

Query  118  F  118
            F
Sbjct  174  F  174


 Score = 32.7 bits (73),  Expect = 0.092, Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 37/81 (46%), Gaps = 1/81 (1%)

Query  97   VFKNYDSNRSGSIEEQELNLAFQQMGFR-FSSDFIKFLISRSDLKNHQLISVDQFIVLCV  155
            VF+  D +RSG I   EL +A     +  F+ + I+ +I   D +N   +S   F  L  
Sbjct  17   VFQRVDKDRSGHISADELQVALSNGTWSAFNPETIRLMIGMFDRENKGTVSFKDFGALWK  76

Query  156  QIQRLTEAFRVRDKEMKGVIN  176
             +      FR  D++  G I+
Sbjct  77   YVTDWQNCFRSFDRDNSGNID  97


>Q8SYT2_DROME unnamed protein product
Length=219

 Score = 99.4 bits (246),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 70/125 (56%), Gaps = 0/125 (0%)

Query  31   FQAVDRDHSGQINWEELQSALVNGQGENFSSQACKLMIGMFDVDKSGTIGINEFQLLYNY  90
            FQ VD+D SG I+ +ELQ AL NG    F+ +  +LMIGMFD +  GT+   +F  L+ Y
Sbjct  18   FQRVDKDRSGHISADELQVALSNGTWSAFNPETIRLMIGMFDRENKGTVSFKDFGALWKY  77

Query  91   INQWLTVFKNYDSNRSGSIEEQELNLAFQQMGFRFSSDFIKFLISRSDLKNHQLISVDQF  150
            +  W   F+++D + SG+I++ EL  A    G+R S   I  L+ + D      I  D F
Sbjct  78   VTDWQNCFRSFDRDNSGNIDKTELKTALTSFGYRLSDHLIDVLLRKFDRFGRGTILFDDF  137

Query  151  IVLCV  155
            I  C+
Sbjct  138  IQCCI  142


 Score = 39.3 bits (90),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 42/84 (50%), Gaps = 3/84 (4%)

Query  1    MFGNPGYGGGSYPGFGAPTQTPIGPEVQQWFQAVDRDHSGQINWEELQSALVNGQGENFS  60
            MF     G  S+  FGA  +     + Q  F++ DRD+SG I+  EL++AL +  G   S
Sbjct  57   MFDRENKGTVSFKDFGALWKYV--TDWQNCFRSFDRDNSGNIDKTELKTALTSF-GYRLS  113

Query  61   SQACKLMIGMFDVDKSGTIGINEF  84
                 +++  FD    GTI  ++F
Sbjct  114  DHLIDVLLRKFDRFGRGTILFDDF  137


 Score = 32.0 bits (71),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 37/81 (46%), Gaps = 1/81 (1%)

Query  97   VFKNYDSNRSGSIEEQELNLAFQQMGFR-FSSDFIKFLISRSDLKNHQLISVDQFIVLCV  155
            VF+  D +RSG I   EL +A     +  F+ + I+ +I   D +N   +S   F  L  
Sbjct  17   VFQRVDKDRSGHISADELQVALSNGTWSAFNPETIRLMIGMFDRENKGTVSFKDFGALWK  76

Query  156  QIQRLTEAFRVRDKEMKGVIN  176
             +      FR  D++  G I+
Sbjct  77   YVTDWQNCFRSFDRDNSGNID  97


>PEFA_DICDI unnamed protein product
Length=197

 Score = 80.1 bits (196),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 53/152 (35%), Positives = 77/152 (51%), Gaps = 3/152 (2%)

Query  26   EVQQWFQAVDRDHSGQINWEELQSALVNGQGENFSSQACKLMIGMFDVDKSGTIGINEFQ  85
            E+  WF+++D+D SG I+  ELQ   V G G      A KL I +FDVDKSG I   E+ 
Sbjct  37   EMSAWFRSIDKDRSGSISAMELQHLHV-GYGPLGIETATKL-IRVFDVDKSGQIDFYEYA  94

Query  86   LLYNYINQWLTVFKNYDSNRSGSIEEQELNLAFQQMGFRFSSDFIKFLISRSDLKNHQLI  145
             L+ +IN     F   D NRSG+I+ QE++ A    GF    + +  L  ++  + + L 
Sbjct  95   ALHQFINILYANFLANDRNRSGTIDAQEIHRALGTSGFNLPFNTVNLLFLKASPRGYGLK  154

Query  146  SVDQFIVLCVQIQRLTEAFRVRDKEMKGVINI  177
              D F+ LC  I      F   D+   GV ++
Sbjct  155  FSD-FLGLCASIAIARSLFEAHDRMRTGVAHL  185


>CANB_DROME unnamed protein product
Length=925

 Score = 80.9 bits (198),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 45/153 (29%), Positives = 75/153 (49%), Gaps = 7/153 (5%)

Query  41   QINWEELQSALVNGQ------GENFSSQACKLMIGMFDVDKSGTIGINEFQLLYNYINQW  94
            +++W+EL+  L +         + FS  A + M+ M D D+SG +G  EF+ L   I +W
Sbjct  772  EVDWQELKRILDHSMRDVMVGSDGFSKDAVRSMVAMLDKDRSGRLGFEEFEALLTDIAKW  831

Query  95   LTVFKNYDSNRSGSIEEQELNLAFQQMGFRFSSDFIKFLISRSDLKNHQLISVDQFIVLC  154
              VFK YD+ R+GSI+   L  A    G+  ++  +  L  R   +  Q I  D F++  
Sbjct  832  RAVFKLYDTRRTGSIDGFHLRGALNSAGYHLNNRLLNALAHRYGSREGQ-IPFDDFLMCA  890

Query  155  VQIQRLTEAFRVRDKEMKGVINIAFEDFLTVAI  187
            ++++   E FR RD +         +D+L   I
Sbjct  891  IKVRTFIEMFRERDTDNSDTAFFNLDDWLERTI  923



Lambda      K        H
   0.330    0.140    0.436 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4302909968


Query= XP_018560862.1 probable ATP-dependent RNA helicase DDX28 isoform X1
[Anoplophora glabripennis]

Length=482
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VPT3_DROME  unnamed protein product                                 372     7e-124
VASA1_DROME  unnamed protein product                                  169     1e-45 
M9PBB5_DROME  unnamed protein product                                 169     1e-45 
Q388E8_TRYB2  unnamed protein product                                 160     2e-42 
Q4Q5P5_LEIMA  unnamed protein product                                 157     7e-42 


>Q9VPT3_DROME unnamed protein product
Length=536

 Score = 372 bits (954),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 194/470 (41%), Positives = 299/470 (64%), Gaps = 29/470 (6%)

Query  38   LISCKRKQLD--HYSSTYYSKLEEVPLASKGWNHSKAKNDFFTVHPFV--DKIPEETYSF  93
            LISC+R Q D   Y  T  +K   + LASKGW H+K+K DFF ++  V  +++ +E  + 
Sbjct  46   LISCRRSQFDLTQYEQTD-AKFGSLSLASKGWLHNKSKGDFFILNASVRGEELQQEMQTV  104

Query  94   QE------CGLNKDIISVLNKQ-DIKKATEFQYRAITTIESGRHVLLAAETGCGKTISYL  146
             E        ++  ++  L  +  IK  T  Q + +  +    H L+AAETGCGKTI+YL
Sbjct  105  DEFLESTGMQIHPQLLENLRVELGIKLLTGIQKQGMPVVHGNEHCLIAAETGCGKTITYL  164

Query  147  LPIIKKLIGNEA---SNLNTPKAVVIVPNRELAYQVGEVAQILAASAGLSVKIVVGGRTK  203
            LPI+ KL+  E      LNTP+ +++ P RELA Q+  V + L     L V+ ++GG TK
Sbjct  165  LPIVDKLLQKEVVTERKLNTPRVLILTPGRELATQIAGVTEKLTQGTNLKVQSLLGGNTK  224

Query  204  KIMMNPEFEKIDLLVATPGALGKLSSVGIYKLNEVQCTVLDEADTLIDDSFIERMNSLLK  263
            ++MMNP+FE++D+LVAT GAL KL + GIY++ +V+  VLDEADTL+DD+F ++++  L+
Sbjct  225  QLMMNPQFEEVDILVATLGALSKLVTTGIYRMEQVRHLVLDEADTLLDDTFTDKLSYFLR  284

Query  264  RV---------SQSQIILVSATLPRQLPDVLIPI--ESTLKHVVSPKIHKPLLNITQKFL  312
            R          + +Q+IL SAT+P    ++L  +    T++ VVSP +H+ + ++TQKFL
Sbjct  285  RFPFHLVQKEDAGTQMILASATMPTNTREILHKVIDVDTIREVVSPHLHRLMSHVTQKFL  344

Query  313  RLTRSSKPPHLLQIAKSN---NSPMLIFTNKNETCNWVALFLRENGVTCANINGDMNYHI  369
            RL+++ +P  LL + K +     P+++F+NK+ T ++V++FL  +GV C N+NGDM   I
Sbjct  345  RLSKADRPATLLSLVKHDLAKRRPLIVFSNKSTTSDFVSIFLNNSGVNCLNLNGDMLMKI  404

Query  370  RVEQWNQFVRGDAQILSATDIGSRGLNTVQVRHVLNYDFPLYAADYIHRIGRVGRLGSPA  429
            R+ ++ QF  G   +LS TD+GSRGL+T + RHV+N+DFPL+ +DYIHR GR+GR+G+  
Sbjct  405  RLGRFEQFQNGHCDVLSTTDVGSRGLDTTRARHVVNFDFPLHVSDYIHRCGRIGRVGNMD  464

Query  430  SCKATNFISGAEEIKLVQQIELAIRRNQPLANVDGNITSIVQKNIARKLR  479
                TN IS   EI +VQ+IE A R    L +V+ NI +I+ K I  +++
Sbjct  465  KALVTNLISSRREIDVVQRIEHAARTGGLLPDVNANIRNIINKRIVAEMK  514


>VASA1_DROME unnamed protein product
Length=661

 Score = 169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 106/357 (30%), Positives = 172/357 (48%), Gaps = 6/357 (2%)

Query  86   IPEETYSFQECGLNKDIISVLNKQDIKKATEFQYRAITTIESGRHVLLAAETGCGKTISY  145
            +P+    F    L   II  +NK   K  T  Q  +I  I SGR ++  A+TG GKT ++
Sbjct  240  VPQPIQHFTSADLRDIIIDNVNKSGYKIPTPIQKCSIPVISSGRDLMACAQTGSGKTAAF  299

Query  146  LLPIIKKLIGNEAS-NLNTPKAVVIVPNRELAYQVGEVAQILAASAGLSVKIVVGGRTKK  204
            LLPI+ KL+ +     L  P+ V++ P RELA Q+   A+  A  + L + IV GG + +
Sbjct  300  LLPILSKLLEDPHELELGRPQVVIVSPTRELAIQIFNEARKFAFESYLKIGIVYGGTSFR  359

Query  205  IMMNPEFEKIDLLVATPGALGKLSSVGIYKLNEVQCTVLDEADTLIDDSFIERMNSLLKR  264
                       +++ATPG L            + +  VLDEAD ++D  F E M  ++  
Sbjct  360  HQNECITRGCHVVIATPGRLLDFVDRTFITFEDTRFVVLDEADRMLDMGFSEDMRRIMTH  419

Query  265  VS---QSQIILVSATLPRQLPDVLIPIESTLKHVVSPKIHKPLLNITQKFLRLTRSSKPP  321
            V+   + Q ++ SAT P ++  +          V    +     ++ Q    + + +K  
Sbjct  420  VTMRPEHQTLMFSATFPEEIQRMAGEFLKNYVFVAIGIVGGACSDVKQTIYEVNKYAKRS  479

Query  322  HLLQIAKSNNSPMLIFTNKNETCNWVALFLRENGVTCANINGDMNYHIRVEQWNQFVRGD  381
             L++I        ++F       +++A FL E      +I+GD     R +    F  G 
Sbjct  480  KLIEILSEQADGTIVFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQREQALRDFKNGS  539

Query  382  AQILSATDIGSRGLNTVQVRHVLNYDFPLYAADYIHRIGRVGRLGSPASCKATNFIS  438
             ++L AT + SRGL+   ++HV+NYD P    DY+HRIGR GR+G+  + +AT+F  
Sbjct  540  MKVLIATSVASRGLDIKNIKHVINYDMPSKIDDYVHRIGRTGRVGN--NGRATSFFD  594


>M9PBB5_DROME unnamed protein product
Length=661

 Score = 169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 106/357 (30%), Positives = 172/357 (48%), Gaps = 6/357 (2%)

Query  86   IPEETYSFQECGLNKDIISVLNKQDIKKATEFQYRAITTIESGRHVLLAAETGCGKTISY  145
            +P+    F    L   II  +NK   K  T  Q  +I  I SGR ++  A+TG GKT ++
Sbjct  240  VPQPIQHFTSADLRDIIIDNVNKSGYKIPTPIQKCSIPVISSGRDLMACAQTGSGKTAAF  299

Query  146  LLPIIKKLIGNEAS-NLNTPKAVVIVPNRELAYQVGEVAQILAASAGLSVKIVVGGRTKK  204
            LLPI+ KL+ +     L  P+ V++ P RELA Q+   A+  A  + L + IV GG + +
Sbjct  300  LLPILSKLLEDPHELELGRPQVVIVSPTRELAIQIFNEARKFAFESYLKIGIVYGGTSFR  359

Query  205  IMMNPEFEKIDLLVATPGALGKLSSVGIYKLNEVQCTVLDEADTLIDDSFIERMNSLLKR  264
                       +++ATPG L            + +  VLDEAD ++D  F E M  ++  
Sbjct  360  HQNECITRGCHVVIATPGRLLDFVDRTFITFEDTRFVVLDEADRMLDMGFSEDMRRIMTH  419

Query  265  VS---QSQIILVSATLPRQLPDVLIPIESTLKHVVSPKIHKPLLNITQKFLRLTRSSKPP  321
            V+   + Q ++ SAT P ++  +          V    +     ++ Q    + + +K  
Sbjct  420  VTMRPEHQTLMFSATFPEEIQRMAGEFLKNYVFVAIGIVGGACSDVKQTIYEVNKYAKRS  479

Query  322  HLLQIAKSNNSPMLIFTNKNETCNWVALFLRENGVTCANINGDMNYHIRVEQWNQFVRGD  381
             L++I        ++F       +++A FL E      +I+GD     R +    F  G 
Sbjct  480  KLIEILSEQADGTIVFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQREQALRDFKNGS  539

Query  382  AQILSATDIGSRGLNTVQVRHVLNYDFPLYAADYIHRIGRVGRLGSPASCKATNFIS  438
             ++L AT + SRGL+   ++HV+NYD P    DY+HRIGR GR+G+  + +AT+F  
Sbjct  540  MKVLIATSVASRGLDIKNIKHVINYDMPSKIDDYVHRIGRTGRVGN--NGRATSFFD  594


>Q388E8_TRYB2 unnamed protein product
Length=660

 Score = 160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 105/350 (30%), Positives = 169/350 (48%), Gaps = 15/350 (4%)

Query  92   SFQECGLNKDIISVLNKQDIKKATEFQYRAITTIESGRHVLLAAETGCGKTISYLLPIIK  151
            SF E  +   ++  + +    K T  Q   I T  + R ++  A+TG GKT SYL+P I 
Sbjct  158  SFSEMNMVPVLLENVKRCGYTKPTPVQSLGIPTALNHRDLMACAQTGSGKTASYLIPAIN  217

Query  152  KLIGN-------EASNLNTPKAVVIVPNRELAYQVGEVAQILAASAGLSVKIVVGGRTKK  204
            +++ N          + ++P+A+++ P REL+ Q+   A+       +   +V GG   +
Sbjct  218  EILLNISNRPPYSPGSHSSPQALILAPTRELSLQIYGEARKFTYHTPVRCVVVYGGADPR  277

Query  205  IMMNPEFEKIDLLVATPGALGKLSSVGIYKLNEVQCTVLDEADTLIDDSF-------IER  257
              ++       LLVATPG L  + S G  + +E++  +LDEAD ++D  F       ++ 
Sbjct  278  HQVHELSRGCKLLVATPGRLMDMFSRGYVRFSEIRFLILDEADRMLDMGFEPQIRMIVQG  337

Query  258  MNSLLKRVSQSQIILVSATLPRQLPDVLIPIESTLKHVVSPKIHKPLLNITQKFLRLTRS  317
             +S + R  Q Q +L SAT P ++  +          +   ++     NITQ    +   
Sbjct  338  PDSDMPRAGQRQTLLYSATFPVEIQRLAREFMCRHSFLQVGRVGSTTENITQDVRWIEDP  397

Query  318  SKPPHLLQIAKSNNSPM-LIFTNKNETCNWVALFLRENGVTCANINGDMNYHIRVEQWNQ  376
             K   LL + + N   + L+F  K    +++  FLR + + C +I+GD     R E    
Sbjct  398  DKRQALLTLLRENEGKLVLVFVEKKRDADYLERFLRNSELACVSIHGDRVQREREEALRL  457

Query  377  FVRGDAQILSATDIGSRGLNTVQVRHVLNYDFPLYAADYIHRIGRVGRLG  426
            F  G  Q+L ATD+ SRGL+   V  V+ YD P    DY+HRIGR GR G
Sbjct  458  FKSGACQVLVATDVASRGLDIPNVGVVIQYDMPSNIDDYVHRIGRTGRAG  507


>Q4Q5P5_LEIMA unnamed protein product
Length=615

 Score = 157 bits (398),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 106/356 (30%), Positives = 172/356 (48%), Gaps = 20/356 (6%)

Query  88   EETYSFQECGLNKDIISVLNKQDIKKATEFQYRAITTIESGRHVLLAAETGCGKTISYLL  147
            E   SF    L   +   +N+   +K T  Q   I  + +G  ++  A+TG GKT +YL+
Sbjct  132  EPAESFATMALAPALAENVNRCRYQKPTPVQKYGIPCVLNGSDLMACAQTGSGKTAAYLI  191

Query  148  PIIKKLIGNEASNLN---------TPKAVVIVPNRELAYQVGEVAQILAASAGLSVKIVV  198
            P I  ++ N   NLN          P A+V+ P REL+ Q+ E  +      G    +V 
Sbjct  192  PAINFMLVN---NLNRAKPTNSQAAPSALVLSPTRELSIQIYEEGRKFTYRTGFRCVVVY  248

Query  199  GGRTKKIMMNPEFEKIDLLVATPGALGKLSSVGIYKLNEVQCTVLDEADTLIDDSF----  254
            GG   +  ++       LLVATPG L  + + G  + ++V+  VLDEAD ++D  F    
Sbjct  249  GGADPRHQIHELTRGCGLLVATPGRLSDMFTRGYTRYSDVRFLVLDEADRMLDMGFEPQI  308

Query  255  ---IERMNSLLKRVSQSQIILVSATLPRQLPDVLIPIESTLKHVVSPKIHKPLLNITQKF  311
               ++  +S +    + Q +L SAT P+++  +          +   ++     NITQ  
Sbjct  309  RAIVQGPDSDMPPPGERQTLLYSATFPKEIQQMAREFLYHHHFLQVGRVGSTTENITQDV  368

Query  312  LRLTRSSKPPHLLQIAKSNNSP-MLIFTNKNETCNWVALFLRENGVTCANINGDMNYHIR  370
              +    K   LL++ K +    +L+F  K    +++  +LR++ + C++I+GD     R
Sbjct  369  RWVEDMDKRGCLLEVLKEHQGERVLVFVEKKRDADYLERYLRQSRIPCSSIHGDRVQRER  428

Query  371  VEQWNQFVRGDAQILSATDIGSRGLNTVQVRHVLNYDFPLYAADYIHRIGRVGRLG  426
             E  + F  G  ++L ATD+ SRGL+   V  V+ YD P    DY+HRIGR GR G
Sbjct  429  EEALDIFKSGVCRVLVATDVASRGLDIPNVAVVVQYDLPSNIDDYVHRIGRTGRAG  484



Lambda      K        H
   0.330    0.140    0.436 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4302909968


Query= XP_018560863.1 probable ATP-dependent RNA helicase DDX28 isoform X2
[Anoplophora glabripennis]

Length=480
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VPT3_DROME  unnamed protein product                                 365     1e-121
VASA1_DROME  unnamed protein product                                  164     6e-44 
M9PBB5_DROME  unnamed protein product                                 164     6e-44 
Q388E8_TRYB2  unnamed protein product                                 154     2e-40 
Q4Q5P5_LEIMA  unnamed protein product                                 151     1e-39 


>Q9VPT3_DROME unnamed protein product
Length=536

 Score = 365 bits (938),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 193/470 (41%), Positives = 297/470 (63%), Gaps = 31/470 (7%)

Query  38   LISCKRKQLD--HYSSTYYSKLEEVPLASKGWNHSKAKNDFFTVHPFV--DKIPEETYSF  93
            LISC+R Q D   Y  T  +K   + LASKGW H+K+K DFF ++  V  +++ +E  + 
Sbjct  46   LISCRRSQFDLTQYEQTD-AKFGSLSLASKGWLHNKSKGDFFILNASVRGEELQQEMQTV  104

Query  94   QE------CGLNKDIISVLNKQ-DIKKATEFQYRAITTIESGRHVLLAAETGCGKTISYL  146
             E        ++  ++  L  +  IK  T  Q + +  +    H L+AAETGCGKTI+YL
Sbjct  105  DEFLESTGMQIHPQLLENLRVELGIKLLTGIQKQGMPVVHGNEHCLIAAETGCGKTITYL  164

Query  147  LPIIKKLIGNEA---SNLNTPKAVVIVPNRELAYQVGEVAQILAASAGLSVKIVVGGRTK  203
            LPI+ KL+  E      LNTP+ +++ P RELA Q+  V + L     L V+ ++GG TK
Sbjct  165  LPIVDKLLQKEVVTERKLNTPRVLILTPGRELATQIAGVTEKLTQGTNLKVQSLLGGNTK  224

Query  204  KIMMNPEFEKIDLLVATPGALGKLSSVGIYKLNECT--VLDEADTLIDDSFIERMNSLLK  261
            ++MMNP+FE++D+LVAT GAL KL + GIY++ +    VLDEADTL+DD+F ++++  L+
Sbjct  225  QLMMNPQFEEVDILVATLGALSKLVTTGIYRMEQVRHLVLDEADTLLDDTFTDKLSYFLR  284

Query  262  RV---------SQSQIILVSATLPRQLPDVLIPI--ESTLKHVVSPKIHKPLLNITQKFL  310
            R          + +Q+IL SAT+P    ++L  +    T++ VVSP +H+ + ++TQKFL
Sbjct  285  RFPFHLVQKEDAGTQMILASATMPTNTREILHKVIDVDTIREVVSPHLHRLMSHVTQKFL  344

Query  311  RLTRSSKPPHLLQIAKSN---NSPMLIFTNKNETCNWVALFLRENGVTCANINGDMNYHI  367
            RL+++ +P  LL + K +     P+++F+NK+ T ++V++FL  +GV C N+NGDM   I
Sbjct  345  RLSKADRPATLLSLVKHDLAKRRPLIVFSNKSTTSDFVSIFLNNSGVNCLNLNGDMLMKI  404

Query  368  RVEQWNQFVRGDAQILSATDIGSRGLNTVQVRHVLNYDFPLYAADYIHRIGRVGRLGSPA  427
            R+ ++ QF  G   +LS TD+GSRGL+T + RHV+N+DFPL+ +DYIHR GR+GR+G+  
Sbjct  405  RLGRFEQFQNGHCDVLSTTDVGSRGLDTTRARHVVNFDFPLHVSDYIHRCGRIGRVGNMD  464

Query  428  SCKATNFISGAEEIKLVQQIELAIRRNQPLANVDGNITSIVQKNIARKLR  477
                TN IS   EI +VQ+IE A R    L +V+ NI +I+ K I  +++
Sbjct  465  KALVTNLISSRREIDVVQRIEHAARTGGLLPDVNANIRNIINKRIVAEMK  514


>VASA1_DROME unnamed protein product
Length=661

 Score = 164 bits (415),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 106/357 (30%), Positives = 173/357 (48%), Gaps = 8/357 (2%)

Query  86   IPEETYSFQECGLNKDIISVLNKQDIKKATEFQYRAITTIESGRHVLLAAETGCGKTISY  145
            +P+    F    L   II  +NK   K  T  Q  +I  I SGR ++  A+TG GKT ++
Sbjct  240  VPQPIQHFTSADLRDIIIDNVNKSGYKIPTPIQKCSIPVISSGRDLMACAQTGSGKTAAF  299

Query  146  LLPIIKKLIGNEAS-NLNTPKAVVIVPNRELAYQVGEVAQILAASAGLSVKIVVGGRTKK  204
            LLPI+ KL+ +     L  P+ V++ P RELA Q+   A+  A  + L + IV GG + +
Sbjct  300  LLPILSKLLEDPHELELGRPQVVIVSPTRELAIQIFNEARKFAFESYLKIGIVYGGTSFR  359

Query  205  IMMNPEFEKIDLLVATPGALGKL--SSVGIYKLNECTVLDEADTLIDDSFIERMNSLLKR  262
                       +++ATPG L      +   ++     VLDEAD ++D  F E M  ++  
Sbjct  360  HQNECITRGCHVVIATPGRLLDFVDRTFITFEDTRFVVLDEADRMLDMGFSEDMRRIMTH  419

Query  263  VS---QSQIILVSATLPRQLPDVLIPIESTLKHVVSPKIHKPLLNITQKFLRLTRSSKPP  319
            V+   + Q ++ SAT P ++  +          V    +     ++ Q    + + +K  
Sbjct  420  VTMRPEHQTLMFSATFPEEIQRMAGEFLKNYVFVAIGIVGGACSDVKQTIYEVNKYAKRS  479

Query  320  HLLQIAKSNNSPMLIFTNKNETCNWVALFLRENGVTCANINGDMNYHIRVEQWNQFVRGD  379
             L++I        ++F       +++A FL E      +I+GD     R +    F  G 
Sbjct  480  KLIEILSEQADGTIVFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQREQALRDFKNGS  539

Query  380  AQILSATDIGSRGLNTVQVRHVLNYDFPLYAADYIHRIGRVGRLGSPASCKATNFIS  436
             ++L AT + SRGL+   ++HV+NYD P    DY+HRIGR GR+G+  + +AT+F  
Sbjct  540  MKVLIATSVASRGLDIKNIKHVINYDMPSKIDDYVHRIGRTGRVGN--NGRATSFFD  594


>M9PBB5_DROME unnamed protein product
Length=661

 Score = 164 bits (415),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 106/357 (30%), Positives = 173/357 (48%), Gaps = 8/357 (2%)

Query  86   IPEETYSFQECGLNKDIISVLNKQDIKKATEFQYRAITTIESGRHVLLAAETGCGKTISY  145
            +P+    F    L   II  +NK   K  T  Q  +I  I SGR ++  A+TG GKT ++
Sbjct  240  VPQPIQHFTSADLRDIIIDNVNKSGYKIPTPIQKCSIPVISSGRDLMACAQTGSGKTAAF  299

Query  146  LLPIIKKLIGNEAS-NLNTPKAVVIVPNRELAYQVGEVAQILAASAGLSVKIVVGGRTKK  204
            LLPI+ KL+ +     L  P+ V++ P RELA Q+   A+  A  + L + IV GG + +
Sbjct  300  LLPILSKLLEDPHELELGRPQVVIVSPTRELAIQIFNEARKFAFESYLKIGIVYGGTSFR  359

Query  205  IMMNPEFEKIDLLVATPGALGKL--SSVGIYKLNECTVLDEADTLIDDSFIERMNSLLKR  262
                       +++ATPG L      +   ++     VLDEAD ++D  F E M  ++  
Sbjct  360  HQNECITRGCHVVIATPGRLLDFVDRTFITFEDTRFVVLDEADRMLDMGFSEDMRRIMTH  419

Query  263  VS---QSQIILVSATLPRQLPDVLIPIESTLKHVVSPKIHKPLLNITQKFLRLTRSSKPP  319
            V+   + Q ++ SAT P ++  +          V    +     ++ Q    + + +K  
Sbjct  420  VTMRPEHQTLMFSATFPEEIQRMAGEFLKNYVFVAIGIVGGACSDVKQTIYEVNKYAKRS  479

Query  320  HLLQIAKSNNSPMLIFTNKNETCNWVALFLRENGVTCANINGDMNYHIRVEQWNQFVRGD  379
             L++I        ++F       +++A FL E      +I+GD     R +    F  G 
Sbjct  480  KLIEILSEQADGTIVFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQREQALRDFKNGS  539

Query  380  AQILSATDIGSRGLNTVQVRHVLNYDFPLYAADYIHRIGRVGRLGSPASCKATNFIS  436
             ++L AT + SRGL+   ++HV+NYD P    DY+HRIGR GR+G+  + +AT+F  
Sbjct  540  MKVLIATSVASRGLDIKNIKHVINYDMPSKIDDYVHRIGRTGRVGN--NGRATSFFD  594


>Q388E8_TRYB2 unnamed protein product
Length=660

 Score = 154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 105/350 (30%), Positives = 167/350 (48%), Gaps = 17/350 (5%)

Query  92   SFQECGLNKDIISVLNKQDIKKATEFQYRAITTIESGRHVLLAAETGCGKTISYLLPIIK  151
            SF E  +   ++  + +    K T  Q   I T  + R ++  A+TG GKT SYL+P I 
Sbjct  158  SFSEMNMVPVLLENVKRCGYTKPTPVQSLGIPTALNHRDLMACAQTGSGKTASYLIPAIN  217

Query  152  KLIGN-------EASNLNTPKAVVIVPNRELAYQVGEVAQILAASAGLSVKIVVGGRTKK  204
            +++ N          + ++P+A+++ P REL+ Q+   A+       +   +V GG   +
Sbjct  218  EILLNISNRPPYSPGSHSSPQALILAPTRELSLQIYGEARKFTYHTPVRCVVVYGGADPR  277

Query  205  IMMNPEFEKIDLLVATPGALGKLSSVGIYKLNECT--VLDEADTLIDDSF-------IER  255
              ++       LLVATPG L  + S G  + +E    +LDEAD ++D  F       ++ 
Sbjct  278  HQVHELSRGCKLLVATPGRLMDMFSRGYVRFSEIRFLILDEADRMLDMGFEPQIRMIVQG  337

Query  256  MNSLLKRVSQSQIILVSATLPRQLPDVLIPIESTLKHVVSPKIHKPLLNITQKFLRLTRS  315
             +S + R  Q Q +L SAT P ++  +          +   ++     NITQ    +   
Sbjct  338  PDSDMPRAGQRQTLLYSATFPVEIQRLAREFMCRHSFLQVGRVGSTTENITQDVRWIEDP  397

Query  316  SKPPHLLQIAKSNNSPM-LIFTNKNETCNWVALFLRENGVTCANINGDMNYHIRVEQWNQ  374
             K   LL + + N   + L+F  K    +++  FLR + + C +I+GD     R E    
Sbjct  398  DKRQALLTLLRENEGKLVLVFVEKKRDADYLERFLRNSELACVSIHGDRVQREREEALRL  457

Query  375  FVRGDAQILSATDIGSRGLNTVQVRHVLNYDFPLYAADYIHRIGRVGRLG  424
            F  G  Q+L ATD+ SRGL+   V  V+ YD P    DY+HRIGR GR G
Sbjct  458  FKSGACQVLVATDVASRGLDIPNVGVVIQYDMPSNIDDYVHRIGRTGRAG  507


>Q4Q5P5_LEIMA unnamed protein product
Length=615

 Score = 151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 105/356 (29%), Positives = 170/356 (48%), Gaps = 22/356 (6%)

Query  88   EETYSFQECGLNKDIISVLNKQDIKKATEFQYRAITTIESGRHVLLAAETGCGKTISYLL  147
            E   SF    L   +   +N+   +K T  Q   I  + +G  ++  A+TG GKT +YL+
Sbjct  132  EPAESFATMALAPALAENVNRCRYQKPTPVQKYGIPCVLNGSDLMACAQTGSGKTAAYLI  191

Query  148  PIIKKLIGNEASNLN---------TPKAVVIVPNRELAYQVGEVAQILAASAGLSVKIVV  198
            P I  ++ N   NLN          P A+V+ P REL+ Q+ E  +      G    +V 
Sbjct  192  PAINFMLVN---NLNRAKPTNSQAAPSALVLSPTRELSIQIYEEGRKFTYRTGFRCVVVY  248

Query  199  GGRTKKIMMNPEFEKIDLLVATPGALGKLSSVGIYKLNECT--VLDEADTLIDDSF----  252
            GG   +  ++       LLVATPG L  + + G  + ++    VLDEAD ++D  F    
Sbjct  249  GGADPRHQIHELTRGCGLLVATPGRLSDMFTRGYTRYSDVRFLVLDEADRMLDMGFEPQI  308

Query  253  ---IERMNSLLKRVSQSQIILVSATLPRQLPDVLIPIESTLKHVVSPKIHKPLLNITQKF  309
               ++  +S +    + Q +L SAT P+++  +          +   ++     NITQ  
Sbjct  309  RAIVQGPDSDMPPPGERQTLLYSATFPKEIQQMAREFLYHHHFLQVGRVGSTTENITQDV  368

Query  310  LRLTRSSKPPHLLQIAKSNNSP-MLIFTNKNETCNWVALFLRENGVTCANINGDMNYHIR  368
              +    K   LL++ K +    +L+F  K    +++  +LR++ + C++I+GD     R
Sbjct  369  RWVEDMDKRGCLLEVLKEHQGERVLVFVEKKRDADYLERYLRQSRIPCSSIHGDRVQRER  428

Query  369  VEQWNQFVRGDAQILSATDIGSRGLNTVQVRHVLNYDFPLYAADYIHRIGRVGRLG  424
             E  + F  G  ++L ATD+ SRGL+   V  V+ YD P    DY+HRIGR GR G
Sbjct  429  EEALDIFKSGVCRVLVATDVASRGLDIPNVAVVVQYDLPSNIDDYVHRIGRTGRAG  484



Lambda      K        H
   0.330    0.140    0.436 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4302909968


Query= XP_018560864.1 peflin [Anoplophora glabripennis]

Length=189
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7K2L7_DROME  unnamed protein product                                 246     1e-83
A8Y589_DROME  unnamed protein product                                 125     2e-36
Q8SYT2_DROME  unnamed protein product                                 101     8e-27
CANB_DROME  unnamed protein product                                   84.3    5e-19
PEFA_DICDI  unnamed protein product                                   77.4    8e-18


>Q7K2L7_DROME unnamed protein product
Length=199

 Score = 246 bits (627),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 138/174 (79%), Gaps = 0/174 (0%)

Query  15   PPGQPPVNPDIQRWFETVDRDRSGQINWQELKSALINGQGENFSDQACKLMIGMFDTDKN  74
            PP    V+P  Q+WF  VDRDRSG+IN  EL++AL+NG+G++FSD ACKLMI MFD D +
Sbjct  25   PPQNAQVSPQAQQWFSMVDRDRSGKINASELQAALVNGRGDHFSDNACKLMISMFDNDAS  84

