BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= NP_001291655.1 vitellogenin-1-like precursor [Bactrocera dorsalis]

Length=436
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

VIT3_DROME  unnamed protein product                                   496     6e-175
VIT2_DROME  unnamed protein product                                   483     2e-169
Q9VX69_DROME  unnamed protein product                                 159     5e-44 


>VIT3_DROME unnamed protein product
Length=420

 Score = 496 bits (1276),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 248/434 (57%), Positives = 313/434 (72%), Gaps = 24/434 (6%)

Query  1    MNPLKIFCFMAFVLAIANASPKHGKNKDNMNSLKPVDWLSASELESMPSVEDITLQQLEN  60
            M  L+I C +A  L +A  + K   N    + LKP  WL+A+ELE++PS+ DIT ++LEN
Sbjct  1    MMSLRI-CLLATCLLVAAHASKDASN----DRLKPTKWLTATELENVPSLNDITWERLEN  55

Query  61   MSVEDAQRKIEKLYHLSQINHALEPSFVPSPSNVPVILMKPNGQPERTNLNELVQTAKQQ  120
              +E   + IEK+YH+ QI H L PSFVPSPSNVPV ++K NGQ     LN  V+TAK Q
Sbjct  56   QPLEQGAKVIEKIYHVGQIKHDLTPSFVPSPSNVPVWIIKSNGQKVECKLNNYVETAKAQ  115

Query  121  PNFGDEEVTIFITGLPQSSPSVAKANKKLIQAYMQRYNGQR--------QPISNNQDYDY  172
            P FG++EVTI +TGLP++SP+  KA ++LIQAY+Q+YN Q+        Q    + DYDY
Sbjct  116  PGFGEDEVTIVLTGLPKTSPAQQKAMRRLIQAYVQKYNLQQLQKNAQEQQQQLKSSDYDY  175

Query  173  GNNKDNQGATSSEEDYSESWKNPKPTKGNLVVISLGSTLTNMKRLALIDVEQTGNMIGKA  232
                     TSSEE  ++ WK+ K   G+L++I LGSTLTN KR A++DV  TG MIG+ 
Sbjct  176  ---------TSSEEA-ADQWKSAKAASGDLIIIDLGSTLTNFKRYAMLDVLNTGAMIGQT  225

Query  233  LVELTNECGVPQEIIHIVGQGVGAQVAGAAGRQYKRLTGHQLRRITALDPAKLFAKDKDM  292
            L++LTN+ GVPQEIIH++GQG+ A VAGAAG +Y   TGH+LRRIT LDPAK+ +K   +
Sbjct  226  LIDLTNK-GVPQEIIHLIGQGISAHVAGAAGNKYTAQTGHKLRRITGLDPAKVLSKRPQI  284

Query  293  LTGLARGDADFVDAIHTSTCGMGTRQRVGDVDFYVNGPASAAPGATNVIEATMRATRYFA  352
            L GL+RGDADFVDAIHTST  MGT  R GDVDFY NGP++  PG+ NVIEA  RATRYFA
Sbjct  285  LGGLSRGDADFVDAIHTSTFAMGTPIRCGDVDFYPNGPSTGVPGSENVIEAVARATRYFA  344

Query  353  ESVRPGNERNFPAVAANSMDQYENNDGAGKRAYMGIATDFDLEGDYILKVNSKSPFGKSA  412
            ESVRPG+ERNFPAV ANS+ QY+  DG GKRAYMG+  D+DL GDYIL+VN+KSPFG+ +
Sbjct  345  ESVRPGSERNFPAVPANSLKQYKEQDGFGKRAYMGLQIDYDLRGDYILEVNAKSPFGQRS  404

Query  413  PAQKQSTYHGQHQA  426
            PA KQ+ YHG H A
Sbjct  405  PAHKQAAYHGMHHA  418


>VIT2_DROME unnamed protein product
Length=442

 Score = 483 bits (1243),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 235/442 (53%), Positives = 315/442 (71%), Gaps = 14/442 (3%)

Query  1    MNPLKIFCFMAFVLAIANASPKHG-KNKDNMNSL----KPVDWLSASELESMPSVEDITL  55
            MNPL+  C MA +LA+A  +P+ G ++    NSL    +P +W++  E+E +P+++++TL
Sbjct  1    MNPLRTLCVMACLLAVAMGNPQSGNRSGRRSNSLDNVEQPSNWVNPREVEELPNLKEVTL  60

Query  56   QQLENMSVEDAQRKIEKLYHLSQINHALEPSFVPSPSNVPVILMKPNGQPERTNLNELVQ  115
            ++L+ MS+E+    ++KLYHLSQ NH  +P + P PS +   ++   GQ    NLN LV+
Sbjct  61   KKLQEMSLEEGATLLDKLYHLSQFNHVFKPDYTPEPSQIRGYIVGERGQKIEFNLNTLVE  120

Query  116  TAKQQPNFGDEEVTIFITGLPQSSPSVAKANKKLIQAYMQRYNGQRQPISNNQDYDYGNN  175
              K+Q  FGD+EVTIFI GLP+++  V KA +KL+QAY QRYN   QP       DY N 
Sbjct  121  KVKRQQKFGDDEVTIFIQGLPETNTQVQKATRKLVQAYQQRYN--LQPYETT---DYSNE  175

Query  176  KDNQGATSSEEDYSESWKNPK---PTKGNLVVISLGSTLTNMKRLALIDVEQTGNMIGKA  232
            + +Q ++S E+      +N +      G+L+VI LG+ + + ++ A +++E+ G +IG  
Sbjct  176  EQSQRSSSEEQQTQRRKQNGEQDDTKTGDLIVIQLGNAIEDFEQYATLNIERLGEIIGNR  235

Query  233  LVELTNECGVPQEIIHIVGQGVGAQVAGAAGRQYKRLTGHQLRRITALDPAKLFAKDKDM  292
            LVELTN   VPQEIIH++G G  A VAG AGRQ+ R TGH+LRRITALDP K++ K ++ 
Sbjct  236  LVELTNTVNVPQEIIHLIGSGPAAHVAGVAGRQFTRQTGHKLRRITALDPTKIYGKPEER  295

Query  293  LTGLARGDADFVDAIHTSTCGMGTRQRVGDVDFYVNGPASAAPGATNVIEATMRATRYFA  352
            LTGLARGDADFVDAIHTS  GMGT QR+ +VDF+ NGP++  PGA NV+EATMRATRYFA
Sbjct  296  LTGLARGDADFVDAIHTSAYGMGTSQRLANVDFFPNGPSTGVPGADNVVEATMRATRYFA  355

Query  353  ESVRPGNERNFPAVAANSMDQYENNDGAGKRAYMGIATDFDLEGDYILKVNSKSPFGKSA  412
            ESVRPGNERNFP+VAA+S  +Y+ N G GKR YMGIATDFDL+GDYIL+VNSKSPFG+S 
Sbjct  356  ESVRPGNERNFPSVAASSYQEYKQNKGYGKRGYMGIATDFDLQGDYILQVNSKSPFGRST  415

Query  413  PAQKQSTYHGQHQAWK-SGKNQ  433
            PAQKQ+ YH  HQ W+ S  NQ
Sbjct  416  PAQKQTGYHQVHQPWRQSSSNQ  437


>Q9VX69_DROME unnamed protein product
Length=411

 Score = 159 bits (401),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 86/224 (38%), Positives = 125/224 (56%), Gaps = 4/224 (2%)

Query  201  NLVVISLGSTLTNMKRLALIDVEQTGNMIGKALVELTNECGVPQEIIHIVGQGVGAQVAG  260
            N V +     +  +   +  + E+ G  I   LV+L +   VP E IH++G  +GA + G
Sbjct  164  NFVAVDAARFVDTLYTWSAFNTEEIGENIALGLVKLLDL--VPVENIHLIGHSLGAHIVG  221

Query  261  AAGRQYKRLTGHQLRRITALDPAKLFAKDKDMLTGLARGDADFVDAIHTSTCGMGTRQRV  320
            +AGR  + LT   + RIT LDPAK    + + L+GL RGDA FVD IH++   +G R  V
Sbjct  222  SAGRHLQHLTNQTIPRITGLDPAKPCFNEGEALSGLMRGDAHFVDVIHSNPGVLGKRDPV  281

Query  321  GDVDFYVNGPASAAPGATNVIEATMRATRYFAESVRPGNERNFPAVAANSMDQYENNDGA  380
            GDVDFY  G +  A G  +V  A  R+  YFAE+V PGNERNF A   NS+ +  +    
Sbjct  282  GDVDFYPGGMSPLAAGCFSVTCAHARSWEYFAETVFPGNERNFMATRCNSISKLRDFRCP  341

Query  381  GKRAYMGIATDFDLEGDYILKVNSKSPFGKSAPAQKQSTYHGQH  424
            G    MG A   +++G+Y L+V++ +PFG  A   + +  H +H
Sbjct  342  GDEVPMGYAVPQNIKGNYFLEVSASAPFGMHASVVRSA--HLEH  383



Lambda      K        H
   0.312    0.129    0.370 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4811699998


Query= NP_001291656.1 uncharacterized LOC105226562 [Bactrocera dorsalis]

Length=1592
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8IPN4_DROME  unnamed protein product                                 2942    0.0  
Q9I7P4_DROME  unnamed protein product                                 2917    0.0  
Q8MQN8_DROME  unnamed protein product                                 2122    0.0  


>Q8IPN4_DROME unnamed protein product
Length=1615

 Score = 2942 bits (7626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1418/1600 (89%), Positives = 1511/1600 (94%), Gaps = 18/1600 (1%)

Query  1     MSAVRHRPLAPPGN------AG---DSDDN-FTDDESTPLTQDIYGGSQRTIQETKGWDD  50
             MSA+RHRP+APPG       AG   DSDDN FTDDES+PLT DIYGGSQRTIQETKGWD 
Sbjct  1     MSAMRHRPMAPPGQGPGAGTAGEHVDSDDNNFTDDESSPLTHDIYGGSQRTIQETKGWDV  60

Query  51    FRDPPIKIETGSTANQECLELTVKILKIFAYAFTFILVLTGGVMAKVCVLFMTSQIRKDK  110
             FRDPPIKIETGSTANQECLELTVKILKIFAY  TFI+VLTGGV+AK  +LFMTSQ+RKDK
Sbjct  61    FRDPPIKIETGSTANQECLELTVKILKIFAYVITFIIVLTGGVIAKGTMLFMTSQVRKDK  120

Query  111   KIEYCNKGLGRDKTFVVKLPEEERIAWIWALLIAYAIPEIGAFIRSARICFFKTFRVPKT  170
             K+EYCNK LGRDK+FVV+LPEEER+AWIWALLIAYA+PEIGA IRSARICFFKTF+VPKT
Sbjct  121   KMEYCNKDLGRDKSFVVRLPEEERVAWIWALLIAYALPEIGALIRSARICFFKTFKVPKT  180

Query  171   GHFLFVTLMESLSCFGTALLMFVVLPQIDAIQGAMLTNCLCVIPGILGLLSRCSKEGKRA  230
             GHFLFV LMESLS  G ALLMFVVLPQIDAIQGAMLTNCLCV+PGI GLLSR SKEGKR 
Sbjct  181   GHFLFVWLMESLSAVGMALLMFVVLPQIDAIQGAMLTNCLCVVPGIFGLLSRTSKEGKRF  240

Query  231   VKVLIDMAAIAAQVTGFVIWPLLENRPELWVIPIACVMISCGWWENFVSLQSPIGLVRAM  290
             VKV+ID+AA+AAQVTG VIWPLLENR ELWVIP+ACVMISCGWWEN+VS QSP+GLVRA+
Sbjct  241   VKVIIDLAAVAAQVTGLVIWPLLENRRELWVIPVACVMISCGWWENYVSPQSPLGLVRAL  300

Query  291   GRVKDEMRTTRYFNHMFLSLWKVVLFVCFALLIFWAQGDEPGNIFSMYGDALGPHKISID  350
             GR+K+EM+ TRYF H+FLS+WK++LF    LLI+WAQG+EPGN+F+MYGDA GPHKI + 
Sbjct  301   GRIKEEMKYTRYFCHIFLSIWKILLFFTVTLLIYWAQGEEPGNLFAMYGDAFGPHKIIVY  360

Query  351   ELATSLTGNLPDTLDAANIDSIEIDAVHNTVIYVLLIQIFSAYLCYIFGKFACKILIQGF  410
             EL   L G LPDTL++ANID++++DA +NTV+YVLL+QIF AYLCYIFGKFACKILIQGF
Sbjct  361   ELPAGLGGVLPDTLESANIDTVDVDAAYNTVVYVLLLQIFGAYLCYIFGKFACKILIQGF  420

Query  411   SYAFPVSLTIPITVSLLIAACGLRIDDPCFFHDTIPDYLFFTRPRNFRFNDFVTQQMAWA  470
             SYAFPVSLT+P++V+ LIAACG+RIDDPCFFHDTIPDYLFFT P NFRFN+FVT+QMAWA
Sbjct  421   SYAFPVSLTVPLSVTFLIAACGIRIDDPCFFHDTIPDYLFFTSPSNFRFNNFVTEQMAWA  480

Query  471   WILWLLSQTWISLHIWTPKCERLATTEKLFVRPMYSALLIDQSMAMNRRRDDQADVKTED  530
             WILWLLSQTWI+LHIWTPKCERLATTEKLFV+PMYS+LLIDQSMA+NRRRDDQADVKTED
Sbjct  481   WILWLLSQTWIALHIWTPKCERLATTEKLFVQPMYSSLLIDQSMALNRRRDDQADVKTED  540

Query  531   LSEIEKEKGDEYYETISVHTDGSAIQNKPSIKSSDHITRIYACATMWHETKDEMMEFLKS  590
             LSEIEKEKGDEYYETISVHTD S+  NKPSIKSSD+ITRIY+CATMWHETKDEM+EFLKS
Sbjct  541   LSEIEKEKGDEYYETISVHTDRSSAPNKPSIKSSDNITRIYSCATMWHETKDEMIEFLKS  600

Query  591   IMRMDEDQCARRVAQKYLRIVDPDYYEFETHTFFDDAFEISDHSDDDIQVNRFVKLLVAT  650
             IMRMDEDQCARRVAQKYLR++DPDYYEFETH FFDDAFEISDHSDDDIQ NRFVKLL+AT
Sbjct  601   IMRMDEDQCARRVAQKYLRVLDPDYYEFETHIFFDDAFEISDHSDDDIQCNRFVKLLIAT  660

Query  651   MDDAASEIHQTTIRLRPPKKYPTPYGGRLVWTLPGKTKFITHLKDKDRIRHRKRWSQVMY  710
             MD+AASEIHQTTIRLRPPKKYPTPYGGRLVWTLPGKTKFITHLKDKDRIRHRKRWSQVMY
Sbjct  661   MDEAASEIHQTTIRLRPPKKYPTPYGGRLVWTLPGKTKFITHLKDKDRIRHRKRWSQVMY  720

Query  711   MYYLLGHRLIELPISADRKDEIAQNTYLLTLDGDIDFKPNAVTLLIDLMKKNRNLGAACG  770
             MYYLLGHRL+ELPIS DRKD IA+NTYLLTLDGDIDFKPNAVTLL+DLMKKN+NLGAACG
Sbjct  721   MYYLLGHRLMELPISVDRKDAIAENTYLLTLDGDIDFKPNAVTLLVDLMKKNKNLGAACG  780

Query  771   RIHPVGSGPMVWYQLFEYAIGHWLQKATEHMIGCVLCSPGCFSLFRGKALMDDNVMKKYT  830
             RIHPVGSGPMVWYQLFEYAIGHWLQKATEHMIGCVLCSPGCFSLFRGKALMDDNVMKKYT
Sbjct  781   RIHPVGSGPMVWYQLFEYAIGHWLQKATEHMIGCVLCSPGCFSLFRGKALMDDNVMKKYT  840

Query  831   TRSDQARHYVQYDQGEDRWLCTLLLQRGYRVEYSAASDAYTHCPEGFNEFYNQRRRWVPS  890
             TRSD+ARHYVQYDQGEDRWLCTLLLQRGYRVEYSAASDAYTHCPEGFNEFYNQRRRWVPS
Sbjct  841   TRSDEARHYVQYDQGEDRWLCTLLLQRGYRVEYSAASDAYTHCPEGFNEFYNQRRRWVPS  900

Query  891   TIANIMDLLGDAKRTIKINDNISLLYIFYQMMLIGGTILGPGTIFLMLVGAFVAAFRIDN  950
             TIANIMDLL DAKRTIKINDNISLLYIFYQMML+GGTILGPGTIFLMLVGAFVAAFRIDN
Sbjct  901   TIANIMDLLADAKRTIKINDNISLLYIFYQMMLMGGTILGPGTIFLMLVGAFVAAFRIDN  960

Query  951   WTSFHYNIVPILLFMLVCFTCKSNIQLFVAQVLSTAYALIMMAVIVGTALQLGEDGIGSP  1010
             WTSFHYNIVPIL FM +CFTCKSNIQLFVAQVLSTAYALIMMAVIVGTALQLGEDGIGSP
Sbjct  961   WTSFHYNIVPILAFMFICFTCKSNIQLFVAQVLSTAYALIMMAVIVGTALQLGEDGIGSP  1020

Query  1011  SAIFLIAMTGSFWIAACLHPQEFWCITAGLIYLLSIPSMYLLLILYSIINLNVVSWGTRE  1070
             SAIFLI+M GSF+IAACLHPQEFWCIT GLIYLLSIPSMYLLLILYSIINLNVVSWGTRE
Sbjct  1021  SAIFLISMVGSFFIAACLHPQEFWCITCGLIYLLSIPSMYLLLILYSIINLNVVSWGTRE  1080

Query  1071  VVAKKTKKEMEAEKKAAEEAAKRVKQKSMLSFLQSGIGDNGDEEGSIEFSLAGLFRCILC  1130
             VVAKKTKKE+EAEKKAAEEA KRVKQKSMLSFLQSGIGDNGDEEGS+EFSLAGLFRCI C
Sbjct  1081  VVAKKTKKELEAEKKAAEEAKKRVKQKSMLSFLQSGIGDNGDEEGSVEFSLAGLFRCIFC  1140

Query  1131  THGKTSEEKAQLTAIAESLNTIKTRLEALEHTLDPHGH--SRHGRRRTTSSGSKDHHLLS  1188
             THGKTS+EK QLT+IAESL+TIK R++ +E  +DPHGH  SRHGRRRTTSSGSKDHHLL+
Sbjct  1141  THGKTSDEKQQLTSIAESLDTIKHRMDTIESAVDPHGHHASRHGRRRTTSSGSKDHHLLT  1200

Query  1189  SVAEKSGDESEESDSDTSAEPRQERDFLTNPFWIEDQDLRKGEVDFLSSTEIQFWKDLID  1248
             SVAEKSGDES+ESDSDTSAEP+QERDFLTNP+WIED D+RKGEVDFLSSTEIQFWKDLID
Sbjct  1201  SVAEKSGDESDESDSDTSAEPKQERDFLTNPYWIEDPDVRKGEVDFLSSTEIQFWKDLID  1260

Query  1249  KYLFPIDNDPVEQARIAKDLKELRDSSVFAFFMCNALFVLIVFLLQLNKDNIHVKWPFGV  1308
             +YL+PIDNDPVEQARIAKDLKELRDSSVFAFFM NALFVLIVFLLQLNKDNIHVKWPFGV
Sbjct  1261  QYLYPIDNDPVEQARIAKDLKELRDSSVFAFFMINALFVLIVFLLQLNKDNIHVKWPFGV  1320

Query  1309  RTNITYDESTQEVHISKEYLQLEPIGLVFVFFFALILIIQFTAMLFHRFGTISHILASTE  1368
             RTNITYDESTQEVHISKEYLQLEPIGLVFVFFFALILIIQFTAMLFHRFGTISHILASTE
Sbjct  1321  RTNITYDESTQEVHISKEYLQLEPIGLVFVFFFALILIIQFTAMLFHRFGTISHILASTE  1380

Query  1369  LNFCKKKSEDTSQDALIDKHAVEIVKNLQRLQGIDGDYDNDSGSGPDRIARRRTIQNLEK  1428
             LNFCKKKSED +QD LIDKHAVEIVKNLQRLQGIDGDYDNDSGSGPDRIARR+TIQNLEK
Sbjct  1381  LNFCKKKSEDLTQDQLIDKHAVEIVKNLQRLQGIDGDYDNDSGSGPDRIARRKTIQNLEK  1440

Query  1429  ARQPRRQIGTLDVAFKKRFLKLTAD-ENNPATPILTRRLTMRAETIRALEVRKNSVMAER  1487
             ARQPRRQIGTLDVAFKKRFLKLTAD ENNPATPILTRRLTMRAETIRALEVRKNSVMAER
Sbjct  1441  ARQPRRQIGTLDVAFKKRFLKLTADAENNPATPILTRRLTMRAETIRALEVRKNSVMAER  1500

Query  1488  RKSAMQTLGAKNEYGITTTAALNNNGVIPNQRSGRISNAGISIKDVFNANGGPGEQIYGS  1547
             RKSAMQTLGAKNEYGITT A +NNNG +PNQRSGR+SNAGISIKDVFN NGG  EQIYGS
Sbjct  1501  RKSAMQTLGAKNEYGITTGAPINNNGALPNQRSGRVSNAGISIKDVFNVNGGGAEQIYGS  1560

Query  1548  NGGGTINQGYEHVL-EDDDRNSLRLTARN----PNQQVSW  1582
             NGGGTINQGYEHV+ ED D NSLRLT RN    P+ QVSW
Sbjct  1561  NGGGTINQGYEHVIDEDGDGNSLRLTTRNPHPHPHHQVSW  1600


>Q9I7P4_DROME unnamed protein product
Length=1615

 Score = 2917 bits (7561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1405/1600 (88%), Positives = 1502/1600 (94%), Gaps = 18/1600 (1%)

Query  1     MSAVRHRPLAPPGN------AG---DSDDN-FTDDESTPLTQDIYGGSQRTIQETKGWDD  50
             MSA+RHRP+APPG       AG   DSDDN FTDDES+PLT DIYGGSQRTIQETKGWD 
Sbjct  1     MSAMRHRPMAPPGQGPGAGTAGEHVDSDDNNFTDDESSPLTHDIYGGSQRTIQETKGWDV  60

Query  51    FRDPPIKIETGSTANQECLELTVKILKIFAYAFTFILVLTGGVMAKVCVLFMTSQIRKDK  110
             FRDPPIKIETGSTANQECLELTVKILKIFAY  TFI+VLTGGV+AK  +LFMTSQ+RKDK
Sbjct  61    FRDPPIKIETGSTANQECLELTVKILKIFAYVITFIIVLTGGVIAKGTMLFMTSQVRKDK  120

Query  111   KIEYCNKGLGRDKTFVVKLPEEERIAWIWALLIAYAIPEIGAFIRSARICFFKTFRVPKT  170
             K+EYCNK LGRDK+FVV+LPEEER+AWIWALLIAYA+PEIGA IRSARICFFKTF+VPKT
Sbjct  121   KMEYCNKDLGRDKSFVVRLPEEERVAWIWALLIAYALPEIGALIRSARICFFKTFKVPKT  180

Query  171   GHFLFVTLMESLSCFGTALLMFVVLPQIDAIQGAMLTNCLCVIPGILGLLSRCSKEGKRA  230
             GHFLFV LMESLS  G ALLMFVVLPQIDAIQGAMLTNCLCV+PGI GLLSR SKEGKR 
Sbjct  181   GHFLFVWLMESLSAVGMALLMFVVLPQIDAIQGAMLTNCLCVVPGIFGLLSRTSKEGKRF  240

Query  231   VKVLIDMAAIAAQVTGFVIWPLLENRPELWVIPIACVMISCGWWENFVSLQSPIGLVRAM  290
             VKV+ID+AA+AAQVTG VIWPLLENR ELWVIP+ACVMISCGWWEN+VS QSP+GLVRA+
Sbjct  241   VKVIIDLAAVAAQVTGLVIWPLLENRRELWVIPVACVMISCGWWENYVSPQSPLGLVRAL  300

Query  291   GRVKDEMRTTRYFNHMFLSLWKVVLFVCFALLIFWAQGDEPGNIFSMYGDALGPHKISID  350
             GR+K+EM+ TRYF H+FLS+WK++LF    LLI+WAQG+EPGN+F+MYGDA GPHKI + 
Sbjct  301   GRIKEEMKYTRYFCHIFLSIWKILLFFTVTLLIYWAQGEEPGNLFAMYGDAFGPHKIIVY  360

Query  351   ELATSLTGNLPDTLDAANIDSIEIDAVHNTVIYVLLIQIFSAYLCYIFGKFACKILIQGF  410
             EL   L G LPDTL++ANID++++DA +NTV+YVLL+QIF AYLCYIFGKFACKILIQGF
Sbjct  361   ELPAGLGGVLPDTLESANIDTVDVDAAYNTVVYVLLLQIFGAYLCYIFGKFACKILIQGF  420

Query  411   SYAFPVSLTIPITVSLLIAACGLRIDDPCFFHDTIPDYLFFTRPRNFRFNDFVTQQMAWA  470
             SYAFPVSLT+P++V+ LIAACG+RIDDPCFFHDTIPDYLFFT P NFRFN+FVT+QMAWA
Sbjct  421   SYAFPVSLTVPLSVTFLIAACGIRIDDPCFFHDTIPDYLFFTSPSNFRFNNFVTEQMAWA  480

Query  471   WILWLLSQTWISLHIWTPKCERLATTEKLFVRPMYSALLIDQSMAMNRRRDDQADVKTED  530
             WILWLLSQTWI+LHIWTPKCERLATTEKLFV+PMYS+LLIDQSMA+NRRRDDQADVKTED
Sbjct  481   WILWLLSQTWIALHIWTPKCERLATTEKLFVQPMYSSLLIDQSMALNRRRDDQADVKTED  540

Query  531   LSEIEKEKGDEYYETISVHTDGSAIQNKPSIKSSDHITRIYACATMWHETKDEMMEFLKS  590
             LSEIEKEKGDEYYETISVHTD S+  NKPSIKSSD+ITRIY+CATMWHETKDEM+EFLKS
Sbjct  541   LSEIEKEKGDEYYETISVHTDRSSAPNKPSIKSSDNITRIYSCATMWHETKDEMIEFLKS  600

Query  591   IMRMDEDQCARRVAQKYLRIVDPDYYEFETHTFFDDAFEISDHSDDDIQVNRFVKLLVAT  650
             IMRMDEDQCARRVAQKYLR++DPDYYEFETH FFDDAFEISDHSDDDIQ NRFVKLL+AT
Sbjct  601   IMRMDEDQCARRVAQKYLRVLDPDYYEFETHIFFDDAFEISDHSDDDIQCNRFVKLLIAT  660

Query  651   MDDAASEIHQTTIRLRPPKKYPTPYGGRLVWTLPGKTKFITHLKDKDRIRHRKRWSQVMY  710
             MD+AASEIHQTTIRLRPPKKYPTPYGGRLVWTLPGKTKFITHLKDKDRIRHRKRWSQVMY
Sbjct  661   MDEAASEIHQTTIRLRPPKKYPTPYGGRLVWTLPGKTKFITHLKDKDRIRHRKRWSQVMY  720

Query  711   MYYLLGHRLIELPISADRKDEIAQNTYLLTLDGDIDFKPNAVTLLIDLMKKNRNLGAACG  770
             MYYLLGHRL+ELPIS DRKD IA+NTYLLTLDGDIDFKPNAVTLL+DLMKKN+NLGAACG
Sbjct  721   MYYLLGHRLMELPISVDRKDAIAENTYLLTLDGDIDFKPNAVTLLVDLMKKNKNLGAACG  780

Query  771   RIHPVGSGPMVWYQLFEYAIGHWLQKATEHMIGCVLCSPGCFSLFRGKALMDDNVMKKYT  830
             RIHPVGSGPMVWYQLFEYAIGHWLQKATEHMIGCVLCSPGCFSLFRGKALMDDNVMKKYT
Sbjct  781   RIHPVGSGPMVWYQLFEYAIGHWLQKATEHMIGCVLCSPGCFSLFRGKALMDDNVMKKYT  840

Query  831   TRSDQARHYVQYDQGEDRWLCTLLLQRGYRVEYSAASDAYTHCPEGFNEFYNQRRRWVPS  890
             TRSD+ARHYVQYDQGEDRWLCTLLLQRGYRVEYSAASDAYTHCPEGFNEFYNQRRRWVPS
Sbjct  841   TRSDEARHYVQYDQGEDRWLCTLLLQRGYRVEYSAASDAYTHCPEGFNEFYNQRRRWVPS  900

Query  891   TIANIMDLLGDAKRTIKINDNISLLYIFYQMMLIGGTILGPGTIFLMLVGAFVAAFRIDN  950
             TIANIMDLL DAKRTIKINDNISLLYIFYQMML+GGTILGPGTIFLMLVGAFVAAFRIDN
Sbjct  901   TIANIMDLLADAKRTIKINDNISLLYIFYQMMLMGGTILGPGTIFLMLVGAFVAAFRIDN  960

Query  951   WTSFHYNIVPILLFMLVCFTCKSNIQLFVAQVLSTAYALIMMAVIVGTALQLGEDGIGSP  1010
             WTSFHYNIVPIL FM +CFTCKSNIQLFVAQVLSTAYALIMMAVIVGTALQLGEDGIGSP
Sbjct  961   WTSFHYNIVPILAFMFICFTCKSNIQLFVAQVLSTAYALIMMAVIVGTALQLGEDGIGSP  1020

Query  1011  SAIFLIAMTGSFWIAACLHPQEFWCITAGLIYLLSIPSMYLLLILYSIINLNVVSWGTRE  1070
             SAIFLI+M GSF+IAACLHPQEFWCIT GLIYLLSIPSMYLLLILYSIINLNVVSWGTRE
Sbjct  1021  SAIFLISMVGSFFIAACLHPQEFWCITCGLIYLLSIPSMYLLLILYSIINLNVVSWGTRE  1080

Query  1071  VVAKKTKKEMEAEKKAAEEAAKRVKQKSMLSFLQSGIGDNGDEEGSIEFSLAGLFRCILC  1130
             VVAKKTKKE+EAEKKAAEEA KRVKQKSMLSFLQSGIGDNGDEEGS+EFSLAGLFRCI C
Sbjct  1081  VVAKKTKKELEAEKKAAEEAKKRVKQKSMLSFLQSGIGDNGDEEGSVEFSLAGLFRCIFC  1140

Query  1131  THGKTSEEKAQLTAIAESLNTIKTRLEALEHTLDPHGH--SRHGRRRTTSSGSKDHHLLS  1188
             THGKTS+EK QLT+IAESL+TIK R++ +E  +DPHGH  SRHGRRRTTSSGSKDHHLL+
Sbjct  1141  THGKTSDEKQQLTSIAESLDTIKHRMDTIESAVDPHGHHASRHGRRRTTSSGSKDHHLLT  1200

Query  1189  SVAEKSGDESEESDSDTSAEPRQERDFLTNPFWIEDQDLRKGEVDFLSSTEIQFWKDLID  1248
             SVAEKSGDES+ESDSDTSAEP+QERDFLTNP+WIED D+RKGEVDFLSSTEIQFWKDLID
Sbjct  1201  SVAEKSGDESDESDSDTSAEPKQERDFLTNPYWIEDPDVRKGEVDFLSSTEIQFWKDLID  1260

Query  1249  KYLFPIDNDPVEQARIAKDLKELRDSSVFAFFMCNALFVLIVFLLQLNKDNIHVKWPFGV  1308
             +YL+PIDNDPVEQARIA DL ELR+ SVFAFFM NALFVLIVFLLQLNKD +H+ WP GV
Sbjct  1261  QYLYPIDNDPVEQARIASDLIELRNKSVFAFFMANALFVLIVFLLQLNKDKLHIIWPLGV  1320

Query  1309  RTNITYDESTQEVHISKEYLQLEPIGLVFVFFFALILIIQFTAMLFHRFGTISHILASTE  1368
             +TNITY E T EVHISKEYLQLEPIGLVFVFFFALILIIQFTAMLFHRFGTISHILASTE
Sbjct  1321  KTNITYIEETSEVHISKEYLQLEPIGLVFVFFFALILIIQFTAMLFHRFGTISHILASTE  1380

Query  1369  LNFCKKKSEDTSQDALIDKHAVEIVKNLQRLQGIDGDYDNDSGSGPDRIARRRTIQNLEK  1428
             LNFCKKKSED +QD LIDKHAVEIVKNLQRLQGIDGDYDNDSGSGPDRIARR+TIQNLEK
Sbjct  1381  LNFCKKKSEDLTQDQLIDKHAVEIVKNLQRLQGIDGDYDNDSGSGPDRIARRKTIQNLEK  1440

Query  1429  ARQPRRQIGTLDVAFKKRFLKLTAD-ENNPATPILTRRLTMRAETIRALEVRKNSVMAER  1487
             ARQPRRQIGTLDVAFKKRFLKLTAD ENNPATPILTRRLTMRAETIRALEVRKNSVMAER
Sbjct  1441  ARQPRRQIGTLDVAFKKRFLKLTADAENNPATPILTRRLTMRAETIRALEVRKNSVMAER  1500

Query  1488  RKSAMQTLGAKNEYGITTTAALNNNGVIPNQRSGRISNAGISIKDVFNANGGPGEQIYGS  1547
             RKSAMQTLGAKNEYGITT A +NNNG +PNQRSGR+SNAGISIKDVFN NGG  EQIYGS
Sbjct  1501  RKSAMQTLGAKNEYGITTGAPINNNGALPNQRSGRVSNAGISIKDVFNVNGGGAEQIYGS  1560

Query  1548  NGGGTINQGYEHVL-EDDDRNSLRLTARN----PNQQVSW  1582
             NGGGTINQGYEHV+ ED D NSLRLT RN    P+ QVSW
Sbjct  1561  NGGGTINQGYEHVIDEDGDGNSLRLTTRNPHPHPHHQVSW  1600


>Q8MQN8_DROME unnamed protein product
Length=1113

 Score = 2122 bits (5498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1019/1113 (92%), Positives = 1075/1113 (97%), Gaps = 2/1113 (0%)

Query  337   MYGDALGPHKISIDELATSLTGNLPDTLDAANIDSIEIDAVHNTVIYVLLIQIFSAYLCY  396
             MYGDA GPHKI + EL   L G LPDTL++ANID++++DA +NTV+YVLL+QIF AYLCY
Sbjct  1     MYGDAFGPHKIIVYELPAGLGGVLPDTLESANIDTVDVDAAYNTVVYVLLLQIFGAYLCY  60

Query  397   IFGKFACKILIQGFSYAFPVSLTIPITVSLLIAACGLRIDDPCFFHDTIPDYLFFTRPRN  456
             IFGKFACKILIQGFSYAFPVSLT+P++V+ LIAACG+RIDDPCFFHDTIPDYLFFT P N
Sbjct  61    IFGKFACKILIQGFSYAFPVSLTVPLSVTFLIAACGIRIDDPCFFHDTIPDYLFFTSPSN  120

Query  457   FRFNDFVTQQMAWAWILWLLSQTWISLHIWTPKCERLATTEKLFVRPMYSALLIDQSMAM  516
             FRFN+FVT+QMAWAWILWLLSQTWI+LHIWTPKCERLATTEKLFV+PMYS+LLIDQSMA+
Sbjct  121   FRFNNFVTEQMAWAWILWLLSQTWIALHIWTPKCERLATTEKLFVQPMYSSLLIDQSMAL  180

Query  517   NRRRDDQADVKTEDLSEIEKEKGDEYYETISVHTDGSAIQNKPSIKSSDHITRIYACATM  576
             NRRRDDQADVKTEDLSEIEKEKGDEYYETISVHTD S+  NKPSIKSSD+ITRIY+CATM
Sbjct  181   NRRRDDQADVKTEDLSEIEKEKGDEYYETISVHTDRSSAPNKPSIKSSDNITRIYSCATM  240

Query  577   WHETKDEMMEFLKSIMRMDEDQCARRVAQKYLRIVDPDYYEFETHTFFDDAFEISDHSDD  636
             WHETKDEM+EFLKSIMRMDEDQCARRVAQKYLR++DPDYYEFETH FFDDAFEISDHSDD
Sbjct  241   WHETKDEMIEFLKSIMRMDEDQCARRVAQKYLRVLDPDYYEFETHIFFDDAFEISDHSDD  300

Query  637   DIQVNRFVKLLVATMDDAASEIHQTTIRLRPPKKYPTPYGGRLVWTLPGKTKFITHLKDK  696
             DIQ NRFVKLL+ATMD+AASEIHQTTIRLRPPKKYPTPYGGRLVWTLPGKTKFITHLKDK
Sbjct  301   DIQCNRFVKLLIATMDEAASEIHQTTIRLRPPKKYPTPYGGRLVWTLPGKTKFITHLKDK  360

Query  697   DRIRHRKRWSQVMYMYYLLGHRLIELPISADRKDEIAQNTYLLTLDGDIDFKPNAVTLLI  756
             DRIRHRKRWSQVMYMYYLLGHRL+ELPIS DRKD IA+NTYLLTLDGDIDFKPNAVTLL+
Sbjct  361   DRIRHRKRWSQVMYMYYLLGHRLMELPISVDRKDAIAENTYLLTLDGDIDFKPNAVTLLV  420

Query  757   DLMKKNRNLGAACGRIHPVGSGPMVWYQLFEYAIGHWLQKATEHMIGCVLCSPGCFSLFR  816
             DLMKKN+NLGAACGRIHPVGSGPMVWYQLFEYAIGHWLQKATEHMIGCVLCSPGCFSLFR
Sbjct  421   DLMKKNKNLGAACGRIHPVGSGPMVWYQLFEYAIGHWLQKATEHMIGCVLCSPGCFSLFR  480

Query  817   GKALMDDNVMKKYTTRSDQARHYVQYDQGEDRWLCTLLLQRGYRVEYSAASDAYTHCPEG  876
             GKALMDDNVMKKYTTRSD+ARHYVQYDQGEDRWLCTLLLQRGYRVEYSAASDAYTHCPEG
Sbjct  481   GKALMDDNVMKKYTTRSDEARHYVQYDQGEDRWLCTLLLQRGYRVEYSAASDAYTHCPEG  540

Query  877   FNEFYNQRRRWVPSTIANIMDLLGDAKRTIKINDNISLLYIFYQMMLIGGTILGPGTIFL  936
             FNEFYNQRRRWVPSTIANIMDLL DAKRTIKINDNISLLYIFYQMML+GGTILGPGTIFL
Sbjct  541   FNEFYNQRRRWVPSTIANIMDLLADAKRTIKINDNISLLYIFYQMMLMGGTILGPGTIFL  600

Query  937   MLVGAFVAAFRIDNWTSFHYNIVPILLFMLVCFTCKSNIQLFVAQVLSTAYALIMMAVIV  996
             MLVGAFVAAFRIDNWTSFHYNIVPIL FM +CFTCKSNIQLFVAQVLSTAYALIMMAVIV
Sbjct  601   MLVGAFVAAFRIDNWTSFHYNIVPILAFMFICFTCKSNIQLFVAQVLSTAYALIMMAVIV  660

Query  997   GTALQLGEDGIGSPSAIFLIAMTGSFWIAACLHPQEFWCITAGLIYLLSIPSMYLLLILY  1056
             GTALQLGEDGIGSPSAIFLI+M GSF+IAACLHPQEFWCIT GLIYLLSIPSMYLLLILY
Sbjct  661   GTALQLGEDGIGSPSAIFLISMVGSFFIAACLHPQEFWCITCGLIYLLSIPSMYLLLILY  720

Query  1057  SIINLNVVSWGTREVVAKKTKKEMEAEKKAAEEAAKRVKQKSMLSFLQSGIGDNGDEEGS  1116
             SIINLNVVSWGTREVVAKKTKKE+EAEKKAAEEA KRVKQKSMLSFLQSGIGDNGDEEGS
Sbjct  721   SIINLNVVSWGTREVVAKKTKKELEAEKKAAEEAKKRVKQKSMLSFLQSGIGDNGDEEGS  780

Query  1117  IEFSLAGLFRCILCTHGKTSEEKAQLTAIAESLNTIKTRLEALEHTLDPHGH--SRHGRR  1174
             +EFSLAGLFRCI CTHGKTS+EK QLT+IAESL+TIK R++ +E  +DPHGH  SRHGRR
Sbjct  781   VEFSLAGLFRCIFCTHGKTSDEKQQLTSIAESLDTIKHRMDTIESAVDPHGHHASRHGRR  840

Query  1175  RTTSSGSKDHHLLSSVAEKSGDESEESDSDTSAEPRQERDFLTNPFWIEDQDLRKGEVDF  1234
             RTTSSGSKDHHLL+SVAEKSGDES+ESDSDTSAEP+QERDFLTNP+WIED D+RKGEVDF
Sbjct  841   RTTSSGSKDHHLLTSVAEKSGDESDESDSDTSAEPKQERDFLTNPYWIEDPDVRKGEVDF  900

Query  1235  LSSTEIQFWKDLIDKYLFPIDNDPVEQARIAKDLKELRDSSVFAFFMCNALFVLIVFLLQ  1294
             LSSTEIQFWKDLID+YL+PIDNDPVEQARIAKDLKELRDSSVFAFFM NALFVLIVFLLQ
Sbjct  901   LSSTEIQFWKDLIDQYLYPIDNDPVEQARIAKDLKELRDSSVFAFFMINALFVLIVFLLQ  960

Query  1295  LNKDNIHVKWPFGVRTNITYDESTQEVHISKEYLQLEPIGLVFVFFFALILIIQFTAMLF  1354
             LNKDNIHVKWPFGVRTNITYDESTQEVHISKEYLQLEPIGLVFVFFFALILIIQFTAMLF
Sbjct  961   LNKDNIHVKWPFGVRTNITYDESTQEVHISKEYLQLEPIGLVFVFFFALILIIQFTAMLF  1020

Query  1355  HRFGTISHILASTELNFCKKKSEDTSQDALIDKHAVEIVKNLQRLQGIDGDYDNDSGSGP  1414
             HRFGTISHILASTELNFCKKKSED +QD LIDKHAVEIVKNLQRLQGIDGDYDNDSGSGP
Sbjct  1021  HRFGTISHILASTELNFCKKKSEDLTQDQLIDKHAVEIVKNLQRLQGIDGDYDNDSGSGP  1080

Query  1415  DRIARRRTIQNLEKARQPRRQIGTLDVAFKKRF  1447
             DRIARR+TIQNLEKARQPRRQIGTLDVAFKKRF
Sbjct  1081  DRIARRKTIQNLEKARQPRRQIGTLDVAFKKRF  1113



Lambda      K        H
   0.312    0.129    0.370 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4811699998


Query= NP_001291657.1 probable cytochrome P450 6g2 [Bactrocera dorsalis]

Length=535
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CP6G2_DROME  unnamed protein product                                  531     0.0   
CP6G1_DROME  unnamed protein product                                  468     4e-161
CP6W1_DROME  unnamed protein product                                  397     2e-133


>CP6G2_DROME unnamed protein product
Length=519

 Score = 531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/516 (50%), Positives = 346/516 (67%), Gaps = 5/516 (1%)

Query  21   ILATLAFVCFALYIWLQYQYTYWRRHSIPYIEPSMFFGNLKGIINSETDPCTWFQHLYNH  80
            +L  +A +    ++ LQ  Y+YWRR  +  I P    GNL G++N    P  +   LYNH
Sbjct  5    LLILVASLIGIAFLALQQHYSYWRRMGVREIRPKWIVGNLMGLLNMRMSPAEFISQLYNH  64

Query  81   EKAKNLAAVGIYIFNKPSLLIRDLELIKAILIKDFNYFSNRHSSSDPHSDSLGSDNLFFA  140
              A+N   VGI++F+KP+LL+RD E+++ IL+KDF  FSNR+SSSDP  D LGS N+FF 
Sbjct  65   PDAENEPFVGIHVFHKPALLLRDPEMVRNILVKDFAGFSNRYSSSDPKGDPLGSQNIFFL  124

Query  141  KNPRWKEIRVKLTPVFTSGKMKQMFPLIEEVAREYDKYLCALKM-DAKTNSTILEVKEPN  199
            KNP WKE+R+KL+P FT  ++KQMFPLIEEV    D +L    + + +     LE KE  
Sbjct  125  KNPAWKEVRLKLSPFFTGNRLKQMFPLIEEVGASLDAHLRQQPLHNERMRCFDLEAKELC  184

Query  200  ALYTTDVISITAYGIQANSLNDPNGIFRKSGKKIFTFTWLRSMEFKAFFFIPMMVKLFGF  259
            ALYTTDVI+  AYG+ ANS  DP   FR+ G+ +F F  LR+ EF   FF+P +V    F
Sbjct  185  ALYTTDVIATVAYGVSANSFTDPKCEFRRHGRSVFEFNLLRAAEFTLVFFLPHLVPFVRF  244

Query  260  KVFSKQATIFLRDTINHVMEERIKRGNVRNDLIDILIKFKQEAEEELKEG-KKPFILERD  318
            KV   +AT FLR TIN+VM ER K G  RNDLIDILI+F++  +     G K  F+ E D
Sbjct  245  KVVPAEATRFLRKTINYVMSEREKSGQKRNDLIDILIEFRRSTQLAKASGIKDQFVFEGD  304

Query  319  ALAAQAAIFFSAGFETSSATMSFAMFEMAQNPEVQRRLREELREAYKSNDGKITYELIMG  378
             L AQA +FF+AGFE+SS+TM+FAM+E+A++ +VQ+RLREE+++A   + G++T ++I  
Sbjct  305  ILVAQAVLFFTAGFESSSSTMAFAMYELAKDTDVQQRLREEIKDALVESGGQVTLKMIES  364

Query  379  LKYMDNVVKEVLRHYPPLPFLDRVCTPKPDEKGYSLQAFGLDFTVPDNMPVYIPSQALHM  438
            L++M  ++ EVLR YPPLPFLDR CT   D   YSL  F   F VP  MPVYIP  ALHM
Sbjct  365  LEFMQMILLEVLRMYPPLPFLDRECTSGRD---YSLAPFHKKFVVPKGMPVYIPCYALHM  421

Query  439  DPKYFKDPETFNPDRFLPENKHENNMNAYMPFGIGPHNCIGERFAMIQTKLGLLYFYRNH  498
            DP+YF  P  F P+RF PEN+  +    YMPFG+GPH CIGERF  +Q K+GL+   RNH
Sbjct  422  DPQYFPQPRKFLPERFSPENRKLHTPYTYMPFGLGPHGCIGERFGYLQAKVGLVNLLRNH  481

Query  499  YVTPCEKTPRKLHLNPRAIIIQSLGGIQLKVVRDPL  534
             +T  E+TP ++ L+P+AII Q+ GGI L++VRD L
Sbjct  482  MITTSERTPHRMQLDPKAIITQAKGGIHLRLVRDAL  517


>CP6G1_DROME unnamed protein product
Length=524

 Score = 468 bits (1205),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 245/520 (47%), Positives = 339/520 (65%), Gaps = 8/520 (2%)

Query  18   LTEILATLAFVCFALYIWLQYQYTYWRRHSIPYIEPSMFFGNLKGIINSETDPCTWFQHL  77
            LTE+L  +     ALY W Q  ++YW+R  IPYI P+   GN K +   E         +
Sbjct  3    LTEVLFVVVAALVALYTWFQRNHSYWQRKGIPYIPPTPIIGNTKVVFKMENSFGMHLSEI  62

Query  78   YNHEKAKNLAAVGIYIFNKPSLLIRDLELIKAILIKDFNYFSNRHSSSDPHSDSLGSDNL  137
            YN  + K+ A VGIY  NKP L+IRD+ELIK+ILIKDFN F NR++  DPH D LG +NL
Sbjct  63   YNDPRLKDEAVVGIYSMNKPGLIIRDIELIKSILIKDFNRFHNRYARCDPHGDPLGYNNL  122

Query  138  FFAKNPRWKEIRVKLTPVFTSGKMKQMFPLIEEVAREYDKYLCALKMDAKTNST--ILEV  195
            FF ++  WK IR KLTPVFTSGK+KQM+ L++E+ ++ +    AL+   + NS   I E+
Sbjct  123  FFVRDAHWKGIRTKLTPVFTSGKVKQMYTLMQEIGKDLE---LALQRRGEKNSGSFITEI  179

Query  196  KEPNALYTTDVISITAYGIQANSLNDPNGIFRKSGKKIFTFTWLRSMEFKAFFFIPMMVK  255
            KE  A ++TD I+  A+GI+ANSL +PN  FR  G+K+FTFT  R+ +F   FF+P +V 
Sbjct  180  KEICAQFSTDSIATIAFGIRANSLENPNAEFRNYGRKMFTFTVARAKDFFVAFFLPKLVS  239

Query  256  LFGFKVFSKQATIFLRDTINHVMEERIKRGNVRNDLIDILIKFKQEAEEELKEGKKPFIL  315
            L   + F+   + F+R TI HVMEER + G +RNDLID+L+  ++EA  E    K  +  
Sbjct  240  LMRIQFFTADFSHFMRSTIGHVMEERERSGLLRNDLIDVLVSLRKEAAAE--PSKPHYAK  297

Query  316  ERDALAAQAAIFFSAGFETSSATMSFAMFEMAQNPEVQRRLREELREAYKSNDGKITYEL  375
             +D L AQA +FF+AGFETSS+TMSFA++EMA++PE+Q+RLR+E+ EA     G ++YE 
Sbjct  298  NQDFLVAQAGVFFTAGFETSSSTMSFALYEMAKHPEMQKRLRDEINEALVEGGGSLSYEK  357

Query  376  IMGLKYMDNVVKEVLRHYPPLPFLDRVCTPKPDEKGYSLQAFGLDFTVPDNMPVYIPSQA  435
            I  L+Y+  VV EVLR YP LPFLDR       +   SL+ F  D+T+ +  PV+IP  A
Sbjct  358  IQSLEYLAMVVDEVLRMYPVLPFLDREYESVEGQPDLSLKPF-YDYTLENGTPVFIPIYA  416

Query  436  LHMDPKYFKDPETFNPDRFLPENKHENNMNAYMPFGIGPHNCIGERFAMIQTKLGLLYFY  495
            LH DPKY+ +P  F+P+RF P N+      AY PFG GPHNCIG R  ++Q+KLGL+   
Sbjct  417  LHHDPKYWTNPSQFDPERFSPANRKNIVAMAYQPFGSGPHNCIGSRIGLLQSKLGLVSLL  476

Query  496  RNHYVTPCEKTPRKLHLNPRAIIIQSLGGIQLKVVRDPLF  535
            +NH V  CE T + +  +P+  ++Q+ GGI L++V D L+
Sbjct  477  KNHSVRNCEATMKDMKFDPKGFVLQADGGIHLEIVNDRLY  516


>CP6W1_DROME unnamed protein product
Length=514

 Score = 397 bits (1021),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 195/502 (39%), Positives = 316/502 (63%), Gaps = 9/502 (2%)

Query  28   VCFALYIWLQYQYTYWRRHSIPYIEPSMFFGNLKGIINSETDPCTWFQHLYNHEKAKNLA  87
            +    YIW +   ++W RH + YI P    G  +  + ++       Q  +     +N  
Sbjct  10   LTIVFYIWQRRTLSFWERHGVKYIRPFPVVGCTREFLTAKVPFFEQIQKFHEAPGFENEP  69

Query  88   AVGIYIFNKPSLLIRDLELIKAILIKDFNYFSNRHSSSDPHSDSLGSDNLFFAKNPRWKE  147
             VG+Y+ ++P+L+IRDLELIK ++IK F YF+NR   +DPH+D+LG  NLFFA++P W+E
Sbjct  70   FVGVYMTHRPALVIRDLELIKTVMIKKFQYFNNRVLQTDPHNDALGYKNLFFARSPGWRE  129

Query  148  IRVKLTPVFTSGKMKQMFPLIEEVAREYDKYLCALKMDAKTNSTILEVKEPNALYTTDVI  207
            +R K++PVFTSGK+KQM+PL+ ++ +       A ++ + T    ++VK+  + +TTD+I
Sbjct  130  LRTKISPVFTSGKIKQMYPLMVKIGKNLQD--SAERLGSGTE---VQVKDLCSRFTTDLI  184

Query  208  SITAYGIQANSLNDPNGIFRKSGKKIFTFTWLRSMEFKAFFFIPMMVKLFGFKVFSKQAT  267
            +  A+G++AN+L D    F    + IF+ T  R ++F   F IP +  L   K+FS++ T
Sbjct  185  ATIAFGVEANALQDAKSEFFYHNRAIFSLTLSRGIDFAIIFMIPALASLARVKLFSRETT  244

Query  268  IFLRDTINHVMEERIKRGNVRNDLIDILIKFKQEAEEELKEGKKPFILERDALAAQAAIF  327
             F+R ++N+V++ER + G  RNDLIDIL+  K+EA      GK    ++ D L AQAA+F
Sbjct  245  KFIRSSVNYVLKERERTGEKRNDLIDILLALKREAAA--NPGKMSKEVDLDYLVAQAAVF  302

Query  328  FSAGFETSSATMSFAMFEMAQNPEVQRRLREELREAYKSNDGKITYELIMGLKYMDNVVK  387
             +AGFETS++TM+  ++E+A+N  +Q RLR+E+ + +   D  I+YE I  + Y+  VV 
Sbjct  303  QTAGFETSASTMTMTLYELAKNEALQDRLRQEIVDFFGDED-HISYERIQEMPYLSQVVN  361

Query  388  EVLRHYPPLPFLDRVCTPKPDEKGYSLQAFGLDFTVPDNMPVYIPSQALHMDPKYFKDPE  447
            E LR YP + +++R C+   + + ++L+ F  +  +P  M +Y+ + A+H DP+Y+ DPE
Sbjct  362  ETLRKYPIVGYIERECSQPAEGERFTLEPFH-NMELPHGMSIYMSTVAVHRDPQYWPDPE  420

Query  448  TFNPDRFLPENKHENNMNAYMPFGIGPHNCIGERFAMIQTKLGLLYFYRNHYVTPCEKTP  507
             ++P+RF   N+   NM+AYMPFG+GP NCIG R  ++Q+KLGL++  RNH    C+KT 
Sbjct  421  KYDPERFNSSNRDNLNMDAYMPFGVGPRNCIGMRLGLLQSKLGLVHILRNHRFHTCDKTI  480

Query  508  RKLHLNPRAIIIQSLGGIQLKV  529
            +K+   P + ++ S   I L+V
Sbjct  481  KKIEWAPTSPVMASKRDIILRV  502



Lambda      K        H
   0.312    0.129    0.370 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4811699998


Query= NP_001291658.1 pyrimidodiazepine synthase-like [Bactrocera dorsalis]

Length=255
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VSL6_DROME  unnamed protein product                                 326     1e-113
Q9VSL2_DROME  unnamed protein product                                 315     4e-109
Q7K206_DROME  unnamed protein product                                 299     1e-102


>Q9VSL6_DROME unnamed protein product
Length=254

 Score = 326 bits (836),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 161/253 (64%), Positives = 187/253 (74%), Gaps = 5/253 (2%)

Query  1    MSGGKHLAKGSQKPELPDDGVLRLYSMRFCPYAHRAHLVLDAKNIPHHTIYINLTEKPEW  60
            MS  +HL  GS KP  PDDG+L+LYSMRFCPYAHR HLVLDAK IP+H IYINL +KPEW
Sbjct  1    MSNTQHLTIGSPKPVFPDDGILKLYSMRFCPYAHRVHLVLDAKKIPYHAIYINLRDKPEW  60

Query  61   LTEVSPLGKVPALQLPKEEGNPSLIESLIIAEYLDEKYPEVPLFPKDPLKKAQDKILIER  120
             + VS   KVPAL+L KE+GNP LIESLII +YLDEKYPEVPL+PKD LKKAQ+KILIER
Sbjct  61   FSLVSSSTKVPALELVKEQGNPVLIESLIICDYLDEKYPEVPLYPKDLLKKAQEKILIER  120

Query  121  FNAVTSAMYKVFLGGSEAAPGAL--TEISTGLDIFEKELNSRGTPYFGGDKPGMLDYMIW  178
            F    +A Y + L  +   P  L  T+   GL ++E+EL  R T +FGGD PGMLDYM+W
Sbjct  121  FGQFINAFYYLLLHDN---PEQLVDTDHYAGLVVYEEELKRRCTKFFGGDSPGMLDYMMW  177

Query  179  PWCERSAMLKYLLPDKYEMDKERFGKLIAWRDLMINDPAVKVFYLDGETHAKFMKARREN  238
            PWCER   LKY    K+E+  ERF  LI WRDLMI D AVK FYLDG+THAK+M +RR  
Sbjct  178  PWCERFDSLKYTFEQKFELSPERFPTLIKWRDLMIQDRAVKCFYLDGQTHAKYMNSRRSG  237

Query  239  VHDYNMLVNDAKR  251
              DYNML N+AKR
Sbjct  238  QADYNMLYNEAKR  250


>Q9VSL2_DROME unnamed protein product
Length=241

 Score = 315 bits (806),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 151/245 (62%), Positives = 186/245 (76%), Gaps = 5/245 (2%)

Query  1    MSGGKHLAKGSQKPELPDDGVLRLYSMRFCPYAHRAHLVLDAKNIPHHTIYINLTEKPEW  60
            MS GKHLAKGS KP LPDDGVLRLYSMRFCPYA RAHLVL+AKN+P+H++YINLTEKPEW
Sbjct  1    MSSGKHLAKGSPKPVLPDDGVLRLYSMRFCPYAQRAHLVLNAKNVPYHSVYINLTEKPEW  60

Query  61   LTEVSPLGKVPALQLPKEEGNPSLIESLIIAEYLDEKYPEVPLFPKDPLKKAQDKILIER  120
            L EVSPL KVPALQL  E+G PSLIESLIIAEYLD+KYPE PL PKDPLK+AQDKIL+ER
Sbjct  61   LVEVSPLLKVPALQLVAEKGEPSLIESLIIAEYLDDKYPENPLLPKDPLKRAQDKILLER  120

Query  121  FNAVTSAMYKVFLGGSEAAPGALTEISTGLDIFEKELNSRGTPYFGGDKPGMLDYMIWPW  180
            F+++TSA   + + G+      L +  T LDIFE+EL  RGTPYFGG+KPG +DYMIWPW
Sbjct  121  FSSITSAFINILVQGT-----GLEDYWTALDIFEEELTKRGTPYFGGNKPGFVDYMIWPW  175

Query  181  CERSAMLKYLLPDKYEMDKERFGKLIAWRDLMINDPAVKVFYLDGETHAKFMKARRENVH  240
             ER ++++  L  +Y  ++ RF K+  W  L+  D  V+ FY   E H +F + R+    
Sbjct  176  FERLSVIELKLQKEYNFNESRFPKITKWIALLKADSVVQSFYATPEQHNEFWRTRKAGNA  235

Query  241  DYNML  245
            +Y++L
Sbjct  236  NYDLL  240


>Q7K206_DROME unnamed protein product
Length=267

 Score = 299 bits (766),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 145/241 (60%), Positives = 176/241 (73%), Gaps = 2/241 (1%)

Query  5    KHLAKGSQKPELPDDGVLRLYSMRFCPYAHRAHLVLDAKNIPHHTIYINLTEKPEWLTEV  64
            KH  +GS KPE+P+DGVLR YSMRFCPY+ RA LVL AK IPHHT+YI+L+EKPEW  + 
Sbjct  23   KHFKRGSPKPEIPEDGVLRYYSMRFCPYSQRAGLVLAAKKIPHHTVYIDLSEKPEWYIDY  82

Query  65   SPLGKVPALQLPKEEGNPSLIESLIIAEYLDEKYP-EVPLFPKDPLKKAQDKILIERFNA  123
            SPLGKVPA+QLP   G P+L+ESL+IAEYLDE+YP E  LFPKDPL+KA D+ILIER + 
Sbjct  83   SPLGKVPAIQLPNLPGQPALVESLVIAEYLDEQYPGEGSLFPKDPLQKALDRILIERLSP  142

Query  124  VTSAMYKVFLGGSEAAPGALTEISTGLDIFEKELNSRGTPYFGGDKPGMLDYMIWPWCER  183
              SA+Y V    +  A  A+    T LD+FE+E+  RGTPYFGG+K G+ DYMIWPW ER
Sbjct  143  AVSAIYPVLFTKNPPA-DAIKNFETALDVFEQEITKRGTPYFGGNKIGIADYMIWPWFER  201

Query  184  SAMLKYLLPDKYEMDKERFGKLIAWRDLMINDPAVKVFYLDGETHAKFMKARRENVHDYN  243
               LKY L + YE+DK R+  L+ WRDL+  D AVK   LD   HAKFMK R EN  DY+
Sbjct  202  FPALKYTLDEPYELDKTRYQNLLKWRDLVAQDEAVKATALDARIHAKFMKTRHENKPDYD  261

Query  244  M  244
            +
Sbjct  262  V  262



Lambda      K        H
   0.312    0.129    0.370 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4811699998


Query= NP_001291659.1 glutactin-like [Bactrocera dorsalis]

Length=569
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GLT_DROME  unnamed protein product                                    195     5e-53
Q24201_DROME  unnamed protein product                                 176     6e-48
Q9VIB5_DROME  unnamed protein product                                 175     1e-47


>GLT_DROME unnamed protein product
Length=1026

 Score = 195 bits (495),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 143/500 (29%), Positives = 235/500 (47%), Gaps = 36/500 (7%)

Query  41   PSEVRVNLSGQGVVIGNTNTTAWTGQTYMQFRGIPYAESPSGERRYKPPAPRKPWSTPLQ  100
            P E  V     G ++G +       +    F GI Y     G  R++   P   +   + 
Sbjct  57   PQEAVVQAPEVGQILGISGHKTIANRPVNAFLGIRYGTVGGGLARFQAAQPIG-YQGRVN  115

Query  101  ANDYGRICPQLFTYNRLSPDKLQGD-LEDCLTLNIFTKKLNATQPVMFYVHGGSLQVGFA  159
            A      C Q    +RL   + +G+ ++DCLTL+I+  +     PV+ +VHG  L  G +
Sbjct  116  ATVQSPNCAQFPELDRLRLSESRGENVDDCLTLDIYAPEGANQLPVLVFVHGEMLFDGGS  175

Query  160  SDHRPDYLLEEDIVLVVIQYRLGVLGFAGTKTPDMAGNFGLMDIMLALQWVQEHISAFGG  219
             + +PDY+LE+D++LV I YRL   GF    T ++ GN  L D+ LAL+W+Q ++  FGG
Sbjct  176  EEAQPDYVLEKDVLLVSINYRLAPFGFLSALTDELPGNVALSDLQLALEWLQRNVVHFGG  235

Query  220  DSAKVTVFGESSGGELGGALLISPKTPPSAFQRLIIQSGSIVDKQSINMEPRAQVTRVCR  279
            ++ +VT+ G++ G  L  AL +S +   + FQ+LI+QSG+ ++   I+ +P   ++   R
Sbjct  236  NAGQVTLVGQAGGATLAHALSLSGRA-GNLFQQLILQSGTALNPYLIDNQPLDTLSTFAR  294

Query  280  ALKCEKCECIHRAQ------RCLKGAPVMDLLKAAE-----SERYG--------LIIDDY  320
              +C        AQ       CL   P   L+ A E     +E  G        L++ D 
Sbjct  295  LARCPPPSINPSAQGLKPLYDCLARLPTSQLVAAFEQLLLQNEHLGLTQLGGFKLVVGDP  354

Query  321  YDTIPEHPAQLIGQTNKNVPIMTGFTKHDGAIVLGFFYDDFKVSHPNLNTVTVRDFATAL  380
               +P HPA L   ++  +P++ G TK   A ++   YD        L +  V D+   +
Sbjct  355  LGFLPSHPASLATNSSLALPMIIGATKDASAFIVSRIYDQLA----RLQSRNVSDYIDVV  410

Query  381  MNWMNDTTG--LTNNAMTRLLFPADLWHSADHRRALPAYFDLVNILFFKSVMLGFTNKLF  438
            +      +   L      R +F      +A  +   P   +L N + +++ ++   ++ +
Sbjct  411  LRHTAPPSEHRLWKQWALREIFTPIQEQTASLQTVAPGLLELSNYILYRAPVINSISQSY  470

Query  439  EKAAQPPIYFYTFDYAGEKTNFSFDLGNAQYPFNGGVHHTDELIYLFAMKPP---LNAQD  495
                  P Y YTFDY GE   F   L N   PF      +D+ +YLF   P    LN  D
Sbjct  471  RSV---PAYLYTFDYRGEHHRFGH-LSNP-LPFGVDASLSDDSVYLFPYPPEASRLNPLD  525

Query  496  TAIAKKMVALWVSFATTGVP  515
             ++++ +V +WV+FATTGVP
Sbjct  526  RSLSRALVTMWVNFATTGVP  545


>Q24201_DROME unnamed protein product
Length=556

 Score = 176 bits (445),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 136/475 (29%), Positives = 222/475 (47%), Gaps = 42/475 (9%)

Query  68   YMQFRGIPYAESPSGERRYKPPAPRKPWSTPLQANDYGRICPQL-FTYNRLSPDKLQGDL  126
            Y  F GIPYA+ P GE R+K P    PW      +       Q+ F +     DK++G  
Sbjct  39   YFSFEGIPYAQPPVGELRFKAPQRPIPWEGVRDCSQPKDKAVQVQFVF-----DKVEGS-  92

Query  127  EDCLTLNIFTK--KLNATQPVMFYVHGGSLQVGFASD--HRPDYLLEEDIVLVVIQYRLG  182
            EDCL LN++T   K +  +PVM ++HGG   +G A+   + PDY ++ED+VLV IQYRLG
Sbjct  93   EDCLYLNVYTNNVKPDKARPVMVWIHGGGFIIGEANREWYGPDYFMKEDVVLVTIQYRLG  152

Query  183  VLGFAGTKTPDM--AGNFGLMDIMLALQWVQEHISAFGGDSAKVTVFGESSGGELGGALL  240
             LGF   K+P++   GN GL D +LAL+W++ + ++FGGD   +TVFGES+GG     ++
Sbjct  153  ALGFMSLKSPELNVPGNAGLKDQVLALKWIKNNCASFGGDPNCITVFGESAGGASTHYMM  212

Query  241  ISPKTPPSAFQRLIIQSGSIVDKQSINMEPRAQVTRVCRALKCEKCECIHRAQRCLKGAP  300
            ++ +T    F R I+QSGS +   + N +      R+ + +  +  +        L+   
Sbjct  213  LTDQT-QGLFHRGILQSGSAICPWAYNGDITHNPYRIAKLVGYKGEDNDKDVLEFLQNVK  271

Query  301  VMDLLKAAESE------------RYGLIIDDYYD---TIPEHPAQLIGQTNKN-VPIMTG  344
              DL++  E+             R+G  ++ +      I + P +++     N +P+  G
Sbjct  272  AKDLIRVEENVLTLEERMNKIMFRFGPSLEPFSTPECVISKPPKEMMKTAWSNSIPMFIG  331

Query  345  FTKHDGAIVLGFFYDDFKVSHPNLNTVTVRDFATALMNWMNDTTGLTNNAMTRLLFPADL  404
             T ++G +    +  + K+    L  +   D  T  +      T  +   +         
Sbjct  332  NTSYEGLL----WVPEVKLMPQVLQQL---DAGTPFIPKELLATEPSKEKLDSWSAQIRD  384

Query  405  WHSADHRRALPAYFDLVNILFFKSVMLGFTNKLFEKAAQPPIYFYTFDYAGEKTNFSFDL  464
             H          Y DL +I +F    L   +     AA  P+YFY +D+  E+  F + +
Sbjct  385  VHRTGSESTPDNYMDLCSIYYFVFPALRVVHSRHAYAAGAPVYFYRYDFDSEELIFPYRI  444

Query  465  GNAQYPFNGGVHHTDELIY----LFAMKPPLNAQDTAIAKKMVALWVSFATTGVP  515
                     GV H D+L Y    L A + P  +++    ++ V +W  FA TG P
Sbjct  445  MRMGRGVK-GVSHADDLSYQFSSLLARRLPKESREYRNIERTVGIWTQFAATGNP  498


>Q9VIB5_DROME unnamed protein product
Length=572

 Score = 175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 137/475 (29%), Positives = 222/475 (47%), Gaps = 42/475 (9%)

Query  68   YMQFRGIPYAESPSGERRYKPPAPRKPWSTPLQANDYGRICPQL-FTYNRLSPDKLQGDL  126
            Y  F GIPYA+ P GE R+K P    PW      +       Q+ F +     DK++G  
Sbjct  55   YFSFEGIPYAQPPVGELRFKAPQRPIPWERVRDCSQPKDKAVQVQFVF-----DKVEGS-  108

Query  127  EDCLTLNIFTK--KLNATQPVMFYVHGGSLQVGFASD--HRPDYLLEEDIVLVVIQYRLG  182
            EDCL LN++T   K +  +PVM ++HGG   +G A+   + PDY ++ED+VLV IQYRLG
Sbjct  109  EDCLYLNVYTNNVKPDKARPVMVWIHGGGFIIGEANREWYGPDYFMKEDVVLVTIQYRLG  168

Query  183  VLGFAGTKTPDM--AGNFGLMDIMLALQWVQEHISAFGGDSAKVTVFGESSGGELGGALL  240
             LGF   K+P++   GN GL D +LAL+W++ + ++FGGD   +TVFGES+GG     ++
Sbjct  169  ALGFMSLKSPELNVPGNAGLKDQVLALKWIKNNCASFGGDPNCITVFGESAGGASTHYMM  228

Query  241  ISPKTPPSAFQRLIIQSGSIVDKQSINMEPRAQVTRVCRALKCEKCECIHRAQRCLKGAP  300
            ++ +T    F R I+QSGS +   + N +      R+ + +  +  +        L+   
Sbjct  229  LTDQT-QGLFHRGILQSGSAICPWAYNGDITHNPYRIAKLVGYKGEDNDKDVLEFLQNVK  287

Query  301  VMDLLKAAES-----ERYGLIIDDYYDT----------IPEHPAQLIGQTNKN-VPIMTG  344
              DL++  E+     ER   I+  +  +          I + P +++     N +P+  G
Sbjct  288  AKDLIRVEENVLTLEERMNKIMFAFGPSLEPFSTPECVISKPPKEMMKTAWSNSIPMFIG  347

Query  345  FTKHDGAIVLGFFYDDFKVSHPNLNTVTVRDFATALMNWMNDTTGLTNNAMTRLLFPADL  404
             T ++G +    +  + K+    L  +   D  T  +      T  +   +         
Sbjct  348  NTSYEGLL----WVPEVKLMPQVLQQL---DAGTPFIPKELLATEPSKEKLDSWSAQIRD  400