Query  75   GSIGVNEFQLLYNYINQWLAVFKNYDRDGSGSIEEQELGQAFHQMGFRFSPEFVKFLITK  134
            G+I + EF+ LYNYINQWL VFK YD+D SG IEEQEL QAF QMGFRFSPEF+ FL+ K
Sbjct  85   GTIDIYEFEKLYNYINQWLQVFKTYDQDSSGHIEEQELTQAFTQMGFRFSPEFINFLVKK  144

Query  135  SDYKNHRQMSLDQFIVACVQIQRYTEAFRARDRELKGVITLAFEDFLNIAINCS  188
            SD + H+++S+DQFIV CVQ+QR+TEAFR RD +  G IT+ FEDFL +AI CS
Sbjct  145  SDPQGHKEVSVDQFIVLCVQVQRFTEAFRQRDTQQNGTITIGFEDFLTVAIGCS  198


>A8Y589_DROME unnamed protein product
Length=178

 Score = 125 bits (313),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 92/161 (57%), Gaps = 0/161 (0%)

Query  29   FETVDRDRSGQINWQELKSALINGQGENFSDQACKLMIGMFDTDKNGSIGVNEFQLLYNY  88
            F+ VD+DRSG I+  EL+ AL NG    F+ +  +LMIGMFD +  G++   +F  L+ Y
Sbjct  18   FQRVDKDRSGHISADELQVALSNGTWSAFNPETIRLMIGMFDRENKGTVSFKDFGALWKY  77

Query  89   INQWLAVFKNYDRDGSGSIEEQELGQAFHQMGFRFSPEFVKFLITKSDYKNHRQMSLDQF  148
            +  W   F+++DRD SG+I++ EL  A    G+R S   +  L+ K D      +  D F
Sbjct  78   VTDWQNCFRSFDRDNSGNIDKTELKTALTSFGYRLSDHLIDVLLRKFDRFGRGTILFDDF  137

Query  149  IVACVQIQRYTEAFRARDRELKGVITLAFEDFLNIAINCSI  189
            I  C+ +   T AFR  D +L G+IT+ +E FL++  +  I
Sbjct  138  IQCCIVLYTLTTAFRQHDTDLDGIITIHYEQFLSMVFSLKI  178


 Score = 40.8 bits (94),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 50/116 (43%), Gaps = 6/116 (5%)

Query  4    NPGYGEYSGYGPPGQPPVNPDIQRWFETVDRDRSGQINWQELKSALINGQGENFSDQACK  63
            N G   +  +G   +     D Q  F + DRD SG I+  ELK+AL +  G   SD    
Sbjct  62   NKGTVSFKDFGALWKYV--TDWQNCFRSFDRDNSGNIDKTELKTALTSF-GYRLSDHLID  118

Query  64   LMIGMFDTDKNGSIGVNEFQLLYNYINQWLAVFKNYDRDGSGSIE---EQELGQAF  116
            +++  FD    G+I  ++F      +      F+ +D D  G I    EQ L   F
Sbjct  119  VLLRKFDRFGRGTILFDDFIQCCIVLYTLTTAFRQHDTDLDGIITIHYEQFLSMVF  174


 Score = 35.4 bits (80),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 37/80 (46%), Gaps = 1/80 (1%)

Query  95   VFKNYDRDGSGSIEEQELGQAFHQMGFR-FSPEFVKFLITKSDYKNHRQMSLDQFIVACV  153
            VF+  D+D SG I   EL  A     +  F+PE ++ +I   D +N   +S   F     
Sbjct  17   VFQRVDKDRSGHISADELQVALSNGTWSAFNPETIRLMIGMFDRENKGTVSFKDFGALWK  76

Query  154  QIQRYTEAFRARDRELKGVI  173
             +  +   FR+ DR+  G I
Sbjct  77   YVTDWQNCFRSFDRDNSGNI  96


>Q8SYT2_DROME unnamed protein product
Length=219

 Score = 101 bits (252),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 84/166 (51%), Gaps = 14/166 (8%)

Query  29   FETVDRDRSGQINWQELKSALINGQGENFSDQACKLMIGMFDTDKNGSIGVNEFQLLYNY  88
            F+ VD+DRSG I+  EL+ AL NG    F+ +  +LMIGMFD +  G++   +F  L+ Y
Sbjct  18   FQRVDKDRSGHISADELQVALSNGTWSAFNPETIRLMIGMFDRENKGTVSFKDFGALWKY  77

Query  89   INQWLAVFKNYDRDGSGSIEEQELGQAFHQMGFRFSPEFVKFLITKSDYKNHRQMSLDQF  148
            +  W   F+++DRD SG+I++ EL  A    G+R S   +  L+ K D      +  D F
Sbjct  78   VTDWQNCFRSFDRDNSGNIDKTELKTALTSFGYRLSDHLIDVLLRKFDRFGRGTILFDDF  137

Query  149  IVAC---------VQIQRYTEAFRARDRELKGVITLAFEDFLNIAI  185
            I  C         + I  Y  A  +RD        LA+E    IA+
Sbjct  138  IQCCIVLYVSMTVIAIYEYKVAVGSRDFR-----CLAYEKIFEIAL  178


 Score = 36.6 bits (83),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 22/60 (37%), Positives = 31/60 (52%), Gaps = 1/60 (2%)

Query  23   PDIQRWFETVDRDRSGQINWQELKSALINGQGENFSDQACKLMIGMFDTDKNGSIGVNEF  82
             D Q  F + DRD SG I+  ELK+AL    G   SD    +++  FD    G+I  ++F
Sbjct  79   TDWQNCFRSFDRDNSGNIDKTELKTAL-TSFGYRLSDHLIDVLLRKFDRFGRGTILFDDF  137


 Score = 34.7 bits (78),  Expect = 0.025, Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 37/80 (46%), Gaps = 1/80 (1%)

Query  95   VFKNYDRDGSGSIEEQELGQAFHQMGFR-FSPEFVKFLITKSDYKNHRQMSLDQFIVACV  153
            VF+  D+D SG I   EL  A     +  F+PE ++ +I   D +N   +S   F     
Sbjct  17   VFQRVDKDRSGHISADELQVALSNGTWSAFNPETIRLMIGMFDRENKGTVSFKDFGALWK  76

Query  154  QIQRYTEAFRARDRELKGVI  173
             +  +   FR+ DR+  G I
Sbjct  77   YVTDWQNCFRSFDRDNSGNI  96


>CANB_DROME unnamed protein product
Length=925

 Score = 84.3 bits (207),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 54/195 (28%), Positives = 90/195 (46%), Gaps = 17/195 (9%)

Query  6    GYGEYSGYGPPGQPPVNPD---------IQRWFETVDRDRSGQINWQELKSALINGQ---  53
            G+GE      P  PP  P          ++R F++V      +++WQELK  L +     
Sbjct  731  GFGETDDRIAPSLPPPTPKEEDDPQRIALRRLFDSV-AGSDEEVDWQELKRILDHSMRDV  789

Query  54   ---GENFSDQACKLMIGMFDTDKNGSIGVNEFQLLYNYINQWLAVFKNYDRDGSGSIEEQ  110
                + FS  A + M+ M D D++G +G  EF+ L   I +W AVFK YD   +GSI+  
Sbjct  790  MVGSDGFSKDAVRSMVAMLDKDRSGRLGFEEFEALLTDIAKWRAVFKLYDTRRTGSIDGF  849

Query  111  ELGQAFHQMGFRFSPEFVKFLITKSDYKNHRQMSLDQFIVACVQIQRYTEAFRARDRELK  170
             L  A +  G+  +   +  L  +   +   Q+  D F++  ++++ + E FR RD +  
Sbjct  850  HLRGALNSAGYHLNNRLLNALAHRYGSREG-QIPFDDFLMCAIKVRTFIEMFRERDTDNS  908

Query  171  GVITLAFEDFLNIAI  185
                   +D+L   I
Sbjct  909  DTAFFNLDDWLERTI  923


>PEFA_DICDI unnamed protein product
Length=197

 Score = 77.4 bits (189),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 51/152 (34%), Positives = 75/152 (49%), Gaps = 3/152 (2%)

Query  24   DIQRWFETVDRDRSGQINWQELKSALINGQGENFSDQACKLMIGMFDTDKNGSIGVNEFQ  83
            ++  WF ++D+DRSG I+  EL+   + G G    + A KL I +FD DK+G I   E+ 
Sbjct  37   EMSAWFRSIDKDRSGSISAMELQHLHV-GYGPLGIETATKL-IRVFDVDKSGQIDFYEYA  94

Query  84   LLYNYINQWLAVFKNYDRDGSGSIEEQELGQAFHQMGFRFSPEFVKFLITKSDYKNHRQM  143
             L+ +IN   A F   DR+ SG+I+ QE+ +A    GF      V  L  K+  + +  +
Sbjct  95   ALHQFINILYANFLANDRNRSGTIDAQEIHRALGTSGFNLPFNTVNLLFLKASPRGY-GL  153

Query  144  SLDQFIVACVQIQRYTEAFRARDRELKGVITL  175
                F+  C  I      F A DR   GV  L
Sbjct  154  KFSDFLGLCASIAIARSLFEAHDRMRTGVAHL  185



Lambda      K        H
   0.330    0.140    0.436 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4302909968


Query= XP_018560865.2 odorant receptor Or1-like isoform X1 [Anoplophora
glabripennis]

Length=422
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

OR43A_DROME  unnamed protein product                                  93.2    1e-20
OR1_ANOGA  unnamed protein product                                    92.8    2e-20
OR49B_DROME  unnamed protein product                                  81.6    9e-17
OR2_ANOGA  unnamed protein product                                    75.9    8e-15
OR94A_DROME  unnamed protein product                                  73.2    7e-14


>OR43A_DROME unnamed protein product
Length=376

 Score = 93.2 bits (230),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 94/169 (56%), Gaps = 1/169 (1%)

Query  253  LEDKLKLRKDRERFSEEMTKNLVICVELHRQVIRVIKDVERINGTGIFILFVGGGLILCS  312
            L  +L      E+  EE  + L  C+  H QV+R +  + ++    + +  +  G I+CS
Sbjct  206  LVHRLGQIGGEEQSEEERFQRLASCIAYHTQVMRYVWQLNKLVANIVAVEAIIFGSIICS  265

Query  313  SLFSVSVVKIGSLEFIMLLFYLICMLIEQFFYCWFGNEIIFKSSLILQSAFNTPWVSCNV  372
             LF ++++     + I ++ Y++ ML   F Y    NEI  +++ + ++ +N PW     
Sbjct  266  LLFCLNIIT-SPTQVISIVMYILTMLYVLFTYYNRANEICLENNRVAEAVYNVPWYEAGT  324

Query  373  KFQKILLVFMLKTSKPISILTGGLFTMSVPVFVSILRTTYSYFTLLKNI  421
            +F+K LL+F+++T  P+ I  G ++ M++ +F S+L  +YSYFT+L+ +
Sbjct  325  RFRKTLLIFLMQTQHPMEIRVGNVYPMTLAMFQSLLNASYSYFTMLRGV  373


>OR1_ANOGA unnamed protein product
Length=417

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 84/407 (21%), Positives = 187/407 (46%), Gaps = 14/407 (3%)

Query  26   YDFSSYFRPSIIMLKIFGFWRPER-NMKFKGIYNCYT-ALCSLIWMAFLLSQIIYIINNW  83
            YD    F   ++ LK  G W PE  +   +  Y  Y  AL  +    + L+Q +Y   + 
Sbjct  13   YDRRDSFWLQLLCLKYLGLWPPEDTDQATRNRYIAYGWALRIMFLHLYALTQALYF-KDV  71

Query  84   NDVQEVTAALSVTVTFTIILIQMMFFYKNTNYLKILIKEMNRPLFQVKCQKHYH-IAKNT  142
             D+ ++  AL V +T   ++ ++  F  N   ++  ++++N  L+  K ++ +  + ++ 
Sbjct  72   KDINDIANALFVLMTQVTLIYKLEKFNYNIARIQACLRKLNCTLYHPKQREEFSPVLQSM  131

Query  143  ERMYKLMFKSCLYLSVLTDVLVTVVPLMGKEKKSSIKGWFPYDYTKP--LYFILTYIFQN  200
              ++ LM    +++++ T ++  + P    E++  +  WFP DY     +Y +L +++Q 
Sbjct  132  SGVFWLMI-FLMFVAIFTIIMWVMSPAFDNERRLPVPAWFPVDYHHSDIVYGVL-FLYQT  189

Query  201  LVFIWNTFVNLSIFMIILALLIQVGLQCDLLCCTLDSLDDFCTKDNVLYEIGLEDKLKLR  260
            +  + +   N S   +   L++ +  Q   L   +  L      +  L     E K ++R
Sbjct  190  IGIVMSATYNFSTDTMFSGLMLHINGQIVRLGSMVKKLGHDVPPERQLVATDAEWK-EMR  248

Query  261  KDRERFSE---EMTKNLVICVELHRQVIRVIKDVERINGTGIFILFVGGGLILCSSLFSV  317
            K  +  S+    M   +  CV  H+ ++    +V+ I    IF       +I+C +L   
Sbjct  249  KRIDHHSKVYGTMYAKVTECVLFHKDILSFGDEVQDIFQGSIFAQVCASVIIICMTLLQA  308

Query  318  SVVKIGSLEFIMLLFYLICMLIEQFFYCWFGNEIIFKSSLILQSAFNTPWVSCNVKFQKI  377
            +   +   + +   FYL+ M  + F +C+ GNEI + +    +    + +   + +  + 
Sbjct  309  TGDDVTMADLLGCGFYLLVMTSQVFIFCYVGNEISYTTDKFTEFVGFSNYFKFDKRTSQA  368

Query  378  LLVFMLKTSKPISILTGGLF--TMSVPVFVSILRTTYSYFTLLKNIQ  422
            ++ F+  T K + I  G +   T+++  F+ I++ +YSY  +L++++
Sbjct  369  MIFFLQMTLKDVHIKVGSVLKVTLNLHTFLQIMKLSYSYLAVLQSME  415


>OR49B_DROME unnamed protein product
Length=375

 Score = 81.6 bits (200),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 62/287 (22%), Positives = 134/287 (47%), Gaps = 22/287 (8%)

Query  137  HIAKNTERMYKLMFKSCLYLSVLTDVLVTVVPLMGKEKKSSIKGWFP--YDYTKPLYFIL  194
             I     ++ KLM +  L+  +LT +   + PL   E+        P   +Y  P Y+ +
Sbjct  107  EILDQVNKVGKLMARGNLFFGMLTSMGFGLYPLSSSERVLPFGSKIPGLNEYESP-YYEM  165

Query  195  TYIFQNLVFIWNTFVNLSIFMIILALLIQVGLQCDLLCCTLDSLDDFCTKDNVLYEIGLE  254
             YIFQ L+      + +    +I+ L++   ++C  L              + L ++ L+
Sbjct  166  WYIFQMLITPMGCCMYIPYTSLIVGLIMFGIVRCKAL-------------QHRLRQVALK  212

Query  255  DKLKLRKDRERFSEEMTKNLVICVELHRQVIRVIKDVERINGTGIFILFVGGGLILCSSL  314
                 R  RE     + + ++ C+   + +I  +  +  +         +    +LC+ L
Sbjct  213  HPYGDRDPRE-----LREEIIACIRYQQSIIEYMDHINELTTMMFLFELMAFSALLCALL  267

Query  315  FSVSVVKIGSLEFIMLLFYLICMLIEQFFYCWFGNEIIFKSSLILQSAFNTPWVSCNVKF  374
            F + +V  G+ + I++  Y+  +L +     W+ NE+  ++  +  +A+ T W + +V  
Sbjct  268  FMLIIVS-GTSQLIIVCMYINMILAQILALYWYANELREQNLAVATAAYETEWFTFDVPL  326

Query  375  QKILLVFMLKTSKPISILTGGLFTMSVPVFVSILRTTYSYFTLLKNI  421
            +K +L  M++  +P +IL G +  +++ +F ++L TTY++FT+LK +
Sbjct  327  RKNILFMMMRAQRPAAILLGNIRPITLELFQNLLNTTYTFFTVLKRV  373


>OR2_ANOGA unnamed protein product
Length=378

 Score = 75.9 bits (185),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 74/356 (21%), Positives = 153/356 (43%), Gaps = 32/356 (9%)

Query  75   QIIYIINNWNDVQEVTAALSVTVTFTIILIQMMFFYKNTNYLKILIKEMNRPLFQVKCQK  134
            Q + + ++W D+ E    L +   FT++   ++     T++L I  ++     F+    +
Sbjct  44   QFLKLYSSWGDMSE----LIINGYFTVLYFNLVL---RTSFLVINRRKFET-FFEGVAAE  95

Query  135  HYHIAKNTE---------RMYKLMFKSCLYLSVLTDVLVTVVPLMGKEKKSSIKGWFPYD  185
            +  + KN +         R  +++  S L+L           PL    +        PY 
Sbjct  96   YALLEKNDDIRPVLERYTRRGRMLSISNLWLGAFISACFVTYPLFVPGRG------LPYG  149

Query  186  YTKPLYFILTYIFQNLVFIWNTFVNLSIFMIILALLIQVGLQCDLLCCTLDSLDDFCTKD  245
             T P   +L      +VF+      L +++   A  + +        CTL +L       
Sbjct  150  VTIPGVDVLATPTYQVVFV------LQVYLTFPACCMYIPFTSFYATCTLFALVQIAALK  203

Query  246  NVLYEIGLEDKLKLRKDRERFSEEMTKNLVICVELHRQVIRVIKDVERINGTGIFILFVG  305
              L  +G              +  +   L  C++ H+Q+I+ + D+  +      + F+ 
Sbjct  204  QRLGRLGRHSGTMASTGHS--AGTLFAELKECLKYHKQIIQYVHDLNSLVTHLCLLEFLS  261

Query  306  GGLILCSSLFSVSVVKIGSLEFIMLLFYLICMLIEQFFYCWFGNEIIFKSSLILQSAFNT  365
             G++LC+ LF +S+    + + IM+  Y+  +L + F + W  NE++ +S  I  + +N 
Sbjct  262  FGMMLCALLFLLSISNQLA-QMIMIGSYIFMILSQMFAFYWHANEVLEQSLGIGDAIYNG  320

Query  366  PWVSCNVKFQKILLVFMLKTSKPISILTGGLFTMSVPVFVSILRTTYSYFTLLKNI  421
             W       +K L++ + +  +P+ I  G ++ M++ +F  +L  +YSYFTLL+ +
Sbjct  321  AWPDFEEPIRKRLILIIARAQRPMVIKVGNVYPMTLEMFQKLLNVSYSYFTLLRRV  376


>OR94A_DROME unnamed protein product
Length=387

 Score = 73.2 bits (178),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 75/144 (52%), Gaps = 2/144 (1%)

Query  280  LHRQVIRVIKDVERINGTGIFILFVGGGLILCSSLFSVSVVKI--GSLEFIMLLFYLICM  337
            +H+++  +    +RI    I    +   LI+C S + +  V I     +FI +L ++  M
Sbjct  242  MHQRIRSLTLTCQRIVSPYILSQIILSALIICFSGYRLQHVGIRDNPGQFISMLQFVSVM  301

Query  338  LIEQFFYCWFGNEIIFKSSLILQSAFNTPWVSCNVKFQKILLVFMLKTSKPISILTGGLF  397
            +++ +  C++GNEI   ++ +    ++T W+ C    +K+L  +M    KP++I  G  F
Sbjct  302  ILQIYLPCYYGNEITVYANQLTNEVYHTNWLECRPPIRKLLNAYMEHLKKPVTIRAGNFF  361

Query  398  TMSVPVFVSILRTTYSYFTLLKNI  421
             + +P+FV  +   YS+  LL N+
Sbjct  362  AVGLPIFVKTINNAYSFLALLLNV  385



Lambda      K        H
   0.330    0.140    0.436 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4302909968


Query= XP_018560866.1 ecdysone receptor isoform X3 [Anoplophora
glabripennis]

Length=490
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ECR_DROME  unnamed protein product                                    553     0.0  
ECR_HELVI  unnamed protein product                                    521     0.0  
HR38_DROME  unnamed protein product                                   157     7e-41
E75BC_DROME  unnamed protein product                                  148     7e-38
E75BB_DROME  unnamed protein product                                  148     9e-38


>ECR_DROME unnamed protein product
Length=878

 Score = 553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/427 (65%), Positives = 326/427 (76%), Gaps = 28/427 (7%)

Query  88   SGREDLSPPSSLNGYSAD-SCDAKK-KKGPTPRQQEELCLVCGDRASGYHYNALTCEGCK  145
            SGR+DLSP SSLNGYSA+ SCDAKK KKGP PR QEELCLVCGDRASGYHYNALTCEGCK
Sbjct  226  SGRDDLSPSSSLNGYSANESCDAKKSKKGPAPRVQEELCLVCGDRASGYHYNALTCEGCK  285

Query  146  GFFRRSITKNAVYQCKYGNNCEIDMYMRRKCQECRLKKCLSVGMRPECVVPEVQCAVKRK  205
            GFFRRS+TK+AVY CK+G  CE+DMYMRRKCQECRLKKCL+VGMRPECVVPE QCA+KR+
Sbjct  286  GFFRRSVTKSAVYCCKFGRACEMDMYMRRKCQECRLKKCLAVGMRPECVVPENQCAMKRR  345

Query  206  EKKAQKEKDK----PNS--------TTNGSPEMIKLE---------PEMFFLQLSDSE--  242
            EKKAQKEKDK    P+S         + G  + +K E         P+   + L   E  
Sbjct  346  EKKAQKEKDKMTTSPSSQHGGNGSLASGGGQDFVKKEILDLMTCEPPQHATIPLLPDEIL  405

Query  243  -KTLTNGVKPISPEQEELIHRLVYFQNEYEHPSEEDVKRIINQPMEGEDQCDIRFRHITE  301
             K     +  ++  Q  +I++L+++Q+ YE PSEED++RI++QP E E Q D+ FRHITE
Sbjct  406  AKCQARNIPSLTYNQLAVIYKLIWYQDGYEQPSEEDLRRIMSQPDENESQTDVSFRHITE  465

Query  302  ITILTVQLIVEFAKRLPGFDKLLREDQIALLKACSSEVMMFRMARRYDVQSDSILFVNNQ  361
            ITILTVQLIVEFAK LP F K+ +EDQI LLKACSSEVMM RMARRYD  SDSI F NN+
Sbjct  466  ITILTVQLIVEFAKGLPAFTKIPQEDQITLLKACSSEVMMLRMARRYDHSSDSIFFANNR  525

Query  362  PYSRDSYNLAGMGETIEDLLHFCRTMYSMKVDNAEYALLTAIVIFSERPALIEGWKVEKI  421
             Y+RDSY +AGM + IEDLLHFCR M+SMKVDN EYALLTAIVIFS+RP L +   VE I
Sbjct  526  SYTRDSYKMAGMADNIEDLLHFCRQMFSMKVDNVEYALLTAIVIFSDRPGLEKAQLVEAI  585

Query  422  QEIYLEALRAYVDNRRKPRPGTI--FAKLLSVLTELRTLGNQNSEMCFSLKLKNKKLPPF  479
            Q  Y++ LR Y+ NR      ++  +AKLLS+LTELRTLGNQN+EMCFSLKLKN+KLP F
Sbjct  586  QSYYIDTLRIYILNRHCGDSMSLVFYAKLLSILTELRTLGNQNAEMCFSLKLKNRKLPKF  645

Query  480  LAEIWDV  486
            L EIWDV
Sbjct  646  LEEIWDV  652


>ECR_HELVI unnamed protein product
Length=576

 Score = 521 bits (1343),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/500 (57%), Positives = 341/500 (68%), Gaps = 41/500 (8%)

Query  24   TLLMSPHNSLASTDIGDVDLELWDLD---LNHQNQARGFIIQNGYVIQGHTVIGNSAAIA  80
             ++MSP  SLAS +IG   LELW  D        Q+ G         Q       +  + 
Sbjct  51   AMVMSPE-SLASPEIGG--LELWGYDDGITYSMAQSLGTCTMEQQQPQPQQQPQQTQPLP  107

Query  81   -----------KSDTSSMS-GREDLSPPSSLNGYSADSCDAKKKKGPTPRQQEELCLVCG  128
                       KS+  SMS GRE+LSP SS+NG S D    ++KKGP PRQQEELCLVCG
Sbjct  108  SMPLPMPPTTPKSENESMSSGREELSPASSVNGCSTDGEARRQKKGPAPRQQEELCLVCG  167

Query  129  DRASGYHYNALTCEGCKGFFRRSITKNAVYQCKYGNNCEIDMYMRRKCQECRLKKCLSVG  188
            DRASGYHYNALTCEGCKGFFRRS+TKNAVY CK+G+ CE+D+YMRRKCQECRLKKCL+VG
Sbjct  168  DRASGYHYNALTCEGCKGFFRRSVTKNAVYICKFGHACEMDIYMRRKCQECRLKKCLAVG  227

Query  189  MRPECVVPEVQCAVKRKEKKAQKEKDK-PNSTT---NGSPEMIKLEP-------------  231
            MRPECVVPE QCA+KRKEKKAQ+EKDK P STT   +  P +++ +P             
Sbjct  228  MRPECVVPENQCAMKRKEKKAQREKDKLPVSTTTVDDHMPPIMQCDPPPPEAARILECVQ  287

Query  232  -EMF--FLQLSDSEKTLTNGVKPISPEQEELIHRLVYFQNEYEHPSEEDVKRIINQPMEG  288
             E+   FL     E+     V P++  Q+ LI RLV++Q  YE PSEED+KR + Q  E 
Sbjct  288  HEVVPRFLNEKLMEQNRLKNVPPLTANQKSLIARLVWYQEGYEQPSEEDLKR-VTQSDED  346

Query  289  EDQCDIRFRHITEITILTVQLIVEFAKRLPGFDKLLREDQIALLKACSSEVMMFRMARRY  348
            ++  D+ FR ITE+TILTVQLIVEFAK LPGF K+ + DQI LLKACSSEVMM R+ARRY
Sbjct  347  DEDSDMPFRQITEMTILTVQLIVEFAKGLPGFAKISQSDQITLLKACSSEVMMLRVARRY  406

Query  349  DVQSDSILFVNNQPYSRDSYNLAGMGETIEDLLHFCRTMYSMKVDNAEYALLTAIVIFSE  408
            D  +DS+LF NNQ Y+RD+Y  AGM   IEDLLHFCR MYSM +DN  YALLTAIVIFS+
Sbjct  407  DAATDSVLFANNQAYTRDNYRKAGMAYVIEDLLHFCRCMYSMMMDNVHYALLTAIVIFSD  466

Query  409  RPALIEGWKVEKIQEIYLEALRAYV--DNRRKPRPGTIFAKLLSVLTELRTLGNQNSEMC  466
            RP L +   VE+IQ  YL  LR Y+   N   PR   IF ++L +LTE+RTLG QNS MC
Sbjct  467  RPGLEQPLLVEEIQRYYLNTLRVYILNQNSASPRGAVIFGEILGILTEIRTLGMQNSNMC  526

Query  467  FSLKLKNKKLPPFLAEIWDV  486
             SLKLKN+KLPPFL EIWDV
Sbjct  527  ISLKLKNRKLPPFLEEIWDV  546


>HR38_DROME unnamed protein product
Length=1073

 Score = 157 bits (397),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 111/362 (31%), Positives = 174/362 (48%), Gaps = 40/362 (11%)

Query  122   ELCLVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYQCKYGNNCEIDMYMRRKCQECRL  181
             +LC VCGD A+  HY   TCEGCKGFF+R++ K + Y C    NC +D   R +CQ CR 
Sbjct  742   QLCAVCGDTAACQHYGVRTCEGCKGFFKRTVQKGSKYVCLADKNCPVDKRRRNRCQFCRF  801

Query  182   KKCLSVGMRPECVVPEVQCAVKRKEKKAQKEKDKPNSTTNGSPEMIKLEPEMFFLQLSDS  241
             +KCL VGM  E V         R+ +   K K    S  +    +I              
Sbjct  802   QKCLVVGMVKEVV--RTDSLKGRRGRLPSKPKSPQESPPSPPISLI--------------  845

Query  242   EKTLTNGVKPISPEQEELIHRLVYFQNEYEHPSEEDVKRIINQPMEGEDQCDIRFRHITE  301
                L       +P+   L         +Y H  E        Q M   D+    ++ +T 
Sbjct  846   -TALVRSHVDTTPDPSCL---------DYSHYEE--------QSMSEADKVQQFYQLLTS  887

Query  302   ITILTVQLIVEFAKRLPGFDKLLREDQIALLKACSSEVMMFRMARRYDVQSDSILFVNNQ  361
                 +V +I +FA+++PG+  LL EDQ  L ++ S E+ + R+A R  +    ++F N  
Sbjct  888   ----SVDVIKQFAEKIPGYFDLLPEDQELLFQSASLELFVLRLAYRARIDDTKLIFCNGT  943

Query  362   PYSRDSYNLAGMGETIEDLLHFCRTMYSMKVDNAEYALLTAIVIFSERPALIEGWKVEKI  421
                R +  L   GE + D++ F R+++++++D + +A L A+ + +ER  L E  KVE++
Sbjct  944   VLHR-TQCLRSFGEWLNDIMEFSRSLHNLEIDISAFACLCALTLITERHGLREPKKVEQL  1002

Query  422   QEIYLEALRAYVD-NRRKPRPGTIFAKLLSVLTELRTLGNQNSEMCFSLKLKNKKLPPFL  480
             Q   + +LR +V  N    +    F++LL  L ELR+L  Q  +  F LKL++    P L
Sbjct  1003  QMKIIGSLRDHVTYNAEAQKKQHYFSRLLGKLPELRSLSVQGLQRIFYLKLEDLVPAPAL  1062

Query  481   AE  482
              E
Sbjct  1063  IE  1064


>E75BC_DROME unnamed protein product
Length=1199

 Score = 148 bits (374),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 110/380 (29%), Positives = 181/380 (48%), Gaps = 41/380 (11%)

Query  123  LCLVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYQ-CKYGNNCEIDMYMRRKCQECRL  181
            LC VCGD+ASG+HY   +CEGCKGFFRRSI +   Y+ C     C I    R +CQ CRL
Sbjct  244  LCRVCGDKASGFHYGVHSCEGCKGFFRRSIQQKIQYRPCTKNQQCSILRINRNRCQYCRL  303

Query  182  KKCLSVGMRPECV----VPEVQCAVKRKEKKAQKEKDKPNSTTNGSPEMIKLEPEMFFLQ  237
            KKC++VGM  + V    VP        K +KA+       ST N      + +      +
Sbjct  304  KKCIAVGMSRDAVRFGRVP--------KREKARILAAMQQSTQN------RGQQRALATE  349

Query  238  LSDSEKTLTNGVKP------ISPEQEELIHRLVYFQNEYEHPSEEDVKRIINQPMEGEDQ  291
            L D  + L   ++        + E+   + +       Y  P+           ++ E +
Sbjct  350  LDDQPRLLAAVLRAHLETCEFTKEKVSAMRQRARDCPSYSMPTLLACPLNPAPELQSEQE  409

Query  292  CDIRFRHITEITILTVQLIVEFAKRLPGFDKLLREDQIALLKACSSEVMMFRMARRYDVQ  351
               RF H+       ++ +++FA  +PGF  L ++D+  LLKA   + +  R+   +D  
Sbjct  410  FSQRFAHV-------IRGVIDFAGMIPGFQLLTQDDKFTLLKAGLFDALFVRLICMFDSS  462

Query  352  SDSILFVNNQPYSRDSY-NLAGMGETIEDLLHFCRTMYSMKVDNAEYALLTAIVIFS-ER  409
             +SI+ +N Q   RD+  N A     ++   +F   M SM + +AE  L  AIV+ + +R
Sbjct  463  INSIICLNGQVMRRDAIQNGANARFLVDSTFNFAERMNSMNLTDAEIGLFCAIVLITPDR  522

Query  410  PALIEGWKVEKIQEIY--LEALRAYVDNRRKPRPGTIFAKLLSVLTELRTLGNQNSEMCF  467
            P L     +E I+++Y  L+    Y+  + +P      AKLL  + +LRTL   ++E   
Sbjct  523  PGL---RNLELIEKMYSRLKGCLQYIVAQNRPDQPEFLAKLLETMPDLRTLSTLHTEKLV  579

Query  468  SLKLKNKKLPPFLAEIWDVD  487
              + ++K+L     ++W ++
Sbjct  580  VFRTEHKEL--LRQQMWSME  597


>E75BB_DROME unnamed protein product
Length=1412

 Score = 148 bits (373),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 110/380 (29%), Positives = 181/380 (48%), Gaps = 41/380 (11%)

Query  123  LCLVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYQ-CKYGNNCEIDMYMRRKCQECRL  181
            LC VCGD+ASG+HY   +CEGCKGFFRRSI +   Y+ C     C I    R +CQ CRL
Sbjct  457  LCRVCGDKASGFHYGVHSCEGCKGFFRRSIQQKIQYRPCTKNQQCSILRINRNRCQYCRL  516

Query  182  KKCLSVGMRPECV----VPEVQCAVKRKEKKAQKEKDKPNSTTNGSPEMIKLEPEMFFLQ  237
            KKC++VGM  + V    VP        K +KA+       ST N      + +      +
Sbjct  517  KKCIAVGMSRDAVRFGRVP--------KREKARILAAMQQSTQN------RGQQRALATE  562

Query  238  LSDSEKTLTNGVKP------ISPEQEELIHRLVYFQNEYEHPSEEDVKRIINQPMEGEDQ  291
            L D  + L   ++        + E+   + +       Y  P+           ++ E +
Sbjct  563  LDDQPRLLAAVLRAHLETCEFTKEKVSAMRQRARDCPSYSMPTLLACPLNPAPELQSEQE  622

Query  292  CDIRFRHITEITILTVQLIVEFAKRLPGFDKLLREDQIALLKACSSEVMMFRMARRYDVQ  351
               RF H+       ++ +++FA  +PGF  L ++D+  LLKA   + +  R+   +D  
Sbjct  623  FSQRFAHV-------IRGVIDFAGMIPGFQLLTQDDKFTLLKAGLFDALFVRLICMFDSS  675

Query  352  SDSILFVNNQPYSRDSY-NLAGMGETIEDLLHFCRTMYSMKVDNAEYALLTAIVIFS-ER  409
             +SI+ +N Q   RD+  N A     ++   +F   M SM + +AE  L  AIV+ + +R
Sbjct  676  INSIICLNGQVMRRDAIQNGANARFLVDSTFNFAERMNSMNLTDAEIGLFCAIVLITPDR  735

Query  410  PALIEGWKVEKIQEIY--LEALRAYVDNRRKPRPGTIFAKLLSVLTELRTLGNQNSEMCF  467
            P L     +E I+++Y  L+    Y+  + +P      AKLL  + +LRTL   ++E   
Sbjct  736  PGL---RNLELIEKMYSRLKGCLQYIVAQNRPDQPEFLAKLLETMPDLRTLSTLHTEKLV  792