Query  405  WHSADHRRALPAYFDLVNILFFKSVMLGFTNKLFEKAAQPPIYFYTFDYAGEKTNFSFDL  464
             H          Y DL +I +F    L   +     AA  P+YFY +D+  E+  F + +
Sbjct  401  VHRTGSESTPDNYMDLCSIYYFVFPALRVVHSRHAYAAGAPVYFYRYDFDSEELIFPYRI  460

Query  465  GNAQYPFNGGVHHTDELIY----LFAMKPPLNAQDTAIAKKMVALWVSFATTGVP  515
                     GV H D+L Y    L A + P  +++    ++ V +W  FA TG P
Sbjct  461  MRLGRGVK-GVSHADDLSYQFSSLLARRLPKESREYRNIERTVGIWTQFAATGNP  514



Lambda      K        H
   0.312    0.129    0.370 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4811699998


Query= NP_001291901.1 ras-related protein Rab-40C [Bactrocera dorsalis]

Length=257
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

G5EFC1_CAEEL  unnamed protein product                                 144     9e-43
O15971_DROME  unnamed protein product                                 144     2e-42
Q9U2C3_CAEEL  unnamed protein product                                 138     3e-40


>G5EFC1_CAEEL unnamed protein product
Length=211

 Score = 144 bits (364),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 77/167 (46%), Positives = 103/167 (62%), Gaps = 3/167 (2%)

Query  6    MTKDYDYLLKVLLVGDSDVGKHEILSCLEDASSESPFCS--GNAYKTTTILLEGKRVKLQ  63
            M K YDYL K+LL+GDS VGK  +L    D S  + F S  G  +K  TI L+GK++KLQ
Sbjct  1    MAKTYDYLFKLLLIGDSGVGKTCVLFRFSDDSFNNSFISTIGIDFKIRTIELDGKKIKLQ  60

Query  64   IWDTSGQGRFCTIIRSYSRGAQGIILVYDITNKWSFDGIDRWLKEVEEHAPG-IPKVLVG  122
            IWDT+GQ RF TI  +Y RGA GIILVYDITN+ SF+ I  W++ +EEHA   + ++++G
Sbjct  61   IWDTAGQERFRTITTAYYRGAMGIILVYDITNERSFENIKNWIRNIEEHAASDVERMIIG  120

Query  123  NRLHLAFKRQVLAKHAELYASRNNMSCFEISPLCDFNIRESFCELAR  169
            N+  +  +R+V     E  A        E S   + NI E+F  LAR
Sbjct  121  NKCDIEERREVSRDRGEQLAIEYGTKFLETSAKANLNIDEAFFTLAR  167


>O15971_DROME unnamed protein product
Length=204

 Score = 144 bits (362),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/170 (46%), Positives = 105/170 (62%), Gaps = 3/170 (2%)

Query  8    KDYDYLLKVLLVGDSDVGKHEILSCLEDASSESPFCS--GNAYKTTTILLEGKRVKLQIW  65
            K YD L K+LL+GDS VGK  IL    D +  S F S  G  +K  T+ L GK++KLQIW
Sbjct  4    KTYDLLFKLLLIGDSGVGKTCILFRFSDDAFTSTFISTIGIDFKIKTVELRGKKIKLQIW  63

Query  66   DTSGQGRFCTIIRSYSRGAQGIILVYDITNKWSFDGIDRWLKEVEEHA-PGIPKVLVGNR  124
            DT+GQ RF TI  SY RGA GI+LVYDITN+ SF+ I +WL+ ++EHA   + K+++GN+
Sbjct  64   DTAGQERFHTITTSYYRGAMGIMLVYDITNEKSFENIVKWLRNIDEHANEDVEKMILGNK  123

Query  125  LHLAFKRQVLAKHAELYASRNNMSCFEISPLCDFNIRESFCELARMALHR  174
              +  KR V  +  E  A  + +   E S   + NI  +FCELA   L +
Sbjct  124  CDMTDKRVVNKERGEAIAREHGIRFMETSAKSNINIERAFCELAEAILDK  173


>Q9U2C3_CAEEL unnamed protein product
Length=209

 Score = 138 bits (348),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 101/168 (60%), Gaps = 2/168 (1%)

Query  7    TKDYDYLLKVLLVGDSDVGKHEILSCLEDASSESPFCS--GNAYKTTTILLEGKRVKLQI  64
            T+DYD+L K+L++GDS VGK  +L    D +    + +  G  +K  T+ + G+RVKLQI
Sbjct  4    TRDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSENYITTIGVDFKIRTMDINGQRVKLQI  63

Query  65   WDTSGQGRFCTIIRSYSRGAQGIILVYDITNKWSFDGIDRWLKEVEEHAPGIPKVLVGNR  124
            WDT+GQ RF TI  +Y RG  G+++VYD+TN  SF  + RWL+E+E +   + KVLVGN+
Sbjct  64   WDTAGQERFRTITSTYYRGTHGVVVVYDVTNGESFGNVKRWLQEIENNCDSVQKVLVGNK  123

Query  125  LHLAFKRQVLAKHAELYASRNNMSCFEISPLCDFNIRESFCELARMAL  172
                 +R VL   A  YA   N+S FE S   D N+   F  +  + L
Sbjct  124  CEENERRVVLESDARNYAQSMNISFFETSAKEDKNVEPMFTCITSLVL  171



Lambda      K        H
   0.312    0.129    0.370 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4811699998


Query= NP_001291902.1 opsin Rh1 [Bactrocera dorsalis]

Length=369
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

OPS1_DROME  unnamed protein product                                   711     0.0   
OPS2_DROME  unnamed protein product                                   533     0.0   
OPS6_DROME  unnamed protein product                                   398     3e-138


>OPS1_DROME unnamed protein product
Length=373

 Score = 711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/364 (94%), Positives = 350/364 (96%), Gaps = 0/364 (0%)

Query  6    SLGPHFAALSNGSVTDKVTPDMAHLIHPYWNQFPAMDPIWAKILTAYMICIGMISWCGNG  65
             LGPHFA LSNGSV DKVTPDMAHLI PYWNQFPAMDPIWAKILTAYMI IGMISWCGNG
Sbjct  10   QLGPHFAPLSNGSVVDKVTPDMAHLISPYWNQFPAMDPIWAKILTAYMIMIGMISWCGNG  69

Query  66   VVIYIFSTTKSLRTPANLLVINLALSDFGIMITNTPMMGINLYFETWVLGPAMCDLYGGL  125
            VVIYIF+TTKSLRTPANLLVINLA+SDFGIMITNTPMMGINLYFETWVLGP MCD+Y GL
Sbjct  70   VVIYIFATTKSLRTPANLLVINLAISDFGIMITNTPMMGINLYFETWVLGPMMCDIYAGL  129

Query  126  GSAFGCSSIWSMCMISLDRYQVIVKGVAGRPMTIKLALMKIAFIWAMGSIWTLAPVFGWS  185
            GSAFGCSSIWSMCMISLDRYQVIVKG+AGRPMTI LAL KIA+IW M SIW LAP FGWS
Sbjct  130  GSAFGCSSIWSMCMISLDRYQVIVKGMAGRPMTIPLALGKIAYIWFMSSIWCLAPAFGWS  189

Query  186  RYVPEGNLTSCGIDYLERDWNPRSYLIFYSIFVYYVPLFLICYSYWFIIAAVSAHEKAMR  245
            RYVPEGNLTSCGIDYLERDWNPRSYLIFYSIFVYY+PLFLICYSYWFIIAAVSAHEKAMR
Sbjct  190  RYVPEGNLTSCGIDYLERDWNPRSYLIFYSIFVYYIPLFLICYSYWFIIAAVSAHEKAMR  249

Query  246  EQAKKMNVKSLRSSEDAEKSAEGKLAKVALVTISLWFMAWTPYLVINCMGLFKFEGLTPL  305
            EQAKKMNVKSLRSSEDAEKSAEGKLAKVALVTI+LWFMAWTPYLVINCMGLFKFEGLTPL
Sbjct  250  EQAKKMNVKSLRSSEDAEKSAEGKLAKVALVTITLWFMAWTPYLVINCMGLFKFEGLTPL  309

Query  306  NTIWGACFAKSAACYNPIVYGISHPKYRLALKEKCPCCVFGKVDDGKSSDAQSQATTNES  365
            NTIWGACFAKSAACYNPIVYGISHPKYRLALKEKCPCCVFGKVDDGKSSDAQSQAT +E+
Sbjct  310  NTIWGACFAKSAACYNPIVYGISHPKYRLALKEKCPCCVFGKVDDGKSSDAQSQATASEA  369

Query  366  ESKA  369
            ESKA
Sbjct  370  ESKA  373


>OPS2_DROME unnamed protein product
Length=381

 Score = 533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/370 (70%), Positives = 296/370 (80%), Gaps = 3/370 (1%)

Query  3    SLQSLGPHFAALS--NGSVTDKVTPDMAHLIHPYWNQFPAMDPIWAKILTAYMICIGMIS  60
             L   GP F A S  NGSV D V PDMAHL++PYW++F  MDP+ +KIL  + + I +IS
Sbjct  12   DLAHSGPRFQAQSSGNGSVLDNVLPDMAHLVNPYWSRFAPMDPMMSKILGLFTLAIMIIS  71

Query  61   WCGNGVVIYIFSTTKSLRTPANLLVINLALSDFGIMITNTPMMGINLYFETWVLGPAMCD  120
             CGNGVV+YIF  TKSLRTPANLLV+NLA SDF +M + +P+M IN Y+ETWVLGP  CD
Sbjct  72   CCGNGVVVYIFGGTKSLRTPANLLVLNLAFSDFCMMASQSPVMIINFYYETWVLGPLWCD  131

Query  121  LYGGLGSAFGCSSIWSMCMISLDRYQVIVKGVAGRPMTIKLALMKIAFIWAMGSIWTLAP  180
            +Y G GS FGC SIWSMCMI+ DRY VIVKG+ G PMTIK ++MKI FIW M   WT+ P
Sbjct  132  IYAGCGSLFGCVSIWSMCMIAFDRYNVIVKGINGTPMTIKTSIMKILFIWMMAVFWTVMP  191

Query  181  VFGWSRYVPEGNLTSCGIDYLERDWNPRSYLIFYSIFVYYVPLFLICYSYWFIIAAVSAH  240
            + GWS YVPEGNLT+C IDY+ R WNPRSYLI YS+FVYY PLFLICYSYWFIIAAV+AH
Sbjct  192  LIGWSAYVPEGNLTACSIDYMTRMWNPRSYLITYSLFVYYTPLFLICYSYWFIIAAVAAH  251

Query  241  EKAMREQAKKMNVKSLRSSEDAEKSAEGKLAKVALVTISLWFMAWTPYLVINCMGLFKFE  300
            EKAMREQAKKMNVKSLRSSED +KSAEGKLAKVAL TISLWFMAWTPYLVI   GLFK +
Sbjct  252  EKAMREQAKKMNVKSLRSSEDCDKSAEGKLAKVALTTISLWFMAWTPYLVICYFGLFKID  311

Query  301  GLTPLNTIWGACFAKSAACYNPIVYGISHPKYRLALKEKCPCCVFGKVDDGK-SSDAQSQ  359
            GLTPL TIWGA FAK++A YNPIVYGISHPKYR+ LKEKCP CVFG  D+ K  + A   
Sbjct  312  GLTPLTTIWGATFAKTSAVYNPIVYGISHPKYRIVLKEKCPMCVFGNTDEPKPDAPASDT  371

Query  360  ATTNESESKA  369
             TT+E++SKA
Sbjct  372  ETTSEADSKA  381


>OPS6_DROME unnamed protein product
Length=369

 Score = 398 bits (1022),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 192/365 (53%), Positives = 264/365 (72%), Gaps = 6/365 (2%)

Query  9    PHFAALSNG---SVTDKVTPDMAHLIHPYWNQFPAMDPIWAKILTAYMICIGMISWCGNG  65
            P FA + +G   S+ + V  ++ H++ PYW Q+P ++P+W  I+   +  +G +S  GN 
Sbjct  7    PSFAYMRDGRNLSLAESVPAEIMHMVDPYWYQWPPLEPMWFGIIGFVIAILGTMSLAGNF  66

Query  66   VVIYIFSTTKSLRTPANLLVINLALSDFGIMITNTPMMGINLYFETWVLGPAMCDLYGGL  125
            +V+YIF+++K LRTP+N+ V+NLA SDF +M T  P + +N ++ TW++GP +C+LYG  
Sbjct  67   IVMYIFTSSKGLRTPSNMFVVNLAFSDFMMMFTMFPPVVLNGFYGTWIMGPFLCELYGMF  126

Query  126  GSAFGCSSIWSMCMISLDRYQVIVKGVAGRPMTIKLALMKIAFIWAMGSIWTLAPVFGWS  185
            GS FGC SIWSM +I+ DRY VIVKG+A +P+T   A++++  +W +   W L P+FGW+
Sbjct  127  GSLFGCVSIWSMTLIAYDRYCVIVKGMARKPLTATAAVLRLMVVWTICGAWALMPLFGWN  186

Query  186  RYVPEGNLTSCGIDYLERDWNPRSYLIFYSIFVYYVPLFLICYSYWFIIAAVSAHEKAMR  245
            RYVPEGN+T+CG DY  +DW  RSY+I YS++VY  PL  I +SYW I+ AV+AHEKAMR
Sbjct  187  RYVPEGNMTACGTDYFAKDWWNRSYIIVYSLWVYLTPLLTIIFSYWHIMKAVAAHEKAMR  246

Query  246  EQAKKMNVKSLRSSE-DAEKSAEGKLAKVALVTISLWFMAWTPYLVINCMGLFKFEGLTP  304
            EQAKKMNV SLR+SE D  K+ E KLAKVAL TISLWF AWTPY +IN  G+F+   L+P
Sbjct  247  EQAKKMNVASLRNSEADKSKAIEIKLAKVALTTISLWFFAWTPYTIINYAGIFESMHLSP  306

Query  305  LNTIWGACFAKSAACYNPIVYGISHPKYRLALKEKCPCCVFGKVDDGKSSDAQSQATTNE  364
            L+TI G+ FAK+ A  NPIVYG+SHPKY+  L+EK PC   GK  D  +SD+++QAT   
Sbjct  307  LSTICGSVFAKANAVCNPIVYGLSHPKYKQVLREKMPCLACGK--DDLTSDSRTQATAEI  364

Query  365  SESKA  369
            SES+A
Sbjct  365  SESQA  369



Lambda      K        H
   0.312    0.129    0.370 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4811699998


Query= NP_001291903.1 copper chaperone for superoxide dismutase [Bactrocera
dorsalis]

Length=261
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9BLY4_DROME  unnamed protein product                                 382     4e-135
E1JH26_DROME  unnamed protein product                                 381     5e-135
A1Z850_DROME  unnamed protein product                                 368     7e-130


>Q9BLY4_DROME unnamed protein product
Length=264

 Score = 382 bits (980),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 195/264 (74%), Positives = 228/264 (86%), Gaps = 3/264 (1%)

Query  1    MGDIKVEFSVQMR--GEHCAERVRNALQGTSKVDIDSSEGRVTIETKEPWYVIKDKIEST  58
            M  IK+EF+VQMR   E  A  +R+AL G  +V+ID+ EGRV I+T+ PW  I+DKIE+T
Sbjct  1    MSSIKIEFAVQMRRGDESYAGALRSALDGVGQVEIDTQEGRVIIQTQRPWSEIQDKIEAT  60

Query  59   GRKAVLVGFGGQSAVAIINTTGSDVDRTPIQGILRFCALTKDN-PGVVVDGVVDGLTPGL  117
            G +AVL GFGGQSAVA+INTTGS VD+TPIQG++RF  +T D  PGVVVDGVVDGL+PGL
Sbjct  61   GVRAVLSGFGGQSAVALINTTGSVVDKTPIQGVVRFTTITADKKPGVVVDGVVDGLSPGL  120

Query  118  HGLHVHESGDVSSGCASIGEHYNPRGSPHGSPDNAPDSRHAGDLGNIRADESGRATFRFV  177
            HGLH+HESGD S+GC+S+GEHYNPR SPHGSP    + RHAGDLGNIRADE+GRATFRFV
Sbjct  121  HGLHIHESGDTSAGCSSVGEHYNPRQSPHGSPAAGAEERHAGDLGNIRADENGRATFRFV  180

Query  178  DPVLAVWDIIGRSVAITANADDLGRGGNEQSRIDGNAGERIACGIIARSAGIMENFKKIC  237
            DPVL VWDIIGR+V +TANADDLGRGGN+QS IDGN+GERIACGIIARSAGI+ENFK+IC
Sbjct  181  DPVLEVWDIIGRAVVLTANADDLGRGGNDQSLIDGNSGERIACGIIARSAGILENFKRIC  240

Query  238  ACDGVTLWDERNKPIAGGNRAQKL  261
            ACDGVTLWDERNKP+AG +R+QKL
Sbjct  241  ACDGVTLWDERNKPLAGKDRSQKL  264


>E1JH26_DROME unnamed protein product
Length=264

 Score = 381 bits (979),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 195/264 (74%), Positives = 227/264 (86%), Gaps = 3/264 (1%)

Query  1    MGDIKVEFSVQMR--GEHCAERVRNALQGTSKVDIDSSEGRVTIETKEPWYVIKDKIEST  58
            M  IK+EF+VQMR   E  A  +R+AL G  +V+ID+ EGRV I+T+ PW  I+DKIE+T
Sbjct  1    MSSIKIEFAVQMRRGDESYAGALRSALDGVGQVEIDTQEGRVIIQTQRPWSEIQDKIEAT  60

Query  59   GRKAVLVGFGGQSAVAIINTTGSDVDRTPIQGILRFCALTKDN-PGVVVDGVVDGLTPGL  117
            G +AVL GFGGQSAVA+INTTGS VD+TPIQG++RF  +T D  PGVVVDGVVDGL+PGL
Sbjct  61   GVRAVLSGFGGQSAVALINTTGSVVDKTPIQGVVRFTTITADKKPGVVVDGVVDGLSPGL  120

Query  118  HGLHVHESGDVSSGCASIGEHYNPRGSPHGSPDNAPDSRHAGDLGNIRADESGRATFRFV  177
            HGLH+HESGD S+GC+S+GEHYNPR SPHGSP    + RHAGDLGNIRADE+GRATFRFV
Sbjct  121  HGLHIHESGDTSAGCSSVGEHYNPRQSPHGSPAAGAEERHAGDLGNIRADENGRATFRFV  180

Query  178  DPVLAVWDIIGRSVAITANADDLGRGGNEQSRIDGNAGERIACGIIARSAGIMENFKKIC  237
            DPVL VWDIIGR+V +TANADDLGRGGN+QS IDGN+GERIACGIIARSAGI+ENFK+IC
Sbjct  181  DPVLEVWDIIGRAVVLTANADDLGRGGNDQSLIDGNSGERIACGIIARSAGILENFKRIC  240

Query  238  ACDGVTLWDERNKPIAGGNRAQKL  261
            ACDGVTLWDERNKP+AG  R+QKL
Sbjct  241  ACDGVTLWDERNKPLAGKERSQKL  264


>A1Z850_DROME unnamed protein product
Length=258

 Score = 368 bits (944),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 189/256 (74%), Positives = 221/256 (86%), Gaps = 3/256 (1%)

Query  9    SVQMR--GEHCAERVRNALQGTSKVDIDSSEGRVTIETKEPWYVIKDKIESTGRKAVLVG  66
            S++MR   E  A  +R+AL G  +V+ID+ EGRV I+T+ PW  I+DKIE+TG +AVL G
Sbjct  3    SIKMRRGDESYAGALRSALDGVGQVEIDTQEGRVIIQTQRPWSEIQDKIEATGVRAVLSG  62

Query  67   FGGQSAVAIINTTGSDVDRTPIQGILRFCALTKDN-PGVVVDGVVDGLTPGLHGLHVHES  125
            FGGQSAVA+INTTGS VD+TPIQG++RF  +T D  PGVVVDGVVDGL+PGLHGLH+HES
Sbjct  63   FGGQSAVALINTTGSVVDKTPIQGVVRFTTITADKKPGVVVDGVVDGLSPGLHGLHIHES  122

Query  126  GDVSSGCASIGEHYNPRGSPHGSPDNAPDSRHAGDLGNIRADESGRATFRFVDPVLAVWD  185
            GD S+GC+S+GEHYNPR SPHGSP    + RHAGDLGNIRADE+GRATFRFVDPVL VWD
Sbjct  123  GDTSAGCSSVGEHYNPRQSPHGSPAAGAEERHAGDLGNIRADENGRATFRFVDPVLEVWD  182

Query  186  IIGRSVAITANADDLGRGGNEQSRIDGNAGERIACGIIARSAGIMENFKKICACDGVTLW  245
            IIGR+V +TANADDLGRGGN+QS IDGN+GERIACGIIARSAGI+ENFK+ICACDGVTLW
Sbjct  183  IIGRAVVLTANADDLGRGGNDQSLIDGNSGERIACGIIARSAGILENFKRICACDGVTLW  242

Query  246  DERNKPIAGGNRAQKL  261
            DERNKP+AG  R+QKL
Sbjct  243  DERNKPLAGKERSQKL  258



Lambda      K        H
   0.312    0.129    0.370 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4811699998


Query= NP_001291904.1 glutamate [NMDA] receptor subunit 1 precursor
[Bactrocera dorsalis]

Length=985
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

NMDA1_DROME  unnamed protein product                                  1696    0.0   
G5EGQ9_CAEEL  unnamed protein product                                 501     3e-161
Q6IWN7_DROME  unnamed protein product                                 274     4e-77 


>NMDA1_DROME unnamed protein product
Length=997

 Score = 1696 bits (4393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 832/976 (85%), Positives = 887/976 (91%), Gaps = 18/976 (2%)

Query  23   AQKHSQHSDNPSTYNIGGVLADPESESHFRTIISNLNFDQQYVPRKVTYYDKTIRMDKNP  82
            AQ+H+  SDNPSTYNIGGVL++ +SE HF T I +LNFDQQYVPRKVTYYDKTIRMDKNP
Sbjct  27   AQRHTA-SDNPSTYNIGGVLSNSDSEEHFSTTIKHLNFDQQYVPRKVTYYDKTIRMDKNP  85

Query  83   IKTVFNVCDKLIEKRVYAVVVSHEQTSGDLSPAAVSYTSGFYQIPVIGISSRDAAFSDKN  142
            IKTVFNVCDKLIE RVYAVVVSHEQTSGDLSPAAVSYTSGFY IPVIGISSRDAAFSDKN
Sbjct  86   IKTVFNVCDKLIENRVYAVVVSHEQTSGDLSPAAVSYTSGFYSIPVIGISSRDAAFSDKN  145

Query  143  IHVSFLRTVPPYYHQADVWLEIMFHFGYTKVIIIHSSDTDGRAILGRFQTTSQTNYDDID  202
            IHVSFLRTVPPYYHQADVWLE++ HF YTKVIIIHSSDTDGRAILGRFQTTSQT YDD+D
Sbjct  146  IHVSFLRTVPPYYHQADVWLEMLSHFAYTKVIIIHSSDTDGRAILGRFQTTSQTYYDDVD  205

Query  203  VRATVEMIVEFEPKLDSFTEHLIDMKTAQSRVYLLYASTEDAQVIFRDAAINNMTEAGHA  262
            VRATVE+IVEFEPKL+SFTEHLIDMKTAQSRVYL+YASTEDAQVIFRDA   NMT  GH 
Sbjct  206  VRATVELIVEFEPKLESFTEHLIDMKTAQSRVYLMYASTEDAQVIFRDAGEYNMTGEGHV  265

Query  263  WIVTEQALHANNTPVGVLGLVLEHANSDKEHIRDSVYVLASAIKEMMSNETITEAPKDCG  322
            WIVTEQAL +NNTP GVLGL LEHA+SDK HIRDSVYVLASAIKEM+SNETI EAPKDCG
Sbjct  266  WIVTEQALFSNNTPDGVLGLQLEHAHSDKGHIRDSVYVLASAIKEMISNETIAEAPKDCG  325

Query  323  DSGVNWESGKRLFQYLKTRNITGKTGQVAFDDNGDRIYAGYDVINIHEKQKKHVVGKFYY  382
            DS VNWESGKRLFQYLK+RNITG+TGQVAFDDNGDRIYAGYDVINI E+QKKHVVGKF Y
Sbjct  326  DSAVNWESGKRLFQYLKSRNITGETGQVAFDDNGDRIYAGYDVINIREQQKKHVVGKFSY  385

Query  383  DPEKAKMRLRINDSEILWPGKQKKKPEGIMIPTHLKILTIEEKPFVYTRRLTDDEVNCDE  442
            D  +AKMR+RINDSEI+WPGKQ++KPEGIMIPTHL++LTIEEKPFVY RR+ DDE  C+ 
Sbjct  386  DSMRAKMRMRINDSEIIWPGKQRRKPEGIMIPTHLRLLTIEEKPFVYVRRMGDDEFRCEP  445

Query  443  DEIPCPLFNATDGSENENCCRGYCIDLLNALSHRINFTFALALSPDGQFGHFTLKNVSSS  502
            DE PCPLFN +D + NE CCRGYCIDLL  LS RINFT+ LALSPDGQFGH+ L+N    
Sbjct  446  DERPCPLFNNSDATANEFCCRGYCIDLLIELSKRINFTYDLALSPDGQFGHYILRN----  501

Query  503  SSGAITSRKEWSGLIGELVNERADMAM-PLTINPERAEFIEFSKPFKYQGITILEKKPSR  561
            ++GA+T RKEW+GLIGELVNERADM + PLTINPERAE+IEFSKPFKYQGITILEKKPSR
Sbjct  502  NTGAMTLRKEWTGLIGELVNERADMIVAPLTINPERAEYIEFSKPFKYQGITILEKKPSR  561

Query  562  SSTLVSFLQPFSNTLWILVMVSVHVVALVLYLLDRFSPFGRFKLSHTDSNEEKALNLSSA  621
            SSTLVSFLQPFSNTLWILVMVSVHVVALVLYLLDRFSPFGRFKLSH+DSNEEKALNLSSA
Sbjct  562  SSTLVSFLQPFSNTLWILVMVSVHVVALVLYLLDRFSPFGRFKLSHSDSNEEKALNLSSA  621

Query  622  VWFAWGVLLNSGIGEGTPRSFSARVLGMFWAGFAMIIVASYTANLAAFLVLERPKTKLSG  681
            VWFAWGVLLNSGIGEGTPRSFSARVLGM WAGFAMIIVASYTANLAAFLVLERPKTKLSG
Sbjct  622  VWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLERPKTKLSG  681

Query  682  INDARLRNTMENLTCATVKGSSVDMYFRRQVELSNMYRTMEANNYDTAEQAIQDVKKGKL  741
            INDARLRNTMENLTCATVKGSSVDMYFRRQVELSNMYRTMEANNY TAEQAIQDVKKGKL
Sbjct  682  INDARLRNTMENLTCATVKGSSVDMYFRRQVELSNMYRTMEANNYATAEQAIQDVKKGKL  741

Query  742  MAFIWDSSRLEYEASKDCELVTAGELFGRSGYGIGLQKGSPWTDAVTLAILEFHESGFME  801
            MAFIWDSSRLEYEASKDCELVTAGELFGRSGYGIGLQKGSPWTDAVTLAILEFHESGFME
Sbjct  742  MAFIWDSSRLEYEASKDCELVTAGELFGRSGYGIGLQKGSPWTDAVTLAILEFHESGFME  801

Query  802  ALDKHWIFHGNAQQ-CELFEKTPNTLGLQNMAGVFILVAAGVAGGVGLIIVEVIYKKHQV  860
             LDK WIFHG+ QQ CELFEKTPNTLGL+NMAGVFILV  G+AGGVGLII+EVIYKKHQV
Sbjct  802  KLDKQWIFHGHVQQNCELFEKTPNTLGLKNMAGVFILVGVGIAGGVGLIIIEVIYKKHQV  861

Query  861  KKQKRLDIARHAADKWRGTIEKRKTLRASLAMQRQYNVGLNAT--PGTISFAVDKRRYPR  918
            KKQKRLDIARHAADKWRGTIEKRKT+RASLAMQRQYNVGLN+T  PGTIS AVDKRRYPR
Sbjct  862  KKQKRLDIARHAADKWRGTIEKRKTIRASLAMQRQYNVGLNSTHAPGTISLAVDKRRYPR  921

Query  919  MGPR-APEQAWKSD-ADILRNRRYLDDATKG-------GHSPAVHMPILGKMRPPTNMLP  969
            +G R  PE+AW  D AD+LR RR  +    G        + P + MP+LGK RP  ++LP
Sbjct  922  LGQRLGPERAWPGDAADVLRIRRPYELGNPGQSPKVMAANQPGMPMPMLGKTRPQQSVLP  981

Query  970  PRYSPAYTSNVSHLVV  985
            PRYSP YTS+VSHLVV
Sbjct  982  PRYSPGYTSDVSHLVV  997


>G5EGQ9_CAEEL unnamed protein product
Length=1025

 Score = 501 bits (1290),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 326/857 (38%), Positives = 456/857 (53%), Gaps = 89/857 (10%)

Query  89   VCDKLIEKRVYAVVVSHEQTSG----DLSPAAVSYTSGFYQIPVIGISSRDAAFSDKNIH  144
            VC +++   + +V+ S   TS     DL  ++ +YT  FY++PV+G+  RDA FS KNI+
Sbjct  84   VCSQMLNHSLASVIFSPLLTSSSRFIDLVTSS-AYTLSFYKLPVVGVMVRDAEFSKKNIY  142

Query  145  VSFLRTVPPYYHQADVWLEIMFHFGYTKVIIIH-SSDTDGRAILGRFQTTSQTNYDDIDV  203
             +F+R   P   +A V+L ++    Y +V+++    D +    +  F+         ++ 
Sbjct  143  PTFVRPTAPLSDEAFVFLHMLLSLKYRQVVVLSVKRDINADQFVEEFEKRR------VEF  196

Query  204  RATVEMIVEFEPKLDSFTEHLID-----MKTAQSRVYLLYASTEDAQVIFRDAAINNMTE  258
            +  V+  +E E       E+L D      +   S + +L+A  +DA  IF +A   ++T 
Sbjct  197  KIIVQRYIEVE-----LNENLNDTLAESFEEVTSNIIVLFAKKDDAVRIFANAG--DLTG  249

Query  259  AGHAWIVTEQALHANNTPVGVLGLVLEHANSDKEHIRDSVYVLASAIKEMMSNETI-TEA  317
             G  WIV+E A  A+N P G LG  L    +    +RDS  +L SA++ +     I    
Sbjct  250  KGKVWIVSESAGEAHNVPNGSLGCRL--GQTAFSVLRDSFSILKSAMETIFRESKIDIFP  307

Query  318  PKDCGDSGVNWESGKRLFQYLKTRNITGKTGQVAFDDNGDRIYAGYDVINIHEKQKKHVV  377
            P +C    V+ E        L        T +V F+D  +RI   YD+IN H ++K+  V
Sbjct  308  PVECDRDSVDAEWNSLQAPALLNEICGTSTSRVHFNDKCERIGVEYDIINFHMERKQ--V  365

Query  378  GKFYYDPEKAKMRLRINDSEILWPGKQKKKPEGIMIPTHLKILTIEEKPFVYTRRLTDDE  437
            G    D       LR+++  I W G  K  P  I +P HL+++T+ + PFVYT  +    
Sbjct  366  GNMVGDI------LRLDEDSIEWAGGTK--PLEISLPKHLRVVTVADPPFVYTTPIGSPS  417

Query  438  VNCDE-----------DEI-------PCPLFNATDGSENENCCRGYCIDLLNALS-----  474
              C E           D+I        CPL    + S    CC G  IDLL+ LS     
Sbjct  418  -QCAELGNTVVEWSIFDKIVVSGPWYSCPL--TLENSTEYFCCAGLAIDLLSNLSLPEAN  474

Query  475  HRINFTFALALSPDGQFGHFTLKNVSSSSSGAITSRKEWSGLIGELVNERADMAMP-LTI  533
            + I+ +F  +L  +  +G      V +S +  IT     SG+IGEL  + ADMA+  +TI
Sbjct  475  NSIDTSFTFSLHLNESYGV-----VQASETTGITI----SGVIGELDGDTADMAIGGITI  525

Query  534  NPERAEFIEFSKPFKYQGITILEKKPSRSSTLVSFLQPFSNTLWILVMVSVHVVALVLYL  593
            NPER   ++F++P+ Y GI ILEK   R S + SFLQP  ++LW  + +SV +V L +Y 
Sbjct  526  NPERERIVDFTEPWLYHGIRILEKNIPRDSPMQSFLQPLQSSLWTALFISVILVGLAIYC  585

Query  594  LDRFSPFGRF----KLSHTDSNEEKAL----------NLSSAVWFAWGVLLNSGIGEGTP  639
            LD  SPF RF    K    D  +E  L          N   A+WF WGVLLNSG+ E TP
Sbjct  586  LDFKSPFERFYQADKEMEQDLKKEFELWIGKDADENVNFGEAMWFVWGVLLNSGVSEKTP  645

Query  640  RSFSARVLGMFWAGFAMIIVASYTANLAAFLVLERPKTKLSGINDARLRNTMENLTCATV  699
            RS SARVLG+ W GF MI+VASYTANLAAFLVL++P+  L+G+ D RLRN   N +  TV
Sbjct  646  RSCSARVLGIVWCGFCMIMVASYTANLAAFLVLDQPEKGLTGVTDPRLRNPSANFSFGTV  705

Query  700  KGSSVDMYFRRQVELSNMYRTMEANNYDTAEQAIQDVKKGKLMAFIWDSSRLEYEASKDC  759
              S+V  YF+R VELS+M+R ME +N   A +A+  +  G L AFIWDS+RLE+EA++ C
Sbjct  706  LNSNVYQYFKRHVELSSMFRKMEPHNVRRASEAVHSLLNGSLDAFIWDSTRLEFEAARHC  765

Query  760  ELVTAGELFGRSGYGIGLQKGSPWTDAVTLAILEFHESGFMEALDKHWIFHGNAQQCELF  819
            EL T G LFGRS YGIGLQK SPWT  +T AIL   ESG ME LD+ WI  G        
Sbjct  766  ELRTRGSLFGRSAYGIGLQKNSPWTPHITSAILRMSESGVMEKLDQKWIDRGGPNCVVEA  825

Query  820  EKTPNTLGLQNMAGVFILVAAGVAGGVGLIIVEVIYKKHQVKKQKRLDIARHAADKWRGT  879
             K+P  LGL NM  +FILV++GVA G+ L  VEV Y +    K +R  I      KW   
Sbjct  826  HKSPARLGLVNMKDIFILVSSGVALGIFLSFVEVSYGRRLADKGRRRRIVTRYFQKWHDL  885

Query  880  I--EKRKTLRASLAMQR  894
               +KR+  R    + R
Sbjct  886  TLGKKRRPYRLKYNLDR  902


>Q6IWN7_DROME unnamed protein product
Length=1070

 Score = 274 bits (700),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 220/868 (25%), Positives = 404/868 (47%), Gaps = 97/868 (11%)

Query  53   TIISNLNFDQQYVPRKVTYYDKTIRMDKNPIKTVFNVCDKLIEKRVYAVVVSHEQTSGDL  112
            T + + +F+Q+ +     ++D  + +  +P   +  +C + +   V A++          
Sbjct  137  TFLKDYSFEQKNI-----HFD-MMSLTPSPTAILSTLCKEFLRVNVSAILYMMNNEQFGH  190

Query  113  SPAAVSY---TSGFYQIPVIGISSRDAAFSDKNIHVSF-LRTVPPYYHQADVWLEIMFHF  168
            S A+  Y    +G+  IPVI  ++ ++    +    +  L+  P   HQ+   L I+  +
Sbjct  191  STASAQYFLQLAGYLGIPVISWNADNSGLERRASQSTLQLQLAPSIEHQSAAMLSILERY  250