Query  468  SLKLKNKKLPPFLAEIWDVD  487
              + ++K+L     ++W ++
Sbjct  793  VFRTEHKEL--LRQQMWSME  810



Lambda      K        H
   0.330    0.140    0.436 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4302909968


Query= XP_018560867.1 keratin-associated protein 19-2-like [Anoplophora
glabripennis]

Length=116
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9V3Z9_DROME  unnamed protein product                                 31.2    0.14 


>Q9V3Z9_DROME unnamed protein product
Length=277

 Score = 31.2 bits (69),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 30/59 (51%), Gaps = 5/59 (8%)

Query  4   FKYMIVLISIVVLAFAEEEEENAIAPEAKKTTKRGIYGLGYGGLGYGH-GYGHGY-GHG  60
            K  I L +++V +    + E    P  KK  KRG+  LGY   GYGH G   GY GHG
Sbjct  1   MKVFICLAALLVASACASKTEGEKVPLEKKLDKRGLLDLGY---GYGHAGLDTGYLGHG  56



Lambda      K        H
   0.330    0.140    0.436 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4302909968


Query= XP_018560868.1 transient receptor potential channel pyrexia-like
[Anoplophora glabripennis]

Length=594
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PYX_DROME  unnamed protein product                                    225     2e-63
Q6NQV8_DROME  unnamed protein product                                 179     1e-47
A0A0B4LGT2_DROME  unnamed protein product                             178     3e-47
Q9VHY7_DROME  unnamed protein product                                 178     3e-47
TRPA1_DROME  unnamed protein product                                  134     1e-32


>PYX_DROME unnamed protein product
Length=956

 Score = 225 bits (574),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 182/598 (30%), Positives = 283/598 (47%), Gaps = 41/598 (7%)

Query  11   LHDAVRSGCLEAVCLMLGNGADVNAKDGSGN-TPLLLAVCIRQEEIYNAIVKRLIESGAD  69
            LH A  +G  + V L+L + ADV ++ G G  T L LA     E  Y    + L+E  A+
Sbjct  236  LHTASAAGFAKCVQLLLSHNADVRSQFGEGKVTALHLAA----ENDYVECARLLLEHRAE  291

Query  70   VNAYNKG-LTPLYNAVFYKRQESVRMLLQEGAWLAPTFRNELHLL--AELGGSNILEIIL  126
            V+  N    TPL+ A   +   +V +L+  GA +   +R+    L  A +  S  L+   
Sbjct  292  VDCRNASHQTPLHLACLSQSIGTVDLLISYGANVNAVYRDGRTALHAAIVKQSRSLDCCN  351

Query  127  SDKRCTPDTVNLPDEKGWTPLHLAAQYYHRNCLKMLIKHGGDLTVVNSEDDSVIDIIFRE  186
            +  +   D VN  D  G+TPLH+AA     +C+   I+HG D+T       S +  I R 
Sbjct  352  ALLKAGAD-VNKADNYGYTPLHIAALNEFSSCVYTFIEHGADITARTDGRVSALSFIVRR  410

Query  187  IIKPERIIKELLDEQILMKRTDK----YKHYYTIDFTVLAPKKCRRQMEVISNVLVVASE  242
               PE I K +      +K  D+          +DF +L P     + E  + +L+   E
Sbjct  411  T--PEIIPKLMQKLDSSIKANDQEIGDVDCQIKLDFRLLVPSSSMDRGE--TELLLSLIE  466

Query  243  DEKTEVLQHPVIELYLLLKWSRISYFFYLWISIYAVFAVFMGFYATLIL------HNYHV  296
              +  +L HP+ E +L LKW RI  FF + ++ + +F +   FY   +           V
Sbjct  467  VGQKRILMHPLCETFLFLKWRRIRKFFLMSLAYHTLFVILFTFYVIWVYVRCCKKEELCV  526

Query  297  LHVMKTTVKYILILTSSGLLGHAILQCVLMNRNYLRRYELWMNLICTCLSLTVVIIADHT  356
                 +T+ Y++I+ +  LLG  + Q     R Y + +E W+        L  V      
Sbjct  527  APGYVSTIGYLVIILNLILLGKEVFQMAHGLRGYAKYWENWLQWTIGTGVLLCVTPETVR  586

Query  357  VDDSNGNAQHSNFSGAPTWLLHATSIAVLLAWIELMLLIGRLPSLGYYALMFSTVLQNVV  416
             DD          +  P W  H  +I +LL W+ELM+L+GR P  G Y  MF+ V  N  
Sbjct  587  TDD---------LTAVPVWQHHVAAIVILLVWLELMMLVGRFPIFGVYVQMFTKVAVNFA  637

Query  417  KVLLAFLCLVIGFALSFSIQFRSYEQFSDPWRALVKTTVMMMGEFEYADLFADSRG--GS  474
            K LLA++CL++ F LSF++ F  Y  F +   + +K+  MM GE E+ D+F         
Sbjct  638  KFLLAYICLLVAFGLSFAVLFNDYPAFENITWSFLKSITMMSGELEFEDIFYGDYAVKFP  697

Query  475  LLPRIIFLMFIILTSIVLMNLMVGLAVSDIQELQRRGRARKLEKRAEFLCQLEKVISSRQ  534
            +   IIFL F++L +++L NLMVGLAVSDIQ LQ      +L ++AE + +LE +  SR 
Sbjct  698  VTAHIIFLSFVLLVTVILTNLMVGLAVSDIQGLQVSATLDRLVRQAELVSRLESLFFSRL  757

Query  535  LNSKYIPT----LIKRVFVRRSFVDDKYELETSAEFHRTHRVPRRLMDSITAIAKGRK  588
            L S   PT    L KR  + R+   DK +        R +++P  +  ++  +   R+
Sbjct  758  LRSA--PTNLIQLCKRSALLRT-SRDKLQFTIRPNDPRDNQLPEDIKLNVYKLVAERR  812


 Score = 56.2 bits (134),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 54/191 (28%), Positives = 82/191 (43%), Gaps = 38/191 (20%)

Query  9    GGLH--DAVRSGCLEAV-------------CLMLGN-----------GADVNAKDGSGNT  42
            GG H  D V+SGC   +             C + G+            AD N  D  G T
Sbjct  76   GGKHVVDMVQSGCFLELMTDSADCNLALICCSVFGSVENTLFLLKHYNADPNVADSRGRT  135

Query  43   PLLLAVCIRQEEIYNAIVKRLIESGADVNAYN--KGLTPLYNAVFYKRQESVRMLLQEGA  100
            PL  A C         I K L++ GAD N ++  K +T L+ A   K  E + +LL+  A
Sbjct  136  PLHFACC----RANAPIAKVLLDFGADPNRWDARKEVTSLHCAASSKSVECILLLLRRKA  191

Query  101  WLAPTF--RNELHLLAELGGSNILEIILSDKRCTPDTVNLPDEKGWTPLHLAAQYYHRNC  158
             +      R+ LH   ++   + +EI+L      P+T  +  E   TPLH A+      C
Sbjct  192  SINIGIEKRSALHYAIDVNAVDCVEILLK-YGADPNTPQVYTE---TPLHTASAAGFAKC  247

Query  159  LKMLIKHGGDL  169
            +++L+ H  D+
Sbjct  248  VQLLLSHNADV  258


>Q6NQV8_DROME unnamed protein product
Length=986

 Score = 179 bits (455),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 169/657 (26%), Positives = 285/657 (43%), Gaps = 100/657 (15%)

Query  11   LHDAVRSGCLEAVCLMLGNGADVNAKDGSGNTPLLLA-----------------------  47
            LH AVRS  LE + + +  GADVN+   +G   + LA                       
Sbjct  255  LHCAVRSNALECLQIFIAEGADVNSLKPNGTNAIHLAADLGNIQCLEALLNAPNADANVR  314

Query  48   VCIRQEEIYN----------AIVKRLIESGADVNAYN-KGLTPLYNAVFYKRQESVRMLL  96
            +CIR++E               V  L+  GAD    N +G TPL+ A      + V  LL
Sbjct  315  ICIREKESTALHLAADEGNVECVDLLLAKGADAKLKNHRGFTPLHLAARTSSLDCVESLL  374

Query  97   QEGAW--LAPTFRNELHLLAELGGSNILEIILSDKRCTPDTVNLPDEKGWTPLHLAAQYY  154
            + G     A  F +   L A +G S     I+         VN  D  G+T LHLAA   
Sbjct  375  RNGNADANAEDFDHRTPLHAAVGKSENAYDIMETLIQWGANVNHKDIYGFTALHLAALDG  434

Query  155  HRNCLKMLIKHGGDLTVVNSEDDSVIDIIFREIIKPERIIKELLDEQILMKRTDKYKHYY  214
               C++MLI HG D+T  + +  S +++I R+      +I++ LD  I +  +    +  
Sbjct  435  LVQCVEMLIFHGADVTTKSKKGTSALNVITRKTPASVAMIRQKLDAAITLHHSQDPVNRE  494

Query  215  T---IDFTVLAPKKCRRQMEVISNVLVVASEDEKTEVLQHPVIELYLLLKWSRISYFFYL  271
                +DF  L      R++  ++  +    ++ + E+L+HP+   +L +KW RI  ++  
Sbjct  495  VELELDFRQLLQHCHPREISYLNTFV----DEGQKEILEHPLCSSFLYIKWGRIRKYYIG  550

Query  272  WISIYAVFAVFMGFYA-TLILHN-YHVLHVMKTTVKYILILTSSGLLGHAILQCVLMNRN  329
             +     F +F+  Y  T + HN Y+      TT+    +     +LG      +L N  
Sbjct  551  RLIFCFSFVLFLTLYVLTALAHNCYNGSKNDNTTIPAQELCQKQSILGD-----MLRNNP  605

Query  330  YLRRYELWMNLICTCLSLTVVIIADHTVDDSNGNAQHSNFSGAPT-------WLL-----  377
            ++   + W+      +++T+V I         G   +S+F    T       W +     
Sbjct  606  FVMEMQWWV-----LVAITIVEIFRKLY----GITGYSSFRHYVTQVENIMEWFVITSVF  656

Query  378  ---------------HATSIAVLLAWIELMLLIGRLPSLGYYALMFSTVLQNVVKVLLAF  422
                           H  + AVLL W  LML+IG+LP    Y  M++ V     K+ +A+
Sbjct  657  VISYIYTNKTYTFQNHIGAFAVLLGWTNLMLMIGQLPVFDVYVAMYTRVQGEFAKLFMAY  716

Query  423  LCLVIGFALSFSIQFRSYEQFSDPWRALVKTTVMMMGEFEYADLFADSRGGS------LL  476
             C++IGF +SF + F S   F++P+   +   VMM+GE + + L  D  G        + 
Sbjct  717  SCMLIGFTISFCVIFPSSSSFANPFMGFITVLVMMIGEQDLSLLINDPEGKDPPFLLEVS  776

Query  477  PRIIFLMFIILTSIVLMNLMVGLAVSDIQELQRRGRARKLEKRAEFLCQLEKVISSRQLN  536
             +I F++F++  +I+LMNL+VG+AV DIQ L++     KL ++ + +  +E       L 
Sbjct  777  AQITFVLFLLFVTIILMNLLVGIAVHDIQGLKKTAGLSKLVRQTKLISYIESA-----LF  831

Query  537  SKYIPTLIKRVFVRRSFVDD---KYELETSAEFHRTHRVPRRLMDSITAIAKGRKQL  590
            + Y+PT ++ +    + V     +  L          R+PR ++     + K RK  
Sbjct  832  NGYLPTWLRNLLHYTALVSPQAYRVVLCVKPLNPSEKRLPREILMKAYEVGKMRKHF  888


 Score = 55.1 bits (131),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 77/172 (45%), Gaps = 12/172 (7%)

Query  9    GGLHDAVRSGCLEAVCLMLGNGADVNAKDGSGNTPLLLAVCIRQEEIYNAIVKRLIESGA  68
              LH +  SGCL  + L++  G +VN +     TPL  A             K LI +GA
Sbjct  185  SALHLSAFSGCLATLGLLVAKGLNVNLQSKC-YTPLHCAA----FGNAAEAAKLLINNGA  239

Query  69   DV----NAYNKGLTPLYNAVFYKRQESVRMLLQEGA---WLAPTFRNELHLLAELGGSNI  121
            D+    +  N   + L+ AV     E +++ + EGA    L P   N +HL A+LG    
Sbjct  240  DISKDTSKPNCEESLLHCAVRSNALECLQIFIAEGADVNSLKPNGTNAIHLAADLGNIQC  299

Query  122  LEIILSDKRCTPDTVNLPDEKGWTPLHLAAQYYHRNCLKMLIKHGGDLTVVN  173
            LE +L+      +      EK  T LHLAA   +  C+ +L+  G D  + N
Sbjct  300  LEALLNAPNADANVRICIREKESTALHLAADEGNVECVDLLLAKGADAKLKN  351


 Score = 43.5 bits (101),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 43/168 (26%), Positives = 72/168 (43%), Gaps = 31/168 (18%)

Query  25   LMLGNGADVNAKDGSGNTPLLLAVCIRQEEIYNAIVKRLIESGADVNAYNKG--------  76
            L++ NGAD++      N    L  C  +      + +  I  GADVN+            
Sbjct  233  LLINNGADISKDTSKPNCEESLLHCAVRSNALECL-QIFIAEGADVNSLKPNGTNAIHLA  291

Query  77   --------LTPLYNAVFYKRQESVRMLLQEGAWLAPTFRNELHLLAELGGSNILEIILSD  128
                    L  L NA       +VR+ ++E    A      LHL A+ G    ++++L+ 
Sbjct  292  ADLGNIQCLEALLNAP--NADANVRICIREKESTA------LHLAADEGNVECVDLLLAK  343

Query  129  KRCTPDTVNLPDEKGWTPLHLAAQYYHRNCLKMLIKHGGDLTVVNSED  176
                     L + +G+TPLHLAA+    +C++ L+++G      N+ED
Sbjct  344  GA----DAKLKNHRGFTPLHLAARTSSLDCVESLLRNGN--ADANAED  385


>A0A0B4LGT2_DROME unnamed protein product
Length=969

 Score = 178 bits (452),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 168/657 (26%), Positives = 285/657 (43%), Gaps = 100/657 (15%)

Query  11   LHDAVRSGCLEAVCLMLGNGADVNAKDGSGNTPLLLA-----------------------  47
            LH AVRS  LE + + +  GADVN+   +G   + LA                       
Sbjct  238  LHCAVRSNALECLQIFIAEGADVNSLKPNGTNAIHLAADLGNIQCLEALLNAPNADANVR  297

Query  48   VCIRQEEIYN----------AIVKRLIESGADVNAYN-KGLTPLYNAVFYKRQESVRMLL  96
            +CIR++E               V  L+  GAD    N +G TPL+ A      + V  LL
Sbjct  298  ICIREKESTALHLAADEGNVECVDLLLAKGADAKLKNHRGFTPLHLAARTSSLDCVESLL  357

Query  97   QEGAW--LAPTFRNELHLLAELGGSNILEIILSDKRCTPDTVNLPDEKGWTPLHLAAQYY  154
            + G     A  F +   L A +G S     I+         VN  D  G+T LHLAA   
Sbjct  358  RNGNADANAEDFDHRTPLHAAVGKSENAYDIMETLIQWGANVNHKDIYGFTALHLAALDG  417

Query  155  HRNCLKMLIKHGGDLTVVNSEDDSVIDIIFREIIKPERIIKELLDEQILMKRTDKYKHYY  214
               C++MLI HG D+T  + +  S +++I R+      +I++ LD  I +  +    +  
Sbjct  418  LVQCVEMLIFHGADVTTKSKKGTSALNVITRKTPASVAMIRQKLDAAITLHHSQDPVNRE  477

Query  215  T---IDFTVLAPKKCRRQMEVISNVLVVASEDEKTEVLQHPVIELYLLLKWSRISYFFYL  271
                +DF  L      R++  ++  +    ++ + E+L+HP+   +L +KW +I  ++  
Sbjct  478  VELELDFRQLLQHCHPREISYLNTFV----DEGQKEILEHPLCSSFLYIKWGKIRKYYIG  533

Query  272  WISIYAVFAVFMGFYA-TLILHN-YHVLHVMKTTVKYILILTSSGLLGHAILQCVLMNRN  329
             +     F +F+  Y  T + HN Y+      TT+    +     +LG      +L N  
Sbjct  534  RLIFCFSFVLFLTLYVLTALAHNCYNGSKNDNTTIPAQELCQKQSILGD-----MLRNNP  588

Query  330  YLRRYELWMNLICTCLSLTVVIIADHTVDDSNGNAQHSNFSGAPT-------WLL-----  377
            ++   + W+      +++T+V I         G   +S+F    T       W +     
Sbjct  589  FVMEMQWWV-----LVAITIVEIFRKLY----GITGYSSFRHYVTQVENIMEWFVITSVF  639

Query  378  ---------------HATSIAVLLAWIELMLLIGRLPSLGYYALMFSTVLQNVVKVLLAF  422
                           H  + AVLL W  LML+IG+LP    Y  M++ V     K+ +A+
Sbjct  640  VISYIYTNKTYTFQNHIGAFAVLLGWTNLMLMIGQLPVFDVYVAMYTRVQGEFAKLFMAY  699

Query  423  LCLVIGFALSFSIQFRSYEQFSDPWRALVKTTVMMMGEFEYADLFADSRGGS------LL  476
             C++IGF +SF + F S   F++P+   +   VMM+GE + + L  D  G        + 
Sbjct  700  SCMLIGFTISFCVIFPSSSSFANPFMGFITVLVMMIGEQDLSLLINDPEGKDPPFLLEVS  759

Query  477  PRIIFLMFIILTSIVLMNLMVGLAVSDIQELQRRGRARKLEKRAEFLCQLEKVISSRQLN  536
             +I F++F++  +I+LMNL+VG+AV DIQ L++     KL ++ + +  +E       L 
Sbjct  760  AQITFVLFLLFVTIILMNLLVGIAVHDIQGLKKTAGLSKLVRQTKLISYIESA-----LF  814

Query  537  SKYIPTLIKRVFVRRSFVDD---KYELETSAEFHRTHRVPRRLMDSITAIAKGRKQL  590
            + Y+PT ++ +    + V     +  L          R+PR ++     + K RK  
Sbjct  815  NGYLPTWLRNLLHYTALVSPQAYRVVLCVKPLNPSEKRLPREILMKAYEVGKMRKHF  871


 Score = 55.5 bits (132),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 77/172 (45%), Gaps = 12/172 (7%)

Query  9    GGLHDAVRSGCLEAVCLMLGNGADVNAKDGSGNTPLLLAVCIRQEEIYNAIVKRLIESGA  68
              LH +  SGCL  + L++  G +VN +     TPL  A             K LI +GA
Sbjct  168  SALHLSAFSGCLATLGLLVAKGLNVNLQSKC-YTPLHCAA----FGNAAEAAKLLINNGA  222

Query  69   DV----NAYNKGLTPLYNAVFYKRQESVRMLLQEGA---WLAPTFRNELHLLAELGGSNI  121
            D+    +  N   + L+ AV     E +++ + EGA    L P   N +HL A+LG    
Sbjct  223  DISKDTSKPNCEESLLHCAVRSNALECLQIFIAEGADVNSLKPNGTNAIHLAADLGNIQC  282

Query  122  LEIILSDKRCTPDTVNLPDEKGWTPLHLAAQYYHRNCLKMLIKHGGDLTVVN  173
            LE +L+      +      EK  T LHLAA   +  C+ +L+  G D  + N
Sbjct  283  LEALLNAPNADANVRICIREKESTALHLAADEGNVECVDLLLAKGADAKLKN  334


 Score = 43.5 bits (101),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 43/168 (26%), Positives = 72/168 (43%), Gaps = 31/168 (18%)

Query  25   LMLGNGADVNAKDGSGNTPLLLAVCIRQEEIYNAIVKRLIESGADVNAYNKG--------  76
            L++ NGAD++      N    L  C  +      + +  I  GADVN+            
Sbjct  216  LLINNGADISKDTSKPNCEESLLHCAVRSNALECL-QIFIAEGADVNSLKPNGTNAIHLA  274

Query  77   --------LTPLYNAVFYKRQESVRMLLQEGAWLAPTFRNELHLLAELGGSNILEIILSD  128
                    L  L NA       +VR+ ++E    A      LHL A+ G    ++++L+ 
Sbjct  275  ADLGNIQCLEALLNAP--NADANVRICIREKESTA------LHLAADEGNVECVDLLLAK  326

Query  129  KRCTPDTVNLPDEKGWTPLHLAAQYYHRNCLKMLIKHGGDLTVVNSED  176
                     L + +G+TPLHLAA+    +C++ L+++G      N+ED
Sbjct  327  GA----DAKLKNHRGFTPLHLAARTSSLDCVESLLRNGN--ADANAED  368


 Score = 29.6 bits (65),  Expect = 9.6, Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 60/131 (46%), Gaps = 12/131 (9%)

Query  50   IRQEEIYNAIVKRLIESGADVNAYNKGLTPLYNAVFYKRQESVRMLLQEGAWLAPTFRN-  108
            I Q  +    ++   ES + +    K L  L+ A + KR + +  LL+ GA L    +N 
Sbjct  111  IEQSNVVAEGIRTHFESASKLE---KNLCYLW-AAYLKRWDLIESLLEAGADLHFCDQNG  166

Query  109  --ELHLLAELGGSNILEIILSDKRCTPDTVNLPDEKGWTPLHLAAQYYHRNCLKMLIKHG  166
               LHL A  G    L ++++        VNL   K +TPLH AA        K+LI +G
Sbjct  167  ISALHLSAFSGCLATLGLLVAKGL----NVNL-QSKCYTPLHCAAFGNAAEAAKLLINNG  221

Query  167  GDLTVVNSEDD  177
             D++   S+ +
Sbjct  222  ADISKDTSKPN  232


>Q9VHY7_DROME unnamed protein product
Length=986

 Score = 178 bits (452),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 168/657 (26%), Positives = 285/657 (43%), Gaps = 100/657 (15%)

Query  11   LHDAVRSGCLEAVCLMLGNGADVNAKDGSGNTPLLLA-----------------------  47
            LH AVRS  LE + + +  GADVN+   +G   + LA                       
Sbjct  255  LHCAVRSNALECLQIFIAEGADVNSLKPNGTNAIHLAADLGNIQCLEALLNAPNADANVR  314

Query  48   VCIRQEEIYN----------AIVKRLIESGADVNAYN-KGLTPLYNAVFYKRQESVRMLL  96
            +CIR++E               V  L+  GAD    N +G TPL+ A      + V  LL
Sbjct  315  ICIREKESTALHLAADEGNVECVDLLLAKGADAKLKNHRGFTPLHLAARTSSLDCVESLL  374

Query  97   QEGAW--LAPTFRNELHLLAELGGSNILEIILSDKRCTPDTVNLPDEKGWTPLHLAAQYY  154
            + G     A  F +   L A +G S     I+         VN  D  G+T LHLAA   
Sbjct  375  RNGNADANAEDFDHRTPLHAAVGKSENAYDIMETLIQWGANVNHKDIYGFTALHLAALDG  434

Query  155  HRNCLKMLIKHGGDLTVVNSEDDSVIDIIFREIIKPERIIKELLDEQILMKRTDKYKHYY  214
               C++MLI HG D+T  + +  S +++I R+      +I++ LD  I +  +    +  
Sbjct  435  LVQCVEMLIFHGADVTTKSKKGTSALNVITRKTPASVAMIRQKLDAAITLHHSQDPVNRE  494

Query  215  T---IDFTVLAPKKCRRQMEVISNVLVVASEDEKTEVLQHPVIELYLLLKWSRISYFFYL  271
                +DF  L      R++  ++  +    ++ + E+L+HP+   +L +KW +I  ++  
Sbjct  495  VELELDFRQLLQHCHPREISYLNTFV----DEGQKEILEHPLCSSFLYIKWGKIRKYYIG  550

Query  272  WISIYAVFAVFMGFYA-TLILHN-YHVLHVMKTTVKYILILTSSGLLGHAILQCVLMNRN  329
             +     F +F+  Y  T + HN Y+      TT+    +     +LG      +L N  
Sbjct  551  RLIFCFSFVLFLTLYVLTALAHNCYNGSKNDNTTIPAQELCQKQSILGD-----MLRNNP  605

Query  330  YLRRYELWMNLICTCLSLTVVIIADHTVDDSNGNAQHSNFSGAPT-------WLL-----  377
            ++   + W+      +++T+V I         G   +S+F    T       W +     
Sbjct  606  FVMEMQWWV-----LVAITIVEIFRKLY----GITGYSSFRHYVTQVENIMEWFVITSVF  656

Query  378  ---------------HATSIAVLLAWIELMLLIGRLPSLGYYALMFSTVLQNVVKVLLAF  422
                           H  + AVLL W  LML+IG+LP    Y  M++ V     K+ +A+
Sbjct  657  VISYIYTNKTYTFQNHIGAFAVLLGWTNLMLMIGQLPVFDVYVAMYTRVQGEFAKLFMAY  716

Query  423  LCLVIGFALSFSIQFRSYEQFSDPWRALVKTTVMMMGEFEYADLFADSRGGS------LL  476
             C++IGF +SF + F S   F++P+   +   VMM+GE + + L  D  G        + 
Sbjct  717  SCMLIGFTISFCVIFPSSSSFANPFMGFITVLVMMIGEQDLSLLINDPEGKDPPFLLEVS  776

Query  477  PRIIFLMFIILTSIVLMNLMVGLAVSDIQELQRRGRARKLEKRAEFLCQLEKVISSRQLN  536
             +I F++F++  +I+LMNL+VG+AV DIQ L++     KL ++ + +  +E       L 
Sbjct  777  AQITFVLFLLFVTIILMNLLVGIAVHDIQGLKKTAGLSKLVRQTKLISYIESA-----LF  831

Query  537  SKYIPTLIKRVFVRRSFVDD---KYELETSAEFHRTHRVPRRLMDSITAIAKGRKQL  590
            + Y+PT ++ +    + V     +  L          R+PR ++     + K RK  
Sbjct  832  NGYLPTWLRNLLHYTALVSPQAYRVVLCVKPLNPSEKRLPREILMKAYEVGKMRKHF  888


 Score = 55.1 bits (131),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 77/172 (45%), Gaps = 12/172 (7%)

Query  9    GGLHDAVRSGCLEAVCLMLGNGADVNAKDGSGNTPLLLAVCIRQEEIYNAIVKRLIESGA  68
              LH +  SGCL  + L++  G +VN +     TPL  A             K LI +GA
Sbjct  185  SALHLSAFSGCLATLGLLVAKGLNVNLQSKC-YTPLHCAA----FGNAAEAAKLLINNGA  239

Query  69   DV----NAYNKGLTPLYNAVFYKRQESVRMLLQEGA---WLAPTFRNELHLLAELGGSNI  121
            D+    +  N   + L+ AV     E +++ + EGA    L P   N +HL A+LG    
Sbjct  240  DISKDTSKPNCEESLLHCAVRSNALECLQIFIAEGADVNSLKPNGTNAIHLAADLGNIQC  299

Query  122  LEIILSDKRCTPDTVNLPDEKGWTPLHLAAQYYHRNCLKMLIKHGGDLTVVN  173
            LE +L+      +      EK  T LHLAA   +  C+ +L+  G D  + N
Sbjct  300  LEALLNAPNADANVRICIREKESTALHLAADEGNVECVDLLLAKGADAKLKN  351


 Score = 43.5 bits (101),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 43/168 (26%), Positives = 72/168 (43%), Gaps = 31/168 (18%)

Query  25   LMLGNGADVNAKDGSGNTPLLLAVCIRQEEIYNAIVKRLIESGADVNAYNKG--------  76
            L++ NGAD++      N    L  C  +      + +  I  GADVN+            
Sbjct  233  LLINNGADISKDTSKPNCEESLLHCAVRSNALECL-QIFIAEGADVNSLKPNGTNAIHLA  291

Query  77   --------LTPLYNAVFYKRQESVRMLLQEGAWLAPTFRNELHLLAELGGSNILEIILSD  128
                    L  L NA       +VR+ ++E    A      LHL A+ G    ++++L+ 
Sbjct  292  ADLGNIQCLEALLNAP--NADANVRICIREKESTA------LHLAADEGNVECVDLLLAK  343

Query  129  KRCTPDTVNLPDEKGWTPLHLAAQYYHRNCLKMLIKHGGDLTVVNSED  176
                     L + +G+TPLHLAA+    +C++ L+++G      N+ED
Sbjct  344  GA----DAKLKNHRGFTPLHLAARTSSLDCVESLLRNGN--ADANAED  385


>TRPA1_DROME unnamed protein product
Length=1197

 Score = 134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 162/629 (26%), Positives = 280/629 (45%), Gaps = 132/629 (21%)

Query  11    LHDAVRSGCLEAVCLMLGNGADVNAKDGSGNTPLLLAVCIRQEEIYNAIVKRLIESGADV  70
             LH A R G + ++  ++  GA +N K+ +  +PL  A    +   YN  V++L++S    
Sbjct  448   LHYASRDGHIRSLENLIRLGACINLKNNNNESPLHFAARYGR---YNT-VRQLLDSEKGS  503

Query  71    NAYNK----GLTPLYNAVFYKRQESVRMLLQEGAWL--APTFRNELHLLAELGGSNILEI  124
                N+    G+TPL+ +        V++LL  GA L    T RN L L A  G +  +E+
Sbjct  504   FIINESDGAGMTPLHISSQQGHTRVVQLLLNRGALLHRDHTGRNPLQLAAMSGYTETIEL  563

Query  125   ILSDKRCTPDTVNLPDEKGWTPLHLAAQYYHRNCLKMLIKHGGDLTVVNSEDDSVID--I  182
             + S      D V   D+ G T LHLA      + + +L+  G  L V N  D S ID  I
Sbjct  564   LHSVHSHLLDQV---DKDGNTALHLATMENKPHAISVLMSMGCKL-VYNVLDMSAIDYAI  619

Query  183   IFREIIKPERIIKELLDEQ----ILMKRTDKY------------KHYYTIDFTVLAPKKC  226
              ++    PE  +  +  E+    ++  R+DK+            K +  +    +    C
Sbjct  620   YYK---YPEAALAMVTHEERANEVMALRSDKHPCVTLALIASMPKVFEAVQDKCITKANC  676

Query  227   RRQME---------VISNVLVVASEDEKT------------------------EVLQHPV  253
             ++  +          +    + A  DEKT                        E+L HP+
Sbjct  677   KKDSKSFYIKYSFAFLQCPFMFAKIDEKTGESITTASPIPLPALNTMVTHGRVELLAHPL  736

Query  254   IELYLLLKWSRISYFFYLW-ISIYAVFAVFMGFYATLILHNYHV-LHVMKTTVKY-----  306
              + YL +KW+    +F+L  + IY++F VF+  Y++L+++N  +     KT  +Y     
Sbjct  737   SQKYLQMKWNSYGKYFHLANLLIYSIFLVFVTIYSSLMMNNIELKAGDNKTMSQYCNMGW  796

Query  307   ---ILILTSSGLLGH---------------AILQC-------VLMN--RNYLRRYELWM-  338
                 + L+ +  +                 AIL C       +L+N  R  ++ Y+  + 
Sbjct  797   EQLTMNLSQNPSVASQIRLDSCEERINRTTAILFCAVVIVVYILLNSMRELIQIYQQKLH  856

Query  339   ------NLICTCLSLTVVIIADHTVDDSNG-NAQHSNFSGAPTWLLHATSIAVLLAWIEL  391
                   NLI   L ++ +++         G N  H +          A SIAV L+W  L
Sbjct  857   YILETVNLISWVLYISALVMVTPAFQPDGGINTIHYS----------AASIAVFLSWFRL  906

Query  392   MLLIGRLPSLGYYALMFSTVLQNVVKVLLAFLCLVIGFALSFSIQFR-------SYEQFS  444
             +L + R   +G Y +MF  +LQ ++KVL+ F  L+I F L+F I          ++  FS
Sbjct  907   LLFLQRFDQVGIYVVMFLEILQTLIKVLMVFSILIIAFGLAFYILLSKIIDPQPNHLSFS  966

Query  445   DPWRALVKTTVMMMGEFEYADLFADS--RGGSLLPRIIFLM---FIILTSIVLMNLMVGL  499
             +   +L++T  MM+GE ++   + ++  R    +P   FL+   F+IL  I+LMNL++GL
Sbjct  967   NIPMSLLRTFSMMLGELDFVGTYVNTYYRDQLKVPMTSFLILSVFMILMPILLMNLLIGL  1026

Query  500   AVSDIQELQRRGRARKLEKRAEFLCQLEK  528
             AV DI+ ++R  + ++L  +     +LE+
Sbjct  1027  AVGDIESVRRNAQLKRLAMQVVLHTELER  1055


 Score = 50.4 bits (119),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 56/234 (24%), Positives = 100/234 (43%), Gaps = 46/234 (20%)

Query  11   LHDAVRSGCLEAVCLMLGNGADVNAKDGSGNTPLLLA---------------------VC  49
            LH AV  G ++AV L L +GA ++ +    +TP+ LA                     +C
Sbjct  270  LHSAVHGGDIKAVELCLKSGAKISTQQHDLSTPVHLACAQGAIDIVKLMFEMQPMEKRLC  329

Query  50   IRQEEI-------------YNAIVKRLIESGADVNAYNKG-LTPLYNAVFYKRQESVRML  95
            +   ++             +  IV  L+  GAD+NA +K   +PL  A      ++V +L
Sbjct  330  LSCTDVQKMTPLHCASMFDHPDIVSYLVAEGADINALDKEHRSPLLLAASRSGWKTVHLL  389

Query  96   LQEGAWLA---PTFRNELHLLAELGGSNILEIILSDKRCTPDT-----VNLPDEKGWTPL  147
            ++ GA ++      RN LH +  + G  + +       C         +N  D  G +PL
Sbjct  390  IRLGACISVKDAAARNVLHFVI-MNGGRLTDFAEQVANCQTQAQLKLLLNEKDSMGCSPL  448

Query  148  HLAAQYYHRNCLKMLIKHGGDLTVVNSEDDSVIDIIFREIIKPERIIKELLDEQ  201
            H A++  H   L+ LI+ G  + + N+ ++S +    R        +++LLD +
Sbjct  449  HYASRDGHIRSLENLIRLGACINLKNNNNESPLHFAAR--YGRYNTVRQLLDSE  500


 Score = 44.3 bits (103),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 42/136 (31%), Positives = 62/136 (46%), Gaps = 38/136 (28%)

Query  29   NGADVNAKDGSGNTPLLLAVCIRQEEIYNAIVKRLIESGADVNAYN-KGLTPLYNAVFYK  87
            NG D NAKD +GNTPL +AV   + + Y+A+   L+    D    N K   P++ A    
Sbjct  113  NG-DFNAKDNAGNTPLHIAV---ESDAYDAL-DYLLSIPVDTGVLNEKKQAPVHLATELN  167