Query  169  GYTKVIIIHSSDTDGRAILGRFQTTSQTNYDDIDVRATVEMIVEFEPK-----LDSF---  220
             + +  ++                TSQ    D  V+A  E + E +       L+S    
Sbjct  251  KWHQFSVV----------------TSQIAGHDDFVQAVRERVAEMQEHFKFTILNSIVVT  294

Query  221  -TEHLIDMKTAQSRVYLLYASTEDAQVIFRDAAINNMTEAGHAWIVTEQALHANNT----  275
             T  L+++  +++RV LLYA+  +A  I R A    +T   + W+V++  +   +     
Sbjct  295  RTSDLMELVNSEARVMLLYATQTEAITILRAAEEMKLTGENYVWVVSQSVIEKKDAHSQF  354

Query  276  PVGVLGLVLEHANSD-KEHIRDSVYVLASAIKEMMSN-----ETITEAPKDCGDSGVN-W  328
            PVG+LG+  + +++     I +++ + +  ++  +++       +T     C D G   W
Sbjct  355  PVGMLGVHFDTSSAALMNEISNAIKIYSYGVEAYLTDPANRDRRLTTQSLSCEDEGRGRW  414

Query  329  ESGKRLFQYLKTRNITGKTGQ--VAFDDNGDRIYAGYDVINIH-EKQKKHVVGK---FYY  382
            ++G+  F+YL+  +I G   +  + F  +GD   A   ++N+      K++V +    + 
Sbjct  415  DNGEIFFKYLRNVSIEGDLNKPNIEFTADGDLRSAELKIMNLRPSANNKNLVWEEIGVWK  474

Query  383  DPEKAKMRLRINDSEILWPGKQKKKPEGIMIPTHLKILTIEEKPF--------VYTRRLT  434
              E  K+ +R    +I WPG     P+G+    HLKI  +EE P+        V  + L 
Sbjct  475  SWETQKLDIR----DIAWPGNSHAPPQGVPEKFHLKITFLEEAPYINLSPADPVSGKCLM  530

Query  435  DDEVNCD--EDEIPCPLFNATDGSENEN---CCRGYCIDLLNALSHRINFTFALALSPDG  489
            D  V C    D       +      NE+   CC G+CIDLL   +  + FT+ L    DG
Sbjct  531  DRGVLCRVAADHEMAADIDVGQAHRNESFYQCCSGFCIDLLEKFAEELGFTYELVRVEDG  590

Query  490  QFGHFTLKNVSSSSSGAITSRKEWSGLIGELVNERADMAM-PLTINPERAEFIEFSKPFK  548
            ++G  TL+N             +W+GLI +LVN + DM +  L IN ER   ++FS+PF 
Sbjct  591  KWG--TLEN------------GKWNGLIADLVNRKTDMVLTSLMINTEREAVVDFSEPFM  636

Query  549  YQGITILEKKPSRSSTLVSFLQPFSNTLWILV-MVSVHVVALVLYLLDRFSPFG---RFK  604
              GI I+  K +   +  +FL+PF    W+LV +V++     +++L +  SP G   +  
Sbjct  637  ETGIAIVVAKRTGIISPTAFLEPFDTASWMLVGIVAIQAATFMIFLFEWLSPSGYDMKLY  696

Query  605  LSHTDSNEEKALNLSSAVWFAWGVLLNSGIGEGTPRSFSARVLGMFWAGFAMIIVASYTA  664
            L +T+    +  +L    W  W VL  + +   +PR F++R +   WA FA++ +A YTA
Sbjct  697  LQNTNVTPYR-FSLFRTYWLVWAVLFQAAVHVDSPRGFTSRFMTNVWALFAVVFLAIYTA  755

Query  665  NLAAFLVLERPKTKLSGINDARLRNTMEN---LTCATVKGSSVDMYFRRQVELSNMYRTM  721
            NLAAF++      + SG+ND+RL +   +       T+  S  D    +   +  M+  M
Sbjct  756  NLAAFMITREEFHEFSGLNDSRLVHPFSHKPSFKFGTIPYSHTDSTIHKYFNV--MHNYM  813

Query  722  EANNYDTAEQAIQDVKKGKLMAFIWDSSRLEYEASK--DCELVTAGELFGRSGYGIGLQK  779
               N  +    +  V  G L +FI+D + L+Y  ++  DC L+T G  +  +GYG+   +
Sbjct  814  RQYNKTSVADGVAAVLNGNLDSFIYDGTVLDYLVAQDEDCRLMTVGSWYAMTGYGLAFSR  873

Query  780  GSPWTDAVTLAILEFHESGFMEALDKHWIFHGNAQQCELFEKTPNTLGLQNMAGVFILVA  839
             S +       +LEF  +G +E L ++W+  G  +  +   K+ + L L+     F+L+ 
Sbjct  874  NSKYVQMFNKRLLEFRANGDLERLRRYWM-TGTCRPGKQEHKSSDPLALEQFLSAFLLLM  932

Query  840  AGVAGGVGLIIVEVIYKKHQVKKQKRLD  867
            AG+     L+++E +Y K+  K+  + D
Sbjct  933  AGILLAALLLLLEHVYFKYIRKRLAKKD  960



Lambda      K        H
   0.312    0.129    0.370 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4811699998


Query= NP_001291905.1 superoxide dismutase [Bactrocera dorsalis]

Length=153
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SODC_DROME  unnamed protein product                                   253     5e-88
SODC1_DICDI  unnamed protein product                                  194     1e-64
SODC_CAEEL  unnamed protein product                                   183     8e-60


>SODC_DROME unnamed protein product
Length=153

 Score = 253 bits (647),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 123/152 (81%), Positives = 135/152 (89%), Gaps = 0/152 (0%)

Query  1    MPAKAVSVINGDVKGTVYFEQKDESSPVIVTGEVSGLSKGLHGFHVHEFGDNTNGCTSAG  60
            M  KAV VINGD KGTV+FEQ+   +PV V+GEV GL+KGLHGFHVHEFGDNTNGC S+G
Sbjct  1    MVVKAVCVINGDAKGTVFFEQESSGTPVKVSGEVCGLAKGLHGFHVHEFGDNTNGCMSSG  60

Query  61   PHFNPAGKEHGAPTDENRHLGDLGNIEASGDGPTKVNISDKLITLFGANSIVGRTVVVHA  120
            PHFNP GKEHGAP DENRHLGDLGNIEA+GD PTKVNI+D  ITLFGA+SI+GRTVVVHA
Sbjct  61   PHFNPYGKEHGAPVDENRHLGDLGNIEATGDCPTKVNITDSKITLFGADSIIGRTVVVHA  120

Query  121  DPDDLGKGGHELSKSTGNAGARLGCGVIGITK  152
            D DDLG+GGHELSKSTGNAGAR+GCGVIGI K
Sbjct  121  DADDLGQGGHELSKSTGNAGARIGCGVIGIAK  152


>SODC1_DICDI unnamed protein product
Length=153

 Score = 194 bits (494),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 119/153 (78%), Gaps = 1/153 (1%)

Query  1    MPAKAVSVINGD-VKGTVYFEQKDESSPVIVTGEVSGLSKGLHGFHVHEFGDNTNGCTSA  59
            M   AV VI G+ V G V F Q+++ SPV V  +++GL KG HGFHVH FGD TNGC SA
Sbjct  1    MSKTAVCVIKGEKVNGVVKFTQENKDSPVTVNYDITGLEKGEHGFHVHAFGDTTNGCVSA  60

Query  60   GPHFNPAGKEHGAPTDENRHLGDLGNIEASGDGPTKVNISDKLITLFGANSIVGRTVVVH  119
            GPHFNP GK HGAP+DE+RH+GDLGNI A G+  TK  ISDK+I+LFG ++IVGRT+VVH
Sbjct  61   GPHFNPFGKNHGAPSDEDRHVGDLGNIVADGESNTKGTISDKIISLFGEHTIVGRTMVVH  120

Query  120  ADPDDLGKGGHELSKSTGNAGARLGCGVIGITK  152
            AD DDLGKGG   S +TG AGARLGCGVIG+++
Sbjct  121  ADQDDLGKGGKPDSLTTGAAGARLGCGVIGVSQ  153


>SODC_CAEEL unnamed protein product
Length=180

 Score = 183 bits (464),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 114/154 (74%), Gaps = 4/154 (3%)

Query  1    MPAKAVSVINGD-VKGTVYFEQKDESSPVIVTGEVSGLSKGLHGFHVHEFGDNTNGCTSA  59
            M  +AV+V+ G+ V GT++  QK E+   ++ GE+ GL+ GLHGFHVH++GD+TNGC SA
Sbjct  23   MSNRAVAVLRGETVTGTIWITQKSENDQAVIEGEIKGLTPGLHGFHVHQYGDSTNGCISA  82

Query  60   GPHFNPAGKEHGAPTDENRHLGDLGNIEASGDGPTKVNISDKLITLFGANSIVGRTVVVH  119
            GPHFNP GK HG P  E RH+GDLGN+EA  DG  K+ ++D L+TL+G N++VGR++VVH
Sbjct  83   GPHFNPFGKTHGGPKSEIRHVGDLGNVEAGADGVAKIKLTDTLVTLYGPNTVVGRSMVVH  142

Query  120  ADPDDLGKG---GHELSKSTGNAGARLGCGVIGI  150
            A  DDLG+G     E SK TGNAGAR  CGVI +
Sbjct  143  AGQDDLGEGVGDKAEESKKTGNAGARAACGVIAL  176



Lambda      K        H
   0.312    0.129    0.370 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4811699998


Query= NP_001291906.1 trehalase [Bactrocera dorsalis]

Length=613
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TREA_DROME  unnamed protein product                                   776     0.0   
F5GUD3_CAEEL  unnamed protein product                                 429     2e-143
LAMC1_DROME  unnamed protein product                                  30.8    4.9   


>TREA_DROME unnamed protein product
Length=596

 Score = 776 bits (2005),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/588 (65%), Positives = 454/588 (77%), Gaps = 6/588 (1%)

Query  1    MFALKSVVSTRFMSLGALVILNLCVRVSFGH--TIPSNAIQKRLYEAVGP-ETCQIYCHG  57
            MF L ++ S   +S   LV L+     S     T  +NAI     EA  P  +C+IYC G
Sbjct  1    MFKLPTI-SLLLVSWSCLVALSQAKTYSLPDLTTDYNNAIPVDEEEAQDPFASCKIYCEG  59

Query  58   PLLHTVQMA--QLYQDSKTFVDMKLKNRPEKTMEEFNAFMLKYNDTPTEAEIRDFVDTHF  115
             LLHT+Q A  +L+ DSKTFVDMKL N P+KT+E+FNA M   N TP+  +++ FVD +F
Sbjct  60   NLLHTIQTAVPKLFADSKTFVDMKLNNSPDKTLEDFNAMMEAKNQTPSSEDLKQFVDKYF  119

Query  116  EERGKEFETWVPNDWKENPEFLNAINDPDLKQWGSDLNGIWKELGRKMIEDVHKNPEYYS  175
               G E E W P DWKENP FL+ I+DPDLKQWG +LN IWK+LGRKM ++V KNPEYYS
Sbjct  120  SAPGTELEKWTPTDWKENPSFLDLISDPDLKQWGVELNSIWKDLGRKMKDEVSKNPEYYS  179

Query  176  IIPVDNPVIVPGGRFIEFYYWDSYWIIRGLLYSEMYDTARGMIENFLSIVQRFGYIPNGG  235
            IIPV NPVIVPGGRFIEFYYWDSYWIIRGLLYS+M+DTARGMIENF SIV RFG+IPNGG
Sbjct  180  IIPVPNPVIVPGGRFIEFYYWDSYWIIRGLLYSQMFDTARGMIENFFSIVNRFGFIPNGG  239

Query  236  RVYYSGRSQPPFLTAMVKAYVDFKKDYSFALEALDTLEHEFEYWMNNHTVQAKGYDVAIY  295
            RVYY GRSQPP LT MVK+YVDF  D  FA++ALDTLEHEFE+++NNH V  K + + +Y
Sbjct  240  RVYYHGRSQPPLLTGMVKSYVDFTNDDKFAIDALDTLEHEFEFFVNNHNVTVKNHSLCVY  299

Query  296  TDASTGPRPESYREDIKTSEDFRTDEDKEQIYTELKAGAESGMDFSSRWFVDENGTNDGG  355
             D+S+GPRPESYRED++T E+F TDE KE  Y+ELKAGAESGMDFSSRWF+   GTNDG 
Sbjct  300  RDSSSGPRPESYREDVETGEEFPTDEAKELHYSELKAGAESGMDFSSRWFISPTGTNDGN  359

Query  356  LKNLKTRSIVPVDLNALLYMNAKIIAEFHDKAGNTAKSAEYEAKAARILEAIQAVHWNEE  415
               L T SIVPVDLNA LY NAK+IAEFH KAGNT K  EYE KA ++L  IQ V WNEE
Sbjct  360  RSALSTTSIVPVDLNAYLYWNAKLIAEFHSKAGNTKKVTEYETKAEKLLLGIQEVLWNEE  419

Query  416  AGVWLDYDMINQKPRNYFVPTNLSPLYTGAFNKSDSERISASVLKYIDDLKLDSYPGGVP  475
            AGVWLDYDMINQKPR+Y+ PTNLSPL+  AFN S+SE+ISASV+ YI+  KLDS+PGGVP
Sbjct  420  AGVWLDYDMINQKPRDYYTPTNLSPLWVKAFNISESEKISASVMAYIERNKLDSFPGGVP  479

Query  476  NTLAHTGEQWDFPNVWPPMQYILIRGLENLGTPEAKKLSERWGHRWVKSNFEAYKQTQTM  535
            NTL++TGEQWD PNVW PMQYIL+ GL NL TPEAK +S +W  RWVK+NF A+ + + M
Sbjct  480  NTLSYTGEQWDAPNVWAPMQYILVEGLNNLNTPEAKNMSLKWATRWVKTNFAAFSKDRHM  539

Query  536  FEKYDALRFGGHGGGGEYDVQKGFGWSNGVIIEFLTKYGGDLSLSNSA  583
            +EKY+A  FG  GGGGEY+VQ GFGWSNGVIIE+L+K+G D+S+ +  
Sbjct  540  YEKYNADEFGVGGGGGEYEVQTGFGWSNGVIIEWLSKHGRDISIGSGC  587


>F5GUD3_CAEEL unnamed protein product
Length=608

 Score = 429 bits (1103),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 224/572 (39%), Positives = 325/572 (57%), Gaps = 19/572 (3%)

Query  35   SNAIQKRLYEAVGPETCQIYCHGPLLHTVQMAQLYQDSKTFVDMKLKNRPEKTMEEFNAF  94
            SN ++  + +        IYC+GP+L  V    LY DSK FVDM LK+ P+     +NA+
Sbjct  21   SNQVEVHVCDTTNSNNSFIYCNGPILDAVNYHSLYNDSKEFVDMPLKDDPQIV---YNAW  77

Query  95   MLKYNDTPT----EAEIRDFVDTHFEERGKEFETWVPNDWKENPEFLNAINDPDLKQWGS  150
              KY +  +    +++++ FV+ +F   G E     P+DW+E P  L  I DP L++W  
Sbjct  78   RAKYGNQSSANLNKSDVQAFVNQYFSAAGTELVVCTPDDWQEKPPKLATIADPKLREWAY  137

Query  151  DLNGIWKELGRKMIEDVHKNPEYYSIIPVDNPVIVPGGRFIEFYYWDSYWIIRGLLYSEM  210
             LNGIWK+L RK+   + ++   YS++ V N  IVPGGRF EFYYWD+YWII+GL+ S+M
Sbjct  138  KLNGIWKQLCRKIDPAIEQHTSRYSLLYVPNSFIVPGGRFREFYYWDAYWIIKGLIASDM  197

Query  211  YDTARGMIENFLSIVQRFGYIPNGGRVYYSGRSQPPFLTAMVKAYVDFKKDYSFALEALD  270
            Y+T R MI N  S+V ++G++PNGGRVYY  RSQPPFL AMV    +   D +F  E L 
Sbjct  198  YNTTRSMIRNLASMVDKYGFVPNGGRVYYLQRSQPPFLAAMVYELYEATNDKAFVAELLP  257

Query  271  TLEHEFEYW----MNNHTVQAKGYDVAIYTDASTGPRPESYREDIKTSEDFRTDEDKEQI  326
            TL  E  +W    M +  +  K + V  Y  AS  PRPESYR D + S       D++Q 
Sbjct  258  TLLKELNFWNEKRMTDVQMNGKSFKVYQYKTASNVPRPESYRVDTQNSAKLANGADQQQF  317

Query  327  YTELKAGAESGMDFSSRWFVDENGTNDGGLKNLKTRSIVPVDLNALLYMNAKIIAEFHDK  386
            Y +L + AESG DFS+RWF D        L +++T  ++PVDLN LL  N  I+   +++
Sbjct  318  YQDLASAAESGWDFSTRWFSDYK-----TLTSIETTKVLPVDLNGLLCWNMDIMEYLYEQ  372

Query  387  AGNTAKSAEYEAKAARILEAIQAVHWNEEAGVWLDYDMINQKPRNYFVPTNLSPLYTGAF  446
             G+T  S  +  K A   + +Q V +N   G W DY++  Q     F  +   PL+T  +
Sbjct  373  IGDTKNSQIFRNKRADFRDTVQNVFYNRTDGTWYDYNLRTQSHNPRFYTSTAVPLFTNCY  432

Query  447  NKSDSERISASVLKYIDDLKLDSYPGGVPNTLAH-TGEQWDFPNVWPPMQYILIRGLENL  505
            N  ++ + S  V  Y+D + + +YPGG+P +++  + +QWDFPN W P  +++I GL   
Sbjct  433  NTLNTGK-SQKVFDYMDKMGVFTYPGGIPTSMSQESDQQWDFPNGWSPNNHMIIEGLRKS  491

Query  506  GTPEAKKLSERWGHRWVKSNFEAYKQTQTMFEKYDAL-RFGGHGGGGEYDVQKGFGWSNG  564
              PE +        +WV  NF  + +T  M+EKY+ +  +   G GGEYDVQ GFGWSNG
Sbjct  492  ANPEMQDKGFLIASKWVMGNFRVFYETGHMWEKYNVIGSYPQPGSGGEYDVQDGFGWSNG  551

Query  565  VIIEFLTKYGGDLSLSNSAVSTVSKNTVFSLT  596
             I++ L  Y   L +  + V+T    +V S T
Sbjct  552  AILDLLLTYNDRLFVPENFVNTTVTPSVESTT  583


>LAMC1_DROME unnamed protein product
Length=1639

 Score = 30.8 bits (68),  Expect = 4.9, Method: Compositional matrix adjust.
 Identities = 23/70 (33%), Positives = 30/70 (43%), Gaps = 6/70 (9%)

Query  83   RPEKTMEEF--NAFMLKYNDTPTEAEIRD--FVDTHFEERGKEFETWVPNDWKENPEFLN  138
            RP+K + EF   A+ L+   T T  E  D  F      +  K  E    ND   NP FL 
Sbjct  63   RPQKCLPEFINAAYQLQIESTNTCGEQNDNHFCIQTMNQNHKNCEFCKYND--HNPSFLT  120

Query  139  AINDPDLKQW  148
             ++DP    W
Sbjct  121  DLHDPQSPTW  130



Lambda      K        H
   0.312    0.129    0.370 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4811699998


Query= NP_001291907.1 dnaJ homolog subfamily C member 8 [Bactrocera
dorsalis]

Length=252
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DNJC5_DROME  unnamed protein product                                  45.1    2e-05
Q7KQK3_PLAF7  unnamed protein product                                 45.1    2e-05
Q9VS57_DROME  unnamed protein product                                 44.3    6e-05


>DNJC5_DROME unnamed protein product
Length=249

 Score = 45.1 bits (105),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 37/65 (57%), Gaps = 2/65 (3%)

Query  54   FEVLQIEPGATVEEIKKRYRTLSILVHPDKIQDNKDRAQTAFDIVNRAWKTLENDVTRKK  113
            +E+L +   AT ++IKK YR L++  HPDK  DN D A   F  VNRA   L N  T++ 
Sbjct  19   YEILGLPKTATGDDIKKTYRKLALKYHPDKNPDNVDAADK-FKEVNRAHSILSNQ-TKRN  76

Query  114  CLDVY  118
              D Y
Sbjct  77   IYDNY  81


>Q7KQK3_PLAF7 unnamed protein product
Length=244

 Score = 45.1 bits (105),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 40/68 (59%), Gaps = 1/68 (1%)

Query  51   LNPFEVLQIEPGATVEEIKKRYRTLSILVHPDKIQDNKDRAQTAFDIVNRAWKTLENDVT  110
            +N +EVL +   A +  IKK YRTL++  HPDK  +NK  A   F  ++ A++ L  D  
Sbjct  5    VNYYEVLGVPQDADLTVIKKSYRTLAMKWHPDKNPNNKAEATERFKQISEAYEVLS-DPK  63

Query  111  RKKCLDVY  118
            R++  D+Y
Sbjct  64   RRRKYDLY  71


>Q9VS57_DROME unnamed protein product
Length=753

 Score = 44.3 bits (103),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 41/62 (66%), Gaps = 4/62 (6%)

Query  50   NLNPFEVLQIEPGATVEEIKKRYRTLSILVHPDKIQDNKDRAQTAFDIVNRAWKTLENDV  109
            + +PFE+L + P ++  EIKK Y  LS ++HPDK  +  D  + +F ++++A++ L +DV
Sbjct  103  SFDPFEILNVPPTSSQAEIKKAYYRLSKVLHPDK--ETGD--EKSFMMLSKAYQALTDDV  158

Query  110  TR  111
             +
Sbjct  159  AK  160



Lambda      K        H
   0.312    0.129    0.370 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4811699998


Query= NP_001291909.1 ribonuclease Z, mitochondrial [Bactrocera dorsalis]

Length=852
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RNZ_DROME  unnamed protein product                                    890     0.0  
RNZ_CAEEL  unnamed protein product                                    224     1e-61
Q553S7_DICDI  unnamed protein product                                 32.0    3.0  


>RNZ_DROME unnamed protein product
Length=766

 Score = 890 bits (2301),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/780 (57%), Positives = 563/780 (72%), Gaps = 38/780 (5%)

Query  70   NSVLSKVTVSTRQPKPAPPQLRREKQLQAAKKKTTPYIPGIVNLQVLGAGANGSPSAIYL  129
            +++++    S + P   P   R E++    +KK    +PG VNLQVLG+GANG+P+A+YL
Sbjct  21   SNLMAATIASAKDPLTGP---RYEREPNVLRKKLASVVPGTVNLQVLGSGANGAPAAVYL  77

Query  130  FTDQARYLFNCGEGTQRLAHEHKTKLARLEHIFVTRNTWPVVGGFPGLALTVQDAGVKEM  189
            FTDQARYLFNCGEGTQRLAHEHKT+L+RLE IF+T+NTW   GG PGL LT+QDAGV+++
Sbjct  78   FTDQARYLFNCGEGTQRLAHEHKTRLSRLEQIFLTQNTWASCGGLPGLTLTIQDAGVRDI  137

Query  190  ALHGPPHLDSILHSMKRFVVLKTLKVNTCDCTQSTDFEDAVMSVKSVPLYKQPLVTTSNA  249
             LHGPPHL S+L SM+RFVVLK L+V   DC++   FED+++ V S+PL      T S  
Sbjct  138  GLHGPPHLGSMLQSMRRFVVLKNLQVRPNDCSEGACFEDSILKVDSLPLINSEDPTKS--  195

Query  250  TQMIDANNQMVVAYVCKLKPRPGALNLVKCVKRGVPPGPLLGQLKNGFDVTLPDGTVVHS  309
                      V+ Y+C+LKPR GALNLVKCV++GVPPGPLLGQLKNG D+TLPDG VV S
Sbjct  196  ----------VINYICQLKPRAGALNLVKCVEQGVPPGPLLGQLKNGNDITLPDGKVVRS  245

Query  310  KDVSEPSETALSFVFLDIPTAEYLPALQAQADVFRNLQQDMENEVALVVHFTPAEILENN  369
             DV+E SETALSFVFLD+P+  YLPAL       + L ++   EVALVVHFTP  I    
Sbjct  246  VDVTEASETALSFVFLDVPSENYLPALLTHGKRLKKLGEEKLTEVALVVHFTPYHISSRQ  305

Query  370  CYRDF-MENFTPRTQHLYLNSPHNNFSGYVAAHRIQYQLNQLNTRTFPLLTEAKDACSSL  428
             Y+DF +E+F+   QH+YL+SP N FSGY AAHRIQ+QL+QL  + FPLL E + +C S 
Sbjct  306  VYKDFVVESFSSEAQHIYLSSPLNQFSGYAAAHRIQHQLHQLAPQVFPLLGE-QLSCQSQ  364

Query  429  HISNKLKRTKLGETEKVTEGTQKAVGDANETQLTNINSLTNFHLRPRKGLDRSAEAQLNP  488
             +S  LK+TKL E     +   KA   ANET+   + ++TN+HLRPRKGLDR+ E++L P
Sbjct  365  TLSLNLKKTKLDE----ADSEDKANAKANETEEQGVVAMTNYHLRPRKGLDRTLESKLTP  420

Query  489  SEYISETQALADFPTLLSKLKDIQQTLPAPNCTAEYPKITFLGTGSCIPNKTRNVSAIMI  548
             EY+ ET A+  F  LL+K K+ + + P  N    YPKI FLGTGSCIPNKTRNVS+I+I
Sbjct  421  EEYVKETHAVPGFLELLAKFKE-EYSFP-DNSADSYPKIIFLGTGSCIPNKTRNVSSILI  478

Query  549  QPAENSFMLLDCGEGTLGQIVRFYGKTRAESVVRNLKAIYISHLHADHHIGLIGLLNERQ  608
            + A ++++LLDCGEGT GQIVR YG  + + ++R L+AIY+SHLHADHHIGLIGLL ER+
Sbjct  479  RTAIDAYVLLDCGEGTYGQIVRLYGHEKGQLILRQLQAIYVSHLHADHHIGLIGLLRERR  538

Query  609  RLLQEADVPQAEQKVLLFAPIQIQPWLNFYNERIENIAQTYTLIGNAEMLEQPMLLHETR  668
            +L   AD       ++L AP QI+PWL FYN +IE +   YTL+GN E+L  P L  E  
Sbjct  539  QLKPRAD------PLILLAPRQIEPWLEFYNRQIETVEDAYTLVGNGELLASP-LSGEQV  591

Query  669  ADLAIDAIGTCLVRHCPHSFGVCLQLPAPIAGDAPITITYSGDSMPCRDLVELGRNSTVL  728
              L I +I TCLVRHCP+SFG+ L L A      P+ ITYSGD+MPC+DL++LGR+STVL
Sbjct  592  ERLGITSISTCLVRHCPNSFGISLTLAAK-HNSEPVKITYSGDTMPCQDLIDLGRDSTVL  650

Query  729  IHEATMEDDLIEEAKVKMHSTISQAIAQGREMQARHIILTHFSQRYAKLPRMQQLVGGDE  788
            IHEATMEDDL EEA++K HST+SQAI QGR M ARH ILTHFSQRYAK PR+      DE
Sbjct  651  IHEATMEDDLEEEARLKTHSTVSQAIQQGRNMNARHTILTHFSQRYAKCPRLP----SDE  706

Query  789  AQPQLNNVSIAFDNMQVTLGDLEQFHYMYPALHALFAEHAEELEQKALKREMKLERKRRL  848
                +  V+IAFDNM+VT+ DL+ +H +YPAL A++AE+ EELEQ+A+KRE+K ERKR+L
Sbjct  707  ---DMQRVAIAFDNMEVTIEDLQHYHKLYPALFAMYAEYTEELEQRAVKRELKQERKRKL  763


>RNZ_CAEEL unnamed protein product
Length=833

 Score = 224 bits (571),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 200/794 (25%), Positives = 347/794 (44%), Gaps = 104/794 (13%)

Query  107  IPGIVNLQVLGAGANGSPSAIYLFTDQARYLFNCGEGTQRLAHEHKTKLARLEHIFVTRN  166
            IP  V+++VLG G     +   L T    Y+FNC E   R   + + + + +  +F+T  
Sbjct  95   IPSQVSIEVLGNGTGLLRACFILRTPLKTYMFNCPENACRFLWQLRIRSSSVVDLFITSA  154

Query  167  TWPVVGGFPGLALTVQDAGVKEMALHGPPHLDSILHSMKRFVVLKTLKVNTCDCTQSTD-  225
             W  + G   + L+ +++      LHG  ++   L  ++ F   +     +C      + 
Sbjct  155  NWDNIAGISSILLS-KESNALSTRLHGAMNIKHFLECIRPF---QDSDYGSCKYPSQVEE  210

Query  226  -------FEDAVMSVKSVPLYKQPLVTTSNATQMIDAN-NQMVVAYVCKLKPRPGALNLV  277
                   +EDA + V  +PL   PL   SN  +  +   N + +A++ ++K     ++ +
Sbjct  211  RPYTMENYEDAGLKVTYIPL-SPPLNIGSNNEKSKNVKVNNVDIAFLIEMKEAARRIDTM  269

Query  278  KCVKRGVPPGPLLGQLKNGFDVTLPDGTVVHSKDV--SEPSETALSFVFL-DIPTAEYLP  334
            K ++  VP GPL+G+LK+G  VTLPDG  +    V  S+  E     + + +  T +++ 
Sbjct  270  KLMELKVPKGPLIGKLKSGEAVTLPDGRTIQPDQVFSSDKVEGDKPLLLVTECTTEDHVK  329

Query  335  ALQAQADVFRNLQQDMENEVALVVHFTPAEILENNCYRDFMENFT-PRTQHLYLNSPHNN  393
            AL   + +   L  + E ++  +VH +   ++    YR  ME    P   HL +N  +  
Sbjct  330  ALIDSSSLQPFL--NGEKQLDYMVHISDDAVINTPTYRHLMEKLNNPSITHLLINGGNPV  387

Query  394  FSGYVAAHRIQYQLNQLNTRTFPLLTEAKDACSSLHISNKLKRTKLGETEKVTEGTQKAV  453
                 + ++    L  +    FP L     +               G   +  E +Q+  
Sbjct  388  IPAVESVYKHTRLLRSIAPSLFPALHPIDWS---------------GIITQNEELSQR--  430

Query  454  GDANETQLTNINSLTNFHLRPRKGLDRSAEAQLNPSEYISETQALADFPTLLSKLKDI--  511
                + Q   +  +  + +R  +G   + E  +N          LA  P L  K K++  
Sbjct  431  ----QDQFIRVAPMQRYWMR--RGASFNEEPIVN--------NLLAAEPELSDKAKELIK  476

Query  512  -QQTLPAPN-CTAEYPKITFLGTGSCIPNKTRNVSAIMIQPAENSFMLLDCGEGTLGQIV  569
              Q L   N    E+PK+TF GT S +P+K RNV+  +++ +ENS +L+D GEGT GQ+ 
Sbjct  477  EYQKLEKENKMDCEFPKLTFFGTSSAVPSKYRNVTGYLVEASENSAILIDVGEGTYGQMR  536

Query  570  RFYGKTRAESVVRNLKAIYISHLHADHHIGLIGLLNERQRLLQEADVPQAEQKVLLFAPI  629
              +G+   + ++ NL  + I+H H DH  GL  ++  R+   +    P   + ++L    
Sbjct  537  AVFGEDGCKQLLVNLNCVLITHAHQDHMNGLYTIIARRKEAFESLGAPY--RPLVLVCNR  594

Query  630  QIQPWLNFYNERIENIAQTYTLIGNAEM----------------------------LEQP  661
             +   +  Y+   ENI     ++  +                              + Q 
Sbjct  595  NVLKPMKTYSICFENIEHLLEIVDISRYPLTPPGSPGGPPGKRPRLPSPHLPPSRDVLQD  654

Query  662  MLLHETRADLAIDAIGTCLVRHCPHSFGVCLQLPAPIAGDAPITITYSGDSMPCRDLVEL  721
            M     +    +D +    V H   + G  ++    +AG     I +SGD+ PC  LVE 
Sbjct  655  MSSSFDKKAWKLDELKAVQVHHTRMANGFVMR----VAGK---RIVFSGDTKPCDLLVEE  707

Query  722  GRNSTVLIHEATMEDDLIEEAKVKMHSTISQAIAQGREMQARHIILTHFSQRYAKLPRMQ  781
            G+++ VL+HE+T ED    +A  K HST+ QA+  G+ M A+HIILTHFS RY K+P + 
Sbjct  708  GKDADVLVHESTFEDGHEADAMRKRHSTMGQAVDVGKRMNAKHIILTHFSARYPKVPVLP  767

Query  782  QLVGGDEAQPQLNNVSIAFDNMQVTLGDLEQFHYMYPALHALFAEHAEEL----EQKALK  837
            + +  +       N+ +A D ++V    L     + P    +F     EL    EQ+ LK
Sbjct  768  EYLDKE-------NIGVAMDMLRVRFDHLPLVSKLLPIFREVFVAELFELTIKKEQRVLK  820

Query  838  REMKLERKRRLLNA  851
             + +L  KR  L A
Sbjct  821  -DKELSEKRGQLKA  833


>Q553S7_DICDI unnamed protein product
Length=714

 Score = 32.0 bits (71),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 25/112 (22%), Positives = 49/112 (44%), Gaps = 9/112 (8%)

Query  15   KTLQFTQVNTFLHMESPIAPSTTVTQLGE-----TQADMVQQKNTD----DYKIENKCAS  65
            K+  F ++NT L +E PI    T   L E        + ++ K +D     + +E++  +
Sbjct  311  KSFYFLEMNTRLQVEHPITEEITKQDLVEHMIRIAYGEKLKIKQSDIKIHGWAMESRVYA  370

Query  66   KDALNSVLSKVTVSTRQPKPAPPQLRREKQLQAAKKKTTPYIPGIVNLQVLG  117
            +D   + L  +    +  +P+ P +R +  +    + +T Y P I  L   G
Sbjct  371  EDPYRNFLPSIGRVKKYIRPSGPGIRIDGGIFEGAEISTYYDPLISKLITYG  422



Lambda      K        H
   0.312    0.129    0.370 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4811699998


Query= NP_001291910.1 ras-related protein Rab-7a [Bactrocera dorsalis]

Length=208
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O76742_DROME  unnamed protein product                                 383     2e-137
Q23146_CAEEL  unnamed protein product                                 306     5e-107
RAB7A_DICDI  unnamed protein product                                  298     8e-104


>O76742_DROME unnamed protein product
Length=207

 Score = 383 bits (983),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 180/208 (87%), Positives = 195/208 (94%), Gaps = 1/208 (0%)

Query  1    MATRKKSLLKVIILGDSSVGKTSLMNQYINKRFSNQYKATIGADFCTKEVIADDRVVTMQ  60
            M+ RKKSLLKVIILGDSSVGKTSLMNQY+NKRFSNQYKATIGADFCTKEV+ +DRVVTMQ
Sbjct  1    MSGRKKSLLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQ  60

Query  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVTSPNSFKNLDSWRDEFLIQASPRDPDHFPF  120
            IWDTAGQERFQSLGVAFYRGADCCVLVYDVT+PNSFKNLDSWRDEFLIQASPRDPDHFPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPF  120