Query  88   RQESVRMLLQEGAWLAPTFRNELHLLAELGGSNILEIILSDKRCTPDTVNLPDEKGWTPL  147
            + +S+R++ Q        +RN + +  + GG                      E G T L
Sbjct  168  KVKSLRVMGQ--------YRNVIDI--QQGG----------------------EHGRTAL  195

Query  148  HLAAQYYHRNCLKMLI  163
            HLAA Y H  C ++LI
Sbjct  196  HLAAIYDHEECARILI  211


 Score = 39.7 bits (91),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 42/188 (22%), Positives = 75/188 (40%), Gaps = 42/188 (22%)

Query  21   EAVCLMLGNGADVNAKDGSGNTPLLLAV----------------CIR-QEEIYNAIVKRL  63
            + V  ++  GAD+NA D    +PLLLA                 CI  ++     ++  +
Sbjct  351  DIVSYLVAEGADINALDKEHRSPLLLAASRSGWKTVHLLIRLGACISVKDAAARNVLHFV  410

Query  64   IESGADVNAYNK---------------------GLTPLYNAVFYKRQESVRMLLQEGAWL  102
            I +G  +  + +                     G +PL+ A       S+  L++ GA +
Sbjct  411  IMNGGRLTDFAEQVANCQTQAQLKLLLNEKDSMGCSPLHYASRDGHIRSLENLIRLGACI  470

Query  103  APTFRNE---LHLLAELGGSNILEIILSDKRCTPDTVNLPDEKGWTPLHLAAQYYHRNCL  159
                 N    LH  A  G  N +  +L  ++ +   +N  D  G TPLH+++Q  H   +
Sbjct  471  NLKNNNNESPLHFAARYGRYNTVRQLLDSEKGS-FIINESDGAGMTPLHISSQQGHTRVV  529

Query  160  KMLIKHGG  167
            ++L+  G 
Sbjct  530  QLLLNRGA  537


 Score = 38.9 bits (89),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 55/112 (49%), Gaps = 10/112 (9%)

Query  74   NKGLTPLYNAVFYKRQESVRMLLQEGAWLAPT---FRNELHLLAELGGSNILEIILS---  127
            ++G  PL++AV     ++V + L+ GA ++         +HL    G  +I++++     
Sbjct  264  SEGNVPLHSAVHGGDIKAVELCLKSGAKISTQQHDLSTPVHLACAQGAIDIVKLMFEMQP  323

Query  128  -DKRCTPDTVNLPDEKGWTPLHLAAQYYHRNCLKMLIKHGGDLTVVNSEDDS  178
             +KR     ++  D +  TPLH A+ + H + +  L+  G D+  ++ E  S
Sbjct  324  MEKRLC---LSCTDVQKMTPLHCASMFDHPDIVSYLVAEGADINALDKEHRS  372



Lambda      K        H
   0.330    0.140    0.436 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4302909968


Query= XP_018560869.2 40S ribosomal protein S12, mitochondrial-like
[Anoplophora glabripennis]

Length=157
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RT12_DROME  unnamed protein product                                   182     4e-60
RS23_DROME  unnamed protein product                                   55.8    2e-10
Q38CD1_TRYB2  unnamed protein product                                 54.3    9e-10
Q8MT86_DROME  unnamed protein product                                 28.9    1.8  
Q9VHM7_DROME  unnamed protein product                                 28.1    3.5  


>RT12_DROME unnamed protein product
Length=140

 Score = 182 bits (463),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 93/106 (88%), Gaps = 0/106 (0%)

Query  48   VSLLQMHRRGPHIKKKKKRQPLDGKPFMKGVVLKTLIKKPKKPNSANRKCVLVKLSNGKE  107
             SL QMHR GPHIK +  RQPLDGKPF KGVVLKTLIKKPKKPNSANRKCVLV+LS GKE
Sbjct  31   ASLQQMHRSGPHIKTRPPRQPLDGKPFAKGVVLKTLIKKPKKPNSANRKCVLVRLSTGKE  90

Query  108  MVAYIPGIGHNLQEHNIVLCRVGRVPDCPGVKIKCVRGKYDLGHVI  153
            MVAYIPGIGHNLQEHNIVLCRVGR+ D PGVK+K VRG YDL HV+
Sbjct  91   MVAYIPGIGHNLQEHNIVLCRVGRLQDVPGVKLKAVRGVYDLAHVV  136


>RS23_DROME unnamed protein product
Length=143

 Score = 55.8 bits (133),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 54/94 (57%), Gaps = 8/94 (9%)

Query  59   HIKKKKKRQPLDGKPFMKGVVLKTLIKKPKKPNSANRKCVLVKL-SNGKEMVAYIPGIGH  117
            H+  + K  P  G    KG+VL+ +  + K+PNSA RKCV V+L  NGK++ A++P  G 
Sbjct  31   HLGTRWKANPFGGASHAKGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPRDGS  90

Query  118  -NLQEHN--IVLCRVGR----VPDCPGVKIKCVR  144
             N  E N  +++   GR    V D PGV+ K V+
Sbjct  91   LNYIEENDEVLVAGFGRKGHAVGDIPGVRFKVVK  124


>Q38CD1_TRYB2 unnamed protein product
Length=143

 Score = 54.3 bits (129),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 54/94 (57%), Gaps = 8/94 (9%)

Query  59   HIKKKKKRQPLDGKPFMKGVVLKTLIKKPKKPNSANRKCVLVKL-SNGKEMVAYIPGIG-  116
            H    +K  P  G    KG+VL+ +    K+PNSA RKCV V+L  N K+++A++P  G 
Sbjct  31   HTFVAQKANPFGGSSHAKGIVLEKIGVGAKQPNSAIRKCVRVQLIKNDKKIIAFVPNDGC  90

Query  117  -HNLQEHNIVLCR-VGR----VPDCPGVKIKCVR  144
             H ++E++ VL    GR    V D PGV+ K V+
Sbjct  91   LHFIEENDEVLVSGFGRSGHAVGDIPGVRFKIVK  124


>Q8MT86_DROME unnamed protein product
Length=370

 Score = 28.9 bits (63),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 22/72 (31%), Positives = 36/72 (50%), Gaps = 6/72 (8%)

Query  7    IVRRIPQAPTLVSNIVKNKPLLDLSSFLSNRLSCLTIQERPVSLLQMHRRGPHIKKKKKR  66
            ++++IP AP +V    +     DL S +  R  C+  Q++ V LLQ  + G    ++KK 
Sbjct  40   LLQQIPNAPDMVCFCCQT----DLQSAMIFRRQCILQQKKWVPLLQSDKVGA--SEEKKV  93

Query  67   QPLDGKPFMKGV  78
            +P D    MK  
Sbjct  94   EPNDPSTKMKTT  105


>Q9VHM7_DROME unnamed protein product
Length=370

 Score = 28.1 bits (61),  Expect = 3.5, Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 34/64 (53%), Gaps = 6/64 (9%)

Query  7   IVRRIPQAPTLVSNIVKNKPLLDLSSFLSNRLSCLTIQERPVSLLQMHRRGPHIKKKKKR  66
           ++++IP AP +V    +     DL S +  R  C+  Q++ V LLQ  + G    ++KK 
Sbjct  40  LLQQIPNAPDMVCFCCQT----DLQSAMIFRRQCILQQKKWVPLLQSDKVGA--SEEKKV  93

Query  67  QPLD  70
           +P D
Sbjct  94  EPND  97



Lambda      K        H
   0.330    0.140    0.436 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4302909968


Query= XP_018560870.1 transcription elongation regulator 1-like
[Anoplophora glabripennis]

Length=355


***** No hits found *****



Lambda      K        H
   0.330    0.140    0.436 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4302909968


Query= XP_018560871.1 uncharacterized protein LOC108903254 isoform X1
[Anoplophora glabripennis]

Length=152
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q57XB2_TRYB2  unnamed protein product                                 30.8    0.43 
RT25_DROME  unnamed protein product                                   28.5    1.7  
ABCG5_DICDI  unnamed protein product                                  28.1    3.2  
STK11_DICDI  unnamed protein product                                  28.1    3.4  
Q7K561_DROME  unnamed protein product                                 27.3    5.8  


>Q57XB2_TRYB2 unnamed protein product
Length=3099

 Score = 30.8 bits (68),  Expect = 0.43, Method: Composition-based stats.
 Identities = 28/103 (27%), Positives = 46/103 (45%), Gaps = 23/103 (22%)

Query  50   PIVSKITEEEDIDKDG----DNPISSGVNKVRHTQEWVPGQVRHHSFIPAH-IHHIYVPI  104
            P V+K+  EE + K       NP+S GV+ +  TQ+   GQ+    F+  H +  ++V  
Sbjct  63   PTVAKVAAEEGLSKGNRAPNSNPLSDGVSNIYSTQQVTFGQL----FVLVHAVSRLHVAA  118

Query  105  LITR------DLQTVLVKPPENL-------YFYPRHYGGYGVG  134
            L +       D   +++ PP  +        F PR Y  +G G
Sbjct  119  LPSEPSERDPDCARLVLAPPGEIEQTFCQFIFTPR-YTTHGEG  160


>RT25_DROME unnamed protein product
Length=167

 Score = 28.5 bits (62),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 21/62 (34%), Positives = 29/62 (47%), Gaps = 5/62 (8%)

Query  41   NEIVKHKHVPIVSKITE----EEDIDKDGDNPISSGVNKVRHTQEWVPGQVRHHSFIPAH  96
            N+I+ H  V +V K  E    EE + +  DNP + G    RH    +PGQV     +P  
Sbjct  97   NDIIDH-LVKVVGKTREQLDAEERLKESKDNPANFGYGCGRHCICEIPGQVPCPGTVPLP  155

Query  97   IH  98
             H
Sbjct  156  DH  157


>ABCG5_DICDI unnamed protein product
Length=1509

 Score = 28.1 bits (61),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 13/41 (32%), Positives = 21/41 (51%), Gaps = 0/41 (0%)

Query  108  RDLQTVLVKPPENLYFYPRHYGGYGVGTYSGGQGAGHGFQI  148
            +D + +  + P+NL  YP  +GG  V  Y+ G+     F I
Sbjct  676  KDSELIPPRTPQNLLPYPEGFGGNQVCQYTSGEQIMDAFGI  716


>STK11_DICDI unnamed protein product
Length=586

 Score = 28.1 bits (61),  Expect = 3.4, Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 31/54 (57%), Gaps = 3/54 (6%)

Query  54   KITEEEDIDKDGDNPISSGVNKVRHTQEWVPGQVRHHSFIPAHIHHI--YVPIL  105
            KI    D+DKD  N I  G+ +V H Q +  GQ+++H +   +I  +  +VP+L
Sbjct  263  KIEFPNDLDKDLVNLIK-GILQVDHIQRFSLGQIKNHPWCIKYIPEVEPFVPLL  315


>Q7K561_DROME unnamed protein product
Length=513

 Score = 27.3 bits (59),  Expect = 5.8, Method: Composition-based stats.
 Identities = 22/79 (28%), Positives = 38/79 (48%), Gaps = 8/79 (10%)

Query  46   HKHVP--IVSKITEEEDIDKDGDNPIS-SGVNKVRHTQEWVPGQVRHHSFIPAHIHHIYV  102
            HK V    V +I E    D      I+ +G+  ++H ++W+P Q  H S I      I +
Sbjct  343  HKQVQKHYVERILERAGKDIQSMEKIAENGLKYLKHYEKWLPPQHFHMSEI-----KILL  397

Query  103  PILITRDLQTVLVKPPENL  121
              L+ +D + ++V P + L
Sbjct  398  VQLLAKDQKELMVIPDDRL  416



Lambda      K        H
   0.330    0.140    0.436 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4302909968


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Nov 3, 2023  11:39 AM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_018560872.1 uncharacterized protein LOC108903254 isoform X2
[Anoplophora glabripennis]

Length=106
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q57XB2_TRYB2  unnamed protein product                                 28.5    1.2  
RT25_DROME  unnamed protein product                                   27.7    1.4  
Q9W2Q5_DROME  unnamed protein product                                 27.7    1.6  
WHITE_DROME  unnamed protein product                                  27.3    2.7  
TRAP1_DICDI  unnamed protein product                                  26.9    3.6  


>Q57XB2_TRYB2 unnamed protein product
Length=3099

 Score = 28.5 bits (62),  Expect = 1.2, Method: Composition-based stats.
 Identities = 14/42 (33%), Positives = 23/42 (55%), Gaps = 4/42 (10%)

Query  50   PIVSKITEEEDIDKDG----DNPISSGVNKVRHTQEWVPGRV  87
            P V+K+  EE + K       NP+S GV+ +  TQ+   G++
Sbjct  63   PTVAKVAAEEGLSKGNRAPNSNPLSDGVSNIYSTQQVTFGQL  104


>RT25_DROME unnamed protein product
Length=167

 Score = 27.7 bits (60),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 33/70 (47%), Gaps = 8/70 (11%)

Query  41   NEIVKHKHVPIVSKITE----EEDIDKDGDNPISSGVNKVRHTQEWVPGRV---KSATIP  93
            N+I+ H  V +V K  E    EE + +  DNP + G    RH    +PG+V    +  +P
Sbjct  97   NDIIDHL-VKVVGKTREQLDAEERLKESKDNPANFGYGCGRHCICEIPGQVPCPGTVPLP  155

Query  94   SYQLISIIFT  103
             +    I+F 
Sbjct  156  DHMRGKILFA  165


>Q9W2Q5_DROME unnamed protein product
Length=189

 Score = 27.7 bits (60),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 15/25 (60%), Gaps = 0/25 (0%)

Query  41   NEIVKHKHVPIVSKITEEEDIDKDG  65
            NE+   +H  I  K+ EE D+D DG
Sbjct  140  NELSPEEHQQIADKVIEEADVDGDG  164


>WHITE_DROME unnamed protein product
Length=687

 Score = 27.3 bits (59),  Expect = 2.7, Method: Composition-based stats.
 Identities = 18/69 (26%), Positives = 32/69 (46%), Gaps = 0/69 (0%)

Query  20   LQAHCLTVKRSPLELGYATFPNEIVKHKHVPIVSKITEEEDIDKDGDNPISSGVNKVRHT  79
            +QA C  V++  L +G  T    ++    V +   +T  + + +         ++K +HT
Sbjct  171  MQARCAYVQQDDLFIGSLTAREHLIFQAMVRMPRHLTYRQRVARVDQVIQELSLSKCQHT  230

Query  80   QEWVPGRVK  88
               VPGRVK
Sbjct  231  IIGVPGRVK  239


>TRAP1_DICDI unnamed protein product
Length=711

 Score = 26.9 bits (58),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 0/56 (0%)

Query  38   TFPNEIVKHKHVPIVSKITEEEDIDKDGDNPISSGVNKVRHTQEWVPGRVKSATIP  93
            +F  E  K  H+   S  TE+E   ++  +  S  + KVRHTQ      ++ A+IP
Sbjct  102  SFQTETQKILHIVAESLYTEKEVFIRELISNASDAIEKVRHTQLTNASMIEDASIP  157



Lambda      K        H
   0.321    0.136    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 426081712


Query= XP_018560873.1 odorant receptor 94a-like [Anoplophora glabripennis]

Length=287
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

OR94B_DROME  unnamed protein product                                  74.3    6e-15
OR2A_DROME  unnamed protein product                                   74.3    7e-15
OR94A_DROME  unnamed protein product                                  71.6    5e-14
OR46A_DROME  unnamed protein product                                  66.2    3e-12
OR2_ANOGA  unnamed protein product                                    61.6    1e-10


>OR94B_DROME unnamed protein product
Length=383

 Score = 74.3 bits (181),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 69/243 (28%), Positives = 103/243 (42%), Gaps = 26/243 (11%)

Query  44   LPYYSWVPFGFDTGPSYLIALGYQAGPMFSYGYSISGMDALCYGLMLCIAGNLAIIQGAF  103
            LP+  +VPF + T   Y  A GY    M            LC     C++  L    G +
Sbjct  158  LPFGYYVPFEWRTRERYFYAWGYNVVAM-----------TLC-----CLSNILLDTLGCY  201

Query  104  LTIRERSLKRIKGPEWAADGLYNSACLNAAMNGEMRSICRNLQTVLNSCKDLEHLQKYVI  163
                  SL R+ G     + L N+A   A    E+R I +    V    ++ E L    +
Sbjct  202  FMFHIASLFRLLGMR--LEALKNAAEEKA--RPELRRIFQLHTKVRRLTRECEVLVSPYV  257

Query  164  LAQVSTIQMIICSCLYLVSTVPINSKQ----FYAEIVYLVAMGIQPFFLCLFGNEVTFQA  219
            L+QV     IIC   Y    V +  KQ    F   + ++  M +Q F  C +GNE+TF A
Sbjct  258  LSQVVFSAFIICFSAY--RLVHMGFKQRPGLFVTTVQFVAVMIVQIFLPCYYGNELTFHA  315

Query  220  KYMPDYLWQCDWLAADKKFKKSMIITMARLSKPVSLTAGNFASLTLTTFVSIMKASYSFF  279
              + + ++  +WL      +K +   M  L +PV + AG F  + L  FV  +  +YSFF
Sbjct  316  NALTNSVFGTNWLEYSVGTRKLLNCYMEFLKRPVKVRAGVFFEIGLPIFVKTINNAYSFF  375

Query  280  TFL  282
              L
Sbjct  376  ALL  378


>OR2A_DROME unnamed protein product
Length=397

 Score = 74.3 bits (181),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 56/88 (64%), Gaps = 0/88 (0%)

Query  195  IVYLVAMGIQPFFLCLFGNEVTFQAKYMPDYLWQCDWLAADKKFKKSMIITMARLSKPVS  254
            IV+  A+ ++ F +C FG+ +  Q++ + D  + C+W+    KFK+ ++ T+AR  +P  
Sbjct  306  IVFFSAVTLEVFVICYFGDRMRTQSEALCDAFYDCNWIEQLPKFKRELLFTLARTQRPSL  365

Query  255  LTAGNFASLTLTTFVSIMKASYSFFTFL  282
            + AGN+ +L+L TF  +M+ +YS FT L
Sbjct  366  IYAGNYIALSLETFEQVMRFTYSVFTLL  393


>OR94A_DROME unnamed protein product
Length=387

 Score = 71.6 bits (174),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 63/247 (26%), Positives = 105/247 (43%), Gaps = 23/247 (9%)

Query  43   RLPYYSWVPFGFDTGPSYLIALGYQAGPMFSYGYSISGMDAL-CYGLMLCIAGNLAIIQG  101
             LP+  +VPF +     Y  A GY    M     S   +D L CY  +  I+    ++  
Sbjct  160  ELPFAYYVPFEWQNERRYWFAYGYDMAGMTLTCISNITLDTLGCY-FLFHISLLYRLLGL  218

Query  102  AFLTIRERSLKRIKGPEWAADGLYNSACLNAAMNGEMRSICRNLQTVLNSCKDLEHLQKY  161
                 +      I G +  A  +         M+  +RS+    Q +++           
Sbjct  219  RLRETKNMKNDTIFGQQLRAIFI---------MHQRIRSLTLTCQRIVSP----------  259

Query  162  VILAQVSTIQMIICSCLYLVSTVPI--NSKQFYAEIVYLVAMGIQPFFLCLFGNEVTFQA  219
             IL+Q+    +IIC   Y +  V I  N  QF + + ++  M +Q +  C +GNE+T  A
Sbjct  260  YILSQIILSALIICFSGYRLQHVGIRDNPGQFISMLQFVSVMILQIYLPCYYGNEITVYA  319

Query  220  KYMPDYLWQCDWLAADKKFKKSMIITMARLSKPVSLTAGNFASLTLTTFVSIMKASYSFF  279
              + + ++  +WL      +K +   M  L KPV++ AGNF ++ L  FV  +  +YSF 
Sbjct  320  NQLTNEVYHTNWLECRPPIRKLLNAYMEHLKKPVTIRAGNFFAVGLPIFVKTINNAYSFL  379

Query  280  TFLKNTG  286
              L N  
Sbjct  380  ALLLNVS  386


>OR46A_DROME unnamed protein product
Length=381

 Score = 66.2 bits (160),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 56/246 (23%), Positives = 104/246 (42%), Gaps = 19/246 (8%)

Query  43   RLPYYSWVPFGFDTG-PSYLIALGYQAGPMFSYGYSISGMDALCYGLMLCIAGNLAIIQG  101
             LP  ++ P G +TG P+Y +   YQ   +     +  G D+LC  L + +   L I   
Sbjct  152  HLPLKTYNPLGENTGSPAYWLLYCYQCLALSVSCITNIGFDSLCSSLFIFLKCQLDI---  208

Query  102  AFLTIRERSLKRIKGPEWAADGLYNSACLNAAMNGEMRSICRNLQTVLNSCKDLEHLQKY  161
              L +R   + R+                   +  +++   R   T++   K +E L   
Sbjct  209  --LAVRLDKIGRLITTS------------GGTVEQQLKENIRYHMTIVELSKTVERLLCK  254

Query  162  VILAQVSTIQMIICSCLYLVSTVPINSKQFYAEIVYLVAMGIQPFFLCLFGNEVTFQAKY  221
             I  Q+    +++ +  Y ++ +     + +  + Y   M IQ F LC +  EVT ++  
Sbjct  255  PISVQIFCSVLVLTANFYAIAVLSDERLELFKYVTYQACMLIQIFILCYYAGEVTQRSLD  314

Query  222  MPDYLWQCDWLAADKKFKKSMIITMARLSKPVSLTAGNFA-SLTLTTFVSIMKASYSFFT  280
            +P  L++  W+  D + ++  ++ M RL   + +   N +    L  F SI+  SYS+F 
Sbjct  315  LPHELYKTSWVDWDYRSRRIALLFMQRLHSTLRIRTLNPSLGFDLMLFSSIVNCSYSYFA  374

Query  281  FLKNTG  286
             LK   
Sbjct  375  LLKRVN  380


>OR2_ANOGA unnamed protein product
Length=378

 Score = 61.6 bits (148),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 91/192 (47%), Gaps = 13/192 (7%)

Query  97   AIIQGAFLTIRERSLKRIKGPEWAADGLYNSACLNAAMNGEMRSICRNLQTVLNSCKDLE  156
            A++Q A L  R   L R  G   A+ G  +SA     +  E++   +  + ++    DL 
Sbjct  195  ALVQIAALKQRLGRLGRHSG-TMASTG--HSA---GTLFAELKECLKYHKQIIQYVHDLN  248

Query  157  HLQKYVILAQVSTIQMIICSCLYLVSTVPINSKQFYAEIV---YLVAMGIQPFFLCLFGN  213
             L  ++ L +  +  M++C+ L+L+S     S Q    I+   Y+  +  Q F      N
Sbjct  249  SLVTHLCLLEFLSFGMMLCALLFLLSI----SNQLAQMIMIGSYIFMILSQMFAFYWHAN  304

Query  214  EVTFQAKYMPDYLWQCDWLAADKKFKKSMIITMARLSKPVSLTAGNFASLTLTTFVSIMK  273
            EV  Q+  + D ++   W   ++  +K +I+ +AR  +P+ +  GN   +TL  F  ++ 
Sbjct  305  EVLEQSLGIGDAIYNGAWPDFEEPIRKRLILIIARAQRPMVIKVGNVYPMTLEMFQKLLN  364

Query  274  ASYSFFTFLKNT  285
             SYS+FT L+  
Sbjct  365  VSYSYFTLLRRV  376



Lambda      K        H
   0.321    0.136    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 426081712


Query= XP_018560874.1 ecdysone receptor isoform X4 [Anoplophora
glabripennis]

Length=485
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ECR_DROME  unnamed protein product                                    553     0.0  
ECR_HELVI  unnamed protein product                                    521     0.0  
HR38_DROME  unnamed protein product                                   159     1e-41
E75BC_DROME  unnamed protein product                                  152     2e-39
E75BB_DROME  unnamed protein product                                  152     3e-39


>ECR_DROME unnamed protein product
Length=878

 Score = 553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/427 (65%), Positives = 324/427 (76%), Gaps = 33/427 (8%)

Query  88   SGREDLSPPSSLNGYSAD-SCDAKK-KKGPTPRQQEELCLVCGDRASGYHYNALTCEGCK  145
            SGR+DLSP SSLNGYSA+ SCDAKK KKGP PR QEELCLVCGDRASGYHYNALTCEGCK
Sbjct  226  SGRDDLSPSSSLNGYSANESCDAKKSKKGPAPRVQEELCLVCGDRASGYHYNALTCEGCK  285

Query  146  GFFRRSITKNAVYQCKYGNNCEIDMYMRRKCQECRLKKCLSVGMRPECVVPEVQCAVKRK  205
            GFFRRS+TK+AVY CK+G  CE+DMYMRRKCQECRLKKCL+VGMRPECVVPE QCA+KR+
Sbjct  286  GFFRRSVTKSAVYCCKFGRACEMDMYMRRKCQECRLKKCLAVGMRPECVVPENQCAMKRR  345

Query  206  EKKAQKEKDK----PNS--------TTNGSPEMIKLE---------------PELSDS--  236
            EKKAQKEKDK    P+S         + G  + +K E               P L D   
Sbjct  346  EKKAQKEKDKMTTSPSSQHGGNGSLASGGGQDFVKKEILDLMTCEPPQHATIPLLPDEIL  405

Query  237  EKTLTNGVKPISPEQEELIHRLVYFQNEYEHPSEEDVKRIINQPMEGEDQCDIRFRHITE  296
             K     +  ++  Q  +I++L+++Q+ YE PSEED++RI++QP E E Q D+ FRHITE
Sbjct  406  AKCQARNIPSLTYNQLAVIYKLIWYQDGYEQPSEEDLRRIMSQPDENESQTDVSFRHITE  465

Query  297  ITILTVQLIVEFAKRLPGFDKLLREDQIALLKACSSEVMMFRMARRYDVQSDSILFVNNQ  356
            ITILTVQLIVEFAK LP F K+ +EDQI LLKACSSEVMM RMARRYD  SDSI F NN+
Sbjct  466  ITILTVQLIVEFAKGLPAFTKIPQEDQITLLKACSSEVMMLRMARRYDHSSDSIFFANNR  525

Query  357  PYSRDSYNLAGMGETIEDLLHFCRTMYSMKVDNAEYALLTAIVIFSERPALIEGWKVEKI  416
             Y+RDSY +AGM + IEDLLHFCR M+SMKVDN EYALLTAIVIFS+RP L +   VE I
Sbjct  526  SYTRDSYKMAGMADNIEDLLHFCRQMFSMKVDNVEYALLTAIVIFSDRPGLEKAQLVEAI  585

Query  417  QEIYLEALRAYVDNRRKPRPGTI--FAKLLSVLTELRTLGNQNSEMCFSLKLKNKKLPPF  474
            Q  Y++ LR Y+ NR      ++  +AKLLS+LTELRTLGNQN+EMCFSLKLKN+KLP F
Sbjct  586  QSYYIDTLRIYILNRHCGDSMSLVFYAKLLSILTELRTLGNQNAEMCFSLKLKNRKLPKF  645

Query  475  LAEIWDV  481
            L EIWDV
Sbjct  646  LEEIWDV  652


>ECR_HELVI unnamed protein product
Length=576

 Score = 521 bits (1343),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/500 (57%), Positives = 339/500 (68%), Gaps = 46/500 (9%)

Query  24   TLLMSPHNSLASTDIGDVDLELWDLD---LNHQNQARGFIIQNGYVIQGHTVIGNSAAIA  80
             ++MSP  SLAS +IG   LELW  D        Q+ G         Q       +  + 
Sbjct  51   AMVMSPE-SLASPEIGG--LELWGYDDGITYSMAQSLGTCTMEQQQPQPQQQPQQTQPLP  107

Query  81   -----------KSDTSSMS-GREDLSPPSSLNGYSADSCDAKKKKGPTPRQQEELCLVCG  128
                       KS+  SMS GRE+LSP SS+NG S D    ++KKGP PRQQEELCLVCG
Sbjct  108  SMPLPMPPTTPKSENESMSSGREELSPASSVNGCSTDGEARRQKKGPAPRQQEELCLVCG  167

Query  129  DRASGYHYNALTCEGCKGFFRRSITKNAVYQCKYGNNCEIDMYMRRKCQECRLKKCLSVG  188
            DRASGYHYNALTCEGCKGFFRRS+TKNAVY CK+G+ CE+D+YMRRKCQECRLKKCL+VG
Sbjct  168  DRASGYHYNALTCEGCKGFFRRSVTKNAVYICKFGHACEMDIYMRRKCQECRLKKCLAVG  227

Query  189  MRPECVVPEVQCAVKRKEKKAQKEKDK-PNSTT---NGSPEMIKLEPELSDSEKTL----  240
            MRPECVVPE QCA+KRKEKKAQ+EKDK P STT   +  P +++ +P   ++ + L    
Sbjct  228  MRPECVVPENQCAMKRKEKKAQREKDKLPVSTTTVDDHMPPIMQCDPPPPEAARILECVQ  287

Query  241  -----------------TNGVKPISPEQEELIHRLVYFQNEYEHPSEEDVKRIINQPMEG  283
                                V P++  Q+ LI RLV++Q  YE PSEED+KR + Q  E 
Sbjct  288  HEVVPRFLNEKLMEQNRLKNVPPLTANQKSLIARLVWYQEGYEQPSEEDLKR-VTQSDED  346

Query  284  EDQCDIRFRHITEITILTVQLIVEFAKRLPGFDKLLREDQIALLKACSSEVMMFRMARRY  343
            ++  D+ FR ITE+TILTVQLIVEFAK LPGF K+ + DQI LLKACSSEVMM R+ARRY
Sbjct  347  DEDSDMPFRQITEMTILTVQLIVEFAKGLPGFAKISQSDQITLLKACSSEVMMLRVARRY  406

Query  344  DVQSDSILFVNNQPYSRDSYNLAGMGETIEDLLHFCRTMYSMKVDNAEYALLTAIVIFSE  403
            D  +DS+LF NNQ Y+RD+Y  AGM   IEDLLHFCR MYSM +DN  YALLTAIVIFS+
Sbjct  407  DAATDSVLFANNQAYTRDNYRKAGMAYVIEDLLHFCRCMYSMMMDNVHYALLTAIVIFSD  466

Query  404  RPALIEGWKVEKIQEIYLEALRAYV--DNRRKPRPGTIFAKLLSVLTELRTLGNQNSEMC  461
            RP L +   VE+IQ  YL  LR Y+   N   PR   IF ++L +LTE+RTLG QNS MC
Sbjct  467  RPGLEQPLLVEEIQRYYLNTLRVYILNQNSASPRGAVIFGEILGILTEIRTLGMQNSNMC  526

Query  462  FSLKLKNKKLPPFLAEIWDV  481
             SLKLKN+KLPPFL EIWDV
Sbjct  527  ISLKLKNRKLPPFLEEIWDV  546


>HR38_DROME unnamed protein product
Length=1073

 Score = 159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 111/357 (31%), Positives = 174/357 (49%), Gaps = 35/357 (10%)

Query  122   ELCLVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYQCKYGNNCEIDMYMRRKCQECRL  181
             +LC VCGD A+  HY   TCEGCKGFF+R++ K + Y C    NC +D   R +CQ CR 
Sbjct  742   QLCAVCGDTAACQHYGVRTCEGCKGFFKRTVQKGSKYVCLADKNCPVDKRRRNRCQFCRF  801

Query  182   KKCLSVGMRPECVVPEVQCAVKRKEKKAQKEKDKPNSTTNGSPEMIKLEPELSDSEKTLT  241
             +KCL VGM  E V         R+ +   K K    S  +    +I            L 
Sbjct  802   QKCLVVGMVKEVV--RTDSLKGRRGRLPSKPKSPQESPPSPPISLI----------TALV  849

Query  242   NGVKPISPEQEELIHRLVYFQNEYEHPSEEDVKRIINQPMEGEDQCDIRFRHITEITILT  301
                   +P+   L         +Y H  E        Q M   D+    ++ +T     +
Sbjct  850   RSHVDTTPDPSCL---------DYSHYEE--------QSMSEADKVQQFYQLLTS----S  888

Query  302   VQLIVEFAKRLPGFDKLLREDQIALLKACSSEVMMFRMARRYDVQSDSILFVNNQPYSRD  361
             V +I +FA+++PG+  LL EDQ  L ++ S E+ + R+A R  +    ++F N     R 
Sbjct  889   VDVIKQFAEKIPGYFDLLPEDQELLFQSASLELFVLRLAYRARIDDTKLIFCNGTVLHR-  947

Query  362   SYNLAGMGETIEDLLHFCRTMYSMKVDNAEYALLTAIVIFSERPALIEGWKVEKIQEIYL  421
             +  L   GE + D++ F R+++++++D + +A L A+ + +ER  L E  KVE++Q   +
Sbjct  948   TQCLRSFGEWLNDIMEFSRSLHNLEIDISAFACLCALTLITERHGLREPKKVEQLQMKII  1007

Query  422   EALRAYVD-NRRKPRPGTIFAKLLSVLTELRTLGNQNSEMCFSLKLKNKKLPPFLAE  477
              +LR +V  N    +    F++LL  L ELR+L  Q  +  F LKL++    P L E
Sbjct  1008  GSLRDHVTYNAEAQKKQHYFSRLLGKLPELRSLSVQGLQRIFYLKLEDLVPAPALIE  1064


>E75BC_DROME unnamed protein product
Length=1199

 Score = 152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 112/375 (30%), Positives = 181/375 (48%), Gaps = 36/375 (10%)

Query  123  LCLVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYQ-CKYGNNCEIDMYMRRKCQECRL  181
            LC VCGD+ASG+HY   +CEGCKGFFRRSI +   Y+ C     C I    R +CQ CRL
Sbjct  244  LCRVCGDKASGFHYGVHSCEGCKGFFRRSIQQKIQYRPCTKNQQCSILRINRNRCQYCRL  303

Query  182  KKCLSVGMRPECV----VPEVQCAVKRKEKKAQKEKDKPNSTTNGSPEMIKLEPELSDSE  237
            KKC++VGM  + V    VP        K +KA+       ST N   +   L  EL D  
Sbjct  304  KKCIAVGMSRDAVRFGRVP--------KREKARILAAMQQSTQNRG-QQRALATELDDQP  354

Query  238  KTLTNGVKP------ISPEQEELIHRLVYFQNEYEHPSEEDVKRIINQPMEGEDQCDIRF  291
            + L   ++        + E+   + +       Y  P+           ++ E +   RF
Sbjct  355  RLLAAVLRAHLETCEFTKEKVSAMRQRARDCPSYSMPTLLACPLNPAPELQSEQEFSQRF  414

Query  292  RHITEITILTVQLIVEFAKRLPGFDKLLREDQIALLKACSSEVMMFRMARRYDVQSDSIL  351
             H+       ++ +++FA  +PGF  L ++D+  LLKA   + +  R+   +D   +SI+
Sbjct  415  AHV-------IRGVIDFAGMIPGFQLLTQDDKFTLLKAGLFDALFVRLICMFDSSINSII  467

Query  352  FVNNQPYSRDSY-NLAGMGETIEDLLHFCRTMYSMKVDNAEYALLTAIVIFS-ERPALIE  409
             +N Q   RD+  N A     ++   +F   M SM + +AE  L  AIV+ + +RP L  
Sbjct  468  CLNGQVMRRDAIQNGANARFLVDSTFNFAERMNSMNLTDAEIGLFCAIVLITPDRPGL--  525

Query  410  GWKVEKIQEIY--LEALRAYVDNRRKPRPGTIFAKLLSVLTELRTLGNQNSEMCFSLKLK  467
               +E I+++Y  L+    Y+  + +P      AKLL  + +LRTL   ++E     + +
Sbjct  526  -RNLELIEKMYSRLKGCLQYIVAQNRPDQPEFLAKLLETMPDLRTLSTLHTEKLVVFRTE  584

Query  468  NKKLPPFLAEIWDVD  482
            +K+L     ++W ++
Sbjct  585  HKEL--LRQQMWSME  597


>E75BB_DROME unnamed protein product
Length=1412

 Score = 152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 112/375 (30%), Positives = 181/375 (48%), Gaps = 36/375 (10%)

Query  123  LCLVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYQ-CKYGNNCEIDMYMRRKCQECRL  181
            LC VCGD+ASG+HY   +CEGCKGFFRRSI +   Y+ C     C I    R +CQ CRL
Sbjct  457  LCRVCGDKASGFHYGVHSCEGCKGFFRRSIQQKIQYRPCTKNQQCSILRINRNRCQYCRL  516

Query  182  KKCLSVGMRPECV----VPEVQCAVKRKEKKAQKEKDKPNSTTNGSPEMIKLEPELSDSE  237
            KKC++VGM  + V    VP        K +KA+       ST N   +   L  EL D  
Sbjct  517  KKCIAVGMSRDAVRFGRVP--------KREKARILAAMQQSTQNRG-QQRALATELDDQP  567

Query  238  KTLTNGVKP------ISPEQEELIHRLVYFQNEYEHPSEEDVKRIINQPMEGEDQCDIRF  291
            + L   ++        + E+   + +       Y  P+           ++ E +   RF
Sbjct  568  RLLAAVLRAHLETCEFTKEKVSAMRQRARDCPSYSMPTLLACPLNPAPELQSEQEFSQRF  627

Query  292  RHITEITILTVQLIVEFAKRLPGFDKLLREDQIALLKACSSEVMMFRMARRYDVQSDSIL  351
             H+       ++ +++FA  +PGF  L ++D+  LLKA   + +  R+   +D   +SI+
Sbjct  628  AHV-------IRGVIDFAGMIPGFQLLTQDDKFTLLKAGLFDALFVRLICMFDSSINSII  680

Query  352  FVNNQPYSRDSY-NLAGMGETIEDLLHFCRTMYSMKVDNAEYALLTAIVIFS-ERPALIE  409
             +N Q   RD+  N A     ++   +F   M SM + +AE  L  AIV+ + +RP L  
Sbjct  681  CLNGQVMRRDAIQNGANARFLVDSTFNFAERMNSMNLTDAEIGLFCAIVLITPDRPGL--  738

Query  410  GWKVEKIQEIY--LEALRAYVDNRRKPRPGTIFAKLLSVLTELRTLGNQNSEMCFSLKLK  467
               +E I+++Y  L+    Y+  + +P      AKLL  + +LRTL   ++E     + +
Sbjct  739  -RNLELIEKMYSRLKGCLQYIVAQNRPDQPEFLAKLLETMPDLRTLSTLHTEKLVVFRTE  797

Query  468  NKKLPPFLAEIWDVD  482
            +K+L     ++W ++
Sbjct  798  HKEL--LRQQMWSME  810



Lambda      K        H
   0.321    0.136    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 426081712


Query= XP_018560876.1 putative nuclease HARBI1 [Anoplophora glabripennis]

Length=324
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9XUU8_CAEEL  unnamed protein product                                 33.9    0.21 
KC1A_CAEEL  unnamed protein product                                   28.9    6.6  
HDA2_CAEEL  unnamed protein product                                   28.5    8.0  
LMPB_DICDI  unnamed protein product                                   28.5    8.6  


>Q9XUU8_CAEEL unnamed protein product
Length=686

 Score = 33.9 bits (76),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 22/104 (21%), Positives = 41/104 (39%), Gaps = 7/104 (7%)

Query  55   CHQLSLAFFGGMDKSTVNRIIKRVTLAICHLSQQYIK-----LPETEDQKRNIQLEFFGI  109
            CH +++     M K    +++K  TL +C  S    K     + +++ +     LE    
Sbjct  389  CHDVTIYKISPMVKKINRKVVKTATLDVCATSLSITKNLRFYVAKSDFEVLEFDLETENG  448

Query  110  AAFPKVIGAVDCTHIK--IQSPGGDDAEIFRNRKNFFSLNVQAA  151
                 +I   DC  +   + SP G+   +   R   FS+N +  
Sbjct  449  KELKSIISQADCGSVSRMVSSPCGNYICVLTTRSQIFSINTETG  492


>KC1A_CAEEL unnamed protein product
Length=341

 Score = 28.9 bits (63),  Expect = 6.6, Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 32/67 (48%), Gaps = 7/67 (10%)

Query  1    MSDLLFFQHFRLKKETVLFLLQKIEDRIEYDHNWN---NSVSPINQLLICLRYYATGCHQ  57
            + DL  F   R   +TVL L  ++  RIEY H  N     + P N L+   R+    C++
Sbjct  96   LEDLFNFCSRRFTMKTVLMLADQMIGRIEYVHVKNFIHRDIKPDNFLMGIGRH----CNK  151

Query  58   LSLAFFG  64
            L L  FG
Sbjct  152  LFLIDFG  158


>HDA2_CAEEL unnamed protein product
Length=507

 Score = 28.5 bits (62),  Expect = 8.0, Method: Compositional matrix adjust.
 Identities = 14/44 (32%), Positives = 23/44 (52%), Gaps = 4/44 (9%)

Query  131  GDDAEIFRNRKNFFSL----NVQAAVDANYKFLNLVARWPGSTH  170
            G+D  IF    ++ +L    +V+ A   N+K  ++V  WPG  H
Sbjct  118  GEDCPIFAGLWDYCTLYAGGSVEGARRLNHKMNDIVINWPGGLH  161


>LMPB_DICDI unnamed protein product
Length=755

 Score = 28.5 bits (62),  Expect = 8.6, Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 17/25 (68%), Gaps = 0/25 (0%)

Query  235  TFGIWKRRFPILAYGVRTKLQLTMH  259
            +F +WKR FPI+A G R   + T++
Sbjct  118  SFKLWKRYFPIVADGYRDPTKDTIY  142



Lambda      K        H
   0.321    0.136    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 426081712


Query= XP_018560877.1 serine/threonine-protein kinase SIK2 isoform X1
[Anoplophora glabripennis]

Length=884
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9W532_DROME  unnamed protein product                                 523     4e-167
O77268_DROME  unnamed protein product                                 523     5e-167
E1JGM9_DROME  unnamed protein product                                 397     6e-125
Q963E6_DROME  unnamed protein product                                 397     6e-125
Q6NPA6_DROME  unnamed protein product                                 396     1e-124


>Q9W532_DROME unnamed protein product
Length=1398

 Score = 523 bits (1347),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 242/330 (73%), Positives = 278/330 (84%), Gaps = 13/330 (4%)

Query  9    KNPIRVGFYDIERTIGKGNFAVVKLAKHRITKTEVAIKIIDKSQLDASNLQKVYREVDIM  68
            K P+RVGFYDIERTIGKGNFAVVKLA+HRITK EVAIKIIDKSQLD +NLQKVYREV+IM
Sbjct  133  KEPMRVGFYDIERTIGKGNFAVVKLARHRITKNEVAIKIIDKSQLDQTNLQKVYREVEIM  192

Query  69   KRLDHPHIIKLYQVMETKNMIYLVSEYASQGEIFDYIARYGRMTEDQSRVKFWQILSAVE  128
            KRL HPHIIKLYQVMETKNMIY+VSEYASQGEIFDYIA+YGRM+E  +R KFWQI+SAVE
Sbjct  193  KRLKHPHIIKLYQVMETKNMIYIVSEYASQGEIFDYIAKYGRMSESAARFKFWQIISAVE  252

Query  129  YCHNRNIVHRDLKAENLLLDSNNNIKIADFGFSNYYTTGGQLSTWCGSPPYAAPEVFEGK  188
            YCH + IVHRDLKAENLLLD N NIKIADFGFSN++  G  L+TWCGSPPYAAPEVFEGK
Sbjct  253  YCHKKGIVHRDLKAENLLLDLNMNIKIADFGFSNHFKPGELLATWCGSPPYAAPEVFEGK  312

Query  189  KYVGPEIDIWSLGVVLYVLVCGALPFDGCSLQALRDRVLSGRFRIPYFMSSDCESLIRKM  248
            +Y GPEIDIWSLGVVLYVLVCGALPFDG +LQ+LRDRVLSGRFRIP+FMSS+CE LIR+M
Sbjct  313  QYTGPEIDIWSLGVVLYVLVCGALPFDGSTLQSLRDRVLSGRFRIPFFMSSECEHLIRRM  372

Query  249  LVLEPNKRFSIQQIKKHRWMQMGVPPTLPPTISV---------SNTQPNEQILRLM-QSL  298
            LVLEP +R++I QIK+HRWM    P  L   +           ++ +P+E ILR+M + +
Sbjct  373  LVLEPTRRYTIDQIKRHRWM---CPELLEHVLIAKYNLGAERQTSVEPSEDILRIMAEYV  429

Query  299  GIDSSKTRESIRLGSYDHHAAIYYLLLDKL  328
            GI S KTR S++  +YDH AAIY LL D++
Sbjct  430  GIGSDKTRASLKKNTYDHVAAIYLLLQDRV  459


 Score = 66.2 bits (160),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 111/382 (29%), Positives = 149/382 (39%), Gaps = 124/382 (32%)

Query  365   TSEDCRRLLQHSTTA------------------PTASNSKISSI--PRTCDSPPAHGIDA  404
             ++EDCR LLQ ST                    P AS +  SS   P +  +P    I+ 
Sbjct  678   STEDCRALLQQSTAVAEGKDDPPKAESSVGGVPPPASTTPTSSTAGPESGSAPCPGEING  737

Query  405   A--KLLAATNSEDALKILNQASTKTTFSMCSEATKLMSTLQMSAIPSASADPTLFKDYSH  462
                K +++++S D+   L Q+     + M +EA+KL  TLQ S +P            S 
Sbjct  738   KTIKTMSSSSSFDSKANLGQS---FRYKMSAEASKLFQTLQESPLPVEQRTKRRVHVGST  794

Query  463   QGNPYAYAQTTSVCPQPFDIHESKGSIGRFNTSGYKSSEIQTQYSSSTDEGVETDL-EDH  521
              G+     Q T+                + N       ++  Q SSSTDEG ETD   D 
Sbjct  795   NGSGGDSGQETNDA--------------KSNGDSRSEKKVLAQGSSSTDEGCETDQGNDP  840

Query  522   GP-----------------------------RL-------------SYASSSSSSGVVTN  539
             G                              RL             SYASSSSSSGV+  
Sbjct  841   GSASQESKGSNGGGSGNANGGPTSHSSSDLTRLVGTTTSGQSHKMRSYASSSSSSGVLAG  900

Query  540   --FNTSKSLSQNLS-------CDSNFESLEYPLSESSELTSSLPSC---TSTEKQPEPII  587
                + SKSLSQNLS       C   ++SL++ L        SLPSC   +S    P P  
Sbjct  901   SAGSYSKSLSQNLSRGSSKSNCSGPYDSLDFALPSGK---GSLPSCMGSSSMLATPTPAS  957

Query  588   TSSSALSTHNYLSPRYVLHKHNPLVHM-SSLKTTRGV-----------------------  623
              S + +S+  + S R +   HN  +HM  +L    G+                       
Sbjct  958   ASPAGISS-EHSSERSLYGSHNSCIHMPGALPLGLGLPQSSASTPTPNPTPPPNGGGVTF  1016

Query  624   --TRSPVDFREGRRASDGLVAQ  643
                RSP+ FREGRRASDGLVAQ
Sbjct  1017  LDKRSPIHFREGRRASDGLVAQ  1038


>O77268_DROME unnamed protein product
Length=1398

 Score = 523 bits (1346),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 242/330 (73%), Positives = 278/330 (84%), Gaps = 13/330 (4%)

Query  9    KNPIRVGFYDIERTIGKGNFAVVKLAKHRITKTEVAIKIIDKSQLDASNLQKVYREVDIM  68
            K P+RVGFYDIERTIGKGNFAVVKLA+HRITK EVAIKIIDKSQLD +NLQKVYREV+IM
Sbjct  133  KEPMRVGFYDIERTIGKGNFAVVKLARHRITKNEVAIKIIDKSQLDQTNLQKVYREVEIM  192

Query  69   KRLDHPHIIKLYQVMETKNMIYLVSEYASQGEIFDYIARYGRMTEDQSRVKFWQILSAVE  128
            KRL HPHIIKLYQVMETKNMIY+VSEYASQGEIFDYIA+YGRM+E  +R KFWQI+SAVE
Sbjct  193  KRLKHPHIIKLYQVMETKNMIYIVSEYASQGEIFDYIAKYGRMSESAARFKFWQIISAVE  252

Query  129  YCHNRNIVHRDLKAENLLLDSNNNIKIADFGFSNYYTTGGQLSTWCGSPPYAAPEVFEGK  188
            YCH + IVHRDLKAENLLLD N NIKIADFGFSN++  G  L+TWCGSPPYAAPEVFEGK
Sbjct  253  YCHKKGIVHRDLKAENLLLDLNMNIKIADFGFSNHFKPGELLATWCGSPPYAAPEVFEGK  312

Query  189  KYVGPEIDIWSLGVVLYVLVCGALPFDGCSLQALRDRVLSGRFRIPYFMSSDCESLIRKM  248
            +Y GPEIDIWSLGVVLYVLVCGALPFDG +LQ+LRDRVLSGRFRIP+FMSS+CE LIR+M
Sbjct  313  QYTGPEIDIWSLGVVLYVLVCGALPFDGSTLQSLRDRVLSGRFRIPFFMSSECEHLIRRM  372

Query  249  LVLEPNKRFSIQQIKKHRWMQMGVPPTLPPTISV---------SNTQPNEQILRLM-QSL  298
            LVLEP +R++I QIK+HRWM    P  L   +           ++ +P+E ILR+M + +
Sbjct  373  LVLEPTRRYTIDQIKRHRWM---CPELLEHVLIAKYNLGAERQTSVEPSEDILRIMAEYV  429

Query  299  GIDSSKTRESIRLGSYDHHAAIYYLLLDKL  328
            GI S KTR S++  +YDH AAIY LL D++
Sbjct  430  GIGSDKTRASLKKNTYDHVAAIYLLLQDRV  459


 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 111/382 (29%), Positives = 149/382 (39%), Gaps = 124/382 (32%)

Query  365   TSEDCRRLLQHSTTA------------------PTASNSKISSI--PRTCDSPPAHGIDA  404
             ++EDCR LLQ ST                    P AS +  SS   P +  +P    I+ 
Sbjct  678   STEDCRALLQQSTAVAEGKDDPPKAESSVGGVPPPASTTPTSSTAGPESGSAPCPGEING  737

Query  405   A--KLLAATNSEDALKILNQASTKTTFSMCSEATKLMSTLQMSAIPSASADPTLFKDYSH  462
                K +++++S D+   L Q+     + M +EA+KL  TLQ S +P            S 
Sbjct  738   KTIKTMSSSSSFDSKANLGQS---FRYKMSAEASKLFQTLQESPLPVEQRTKRRVHVGST  794

Query  463   QGNPYAYAQTTSVCPQPFDIHESKGSIGRFNTSGYKSSEIQTQYSSSTDEGVETDL-EDH  521
              G+     Q T+                + N       ++  Q SSSTDEG ETD   D 
Sbjct  795   NGSGGDSGQETNDA--------------KSNGDSRSEKKVLAQGSSSTDEGCETDQGNDP  840

Query  522   GP-----------------------------RL-------------SYASSSSSSGVVTN  539
             G                              RL             SYASSSSSSGV+  
Sbjct  841   GSASQESKGSNGGGSGNANGGPTSHSSSDLTRLVGTTASGQSHKMRSYASSSSSSGVLAG  900

Query  540   --FNTSKSLSQNLS-------CDSNFESLEYPLSESSELTSSLPSC---TSTEKQPEPII  587
                + SKSLSQNLS       C   ++SL++ L        SLPSC   +S    P P  
Sbjct  901   SAGSYSKSLSQNLSRGSSKSNCSGPYDSLDFALPSGK---GSLPSCMGSSSMLATPTPAS  957

Query  588   TSSSALSTHNYLSPRYVLHKHNPLVHM-SSLKTTRGV-----------------------  623
              S + +S+  + S R +   HN  +HM  +L    G+                       
Sbjct  958   ASPAGISS-EHSSERSLYGSHNSCIHMPGALPLGLGLPQSSASTPTPNPTPPPNGGGVTF  1016

Query  624   --TRSPVDFREGRRASDGLVAQ  643
                RSP+ FREGRRASDGLVAQ
Sbjct  1017  LDKRSPIHFREGRRASDGLVAQ  1038


>E1JGM9_DROME unnamed protein product
Length=827

 Score = 397 bits (1019),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 181/315 (57%), Positives = 236/315 (75%), Gaps = 1/315 (0%)

Query  14   VGFYDIERTIGKGNFAVVKLAKHRITKTEVAIKIIDKSQLDASNLQKVYREVDIMKRLDH  73
            +G Y + +TIGKGNFA VKLAKH  T  EVAIKIIDK+QL+  +LQK++REV IMK LDH
Sbjct  250  IGKYKLIKTIGKGNFAKVKLAKHLPTGKEVAIKIIDKTQLNPGSLQKLFREVRIMKMLDH  309

Query  74   PHIIKLYQVMETKNMIYLVSEYASQGEIFDYIARYGRMTEDQSRVKFWQILSAVEYCHNR  133
            P+I+KL+QV+ET+  +YL+ EYAS GE+FDY+  +GRM E ++RVKF QI+SAV+YCH +
Sbjct  310  PNIVKLFQVIETEKTLYLIMEYASGGEVFDYLVLHGRMKEKEARVKFRQIVSAVQYCHQK  369

Query  134  NIVHRDLKAENLLLDSNNNIKIADFGFSNYYTTGGQLSTWCGSPPYAAPEVFEGKKYVGP  193
             I+HRDLKAENLLLDS  NIKIADFGFSN +T G +L T+CGSPPYAAPE+F+GKKY GP
Sbjct  370  RIIHRDLKAENLLLDSELNIKIADFGFSNEFTPGSKLDTFCGSPPYAAPELFQGKKYDGP  429

Query  194  EIDIWSLGVVLYVLVCGALPFDGCSLQALRDRVLSGRFRIPYFMSSDCESLIRKMLVLEP  253
            E+D+WSLGV+LY LV G+LPFDG +L+ LR+RVL G++RIP++MS+DCE+L+RK LVL P
Sbjct  430  EVDVWSLGVILYTLVSGSLPFDGSTLRELRERVLRGKYRIPFYMSTDCENLLRKFLVLNP  489

Query  254  NKRFSIQQIKKHRWMQMGVPPT-LPPTISVSNTQPNEQILRLMQSLGIDSSKTRESIRLG  312
             KR S++ I   +WM MG     L P I       + + +  + ++G + S+   S+   
Sbjct  490  AKRASLETIMGDKWMNMGFEEDELKPYIEPKADLADPKRIEALVAMGYNRSEIEASLSQV  549

Query  313  SYDHHAAIYYLLLDK  327
             YD   A Y LL  K
Sbjct  550  RYDDVFATYLLLGRK  564


>Q963E6_DROME unnamed protein product
Length=832

 Score = 397 bits (1020),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 181/315 (57%), Positives = 236/315 (75%), Gaps = 1/315 (0%)

Query  14   VGFYDIERTIGKGNFAVVKLAKHRITKTEVAIKIIDKSQLDASNLQKVYREVDIMKRLDH  73
            +G Y + +TIGKGNFA VKLAKH  T  EVAIKIIDK+QL+  +LQK++REV IMK LDH
Sbjct  250  IGKYKLIKTIGKGNFAKVKLAKHLPTGKEVAIKIIDKTQLNPGSLQKLFREVRIMKMLDH  309

Query  74   PHIIKLYQVMETKNMIYLVSEYASQGEIFDYIARYGRMTEDQSRVKFWQILSAVEYCHNR  133
            P+I+KL+QV+ET+  +YL+ EYAS GE+FDY+  +GRM E ++RVKF QI+SAV+YCH +
Sbjct  310  PNIVKLFQVIETEKTLYLIMEYASGGEVFDYLVLHGRMKEKEARVKFRQIVSAVQYCHQK  369

Query  134  NIVHRDLKAENLLLDSNNNIKIADFGFSNYYTTGGQLSTWCGSPPYAAPEVFEGKKYVGP  193
             I+HRDLKAENLLLDS  NIKIADFGFSN +T G +L T+CGSPPYAAPE+F+GKKY GP
Sbjct  370  RIIHRDLKAENLLLDSELNIKIADFGFSNEFTPGSKLDTFCGSPPYAAPELFQGKKYDGP  429

Query  194  EIDIWSLGVVLYVLVCGALPFDGCSLQALRDRVLSGRFRIPYFMSSDCESLIRKMLVLEP  253
            E+D+WSLGV+LY LV G+LPFDG +L+ LR+RVL G++RIP++MS+DCE+L+RK LVL P
Sbjct  430  EVDVWSLGVILYTLVSGSLPFDGSTLRELRERVLRGKYRIPFYMSTDCENLLRKFLVLNP  489

Query  254  NKRFSIQQIKKHRWMQMGVPPT-LPPTISVSNTQPNEQILRLMQSLGIDSSKTRESIRLG  312
             KR S++ I   +WM MG     L P I       + + +  + ++G + S+   S+   
Sbjct  490  AKRASLETIMGDKWMNMGFEEDELKPYIEPKADLADPKRIEALVAMGYNRSEIEASLSQV  549

Query  313  SYDHHAAIYYLLLDK  327
             YD   A Y LL  K
Sbjct  550  RYDDVFATYLLLGRK  564


>Q6NPA6_DROME unnamed protein product
Length=833

 Score = 396 bits (1018),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 181/315 (57%), Positives = 236/315 (75%), Gaps = 1/315 (0%)

Query  14   VGFYDIERTIGKGNFAVVKLAKHRITKTEVAIKIIDKSQLDASNLQKVYREVDIMKRLDH  73
            +G Y + +TIGKGNFA VKLAKH  T  EVAIKIIDK+QL+  +LQK++REV IMK LDH
Sbjct  250  IGKYKLIKTIGKGNFAKVKLAKHLPTGKEVAIKIIDKTQLNPGSLQKLFREVRIMKMLDH  309

Query  74   PHIIKLYQVMETKNMIYLVSEYASQGEIFDYIARYGRMTEDQSRVKFWQILSAVEYCHNR  133
            P+I+KL+QV+ET+  +YL+ EYAS GE+FDY+  +GRM E ++RVKF QI+SAV+YCH +
Sbjct  310  PNIVKLFQVIETEKTLYLIMEYASGGEVFDYLVLHGRMKEKEARVKFRQIVSAVQYCHQK  369

Query  134  NIVHRDLKAENLLLDSNNNIKIADFGFSNYYTTGGQLSTWCGSPPYAAPEVFEGKKYVGP  193
             I+HRDLKAENLLLDS  NIKIADFGFSN +T G +L T+CGSPPYAAPE+F+GKKY GP
Sbjct  370  RIIHRDLKAENLLLDSELNIKIADFGFSNEFTPGSKLDTFCGSPPYAAPELFQGKKYDGP  429

Query  194  EIDIWSLGVVLYVLVCGALPFDGCSLQALRDRVLSGRFRIPYFMSSDCESLIRKMLVLEP  253
            E+D+WSLGV+LY LV G+LPFDG +L+ LR+RVL G++RIP++MS+DCE+L+RK LVL P
Sbjct  430  EVDVWSLGVILYTLVSGSLPFDGSTLRELRERVLRGKYRIPFYMSTDCENLLRKFLVLNP  489

Query  254  NKRFSIQQIKKHRWMQMGVPPT-LPPTISVSNTQPNEQILRLMQSLGIDSSKTRESIRLG  312
             KR S++ I   +WM MG     L P I       + + +  + ++G + S+   S+   
Sbjct  490  AKRASLETIMGDKWMNMGFEEDELKPYIEPKADLADPKRIEALVAMGYNRSEIEASLSQV  549

Query  313  SYDHHAAIYYLLLDK  327
             YD   A Y LL  K
Sbjct  550  RYDDVFATYLLLGRK  564



Lambda      K        H
   0.321    0.136    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 426081712


Query= XP_018560878.1 serine/threonine-protein kinase SIK2 isoform X2
[Anoplophora glabripennis]

Length=759
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O77268_DROME  unnamed protein product                                 521     5e-168
Q9W532_DROME  unnamed protein product                                 520     9e-168
E1JGM9_DROME  unnamed protein product                                 394     2e-125
Q963E6_DROME  unnamed protein product                                 394     2e-125
Q6NPA6_DROME  unnamed protein product                                 394     3e-125


>O77268_DROME unnamed protein product
Length=1398

 Score = 521 bits (1341),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 242/330 (73%), Positives = 278/330 (84%), Gaps = 13/330 (4%)

Query  9    KNPIRVGFYDIERTIGKGNFAVVKLAKHRITKTEVAIKIIDKSQLDASNLQKVYREVDIM  68
            K P+RVGFYDIERTIGKGNFAVVKLA+HRITK EVAIKIIDKSQLD +NLQKVYREV+IM
Sbjct  133  KEPMRVGFYDIERTIGKGNFAVVKLARHRITKNEVAIKIIDKSQLDQTNLQKVYREVEIM  192

Query  69   KRLDHPHIIKLYQVMETKNMIYLVSEYASQGEIFDYIARYGRMTEDQSRVKFWQILSAVE  128
            KRL HPHIIKLYQVMETKNMIY+VSEYASQGEIFDYIA+YGRM+E  +R KFWQI+SAVE
Sbjct  193  KRLKHPHIIKLYQVMETKNMIYIVSEYASQGEIFDYIAKYGRMSESAARFKFWQIISAVE  252

Query  129  YCHNRNIVHRDLKAENLLLDSNNNIKIADFGFSNYYTTGGQLSTWCGSPPYAAPEVFEGK  188
            YCH + IVHRDLKAENLLLD N NIKIADFGFSN++  G  L+TWCGSPPYAAPEVFEGK
Sbjct  253  YCHKKGIVHRDLKAENLLLDLNMNIKIADFGFSNHFKPGELLATWCGSPPYAAPEVFEGK  312

Query  189  KYVGPEIDIWSLGVVLYVLVCGALPFDGCSLQALRDRVLSGRFRIPYFMSSDCESLIRKM  248
            +Y GPEIDIWSLGVVLYVLVCGALPFDG +LQ+LRDRVLSGRFRIP+FMSS+CE LIR+M
Sbjct  313  QYTGPEIDIWSLGVVLYVLVCGALPFDGSTLQSLRDRVLSGRFRIPFFMSSECEHLIRRM  372

Query  249  LVLEPNKRFSIQQIKKHRWMQMGVPPTLPPTISV---------SNTQPNEQILRLM-QSL  298
            LVLEP +R++I QIK+HRWM    P  L   +           ++ +P+E ILR+M + +
Sbjct  373  LVLEPTRRYTIDQIKRHRWM---CPELLEHVLIAKYNLGAERQTSVEPSEDILRIMAEYV  429

Query  299  GIDSSKTRESIRLGSYDHHAAIYYLLLDKL  328
            GI S KTR S++  +YDH AAIY LL D++
Sbjct  430  GIGSDKTRASLKKNTYDHVAAIYLLLQDRV  459


 Score = 60.1 bits (144),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 59/156 (38%), Positives = 75/156 (48%), Gaps = 42/156 (27%)

Query  401   SYASSSSSSGVVTN--FNTSKSLSQNLS-------CDSNFESLEYPLSESSELTSSLPSC  451
             SYASSSSSSGV+     + SKSLSQNLS       C   ++SL++ L        SLPSC
Sbjct  887   SYASSSSSSGVLAGSAGSYSKSLSQNLSRGSSKSNCSGPYDSLDFALPSGK---GSLPSC  943

Query  452   ---TSTEKQPEPIITSSSALSTHNYLSPRYVLHKHNPLVHM-SSLKTTRGV---------  498
                +S    P P   S + +S+  + S R +   HN  +HM  +L    G+         
Sbjct  944   MGSSSMLATPTPASASPAGISS-EHSSERSLYGSHNSCIHMPGALPLGLGLPQSSASTPT  1002

Query  499   ----------------TRSPVDFREGRRASDGLVAQ  518
                              RSP+ FREGRRASDGLVAQ
Sbjct  1003  PNPTPPPNGGGVTFLDKRSPIHFREGRRASDGLVAQ  1038


>Q9W532_DROME unnamed protein product
Length=1398

 Score = 520 bits (1340),  Expect = 9e-168, Method: Compositional matrix adjust.
 Identities = 242/330 (73%), Positives = 278/330 (84%), Gaps = 13/330 (4%)

Query  9    KNPIRVGFYDIERTIGKGNFAVVKLAKHRITKTEVAIKIIDKSQLDASNLQKVYREVDIM  68
            K P+RVGFYDIERTIGKGNFAVVKLA+HRITK EVAIKIIDKSQLD +NLQKVYREV+IM
Sbjct  133  KEPMRVGFYDIERTIGKGNFAVVKLARHRITKNEVAIKIIDKSQLDQTNLQKVYREVEIM  192

Query  69   KRLDHPHIIKLYQVMETKNMIYLVSEYASQGEIFDYIARYGRMTEDQSRVKFWQILSAVE  128
            KRL HPHIIKLYQVMETKNMIY+VSEYASQGEIFDYIA+YGRM+E  +R KFWQI+SAVE
Sbjct  193  KRLKHPHIIKLYQVMETKNMIYIVSEYASQGEIFDYIAKYGRMSESAARFKFWQIISAVE  252

Query  129  YCHNRNIVHRDLKAENLLLDSNNNIKIADFGFSNYYTTGGQLSTWCGSPPYAAPEVFEGK  188
            YCH + IVHRDLKAENLLLD N NIKIADFGFSN++  G  L+TWCGSPPYAAPEVFEGK
Sbjct  253  YCHKKGIVHRDLKAENLLLDLNMNIKIADFGFSNHFKPGELLATWCGSPPYAAPEVFEGK  312

Query  189  KYVGPEIDIWSLGVVLYVLVCGALPFDGCSLQALRDRVLSGRFRIPYFMSSDCESLIRKM  248
            +Y GPEIDIWSLGVVLYVLVCGALPFDG +LQ+LRDRVLSGRFRIP+FMSS+CE LIR+M
Sbjct  313  QYTGPEIDIWSLGVVLYVLVCGALPFDGSTLQSLRDRVLSGRFRIPFFMSSECEHLIRRM  372

Query  249  LVLEPNKRFSIQQIKKHRWMQMGVPPTLPPTISV---------SNTQPNEQILRLM-QSL  298
            LVLEP +R++I QIK+HRWM    P  L   +           ++ +P+E ILR+M + +
Sbjct  373  LVLEPTRRYTIDQIKRHRWM---CPELLEHVLIAKYNLGAERQTSVEPSEDILRIMAEYV  429

Query  299  GIDSSKTRESIRLGSYDHHAAIYYLLLDKL  328
            GI S KTR S++  +YDH AAIY LL D++
Sbjct  430  GIGSDKTRASLKKNTYDHVAAIYLLLQDRV  459


 Score = 61.2 bits (147),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 63/169 (37%), Positives = 80/169 (47%), Gaps = 43/169 (25%)

Query  388   GVETDLEDHGPRLSYASSSSSSGVVTN--FNTSKSLSQNLS-------CDSNFESLEYPL  438
             G  T  + H  R SYASSSSSSGV+     + SKSLSQNLS       C   ++SL++ L
Sbjct  875   GTTTSGQSHKMR-SYASSSSSSGVLAGSAGSYSKSLSQNLSRGSSKSNCSGPYDSLDFAL  933

Query  439   SESSELTSSLPSC---TSTEKQPEPIITSSSALSTHNYLSPRYVLHKHNPLVHM-SSLKT  494
                     SLPSC   +S    P P   S + +S+  + S R +   HN  +HM  +L  
Sbjct  934   PSGK---GSLPSCMGSSSMLATPTPASASPAGISS-EHSSERSLYGSHNSCIHMPGALPL  989

Query  495   TRGV-------------------------TRSPVDFREGRRASDGLVAQ  518
               G+                          RSP+ FREGRRASDGLVAQ
Sbjct  990   GLGLPQSSASTPTPNPTPPPNGGGVTFLDKRSPIHFREGRRASDGLVAQ  1038


>E1JGM9_DROME unnamed protein product
Length=827

 Score = 394 bits (1013),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 180/312 (58%), Positives = 235/312 (75%), Gaps = 1/312 (0%)

Query  14   VGFYDIERTIGKGNFAVVKLAKHRITKTEVAIKIIDKSQLDASNLQKVYREVDIMKRLDH  73
            +G Y + +TIGKGNFA VKLAKH  T  EVAIKIIDK+QL+  +LQK++REV IMK LDH
Sbjct  250  IGKYKLIKTIGKGNFAKVKLAKHLPTGKEVAIKIIDKTQLNPGSLQKLFREVRIMKMLDH  309

Query  74   PHIIKLYQVMETKNMIYLVSEYASQGEIFDYIARYGRMTEDQSRVKFWQILSAVEYCHNR  133
            P+I+KL+QV+ET+  +YL+ EYAS GE+FDY+  +GRM E ++RVKF QI+SAV+YCH +
Sbjct  310  PNIVKLFQVIETEKTLYLIMEYASGGEVFDYLVLHGRMKEKEARVKFRQIVSAVQYCHQK  369

Query  134  NIVHRDLKAENLLLDSNNNIKIADFGFSNYYTTGGQLSTWCGSPPYAAPEVFEGKKYVGP  193
             I+HRDLKAENLLLDS  NIKIADFGFSN +T G +L T+CGSPPYAAPE+F+GKKY GP
Sbjct  370  RIIHRDLKAENLLLDSELNIKIADFGFSNEFTPGSKLDTFCGSPPYAAPELFQGKKYDGP  429

Query  194  EIDIWSLGVVLYVLVCGALPFDGCSLQALRDRVLSGRFRIPYFMSSDCESLIRKMLVLEP  253
            E+D+WSLGV+LY LV G+LPFDG +L+ LR+RVL G++RIP++MS+DCE+L+RK LVL P
Sbjct  430  EVDVWSLGVILYTLVSGSLPFDGSTLRELRERVLRGKYRIPFYMSTDCENLLRKFLVLNP  489