Query  121  VVLGNKVDMDNRQVSTRRAQQWCQSKNDMPYFETSAKDGTNVELAFQTIARNALAQEAEV  180
            VVLGNKVD+DNRQVSTRRAQQWCQSKND+PY+ETSAK+G NVE+AFQ IA+NAL  EAE 
Sbjct  121  VVLGNKVDLDNRQVSTRRAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALELEAEA  180

Query  181  ELYNEFPDQIRLNTDRNNRNGNSDNCQC  208
            E+ N+FPDQI L + +NNR GN DNCQC
Sbjct  181  EVINDFPDQITLGS-QNNRPGNPDNCQC  207


>Q23146_CAEEL unnamed protein product
Length=209

 Score = 306 bits (783),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 149/207 (72%), Positives = 177/207 (86%), Gaps = 2/207 (1%)

Query  2    ATRKKSLLKVIILGDSSVGKTSLMNQYINKRFSNQYKATIGADFCTKEVIADDRVVTMQI  61
             TRKK+LLKVIILGDS VGKTSLMNQY+N+RFSNQYKATIGADF T++V  DDR VT+QI
Sbjct  3    GTRKKALLKVIILGDSGVGKTSLMNQYVNRRFSNQYKATIGADFLTRDVNIDDRTVTLQI  62

Query  62   WDTAGQERFQSLGVAFYRGADCCVLVYDVTSPNSFKNLDSWRDEFLIQASPRDPDHFPFV  121
            WDTAGQERFQSLGVAFYRGADCCVL +DVT+  SFK+LDSWRDEFLIQASPRDPDHFPFV
Sbjct  63   WDTAGQERFQSLGVAFYRGADCCVLAFDVTNAASFKSLDSWRDEFLIQASPRDPDHFPFV  122

Query  122  VLGNKVDMDN-RQVSTRRAQQWCQSKNDMPYFETSAKDGTNVELAFQTIARNALAQEA-E  179
            +LGNKVD+++ R VS++RAQ WCQ+K ++PY+E SAK+  NVE AF  IAR+ALA+E+ E
Sbjct  123  LLGNKVDLESQRAVSSKRAQSWCQTKGNIPYYEVSAKEALNVEAAFLAIARDALARESQE  182

Query  180  VELYNEFPDQIRLNTDRNNRNGNSDNC  206
               + EFPDQIRLN ++ N+  +  NC
Sbjct  183  TNDFPEFPDQIRLNPNQQNQQNSGCNC  209


>RAB7A_DICDI unnamed protein product
Length=203

 Score = 298 bits (762),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 141/178 (79%), Positives = 157/178 (88%), Gaps = 1/178 (1%)

Query  1    MATRKKSLLKVIILGDSSVGKTSLMNQYINKRFSNQYKATIGADFCTKEVIADDRVVTMQ  60
            MAT+KK LLKVIILGDS VGKTSLMNQY+NK+FSNQYKATIGADF TKE++ DDRVVTMQ
Sbjct  1    MATKKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKELMVDDRVVTMQ  60

Query  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVTSPNSFKNLDSWRDEFLIQASPRDPDHFPF  120
            IWDTAGQERFQSLGVAFYRGADCCVL YDV    +F+NLDSWRDEFLIQA PRDPD+FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLCYDVNVAKTFENLDSWRDEFLIQAGPRDPDNFPF  120

Query  121  VVLGNKVDMDN-RQVSTRRAQQWCQSKNDMPYFETSAKDGTNVELAFQTIARNALAQE  177
            VVLGNK+D++N R VS +RA  WCQSK ++PYFETSAK+  NVE AFQTIARNA+  E
Sbjct  121  VVLGNKIDLENQRVVSQKRAASWCQSKGNIPYFETSAKEAINVEQAFQTIARNAIKLE  178



Lambda      K        H
   0.312    0.129    0.370 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4811699998


Query= NP_001291911.1 head-specific guanylate cyclase [Bactrocera dorsalis]

Length=676
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GCYH_DROME  unnamed protein product                                   1129    0.0  
GCY8E_DROME  unnamed protein product                                  232     9e-65
GCY35_CAEEL  unnamed protein product                                  221     8e-63


>GCYH_DROME unnamed protein product
Length=676

 Score = 1129 bits (2921),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 554/675 (82%), Positives = 607/675 (90%), Gaps = 3/675 (0%)

Query  1    MACPFFRRSDSLARQPSVCAETSNNTWQLEDEEQPGDALTLTHLQMAIQLLTAPSNSDLN  60
            MACPFFRR+DSL RQPSV AE   + W LEDEE   DALTLTHLQMAIQLLTAPSN DLN
Sbjct  1    MACPFFRRADSLTRQPSVIAEPGGH-WALEDEELSDDALTLTHLQMAIQLLTAPSNEDLN  59

Query  61   TAVTSLIAKYSQSWPKISKLRIDLDTLKSVPNYDYLADIQDILLEMDESSASEILVLLGE  120
            TAVTSL+AKY Q+WP I KL++D  T KS  NYDYLADIQ++LL+MDE+SASEILVLLGE
Sbjct  60   TAVTSLVAKYRQNWPNIHKLKLDPQTFKSCANYDYLADIQELLLKMDEASASEILVLLGE  119

Query  121  ELITSCCTGIIERAFRCLGTDLQEFLGSLDGVYDVLKLQEEDVTDTGFVCAGDGELIFAS  180
            ELIT CCTGIIERAFRCLGTDLQEFLGSLDGVYDVLKLQEEDVTDTGFVCAG+GELIF S
Sbjct  120  ELITCCCTGIIERAFRCLGTDLQEFLGSLDGVYDVLKLQEEDVTDTGFVCAGEGELIFTS  179

Query  181  ERPVIAWLLLGSLKALTRMLYNVQVNIKIEPVEGDSRRYRYLFSLVKEYTGSTVPLQRSS  240
            ERPVIAWLLLGSLKALTRMLY V VNIKIEPVEGD+RRYRYLFSLVK+ + + +  + +S
Sbjct  180  ERPVIAWLLLGSLKALTRMLYKVDVNIKIEPVEGDARRYRYLFSLVKDNSQTMLMGRPTS  239

Query  241  VEMVKPTVLPAQRNNSSKAADLAMNSHTFCKAFPWHFIMNEKLELLQMGRGFSKLYKPHI  300
            V    P  +  QR+NSS A+DL MNS +FCK FPWHFIMNE+LEL+Q+GRGFSKLYKP++
Sbjct  240  VSKTIPETV--QRSNSSNASDLQMNSSSFCKMFPWHFIMNEQLELVQLGRGFSKLYKPYM  297

Query  301  AEHGCQATTYFDFKRPKGLTMKFRDIARRTYTPFLIALKSPPNISEFPAKGLEIKGQMVH  360
            A+ GCQATTYFDFKRPKGLTMKFRDI RRTYTPFLI L +PP   +FPA GLEIKGQMVH
Sbjct  298  ADFGCQATTYFDFKRPKGLTMKFRDIVRRTYTPFLIGLNNPPGAVDFPAIGLEIKGQMVH  357

Query  361  CPESNSLLFMGSPFLDGLDGLTCNGLFISDIPLHDATREVILVGEQARAQDGLRRRMDKL  420
            CPESNSLLF+GSPFLDGLDGLTCNGLFISDIPLHDATREVILVGEQARAQDGLRRRMDK+
Sbjct  358  CPESNSLLFIGSPFLDGLDGLTCNGLFISDIPLHDATREVILVGEQARAQDGLRRRMDKI  417

Query  421  KSSIEEANAAVAKERKKNVSLLHLIFPAEIAERLWLGASIDAKTYPDVTILFSDIVGFTS  480
            K+SIEEAN+AV KERKKNVSLLHLIFPAEIAE+LWLG+SIDAKTYPDVTILFSDIVGFTS
Sbjct  418  KNSIEEANSAVTKERKKNVSLLHLIFPAEIAEKLWLGSSIDAKTYPDVTILFSDIVGFTS  477

Query  481  ICSRATPFMVISMLESLYKDFDEFCDLFDVYKVETIGDAYCVASGLHRASIYDAHKVAWM  540
            ICSRATPFMVISMLE LYKDFDEFCD FDVYKVETIGDAYCVASGLHRASIYDAHKVAWM
Sbjct  478  ICSRATPFMVISMLEGLYKDFDEFCDFFDVYKVETIGDAYCVASGLHRASIYDAHKVAWM  537

Query  541  ALKMIVACAKHITHDDQEIQMRIGLHTGTVLAGVVGRKMPRYCLFGHNVTIANKFESGSE  600
            ALKMI AC+KHITHD ++I+MRIGLHTGTVLAGVVGRKMPRYCLFGH+VTIANKFESGSE
Sbjct  538  ALKMIDACSKHITHDGEQIKMRIGLHTGTVLAGVVGRKMPRYCLFGHSVTIANKFESGSE  597

Query  601  ACKINVSPTTKDWLVKYPGFEFDLKARDPSCLPKEFPDTSGDKTCYFLEGYRHPTLSAHS  660
            A KINVSPTTKDWL K+ GFEF+L+ RDPS LPKEFP+  G +TCYFLE +R+P L +  
Sbjct  598  ALKINVSPTTKDWLTKHEGFEFELQPRDPSFLPKEFPNPGGTETCYFLESFRNPALDSEL  657

Query  661  PLVEHISEALKSISE  675
            PLVEHI+ ++K+ISE
Sbjct  658  PLVEHINVSMKTISE  672


>GCY8E_DROME unnamed protein product
Length=1097

 Score = 232 bits (591),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 155/507 (31%), Positives = 257/507 (51%), Gaps = 52/507 (10%)

Query  132  ERAFRCLGTDLQEFLGSLDGVYDVLKLQEEDVTDTGFVCAGDGE----LIFASERPVIAW  187
            +R    LG  +++FL  LD +++ LK     +    F+C  + +    L + S+R    +
Sbjct  83   DRVLSVLGRHMRDFLNGLDNLHEYLKFSYPRMRAPSFICENETKQGLTLHYRSKRRGFVY  142

Query  188  LLLGSLKALTRMLYNVQVNIKIEPVEGDSRRYRYLFSLVK---EYTGSTVPLQRSSVEMV  244
              +G ++ + R  Y+ +++I++        R   LF  V    + T        +S+ M 
Sbjct  143  YTMGQIREVARYFYHKEMHIELV-------REEILFDTVHVTFQLTFDNRAFTLASLAMT  195

Query  245  KPTVLPAQRNNSSKAADLAMNSHTFCKAFPWHFIMNEKLELLQMGRGFSKLYKPHIAEHG  304
            +            +   L +++H   + FP+  +    + +  +G     +  P +   G
Sbjct  196  R------------EEKHLPISAHVLFEIFPFCMVFGADMVVRSIGNSLMVIL-PELL--G  240

Query  305  CQATTYFDFKRPKGLTMKFRDIARRTYTPFLIALKSPPNISEF----------------P  348
             + T +FD  RP  +  KF+ I  RT   F +    P  ++E                 P
Sbjct  241  KKITAWFDLVRPL-IAFKFQTILNRTNNIFELVTVDP--VTERFDVQNEDLLQHEDGSEP  297

Query  349  AKGLEIKGQMVHCPESNSLLFMGSPFLDGLDGLTCNGLFISDIPLHDATREVILVGEQAR  408
             K L +KGQMV+      ++F+G+P +  L  L   GL+I+D+ +HD +R+++L G Q  
Sbjct  298  EKSLRLKGQMVYMENWRMIMFLGTPVMPDLTSLITTGLYINDLSMHDFSRDLMLAGTQQS  357

Query  409  AQDGLRRRMDKLKSS-IEEANAAVAKERKKNVSLLHLIFPAEIAERLWLGAS-IDA-KTY  465
             +  L    ++ KS  +EE+   + +E ++   LL+ + P ++A+RL  G + ID  + +
Sbjct  358  VELKLALDQEQQKSKKLEESMRLLDEEMRRTDELLYQMIPKQVADRLRRGENPIDTCEMF  417

Query  466  PDVTILFSDIVGFTSICSRATPFMVISMLESLYKDFDEFCDLFDVYKVETIGDAYCVASG  525
              V+ILFSDIV FT ICSR TP  V+SML ++Y  FD+  +   VYKVETIGDAY V +G
Sbjct  418  DSVSILFSDIVTFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVYKVETIGDAYMVVAG  477

Query  526  LHRASIYDAHKVAWMALKMIVACAK-HITHDDQEIQMRIGLHTGTVLAGVVGRKMPRYCL  584
                    A +V  MAL M+ A          Q +++R+G+H+G V+AG+VG KMPRYCL
Sbjct  478  APDKDANHAERVCDMALDMVDAITDLKDPSTGQHLRIRVGVHSGAVVAGIVGLKMPRYCL  537

Query  585  FGHNVTIANKFESGSEACKINVSPTTK  611
            FG  V  A++ ES S A K+++S +TK
Sbjct  538  FGDTVNTASRMESTSIAMKVHISESTK  564


>GCY35_CAEEL unnamed protein product
Length=688

 Score = 221 bits (564),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 155/506 (31%), Positives = 258/506 (51%), Gaps = 31/506 (6%)

Query  135  FRCLGTDLQEFLGSLDGVYDVLK--LQEEDVTDTGFVC--AGDGELI--FASERPVIAWL  188
             R +  DL+ FL SLD ++  +   + +  +    F C    DG L+  + S+R  +  +
Sbjct  87   LRAMAPDLEGFLDSLDSLHYFIDHVVYKTKLRGPSFRCDVQADGTLLLHYYSKRSGLYPI  146

Query  189  LLGSLKALTRMLYNVQVNIKIEPVEGDSRRYRYLFSLVKEYTGSTVPLQRSSVEMVKPTV  248
            + G ++ + R +Y+ +V +K++      R+  +L + V E+    V    + +E    T 
Sbjct  147  VKGVVREVARRIYDTEVVMKVQ-----ERKQEHLDAFVTEH----VVFVITQIENANSTQ  197

Query  249  LPAQRNNSSKAADLA-----MNSHTFCKAFPWHFIMNEKLELLQMGRGFSKLYKPHIAEH  303
              +  + +    DL+     ++S  F  AFP+H   +  L +   G    K + P+    
Sbjct  198  PKSISSKADSQIDLSTGIYEISSSDFSLAFPYHICFDPDLFVEHFGNFIKKTF-PNAMRQ  256

Query  304  GCQATTYFDFKRPKGLTMKFRDIARRTYTPFLIALKSPPNI---SEFPAKGLEIKGQMVH  360
              + T   +   P+ +   +  I     + F+  LK   +I   +   AK + +KG MV 
Sbjct  257  ETRVTDLLELVHPE-VPFSYESIKYYKNSLFVFRLKGLGDIVHNANDEAKTVLLKGSMVF  315

Query  361  CPESNSLLFMGSPFLDGLDGLTCNGLFISDIPLHDATREVILVGEQARAQDGLRRRMDKL  420
              E   +L+M S  +  +  L    L +SD+  HD TR+VI++ +   +Q  L R +++ 
Sbjct  316  IDEGKYILYMCSVNVTTVRELIERNLHLSDMQRHDGTRDVIMLNQSRMSQVELNRTLEET  375

Query  421  KSSIEEANAAVAKERKKNVSLLHLIFPAEIAERLWLGASIDAKTYPDVTILFSDIVGFTS  480
               +++    +  E++K   LL  + PA +A+ L  G ++DAK + D T+LF+DIV FT+
Sbjct  376  TKKLKKMAQELEIEKQKTDELLCELMPASVADSLRSGKAMDAKEFADCTLLFTDIVTFTN  435

Query  481  ICSRATPFMVISMLESLYKDFDEFCDLFDVYKVETIGDAYCVASGLHRASIYDAHKVAWM  540
            IC+  TP+ V+++L  LY  FD    L D YKVETIGDAY +  G+       A +V  +
Sbjct  436  ICAMCTPYDVVTLLNDLYLRFDRLVGLHDAYKVETIGDAYMIVGGVPERCENHAERVLNI  495

Query  541  ALKMIVACA---KHITHDDQEIQMRIGLHTGTVLAGVVGRKMPRYCLFGHNVTIANKFES  597
            ++ M++        ITH  + I++R+G+H G V+AGVVG KMPRYCLFG  V +ANK ES
Sbjct  496  SIGMLMESKLVLSPITH--KPIKIRLGVHCGPVVAGVVGIKMPRYCLFGDTVNVANKMES  553

Query  598  GSEACKINVSPTTK-DWLVKYPGFEF  622
                CKI+VS T K + L   P + F
Sbjct  554  NGIQCKIHVSETGKLNGLKANPSYVF  579



Lambda      K        H
   0.312    0.129    0.370 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4811699998


Query= NP_001291912.1 calexcitin-1 [Bactrocera dorsalis]

Length=184
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O16158_DROME  unnamed protein product                                 333     2e-118
O96676_DROME  unnamed protein product                                 35.8    0.013 
Q7KVU4_DROME  unnamed protein product                                 35.4    0.016 


>O16158_DROME unnamed protein product
Length=184

 Score = 333 bits (853),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 157/184 (85%), Positives = 170/184 (92%), Gaps = 0/184 (0%)

Query  1    MSISDFRKKKLLFLFNVFFDVNQSGEIDVKDFELAIERVCKLRGWAENTPKNKEIHAVML  60
            MSISDFRKKKLLFLFNVFFDVNQSGEIDVKDFELAIERVC+LRGW ++TPKNKE + +M+
Sbjct  1    MSISDFRKKKLLFLFNVFFDVNQSGEIDVKDFELAIERVCQLRGWQKDTPKNKETYDLMM  60

Query  61   EIWEGLRSKADKDNDGQVSVDEWCNMWDAYAKDPSSVMDWQTKYMNFMFDLEDASTDGSI  120
            EIW GLRSKADKDNDGQVSVDEWCNMWDAYAKDPSSVMDWQ  YMNFMFDLEDAS DG I
Sbjct  61   EIWTGLRSKADKDNDGQVSVDEWCNMWDAYAKDPSSVMDWQNAYMNFMFDLEDASHDGGI  120

Query  121  DAEEFTLVCSSYGLDKAECQDAFQKMAQGNSEVTRDQFAALWKEYFAAEDVNAPGNFIFG  180
            D  EFTLVCSSYGL+K EC++AF KM+QG SEVTR+QFAALWKEYFAAEDVNAPGN+IFG
Sbjct  121  DVTEFTLVCSSYGLEKTECEEAFAKMSQGQSEVTREQFAALWKEYFAAEDVNAPGNYIFG  180

Query  181  KNAF  184
            K +F
Sbjct  181  KTSF  184


>O96676_DROME unnamed protein product
Length=298

 Score = 35.8 bits (81),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 37/169 (22%), Positives = 72/169 (43%), Gaps = 9/169 (5%)

Query  4    SDFRKKKLLFLFNVFFDVNQSGEIDVKDFELAIERVCKLRGWAENTPK-NKEIHAVMLEI  62
            S F ++K+  L  +  DVN  G +   DF L  +R   L      TP+   E + V+   
Sbjct  121  SAFWRRKMRTLHRIL-DVNHDGVVSFDDFSLLAKRFSDL---GHLTPEVAAEFNDVIKHT  176

Query  63   WEGLRSKADKDNDGQVSVDEWCNMWDAYAKDPSSVMDWQTKYMNFMFDLEDASTDGSIDA  122
            WE    +    N   V+ +++         D   +     +++ ++F   D    G +D 
Sbjct  177  WEEQFGEITPYN--LVTAEQFLTDLHHRLND-KKMAKRIGRFLPYLFKAVDFDHTGHLDL  233

Query  123  EEFTLVCSSYGLDKAECQDAFQKM-AQGNSEVTRDQFAALWKEYFAAED  170
            E++ L     GL + +   +F  +   G+ +++  +F  L +++F  ED
Sbjct  234  EQYKLFFRCLGLTEDDAAVSFAVIDKNGDGQLSLKEFVHLGRQFFLTED  282


>Q7KVU4_DROME unnamed protein product
Length=231

 Score = 35.4 bits (80),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 37/169 (22%), Positives = 72/169 (43%), Gaps = 9/169 (5%)

Query  4    SDFRKKKLLFLFNVFFDVNQSGEIDVKDFELAIERVCKLRGWAENTPK-NKEIHAVMLEI  62
            S F ++K+  L  +  DVN  G +   DF L  +R   L      TP+   E + V+   
Sbjct  54   SAFWRRKMRTLHRIL-DVNHDGVVSFDDFSLLAKRFSDL---GHLTPEVAAEFNDVIKHT  109

Query  63   WEGLRSKADKDNDGQVSVDEWCNMWDAYAKDPSSVMDWQTKYMNFMFDLEDASTDGSIDA  122
            WE    +    N   V+ +++         D   +     +++ ++F   D    G +D 
Sbjct  110  WEEQFGEITPYN--LVTAEQFLTDLHHRLND-KKMAKRIGRFLPYLFKAVDFDHTGHLDL  166

Query  123  EEFTLVCSSYGLDKAECQDAFQKM-AQGNSEVTRDQFAALWKEYFAAED  170
            E++ L     GL + +   +F  +   G+ +++  +F  L +++F  ED
Sbjct  167  EQYKLFFRCLGLTEDDAAVSFAVIDKNGDGQLSLKEFVHLGRQFFLTED  215



Lambda      K        H
   0.312    0.129    0.370 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4811699998


Query= NP_001291913.1 target of rapamycin [Bactrocera dorsalis]

Length=2460
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TOR_DROME  unnamed protein product                                    4014    0.0  
TOR_DICDI  unnamed protein product                                    1920    0.0  
Q38AC2_TRYB2  unnamed protein product                                 813     0.0  


>TOR_DROME unnamed protein product
Length=2470

 Score = 4014 bits (10410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1952/2472 (79%), Positives = 2159/2472 (87%), Gaps = 14/2472 (1%)

Query  1     MSTAALVQQFVAGLKSRNRNVQNKAAQDLFMYVKTELREMSQEDLVAFFDDFNHQIFSMV  60
             MST ++VQQFV GLKSRNRNVQNKA QDL  YVKTELREMSQE+L  FFD+F+H IF+MV
Sbjct  1     MSTTSVVQQFVNGLKSRNRNVQNKATQDLLFYVKTELREMSQEELAQFFDEFDHHIFTMV  60

Query  61    NSADINDKKGAVLAIKCLISGD-VVNTMKRISPYYNHLRTLLPSNDTTVMEIAARTLVKL  119
             N+ DIN+KKG  LA+KCLI+ +  +   K ISPY N LR LL  ND +VMEIAAR+LVKL
Sbjct  61    NATDINEKKGGALAMKCLINCEGSLTARKGISPYLNRLRDLLLINDVSVMEIAARSLVKL  120

Query  120   ANLPGSKGAESIDFDIKRAFEMLSGDRQEYRRHAAVFILRELAIAMPTYFYQQISTFFDN  179
             AN+P SKGA+S DFDIK+AFE+L G+RQEYRRH+AVFILRELAIA+PTYFYQ I TFF+ 
Sbjct  121   ANMPTSKGADSFDFDIKKAFEVLRGERQEYRRHSAVFILRELAIALPTYFYQHILTFFEV  180

Query  180   IFNAIFDPKAAIRESAGEALRAALIVTSQRESTKQSTEPQWYKTCYQEASASFVAEPTGT  239
             IFNAIFDPK AIRESAGEALRAALIVT+QRESTKQS+EPQWY+ CY EA+ SF A+   +
Sbjct  181   IFNAIFDPKPAIRESAGEALRAALIVTAQRESTKQSSEPQWYRICYDEANGSFNADLGSS  240

Query  240   KDQKGMTRDDCIHGGLIILNELFRCSHAAWERRYATLKSLLPDAQHNKFGEVIHSGSVGS  299
             KDQKG+TRDD IHGGL++ NELFRC++A WERRY +LK+L P  QHNKF E   S S+GS
Sbjct  241   KDQKGVTRDDRIHGGLVVFNELFRCANATWERRYTSLKTLFPKTQHNKFLEASSSSSMGS  300

Query  300   QLTTLVPRLKAPFISKLGSTHMHLDHDAQHGGTHKFSSATVLESAYSREILTENYINICD  359
             QL TLVPRLK PFI KLGST  HL     H G  KF+S  VLESAY++EIL E+Y +ICD
Sbjct  301   QLNTLVPRLKVPFIDKLGSTQTHLGEGEHHKGVAKFASHNVLESAYAQEILQEHYTSICD  360

Query  360   NVLEQRTSKSPYVQQALLHILPRLAAFNREVFVQRYLQECVSHLLSIVPRKEKDRNIAYV  419
             NVLEQRTSKSPYVQQALL ILPRLAAFNR VFV++YLQ CVSHL+ I+  KEKDR +AY+
Sbjct  361   NVLEQRTSKSPYVQQALLQILPRLAAFNRAVFVEKYLQTCVSHLMQILRGKEKDRTVAYI  420

Query  420   TIGYIAVAVERDIDKHLRTIMCAIKIALPPKITPSKRKAAIDPAIFHCITLLAHAVKSGI  479
             TIGY+AVAV+  I+ HL +IM ++K+ALP K   SKRK  +DPA+F CITLLAHAVKS I
Sbjct  421   TIGYMAVAVQSAIEVHLSSIMTSVKVALPSKDLTSKRKVPVDPAVFACITLLAHAVKSEI  480

Query  480   TEDVRNILEQMFFSGLSPALTVCLRELAENVPHLKSAIAEGLIRVLSQVLMNKPLAIPYQ  539
              +DV++ILEQMF++GLSPALTVCLREL+ENVP LKSAI EGLI +LSQVLMNK   +PY 
Sbjct  481   ADDVKDILEQMFYTGLSPALTVCLRELSENVPQLKSAITEGLIGILSQVLMNKAAILPYT  540

Query  540   TLATIPLDPSINLQHDVPTVVLALKTLGSFNFEEQNMLDFVQRCADHFINHDQQEIRLEA  599
              L TI +D S+    D  T VLALKTLG+FNFEEQNMLDFVQRCAD+FI H+QQEIRLEA
Sbjct  541   ALPTIAIDGSLMQNGDGATTVLALKTLGTFNFEEQNMLDFVQRCADYFIVHEQQEIRLEA  600

Query  600   VQTCTRLLKLAVQSADSTESSNTLSETVSHVIERLLIVAITDMDCNVRIRILSSLDETFD  659
             VQTCTRLLKLAVQS++S E+S TLS+TVSHVIERLL+VAITDMDCNVRIRIL SLDETFD
Sbjct  601   VQTCTRLLKLAVQSSESMENSKTLSDTVSHVIERLLMVAITDMDCNVRIRILRSLDETFD  660

Query  660   AELAQPESLSALFITLNDEIFEIRELAMVTVGRLSAMNPAYVMPKLRKIMIQLLTELEHS  719
              +LAQPESL++LFITL+DEIFEIRELAMVT+GRLS++NPAYVMPKLR  MI+L+T+L++S
Sbjct  661   GKLAQPESLNSLFITLHDEIFEIRELAMVTIGRLSSINPAYVMPKLRTTMIELITDLKYS  720

Query  720   GMSRNKEQSARMLDHLIISTPRLISSYMHPILTILVPKLREADPNPGVILNVLRAIGDLA  779
             GMSRNKEQSA+MLDHL+ISTPRLISSYM+PIL  LVPKL E + NPGVILNVLR IGDLA
Sbjct  721   GMSRNKEQSAKMLDHLVISTPRLISSYMNPILKALVPKLHEPESNPGVILNVLRTIGDLA  780

Query  780   EVNGGSNEMEMWADDLLSILLEMLGDAGSPEKRGVALWTLGQLISATGRVVTPYHKYPGL  839
             EVNGGS+EME+WADDLLSILLEMLGDAGSP+KRGVALWTLGQLISATGRVVTPYHKYP L
Sbjct  781   EVNGGSDEMELWADDLLSILLEMLGDAGSPDKRGVALWTLGQLISATGRVVTPYHKYPVL  840

Query  840   IDILINFLKTEQRRSIRRETIRVLGLLGAMDPYKHKMNKGLIDSQKDSVLISLSDFKMDE  899
             IDILINFLKTEQRRSIRRETIRVLGLLGAMDPYKHKMNKGLIDSQKD+VLI+ SD K+DE
Sbjct  841   IDILINFLKTEQRRSIRRETIRVLGLLGAMDPYKHKMNKGLIDSQKDNVLIAYSDGKVDE  900

Query  900   NQDISTAELLVNMSNVLDEYYPAVAIAALMRILRDPTLSSRHTSVVQAITFIFKSLGIKC  959
             +QDISTAELLVNM N LDEYYPAVAIAALMRILRDPTLS+RHTSVVQA+TFIF+SLGIKC
Sbjct  901   SQDISTAELLVNMGNALDEYYPAVAIAALMRILRDPTLSTRHTSVVQAVTFIFQSLGIKC  960

Query  960   VPYLAQVLPSLLENVRTADINLREFLFQQLAILVQIVKQHIISYMSDIFKLIKEFWTVYT  1019
             VPYLAQVLP+LL+NVRTAD NLREFLFQQLAILV  VK HIISYM DIFKLIKEFWT+ T
Sbjct  961   VPYLAQVLPNLLDNVRTADNNLREFLFQQLAILVAFVKLHIISYMGDIFKLIKEFWTINT  1020

Query  1020  TLQLTLINLIEQIALALGCEFRNYLSELIPQILRVLQHDTSKDRAVTKRLLQALQKFGNT  1079
              LQ TLINLIEQIA+ALGCEFR+YL+ELIPQILRVLQHD SKDR VT+RLLQALQKFG+T
Sbjct  1021  PLQNTLINLIEQIAVALGCEFRDYLAELIPQILRVLQHDNSKDRMVTRRLLQALQKFGST  1080

Query  1080  LDDYLHLIVPPIVKLFDAPYVPQQVSLVALETIDHLAWILDFTDFSSRIIHPLVRVLEAE  1139
             L  YL LI+PPIVKLFD+PYVPQQVS+VALETI++LA  LDFTDFSSRIIHPLVRVL+AE
Sbjct  1081  LGYYLPLILPPIVKLFDSPYVPQQVSMVALETINNLACQLDFTDFSSRIIHPLVRVLDAE  1140

Query  1140  PELREQAMSTLCSVVIQLGKKYLVFVPLVERTITKHRIVDSKYEKLLTKIQSNTTMCLD-  1198
             PELR+QAM+TL S+  QLGKKYLVFVP+V+RT+ KHRIVD +YE+LL+KI+S +T+    
Sbjct  1141  PELRDQAMTTLRSLAKQLGKKYLVFVPMVQRTLNKHRIVDPEYEELLSKIKSCSTLADSY  1200

Query  1199  --DEFHMRQTKFKSTELVAPNSGGNFAMKRLIVSTSNLRAAWQVTRRVSKDDWVEWLKRL  1256
                E  +R ++FK+ E    +   N   K L V+T+ LR AWQVTRRVSKDDWVEWLKRL
Sbjct  1201  GAGESELRPSRFKNNEPFVTDRNSN--NKNLQVTTNELRTAWQVTRRVSKDDWVEWLKRL  1258

Query  1257  SIGLLKESRSQALRACHVLAQDYDKLLRDLFNAAFISCWTELLQEHKNELTQSLIQALQV  1316
             SIGLLKES S ALRAC  LAQ+YD LLRDLFNAAFISCWTEL  + KNELTQSLIQALQV
Sbjct  1259  SIGLLKESPSHALRACRSLAQEYDTLLRDLFNAAFISCWTELSPDLKNELTQSLIQALQV  1318

Query  1317  TDMPEITQTILNLAEFMEHCDTDPIPIETKLLGTRAMACRAYAKALRYKEEEFQTHKDPQ  1376
             TDMPEITQTILNLAEFMEHCD DPIPIETKLLGTRAMACRAYAKALRYKEEEF   +D Q
Sbjct  1319  TDMPEITQTILNLAEFMEHCDRDPIPIETKLLGTRAMACRAYAKALRYKEEEFLLREDSQ  1378

Query  1377  VLESLILINNKLQQKEAAEGLLTTYRNASNEFKVQGRWYEKLHNWEQALKHYSGNLKDNS  1436
             V ESLILINNKLQQ+EAAEGLLT YRNA+NE  VQGRWYEKLHNW++AL+HY  NLK +S
Sbjct  1379  VFESLILINNKLQQREAAEGLLTRYRNAANELNVQGRWYEKLHNWDEALEHYERNLKTDS  1438

Query  1437  NDLEARLGHMRCLEALGEWSELSSVAKQEWDNLGRDARSRAGPLAAVAAWGLQDWEAMQE  1496
             +DLEARLGHMRCLEALG+WSELS+V K EW+N G +A+SRAGPLAAVAAWGLQDWEAM+E
Sbjct  1439  SDLEARLGHMRCLEALGDWSELSNVTKHEWENFGTEAKSRAGPLAAVAAWGLQDWEAMRE  1498

Query  1497  YVRCIPEETQDGSFYRAVLAVHNEDFETAQRLIDGTRDLLDTELTSMAGESYERAYGAMV  1556
             YVRCIPE+TQDGS+YRAVLAVH++DFETAQRLID TRDLLDTELTSMAGESYERAYGAMV
Sbjct  1499  YVRCIPEDTQDGSYYRAVLAVHHDDFETAQRLIDETRDLLDTELTSMAGESYERAYGAMV  1558

Query  1557  CVQMLAELEEVIQYKLIPERREPLKSMWWKRLQGGPRLVEDWRRIIQVHSLVVRPQEDVH  1616
             CVQMLAELEEVIQYKLIPERREPLK+MWWKRLQGG RLVEDWRRIIQVHSLVV+P ED+H
Sbjct  1559  CVQMLAELEEVIQYKLIPERREPLKTMWWKRLQGGQRLVEDWRRIIQVHSLVVKPHEDIH  1618

Query  1617  TWLKYASLCRKSGSLHLSHKTLVMLLGTDPSTQPKEQLPYNQPQVTYAYTKHMAAAENMQ  1676
             TWLKYASLCRKSGSLHLSHKTLVMLLGTDP   P + LP NQPQVTYAYTK+MAA   +Q
Sbjct  1619  TWLKYASLCRKSGSLHLSHKTLVMLLGTDPKLNPNQPLPCNQPQVTYAYTKYMAANNQLQ  1678

Query  1677  GAYEQLSCFVNAFQAKLNCIGPEEAAKQDHRLLARCYLRLGKWQNKLQSSLEPEIVQGAL  1736
              AYEQL+ FV+ +  +L+C+ PE   +QD RL+ARCYLR+  WQNKLQ S+ P+ +QGAL
Sbjct  1679  EAYEQLTHFVSTYSQELSCLPPEALKQQDQRLMARCYLRMATWQNKLQDSIRPDAIQGAL  1738

Query  1737  DCFEKATENDPTCYKAWHLWAYMNFKVVQAQKQQLDK-----LAHTATNGDILQDKEKLI  1791
             +CFEKAT  DP  YKAWHLWAYMNFKVVQAQK  LDK      +   T G  L     +I
Sbjct  1739  ECFEKATSYDPNWYKAWHLWAYMNFKVVQAQKSALDKQQPPGASMGMTMGSGLDSDLMII  1798

Query  1792  IEHAVQAVDGFFRSISLIKGNSLQDTLRLLTLWFDYGQYSEVYDALLTGMKTIEINTWLQ  1851
               +AV AV GFFRSISLIKGNSLQDTLRLLTLWFDYG ++EVY+ALL+GMK IEINTWLQ
Sbjct  1799  QRYAVPAVQGFFRSISLIKGNSLQDTLRLLTLWFDYGNHAEVYEALLSGMKLIEINTWLQ  1858