Query  254  NKRFSIQQIKKHRWMQMGVPPT-LPPTISVSNTQPNEQILRLMQSLGIDSSKTRESIRLG  312
             KR S++ I   +WM MG     L P I       + + +  + ++G + S+   S+   
Sbjct  490  AKRASLETIMGDKWMNMGFEEDELKPYIEPKADLADPKRIEALVAMGYNRSEIEASLSQV  549

Query  313  SYDHHAAIYYLL  324
             YD   A Y LL
Sbjct  550  RYDDVFATYLLL  561


>Q963E6_DROME unnamed protein product
Length=832

 Score = 394 bits (1013),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 180/312 (58%), Positives = 235/312 (75%), Gaps = 1/312 (0%)

Query  14   VGFYDIERTIGKGNFAVVKLAKHRITKTEVAIKIIDKSQLDASNLQKVYREVDIMKRLDH  73
            +G Y + +TIGKGNFA VKLAKH  T  EVAIKIIDK+QL+  +LQK++REV IMK LDH
Sbjct  250  IGKYKLIKTIGKGNFAKVKLAKHLPTGKEVAIKIIDKTQLNPGSLQKLFREVRIMKMLDH  309

Query  74   PHIIKLYQVMETKNMIYLVSEYASQGEIFDYIARYGRMTEDQSRVKFWQILSAVEYCHNR  133
            P+I+KL+QV+ET+  +YL+ EYAS GE+FDY+  +GRM E ++RVKF QI+SAV+YCH +
Sbjct  310  PNIVKLFQVIETEKTLYLIMEYASGGEVFDYLVLHGRMKEKEARVKFRQIVSAVQYCHQK  369

Query  134  NIVHRDLKAENLLLDSNNNIKIADFGFSNYYTTGGQLSTWCGSPPYAAPEVFEGKKYVGP  193
             I+HRDLKAENLLLDS  NIKIADFGFSN +T G +L T+CGSPPYAAPE+F+GKKY GP
Sbjct  370  RIIHRDLKAENLLLDSELNIKIADFGFSNEFTPGSKLDTFCGSPPYAAPELFQGKKYDGP  429

Query  194  EIDIWSLGVVLYVLVCGALPFDGCSLQALRDRVLSGRFRIPYFMSSDCESLIRKMLVLEP  253
            E+D+WSLGV+LY LV G+LPFDG +L+ LR+RVL G++RIP++MS+DCE+L+RK LVL P
Sbjct  430  EVDVWSLGVILYTLVSGSLPFDGSTLRELRERVLRGKYRIPFYMSTDCENLLRKFLVLNP  489

Query  254  NKRFSIQQIKKHRWMQMGVPPT-LPPTISVSNTQPNEQILRLMQSLGIDSSKTRESIRLG  312
             KR S++ I   +WM MG     L P I       + + +  + ++G + S+   S+   
Sbjct  490  AKRASLETIMGDKWMNMGFEEDELKPYIEPKADLADPKRIEALVAMGYNRSEIEASLSQV  549

Query  313  SYDHHAAIYYLL  324
             YD   A Y LL
Sbjct  550  RYDDVFATYLLL  561


>Q6NPA6_DROME unnamed protein product
Length=833

 Score = 394 bits (1012),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 180/312 (58%), Positives = 235/312 (75%), Gaps = 1/312 (0%)

Query  14   VGFYDIERTIGKGNFAVVKLAKHRITKTEVAIKIIDKSQLDASNLQKVYREVDIMKRLDH  73
            +G Y + +TIGKGNFA VKLAKH  T  EVAIKIIDK+QL+  +LQK++REV IMK LDH
Sbjct  250  IGKYKLIKTIGKGNFAKVKLAKHLPTGKEVAIKIIDKTQLNPGSLQKLFREVRIMKMLDH  309

Query  74   PHIIKLYQVMETKNMIYLVSEYASQGEIFDYIARYGRMTEDQSRVKFWQILSAVEYCHNR  133
            P+I+KL+QV+ET+  +YL+ EYAS GE+FDY+  +GRM E ++RVKF QI+SAV+YCH +
Sbjct  310  PNIVKLFQVIETEKTLYLIMEYASGGEVFDYLVLHGRMKEKEARVKFRQIVSAVQYCHQK  369

Query  134  NIVHRDLKAENLLLDSNNNIKIADFGFSNYYTTGGQLSTWCGSPPYAAPEVFEGKKYVGP  193
             I+HRDLKAENLLLDS  NIKIADFGFSN +T G +L T+CGSPPYAAPE+F+GKKY GP
Sbjct  370  RIIHRDLKAENLLLDSELNIKIADFGFSNEFTPGSKLDTFCGSPPYAAPELFQGKKYDGP  429

Query  194  EIDIWSLGVVLYVLVCGALPFDGCSLQALRDRVLSGRFRIPYFMSSDCESLIRKMLVLEP  253
            E+D+WSLGV+LY LV G+LPFDG +L+ LR+RVL G++RIP++MS+DCE+L+RK LVL P
Sbjct  430  EVDVWSLGVILYTLVSGSLPFDGSTLRELRERVLRGKYRIPFYMSTDCENLLRKFLVLNP  489

Query  254  NKRFSIQQIKKHRWMQMGVPPT-LPPTISVSNTQPNEQILRLMQSLGIDSSKTRESIRLG  312
             KR S++ I   +WM MG     L P I       + + +  + ++G + S+   S+   
Sbjct  490  AKRASLETIMGDKWMNMGFEEDELKPYIEPKADLADPKRIEALVAMGYNRSEIEASLSQV  549

Query  313  SYDHHAAIYYLL  324
             YD   A Y LL
Sbjct  550  RYDDVFATYLLL  561



Lambda      K        H
   0.321    0.136    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 426081712


Query= XP_018560879.1 serine/threonine-protein kinase PAK mbt [Anoplophora
glabripennis]

Length=572
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PAKM_DROME  unnamed protein product                                   571     0.0   
PK2_CAEEL  unnamed protein product                                    352     5e-115
Q24190_DROME  unnamed protein product                                 347     7e-111
Q9VI13_DROME  unnamed protein product                                 347     8e-111
Q24213_DROME  unnamed protein product                                 345     3e-110


>PAKM_DROME unnamed protein product
Length=639

 Score = 571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/296 (91%), Positives = 284/296 (96%), Gaps = 0/296 (0%)

Query  273  HEQRLTHEQFRAALQMVVSSKDPRENLERFVKIGEGSTGTVCIAHDRTTGRQVAVKKMDL  332
             +QRLTHEQFRAALQMVVS+ DPRENL+ F KIGEGSTGTVCIA D++TGRQVAVKKMDL
Sbjct  342  QDQRLTHEQFRAALQMVVSAGDPRENLDHFNKIGEGSTGTVCIATDKSTGRQVAVKKMDL  401

Query  333  RKQQRRELLFNEVVIMRDYHHPNIVEMFDSYLVNDELWVVMEFLEGGALTDIVTHARMDE  392
            RKQQRRELLFNEVVIMRDYHHPNIVE + S+LVNDELWVVME+LEGGALTDIVTH+RMDE
Sbjct  402  RKQQRRELLFNEVVIMRDYHHPNIVETYSSFLVNDELWVVMEYLEGGALTDIVTHSRMDE  461

Query  393  EQIATVCKQCLKALAYLHSQGVIHRDIKSDSILLALDGRVKLSDFGFCAQVSQELPKRKS  452
            EQIATVCKQCLKALAYLHSQGVIHRDIKSDSILLA DGRVKLSDFGFCAQVSQELPKRKS
Sbjct  462  EQIATVCKQCLKALAYLHSQGVIHRDIKSDSILLAADGRVKLSDFGFCAQVSQELPKRKS  521

Query  453  LVGTPYWMSPEVISRLPYGPEVDIWSLGIMVIEMVDGEPPFFNEPPLQAMRRIREMPPPK  512
            LVGTPYWMSPEVISRLPYGPEVDIWSLGIMVIEMVDGEPPFFNEPPLQAMRRIR+M PP 
Sbjct  522  LVGTPYWMSPEVISRLPYGPEVDIWSLGIMVIEMVDGEPPFFNEPPLQAMRRIRDMQPPN  581

Query  513  LKNAHKVSPRLQSFLDKMLVRDPAQRASAQELLSHPFLRQAGPPALLVPLMRGAKH  568
            LKNAHKVSPRLQSFLD+MLVRDPAQRA+A ELL+HPFLRQAGPP+LLVPLMR A+H
Sbjct  582  LKNAHKVSPRLQSFLDRMLVRDPAQRATAAELLAHPFLRQAGPPSLLVPLMRNARH  637


 Score = 186 bits (471),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 104/169 (62%), Positives = 113/169 (67%), Gaps = 35/169 (21%)

Query  1    MFTKKKKKPQISSPTNFEHRVHTGFDKHEGKYVGLPLQWASIVGNNQILKSTNRPLPLVD  60
            MF+KKKKKP IS P+NFEHRVHTGFDK E KYVGLPLQWASIVGNNQILKS+NRPLPLVD
Sbjct  1    MFSKKKKKPLISMPSNFEHRVHTGFDKRENKYVGLPLQWASIVGNNQILKSSNRPLPLVD  60

Query  61   PSEITPTEILDLKTIVRGDHKHENRLSVH-------------------------------  89
            PSEITPTEILDLKTIVR  H +    +                                 
Sbjct  61   PSEITPTEILDLKTIVRPHHNNNKADTTSLNSSSTMMMGSMAPMNPMAPGAHPMMSHGPG  120

Query  90   QAKPANSNGIVLPKMSNVARSNSLRSSSPPRLRREHRNNANVPPAVPEE  138
               P  + GIVLPK S+VARSNSLRSSSPPR+RR     ANVPP+VPEE
Sbjct  121  MMMPPETGGIVLPKTSHVARSNSLRSSSPPRVRRV----ANVPPSVPEE  165


>PK2_CAEEL unnamed protein product
Length=522

 Score = 352 bits (902),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 167/287 (58%), Positives = 212/287 (74%), Gaps = 0/287 (0%)

Query  277  LTHEQFRAALQMVVSSKDPRENLERFVKIGEGSTGTVCIAHDRTTGRQVAVKKMDLRKQQ  336
            ++ E+FR AL+ VV   DPR +L  + +IGEGSTG V  A+  +T + VAVK+M+LRKQQ
Sbjct  209  VSDEEFRNALKFVVDGTDPRSDLTDYKQIGEGSTGVVEAAYKISTKQIVAVKRMNLRKQQ  268

Query  337  RRELLFNEVVIMRDYHHPNIVEMFDSYLVNDELWVVMEFLEGGALTDIVTHARMDEEQIA  396
            RRELLFNEV I+R Y HPNIV  F S+LV+DELWVVMEF+EGG+LTDIVT  RM E QIA
Sbjct  269  RRELLFNEVSILRQYQHPNIVRFFSSHLVDDELWVVMEFMEGGSLTDIVTATRMTEPQIA  328

Query  397  TVCKQCLKALAYLHSQGVIHRDIKSDSILLALDGRVKLSDFGFCAQVSQELPKRKSLVGT  456
            T+ +Q L AL +LH++ VIHRDIKSDSILL  DG VKL+DFGFC Q+S+E+P+R+SLVGT
Sbjct  329  TISRQVLGALDFLHARKVIHRDIKSDSILLKRDGTVKLTDFGFCGQLSEEVPRRRSLVGT  388

Query  457  PYWMSPEVISRLPYGPEVDIWSLGIMVIEMVDGEPPFFNEPPLQAMRRIREMPPPKLKNA  516
            PYW + EVI+R PY    DIWS GIM+IEMV+GEPPFFN+ P QAM+RIR+    +    
Sbjct  389  PYWTAAEVIAREPYDTRADIWSFGIMLIEMVEGEPPFFNDQPFQAMKRIRDEHEARFSRH  448

Query  517  HKVSPRLQSFLDKMLVRDPAQRASAQELLSHPFLRQAGPPALLVPLM  563
             KVS  L   L   +V+D  +R  A++LL HPF  +A   + + PL+
Sbjct  449  AKVSVELSELLSHCIVKDVNKRWPAKDLLRHPFFAKAQHSSSIAPLL  495


 Score = 94.0 bits (232),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 71/114 (62%), Gaps = 9/114 (8%)

Query  4    KKKKKPQISSPTNFEHRVHTGFDKHEGKYVGLPLQWASIVGNNQILKSTNRPLPLVDPSE  63
            +K KK +IS+P+NFEHR+H GFD   G Y GLP QW +++G     +S +RP P+VDPS 
Sbjct  9    RKVKKSEISTPSNFEHRIHAGFDARSGTYTGLPKQWQALLGPP---RSISRPKPMVDPSC  65

Query  64   ITPTEILDLKTIVRGDHKHENRLSVHQAKPANSNGIVLPKMSNVARSNSLRSSS  117
            ITP ++ +LKT++RG        S  +       G+    M +VARSNSLR S+
Sbjct  66   ITPVDVAELKTVIRGPS------SSFRYNSPLPFGMTNSPMPSVARSNSLRISA  113


>Q24190_DROME unnamed protein product
Length=704

 Score = 347 bits (889),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 159/304 (52%), Positives = 221/304 (73%), Gaps = 0/304 (0%)

Query  266  HTAATKHHEQRLTHEQFRAALQMVVSSKDPRENLERFVKIGEGSTGTVCIAHDRTTGRQV  325
            +T A    +++++ E+    L+ +VS  DP     +  KIG+G++GTV  A + +TG +V
Sbjct  397  NTRAANAKKKKMSDEEILEKLRTIVSVGDPNRKYTKMEKIGQGASGTVYTAIESSTGMEV  456

Query  326  AVKKMDLRKQQRRELLFNEVVIMRDYHHPNIVEMFDSYLVNDELWVVMEFLEGGALTDIV  385
            A+K+M+L +Q ++EL+ NE+++MR+  HPN+V   DSYLV++ELWVVME+L GG+LTD+V
Sbjct  457  AIKQMNLSQQPKKELIINEILVMRENKHPNVVNYLDSYLVSEELWVVMEYLPGGSLTDVV  516

Query  386  THARMDEEQIATVCKQCLKALAYLHSQGVIHRDIKSDSILLALDGRVKLSDFGFCAQVSQ  445
            T   MDE QIA VC++ L+AL +LH+  VIHRDIKSD+ILL LDG VKL+DFGFCAQ+S 
Sbjct  517  TETCMDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQISP  576

Query  446  ELPKRKSLVGTPYWMSPEVISRLPYGPEVDIWSLGIMVIEMVDGEPPFFNEPPLQAMRRI  505
            E  KR ++VGTPYWM+PEV++R  YGP+VD+WSLGIM IEMV+GEPP+ NE PL+A+  I
Sbjct  577  EQSKRTTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLI  636

Query  506  REMPPPKLKNAHKVSPRLQSFLDKMLVRDPAQRASAQELLSHPFLRQAGPPALLVPLMRG  565
                 P++K   K+S   Q FLD+ L  +  +RASA +LL HPFL+ A P A L PL+  
Sbjct  637  ATNGKPEIKEKDKLSSAFQDFLDQCLEVEVDRRASALDLLKHPFLKLARPLASLTPLIMA  696

Query  566  AKHS  569
            AK +
Sbjct  697  AKEA  700


 Score = 55.5 bits (132),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 31/50 (62%), Gaps = 0/50 (0%)

Query  8    KPQISSPTNFEHRVHTGFDKHEGKYVGLPLQWASIVGNNQILKSTNRPLP  57
            KP IS PTNFEH VH GFD   G++ G+P  WA ++ N+ I K   +  P
Sbjct  80   KPNISYPTNFEHTVHVGFDAVTGEFTGMPEAWARLLMNSNISKQEQKKNP  129


>Q9VI13_DROME unnamed protein product
Length=704

 Score = 347 bits (889),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 159/304 (52%), Positives = 221/304 (73%), Gaps = 0/304 (0%)

Query  266  HTAATKHHEQRLTHEQFRAALQMVVSSKDPRENLERFVKIGEGSTGTVCIAHDRTTGRQV  325
            +T A    +++++ E+    L+ +VS  DP     +  KIG+G++GTV  A + +TG +V
Sbjct  397  NTRAANAKKKKMSDEEILEKLRTIVSVGDPNRKYTKMEKIGQGASGTVYTAIESSTGMEV  456

Query  326  AVKKMDLRKQQRRELLFNEVVIMRDYHHPNIVEMFDSYLVNDELWVVMEFLEGGALTDIV  385
            A+K+M+L +Q ++EL+ NE+++MR+  HPN+V   DSYLV++ELWVVME+L GG+LTD+V
Sbjct  457  AIKQMNLSQQPKKELIINEILVMRENKHPNVVNYLDSYLVSEELWVVMEYLPGGSLTDVV  516

Query  386  THARMDEEQIATVCKQCLKALAYLHSQGVIHRDIKSDSILLALDGRVKLSDFGFCAQVSQ  445
            T   MDE QIA VC++ L+AL +LH+  VIHRDIKSD+ILL LDG VKL+DFGFCAQ+S 
Sbjct  517  TETCMDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQISP  576

Query  446  ELPKRKSLVGTPYWMSPEVISRLPYGPEVDIWSLGIMVIEMVDGEPPFFNEPPLQAMRRI  505
            E  KR ++VGTPYWM+PEV++R  YGP+VD+WSLGIM IEMV+GEPP+ NE PL+A+  I
Sbjct  577  EQSKRTTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLI  636

Query  506  REMPPPKLKNAHKVSPRLQSFLDKMLVRDPAQRASAQELLSHPFLRQAGPPALLVPLMRG  565
                 P++K   K+S   Q FLD+ L  +  +RASA +LL HPFL+ A P A L PL+  
Sbjct  637  ATNGKPEIKEKDKLSSAFQDFLDQCLEVEVDRRASALDLLKHPFLKLARPLASLTPLIMA  696

Query  566  AKHS  569
            AK +
Sbjct  697  AKEA  700


 Score = 55.5 bits (132),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 31/50 (62%), Gaps = 0/50 (0%)

Query  8    KPQISSPTNFEHRVHTGFDKHEGKYVGLPLQWASIVGNNQILKSTNRPLP  57
            KP IS PTNFEH VH GFD   G++ G+P  WA ++ N+ I K   +  P
Sbjct  80   KPNISYPTNFEHTVHVGFDAVTGEFTGMPEAWARLLMNSNISKQEQKKNP  129


>Q24213_DROME unnamed protein product
Length=704

 Score = 345 bits (885),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 159/304 (52%), Positives = 221/304 (73%), Gaps = 0/304 (0%)

Query  266  HTAATKHHEQRLTHEQFRAALQMVVSSKDPRENLERFVKIGEGSTGTVCIAHDRTTGRQV  325
            +T A    +++++ E+    L+ +VS  DP     +  KIG+G++GTV  A + +TG +V
Sbjct  397  NTRAANAKKKKMSDEEILEKLRTIVSVGDPNRKYTKMEKIGQGASGTVYSAIESSTGMEV  456

Query  326  AVKKMDLRKQQRRELLFNEVVIMRDYHHPNIVEMFDSYLVNDELWVVMEFLEGGALTDIV  385
            A+K+M+L +Q ++EL+ NE+++MR+  HPN+V   DSYLV++ELWVVME+L GG+LTD+V
Sbjct  457  AIKQMNLSQQPKKELIINEILVMRENKHPNVVNYLDSYLVSEELWVVMEYLPGGSLTDVV  516

Query  386  THARMDEEQIATVCKQCLKALAYLHSQGVIHRDIKSDSILLALDGRVKLSDFGFCAQVSQ  445
            T   MDE QIA VC++ L+AL +LH+  VIHRDIKSD+ILL LDG VKL+DFGFCAQ+S 
Sbjct  517  TETCMDEGQIAGVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQISP  576

Query  446  ELPKRKSLVGTPYWMSPEVISRLPYGPEVDIWSLGIMVIEMVDGEPPFFNEPPLQAMRRI  505
            E  KR ++VGTPYWM+PEV++R  YGP+VD+WSLGIM IEMV+GEPP+ NE PL+A+  I
Sbjct  577  EQSKRTTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLI  636

Query  506  REMPPPKLKNAHKVSPRLQSFLDKMLVRDPAQRASAQELLSHPFLRQAGPPALLVPLMRG  565
                 P++K   K+S   Q FLD+ L  +  +RASA +LL HPFL+ A P A L PL+  
Sbjct  637  ATNGKPEIKEKDKLSSAFQDFLDQCLEVEVDRRASALDLLKHPFLKLARPLASLTPLIMA  696

Query  566  AKHS  569
            AK +
Sbjct  697  AKEA  700


 Score = 55.5 bits (132),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 31/50 (62%), Gaps = 0/50 (0%)

Query  8    KPQISSPTNFEHRVHTGFDKHEGKYVGLPLQWASIVGNNQILKSTNRPLP  57
            KP IS PTNFEH VH GFD   G++ G+P  WA ++ N+ I K   +  P
Sbjct  80   KPNISYPTNFEHTVHVGFDAVTGEFTGMPEAWARLLMNSNISKQEQKKNP  129



Lambda      K        H
   0.321    0.136    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 426081712


Query= XP_018560880.1 uncharacterized protein LOC108903259 isoform X1
[Anoplophora glabripennis]

Length=756
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VYE6_DROME  unnamed protein product                                 506     9e-171
Q9VYE7_DROME  unnamed protein product                                 498     2e-170
Q7KV26_DROME  unnamed protein product                                 504     2e-169
IP3KH_CAEEL  unnamed protein product                                  206     3e-58 
M9ND56_DROME  unnamed protein product                                 199     1e-57 


>Q9VYE6_DROME unnamed protein product
Length=669

 Score = 506 bits (1304),  Expect = 9e-171, Method: Compositional matrix adjust.
 Identities = 232/323 (72%), Positives = 268/323 (83%), Gaps = 1/323 (0%)

Query  405  SNCSTCSTLSDEEGEATLHPNRNKEPSGWRKLRNIVQWTPFFQTYKKQRYPWVQLAGHQG  464
            S  +  S      G A+      K+ SGWRK+RNIVQWTPFFQTYKKQRYPWVQLAGHQG
Sbjct  310  STSAAGSATGSGSGAASQASTTGKKSSGWRKIRNIVQWTPFFQTYKKQRYPWVQLAGHQG  369

Query  465  NFKAGPDQGTILKKLCAKEEKCFKILMKDVLRPYVPEYKGIITSDDKECSYIQLQDLLGD  524
            NFKAGP+ GT+LKKLC KEE+CF+ILM D+LRPYVP YKG +TS+D E  Y+QLQDLL D
Sbjct  370  NFKAGPEPGTVLKKLCPKEEECFQILMHDLLRPYVPVYKGQVTSEDGEL-YLQLQDLLSD  428

Query  525  FVSPCVMDCKIGVRTYLEEELAKAKEKPKLRKDMYEKMCQIDQNAPTDEEHKMKGVTKPR  584
            +V PCVMDCK+GVRTYLEEEL+KAKEKPKLRKDMY+KM QID +APT EEH  K VTKPR
Sbjct  429  YVQPCVMDCKVGVRTYLEEELSKAKEKPKLRKDMYDKMIQIDSHAPTAEEHAAKAVTKPR  488

Query  585  YMVWRETISSTATLGFRIEGIRSADGTSSKDFKTTKTKDQIIAAFEKFTDGFPHAIPKYI  644
            YMVWRETISSTATLGFRIEGI+ +DGTSSKDFKTTK+++QI  AF +F  G PH +P+YI
Sbjct  489  YMVWRETISSTATLGFRIEGIKKSDGTSSKDFKTTKSREQIKLAFLEFLSGHPHILPRYI  548

Query  645  QRLKAIKATLETSEFFSTHEVIGSSLLFVHDRYNANVWLIDFAKTIVLPEDITITHSSKW  704
            QRL+AI+ATL  SEFF THEVIGSSLLFVHD+ +A++WLIDFAKT+ LP  + I H S W
Sbjct  549  QRLRAIRATLAVSEFFQTHEVIGSSLLFVHDQTHASIWLIDFAKTVELPPQLRIDHYSAW  608

Query  705  KVGNHEDGYLIGVNNLIKIFMTM  727
            KVGNHEDGYLIG+NNLI IF+ +
Sbjct  609  KVGNHEDGYLIGINNLIDIFVEL  631


>Q9VYE7_DROME unnamed protein product
Length=467

 Score = 498 bits (1282),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 228/301 (76%), Positives = 262/301 (87%), Gaps = 1/301 (0%)

Query  427  NKEPSGWRKLRNIVQWTPFFQTYKKQRYPWVQLAGHQGNFKAGPDQGTILKKLCAKEEKC  486
             K+ SGWRK+RNIVQWTPFFQTYKKQRYPWVQLAGHQGNFKAGP+ GT+LKKLC KEE+C
Sbjct  130  KKKSSGWRKIRNIVQWTPFFQTYKKQRYPWVQLAGHQGNFKAGPEPGTVLKKLCPKEEEC  189

Query  487  FKILMKDVLRPYVPEYKGIITSDDKECSYIQLQDLLGDFVSPCVMDCKIGVRTYLEEELA  546
            F+ILM D+LRPYVP YKG +TS+D E  Y+QLQDLL D+V PCVMDCK+GVRTYLEEEL+
Sbjct  190  FQILMHDLLRPYVPVYKGQVTSEDGEL-YLQLQDLLSDYVQPCVMDCKVGVRTYLEEELS  248

Query  547  KAKEKPKLRKDMYEKMCQIDQNAPTDEEHKMKGVTKPRYMVWRETISSTATLGFRIEGIR  606
            KAKEKPKLRKDMY+KM QID +APT EEH  K VTKPRYMVWRETISSTATLGFRIEGI+
Sbjct  249  KAKEKPKLRKDMYDKMIQIDSHAPTAEEHAAKAVTKPRYMVWRETISSTATLGFRIEGIK  308

Query  607  SADGTSSKDFKTTKTKDQIIAAFEKFTDGFPHAIPKYIQRLKAIKATLETSEFFSTHEVI  666
             +DGTSSKDFKTTK+++QI  AF +F  G PH +P+YIQRL+AI+ATL  SEFF THEVI
Sbjct  309  KSDGTSSKDFKTTKSREQIKLAFLEFLSGHPHILPRYIQRLRAIRATLAVSEFFQTHEVI  368

Query  667  GSSLLFVHDRYNANVWLIDFAKTIVLPEDITITHSSKWKVGNHEDGYLIGVNNLIKIFMT  726
            GSSLLFVHD+ +A++WLIDFAKT+ LP  + I H S WKVGNHEDGYLIG+NNLI IF+ 
Sbjct  369  GSSLLFVHDQTHASIWLIDFAKTVELPPQLRIDHYSAWKVGNHEDGYLIGINNLIDIFVE  428

Query  727  M  727
            +
Sbjct  429  L  429


>Q7KV26_DROME unnamed protein product
Length=691

 Score = 504 bits (1297),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 229/303 (76%), Positives = 265/303 (87%), Gaps = 1/303 (0%)

Query  425  NRNKEPSGWRKLRNIVQWTPFFQTYKKQRYPWVQLAGHQGNFKAGPDQGTILKKLCAKEE  484
            +R+K+ SGWRK+RNIVQWTPFFQTYKKQRYPWVQLAGHQGNFKAGP+ GT+LKKLC KEE
Sbjct  352  DRSKKSSGWRKIRNIVQWTPFFQTYKKQRYPWVQLAGHQGNFKAGPEPGTVLKKLCPKEE  411

Query  485  KCFKILMKDVLRPYVPEYKGIITSDDKECSYIQLQDLLGDFVSPCVMDCKIGVRTYLEEE  544
            +CF+ILM D+LRPYVP YKG +TS+D E  Y+QLQDLL D+V PCVMDCK+GVRTYLEEE
Sbjct  412  ECFQILMHDLLRPYVPVYKGQVTSEDGEL-YLQLQDLLSDYVQPCVMDCKVGVRTYLEEE  470

Query  545  LAKAKEKPKLRKDMYEKMCQIDQNAPTDEEHKMKGVTKPRYMVWRETISSTATLGFRIEG  604
            L+KAKEKPKLRKDMY+KM QID +APT EEH  K VTKPRYMVWRETISSTATLGFRIEG
Sbjct  471  LSKAKEKPKLRKDMYDKMIQIDSHAPTAEEHAAKAVTKPRYMVWRETISSTATLGFRIEG  530

Query  605  IRSADGTSSKDFKTTKTKDQIIAAFEKFTDGFPHAIPKYIQRLKAIKATLETSEFFSTHE  664
            I+ +DGTSSKDFKTTK+++QI  AF +F  G PH +P+YIQRL+AI+ATL  SEFF THE
Sbjct  531  IKKSDGTSSKDFKTTKSREQIKLAFLEFLSGHPHILPRYIQRLRAIRATLAVSEFFQTHE  590

Query  665  VIGSSLLFVHDRYNANVWLIDFAKTIVLPEDITITHSSKWKVGNHEDGYLIGVNNLIKIF  724
            VIGSSLLFVHD+ +A++WLIDFAKT+ LP  + I H S WKVGNHEDGYLIG+NNLI IF
Sbjct  591  VIGSSLLFVHDQTHASIWLIDFAKTVELPPQLRIDHYSAWKVGNHEDGYLIGINNLIDIF  650

Query  725  MTM  727
            + +
Sbjct  651  VEL  653


 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 69/229 (30%), Positives = 96/229 (42%), Gaps = 77/229 (34%)

Query  225  QKNAVRRCGSSDSAVHSDEDAAVVSSWV--EKREEYNVGEGY-------------IAKSP  269
            +K  V RC SSDSA+  D D   +   +  ++R    V +               +  SP
Sbjct  56   RKMKVTRCASSDSALGLDVDDGGMDVPLPPQRRMTLTVTDLPLRPALLPLAEPTALPDSP  115

Query  270  Y-SPRGSIDHS-NVPSRTIIEAQYVPLPLDRKFSVDCVSDAPLEGDASDCRRQSCFSE--  325
              SP G  + S  VP++ ++E + V  P  R+ S                  QS +SE  
Sbjct  116  LTSPTGGGNPSVGVPTKVLLEERVVAAPGSRREST-----------------QSSYSELG  158

Query  326  -GDAPPRYRYWRTPSVVVSDYSDDIM--GLTLEDIEYIRNKK------------------  364
                P   RY RTPSVVVSDYSDDI   G+++E++EY R ++                  
Sbjct  159  VSGLPLGVRYVRTPSVVVSDYSDDITACGISMEEMEYFRLQRARGQRRCSLEAGHHSHSG  218

Query  365  --------------------ENSSSPDSSLHSSCSNLNYCGSSISALEG  393
                                ++    D S  SSCSNL YCGS+ISAL+G
Sbjct  219  GHGAHGHGGSGAAGMSPGCGKDDGQSDVSAASSCSNLYYCGSTISALDG  267


>IP3KH_CAEEL unnamed protein product
Length=494

 Score = 206 bits (524),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 117/289 (40%), Positives = 174/289 (60%), Gaps = 16/289 (6%)

Query  450  KKQRYPWVQLAGHQGNF-KAGPDQGTILKKLCAK--EEKCFKILMKD-VLRPYVPEYKGI  505
            K++   WVQL+GH+G+   A P   T+ KK CA   E + +K + KD  L  + P+Y   
Sbjct  191  KERLKKWVQLSGHEGSIVPATPH--TLYKKQCANCGEGRAYKNISKDPALDGFTPKYYDE  248

Query  506  ITSDDKECSYIQLQDLLGDFVSP---CVMDCKIGVRTYLEEELAKAKEKPKLRKDMYEKM  562
            +  +++   +I+++DLL  F  P    +MD KIG RT+LE E++  K+    R D+YEKM
Sbjct  249  LEKNEEH--FIEIEDLLQQFHDPTKTAIMDIKIGTRTFLESEVSNTKK----RADLYEKM  302

Query  563  CQIDQNAPTDEEHKMKGVTKPRYMVWRETISSTATLGFRIEGIRSADGTSSKDFKTTKTK  622
              ID + PT+EE K   +TK RYM +RE  SSTA LGFRIE  +  +G   K+FK  +T 
Sbjct  303  VAIDNDEPTEEERKCGAITKLRYMQFRERESSTAQLGFRIEAAKRLEGALEKNFKKVRTV  362

Query  623  DQIIAAFEKFTDGFPHAI-PKYIQRLKAIKATLETSEFFSTHEVIGSSLLFVHDRYNANV  681
            + +   F  F       +  + I+RLK+++  +E S FF++HEV+GSS+L V D      
Sbjct  363  EDVTTTFMDFFGTQRSRVRQQLIERLKSMRKAIEHSSFFNSHEVVGSSILIVFDTEKVGC  422

Query  682  WLIDFAKTIVLPEDITITHSSKWKVGNHEDGYLIGVNNLIKIFMTMLEH  730
            W+IDFAK+  +P   T+ H + W  GN+EDGYLIG++NL+KI   + E+
Sbjct  423  WMIDFAKSSPVPNGRTLNHRTTWIPGNNEDGYLIGIDNLVKILEELPEY  471


>M9ND56_DROME unnamed protein product
Length=318

 Score = 199 bits (506),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 110/284 (39%), Positives = 163/284 (57%), Gaps = 13/284 (5%)

Query  447  QTYKKQRYP--WVQLAGHQGNFKAGPDQGTILKKLCAKEE---KCFKILMKD-VLRPYVP  500
            Q   KQ  P  W+QL+GH  +       G + K++   E+     ++++ K+      VP
Sbjct  26   QQAHKQAKPQGWMQLSGHPESI-VPTSTGIVRKRISGLEDSEVHAYRLICKEPQTAQIVP  84

Query  501  EYKGIITSDDKECSYIQLQDLLGDFVSPCVMDCKIGVRTYLEEELAKAKEKPKLRKDMYE  560
             Y GI   + +   +I+LQDLL  F  PCVMD K+G RT+LE E++ A     LR D+Y+
Sbjct  85   AYFGI--QEMQSQHFIELQDLLAGFRDPCVMDIKMGSRTFLESEVSNAT----LRPDLYQ  138

Query  561  KMCQIDQNAPTDEEHKMKGVTKPRYMVWRETISSTATLGFRIEGIRSADGTSSKDFKTTK  620
            KM  +D  APT  EH+ + +TK RYM +RE++SS+ + GFRIE +R       KD KT +
Sbjct  139  KMIAVDAGAPTPAEHEARAITKLRYMTFRESLSSSHSKGFRIEALRLRGRPPVKDLKTCR  198

Query  621  TKDQIIAAFEKFTDGFPHAIPKYIQRLKAIKATLETSEFFSTHEVIGSSLLFVHDRYNAN  680
            + +QI    E+F         + ++RLK ++  +E S FF++HE+IGSS+  V+D     
Sbjct  199  SSEQIAQTIEQFLAARRSVQKELLKRLKHMRLVIEQSTFFASHEIIGSSIFIVYDDDRVG  258

Query  681  VWLIDFAKTIVLPEDITITHSSKWKVGNHEDGYLIGVNNLIKIF  724
            VWLIDFAK   LP  + + H S W  GN E+G L G++ LI+ F
Sbjct  259  VWLIDFAKCRELPPHVRVDHRSAWAPGNREEGLLRGMDELIRSF  302