Query  1852  VIPQLIARIDTHRKLVNQLIHHLLIDISKYHPQALVYPLTVASKSASVARKNAAFKILES  1911
             VIPQLIARIDTHR+LV QLIH LL+DI K HPQALVYPLTVASKSAS+AR+NAAFKIL+S
Sbjct  1859  VIPQLIARIDTHRQLVGQLIHQLLMDIGKNHPQALVYPLTVASKSASLARRNAAFKILDS  1918

Query  1912  MRKHYPTLVQQAMTCSEELIRVAILWHEQWHEGLEEASRLYFADRNVKGMFDILEPLHAL  1971
             MRKH PTLV+QA+ CSEELIRVAILWHEQWHEGLEEASRLYF DRNVKGMF+ILEPLHA+
Sbjct  1919  MRKHSPTLVEQAVMCSEELIRVAILWHEQWHEGLEEASRLYFGDRNVKGMFEILEPLHAM  1978

Query  1972  LARGPQTLKETSFSQAYGRELTEAYEWTQRYKTSSVLMDLDHAWDIYYHVFQKISRQLPQ  2031
             L RGPQTLKETSFSQAYGRELTEAYEW+QRYKTS+V+MDLD AWDIYYHVFQKISRQLPQ
Sbjct  1979  LERGPQTLKETSFSQAYGRELTEAYEWSQRYKTSAVVMDLDRAWDIYYHVFQKISRQLPQ  2038

Query  2032  LTSLELPYVSPKLMTCKNLELAVPGSYNPNQDLIRIDHIKTNLQVITSKQRPRKLCLRGS  2091
             LTSLELPYVSPKLMTCK+LELAVPGSYNP Q+LIRI  IKTNLQVITSKQRPRKLC+RGS
Sbjct  2039  LTSLELPYVSPKLMTCKDLELAVPGSYNPGQELIRISIIKTNLQVITSKQRPRKLCIRGS  2098

Query  2092  NGKDYMYLLKGHEDLRQDERVMQLFSLVNTLLLDDPDTFRRNLAIQRYAVIPLSTNSGLI  2151
             NGKDYMYLLKGHEDLRQDERVMQLFSLVNTLLLDDPDTFRRNLAIQRYAVIPLSTNSGLI
Sbjct  2099  NGKDYMYLLKGHEDLRQDERVMQLFSLVNTLLLDDPDTFRRNLAIQRYAVIPLSTNSGLI  2158

Query  2152  GWVPHCDTLHTLIRDYRDKRKMLLNQEHRLMLSVSPDYDHLTLMQKVEVFECALAQTQGD  2211
             GWVPHCDTLHTLIRDYRDK+K+ LNQEHR ML+ +PDYDHLTLMQKVEVFE AL QTQGD
Sbjct  2159  GWVPHCDTLHTLIRDYRDKKKVPLNQEHRTMLNFAPDYDHLTLMQKVEVFEHALGQTQGD  2218

Query  2212  DLAKLLWLKSPSSEVWFERRTNYTRSLAVMSMVGYILGLGDRHPSNLMLDRMSGKILHID  2271
             DLAKLLWLKSPSSE+WFERR NYTRSLAVMSMVGYILGLGDRHPSNLMLDRMSGKILHID
Sbjct  2219  DLAKLLWLKSPSSELWFERRNNYTRSLAVMSMVGYILGLGDRHPSNLMLDRMSGKILHID  2278

Query  2272  FGDCFEVAMTHEKFPEKIPFRLTRMLIKAMEVTGIEGTYRRTCESVMLVLRRNKDSLMAV  2331
             FGDCFEVAMT EKFPEKIPFRLTRMLIKAMEVTGIEGTYRRTCESVMLVLRRNKDSLMAV
Sbjct  2279  FGDCFEVAMTREKFPEKIPFRLTRMLIKAMEVTGIEGTYRRTCESVMLVLRRNKDSLMAV  2338

Query  2332  LEAFVYDPLLNWRLLDMDKNHRSKSNNDPGGSGMAFGGGNGSLSNSVEE--PLLHSQLMS  2389
             LEAFVYDPLLNWRLLD+DK             G    G   SLSNSVE+  P+  S+   
Sbjct  2339  LEAFVYDPLLNWRLLDVDKKGNDAVAGAGAPGGRGGSGMQDSLSNSVEDSLPMAKSKPYD  2398

Query  2390  ANRLMGGAL-MVADITNSKASKVIKRVRSKLNGTDFQTQNSVAVPQQVDLLIQQATNNEN  2448
                  GG    VAD TNSKAS+VIKRV+ KL GTDFQT+ SV    QV+LLIQQATNNEN
Sbjct  2399  PTLQQGGLHNNVADETNSKASQVIKRVKCKLTGTDFQTEKSVNEQSQVELLIQQATNNEN  2458

Query  2449  LCQCYIGWCPFW  2460
             LCQCYIGWCPFW
Sbjct  2459  LCQCYIGWCPFW  2470


>TOR_DICDI unnamed protein product
Length=2380

 Score = 1920 bits (4973),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1045/2173 (48%), Positives = 1420/2173 (65%), Gaps = 114/2173 (5%)

Query  348   EILTENYINICDNVLEQRTSKSPYVQQALLHILPRLAAFNREVFVQRYLQECVSHLLSIV  407
             + +   + +IC+ VL+ +  +   V++ +L + PRLA F    FV  Y   C++HLL+ +
Sbjct  262   DFMLSKFKDICETVLKYKDHRDKLVKKTVLALFPRLAVFCSRDFVLNYFNACMNHLLAAL  321

Query  408   PRKEKDRNIAYVTIGYIAVAVERDIDKHLRTIMCAIKIALPPKITPSKRKAAIDPAIFHC  467
              R + +R  A++ +G IA+AV   I  +L +I+  IK  L   +T  K+     P +  C
Sbjct  322   -RNQNERPTAFIALGEIAMAVGGSIKPYLDSIVVMIKQGL---MTKGKQFC---PEVLTC  374

Query  468   ITLLAHAVKSGITEDVRNILEQMFFS-GLSPALTVCLRELAENVPHLKSAIAEGLIRVLS  526
             I++LA AV   +   ++ IL QM  S GL+  LT  LR+L  N+P L   I   L+ ++S
Sbjct  375   ISMLASAVGQSMYPHMQVILPQMIVSSGLTVVLTDALRDLTINLPTLIPNIQYKLLNLIS  434

Query  527   QVLMNKPLA-----IPYQTLATIPLDPSI-----NLQHDVPTVVLALKTLGSFNFEEQNM  576
             QVL NKP +      PY+  AT     SI     N   D   + LALKTLGSF+F + N+
Sbjct  435   QVLANKPFSEPGAPSPYRKSATPFQGGSIPQLGQNSDVDPQMIALALKTLGSFDFSKHNL  494

Query  577   LDFVQRCADHFINHDQQEIRLEAVQTCTRLLKLAVQSADSTESSNTLSETVSHVIERLLI  636
             L+FV+ C  ++++ D  EIR EA  TC +L+   V + + T +    +  V  V+E+LL+
Sbjct  495   LEFVRECVVNYLDDDNIEIRREAAITCAQLM---VGTEEPTPTRGHSAVIVGEVLEKLLV  551

Query  637   VAITDMDCNVRIRILSSLDETFDAELAQPESLSALFITLNDEIFEIRELAMVTVGRLSAM  696
             V I D D ++R  +LSSL+  FD  LAQ E+L +LFI LNDE+FEIRELA+  +GRL+  
Sbjct  552   VGIADPDPSIRKTVLSSLEARFDHYLAQAENLRSLFIALNDELFEIRELAITVIGRLTIR  611

Query  697   NPAYVMPKLRKIMIQLLTELEHSGMSRNKEQSARMLDHLIISTPRLISSYMHPILTILVP  756
             NPAYVMP LRK +IQLLTELE SG  RNKE+SAR+L HLI ++ +LI  Y+ PIL  L+P
Sbjct  612   NPAYVMPSLRKTLIQLLTELEFSGDGRNKEESARLLGHLISASEKLIKPYVEPILKALLP  671

Query  757   KLREADPNPGVILNVLRAIGDLAEVNGGSNEMEMWADDLLSILLEMLGDAGSPEKRGVAL  816
             KLR  D NP V   VL A+G+L+ V  G  EM    D LL ++++ L D  S  KR VAL
Sbjct  672   KLR--DSNPRVASCVLAALGELSVV--GGEEMVQHIDSLLPLIIDTLQDQSSTSKREVAL  727

Query  817   WTLGQLISATGRVVTPYHKYPGLIDILINFLKTEQRRSIRRETIRVLGLLGAMDPYKHKM  876
              TL QL S+TG V+ P+ KYP L+D L+N +KTE+  SIRRE I+VLG+LG++DPYKHKM
Sbjct  728   KTLAQLASSTGYVIKPFSKYPMLLDTLLNAIKTERIGSIRREVIKVLGILGSLDPYKHKM  787

Query  877   NKGLIDSQKDSVLISLSDFKMDENQDISTAELLVNMSNVLDEYYPAVAIAALMRILRDPT  936
             N+ L   ++D      +D   D+N +++   + ++ SN  ++YYP VA+ ALM+ILRDP+
Sbjct  788   NE-LGKRREDP---KAND---DKNNNMTNEVITISPSN--EDYYPTVALTALMKILRDPS  838

Query  937   LSSRHTSVVQAITFIFKSLGIKCVPYLAQVLPSLLENVRTADINLREFLFQQLAILVQIV  996
             LSS HTSV+QA+ +IFKSL +K +P+L Q++P  L  + T +   REFLFQQL  LV IV
Sbjct  839   LSSHHTSVIQAVMYIFKSLSLKSIPFLPQIMPPFLHAMNTGEPLFREFLFQQLGSLVSIV  898

Query  997   KQHIISYMSDIFKLIKEFWTVYTTLQLTLINLIEQIALALGCEFRNYLSELIPQILRVLQ  1056
             KQHI  Y+ ++F LI+++W   + L + +I L+E+I+ AL  EF+ YL  LIPQ+L VL 
Sbjct  899   KQHIRDYLVNVFALIEKYWN--SNLLIPIIKLVEEISSALNDEFKVYLPNLIPQMLNVLH  956

Query  1057  HDTSKDRAVTKRLLQALQKFGNTLDDYLHLIVPPIVKLFDAPYVPQQVSLVALETIDHLA  1116
              D S  R+ T ++L+AL+ FG  LDDYLHL++P IVKLF+   V  QV  +A++TI  L 
Sbjct  957   TDRSPKRSPTTKVLRALEVFGTNLDDYLHLVIPAIVKLFEQVDVTTQVRTLAIQTIGRLC  1016

Query  1117  WILDFTDFSSRIIHPLVRVLEA-EPELREQAMSTLCSVVIQLGKKYLVFVPLVERTITKH  1175
               L+F+D++SRIIHPL RVL++ E ELRE+ ++TLC++V QLG  Y +F+P+V + + + 
Sbjct  1017  KKLNFSDYASRIIHPLARVLDSTESELREETLNTLCALVYQLGSDYAIFIPMVGKVLARR  1076

Query  1176  RIVDSKYEKLLTKIQSNTTMCL----DDEFHMRQTKFKS--------TELVAPNSGGNFA  1223
              I  + YE L++K+  N  + L     D+  M   +F           +    ++  +  
Sbjct  1077  EIQSTNYELLISKLLKNQQLMLTPGSGDDGGMGANRFGGDHNGHHLGEDHNNTSTPLDIG  1136

Query  1224  MKRLIVSTSNLRAAWQVTRRVSKDDWVEWLKRLSIGLLKESRSQALRACHVLAQDYDKLL  1283
             +K+L  +  +L+ AW+ ++R +K+DW EW++R S+ LL+ES S ALR+C  LAQDY  L+
Sbjct  1137  VKKLKANEQHLKNAWETSQRSTKEDWGEWIRRFSVELLRESPSPALRSCLSLAQDYHPLV  1196

Query  1284  RDLFNAAFISCWTELLQEHKNELTQSLIQALQVTDMP-EITQTILNLAEFMEHCDTDPIP  1342
             ++LFNA F+SCWTEL ++ + EL +SL  AL   ++P EI QT+LNLAEFME     P+P
Sbjct  1197  KELFNAGFVSCWTELHEQFQEELVRSLETALLSPNIPPEILQTLLNLAEFME-LHEKPLP  1255

Query  1343  IETKLLGTRAMACRAYAKALRYKEEEFQTHKDPQVLESLILINNKLQQKEAAEGLLTTYR  1402
             I+ + LG  A  C AYAKAL YKE EF +      +E+LI INN+LQQ EAA G+L  Y 
Sbjct  1256  IDIRTLGALAEKCHAYAKALHYKESEF-SQSPSSTIEALISINNQLQQPEAAIGILI-YA  1313

Query  1403  NASNEFKVQGRWYEKLHNWEQALKHYSGNLKDNSND--LEARLGHMRCLEALGEWSELSS  1460
               ++  +++  WYEKL  WE AL  Y    KD+ N   +E  +G +RCL ALGEW  LS+
Sbjct  1314  QKNHSVELKEGWYEKLRRWEDALAAYEKKQKDDPNGGTIENTMGILRCLHALGEWERLSA  1373

Query  1461  VAKQEW-DNLGRDARSRAGPLAAVAAWGLQDWEAMQEYVRCIPEETQDGSFYRAVLAVHN  1519
             ++ + W  ++    R+   PLAA AAW L +W+ M EYV  + ++T +GSFYRA+L VH+
Sbjct  1374  LSSETWKSDINDHTRATIAPLAAAAAWNLVNWDKMDEYVCAMNKDTVEGSFYRAILEVHH  1433

Query  1520  EDFETAQRLIDGTRDLLDTELTSMAGESYERAYGAMVCVQMLAELEEVIQYKLI---PER  1576
             ++F  A   ID  R L+DTELT++ GESY RAY  +V +Q L+ELEE+I+YK     PER
Sbjct  1434  DNFTLAHGFIDHARTLVDTELTALLGESYNRAYKVVVRLQQLSELEEIIEYKKCVDSPER  1493

Query  1577  REPLKSMWWKRLQGGPRLVEDWRRIIQVHSLVVRPQEDVHTWLKYASLCRKSGSLHLSHK  1636
             R  +K+ W  RL+G    V+ W+ I+ VHSLV+ P E++  WLK+  LCRK   L L+ K
Sbjct  1494  RNMIKNTWKTRLRGCQHNVDIWQSILAVHSLVISPHEELDMWLKFVGLCRKGSRLGLAQK  1553

Query  1637  TLVMLLGTDPST--QPKEQLPYNQPQVTYAYTKHMAAAENMQGAYEQLSCFVNAFQAKLN  1694
             TL ML+G DPST  Q    LP   P++T+AY K + +A   Q A+E+L  FV A +    
Sbjct  1554  TLTMLMGKDPSTTSQFGSVLPNTHPRITFAYIKQLWSAGAKQPAFEKLRTFVQALRDT--  1611

Query  1695  CIGPEEAAKQDHRLLARCYLRLGKWQNKLQSSLEPEIVQGALDCFEKATENDPTCYKAWH  1754
                       D  L  R YL+LG+WQ  L  +L    +   +  F+ ATE DP  YKAWH
Sbjct  1612  ---------DDLPLQGRAYLKLGEWQLALGDTLSEASIPHIISSFKAATECDPNWYKAWH  1662

Query  1755  LWAYMNFKVVQAQKQQLDKLAHTATNGDILQDKEKLIIEHAVQAVDGFFRSISLIKGNSL  1814
              WA +NF+VV          +H   NG   +     I  H + AV  FF+SISL    SL
Sbjct  1663  SWALINFEVV----------SHYEQNGGTPEQ----IGAHLLPAVHSFFKSISLGPDRSL  1708

Query  1815  QDTLRLLTLWFDYGQYSEVYDALLTGMKTIEINTWLQVIPQLIARIDTHRKLVNQLIHHL  1874
             QDTLRLLTLWF +G   EV  AL+ G  TI I+TWL VIPQ+IARI      V +L+H L
Sbjct  1709  QDTLRLLTLWFKHGAQKEVEAALMQGFNTISIDTWLHVIPQIIARIHAPVLPVRRLLHEL  1768

Query  1875  LIDISKYHPQALVYPLTVASKSASVARKNAAFKILESMRKHYPTLVQQAMTCSEELIRVA  1934
             +  I K HPQALVYPLTVA+KS S AR  AA  +++ MRKH  TLV QA+  S+EL+R A
Sbjct  1769  IDTIGKEHPQALVYPLTVATKSHSPARLAAAKSLMDKMRKHSATLVDQALPVSQELVRTA  1828

Query  1935  ILWHEQWHEGLEEASRLYFADRNVKGMFDILEPLHALLARGPQTLKETSFSQAYGRELTE  1994
             ILW E W+EGLEEASR YF D N + M   L PLH +L +GP+T  ETSF QA+GR+L E
Sbjct  1829  ILWLEMWYEGLEEASRQYFGDHNPEAMLATLAPLHQILEKGPETTSETSFLQAFGRDLQE  1888

Query  1995  AYEWTQRYKTSSVLMDLDHAWDIYYHVFQKISRQLPQLTSLELPYVSPKLMTCKNLELAV  2054
             A EW+++Y+ +    DL+ AWD+YY VF++I +QLPQ++SLEL YVSPKL+   N+ELAV
Sbjct  1889  ALEWSKKYEKTRKEGDLNQAWDLYYQVFRRIYKQLPQMSSLELQYVSPKLLNSNNMELAV  1948

Query  2055  PGSYNPNQDLIRIDHIKTNLQVITSKQRPRKLCLRGSNGKDYMYLLKGHEDLRQDERVMQ  2114
             PG+Y  ++++IRI      L VI SKQRPRKL + GS+G +Y +LLKGHEDLRQDERVMQ
Sbjct  1949  PGTYKASENVIRIQSFSQALSVIPSKQRPRKLTIIGSDGLEYTFLLKGHEDLRQDERVMQ  2008

Query  2115  LFSLVNTLLLDDPDTFRRNLAIQRYAVIPLSTNSGLIGWVPHCDTLHTLIRDYRDKRKML  2174
             LFSLVN LL  + +T + +L+I+R++VIPLS NSGLIGWVPH DTLHTLI+D+RD  K+L
Sbjct  2009  LFSLVNNLLSANHETAKSHLSIRRFSVIPLSPNSGLIGWVPHSDTLHTLIKDFRDSNKIL  2068

Query  2175  LNQEHRLMLSVSPDYDHLTLMQKVEVFECALAQTQGDDLAKLLWLKSPSSEVWFERRTNY  2234
             L+ EHRLML +  DYD+LTL+QKVEVF+ AL  + G DL K+LWLKS +SEVW +RRTNY
Sbjct  2069  LSIEHRLMLQMCSDYDNLTLLQKVEVFQYALENSNGLDLHKVLWLKSRNSEVWLDRRTNY  2128

Query  2235  TRSLAVMSMVGYILGLGDRHPSNLMLDRMSGKILHIDFGDCFEVAMTHEKFPEKIPFRLT  2294
             TRSLAVMSMVGYILGLGDRHPSNLMLDR +G ILHIDFGDCFEVAM  +K+PEKIPFRLT
Sbjct  2129  TRSLAVMSMVGYILGLGDRHPSNLMLDRHTGHILHIDFGDCFEVAMHRDKYPEKIPFRLT  2188

Query  2295  RMLIKAMEVTGIEGTYRRTCESVMLVLRRNKDSLMAVLEAFVYDPLLNWRLLDMDKN---  2351
             RMLI AMEV+GIEG +R TCE+VM VLR NK+SLMAVLEAFV+DPL+NWRLL  ++N   
Sbjct  2189  RMLINAMEVSGIEGNFRLTCEAVMNVLRNNKESLMAVLEAFVHDPLINWRLLTPNENNTK  2248

Query  2352  HRSKSNNDPGGSGMAFGGGNGSLSNSVEEPL------------------LHSQLMSANRL  2393
             H++ +      +  +     G L N+++ P+                  +H + ++ N+ 
Sbjct  2249  HKATNIASNNSTSNSTTKIEGDL-NTIDNPINKESPDHEAVAGSLKSSPVHGRQIARNQR  2307

Query  2394  MG------GALMVADITNSKASKVIKRVRSKLNGTDFQTQNSVAVPQQVDLLIQQATNNE  2447
             +G       A +V +  N +A  VI RV  KL G DF +  ++ VP+QV  LI QAT++E
Sbjct  2308  VGVDAEQVEAEIVPEALNERALSVINRVNKKLTGRDFSSNETLDVPEQVQKLIDQATSHE  2367

Query  2448  NLCQCYIGWCPFW  2460
             NLC  Y+GWCPFW
Sbjct  2368  NLCLSYVGWCPFW  2380


 Score = 180 bits (456),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 110/261 (42%), Positives = 154/261 (59%), Gaps = 14/261 (5%)

Query  4    AALVQQFVAGLKSRNRNVQNKAAQDLFMYVKTELREMSQEDLVAFFDDFNHQ-IFSMVNS  62
            A  + + +  LKS+    + KA+++L  YV ++ REM+ E+   F ++ N+  IF +VNS
Sbjct  11   ADALTKLLNDLKSKKEEDRVKASKNLKSYVISQSREMTNENFTKFMNELNNNLIFELVNS  70

Query  63   ADINDKKGAVLAIKCLISGDVVNTMKRISPYYNHLRTLLPSNDTTVMEIAARTLVKLANL  122
            + I +K G ++AI  LI  D      +I+   N+LR  L  ND TVM +A++ L +LA  
Sbjct  71   SVIPEKIGGIMAIDELIDVDYDENATKITRLANYLRIGLGFNDFTVMLMASKALGRLARS  130

Query  123  PGSKGAESIDFDIKRAFEMLSGDRQEYRRHAAVFILRELAIAMPTYFYQQISTFFDNIFN  182
             G+  AE ++F++ RA E LSGDR E RRHAAV +L+ELA   PT FY   S+F D I+ 
Sbjct  131  SGTLTAEFVEFEVTRALEWLSGDRIEARRHAAVLVLKELAQNAPTLFYVHASSFVDLIWV  190

Query  183  AIFDPKAAIRESAGEALRAALIVTSQRESTKQSTEPQWYKTCYQEASASFVAEPTGTKDQ  242
            A+ DPK AIRE A EALRA L + S+RES  +    QWY+  Y EA  SF         Q
Sbjct  191  ALKDPKVAIREGAVEALRACLELISERESRLRL---QWYQKIYDEAQKSF--------KQ  239

Query  243  KGMTRDDCIHGGLIILNELFR  263
             G    + IHG LI ++EL R
Sbjct  240  NG--SPESIHGSLITVSELLR  258


>Q38AC2_TRYB2 unnamed protein product
Length=2432

 Score = 813 bits (2101),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 644/2230 (29%), Positives = 1071/2230 (48%), Gaps = 210/2230 (9%)

Query  357   ICDNVLEQRTSKSPY-VQQALLHILPRLAAFNREVFVQRYLQECVSHLLSI--VPRKEKD  413
             I + V EQ T  S   +++ LL  L  LA ++ E F +  + + V     +   P ++  
Sbjct  287   IWEYVSEQVTLTSTLELRRELLQSLTILALYDTEAFKRMSIAKVVEAASGVFQTPTEKDL  346

Query  414   RNIAYVTIGYIAVAVERDIDKHLRTIMCAIKIALPPKITPSKRKAAIDPAIFHCITLLAH  473
               + + T+G +A  +   I   L   M  I+     ++    R  A       C+   A 
Sbjct  347   EPLVFQTLGKLAGVMPDQIVTFLGCSMRHIE-----EVLKQGRHDACGLGAIACVAAFAE  401

Query  474   AVKSGITEDVRNILEQMFFSGLSPALTVCLRELAENVPHLKSAIAEGLIRVLSQVLMN-K  532
                  +   +R IL  +    L+      +  +    P L+S     ++ V  + L + +
Sbjct  402   VNPRAVRPYLRQILAPILSGSLTVDFAKGVARICAAFPELRSTCLSKILEVAKKQLRDDR  461

Query  533   PLAIPYQTLATIPLDPSINLQHDVPTVVLALKTLGSFNFEEQNMLDFVQRCADHFINHDQ  592
               A     L    + P+  +          L  L +  F     L F+   A  +++   
Sbjct  462   CNAGGAGALCDGGVSPAAQI----------LSALSNLEFAGYPTLPFLCDTAVAYVSVPN  511

Query  593   QEIRLEAVQTCTRLLKLAV--------QSADST--ESSNTLSETVSHVIERLLIVAITDM  642
              E+R  A++ C +L+            Q++D     S    ++  + VI++L+  A+ D 
Sbjct  512   GEVRRAAIKLCFKLVLSGCLGPQSPCRQTSDGVVIHSGCEHTQLFNKVIKKLVNAAVADP  571

Query  643   DCNVRIRILSSLDETFDAELAQPESLSALFITLNDEIFEIRELAMVTV-GRLSAMNPAYV  701
             + ++R+  L +  E FD  LA  + + +LF  L+D+      LA+V + GR+S  NPA+V
Sbjct  572   ESDIRLDTLRNFTEEFDHTLALRDVVRSLFPALHDK--HQNRLAVVRLLGRVSRRNPAHV  629

Query  702   MPKLRKIMIQLLTELEHSGMSRNKEQSARMLDHLIISTPRLISSYMHPILTILVPKLREA  761
              P LR+IM+Q +TE+++   ++ +EQ+  +L  +I S P L   Y+  +L +   +L + 
Sbjct  630   YPMLRRIMVQCVTEMQYFEHAKKQEQAFSVLGAIIESAPGLGKPYISSLLNMCAARLSDG  689

Query  762   DPNPGVILNVLRAIGDLAEVNGGSNEMEMWADDLLSILLEMLGDAGSPEKRGVALWTLGQ  821
                  V   +L  +G L     G +++ + A     ++  +L  +  P+KR  AL  LG 
Sbjct  690   TREADVCAALLSCVGKLVRYAEG-DDIRVCARIRPIVVQHILDSSHLPKKRE-ALRALGD  747

Query  822   LISATGRVVTPYHKYPGLIDILINFLKTEQRR--SIRRETIRVLGLLGAMDPYKHKMNKG  879
             ++  T + V  Y  +  L+ +L+  L    +    +R++ ++++G++GA+DP +    K 
Sbjct  748   IVRTT-KDVNVYEDHAELLPVLLQALHGGFKELWPVRKDVLQLMGIIGAVDPVR---VKE  803

Query  880   LIDSQKDSVLISLSDFKMDENQDISTAELLVNMSNVLDEYYPAVAIAALMRILRDPTLSS  939
             ++   + +    L  F   E +D + A+ +V                +++ IL  P+L+ 
Sbjct  804   ILRGSRVNNNTKLVPFLPFEGED-TIAQTVVR---------------SVLHILSLPSLTE  847

Query  940   RHT-SVVQAITFIF--KSLGIKC-VPYLAQVLPSLLENVRTADINLREFLFQQLAILVQI  995
               + + VQ I  IF  + L   C V +  +V+ S+ +  R   +  RE +   L  LV+I
Sbjct  848   DQSVAAVQVIVGIFSLEVLSPGCLVSFYGEVISSIQKQARV-QVRKREEILVHLISLVRI  906

Query  996   VKQHIISYMSDIFKLIKEFWTVYTTLQL--TLINLIEQIALALGCEFRNYLSELIPQILR  1053
             +K H+  ++ +I   +  F +  T L +   ++ L++++  +L  EFR Y+S L+  I+ 
Sbjct  907   LKGHLRPHLKEITSTVDSFISA-TDLSVLRQVLALLKELCCSLREEFRPYMSSLLGPIIV  965

Query  1054  VLQHDTSKDRAVTKRLLQALQKFGNTLDDYLHLIVPPIVKLFDAPYVPQQVSLVALETID  1113
             +++ +  +   +      A+   G+ L+D+LH ++P +  +     VP +  +VA++T+ 
Sbjct  966   LVEENVEETSEIVLDFFSAM---GSLLEDHLHTVLPVVCNIIVDTSVPSRCRIVAVKTLI  1022

Query  1114  HLAWIL-DFTDFSSRIIHPLVRVLEAEP---------ELREQAMSTLCSVVIQLGKKYLV  1163
                  L D    +SR +H L RVL              L   AM  LC++   LGK +  
Sbjct  1023  CFTKRLPDLCFHASRCVHCLCRVLRESDGGDGVGDEGRLGFSAMEALCTLAGSLGKNFEN  1082

Query  1164  FVPLVERTITK-------------HRIVDSKYEKLLTKIQSNTTMCLDDEFHMRQTKFKS  1210
             FV +V   +               H I ++   K   ++ SN                 S
Sbjct  1083  FVLVVLPAVADRYGETSGEYCRFCHDIYEAIDGKRAPEVSSNGVG------KAGGGGAPS  1136

Query  1211  TELVAPNSGGNFAMKRLIVSTSNLRAAWQVTRRVSKDDWVEWLKRLSIGLLKESRSQALR  1270
                 A  S     +K    + ++LR   +   + S +DW  WL +L++ LL+ S S +  
Sbjct  1137  LPFTAGTSAS--PLKDRADAYASLRFHLRKRDQASDEDWNHWLPQLAVNLLRSSSSPSHG  1194

Query  1271  ACHVLAQDYDKLLRDLFNAAFISCWTELLQEHKNELTQSLIQALQVTDMP-EITQTILNL  1329
                 LA+ ++   R + ++AF +C+ ++ +  + E+   L + L+   +P E+ Q +LNL
Sbjct  1195  RALTLAELHEPFARQMLHSAFAACYADMDEHTQREVVGLLTEVLRGLRVPSEVMQELLNL  1254

Query  1330  AEFMEH--------------CDTDPIPIETKLLGTRAMACRAYAKALRYKE-EEFQTHKD  1374
             +E ME                 ++  P + ++L   +  C  Y+KAL Y E E F+T ++
Sbjct  1255  SEHMERQGIRLSAGGKASIKHSSNFCPFDRQVLMESSANCNLYSKALHYAEIEFFETVRE  1314

Query  1375  ---------PQVL------------ESLILINNKLQQKEAAEG----------LLTTYRN  1403
                      P+ L            E  I   N L Q+E+A G          LLT  + 
Sbjct  1315  YERSILRGCPKPLPVKDWQNLIKLCEKSIYFCNLLGQRESANGILKFIRQNLPLLTGKKV  1374

Query  1404  ASNEFKVQGRWYEKLHNWEQALKHYSGNLKDNSNDLEARLGHMRCLEALGEWSELSSVAK  1463
                   +    ++KL  W Q+L+ Y   L+   N +   +G +R L+ALGE+  +  + +
Sbjct  1375  TELSQMMDAHLFDKLRWWSQSLQAYERRLQQEPNKVSNMVGLLRALDALGEYPRVLEMWR  1434

Query  1464  QEWDNLGRDARSRAGPLAAVAAWGLQDWEAMQEYVRCIPEETQDGS---FYRAVLAVHNE  1520
             Q    + +   S+   + A AAW L+ W+ M+     + +E   G+   FY+A LA   +
Sbjct  1435  QFSKRVSKREVSKLASMGAHAAWLLRRWDDMEHITSFMSDEDYTGTTALFYKATLAARKK  1494

Query  1521  DFETAQRLIDGTRDLLDTELTSMAGESYERAYGAMVCVQMLAELEEVIQYKLIPERREPL  1580
              F  A++LID  R  +D++L+++  ESY+RAY   V +Q L+ELEE+      P+     
Sbjct  1495  RFREAEKLIDMCRKRVDSKLSALVAESYDRAYDLFVGIQQLSELEELAMATSDPQSAMHW  1554

Query  1581  KSMWWKRLQGGPRLVEDWRRIIQVHSLVVRPQEDVHTWLKYASLCRKSGSLHLSHKTLVM  1640
             + +W +RL       E W   +  H+L+V P  ++  WL++ SL R  G   +S + L  
Sbjct  1555  RQLWERRL--SVMAYEGWPGTLANHTLLVPPSSEIDMWLRFVSLSRAHGQGSVSTEVLRE  1612

Query  1641  LLGTDPSTQPKEQLPYNQPQVTYAYTKHMAAAENMQGAYEQLSCFVNAFQAKLNCIGPEE  1700
             LLG + S +   +     P V     +H+        A  +L  +V    +K+   G + 
Sbjct  1613  LLG-NQSIESAIENGIPTPAVAMGSFQHLYETNQRDSAIARLQLYV----SKVEGSGAQH  1667

Query  1701  AAKQDHRLLARCYLRLGKW--QNKLQSSLEPEIVQGALDCFEKATENDPTCYKAWHLWAY  1758
              +++   + A C+ +L +W    K     E E+ Q       +ATE D +    W   A 
Sbjct  1668  VSREREDM-AVCHAKLAEWLVHQKKAHRTEDEL-QKIFHHLRRATELDKSNGSIWRTLAR  1725

Query  1759  MNFKVVQAQKQQLDKLAHTATNGDILQDKEKLIIEHAVQAVDGFFRSISLIKGNSLQDTL  1818
             ++    +A  +  D    +  +G            H ++A+  + RS+SL     L+D L
Sbjct  1726  VHR---EAATKPADGSDSSGASG------------HIMEALSAYLRSVSL--SEELEDAL  1768

Query  1819  RLLTLWFDYGQY--SEVYDALLTGMKTIEINTWLQVIPQLIARIDTHRKLVNQLIHHLLI  1876
               L+LWF YG     +V   L   ++ +    WL+VIPQ+IARI +    V   +++LL+
Sbjct  1769  GFLSLWFMYGPLLAVQVGSTLKEEIEEVNPTVWLKVIPQIIARISSPNGTVADSVYNLLV  1828

Query  1877  DISKYHPQALVYPLTVASKSA-------SVARKNAAFKILE---SMRKHYPTLVQQAMTC  1926
              +++ HPQA++Y L VA  S         V     + ++L     + ++   +V+ +   
Sbjct  1829  LVARRHPQAILYSLNVAHSSYQGKGTADGVEPLKGSHRVLARIAEIHQNGKAMVEDSALV  1888

Query  1927  SEELIRVAILWHEQWHEGLEEASRLYFADRNVKGMFDILEPLHALLARGPQTLKETSFSQ  1986
               EL+R A+LW E W   L  A   +   R+ + +   + PL   L R P+T+ E  F+ 
Sbjct  1889  CRELVRCAVLWPELWINELGRALYQWERQRSAENLLLAMGPLLEQLKR-PETMAEAQFAA  1947

Query  1987  AYGRELTEAYEWTQRYKTSSVLMDLDHAWDIYYHVFQKISRQLPQLTSLELPYVSPKL-M  2045
                + L  A    +R  +S     ++ A  I+  + ++I  Q+  ++SL L  VSPKL  
Sbjct  1948  ELRQPLENACCHVERAVSSRHEQFMEEARRIFVSIERRIREQISGMSSLALQLVSPKLHQ  2007

Query  2046  TCKNLELAVPGSYNPNQDLIRIDHIKTNLQVITSKQRPRKLCLRGSNGKDYMYLLKGHED  2105
               +NL L VPG Y  + +   I   +  L+V+ SKQRPR++ + GSNG+ Y +LLKGHED
Sbjct  2008  NGRNLSLVVPGQYREDGNYPLIASFQNVLKVLNSKQRPRRIYINGSNGEIYKFLLKGHED  2067

Query  2106  LRQDERVMQLFSLVNTLLLDDPDTFRRNLAIQRYAVIPLSTNSGLIGWVPHCDTLHTLIR  2165
             LR DERVMQL   VNT+L       R +  IQ Y+V PLS N+GL+GWV HCDTL+ +I 
Sbjct  2068  LRLDERVMQLLGFVNTILEKHSVAKRHDCLIQTYSVTPLSDNAGLVGWVDHCDTLNKIIE  2127