Lambda      K        H
   0.321    0.136    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 426081712


Query= XP_018560881.1 uncharacterized protein LOC108903259 isoform X2
[Anoplophora glabripennis]

Length=697
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VYE6_DROME  unnamed protein product                                 508     5e-172
Q9VYE7_DROME  unnamed protein product                                 499     1e-171
Q7KV26_DROME  unnamed protein product                                 504     1e-170
IP3KH_CAEEL  unnamed protein product                                  206     1e-58 
M9ND56_DROME  unnamed protein product                                 199     4e-58 


>Q9VYE6_DROME unnamed protein product
Length=669

 Score = 508 bits (1307),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 232/323 (72%), Positives = 268/323 (83%), Gaps = 1/323 (0%)

Query  346  SNCSTCSTLSDEEGEATLHPNRNKEPSGWRKLRNIVQWTPFFQTYKKQRYPWVQLAGHQG  405
            S  +  S      G A+      K+ SGWRK+RNIVQWTPFFQTYKKQRYPWVQLAGHQG
Sbjct  310  STSAAGSATGSGSGAASQASTTGKKSSGWRKIRNIVQWTPFFQTYKKQRYPWVQLAGHQG  369

Query  406  NFKAGPDQGTILKKLCAKEEKCFKILMKDVLRPYVPEYKGIITSDDKECSYIQLQDLLGD  465
            NFKAGP+ GT+LKKLC KEE+CF+ILM D+LRPYVP YKG +TS+D E  Y+QLQDLL D
Sbjct  370  NFKAGPEPGTVLKKLCPKEEECFQILMHDLLRPYVPVYKGQVTSEDGEL-YLQLQDLLSD  428

Query  466  FVSPCVMDCKIGVRTYLEEELAKAKEKPKLRKDMYEKMCQIDQNAPTDEEHKMKGVTKPR  525
            +V PCVMDCK+GVRTYLEEEL+KAKEKPKLRKDMY+KM QID +APT EEH  K VTKPR
Sbjct  429  YVQPCVMDCKVGVRTYLEEELSKAKEKPKLRKDMYDKMIQIDSHAPTAEEHAAKAVTKPR  488

Query  526  YMVWRETISSTATLGFRIEGIRSADGTSSKDFKTTKTKDQIIAAFEKFTDGFPHAIPKYI  585
            YMVWRETISSTATLGFRIEGI+ +DGTSSKDFKTTK+++QI  AF +F  G PH +P+YI
Sbjct  489  YMVWRETISSTATLGFRIEGIKKSDGTSSKDFKTTKSREQIKLAFLEFLSGHPHILPRYI  548

Query  586  QRLKAIKATLETSEFFSTHEVIGSSLLFVHDRYNANVWLIDFAKTIVLPEDITITHSSKW  645
            QRL+AI+ATL  SEFF THEVIGSSLLFVHD+ +A++WLIDFAKT+ LP  + I H S W
Sbjct  549  QRLRAIRATLAVSEFFQTHEVIGSSLLFVHDQTHASIWLIDFAKTVELPPQLRIDHYSAW  608

Query  646  KVGNHEDGYLIGVNNLIKIFMTM  668
            KVGNHEDGYLIG+NNLI IF+ +
Sbjct  609  KVGNHEDGYLIGINNLIDIFVEL  631


>Q9VYE7_DROME unnamed protein product
Length=467

 Score = 499 bits (1286),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 228/301 (76%), Positives = 262/301 (87%), Gaps = 1/301 (0%)

Query  368  NKEPSGWRKLRNIVQWTPFFQTYKKQRYPWVQLAGHQGNFKAGPDQGTILKKLCAKEEKC  427
             K+ SGWRK+RNIVQWTPFFQTYKKQRYPWVQLAGHQGNFKAGP+ GT+LKKLC KEE+C
Sbjct  130  KKKSSGWRKIRNIVQWTPFFQTYKKQRYPWVQLAGHQGNFKAGPEPGTVLKKLCPKEEEC  189

Query  428  FKILMKDVLRPYVPEYKGIITSDDKECSYIQLQDLLGDFVSPCVMDCKIGVRTYLEEELA  487
            F+ILM D+LRPYVP YKG +TS+D E  Y+QLQDLL D+V PCVMDCK+GVRTYLEEEL+
Sbjct  190  FQILMHDLLRPYVPVYKGQVTSEDGEL-YLQLQDLLSDYVQPCVMDCKVGVRTYLEEELS  248

Query  488  KAKEKPKLRKDMYEKMCQIDQNAPTDEEHKMKGVTKPRYMVWRETISSTATLGFRIEGIR  547
            KAKEKPKLRKDMY+KM QID +APT EEH  K VTKPRYMVWRETISSTATLGFRIEGI+
Sbjct  249  KAKEKPKLRKDMYDKMIQIDSHAPTAEEHAAKAVTKPRYMVWRETISSTATLGFRIEGIK  308

Query  548  SADGTSSKDFKTTKTKDQIIAAFEKFTDGFPHAIPKYIQRLKAIKATLETSEFFSTHEVI  607
             +DGTSSKDFKTTK+++QI  AF +F  G PH +P+YIQRL+AI+ATL  SEFF THEVI
Sbjct  309  KSDGTSSKDFKTTKSREQIKLAFLEFLSGHPHILPRYIQRLRAIRATLAVSEFFQTHEVI  368

Query  608  GSSLLFVHDRYNANVWLIDFAKTIVLPEDITITHSSKWKVGNHEDGYLIGVNNLIKIFMT  667
            GSSLLFVHD+ +A++WLIDFAKT+ LP  + I H S WKVGNHEDGYLIG+NNLI IF+ 
Sbjct  369  GSSLLFVHDQTHASIWLIDFAKTVELPPQLRIDHYSAWKVGNHEDGYLIGINNLIDIFVE  428

Query  668  M  668
            +
Sbjct  429  L  429


>Q7KV26_DROME unnamed protein product
Length=691

 Score = 504 bits (1299),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 229/303 (76%), Positives = 265/303 (87%), Gaps = 1/303 (0%)

Query  366  NRNKEPSGWRKLRNIVQWTPFFQTYKKQRYPWVQLAGHQGNFKAGPDQGTILKKLCAKEE  425
            +R+K+ SGWRK+RNIVQWTPFFQTYKKQRYPWVQLAGHQGNFKAGP+ GT+LKKLC KEE
Sbjct  352  DRSKKSSGWRKIRNIVQWTPFFQTYKKQRYPWVQLAGHQGNFKAGPEPGTVLKKLCPKEE  411

Query  426  KCFKILMKDVLRPYVPEYKGIITSDDKECSYIQLQDLLGDFVSPCVMDCKIGVRTYLEEE  485
            +CF+ILM D+LRPYVP YKG +TS+D E  Y+QLQDLL D+V PCVMDCK+GVRTYLEEE
Sbjct  412  ECFQILMHDLLRPYVPVYKGQVTSEDGEL-YLQLQDLLSDYVQPCVMDCKVGVRTYLEEE  470

Query  486  LAKAKEKPKLRKDMYEKMCQIDQNAPTDEEHKMKGVTKPRYMVWRETISSTATLGFRIEG  545
            L+KAKEKPKLRKDMY+KM QID +APT EEH  K VTKPRYMVWRETISSTATLGFRIEG
Sbjct  471  LSKAKEKPKLRKDMYDKMIQIDSHAPTAEEHAAKAVTKPRYMVWRETISSTATLGFRIEG  530

Query  546  IRSADGTSSKDFKTTKTKDQIIAAFEKFTDGFPHAIPKYIQRLKAIKATLETSEFFSTHE  605
            I+ +DGTSSKDFKTTK+++QI  AF +F  G PH +P+YIQRL+AI+ATL  SEFF THE
Sbjct  531  IKKSDGTSSKDFKTTKSREQIKLAFLEFLSGHPHILPRYIQRLRAIRATLAVSEFFQTHE  590

Query  606  VIGSSLLFVHDRYNANVWLIDFAKTIVLPEDITITHSSKWKVGNHEDGYLIGVNNLIKIF  665
            VIGSSLLFVHD+ +A++WLIDFAKT+ LP  + I H S WKVGNHEDGYLIG+NNLI IF
Sbjct  591  VIGSSLLFVHDQTHASIWLIDFAKTVELPPQLRIDHYSAWKVGNHEDGYLIGINNLIDIF  650

Query  666  MTM  668
            + +
Sbjct  651  VEL  653


 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 69/229 (30%), Positives = 96/229 (42%), Gaps = 77/229 (34%)

Query  166  QKNAVRRCGSSDSAVHSDEDAAVVSSWV--EKREEYNVGEGY-------------IAKSP  210
            +K  V RC SSDSA+  D D   +   +  ++R    V +               +  SP
Sbjct  56   RKMKVTRCASSDSALGLDVDDGGMDVPLPPQRRMTLTVTDLPLRPALLPLAEPTALPDSP  115

Query  211  Y-SPRGSIDHS-NVPSRTIIEAQYVPLPLDRKFSVDCVSDAPLEGDASDCRRQSCFSE--  266
              SP G  + S  VP++ ++E + V  P  R+ S                  QS +SE  
Sbjct  116  LTSPTGGGNPSVGVPTKVLLEERVVAAPGSRREST-----------------QSSYSELG  158

Query  267  -GDAPPRYRYWRTPSVVVSDYSDDIM--GLTLEDIEYIRNKK------------------  305
                P   RY RTPSVVVSDYSDDI   G+++E++EY R ++                  
Sbjct  159  VSGLPLGVRYVRTPSVVVSDYSDDITACGISMEEMEYFRLQRARGQRRCSLEAGHHSHSG  218

Query  306  --------------------ENSSSPDSSLHSSCSNLNYCGSSISALEG  334
                                ++    D S  SSCSNL YCGS+ISAL+G
Sbjct  219  GHGAHGHGGSGAAGMSPGCGKDDGQSDVSAASSCSNLYYCGSTISALDG  267


>IP3KH_CAEEL unnamed protein product
Length=494

 Score = 206 bits (524),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 117/289 (40%), Positives = 174/289 (60%), Gaps = 16/289 (6%)

Query  391  KKQRYPWVQLAGHQGNF-KAGPDQGTILKKLCAK--EEKCFKILMKD-VLRPYVPEYKGI  446
            K++   WVQL+GH+G+   A P   T+ KK CA   E + +K + KD  L  + P+Y   
Sbjct  191  KERLKKWVQLSGHEGSIVPATPH--TLYKKQCANCGEGRAYKNISKDPALDGFTPKYYDE  248

Query  447  ITSDDKECSYIQLQDLLGDFVSP---CVMDCKIGVRTYLEEELAKAKEKPKLRKDMYEKM  503
            +  +++   +I+++DLL  F  P    +MD KIG RT+LE E++  K+    R D+YEKM
Sbjct  249  LEKNEEH--FIEIEDLLQQFHDPTKTAIMDIKIGTRTFLESEVSNTKK----RADLYEKM  302

Query  504  CQIDQNAPTDEEHKMKGVTKPRYMVWRETISSTATLGFRIEGIRSADGTSSKDFKTTKTK  563
              ID + PT+EE K   +TK RYM +RE  SSTA LGFRIE  +  +G   K+FK  +T 
Sbjct  303  VAIDNDEPTEEERKCGAITKLRYMQFRERESSTAQLGFRIEAAKRLEGALEKNFKKVRTV  362

Query  564  DQIIAAFEKFTDGFPHAI-PKYIQRLKAIKATLETSEFFSTHEVIGSSLLFVHDRYNANV  622
            + +   F  F       +  + I+RLK+++  +E S FF++HEV+GSS+L V D      
Sbjct  363  EDVTTTFMDFFGTQRSRVRQQLIERLKSMRKAIEHSSFFNSHEVVGSSILIVFDTEKVGC  422

Query  623  WLIDFAKTIVLPEDITITHSSKWKVGNHEDGYLIGVNNLIKIFMTMLEH  671
            W+IDFAK+  +P   T+ H + W  GN+EDGYLIG++NL+KI   + E+
Sbjct  423  WMIDFAKSSPVPNGRTLNHRTTWIPGNNEDGYLIGIDNLVKILEELPEY  471


>M9ND56_DROME unnamed protein product
Length=318

 Score = 199 bits (506),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 110/284 (39%), Positives = 163/284 (57%), Gaps = 13/284 (5%)

Query  388  QTYKKQRYP--WVQLAGHQGNFKAGPDQGTILKKLCAKEE---KCFKILMKD-VLRPYVP  441
            Q   KQ  P  W+QL+GH  +       G + K++   E+     ++++ K+      VP
Sbjct  26   QQAHKQAKPQGWMQLSGHPESI-VPTSTGIVRKRISGLEDSEVHAYRLICKEPQTAQIVP  84

Query  442  EYKGIITSDDKECSYIQLQDLLGDFVSPCVMDCKIGVRTYLEEELAKAKEKPKLRKDMYE  501
             Y GI   + +   +I+LQDLL  F  PCVMD K+G RT+LE E++ A     LR D+Y+
Sbjct  85   AYFGI--QEMQSQHFIELQDLLAGFRDPCVMDIKMGSRTFLESEVSNAT----LRPDLYQ  138

Query  502  KMCQIDQNAPTDEEHKMKGVTKPRYMVWRETISSTATLGFRIEGIRSADGTSSKDFKTTK  561
            KM  +D  APT  EH+ + +TK RYM +RE++SS+ + GFRIE +R       KD KT +
Sbjct  139  KMIAVDAGAPTPAEHEARAITKLRYMTFRESLSSSHSKGFRIEALRLRGRPPVKDLKTCR  198

Query  562  TKDQIIAAFEKFTDGFPHAIPKYIQRLKAIKATLETSEFFSTHEVIGSSLLFVHDRYNAN  621
            + +QI    E+F         + ++RLK ++  +E S FF++HE+IGSS+  V+D     
Sbjct  199  SSEQIAQTIEQFLAARRSVQKELLKRLKHMRLVIEQSTFFASHEIIGSSIFIVYDDDRVG  258

Query  622  VWLIDFAKTIVLPEDITITHSSKWKVGNHEDGYLIGVNNLIKIF  665
            VWLIDFAK   LP  + + H S W  GN E+G L G++ LI+ F
Sbjct  259  VWLIDFAKCRELPPHVRVDHRSAWAPGNREEGLLRGMDELIRSF  302



Lambda      K        H
   0.321    0.136    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 426081712


Query= XP_018560882.1 uncharacterized protein LOC108903259 isoform X2
[Anoplophora glabripennis]

Length=697
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VYE6_DROME  unnamed protein product                                 508     5e-172
Q9VYE7_DROME  unnamed protein product                                 499     1e-171
Q7KV26_DROME  unnamed protein product                                 504     1e-170
IP3KH_CAEEL  unnamed protein product                                  206     1e-58 
M9ND56_DROME  unnamed protein product                                 199     4e-58 


>Q9VYE6_DROME unnamed protein product
Length=669

 Score = 508 bits (1307),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 232/323 (72%), Positives = 268/323 (83%), Gaps = 1/323 (0%)

Query  346  SNCSTCSTLSDEEGEATLHPNRNKEPSGWRKLRNIVQWTPFFQTYKKQRYPWVQLAGHQG  405
            S  +  S      G A+      K+ SGWRK+RNIVQWTPFFQTYKKQRYPWVQLAGHQG
Sbjct  310  STSAAGSATGSGSGAASQASTTGKKSSGWRKIRNIVQWTPFFQTYKKQRYPWVQLAGHQG  369

Query  406  NFKAGPDQGTILKKLCAKEEKCFKILMKDVLRPYVPEYKGIITSDDKECSYIQLQDLLGD  465
            NFKAGP+ GT+LKKLC KEE+CF+ILM D+LRPYVP YKG +TS+D E  Y+QLQDLL D
Sbjct  370  NFKAGPEPGTVLKKLCPKEEECFQILMHDLLRPYVPVYKGQVTSEDGEL-YLQLQDLLSD  428

Query  466  FVSPCVMDCKIGVRTYLEEELAKAKEKPKLRKDMYEKMCQIDQNAPTDEEHKMKGVTKPR  525
            +V PCVMDCK+GVRTYLEEEL+KAKEKPKLRKDMY+KM QID +APT EEH  K VTKPR
Sbjct  429  YVQPCVMDCKVGVRTYLEEELSKAKEKPKLRKDMYDKMIQIDSHAPTAEEHAAKAVTKPR  488

Query  526  YMVWRETISSTATLGFRIEGIRSADGTSSKDFKTTKTKDQIIAAFEKFTDGFPHAIPKYI  585
            YMVWRETISSTATLGFRIEGI+ +DGTSSKDFKTTK+++QI  AF +F  G PH +P+YI
Sbjct  489  YMVWRETISSTATLGFRIEGIKKSDGTSSKDFKTTKSREQIKLAFLEFLSGHPHILPRYI  548

Query  586  QRLKAIKATLETSEFFSTHEVIGSSLLFVHDRYNANVWLIDFAKTIVLPEDITITHSSKW  645
            QRL+AI+ATL  SEFF THEVIGSSLLFVHD+ +A++WLIDFAKT+ LP  + I H S W
Sbjct  549  QRLRAIRATLAVSEFFQTHEVIGSSLLFVHDQTHASIWLIDFAKTVELPPQLRIDHYSAW  608

Query  646  KVGNHEDGYLIGVNNLIKIFMTM  668
            KVGNHEDGYLIG+NNLI IF+ +
Sbjct  609  KVGNHEDGYLIGINNLIDIFVEL  631


>Q9VYE7_DROME unnamed protein product
Length=467

 Score = 499 bits (1286),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 228/301 (76%), Positives = 262/301 (87%), Gaps = 1/301 (0%)

Query  368  NKEPSGWRKLRNIVQWTPFFQTYKKQRYPWVQLAGHQGNFKAGPDQGTILKKLCAKEEKC  427
             K+ SGWRK+RNIVQWTPFFQTYKKQRYPWVQLAGHQGNFKAGP+ GT+LKKLC KEE+C
Sbjct  130  KKKSSGWRKIRNIVQWTPFFQTYKKQRYPWVQLAGHQGNFKAGPEPGTVLKKLCPKEEEC  189

Query  428  FKILMKDVLRPYVPEYKGIITSDDKECSYIQLQDLLGDFVSPCVMDCKIGVRTYLEEELA  487
            F+ILM D+LRPYVP YKG +TS+D E  Y+QLQDLL D+V PCVMDCK+GVRTYLEEEL+
Sbjct  190  FQILMHDLLRPYVPVYKGQVTSEDGEL-YLQLQDLLSDYVQPCVMDCKVGVRTYLEEELS  248

Query  488  KAKEKPKLRKDMYEKMCQIDQNAPTDEEHKMKGVTKPRYMVWRETISSTATLGFRIEGIR  547
            KAKEKPKLRKDMY+KM QID +APT EEH  K VTKPRYMVWRETISSTATLGFRIEGI+
Sbjct  249  KAKEKPKLRKDMYDKMIQIDSHAPTAEEHAAKAVTKPRYMVWRETISSTATLGFRIEGIK  308

Query  548  SADGTSSKDFKTTKTKDQIIAAFEKFTDGFPHAIPKYIQRLKAIKATLETSEFFSTHEVI  607
             +DGTSSKDFKTTK+++QI  AF +F  G PH +P+YIQRL+AI+ATL  SEFF THEVI
Sbjct  309  KSDGTSSKDFKTTKSREQIKLAFLEFLSGHPHILPRYIQRLRAIRATLAVSEFFQTHEVI  368

Query  608  GSSLLFVHDRYNANVWLIDFAKTIVLPEDITITHSSKWKVGNHEDGYLIGVNNLIKIFMT  667
            GSSLLFVHD+ +A++WLIDFAKT+ LP  + I H S WKVGNHEDGYLIG+NNLI IF+ 
Sbjct  369  GSSLLFVHDQTHASIWLIDFAKTVELPPQLRIDHYSAWKVGNHEDGYLIGINNLIDIFVE  428

Query  668  M  668
            +
Sbjct  429  L  429


>Q7KV26_DROME unnamed protein product
Length=691

 Score = 504 bits (1299),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 229/303 (76%), Positives = 265/303 (87%), Gaps = 1/303 (0%)

Query  366  NRNKEPSGWRKLRNIVQWTPFFQTYKKQRYPWVQLAGHQGNFKAGPDQGTILKKLCAKEE  425
            +R+K+ SGWRK+RNIVQWTPFFQTYKKQRYPWVQLAGHQGNFKAGP+ GT+LKKLC KEE
Sbjct  352  DRSKKSSGWRKIRNIVQWTPFFQTYKKQRYPWVQLAGHQGNFKAGPEPGTVLKKLCPKEE  411

Query  426  KCFKILMKDVLRPYVPEYKGIITSDDKECSYIQLQDLLGDFVSPCVMDCKIGVRTYLEEE  485
            +CF+ILM D+LRPYVP YKG +TS+D E  Y+QLQDLL D+V PCVMDCK+GVRTYLEEE
Sbjct  412  ECFQILMHDLLRPYVPVYKGQVTSEDGEL-YLQLQDLLSDYVQPCVMDCKVGVRTYLEEE  470

Query  486  LAKAKEKPKLRKDMYEKMCQIDQNAPTDEEHKMKGVTKPRYMVWRETISSTATLGFRIEG  545
            L+KAKEKPKLRKDMY+KM QID +APT EEH  K VTKPRYMVWRETISSTATLGFRIEG
Sbjct  471  LSKAKEKPKLRKDMYDKMIQIDSHAPTAEEHAAKAVTKPRYMVWRETISSTATLGFRIEG  530

Query  546  IRSADGTSSKDFKTTKTKDQIIAAFEKFTDGFPHAIPKYIQRLKAIKATLETSEFFSTHE  605
            I+ +DGTSSKDFKTTK+++QI  AF +F  G PH +P+YIQRL+AI+ATL  SEFF THE
Sbjct  531  IKKSDGTSSKDFKTTKSREQIKLAFLEFLSGHPHILPRYIQRLRAIRATLAVSEFFQTHE  590

Query  606  VIGSSLLFVHDRYNANVWLIDFAKTIVLPEDITITHSSKWKVGNHEDGYLIGVNNLIKIF  665
            VIGSSLLFVHD+ +A++WLIDFAKT+ LP  + I H S WKVGNHEDGYLIG+NNLI IF
Sbjct  591  VIGSSLLFVHDQTHASIWLIDFAKTVELPPQLRIDHYSAWKVGNHEDGYLIGINNLIDIF  650

Query  666  MTM  668
            + +
Sbjct  651  VEL  653


 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 69/229 (30%), Positives = 96/229 (42%), Gaps = 77/229 (34%)

Query  166  QKNAVRRCGSSDSAVHSDEDAAVVSSWV--EKREEYNVGEGY-------------IAKSP  210
            +K  V RC SSDSA+  D D   +   +  ++R    V +               +  SP
Sbjct  56   RKMKVTRCASSDSALGLDVDDGGMDVPLPPQRRMTLTVTDLPLRPALLPLAEPTALPDSP  115

Query  211  Y-SPRGSIDHS-NVPSRTIIEAQYVPLPLDRKFSVDCVSDAPLEGDASDCRRQSCFSE--  266
              SP G  + S  VP++ ++E + V  P  R+ S                  QS +SE  
Sbjct  116  LTSPTGGGNPSVGVPTKVLLEERVVAAPGSRREST-----------------QSSYSELG  158

Query  267  -GDAPPRYRYWRTPSVVVSDYSDDIM--GLTLEDIEYIRNKK------------------  305
                P   RY RTPSVVVSDYSDDI   G+++E++EY R ++                  
Sbjct  159  VSGLPLGVRYVRTPSVVVSDYSDDITACGISMEEMEYFRLQRARGQRRCSLEAGHHSHSG  218

Query  306  --------------------ENSSSPDSSLHSSCSNLNYCGSSISALEG  334
                                ++    D S  SSCSNL YCGS+ISAL+G
Sbjct  219  GHGAHGHGGSGAAGMSPGCGKDDGQSDVSAASSCSNLYYCGSTISALDG  267


>IP3KH_CAEEL unnamed protein product
Length=494

 Score = 206 bits (524),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 117/289 (40%), Positives = 174/289 (60%), Gaps = 16/289 (6%)

Query  391  KKQRYPWVQLAGHQGNF-KAGPDQGTILKKLCAK--EEKCFKILMKD-VLRPYVPEYKGI  446
            K++   WVQL+GH+G+   A P   T+ KK CA   E + +K + KD  L  + P+Y   
Sbjct  191  KERLKKWVQLSGHEGSIVPATPH--TLYKKQCANCGEGRAYKNISKDPALDGFTPKYYDE  248

Query  447  ITSDDKECSYIQLQDLLGDFVSP---CVMDCKIGVRTYLEEELAKAKEKPKLRKDMYEKM  503
            +  +++   +I+++DLL  F  P    +MD KIG RT+LE E++  K+    R D+YEKM
Sbjct  249  LEKNEEH--FIEIEDLLQQFHDPTKTAIMDIKIGTRTFLESEVSNTKK----RADLYEKM  302

Query  504  CQIDQNAPTDEEHKMKGVTKPRYMVWRETISSTATLGFRIEGIRSADGTSSKDFKTTKTK  563
              ID + PT+EE K   +TK RYM +RE  SSTA LGFRIE  +  +G   K+FK  +T 
Sbjct  303  VAIDNDEPTEEERKCGAITKLRYMQFRERESSTAQLGFRIEAAKRLEGALEKNFKKVRTV  362

Query  564  DQIIAAFEKFTDGFPHAI-PKYIQRLKAIKATLETSEFFSTHEVIGSSLLFVHDRYNANV  622
            + +   F  F       +  + I+RLK+++  +E S FF++HEV+GSS+L V D      
Sbjct  363  EDVTTTFMDFFGTQRSRVRQQLIERLKSMRKAIEHSSFFNSHEVVGSSILIVFDTEKVGC  422

Query  623  WLIDFAKTIVLPEDITITHSSKWKVGNHEDGYLIGVNNLIKIFMTMLEH  671
            W+IDFAK+  +P   T+ H + W  GN+EDGYLIG++NL+KI   + E+
Sbjct  423  WMIDFAKSSPVPNGRTLNHRTTWIPGNNEDGYLIGIDNLVKILEELPEY  471


>M9ND56_DROME unnamed protein product
Length=318

 Score = 199 bits (506),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 110/284 (39%), Positives = 163/284 (57%), Gaps = 13/284 (5%)

Query  388  QTYKKQRYP--WVQLAGHQGNFKAGPDQGTILKKLCAKEE---KCFKILMKD-VLRPYVP  441
            Q   KQ  P  W+QL+GH  +       G + K++   E+     ++++ K+      VP
Sbjct  26   QQAHKQAKPQGWMQLSGHPESI-VPTSTGIVRKRISGLEDSEVHAYRLICKEPQTAQIVP  84

Query  442  EYKGIITSDDKECSYIQLQDLLGDFVSPCVMDCKIGVRTYLEEELAKAKEKPKLRKDMYE  501
             Y GI   + +   +I+LQDLL  F  PCVMD K+G RT+LE E++ A     LR D+Y+
Sbjct  85   AYFGI--QEMQSQHFIELQDLLAGFRDPCVMDIKMGSRTFLESEVSNAT----LRPDLYQ  138

Query  502  KMCQIDQNAPTDEEHKMKGVTKPRYMVWRETISSTATLGFRIEGIRSADGTSSKDFKTTK  561
            KM  +D  APT  EH+ + +TK RYM +RE++SS+ + GFRIE +R       KD KT +
Sbjct  139  KMIAVDAGAPTPAEHEARAITKLRYMTFRESLSSSHSKGFRIEALRLRGRPPVKDLKTCR  198

Query  562  TKDQIIAAFEKFTDGFPHAIPKYIQRLKAIKATLETSEFFSTHEVIGSSLLFVHDRYNAN  621
            + +QI    E+F         + ++RLK ++  +E S FF++HE+IGSS+  V+D     
Sbjct  199  SSEQIAQTIEQFLAARRSVQKELLKRLKHMRLVIEQSTFFASHEIIGSSIFIVYDDDRVG  258

Query  622  VWLIDFAKTIVLPEDITITHSSKWKVGNHEDGYLIGVNNLIKIF  665
            VWLIDFAK   LP  + + H S W  GN E+G L G++ LI+ F
Sbjct  259  VWLIDFAKCRELPPHVRVDHRSAWAPGNREEGLLRGMDELIRSF  302



Lambda      K        H
   0.321    0.136    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 426081712


Query= XP_018560883.1 uncharacterized protein LOC108903259 isoform X2
[Anoplophora glabripennis]

Length=697
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VYE6_DROME  unnamed protein product                                 508     5e-172
Q9VYE7_DROME  unnamed protein product                                 499     1e-171
Q7KV26_DROME  unnamed protein product                                 504     1e-170
IP3KH_CAEEL  unnamed protein product                                  206     1e-58 
M9ND56_DROME  unnamed protein product                                 199     4e-58 


>Q9VYE6_DROME unnamed protein product
Length=669

 Score = 508 bits (1307),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 232/323 (72%), Positives = 268/323 (83%), Gaps = 1/323 (0%)

Query  346  SNCSTCSTLSDEEGEATLHPNRNKEPSGWRKLRNIVQWTPFFQTYKKQRYPWVQLAGHQG  405
            S  +  S      G A+      K+ SGWRK+RNIVQWTPFFQTYKKQRYPWVQLAGHQG
Sbjct  310  STSAAGSATGSGSGAASQASTTGKKSSGWRKIRNIVQWTPFFQTYKKQRYPWVQLAGHQG  369

Query  406  NFKAGPDQGTILKKLCAKEEKCFKILMKDVLRPYVPEYKGIITSDDKECSYIQLQDLLGD  465
            NFKAGP+ GT+LKKLC KEE+CF+ILM D+LRPYVP YKG +TS+D E  Y+QLQDLL D
Sbjct  370  NFKAGPEPGTVLKKLCPKEEECFQILMHDLLRPYVPVYKGQVTSEDGEL-YLQLQDLLSD  428

Query  466  FVSPCVMDCKIGVRTYLEEELAKAKEKPKLRKDMYEKMCQIDQNAPTDEEHKMKGVTKPR  525
            +V PCVMDCK+GVRTYLEEEL+KAKEKPKLRKDMY+KM QID +APT EEH  K VTKPR
Sbjct  429  YVQPCVMDCKVGVRTYLEEELSKAKEKPKLRKDMYDKMIQIDSHAPTAEEHAAKAVTKPR  488

Query  526  YMVWRETISSTATLGFRIEGIRSADGTSSKDFKTTKTKDQIIAAFEKFTDGFPHAIPKYI  585
            YMVWRETISSTATLGFRIEGI+ +DGTSSKDFKTTK+++QI  AF +F  G PH +P+YI
Sbjct  489  YMVWRETISSTATLGFRIEGIKKSDGTSSKDFKTTKSREQIKLAFLEFLSGHPHILPRYI  548

Query  586  QRLKAIKATLETSEFFSTHEVIGSSLLFVHDRYNANVWLIDFAKTIVLPEDITITHSSKW  645
            QRL+AI+ATL  SEFF THEVIGSSLLFVHD+ +A++WLIDFAKT+ LP  + I H S W
Sbjct  549  QRLRAIRATLAVSEFFQTHEVIGSSLLFVHDQTHASIWLIDFAKTVELPPQLRIDHYSAW  608

Query  646  KVGNHEDGYLIGVNNLIKIFMTM  668
            KVGNHEDGYLIG+NNLI IF+ +
Sbjct  609  KVGNHEDGYLIGINNLIDIFVEL  631


>Q9VYE7_DROME unnamed protein product
Length=467

 Score = 499 bits (1286),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 228/301 (76%), Positives = 262/301 (87%), Gaps = 1/301 (0%)

Query  368  NKEPSGWRKLRNIVQWTPFFQTYKKQRYPWVQLAGHQGNFKAGPDQGTILKKLCAKEEKC  427
             K+ SGWRK+RNIVQWTPFFQTYKKQRYPWVQLAGHQGNFKAGP+ GT+LKKLC KEE+C
Sbjct  130  KKKSSGWRKIRNIVQWTPFFQTYKKQRYPWVQLAGHQGNFKAGPEPGTVLKKLCPKEEEC  189

Query  428  FKILMKDVLRPYVPEYKGIITSDDKECSYIQLQDLLGDFVSPCVMDCKIGVRTYLEEELA  487
            F+ILM D+LRPYVP YKG +TS+D E  Y+QLQDLL D+V PCVMDCK+GVRTYLEEEL+
Sbjct  190  FQILMHDLLRPYVPVYKGQVTSEDGEL-YLQLQDLLSDYVQPCVMDCKVGVRTYLEEELS  248

Query  488  KAKEKPKLRKDMYEKMCQIDQNAPTDEEHKMKGVTKPRYMVWRETISSTATLGFRIEGIR  547
            KAKEKPKLRKDMY+KM QID +APT EEH  K VTKPRYMVWRETISSTATLGFRIEGI+
Sbjct  249  KAKEKPKLRKDMYDKMIQIDSHAPTAEEHAAKAVTKPRYMVWRETISSTATLGFRIEGIK  308

Query  548  SADGTSSKDFKTTKTKDQIIAAFEKFTDGFPHAIPKYIQRLKAIKATLETSEFFSTHEVI  607
             +DGTSSKDFKTTK+++QI  AF +F  G PH +P+YIQRL+AI+ATL  SEFF THEVI
Sbjct  309  KSDGTSSKDFKTTKSREQIKLAFLEFLSGHPHILPRYIQRLRAIRATLAVSEFFQTHEVI  368

Query  608  GSSLLFVHDRYNANVWLIDFAKTIVLPEDITITHSSKWKVGNHEDGYLIGVNNLIKIFMT  667
            GSSLLFVHD+ +A++WLIDFAKT+ LP  + I H S WKVGNHEDGYLIG+NNLI IF+ 
Sbjct  369  GSSLLFVHDQTHASIWLIDFAKTVELPPQLRIDHYSAWKVGNHEDGYLIGINNLIDIFVE  428

Query  668  M  668
            +
Sbjct  429  L  429


>Q7KV26_DROME unnamed protein product
Length=691

 Score = 504 bits (1299),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 229/303 (76%), Positives = 265/303 (87%), Gaps = 1/303 (0%)

Query  366  NRNKEPSGWRKLRNIVQWTPFFQTYKKQRYPWVQLAGHQGNFKAGPDQGTILKKLCAKEE  425
            +R+K+ SGWRK+RNIVQWTPFFQTYKKQRYPWVQLAGHQGNFKAGP+ GT+LKKLC KEE
Sbjct  352  DRSKKSSGWRKIRNIVQWTPFFQTYKKQRYPWVQLAGHQGNFKAGPEPGTVLKKLCPKEE  411