Query  2166  DYRDKRKMLLNQEHRLMLSVSPDYDHLTLMQKVEVFECALAQTQGDDLAKLLWLKSPSSE  2225
             DYR   +  +  E  LM S+  +  +LT +Q+VE FE AL +T+G DL +  W+K+PS+E
Sbjct  2128  DYRVNPR-CIRMELDLMRSMCDNLYYLTAIQRVEPFEFALERTEGVDLVRSFWVKAPSAE  2186

Query  2226  VWFERRTNYTRSLAVMSMVGYILGLGDRHPSNLMLDRMSGKILHIDFGDCFEVAMTHEKF  2285
              W ERRT Y  SLA MSMVG+ILGLGDRHPSNLM+   SG+++HIDFGDCFEVA      
Sbjct  2187  TWLERRTTYVCSLATMSMVGHILGLGDRHPSNLMIHAFSGRVVHIDFGDCFEVAQQRSIH  2246

Query  2286  PEKIPFRLTRMLIKAMEVTGIEGTYRRTCESVMLVLRRNKDSLMAVLEAFVYDPLLNWRL  2345
             PEK+PFRLTRML+KAME+ GIEG +R  C +VM VLR    SL+A+LEAFV+DPL++W  
Sbjct  2247  PEKVPFRLTRMLVKAMEMGGIEGLFRHGCHTVMNVLREEGGSLLALLEAFVHDPLVSW--  2304

Query  2346  LDMDKNHRSKSNNDPGGSGMAFGGGNGSLSNSVEE----PLLHSQLMSANRLMGGALMVA  2401
                       S N    S +      GS++N  EE     L  SQL    R      + A
Sbjct  2305  --WRDEAEGFSGNGQAASSVQTISVIGSMTNVAEEDSVGSLQLSQLSVQRRATTQQRVNA  2362

Query  2402  DITNS-----KASKVIKRVRSKLNGTDF-QTQ-----NSVAVPQQVDLLIQQATNNENLC  2450
             +I        K   V+KR++ KL G +F Q+Q     +   V +QV  LI++AT+NENLC
Sbjct  2363  NIEKDTSQTRKPKSVVKRIKRKLRGLEFPQSQEGKGSDGFTVEEQVSRLIEEATSNENLC  2422

Query  2451  QCYIGWCPFW  2460
               ++GWCPFW
Sbjct  2423  VHFLGWCPFW  2432



Lambda      K        H
   0.312    0.129    0.370 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4811699998


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jan 6, 2022  1:11 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= NP_001291914.1 uncharacterized protein C2orf47 homolog,
mitochondrial [Bactrocera dorsalis]

Length=246
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9W0X3_DROME  unnamed protein product                                 312     4e-108
A0A0B4LHN1_DROME  unnamed protein product                             167     1e-51 
LAM0_DROME  unnamed protein product                                   31.2    0.94  


>Q9W0X3_DROME unnamed protein product
Length=263

 Score = 312 bits (800),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 147/241 (61%), Positives = 185/241 (77%), Gaps = 4/241 (2%)

Query  8    RRTLVTSFKTKELCNNKLLLPNHRSSSNIP---NPDHSNFHLDGSRSLPRLMDFPETLWP  64
            R T+  S   +    +K   P  RS +++P   +    N     +R LPRLMDFPE +WP
Sbjct  22   RPTVAASGGQEAGSISKPTQPVSRSFASLPQEQDKKEQNARESLNR-LPRLMDFPEIVWP  80

Query  65   STINTLRNWILIQFIIRPYFDREFTIKDFVYGAKQALQIISRKLLNGEFDALNGFVSKEA  124
            S +N+L+NWI IQFIIRPYFD EF +KDF+YGAKQALQ++S KL+ G+ D+L+  VS EA
Sbjct  81   SALNSLKNWITIQFIIRPYFDSEFQLKDFIYGAKQALQVVSSKLMGGDLDSLDNLVSPEA  140

Query  125  INELKPTIQKLSVAQRKQLEINKTDIYFAFPYQVGIIFDEEQEKIQKRWVEITMVFHVLR  184
            I EL+P IQKLS+ QR+QLEI ++DIY +FPYQVGI+FD+  +K+QKR+VEITMVFHV+R
Sbjct  141  IAELRPVIQKLSMTQRRQLEIKESDIYLSFPYQVGIMFDDANDKLQKRFVEITMVFHVMR  200

Query  185  GLTEMRNRGEEIPWNMGSLPEYQDKVFVCNYRFKKEFTNGNVSDWTVNALNHFKPIDLVR  244
            GL+EMR RGEEIPWNMG+LPEYQDKVF+CNYRF KEFT G+ SDWTVN  N F+ IDL+ 
Sbjct  201  GLSEMRERGEEIPWNMGTLPEYQDKVFICNYRFVKEFTAGHQSDWTVNVANQFRAIDLIN  260

Query  245  E  245
            E
Sbjct  261  E  261


>A0A0B4LHN1_DROME unnamed protein product
Length=201

 Score = 167 bits (422),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 90/106 (85%), Gaps = 0/106 (0%)

Query  52   LPRLMDFPETLWPSTINTLRNWILIQFIIRPYFDREFTIKDFVYGAKQALQIISRKLLNG  111
            LPRLMDFPE +WPS +N+L+NWI IQFIIRPYFD EF +KDF+YGAKQALQ++S KL+ G
Sbjct  68   LPRLMDFPEIVWPSALNSLKNWITIQFIIRPYFDSEFQLKDFIYGAKQALQVVSSKLMGG  127

Query  112  EFDALNGFVSKEAINELKPTIQKLSVAQRKQLEINKTDIYFAFPYQ  157
            + D+L+  VS EAI EL+P IQKLS+ QR+QLEI ++DIY +FPYQ
Sbjct  128  DLDSLDNLVSPEAIAELRPVIQKLSMTQRRQLEIKESDIYLSFPYQ  173


 Score = 40.0 bits (92),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 20/27 (74%), Gaps = 0/27 (0%)

Query  219  KEFTNGNVSDWTVNALNHFKPIDLVRE  245
            +EFT G+ SDWTVN  N F+ IDL+ E
Sbjct  173  QEFTAGHQSDWTVNVANQFRAIDLINE  199


>LAM0_DROME unnamed protein product
Length=622

 Score = 31.2 bits (69),  Expect = 0.94, Method: Compositional matrix adjust.
 Identities = 14/54 (26%), Positives = 32/54 (59%), Gaps = 0/54 (0%)

Query  105  SRKLLNGEFDALNGFVSKEAINELKPTIQKLSVAQRKQLEINKTDIYFAFPYQV  158
            SR++   E+  ++G +S E   +LK ++Q+L     +Q++IN+ +I   +  ++
Sbjct  241  SRRIKQTEYSEIDGRLSSEYDAKLKQSLQELRAQYEEQMQINRDEIQSLYEDKI  294



Lambda      K        H
   0.323    0.139    0.422 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2140775808


Query= NP_001291915.1 glutathione S-transferase 1 [Bactrocera dorsalis]

Length=225
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9XYZ9_DROME  unnamed protein product                                 338     2e-119
Q7JVZ8_DROME  unnamed protein product                                 236     9e-79 
Q7JVI6_DROME  unnamed protein product                                 190     9e-61 


>Q9XYZ9_DROME unnamed protein product
Length=223

 Score = 338 bits (868),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 159/224 (71%), Positives = 191/224 (85%), Gaps = 2/224 (1%)

Query  1    MAKPVLYYATLSPPSRAVLLTANLLGLDLELRPVNLLKGEQLTDDFIKMNPQHTIPTMID  60
            M+KP LYYATLSPPSRAVLLTA  +GLDLELRP+NLLKGE LT +F+K+NPQHTIPT+ID
Sbjct  1    MSKPALYYATLSPPSRAVLLTAKAIGLDLELRPINLLKGEHLTPEFLKLNPQHTIPTLID  60

Query  61   ADGAVVYDSHAICGYLVDKYGE-DDKLYPKDLVKRAQVNARLHFDSGHLFARLRFLYEPI  119
             +  ++ DSHAIC YLV+KYG+ + +LYPK+LV+RA V+ARLH DSGHLFARLRFLYEPI
Sbjct  61   GEATII-DSHAICAYLVEKYGQKEQQLYPKELVQRANVDARLHLDSGHLFARLRFLYEPI  119

Query  120  LYSGSTDCSMDKIAYIQKTYEIMEEMLKEHPYVWGEDLTIADLCCVATITSVDEVAPIDE  179
            LY GSTDCS+DKIAYIQK +EI+E  LK+ PY+ G DLTIAD C VAT+TSV++ APIDE
Sbjct  120  LYYGSTDCSIDKIAYIQKCWEILEGFLKDQPYLCGSDLTIADFCAVATVTSVNDTAPIDE  179

Query  180  FKFPKLLAWMKRLSELPNYQKINQEGADELKKVFKEILTNNRTK  223
            FKFPK+ AW+KRL+ELP YQ++N +GADELK +FK  L  NR K
Sbjct  180  FKFPKMHAWLKRLAELPYYQEVNGDGADELKSIFKAKLAENRGK  223


>Q7JVZ8_DROME unnamed protein product
Length=225

 Score = 236 bits (601),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 115/224 (51%), Positives = 158/224 (71%), Gaps = 3/224 (1%)

Query  2    AKPVLYYATLSPPSRAVLLTANLLGLDLELRPVNLLKGEQLTDDFIKMNPQHTIPTMIDA  61
            AKP+LYYA  SPP RAVLLTA  LGL+L+LR VN+  GE  + +F+K+N QHTIP ++D 
Sbjct  3    AKPILYYAPRSPPCRAVLLTAAALGLELDLRLVNVKAGEHKSAEFLKLNAQHTIP-VLDD  61

Query  62   DGAVVYDSHAICGYLVDKYGE--DDKLYPKDLVKRAQVNARLHFDSGHLFARLRFLYEPI  119
            +G +V DSH IC YL DKY    DD LYPKD  KR  V+ARL++D GHLF R+RF+ EP+
Sbjct  62   NGTIVSDSHIICSYLADKYAPEGDDSLYPKDPEKRRLVDARLYYDCGHLFPRIRFIVEPV  121

Query  120  LYSGSTDCSMDKIAYIQKTYEIMEEMLKEHPYVWGEDLTIADLCCVATITSVDEVAPIDE  179
            +Y G+ +   D++AY+QK Y+ +E  L E  Y+ G+ LTIADL C+A++++ +  API+ 
Sbjct  122  IYFGAGEVPSDRVAYLQKAYDGLEHCLAEGDYLVGDKLTIADLSCIASVSTAEAFAPIEP  181

Query  180  FKFPKLLAWMKRLSELPNYQKINQEGADELKKVFKEILTNNRTK  223
             +FP+L+ W+KR+  LP YQK NQEG D L  + K +L   + K
Sbjct  182  DQFPRLVQWVKRIQALPYYQKNNQEGLDMLVGLVKGLLAERQQK  225


>Q7JVI6_DROME unnamed protein product
Length=226

 Score = 190 bits (482),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 87/226 (38%), Positives = 145/226 (64%), Gaps = 1/226 (0%)

Query  1    MAKPVLYYATLSPPSRAVLLTANLLGLDLELRPVNLLKGEQLTDDFIKMNPQHTIPTMID  60
            M+KP LYYA  SPP+RA +L A L+GLDLEL+PV+  K E L+++F+K+NPQH IP  +D
Sbjct  1    MSKPTLYYALFSPPARACILVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVD  60

Query  61   ADGAVVYDSHAICGYLVDKYGEDDKLYPKDLVKRAQVNARLHFDSGHLFARLRFLYEPIL  120
            +DG V  DSHAI  +LV KY  +D+LYP+DL +RA ++ R+H+++G LF  ++ +    +
Sbjct  61   SDGEVYVDSHAIVCFLVAKYAGNDQLYPRDLKRRAHIDHRMHYENGVLFQVVKDIVARNI  120

Query  121  YSGSTDCSMDKIAYIQKTYEIMEEMLKEHPYVWGEDLTIADLCCVATITSVDEVAPIDEF  180
            Y G  + +   +      Y  +E  L++  +V G +L++AD+    T+ ++D + P++  
Sbjct  121  YGGEGEYNPRSLTLCHNAYSDLEHFLQQGSFVVGNELSVADVSIHTTLVTLDLLIPVERE  180

Query  181  KFPKLLAWMKRLSE-LPNYQKINQEGADELKKVFKEILTNNRTKQK  225
            K+P+   WM+R+ + LP+ ++IN +GA  L+      +  N+ K +
Sbjct  181  KYPQTKQWMERMDKLLPDNEEINLKGARALQTRILSCMAENKAKSQ  226



Lambda      K        H
   0.323    0.139    0.422 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2140775808


Query= NP_001303920.1 protein kinase, interferon-inducible double stranded
RNA dependent activator [Bactrocera dorsalis]

Length=292
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q2Q0L3_DROME  unnamed protein product                                 294     3e-99
Q2Q0K9_DROME  unnamed protein product                                 291     2e-98
Q2Q0K8_DROME  unnamed protein product                                 291     3e-98


>Q2Q0L3_DROME unnamed protein product
Length=311

 Score = 294 bits (752),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 152/310 (49%), Positives = 209/310 (67%), Gaps = 18/310 (6%)

Query  1    MVGKSSVSVLQEYCAKNKVPPPTYEYLDEDDGSFCCKIEFMETEAVGIGRSKRDAKHNAA  60
            M  KS+VS LQE+CA+ ++  PTY ++  +DG + CK+E +E EA+G GRSKRDAKH AA
Sbjct  1    MDNKSAVSALQEFCARTQINLPTYSFIPGEDGGYVCKVELLEIEALGNGRSKRDAKHLAA  60

Query  61   AVIIKKLRLADA-------SQLADDGAA-SIPPIDMVVQLRDYCVQQSMPLPTFEIVQQA  112
            + I++K++L          S + D G   +    DMV +LRDYCV++ MPLP+ EIVQQ+
Sbjct  61   SNILRKIQLLPGIHGLMKDSTVGDLGEELTNLNRDMVKELRDYCVRREMPLPSIEIVQQS  120

Query  113  GTPDAPEFTALCTIASIRRYGVSEKKKDARQKAAYEMLLAVVDDVNKLEQN-MQIAT---  168
            GTP APEF A C++ASI RYG S+KKKDARQ+AA EML  +  + + L  + MQ+A+   
Sbjct  121  GTPSAPEFVACCSVASIVRYGKSDKKKDARQRAAIEMLALISSNSDNLRPDQMQVASTSK  180

Query  169  -----LQNAQEDIESERYKKFKTYRELTESGTGDIRGVLICDRHNYFKKFYPEL-KEAAN  222
                 ++ + E++E+ R KKF TY EL E+G+ D  G+ +CDRHNYFK FYP L KEA  
Sbjct  181  LKVVDMEESMEELEALRRKKFTTYWELKEAGSVDHTGMRLCDRHNYFKNFYPTLKKEAIE  240

Query  223  KILRSSYDSVQDQALDVLESLKITPKISQMPSIKAEPMLFIELNCEYDVVFAGPTYKVYE  282
             I    Y+S +D+A+DV+ SLKITPKIS++ S    P+L +ELNC +DVV  G    +Y+
Sbjct  241  AINSDEYESSKDKAMDVMSSLKITPKISEVESSSLVPLLSVELNCAFDVVLMGKETDIYD  300

Query  283  DIIAYFKVML  292
             II YF+ ML
Sbjct  301  HIIDYFRTML  310


>Q2Q0K9_DROME unnamed protein product
Length=311

 Score = 291 bits (746),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/310 (49%), Positives = 208/310 (67%), Gaps = 18/310 (6%)

Query  1    MVGKSSVSVLQEYCAKNKVPPPTYEYLDEDDGSFCCKIEFMETEAVGIGRSKRDAKHNAA  60
            M  KS+VS LQE+CA+ ++  PTY ++  +DG + CK+E +E EA+G GRSKRDAKH AA
Sbjct  1    MDNKSAVSALQEFCARTQINLPTYSFIPGEDGGYVCKVELLEIEAIGNGRSKRDAKHLAA  60

Query  61   AVIIKKLRLADA-------SQLADDGAA-SIPPIDMVVQLRDYCVQQSMPLPTFEIVQQA  112
            + I++K++L          S + D G   +    DMV +LRDYCV++ MPLP+ EIVQQ+
Sbjct  61   SNILRKIQLLPGIHGLMKDSTVGDLGEELTNLNRDMVKELRDYCVRREMPLPSIEIVQQS  120

Query  113  GTPDAPEFTALCTIASIRRYGVSEKKKDARQKAAYEMLLAVVDDVNKLEQN-MQIAT---  168
            GTP APEF A C++ASI RYG S+KKKDARQ+AA EML  +  + + L  + MQ+A+   
Sbjct  121  GTPSAPEFVACCSVASIVRYGKSDKKKDARQRAAIEMLALISSNSDNLRPDQMQVASTSK  180

Query  169  -----LQNAQEDIESERYKKFKTYRELTESGTGDIRGVLICDRHNYFKKFYPEL-KEAAN  222
                 ++ + E++E+ R KKF TY EL E+G+ D  G+ +CDRHNYFK FYP L KEA  
Sbjct  181  LKVVDMEESMEELEALRRKKFTTYWELKEAGSVDHTGMRLCDRHNYFKNFYPTLKKEAIE  240

Query  223  KILRSSYDSVQDQALDVLESLKITPKISQMPSIKAEPMLFIELNCEYDVVFAGPTYKVYE  282
             I    Y+S +D+A+DV+ SLKITPKIS++ S    P+L +ELNC +DVV       +Y+
Sbjct  241  AINSDEYESSKDKAMDVMSSLKITPKISEVESSSLVPLLSVELNCAFDVVLMAKETDIYD  300

Query  283  DIIAYFKVML  292
             II YF+ ML
Sbjct  301  HIIDYFRTML  310


>Q2Q0K8_DROME unnamed protein product
Length=311

 Score = 291 bits (745),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 150/310 (48%), Positives = 207/310 (67%), Gaps = 18/310 (6%)

Query  1    MVGKSSVSVLQEYCAKNKVPPPTYEYLDEDDGSFCCKIEFMETEAVGIGRSKRDAKHNAA  60
            M  KS+VS LQE+CA+ ++  PTY ++  +DG + CK+E +E EA+G GRSKRDAKH AA
Sbjct  1    MDNKSAVSALQEFCARTQINLPTYSFIPGEDGGYVCKVELLEIEAIGNGRSKRDAKHLAA  60

Query  61   AVIIKKLRLADA-------SQLADDGAA-SIPPIDMVVQLRDYCVQQSMPLPTFEIVQQA  112
            + I++K++L          S + D G   +    DMV +LRDYCV++ MPLP  E+VQQ+
Sbjct  61   SNILRKIQLLPGIHGLMKDSTVGDLGEELTNLNRDMVKELRDYCVRREMPLPCIEVVQQS  120

Query  113  GTPDAPEFTALCTIASIRRYGVSEKKKDARQKAAYEMLLAVVDDVNKLEQN-MQIAT---  168
            GTP APEF A C++ASI RYG S+KKKDARQ+AA EML  +  + + L  + MQ+A+   
Sbjct  121  GTPSAPEFVACCSVASIVRYGKSDKKKDARQRAAIEMLALISSNSDNLRPDQMQVASTSK  180

Query  169  -----LQNAQEDIESERYKKFKTYRELTESGTGDIRGVLICDRHNYFKKFYPEL-KEAAN  222
                 ++ + E++E+ R KKF TY EL E+G+ D  G+ +CDRHNYFK FYP L KEA  
Sbjct  181  LKVVDMEESMEELEASRRKKFTTYWELKEAGSVDHTGMRLCDRHNYFKNFYPTLKKEAIE  240

Query  223  KILRSSYDSVQDQALDVLESLKITPKISQMPSIKAEPMLFIELNCEYDVVFAGPTYKVYE  282
             I    Y+S +D+A+DV+ SLKITPKIS++ S    P+L +ELNC +DVV       +Y+
Sbjct  241  AINSDEYESSKDKAMDVMSSLKITPKISEVESSSLVPLLSVELNCAFDVVLMAKETDIYD  300

Query  283  DIIAYFKVML  292
             II YF+ ML
Sbjct  301  HIIDYFRTML  310



Lambda      K        H
   0.323    0.139    0.422 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2140775808


Query= NP_001304341.1 60 kDa heat shock protein, mitochondrial [Bactrocera
dorsalis]

Length=573
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CH60A_DROME  unnamed protein product                                  1003    0.0  
CH60C_DROME  unnamed protein product                                  913     0.0  
CH60_CAEEL  unnamed protein product                                   768     0.0  


>CH60A_DROME unnamed protein product
Length=573

 Score = 1003 bits (2594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 500/549 (91%), Positives = 529/549 (96%), Gaps = 0/549 (0%)

Query  1    MLRLPLRLARANIQRQLFVRSYAKDVKFGPEVRALMLQGVDVLADAVAVTMGPKGRNVII  60
            M RLP+ LAR++I RQL +R YAKDV+FGPEVRA+MLQGVDVLADAVAVTMGPKGRNVII
Sbjct  1    MFRLPVSLARSSISRQLAMRGYAKDVRFGPEVRAMMLQGVDVLADAVAVTMGPKGRNVII  60

Query  61   EQSWGSPKITKDGVTVAKSIELKDKFQNIGAKLVQDVANNTNEEAGDGTTTATVLARAIA  120
            EQSWGSPKITKDGVTVAKSIELKDKFQNIGAKLVQDVANNTNEEAGDGTTTATVLARAIA
Sbjct  61   EQSWGSPKITKDGVTVAKSIELKDKFQNIGAKLVQDVANNTNEEAGDGTTTATVLARAIA  120

Query  121  KEGFEKISKGANPVEIRRGVMLAVDNVKDHLKAMSRPVSTPEEIAQVATISANGDQEVGN  180
            KEGFEKISKGANPVEIRRGVMLAV+ VKD+LK MSRPVSTPEEIAQVATISANGDQ +GN
Sbjct  121  KEGFEKISKGANPVEIRRGVMLAVETVKDNLKTMSRPVSTPEEIAQVATISANGDQAIGN  180

Query  181  LISEAMKRVGRDGVITVKDGKTLLDELEVIEGMKFDRGYISPYFINSSKGAKVEFQDALI  240
            LISEAMK+VGRDGVITVKDGKTL DELEVIEGMKFDRGYISPYFINSSKGAKVEFQDAL+
Sbjct  181  LISEAMKKVGRDGVITVKDGKTLTDELEVIEGMKFDRGYISPYFINSSKGAKVEFQDALL  240

Query  241  LLSEKKISSVQTIIPALELANSQRKPLVIIAEDIDGEALSTLVVNRLKIGLQVAAVKAPG  300
            LLSEKKISSVQ+IIPALELAN+QRKPLVIIAEDIDGEALSTLVVNRLKIGLQVAAVKAPG
Sbjct  241  LLSEKKISSVQSIIPALELANAQRKPLVIIAEDIDGEALSTLVVNRLKIGLQVAAVKAPG  300

Query  301  FGDNRKSTLTDMAIASGGIVFGDDANLVKLEDVQINDLGKVGEVVITKDDTLLLKGKGKK  360
            FGDNRKSTLTDMAIASGGIVFGDDA+LVKLEDV+++DLG+VGEVVITKDDTLLLKGKGKK
Sbjct  301  FGDNRKSTLTDMAIASGGIVFGDDADLVKLEDVKVSDLGQVGEVVITKDDTLLLKGKGKK  360

Query  361  EDISRRVEQIKDQINETTSEYEKEKLQERLARLASGVALLRVGGSSEVEVNEKKDRVHDA  420
            +D+ RR  QIKDQI +TTSEYEKEKLQERLARLASGVALLRVGGSSEVEVNEKKDRVHDA
Sbjct  361  DDVLRRANQIKDQIEDTTSEYEKEKLQERLARLASGVALLRVGGSSEVEVNEKKDRVHDA  420

Query  421  LNATRAAVEEGIVPGGGTALLRCIPILEGLKGSNEDQNMGIEIVRRALRMPCMTIAKNAG  480
            LNATRAAVEEGIVPGGGTALLRCI  LEG++ +NEDQ +G+EIVRRALRMPCMTIAKNAG
Sbjct  421  LNATRAAVEEGIVPGGGTALLRCIEKLEGVETTNEDQKLGVEIVRRALRMPCMTIAKNAG  480

Query  481  VDGAMVVAKVETKEGDFGYDALKAEYGNLIEKGIIDPTKVVRTAITDASGVASLLTTAEA  540
            VDGAMVVAKVE + GD+GYDALK EYGNLIEKGIIDPTKVVRTAITDASGVASLLTTAEA
Sbjct  481  VDGAMVVAKVENQAGDYGYDALKGEYGNLIEKGIIDPTKVVRTAITDASGVASLLTTAEA  540

Query  541  VVTEIPKEE  549
            VVTEIPKE+
Sbjct  541  VVTEIPKED  549


>CH60C_DROME unnamed protein product
Length=576

 Score = 913 bits (2359),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/550 (81%), Positives = 506/550 (92%), Gaps = 1/550 (0%)

Query  1    MLRLPLRLAR-ANIQRQLFVRSYAKDVKFGPEVRALMLQGVDVLADAVAVTMGPKGRNVI  59
            M R    L R A I   L+ R+YAKDV+FGPEVRA+MLQGVDVLADAVAVTMGPKGRNVI
Sbjct  4    MFRYTNTLQRTAKISHVLWARNYAKDVRFGPEVRAMMLQGVDVLADAVAVTMGPKGRNVI  63

Query  60   IEQSWGSPKITKDGVTVAKSIELKDKFQNIGAKLVQDVANNTNEEAGDGTTTATVLARAI  119
            IEQSWGSPKITKDGVTVAKSI LKDKFQNIGAKLVQDVANNTNEEAGDGTTTATVLARAI
Sbjct  64   IEQSWGSPKITKDGVTVAKSIALKDKFQNIGAKLVQDVANNTNEEAGDGTTTATVLARAI  123

Query  120  AKEGFEKISKGANPVEIRRGVMLAVDNVKDHLKAMSRPVSTPEEIAQVATISANGDQEVG  179
            AKEGFEKIS+GA+PVEIRRGVMLA++ VKD+L+ +SRPV+TPEEI QVATISANGD+ VG
Sbjct  124  AKEGFEKISRGASPVEIRRGVMLAIETVKDNLRRLSRPVNTPEEICQVATISANGDKSVG  183

Query  180  NLISEAMKRVGRDGVITVKDGKTLLDELEVIEGMKFDRGYISPYFINSSKGAKVEFQDAL  239
            NLISEA+K+VGRDGVITVKDGKTL DELEVIEGMKFDRGYISPYFIN+SKGAKVEFQDAL
Sbjct  184  NLISEAIKKVGRDGVITVKDGKTLCDELEVIEGMKFDRGYISPYFINTSKGAKVEFQDAL  243

Query  240  ILLSEKKISSVQTIIPALELANSQRKPLVIIAEDIDGEALSTLVVNRLKIGLQVAAVKAP  299
            +L  EKKI S  +I+PALELAN+QRKPLVIIAED++ EALSTLVVNRLK+GLQV AVKAP
Sbjct  244  LLFCEKKIKSAPSIVPALELANAQRKPLVIIAEDLEAEALSTLVVNRLKVGLQVCAVKAP  303

Query  300  GFGDNRKSTLTDMAIASGGIVFGDDANLVKLEDVQINDLGKVGEVVITKDDTLLLKGKGK  359
            GFGDNRK  L DMA+A+GGIVFGD+AN+V+LED++++D G+VGEVV++KDDT+LLKGKG+
Sbjct  304  GFGDNRKENLMDMAVATGGIVFGDEANMVRLEDIKMSDFGRVGEVVVSKDDTMLLKGKGQ  363

Query  360  KEDISRRVEQIKDQINETTSEYEKEKLQERLARLASGVALLRVGGSSEVEVNEKKDRVHD  419
            K ++ +RVE +++ I E+TS YEKEK+QERLARL+SGVALLRVGGSS+VEV+EKKDRV D
Sbjct  364  KAEVEKRVEGLREAIKESTSSYEKEKMQERLARLSSGVALLRVGGSSDVEVSEKKDRVID  423

Query  420  ALNATRAAVEEGIVPGGGTALLRCIPILEGLKGSNEDQNMGIEIVRRALRMPCMTIAKNA  479
            ALNATRAAVEEGIVPGGGTALLRCI  L  LKG+NEDQNMGIEI+RRALRMPC+TIAKNA
Sbjct  424  ALNATRAAVEEGIVPGGGTALLRCIQKLNDLKGANEDQNMGIEIIRRALRMPCLTIAKNA  483

Query  480  GVDGAMVVAKVETKEGDFGYDALKAEYGNLIEKGIIDPTKVVRTAITDASGVASLLTTAE  539
            GVDGAMVVAKVE  +GD+GYDALK EYGN+IE+GIIDPTKVVRTAI+DA+GVASLLTTAE
Sbjct  484  GVDGAMVVAKVEILDGDYGYDALKGEYGNMIERGIIDPTKVVRTAISDAAGVASLLTTAE  543

Query  540  AVVTEIPKEE  549
            AVVTE+P EE
Sbjct  544  AVVTELPLEE  553


>CH60_CAEEL unnamed protein product
Length=568

 Score = 768 bits (1982),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/546 (71%), Positives = 457/546 (84%), Gaps = 2/546 (0%)

Query  6    LRLARANIQRQLFVRSYAKDVKFGPEVRALMLQGVDVLADAVAVTMGPKGRNVIIEQSWG  65
            LRLAR  +Q  + VRSYAKDVKFG E R  ML GV++LADAV+VTMGPKGRNVIIEQSWG
Sbjct  2    LRLARKGLQTAV-VRSYAKDVKFGAEGRQAMLVGVNLLADAVSVTMGPKGRNVIIEQSWG  60

Query  66   SPKITKDGVTVAKSIELKDKFQNIGAKLVQDVANNTNEEAGDGTTTATVLARAIAKEGFE  125
            SPKITKDGVTVAKSI+LKDK+QN+GAKL+QDVAN  NEEAGDGTT ATVLARAIAKEGFE
Sbjct  61   SPKITKDGVTVAKSIDLKDKYQNLGAKLIQDVANKANEEAGDGTTCATVLARAIAKEGFE  120

Query  126  KISKGANPVEIRRGVMLAVDNVKDHLKAMSRPVSTPEEIAQVATISANGDQEVGNLISEA  185
             I +G N VEIRRGVM AV+ V   LK +S+ V+TPEEIAQVATISANGD  VGNLIS+A
Sbjct  121  SIRQGGNAVEIRRGVMNAVEVVVAELKKISKKVTTPEEIAQVATISANGDTVVGNLISDA  180

Query  186  MKRVGRDGVITVKDGKTLLDELEVIEGMKFDRGYISPYFINSSKGAKVEFQDALILLSEK  245
            MK+VG  GVITVKDGKTL DELE+IEGMKFDRGYISPYFI S+KGAKVE++ AL+LLSEK
Sbjct  181  MKKVGTTGVITVKDGKTLNDELELIEGMKFDRGYISPYFITSAKGAKVEYEKALVLLSEK  240

Query  246  KISSVQTIIPALELANSQRKPLVIIAEDIDGEALSTLVVNRLKIGLQVAAVKAPGFGDNR  305
            KIS VQ I+PALELAN  R+PLVIIAED+DGEAL+TLV+NRLK+GLQV A+KAPGFGDNR
Sbjct  241  KISQVQDIVPALELANKLRRPLVIIAEDVDGEALTTLVLNRLKVGLQVVAIKAPGFGDNR  300

Query  306  KSTLTDMAIASGGIVFGDDANLVKLEDVQINDLGKVGEVVITKDDTLLLKGKGKKEDISR  365
            K+TL DM IA+G  +FGDD+NL+K+ED+  NDLG+V EV ITKDDTLLL+G+G + +I +
Sbjct  301  KNTLKDMGIATGATIFGDDSNLIKIEDITANDLGEVDEVTITKDDTLLLRGRGDQTEIEK  360

Query  366  RVEQIKDQINETTSEYEKEKLQERLARLASGVALLRVGGSSEVEVNEKKDRVHDALNATR  425
            R+E I D+I ++TS+YEKEKL ERLA+L+ GVA+L++GG SEVEV EKKDRV DAL ATR
Sbjct  361  RIEHITDEIEQSTSDYEKEKLNERLAKLSKGVAVLKIGGGSEVEVGEKKDRVTDALCATR  420

Query  426  AAVEEGIVPGGGTALLRCIPILEGLKGSNEDQNMGIEIVRRALRMPCMTIAKNAGVDGAM  485
            AAVEEGIVPGGG ALLR +  L+  K +NEDQ +G+ IV++AL  P  TI KNAG++ + 
Sbjct  421  AAVEEGIVPGGGVALLRSLTALKNYKAANEDQQIGVNIVKKALTQPIATIVKNAGLEPSS  480

Query  486  VVAKVE-TKEGDFGYDALKAEYGNLIEKGIIDPTKVVRTAITDASGVASLLTTAEAVVTE  544
            ++ +V       +GYDAL  ++ ++ E GIIDPTKVVRTA+ DASGVASLL T E VVTE
Sbjct  481  IIDEVTGNSNTSYGYDALNGKFVDMFEAGIIDPTKVVRTALQDASGVASLLATTECVVTE  540

Query  545  IPKEEA  550
            IPKEEA
Sbjct  541  IPKEEA  546



Lambda      K        H
   0.323    0.139    0.422 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2140775808


Query= NP_001306710.1 v-akt murine thymoma viral oncogene homolog 1
[Bactrocera dorsalis]

Length=536
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

AKT1_DROME  unnamed protein product                                   889     0.0  
AKT1_CAEEL  unnamed protein product                                   560     0.0  
AKT2_CAEEL  unnamed protein product                                   531     0.0  


>AKT1_DROME unnamed protein product
Length=611

 Score = 889 bits (2297),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/541 (81%), Positives = 478/541 (88%), Gaps = 11/541 (2%)

Query  6    TAAPNSSSSTAAIGLS-PTYEPLGGGPHA-----TIVKEGWLQKRGEHIKTWRSRYFILR  59
            +AAP   S T +I  +     P     HA      +VKEGWL KRGEHIK WR RYF+L 
Sbjct  72   SAAPTHDSGTMSINTTFDLSSPSVTSGHALTEQTQVVKEGWLMKRGEHIKNWRQRYFVLH  131

Query  60   DDGTLMGYKSPPVNNA--PAD-PLNNFTVRGCQIMTVDRPKPFTFIIRGLQWTNVIERTF  116
             DG LMGY+S P ++A  P+D  LNNFTVRGCQIMTVDRPKPFTFIIRGLQWT VIERTF
Sbjct  132  SDGRLMGYRSKPADSASTPSDFLLNNFTVRGCQIMTVDRPKPFTFIIRGLQWTTVIERTF  191

Query  117  CVEREIERQQWTDAIRNVASRLSELGETAMSPSTSTDMSDVDMASIAEVELRNSFSVQGT  176
             VE E+ERQQWT+AIRNV+SRL ++GE AM+PS  TDM+DVDMA+IAE EL   FSVQGT
Sbjct  192  AVESELERQQWTEAIRNVSSRLIDVGEVAMTPSEQTDMTDVDMATIAEDELSEQFSVQGT  251

Query  177  TKRSSGGVKKVTLENFEFIKVLGKGTFGKVILCREKATAKLYAIKILKKEVIIQKDEIAH  236
            T  SSG VKKVTLENFEF+KVLGKGTFGKVILCREKATAKLYAIKILKKEVIIQKDE+AH
Sbjct  252  TCNSSG-VKKVTLENFEFLKVLGKGTFGKVILCREKATAKLYAIKILKKEVIIQKDEVAH  310