Query  426  KCFKILMKDVLRPYVPEYKGIITSDDKECSYIQLQDLLGDFVSPCVMDCKIGVRTYLEEE  485
            +CF+ILM D+LRPYVP YKG +TS+D E  Y+QLQDLL D+V PCVMDCK+GVRTYLEEE
Sbjct  412  ECFQILMHDLLRPYVPVYKGQVTSEDGEL-YLQLQDLLSDYVQPCVMDCKVGVRTYLEEE  470

Query  486  LAKAKEKPKLRKDMYEKMCQIDQNAPTDEEHKMKGVTKPRYMVWRETISSTATLGFRIEG  545
            L+KAKEKPKLRKDMY+KM QID +APT EEH  K VTKPRYMVWRETISSTATLGFRIEG
Sbjct  471  LSKAKEKPKLRKDMYDKMIQIDSHAPTAEEHAAKAVTKPRYMVWRETISSTATLGFRIEG  530

Query  546  IRSADGTSSKDFKTTKTKDQIIAAFEKFTDGFPHAIPKYIQRLKAIKATLETSEFFSTHE  605
            I+ +DGTSSKDFKTTK+++QI  AF +F  G PH +P+YIQRL+AI+ATL  SEFF THE
Sbjct  531  IKKSDGTSSKDFKTTKSREQIKLAFLEFLSGHPHILPRYIQRLRAIRATLAVSEFFQTHE  590

Query  606  VIGSSLLFVHDRYNANVWLIDFAKTIVLPEDITITHSSKWKVGNHEDGYLIGVNNLIKIF  665
            VIGSSLLFVHD+ +A++WLIDFAKT+ LP  + I H S WKVGNHEDGYLIG+NNLI IF
Sbjct  591  VIGSSLLFVHDQTHASIWLIDFAKTVELPPQLRIDHYSAWKVGNHEDGYLIGINNLIDIF  650

Query  666  MTM  668
            + +
Sbjct  651  VEL  653


 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 69/229 (30%), Positives = 96/229 (42%), Gaps = 77/229 (34%)

Query  166  QKNAVRRCGSSDSAVHSDEDAAVVSSWV--EKREEYNVGEGY-------------IAKSP  210
            +K  V RC SSDSA+  D D   +   +  ++R    V +               +  SP
Sbjct  56   RKMKVTRCASSDSALGLDVDDGGMDVPLPPQRRMTLTVTDLPLRPALLPLAEPTALPDSP  115

Query  211  Y-SPRGSIDHS-NVPSRTIIEAQYVPLPLDRKFSVDCVSDAPLEGDASDCRRQSCFSE--  266
              SP G  + S  VP++ ++E + V  P  R+ S                  QS +SE  
Sbjct  116  LTSPTGGGNPSVGVPTKVLLEERVVAAPGSRREST-----------------QSSYSELG  158

Query  267  -GDAPPRYRYWRTPSVVVSDYSDDIM--GLTLEDIEYIRNKK------------------  305
                P   RY RTPSVVVSDYSDDI   G+++E++EY R ++                  
Sbjct  159  VSGLPLGVRYVRTPSVVVSDYSDDITACGISMEEMEYFRLQRARGQRRCSLEAGHHSHSG  218

Query  306  --------------------ENSSSPDSSLHSSCSNLNYCGSSISALEG  334
                                ++    D S  SSCSNL YCGS+ISAL+G
Sbjct  219  GHGAHGHGGSGAAGMSPGCGKDDGQSDVSAASSCSNLYYCGSTISALDG  267


>IP3KH_CAEEL unnamed protein product
Length=494

 Score = 206 bits (524),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 117/289 (40%), Positives = 174/289 (60%), Gaps = 16/289 (6%)

Query  391  KKQRYPWVQLAGHQGNF-KAGPDQGTILKKLCAK--EEKCFKILMKD-VLRPYVPEYKGI  446
            K++   WVQL+GH+G+   A P   T+ KK CA   E + +K + KD  L  + P+Y   
Sbjct  191  KERLKKWVQLSGHEGSIVPATPH--TLYKKQCANCGEGRAYKNISKDPALDGFTPKYYDE  248

Query  447  ITSDDKECSYIQLQDLLGDFVSP---CVMDCKIGVRTYLEEELAKAKEKPKLRKDMYEKM  503
            +  +++   +I+++DLL  F  P    +MD KIG RT+LE E++  K+    R D+YEKM
Sbjct  249  LEKNEEH--FIEIEDLLQQFHDPTKTAIMDIKIGTRTFLESEVSNTKK----RADLYEKM  302

Query  504  CQIDQNAPTDEEHKMKGVTKPRYMVWRETISSTATLGFRIEGIRSADGTSSKDFKTTKTK  563
              ID + PT+EE K   +TK RYM +RE  SSTA LGFRIE  +  +G   K+FK  +T 
Sbjct  303  VAIDNDEPTEEERKCGAITKLRYMQFRERESSTAQLGFRIEAAKRLEGALEKNFKKVRTV  362

Query  564  DQIIAAFEKFTDGFPHAI-PKYIQRLKAIKATLETSEFFSTHEVIGSSLLFVHDRYNANV  622
            + +   F  F       +  + I+RLK+++  +E S FF++HEV+GSS+L V D      
Sbjct  363  EDVTTTFMDFFGTQRSRVRQQLIERLKSMRKAIEHSSFFNSHEVVGSSILIVFDTEKVGC  422

Query  623  WLIDFAKTIVLPEDITITHSSKWKVGNHEDGYLIGVNNLIKIFMTMLEH  671
            W+IDFAK+  +P   T+ H + W  GN+EDGYLIG++NL+KI   + E+
Sbjct  423  WMIDFAKSSPVPNGRTLNHRTTWIPGNNEDGYLIGIDNLVKILEELPEY  471


>M9ND56_DROME unnamed protein product
Length=318

 Score = 199 bits (506),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 110/284 (39%), Positives = 163/284 (57%), Gaps = 13/284 (5%)

Query  388  QTYKKQRYP--WVQLAGHQGNFKAGPDQGTILKKLCAKEE---KCFKILMKD-VLRPYVP  441
            Q   KQ  P  W+QL+GH  +       G + K++   E+     ++++ K+      VP
Sbjct  26   QQAHKQAKPQGWMQLSGHPESI-VPTSTGIVRKRISGLEDSEVHAYRLICKEPQTAQIVP  84

Query  442  EYKGIITSDDKECSYIQLQDLLGDFVSPCVMDCKIGVRTYLEEELAKAKEKPKLRKDMYE  501
             Y GI   + +   +I+LQDLL  F  PCVMD K+G RT+LE E++ A     LR D+Y+
Sbjct  85   AYFGI--QEMQSQHFIELQDLLAGFRDPCVMDIKMGSRTFLESEVSNAT----LRPDLYQ  138

Query  502  KMCQIDQNAPTDEEHKMKGVTKPRYMVWRETISSTATLGFRIEGIRSADGTSSKDFKTTK  561
            KM  +D  APT  EH+ + +TK RYM +RE++SS+ + GFRIE +R       KD KT +
Sbjct  139  KMIAVDAGAPTPAEHEARAITKLRYMTFRESLSSSHSKGFRIEALRLRGRPPVKDLKTCR  198

Query  562  TKDQIIAAFEKFTDGFPHAIPKYIQRLKAIKATLETSEFFSTHEVIGSSLLFVHDRYNAN  621
            + +QI    E+F         + ++RLK ++  +E S FF++HE+IGSS+  V+D     
Sbjct  199  SSEQIAQTIEQFLAARRSVQKELLKRLKHMRLVIEQSTFFASHEIIGSSIFIVYDDDRVG  258

Query  622  VWLIDFAKTIVLPEDITITHSSKWKVGNHEDGYLIGVNNLIKIF  665
            VWLIDFAK   LP  + + H S W  GN E+G L G++ LI+ F
Sbjct  259  VWLIDFAKCRELPPHVRVDHRSAWAPGNREEGLLRGMDELIRSF  302



Lambda      K        H
   0.321    0.136    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 426081712


Query= XP_018560884.1 histidine-rich glycoprotein [Anoplophora
glabripennis]

Length=252
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q584T3_TRYB2  unnamed protein product                                 29.3    4.3  


>Q584T3_TRYB2 unnamed protein product
Length=775

 Score = 29.3 bits (64),  Expect = 4.3, Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 43/82 (52%), Gaps = 5/82 (6%)

Query  53   GHEHHSDHHGSHGEKGDK-GYKGHHHHEKGEKGHHDKEGHQKHYEEHGGHKKHHHHDDG-  110
            G + + D+ G  GE GD+ G +G +  + G++ ++D  G +  + + GG +  +  D G 
Sbjct  21   GDQRNYDNRGGRGEWGDRGGQRGDNQRDYGDQRNYDNRGGRGEWGDRGGQRGDNQRDYGD  80

Query  111  ---YHAEHHKGEKGDKGHQYGE  129
               Y     +GE GD+G Q G+
Sbjct  81   QRNYDNRGGRGEWGDRGGQRGD  102



Lambda      K        H
   0.321    0.136    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 426081712


Query= XP_018560885.1 methionine--tRNA ligase, mitochondrial [Anoplophora
glabripennis]

Length=557
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q38C91_TRYB2  unnamed protein product                                 383     3e-124
Q4QCD2_LEIMA  unnamed protein product                                 375     1e-121
Q8IJ60_PLAF7  unnamed protein product                                 249     8e-73 
Q8I716_PLAF7  unnamed protein product                                 140     4e-35 
A1ZBE9_DROME  unnamed protein product                                 99.0    2e-21 


>Q38C91_TRYB2 unnamed protein product
Length=773

 Score = 383 bits (983),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 212/519 (41%), Positives = 301/519 (58%), Gaps = 26/519 (5%)

Query  13   SSQAKSVAYYTTPIYYVNANPHIGHLYSSLIADASQRWHNVANKGCIIKFSTGTDEHGSK  72
            S++ + V + T+PIYYVNA PHIGH+YS+LI D   R+H V  KG  +   TGTDEHG K
Sbjct  235  SAKVEKVFFVTSPIYYVNAAPHIGHVYSTLITDVIGRYHRV--KGERVFALTGTDEHGQK  292

Query  73   IQQAAETNNSSPPDYCSNISKRYKALAERFNIACTDFIRTTEETHKNTVQNFWNVLNKNG  132
            + +AA+    SP D+ + ++  +K   E+ + +   FIRTT E HK  V+  W  L + G
Sbjct  293  VAEAAKQKQVSPYDFTAAVAGEFKKCFEQMDYSIDYFIRTTNEQHKAVVKELWTKLEQKG  352

Query  133  HIYSSTYSGWYCVSDESFLTDSQLKETVGADGRKIMVSSESGHPVEWTEEPNYMFKLHSF  192
             IY   Y GWY +SDESFLT   + + V  DG    VS ESGH V W  E NYMF+L +F
Sbjct  353  DIYLGRYEGWYSISDESFLTPQNITDGVDKDGNPCKVSLESGHVVTWVSEENYMFRLSAF  412

Query  193  REELIYWLTRDEKIIRPKKFQKILLDLICNGDLPDVSISRPSSRVH-WGIRVPGDDAQTV  251
            RE L+ W   +   I P+  ++ ++  +  G LPD+S+SR    +H W I VPG+    V
Sbjct  413  RERLLEWYHANPGCIVPEFRRREVIRAVEKG-LPDLSVSRKKETLHNWAIPVPGNPDHCV  471

Query  252  YVWLDALVNYLTVAGYSLDPS--------EFQKV--WPPDVQVIGKDILKFHGVYWPAFL  301
            YVWLDAL NYLT +   +D S        +F ++  +P DV VIGKDILKFH +YWPAFL
Sbjct  472  YVWLDALTNYLTGSRLRVDESGKEVSLADDFSELERFPADVHVIGKDILKFHAIYWPAFL  531

Query  302  MAANLEPPRSILCHSHWTVDGEKMSKSKNNVVCPFDRSGVYTSDGLRYFLLREGVAHSDG  361
            ++A L  P+ I+ H  WT D +K+SKS  NV  P +++  +  D L+YFLLRE     DG
Sbjct  532  LSAGLPLPKKIVAHGWWTKDRKKISKSLGNVFDPVEKAEEFGYDALKYFLLRESGFSDDG  591

Query  362  NYSDTKVIRILNSELADTLGNLLSRCCGAALNPDQTVPRMEVEALESVAALDVTKRLIES  421
            +YSD  +I  LN ELADTLGNL+ RC  A +N +   P          A  +  + LI+ 
Sbjct  592  DYSDKNMIARLNGELADTLGNLVMRCTSAKINVNGEWP-------SPAAYTEEDESLIQL  644

Query  422  VEKLPDVCRGHYEDFNFYRVADSIISTLHSANLFFETLKPWEL-KKNPQTSKELDVVLHL  480
            ++ LP     +Y   +  +   ++   L + N +   + PW+L K +P+    L  VL++
Sbjct  645  IKDLPGTADHYYLIPDIQKAIIAVFDVLRAINAYVTDMAPWKLVKTDPE---RLRTVLYI  701

Query  481  TMETLRVAAILLQPIIPNISGDLLDKINV-EKHQRHFED  518
            T+E +RV  +LL PI+P  S  + D + V E H++  E+
Sbjct  702  TLEGVRVTTLLLSPILPRKSVVIFDMLGVPEVHRKGIEN  740


>Q4QCD2_LEIMA unnamed protein product
Length=747

 Score = 375 bits (964),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 208/512 (41%), Positives = 286/512 (56%), Gaps = 22/512 (4%)

Query  13   SSQAKSVAYYTTPIYYVNANPHIGHLYSSLIADASQRWHNVANKGCIIKFSTGTDEHGSK  72
            S + + V + TTPIYYVNA+PHIGH+YS+LI D   R+H V  KG  +   TGTDEHG K
Sbjct  204  SPKKQKVFFATTPIYYVNASPHIGHVYSTLIVDVLGRYHRV--KGEEVFVMTGTDEHGQK  261

Query  73   IQQAAETNNSSPPDYCSNISKRYKALAERFNIACTDFIRTTEETHKNTVQNFWNVLNKNG  132
            + +AA     SP D+ +++S  +K   +  N     FIRTT  TH+  VQ+ W  L   G
Sbjct  262  VAEAAAKQGVSPMDFTTSVSSEFKQCFQEMNYDMNYFIRTTNPTHEKLVQDIWKKLAAKG  321

Query  133  HIYSSTYSGWYCVSDESFLTDSQLKETVGADGRKIMVSSESGHPVEWTEEPNYMFKLHSF  192
             IY   Y GWY VSDESFLT   + + V  DG+   VS ESGH V W EE NYMF+L +F
Sbjct  322  DIYLGKYEGWYSVSDESFLTAQNVADGVDRDGKPCKVSLESGHVVTWVEEENYMFRLSAF  381

Query  193  REELIYWLTRDEKIIRPKKFQKILLDLICNGDLPDVSISRP-SSRVHWGIRVPGDDAQTV  251
            RE L+ +       I P+  ++ ++  +  G L D+SISR   S ++W I VPGD+   +
Sbjct  382  RERLLKYFHDHPNCIVPEFRRREVIKTVEKG-LFDLSISRKRESVMNWSIPVPGDERHCI  440

Query  252  YVWLDALVNYLTVAGYSLDPSEFQKV---------WPPDVQVIGKDILKFHGVYWPAFLM  302
            YVWLDAL NY T A   +     + +         WP DV V+GKDILKFH +YWPAFLM
Sbjct  441  YVWLDALFNYYTGALTRVATDGTETLDEDHHALNRWPADVHVVGKDILKFHAIYWPAFLM  500

Query  303  AANLEPPRSILCHSHWTVDGEKMSKSKNNVVCPFDRSGVYTSDGLRYFLLREGVAHSDGN  362
            +A L  P  ++ H  WT D +K+SKS  N   P +++  +  D L+YFL+RE     DG+
Sbjct  501  SAELPLPERLVSHGWWTKDHKKISKSLGNAFDPVEKAKEFGIDALKYFLMRESNFQDDGD  560

Query  363  YSDTKVIRILNSELADTLGNLLSRCCGAALNPDQTVPRMEVEALESVAALDVTKRLIESV  422
            YSD  ++  LN ELADTLGNL+SRC    +N +   P       E     +  K LI S+
Sbjct  561  YSDKNMVARLNGELADTLGNLVSRCVAPKINVNGMWP-------EPAEYSESDKTLIASL  613

Query  423  EKLPDVCRGHYEDFNFYRVADSIISTLHSANLFFETLKPWELKKNPQTSKELDVVLHLTM  482
              L      +Y   +      +I   L S N +     PW+L K    +  L  VL++TM
Sbjct  614  NNLAGTVDHYYCLPDIQHALIAIFDVLRSLNAYVTENAPWKLVK--MDTARLGTVLYVTM  671

Query  483  ETLRVAAILLQPIIPNISGDLLDKINVEKHQR  514
            E LR+  + LQP++P  + +++D + V +  R
Sbjct  672  EGLRICTMFLQPVMPQKAKEIMDALGVPEAAR  703


>Q8IJ60_PLAF7 unnamed protein product
Length=889

 Score = 249 bits (636),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 154/493 (31%), Positives = 255/493 (52%), Gaps = 28/493 (6%)

Query  21   YYTTPIYYVNANPHIGHLYSSLIADASQRWHNVANKGCIIKFSTGTDEHGSKIQQAAETN  80
            Y TT I YVN +PHIGH Y  ++ADA  R+H +  +     F+TG DEHG KI   A  N
Sbjct  226  YITTAINYVNGDPHIGHAYEIVLADAIARYHKIIGRDTF--FTTGADEHGLKIANQAAKN  283

Query  81   NSSPPDYCSNISKRYKALAERFNIACTDFIRTTEETHKNTVQNFWNVLNKNGHIYSSTYS  140
            N +P + C     +++ L +   +    ++RTT ++HK   Q  W+   KNG IY   Y 
Sbjct  284  NMTPKELCDKNVLKFQNLNKLLYVEDDYYVRTTRDSHKKIAQEVWDKCEKNGDIYLGEYE  343

Query  141  GWYCVSDESFLTDSQLKETVGADGRKIMVSSESGHPVEWTEEPNYMFKLHSFREELIYWL  200
            GWY V +E+++ +++ K     D         +   +E  +EP+Y FK+  ++++LI ++
Sbjct  344  GWYNVREETYVPENEAKLMNYIDPL-------NNIKLEKMKEPSYFFKMSKYQDKLIEYI  396

Query  201  TRDEKIIRPKKFQKILLDLICNGDLPDVSISRPSSRVHWGIRVPGDDAQTVYVWLDALVN  260
              +   I+P++ +  +L  +    L D+S SR  ++  WGI+VP D    +YVW+DAL+N
Sbjct  397  QSNPDYIQPEQKRNEILQRL-KEPLADLSCSR--TKFTWGIQVPNDPKHVMYVWMDALIN  453

Query  261  YLTVAGYSLDPSEFQKVWPPDVQVIGKDILKFHGVYWPAFLMAANLEPPRSILCHSH-WT  319
            Y +     +D  + +K WP +V +IGKDI  FH V +P  L++AN+   +S+  H     
Sbjct  454  YYSSCF--IDEGK-KKYWPANVHIIGKDITWFHTVIFPTILLSANIPLSKSVFSHGFVLA  510

Query  320  VDGEKMSKSKNNVVCPFDRSGVYTSDGLRYFLLREGVAHSDGNYSDTKVIRILNSELADT  379
             DG+KMSKS  NV+ P +    Y +D  RY +++E     D  +    ++ + NS+LADT
Sbjct  511  ADGKKMSKSLGNVINPLEIIDKYGADAFRYHVIKETKRGCDTRFDVDNLVDMCNSDLADT  570

Query  380  LGNLLSRCCG-AALNPDQTVPRMEVEALESVAALDVTKRLIESVEKLPDVCRGHYEDFNF  438
            +GNL+ R      L  +  +P    E  E    +D+    I  VE        H + F  
Sbjct  571  IGNLVQRTLSLCQLCNESKIPAFYPE-YEIHLPIDIL-HFINRVE-------YHMKTFCV  621

Query  439  YRVADSIISTLHSANLFFETLKPWELKKNPQTSKELDVVLHLTMETLRVAAILLQPIIPN  498
             +  +  +      N F   + PW+ K + + +K+L ++  + +E +   A  L   IP+
Sbjct  622  QKCCEKSVQVCKDLNKFLTDMAPWKYKDDLK-NKKLHII-RIMLEAIYFIAHYLDIFIPS  679

Query  499  ISGDLLDKINVEK  511
            +S  + +K+N  K
Sbjct  680  LSHKIFEKLNTPK  692


>Q8I716_PLAF7 unnamed protein product
Length=749

 Score = 140 bits (354),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 81/262 (31%), Positives = 140/262 (53%), Gaps = 14/262 (5%)

Query  9    CRHYSSQAKSVAYYTTPIYYVNANPHIGHLYSSLIADASQRWHNVANKGCI---IKFSTG  65
            C      A+     +TP+YY N  PHIGH Y +++ D   ++  +         I F +G
Sbjct  133  CIKKVCNAEEYLLISTPVYYSNDRPHIGHAYCNILCDVLYKYEKLKGVEKKKKGIIFFSG  192

Query  66   TDEHGSKIQQAAETNNSSPPDYCSNISKRYKALAERFNIACTDFIRTTEETHKNTVQNFW  125
             DEHG KI++    N     +Y  +IS  YK + ++ ++    F RT+   HK  VQN W
Sbjct  193  MDEHGLKIEKKCNKNKMKIIEYIDDISNYYKDMNKKLSVDVNLFYRTSYSFHKMFVQNVW  252

Query  126  NVLNKNGHIYSSTYSGWYCVSDESFLTDSQLKETVGADGRKIMVSSESGHPVEWTEEPNY  185
              L  N +IY  TY G+Y +++E ++++ +L+E       K  + +E+   VE  EE +Y
Sbjct  253  KYLVHNNYIYKDTYKGYYNINEERYISEQELREG------KYKIDNENIIYVE--EENSY  304

Query  186  MFKLHSFREELIYWLTRDEKIIRPKKFQKILLDLICNGDLPDVSISRPSSRVHWGIRVPG  245
             F +  F++ LI +  ++E  I P   +K ++  + N +L ++ ISR +++  W I++P 
Sbjct  305  FFNILKFKDYLIDFYEKNENFIYPPYLRKQVIYTLKN-ELRNICISRYNTK--WAIQIPN  361

Query  246  DDAQTVYVWLDALVNYLTVAGY  267
            +   T+YVW DAL++Y++   Y
Sbjct  362  EAEGTIYVWFDALLSYVSSMLY  383


 Score = 122 bits (305),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 78/234 (33%), Positives = 120/234 (51%), Gaps = 11/234 (5%)

Query  275  QKVWPPDVQVIGKDILKFHGVYWPAFLMAANLEPPRSILCHSHWTVDGEKMSKSKNNVVC  334
            +K W P +QVIGKDIL FH + +   L + NLE P+ ILCH     +  KMSKS NNVV 
Sbjct  495  KKFWNPFIQVIGKDILNFHAILYICLLKSLNLELPQKILCHGLIKNENIKMSKSLNNVVN  554

Query  335  PFDRSGVYTSDGLRYFLLREGVAHSDGNYSDTKVIRILNSELADTLGNLLSRCCGAAL-N  393
            PFD    Y  D LR + +  G  + D NY +   I      L + +GNLL R     + N
Sbjct  555  PFDLLKKYNPDVLRLYFMGCGSIYEDKNYKEQN-IESFELFLRNNVGNLLYRVVSLCIEN  613

Query  394  PDQTVPRMEVEALESVAALDVTKRLIESVEKLPDVCRGHYEDFNFYRVADSIISTLHSAN  453
                VP ++    +S   L+  K  I++ + +P     + ++  + +  + I++ + + N
Sbjct  614  NYNMVPVIKTNDYDSNIILNEWKDNIKN-KLIP-----YLDNMEYIQFLELIMTLIKNVN  667

Query  454  LFFETLKPWELKKNPQTSKELDVVLHLTMETLRVAAILLQPIIPNISGDLLDKI  507
             FF    PW  KK+ Q        +++T+E ++  +IL+ P IPNIS  +L  I
Sbjct  668  KFFVHNTPWNYKKDTQ---HFHTTIYVTLECMKYFSILMFPFIPNISLAILRNI  718


>A1ZBE9_DROME unnamed protein product
Length=1022

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 125/531 (24%), Positives = 213/531 (40%), Gaps = 64/531 (12%)

Query  23   TTPIYYVNANPHIGHLYSSLI-ADASQRWHNVANKGCIIKFSTGTDEHGSKIQQAAETNN  81
            T+ + YVN  PH+G++   ++ AD   R+   A    ++    GTDE+G+  +  A   N
Sbjct  259  TSALPYVNNVPHLGNIIGCVLSADIYARYSRSAGYNTLL--ICGTDEYGTATENKALAEN  316

Query  82   SSPPDYCSNISKRYKALAERFNIACTDFIRTTEETHKNTVQNFWNVLNKNGHIYSSTYSG  141
             +P + C    + + A+   F I    F RTT +   + VQ  +  + K G+I + +   
Sbjct  317  LTPREICDKYFELHNAIYRWFGIGFDYFGRTTTQEQTDIVQEAFKDVLKAGYIITESVEQ  376

Query  142  WYCVSDESFLTDSQLKETV-----GADGRKIMVSSESGHPVEWTE---------------  181
              C   + FL D  ++ T      G +  +     + G  V  TE               
Sbjct  377  LLCQKCDRFLADRFVEGTCPHPGCGYEDARGDQCDKCGKLVNATELIRPRCKVCNSAPVL  436

Query  182  --EPNYMFKLHSFREELIYWLTRDEKIIRPKKFQKILLDLICNGDLPDVSISRPSSRVHW  239
                     L     +L  W+ + E         K++        L    I+R    + W
Sbjct  437  RSSDQLFIDLPKAEPQLKEWVDKSEGGWTHNA--KVITRAWLKEGLKPRCITR---DLKW  491

Query  240  GIRVP--GDDAQTVYVWLDALVNYLTVAG-YSLDPSEFQKVWPP----DV---QVIGKDI  289
            GI VP  G + +  YVW DA   Y+++   Y+    E+Q+ W P    DV   Q + KD 
Sbjct  492  GIPVPHEGFEKKVFYVWFDAPFGYVSMTKRYT---KEYQQWWQPAKGTDVELFQFMAKDN  548

Query  290  LKFHGVYWPAFLMAANLEPP--RSILCHSHWTVDGEKMSKSKNNVVCPFD--RSGVYTSD  345
            + FH V WP+ L+A N        I+   +   +  K SKS+   V   D   +G+  +D
Sbjct  549  VPFHSVVWPSVLLAINKGHTLVSHIMATEYLNYEDGKFSKSRGIGVFGNDAQETGI-PAD  607

Query  346  GLRYFLLREGVAHSDGNYSDTKVIRILNSELADTLGNLLSRC-CGAALNPDQTVPRMEVE  404
              R++L        D ++S   +    NSEL + LGN ++R       N   TVP +   
Sbjct  608  VWRFYLASARPEGQDSSFSWNDLAARNNSELLNNLGNFVNRALVFCEKNFSSTVPGVITT  667

Query  405  ALESVAALDVTKRLIESVEKLPDVCRGHYEDFNFYRVADSI---ISTLHSANLFFETLKP  461
              E V    + + L           RG+       ++ D +   ++     N + ++ +P
Sbjct  668  QDELVLLALINREL-----------RGYINSMEKAKLRDGVRHLLAISRHGNGYMQSQQP  716

Query  462  WELKKNPQTSK-ELDVVLHLTMETLRVAAILLQPIIPNISGDLLDKINVEK  511
            W L K     K     ++ L +    + A LL P +P  +  L  ++N ++
Sbjct  717  WVLLKGTDDQKTRASTIIGLCVNIACLLANLLFPYMPTTARTLFGQLNAKQ  767



Lambda      K        H
   0.321    0.136    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 426081712


Query= XP_018560886.1 protein TIS11 [Anoplophora glabripennis]

Length=264
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TIS11_DROME  unnamed protein product                                  159     6e-46
Q7YXD9_CAEEL  unnamed protein product                                 112     1e-28
Q20155_CAEEL  unnamed protein product                                 112     2e-28
G5ECB9_CAEEL  unnamed protein product                                 86.3    6e-19
G5EF15_CAEEL  unnamed protein product                                 77.8    1e-16


>TIS11_DROME unnamed protein product
Length=436

 Score = 159 bits (402),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 81/105 (77%), Gaps = 10/105 (10%)

Query  66   LGNLTQQHRRLERTQSAPAPAVAAPAAAVAATTVNTSRYKTELCRPFEEFGVCKYGDKCQ  125
            LGN+   HR+LERTQS P P             +NTSRYKTELCRPFEE G CKYG+KCQ
Sbjct  108  LGNMNL-HRKLERTQSEPLPP---------QQPMNTSRYKTELCRPFEEAGECKYGEKCQ  157

Query  126  FAHGINELRSLARHPKYKTELCRTYHTVGFCPYGPRCHFVHNQDE  170
            FAHG +ELR++ RHPKYKTE CRT+H+VGFCPYGPRCHFVHN DE
Sbjct  158  FAHGSHELRNVHRHPKYKTEYCRTFHSVGFCPYGPRCHFVHNADE  202


>Q7YXD9_CAEEL unnamed protein product
Length=419

 Score = 112 bits (281),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 67/97 (69%), Gaps = 1/97 (1%)

Query  100  NTSRYKTELCRPFEEFGVCKYGDKCQFAHGINELRSLARHPKYKTELCRTYHTVGFCPYG  159
            N   YKTELCR + + G C YG++CQ+AHG  E R + RHPKYKTE C+++H  G+CPYG
Sbjct  154  NPKLYKTELCRSWMDHGRCNYGERCQYAHGELEKRPVPRHPKYKTEACQSFHQSGYCPYG  213

Query  160  PRCHFVHNQDEVAIQKTAPQVSALLNARTT-SVVASR  195
            PRCHF+HN+   A  + +  +S  +  +TT S+ AS+
Sbjct  214  PRCHFIHNEPPSAQSQYSTPISTPVPHQTTPSLYASQ  250


>Q20155_CAEEL unnamed protein product
Length=460

 Score = 112 bits (281),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 67/97 (69%), Gaps = 1/97 (1%)

Query  100  NTSRYKTELCRPFEEFGVCKYGDKCQFAHGINELRSLARHPKYKTELCRTYHTVGFCPYG  159
            N   YKTELCR + + G C YG++CQ+AHG  E R + RHPKYKTE C+++H  G+CPYG
Sbjct  195  NPKLYKTELCRSWMDHGRCNYGERCQYAHGELEKRPVPRHPKYKTEACQSFHQSGYCPYG  254

Query  160  PRCHFVHNQDEVAIQKTAPQVSALLNARTT-SVVASR  195
            PRCHF+HN+   A  + +  +S  +  +TT S+ AS+
Sbjct  255  PRCHFIHNEPPSAQSQYSTPISTPVPHQTTPSLYASQ  291


>G5ECB9_CAEEL unnamed protein product
Length=494

 Score = 86.3 bits (212),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 45/68 (66%), Gaps = 5/68 (7%)

Query  104  YKTELCRPFEEFGVCKYGDKCQFAHGINELRSLAR-----HPKYKTELCRTYHTVGFCPY  158
            +KT LC  F+  G C YG+ C+FAHG NELR  ++     HPKYKT+LC  +   G CPY
Sbjct  139  FKTALCDAFKRSGSCPYGEACRFAHGENELRMPSQPRGKAHPKYKTQLCDKFSNFGQCPY  198

Query  159  GPRCHFVH  166
            GPRC F+H
Sbjct  199  GPRCQFIH  206


 Score = 43.1 bits (100),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 20/30 (67%), Gaps = 0/30 (0%)

Query  103  RYKTELCRPFEEFGVCKYGDKCQFAHGINE  132
            +YKT+LC  F  FG C YG +CQF H + +
Sbjct  181  KYKTQLCDKFSNFGQCPYGPRCQFIHKLKK  210


 Score = 37.7 bits (86),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 21/40 (53%), Gaps = 0/40 (0%)

Query  134  RSLARHPKYKTELCRTYHTVGFCPYGPRCHFVHNQDEVAI  173
            R   +   +KT LC  +   G CPYG  C F H ++E+ +
Sbjct  131  RQKRKEEAFKTALCDAFKRSGSCPYGEACRFAHGENELRM  170


>G5EF15_CAEEL unnamed protein product
Length=264

 Score = 77.8 bits (190),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 41/68 (60%), Gaps = 5/68 (7%)

Query  104  YKTELCRPFEEFGVCKYGDKCQFAHGINELR-----SLARHPKYKTELCRTYHTVGFCPY  158
            +KT LC  ++    C YGD+C+FAHG++ELR         HPKYKT LC  +   G C Y
Sbjct  99   FKTALCDAYKRSQACSYGDQCRFAHGVHELRLPMNPRGRNHPKYKTVLCDKFSMTGNCKY  158

Query  159  GPRCHFVH  166
            G RC F+H
Sbjct  159  GTRCQFIH  166


 Score = 41.6 bits (96),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 19/31 (61%), Gaps = 0/31 (0%)

Query  100  NTSRYKTELCRPFEEFGVCKYGDKCQFAHGI  130
            N  +YKT LC  F   G CKYG +CQF H I
Sbjct  138  NHPKYKTVLCDKFSMTGNCKYGTRCQFIHKI  168


 Score = 33.1 bits (74),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 13/41 (32%), Positives = 19/41 (46%), Gaps = 0/41 (0%)

Query  133  LRSLARHPKYKTELCRTYHTVGFCPYGPRCHFVHNQDEVAI  173
            +R   +   +KT LC  Y     C YG +C F H   E+ +
Sbjct  90   MRQRRKEDAFKTALCDAYKRSQACSYGDQCRFAHGVHELRL  130



Lambda      K        H
   0.321    0.136    0.421 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 426081712


Query= XP_018560887.1 liprin-beta-2 isoform X1 [Anoplophora glabripennis]

Length=1038
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VU88_DROME  unnamed protein product                                 441     1e-141
A7LPI2_CAEEL  unnamed protein product                                 256     2e-71 
LIPB_CAEEL  unnamed protein product                                   252     3e-70 
Q9W263_DROME  unnamed protein product                                 175     2e-44 
A8DYM0_DROME  unnamed protein product                                 175     3e-44 


>Q9VU88_DROME unnamed protein product
Length=680

 Score = 441 bits (1133),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 264/660 (40%), Positives = 378/660 (57%), Gaps = 103/660 (16%)

Query  354  APPPCCFYGDRSYHWTPPPYPKPGEQDEKFRKIQYERDNLQLQVQVLTEQIEAQSDKISD  413
            AP P          W     P+  + DE+ R++Q +++ L LQ Q+L E++  Q+DKI +
Sbjct  72   APAPDPVTAAIISDWLETHIPRQ-DSDERMRRLQRDKEGLALQYQMLAERVSEQADKIIE  130

Query  414  LEKLLQEKKQLLSETEEKLQREVLSRSSLETQKLELMSIMSELKLQQAALERENLELRNS  473
            LE L+ EK Q L   EE+LQR+++S S+LETQKLELMS +SELKL + ALE+ N