Query  237  TITESRVLQTTNHPFLISLKYSFQTNDRLCFVMQYVNGGELFFHLSRERIFSEDRTRFYG  296
            T+TESRVL++TNHPFLISLKYSFQTNDRLCFVMQYVNGGELF+HLS ERIF+EDRTRFYG
Sbjct  311  TLTESRVLKSTNHPFLISLKYSFQTNDRLCFVMQYVNGGELFWHLSHERIFTEDRTRFYG  370

Query  297  AEIISALGYLHSQGIIYRDLKLENLLLDKDGHIKIADFGLCKEDITYGRTTKTFCGTPEY  356
            AEIISALGYLHSQGIIYRDLKLENLLLDKDGHIK+ADFGLCKEDITYGRTTKTFCGTPEY
Sbjct  371  AEIISALGYLHSQGIIYRDLKLENLLLDKDGHIKVADFGLCKEDITYGRTTKTFCGTPEY  430

Query  357  LAPEVLEDNDYGHAVDWWGTGVVMYEMICGRLPFFNQDHDVLFTLILMEEVRFPRTISDE  416
            LAPEVL+DNDYG AVDWWGTGVVMYEMICGRLPF+N+DHDVLFTLIL+EEV+FPR I+DE
Sbjct  431  LAPEVLDDNDYGQAVDWWGTGVVMYEMICGRLPFYNRDHDVLFTLILVEEVKFPRNITDE  490

Query  417  ARSLLAGLLAKDPRQRLGGGQDDVKEIQAHPFFASINWTDLVNKRITPPFKPQVVSDTDT  476
            A++LLAGLLAKDP++RLGGG+DDVKEIQAHPFFASINWTDLV K+I PPFKPQV SDTDT
Sbjct  491  AKNLLAGLLAKDPKKRLGGGKDDVKEIQAHPFFASINWTDLVLKKIPPPFKPQVTSDTDT  550

Query  477  RYFDTEFTGESVELTPPDPAGTLGSIAEEPLFAQFSYQ-DMASTLGNSSHISSSAGLASM  535
            RYFD EFTGESVELTPPDP G LGSIAEEPLF QFSYQ DMASTLG SSHIS+S  LASM
Sbjct  551  RYFDKEFTGESVELTPPDPTGPLGSIAEEPLFPQFSYQGDMASTLGTSSHISTSTSLASM  610

Query  536  Q  536
            Q
Sbjct  611  Q  611


>AKT1_CAEEL unnamed protein product
Length=541

 Score = 560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/520 (53%), Positives = 354/520 (68%), Gaps = 29/520 (6%)

Query  35   IVKEGWLQKRGEHIKTWRSRYFILRDDGTLMGYKSPPVNNAP-ADPLNNFTVRGCQIMTV  93
            +V EGWL K+GEHI+ WR RYF++ +DG L+G+++ P    P  +PLN+F ++    M  
Sbjct  16   VVIEGWLHKKGEHIRNWRPRYFMIFNDGALLGFRAKPKEGQPFPEPLNDFMIKDAATMLF  75

Query  94   DRPKPFTFIIRGLQWTNVIERTFCVEREIERQQWTDAIRNVASRLS--------ELGETA  145
            ++P+P  F++R LQWT VIERTF  E    RQ+W  AI +++ +          EL ET 
Sbjct  76   EKPRPNMFMVRCLQWTTVIERTFYAESAEVRQRWIHAIESISKKYKGTNANPQEELMETN  135

Query  146  MSPSTSTDMSDVDMASI------------AEVELRNSF-SVQGTTKRSSGGVKKVTLENF  192
              P    D      A                ++ R S  S+  T++  +    K+T+E+F
Sbjct  136  QQPKIDEDSEFAGAAHAIMGQPSSGHGDNCSIDFRASMISIADTSE--AAKRDKITMEDF  193

Query  193  EFIKVLGKGTFGKVILCREKATAKLYAIKILKKEVIIQKDEIAHTITESRVLQTTNHPFL  252
            +F+KVLGKGTFGKVILC+EK T KLYAIKILKK+VII ++E+AHT+TE+RVLQ   HPFL
Sbjct  194  DFLKVLGKGTFGKVILCKEKRTQKLYAIKILKKDVIIAREEVAHTLTENRVLQRCKHPFL  253

Query  253  ISLKYSFQTNDRLCFVMQYVNGGELFFHLSRERIFSEDRTRFYGAEIISALGYLHSQGII  312
              LKYSFQ    LCFVMQ+ NGGELF H+ +   FSE R RFYGAEI+ ALGYLH   I+
Sbjct  254  TELKYSFQEQHYLCFVMQFANGGELFTHVRKCGTFSEPRARFYGAEIVLALGYLHRCDIV  313

Query  313  YRDLKLENLLLDKDGHIKIADFGLCKEDITYGRTTKTFCGTPEYLAPEVLEDNDYGHAVD  372
            YRD+KLENLLLDKDGHIKIADFGLCKE+I++G  T TFCGTPEYLAPEVL+D+DYG  VD
Sbjct  314  YRDMKLENLLLDKDGHIKIADFGLCKEEISFGDKTSTFCGTPEYLAPEVLDDHDYGRCVD  373

Query  373  WWGTGVVMYEMICGRLPFFNQDHDVLFTLILMEEVRFPRTISDEARSLLAGLLAKDPRQR  432
            WWG GVVMYEM+CGRLPF+++DH+ LF LI+  ++RFP  +S EAR+LL GLL KDP QR
Sbjct  374  WWGVGVVMYEMMCGRLPFYSKDHNKLFELIMAGDLRFPSKLSQEARTLLTGLLVKDPTQR  433

Query  433  LGGGQDDVKEIQAHPFFASINWTDLVNKRITPPFKPQVVSDTDTRYFDTEFTGESVELTP  492
            LGGG +D  EI    FF +++W     K I PP+KP V S+TDT YFD EFT + V+LTP
Sbjct  434  LGGGPEDALEICRADFFRTVDWEATYRKEIEPPYKPNVQSETDTSYFDNEFTSQPVQLTP  493

Query  493  PDPAGTLGSIAEEPL----FAQFSYQDMASTLGNSSHISS  528
            P  +G L ++ E+      F QFS+ ++  ++ N  H +S
Sbjct  494  PSRSGALATVDEQEEMQSNFTQFSFHNVMGSI-NRIHEAS  532


>AKT2_CAEEL unnamed protein product
Length=528

 Score = 531 bits (1367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/511 (52%), Positives = 348/511 (68%), Gaps = 16/511 (3%)

Query  35   IVKEGWLQKRGEHIKTWRSRYFILRDDGTLMGYKSPPVNNAP-ADPLNNFTVRGCQIMTV  93
            IV E WL K+GEHI+ WR RYFIL  DGTL+G++S P  + P  +PLNNF +R    + +
Sbjct  13   IVIESWLHKKGEHIRNWRPRYFILFRDGTLLGFRSKPKEDQPLPEPLNNFMIRDAATVCL  72

Query  94   DRPKPFTFIIRGLQWTNVIERTFCVEREIERQQWTDAIRNVAS--RLSE-LGETAMSPST  150
            D+P+P  FI+R LQWT VIERTF  +    RQ W +AI+ V+S  RL E  G T+M    
Sbjct  73   DKPRPNMFIVRCLQWTTVIERTFYADSADFRQMWIEAIQAVSSHNRLKENAGNTSMQEED  132

Query  151  S----TDMSDVDMASIAEVELRNSFSVQGTTKRSSGGVKK---VTLENFEFIKVLGKGTF  203
            +    +  SDV+M + +     N F            V +   VT+++F+F+KVLG+GTF
Sbjct  133  TNGNPSGESDVNMDATS-TRSDNDFESTVMNIDEPEEVPRKNTVTMDDFDFLKVLGQGTF  191

Query  204  GKVILCREKATAKLYAIKILKKEVIIQKDEIAHTITESRVLQTTNHPFLISLKYSFQTND  263
            GKVILCREK++ KLYAIKI++KE+++ + E+AHT+TE+RVL    HPFL  LKYSFQ   
Sbjct  192  GKVILCREKSSDKLYAIKIIRKEMVVDRSEVAHTLTENRVLYACVHPFLTLLKYSFQAQY  251

Query  264  RLCFVMQYVNGGELFFHLSRERIFSEDRTRFYGAEIISALGYLHSQGIIYRDLKLENLLL  323
             +CFVM++ NGGELF HL R + FSE RTRFYG+EII ALGYLH + I+YRD+KLENLLL
Sbjct  252  HICFVMEFANGGELFTHLQRCKTFSEARTRFYGSEIILALGYLHHRNIVYRDMKLENLLL  311

Query  324  DKDGHIKIADFGLCKEDITYGRTTKTFCGTPEYLAPEVLEDNDYGHAVDWWGTGVVMYEM  383
            D+DGHIKI DFGLCKE+I YG  T TFCGTPEYLAPEV+ED DY  +VDWWG GVVMYEM
Sbjct  312  DRDGHIKITDFGLCKEEIKYGDKTSTFCGTPEYLAPEVIEDIDYDRSVDWWGVGVVMYEM  371

Query  384  ICGRLPFFNQDHDVLFTLILMEEVRFPRTISDEARSLLAGLLAKDPRQRLGGGQDDVKEI  443
            +CGRLPF  +++  LF LI   +++FP  +S EA +LL+GLL + P +RLG G DD +E+
Sbjct  372  MCGRLPFSAKENGKLFELITTCDLKFPNRLSPEAVTLLSGLLERVPAKRLGAGPDDAREV  431

Query  444  QAHPFFASINWTDLVNKRITPPFKPQVVSDTDTRYFDTEFTGESVELTPPDPAGTLGSIA  503
                FF  ++W   + K + PPFKP V+S+TDT +FD EFT   V+LTPP     L ++ 
Sbjct  432  SRAEFFKDVDWEATLRKEVEPPFKPNVMSETDTSFFDREFTSMPVQLTPPRRGEELPTVD  491

Query  504  EEPL----FAQFSYQDMASTLGNSSHISSSA  530
            EE      F QF+   ++ +L  S   + SA
Sbjct  492  EEEELQANFIQFASYYVSGSLERSYDTNRSA  522



Lambda      K        H
   0.323    0.139    0.422 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2140775808


Query= NP_001306711.1 insulin receptor substrate 1 [Bactrocera dorsalis]

Length=946
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

IRS1_DROME  unnamed protein product                                   388     2e-119
Q9W3R6_DROME  unnamed protein product                                 50.4    5e-06 
DOS_DROME  unnamed protein product                                    33.1    1.5   


>IRS1_DROME unnamed protein product
Length=968

 Score = 388 bits (996),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 270/687 (39%), Positives = 384/687 (56%), Gaps = 102/687 (15%)

Query  10   EDGLMLSGYQKKLNTMKKKFFVLYRDTTQESARLEYFDSMRKFKSGLAPKRVVKLENCFN  69
            +DG+ LSGY KKL TMKKKFFVLY +T+  +ARLEY+D+ +KF     PKRV+ L+NCFN
Sbjct  6    DDGMALSGYLKKLKTMKKKFFVLYEETSTSAARLEYYDTEKKFLQRAEPKRVIYLKNCFN  65

Query  70   INRRLDTKYDYVIALATKDGGFGMVLETEAEMLKWLQALLSLQRSITNKDDILLPKFDHV  129
            INRRLDTK+ +VI L+++DGGFG+VLE E ++ KWL  LL LQR+I N +      +DHV
Sbjct  66   INRRLDTKHRFVIVLSSRDGGFGIVLENENDLRKWLDKLLVLQRNIANSNGTAHSPYDHV  125

Query  130  WQVVVQKKSLAEERKIIGNYHVCLSPKSVTFIRIGSEKSSSGYIRATDIHIPLNTIRRCG  189
            WQVV+QKK ++E+  I G YH CL+ KS+TF+ IG EK+ +G  R   I I L TIRRCG
Sbjct  126  WQVVIQKKGISEKVGITGTYHCCLTSKSLTFVCIGPEKTPNGEDRVASIEILLTTIRRCG  185

Query  190  DS--HCLFYMEVGRQCIIGPGELWMDTEDPLVAQSMHKMISSAMSV--------------  233
             +   C+FY+E+GRQ ++G G+LWM+T++  +A +MH  I SAMS               
Sbjct  186  HASPQCIFYVELGRQSVLGSGDLWMETDNAAIATNMHNTILSAMSAKTESNTNLINVYQN  245

Query  234  RIDVIGDNIRKRSSSVTETSKPMSFMDTGNLRAENKICNMNQTANYNLGRGRCDSFPTRT  293
            R D+  + +RKRSSS  E SKP++     N +   ++ + +   NY  GR RCDS PTR 
Sbjct  246  RPDLSHEPMRKRSSSANEASKPINVNVIQNSQNSLELRSCSSPHNYGFGRERCDSLPTRN  305

Query  294  RESNDDANQS-FKSSHIHNVPCTATPRILALSRYSTSP----PIVSSFGSTERKESVKLD  348
               ++ +NQ+ F S+H       +  R  + +++S SP    P+  S          + D
Sbjct  306  GTLSESSNQTYFGSNHGLRSNTISGIRPHSTNKHSNSPTFTMPLRCSESEESSISVDESD  365

Query  349  DQEETGNYLPFRY--KSAERAIPEENSEDLIYSDSI------HFRKDLYIPMAPVVKPLD  400
            D    G++  +R   +S+E AIPEEN +D   ++        +   + YIPM P V P D
Sbjct  366  DN---GSFSHYRLNTRSSETAIPEENIDDFASAELFSKVTEQNVSDENYIPMNP-VNPTD  421

Query  401  SIGHNKAQQERQFTVGDAAVLSCNNSQNSIVTTDLAPQIHAIIISSAKPNDFENEE----  456
            +I H K + + Q  + DA+ L  N  +            HA   S     DF+ +     
Sbjct  422  AI-HEKEKADMQ-RLEDAS-LHFNFPE------------HA---SEKLAKDFDLDSDNQC  463

Query  457  -RPKRSYSIGSKIDRNKM-KRSGNSNEILLDKNDIRVRAFSVGSRAKIPKCDLQRAVLFP  514
             RP R+YSIG+K++  K  KR G+ N+    +N  RVRA+SVGS++KIP+CDLQR VL  
Sbjct  464  CRPIRAYSIGNKVEHLKFNKRLGHLNDT--GQNPNRVRAYSVGSKSKIPRCDLQRVVLVE  521

Query  515  RSRF------NQSCISNNSLNFGAEDTGYKLDLNTNCDKKSTSAPILVQNSQVSVDCMSD  568
             ++       +QS I+    ++G+         + N  KKSTSAP+L   +Q++ D MSD
Sbjct  522  DNKHEFTANRSQSSITKEGTSYGS---------SANRQKKSTSAPLLSLKNQINSDRMSD  572

Query  569  LMEIDFSKSSSHKTNGKAVPVSGKGSDISLNEVKSY---------QTSKPIGELLQT---  616
            LMEIDFS++++ +          K   I  NE+  Y         +T      L  T   
Sbjct  573  LMEIDFSQATNLE----------KQKFIKNNEIPKYIENVFPKAPRTDSSSLTLHATSQK  622

Query  617  --FPLKKIN----PEESGYLEMKPLNN  637
              F   K+N      E GYLEMKP+ N
Sbjct  623  DIFNGTKLNNTAITSEDGYLEMKPVGN  649


 Score = 47.0 bits (110),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 36/56 (64%), Gaps = 3/56 (5%)

Query  881  SSTACSSYELYYAKLDLPQCSTKDNAKFQKIENVASPTINI---ENDSYAKIDFDH  933
            SS+  S  EL+YA LDLP CS ++ AK+ K  +  SP ++    + ++YAKIDFD 
Sbjct  900  SSSRISQPELHYASLDLPHCSGQNPAKYLKRGSRESPPVSACPEDGNTYAKIDFDQ  955


>Q9W3R6_DROME unnamed protein product
Length=622

 Score = 50.4 bits (119),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 59/253 (23%), Positives = 107/253 (42%), Gaps = 42/253 (17%)

Query  14   MLSGYQK-------KLNTMKKK-----FFVLYRDTTQESARLEYFDSMRKFKSGLAPKRV  61
            +L+GY          LN + KK     + +L++ +    ARLE  +S    K    PK +
Sbjct  7    VLAGYLNVPTQTGFSLNRISKKKACSRYCLLFKASRHGIARLEMCES----KEDRNPK-I  61

Query  62   VKLENCFNINRRLDTKYDYVIALATKDGGFGMVLETEAEMLKWLQALLSLQ---------  112
              LENC  I +  +   + +I +  +     +   +E E+  W+ AL ++          
Sbjct  62   FTLENCVKITQ--EPPPERLIHIVKRQATLTLSTSSEEELKDWITALQTVAFCDTSPSGG  119

Query  113  -RSITNKDDILLPKFDHVWQVVVQKKSLAEERKIIGNYHVCLSPKSVTFIRIGSE-KSSS  170
              +I   +D+    FD ++ + +    +  E  I      C+ PK+       +E +  S
Sbjct  120  IGAIEEDNDLYCSSFDGLFIITL----IPSEASI----RCCIEPKTYMLQMTPTELQLKS  171

Query  171  GYIRATDIHIPLNTIRRCGDSHCLFYMEVGRQCIIGPGELWMDTEDPLVAQSMHKMISSA  230
              + AT    P   IR+ G     F  E GR+C  G G   +D  +P   Q + + +S+ 
Sbjct  172  EDLGATIAMWPYRFIRKYGYRDGKFTFEAGRKCTTGEGVFTLDHTNP---QEVFRCMSAK  228

Query  231  M-SVRIDVIGDNI  242
            M S++  + GD++
Sbjct  229  MKSMKKLISGDSL  241


>DOS_DROME unnamed protein product
Length=878

 Score = 33.1 bits (74),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 40/87 (46%), Gaps = 13/87 (15%)

Query  29   FFVLYRDTTQESARLEYF--DSMRKFKSGLAPKRVVKLENCFNIN--RRLDT---KYDYV  81
            +F L +    E   LEY+   + RK K       V+ L+ C  ++   RL+    K+ Y+
Sbjct  28   YFTLKQGEIPEQFCLEYYTDHNCRKLKG------VIDLDQCEQVDCGLRLENRKQKFQYM  81

Query  82   IALATKDGGFGMVLETEAEMLKWLQAL  108
              + T    + +  ETEA+M  W+  +
Sbjct  82   FDIKTPKRTYYLAAETEADMRDWVNCI  108



Lambda      K        H
   0.323    0.139    0.422 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2140775808


Query= NP_001306712.1 transformer-2 sex-determining protein [Bactrocera
dorsalis]

Length=251
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TRA2_DROME  unnamed protein product                                   152     3e-45
TRA2_DICDI  unnamed protein product                                   104     4e-26
Q9VIS0_DROME  unnamed protein product                                 64.3    1e-12


>TRA2_DROME unnamed protein product
Length=264

 Score = 152 bits (384),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 103/218 (47%), Positives = 134/218 (61%), Gaps = 43/218 (20%)

Query  43   ASRQPPSPPPLPSGRGGRYSEASQSSSTSLSPRHGRRISRSRSRSTYEKRRGNREKPVQN  102
             S                   +S+S       R GR  SR R     E+   +RE P  +
Sbjct  60   RS-----------------RSSSESPPPEPRHRSGRS-SRDR-----ERMHKSREHPQAS  96

Query  103  RCIGVFGLSVYTTQQKIRDIFSRFGPIERIQVVIDAQTGRSRGFCFIYYEDIADAKAAKD  162
            RCIGVFGL+  T+Q K+R++F+++GPIERIQ+VIDAQT RSRGFCFIY+E ++DA+AAKD
Sbjct  97   RCIGVFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKD  156

Query  163  ACSGMEIDDRRIRVDYSTTQRPHTPTPGVYMGRQTRREREHSDRYRDDYRPRR-------  215
            +CSG+E+D RRIRVD+S TQR HTPTPGVY+GRQ R +   S      + PRR       
Sbjct  157  SCSGIEVDGRRIRVDFSITQRAHTPTPGVYLGRQPRGKAPRS------FSPRRGRRVYHD  210

Query  216  RSGSPYHSRNN--NYRSDRRRRYERSRSRSYSPRRARY  251
            RS SPY +  +  +YR+D   RY+R+  R  SP R RY
Sbjct  211  RSASPYDNYRDRYDYRND---RYDRNLRR--SPSRNRY  243


>TRA2_DICDI unnamed protein product
Length=326

 Score = 104 bits (259),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 64/91 (70%), Gaps = 0/91 (0%)

Query  104  CIGVFGLSVYTTQQKIRDIFSRFGPIERIQVVIDAQTGRSRGFCFIYYEDIADAKAAKDA  163
             +GVFGL+  T ++ ++D FSRFG I+ + +++D +TGRS+ F F+Y+E+  DA  AK+ 
Sbjct  114  VLGVFGLAPQTEERDLKDEFSRFGKIDHVDLIMDRKTGRSKCFGFVYFENKEDAVRAKEE  173

Query  164  CSGMEIDDRRIRVDYSTTQRPHTPTPGVYMG  194
            C  +++  + IR D+S T++PH PTPG Y G
Sbjct  174  CQDLQLHGKSIRTDFSATKKPHEPTPGKYFG  204


>Q9VIS0_DROME unnamed protein product
Length=154

 Score = 64.3 bits (155),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 53/95 (56%), Gaps = 2/95 (2%)

Query  105  IGVFGLSVYTTQQKIRDIFSRFGPIERIQVVIDAQTGRSRGFCFIYYEDIADAKAAKDAC  164
            I V G     T+  +  +FS++G +  I ++ D++TG+S+GFCF+ YED      A D  
Sbjct  36   IFVAGFPYTLTEGDLVCVFSQYGEVVNINLIRDSKTGKSKGFCFLCYEDQRSTVLAVDNL  95

Query  165  SGMEIDDRRIRVDYSTTQRPHTPTPGVYMGRQTRR  199
            +G++I DR +RVD+    +P  P     M  +T R
Sbjct  96   NGIKILDRTLRVDHVADYKP--PKENEKMDEETLR  128



Lambda      K        H
   0.323    0.139    0.422 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2140775808


Query= NP_001306713.1 glutathione S-transferase 1-1-like [Bactrocera
dorsalis]

Length=215
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GSTD1_DROME  unnamed protein product                                  281     7e-97
Q9VGA1_DROME  unnamed protein product                                 231     3e-77
GSTD2_DROME  unnamed protein product                                  226     3e-75


>GSTD1_DROME unnamed protein product
Length=209

 Score = 281 bits (718),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 128/214 (60%), Positives = 165/214 (77%), Gaps = 7/214 (3%)

Query  1    MDFYYMPASAPCRAVLLTAKCVGIELNKILLDLRAGEHLTPEFLKINPQHTIPTLVDKDF  60
            +DFYY+P S+PCR+V++TAK VG+ELNK LL+L+AGEHL PEFLKINPQHTIPTLVD  F
Sbjct  2    VDFYYLPGSSPCRSVIMTAKAVGVELNKKLLNLQAGEHLKPEFLKINPQHTIPTLVDNGF  61

Query  61   ALWESRAIMIYLVEQYAKTDSLYSQCPETRALINQRLYFDMN-LALTFGKYFYKPVMSKT  119
            ALWESRAI +YLVE+Y KTDSLY +CP+ RA+INQRLYFDM  L  +F  Y+Y  V +K 
Sbjct  62   ALWESRAIQVYLVEKYGKTDSLYPKCPKKRAVINQRLYFDMGTLYQSFANYYYPQVFAKA  121

Query  120  PFDPEQRKQLETQLELFNTLLAGNNFVIGETLTLADLALLATISTIDVAQCLKDFNVNVR  179
            P DPE  K++E   E  NT L G ++  G++LT+AD+AL+AT+ST +VA+        + 
Sbjct  122  PADPEAFKKIEAAFEFLNTFLEGQDYAAGDSLTVADIALVATVSTFEVAK------FEIS  175

Query  180  KYAHIQKWYENMRAVTPGFKENQEGCLEMKKFFE  213
            KYA++ +WYEN + VTPG++EN  GCLE KK+FE
Sbjct  176  KYANVNRWYENAKKVTPGWEENWAGCLEFKKYFE  209


>Q9VGA1_DROME unnamed protein product
Length=210

 Score = 231 bits (589),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 109/215 (51%), Positives = 148/215 (69%), Gaps = 8/215 (4%)

Query  1    MDFYYMPASAPCRAVLLTAKCVGIELNK-ILLDLRAGEHLTPEFLKINPQHTIPTLVDKD  59
            MD YY P SAPCR+VL+TAK +G+E +K  +++ RA E  TPE+LKINPQHTIPTL D  
Sbjct  1    MDLYYRPGSAPCRSVLMTAKALGVEFDKKTIINTRAREQFTPEYLKINPQHTIPTLHDHG  60

Query  60   FALWESRAIMIYLVEQYAKTDSLYSQCPETRALINQRLYFDMN-LALTFGKYFYKPVMSK  118
            FALWESRAIM+YLVE+Y K D L+ +  + +ALINQRLYFDM  L  +F +Y+Y  +  K
Sbjct  61   FALWESRAIMVYLVEKYGKDDKLFPKDVQKQALINQRLYFDMGTLYKSFSEYYYPQIFLK  120

Query  119  TPFDPEQRKQLETQLELFNTLLAGNNFVIGETLTLADLALLATISTIDVAQCLKDFNVNV  178
             P + E  K++E   E  NT L G  +  G   +LAD+A LAT+ST DVA        + 
Sbjct  121  KPANEENYKKIEVAFEFLNTFLEGQTYSAGGDYSLADIAFLATVSTFDVA------GFDF  174

Query  179  RKYAHIQKWYENMRAVTPGFKENQEGCLEMKKFFE  213
            ++YA++ +WYEN + +TPG++EN  GC E +K+F+
Sbjct  175  KRYANVARWYENAKKLTPGWEENWAGCQEFRKYFD  209


>GSTD2_DROME unnamed protein product
Length=215

 Score = 226 bits (576),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 107/216 (50%), Positives = 147/216 (68%), Gaps = 7/216 (3%)

Query  1    MDFYYMPASAPCRAVLLTAKCVGIELNKILLDLRAGEHLTPEFLKINPQHTIPTLVDKDF  60
            MDFYYMP    CR V++ AK +G+ELNK LL+   GE L PEF+K+NPQHTIPTLVD  F
Sbjct  1    MDFYYMPGGGGCRTVIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGF  60

Query  61   ALWESRAIMIYLVEQYAKTDSLYSQCPETRALINQRLYFDMN-LALTFGKYFYKPVMSKT  119
            ++WESRAI +YLVE+Y K D L    P+ RA+INQRLYFDM  L  +F KY+Y    +  
Sbjct  61   SIWESRAIAVYLVEKYGKDDYLLPNDPKKRAVINQRLYFDMGTLYESFAKYYYPLFRTGK  120

Query  120  PFDPEQRKQLETQLELFNTLLAGNNFVIGETLTLADLALLATISTIDVAQCLKDFNVNVR  179
            P   E  K++ET     +T L G  +V G+ LT+AD+A+L+T+ST +V++   DF+    
Sbjct  121  PGSDEDLKRIETAFGFLDTFLEGQEYVAGDQLTVADIAILSTVSTFEVSEF--DFS----  174

Query  180  KYAHIQKWYENMRAVTPGFKENQEGCLEMKKFFEGQ  215
            KY+++ +WY+N + VTPG+ EN EG + MK  F+ +
Sbjct  175  KYSNVSRWYDNAKKVTPGWDENWEGLMAMKALFDAR  210



Lambda      K        H
   0.323    0.139    0.422 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2140775808


Query= NP_001306714.1 dnaJ homolog subfamily B member 12 [Bactrocera
dorsalis]

Length=370
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VFP0_DROME  unnamed protein product                                 515     0.0  
DNJ1_CAEEL  unnamed protein product                                   256     2e-82
Q585V4_TRYB2  unnamed protein product                                 82.0    5e-17


>Q9VFP0_DROME unnamed protein product
Length=370

 Score = 515 bits (1327),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/380 (70%), Positives = 311/380 (82%), Gaps = 20/380 (5%)

Query  1    MDGNKDEAHRCIDIAVQAFAEGKMEKAEKFLLKAEKLFPTERAKELLSKVKAGATTGGNR  60
            MDGNKDEA RCID AVQA A GK+EKAEKFLLKAE+LFPT+ AK+LL+++K         
Sbjct  1    MDGNKDEAQRCIDFAVQALAAGKIEKAEKFLLKAERLFPTDNAKKLLAQLK---------  51

Query  61   SSTSGNVNGSPHRNGASN--GNGPRKRKNSDSRHVEPEYTKEQLEAVRKVKGCRNYYEIL  118
            S+ S   NG     GAS+   +GPRKR NSDSR   P+YTK+QLEAVRKVK C++YYE+L
Sbjct  52   STPSNESNGKSRTAGASDEKDSGPRKRVNSDSRSSAPDYTKDQLEAVRKVKTCKDYYEVL  111

Query  119  SITKEATDSEIKKSYKKLALLLHPDKNKAPGASDAFKAVGNAAAILTDAEKRKQYDLYGI  178
             ++K ATDSEIKK+YKKLAL LHPDKNKAPGA +AFKA+GNAA +LTDAEKRK YDLYGI
Sbjct  112  GVSKTATDSEIKKAYKKLALQLHPDKNKAPGAVEAFKALGNAAGVLTDAEKRKNYDLYGI  171

Query  179  NETHSSGHGVRRD--------NYEYAYARGFQAEVSPEDLFNMFFGGGFAQQNVYMRQQR  230
            NE+H+                N EY Y+RGFQA++S E+LFNMFF GGF QQNV+MRQQR
Sbjct  172  NESHNGHGNNGGGHHGHGQYYNNEYGYSRGFQADISAEELFNMFFNGGFPQQNVHMRQQR  231

Query  231  RRQQHRDDGENQSNSSALINFLPILLLIALSMVSSFFISDPIYSLSPSHKYAVKRETNRL  290
            RRQQ R+D E  +NSSAL+N LPI+LLI LSM+SSFFISDP+YSL+PSHKY+VKRETN L
Sbjct  232  RRQQAREDREG-NNSSALVNLLPIVLLIGLSMMSSFFISDPMYSLTPSHKYSVKRETNSL  290

Query  291  KVPYYVKNNFHSEYQGSVGRLEESVEEDYIDHLKYSCSRERNYRDSMLAKARSFGDRDLF  350
            KVPYYVK+NF+SEYQGSV RLEESVEED+++HLK+SCSRERNYRDSMLAKAR+FGDRDL+
Sbjct  291  KVPYYVKDNFYSEYQGSVARLEESVEEDFVNHLKHSCSRERNYRDSMLAKARTFGDRDLY  350

Query  351  RKAQNINMPSCDNLQNYLNT  370
            RKAQNIN PSC+NLQ YL T
Sbjct  351  RKAQNINTPSCENLQKYLIT  370


>DNJ1_CAEEL unnamed protein product
Length=401

 Score = 256 bits (655),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 142/397 (36%), Positives = 225/397 (57%), Gaps = 39/397 (10%)

Query  2    DGNKDEAHRCIDIAVQAFAEGKMEKAEKFLLKAEKLFPTERAKELLSKVKAGATTGGNRS  61
            D NK E+  C+D A +A   G  +KA + LLKA+KL P +  + L  K+        + S
Sbjct  4    DANKSESLLCMDKAREAIKSGDTDKARRMLLKAKKLDPGQNIEFLTKKIDDMTNNTSSSS  63

Query  62   STSGNVNG----------------------SPHRNGASNGNGPRKRKNSDSRHVEPEYTK  99
             TS +                         SP +        P++R  S +  +  +YT 
Sbjct  64   QTSSSRASEERSYAHDDHYDDPNLRNRKARSPVKKNGKTEPEPKQRSASRTPKLGVDYTS  123

Query  100  EQLEAVRKVKGCRNYYEILSITKEATDSEIKKSYKKLALLLHPDKNKAPGASDAFKAVGN  159
            EQ E V +++ C++YYEIL I K+A+D +I+K Y+KLAL LHPDK +AP A++AFKA+GN
Sbjct  124  EQKELVERIRHCKDYYEILKIDKKASDDDIRKEYRKLALKLHPDKCRAPHATEAFKALGN  183

Query  160  AAAILTDAEKRKQYDLYGINETHSSGHGVRRDN------YEYAYARGFQAEVSPEDLFNM  213
            A A+L+D +KR+QYD YG    +S     RR        +E+ YA GF+AE +PE++FNM
Sbjct  184  AYAVLSDTDKRRQYDQYGAEAANSHTPTTRRRGGGHGAFFEHDYAHGFEAEFTPEEIFNM  243

Query  214  FFGGGFAQQNVYMRQQRRRQQH------RDDGENQSNSSALINFLPILLLIALSMVSSFF  267
            FFGGGF  + V     RRR ++          + QS    L+  LP++ ++ + +++   
Sbjct  244  FFGGGFPTEQV-----RRRARYAQQQQYHHYEQQQSPYGPLLQLLPLIAIMVIGLLAQLM  298

Query  268  ISDPIYSLSPSHKYAVKRETNRLKVPYYVKNNFHSEYQGSVGRLEESVEEDYIDHLKYSC  327
            + +P YSL  + K+ +KR T  L+VPY+V+ +F + Y+G + ++E+ VE+DYI +L+ +C
Sbjct  299  VGEPAYSLHQTSKFTIKRLTADLRVPYFVRTDFETSYRGRIRQVEQQVEDDYIQNLRMNC  358

Query  328  SRERNYRDSMLAKARSFGDRDLFRKAQNINMPSCDNL  364
             +E+N +++ L +AR   D  + R A+   +PSC  L
Sbjct  359  YKEQNLKETKLYRARWMRDEAMMRDAERTPLPSCIRL  395


>Q585V4_TRYB2 unnamed protein product
Length=404

 Score = 82.0 bits (201),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 59/104 (57%), Gaps = 17/104 (16%)

Query  114  YYEILSITKEATDSEIKKSYKKLALLLHPDKNKAPGASDAFKAVGNAAAILTDAEKRKQY  173
            YY+ L +   A++ +IK++Y+KLAL  HPDKNK PGA++ FK V  A   L+D EKR++Y
Sbjct  11   YYDALGVPPNASEDDIKRAYRKLALKYHPDKNKEPGANEKFKEVSVAYECLSDVEKRRRY  70

Query  174  DLYGINETHSSGHGVRRDNYEYAYARGFQAEVSPEDLFNMFFGG  217
            D +G     S G G                 + P D+F+ FFGG
Sbjct  71   DQFGEKGVESEGVG-----------------IDPSDIFSSFFGG  97



Lambda      K        H
   0.323    0.139    0.422 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2140775808


Query= NP_001306715.1 soma ferritin precursor [Bactrocera dorsalis]

Length=223
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9U4U2_DROME  unnamed protein product                                 259     4e-88
Q9VA83_DROME  unnamed protein product                                 258     1e-87
Q9U7A3_DROME  unnamed protein product                                 257     4e-87


>Q9U4U2_DROME unnamed protein product
Length=227

 Score = 259 bits (663),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 132/228 (58%), Positives = 163/228 (71%), Gaps = 6/228 (3%)

Query  1    MKPFTALTLFA--GIIALASADNYACHSNVTVGCSNSA-STPVVCHSRYGGIENVESTIQ  57
            MK F AL LFA  G +ALA  D Y C + V   CS SA S   +C++R+ GI+++E  IQ
Sbjct  1    MKFFVALALFACLGSLALAKDDEY-CQNTVITACSTSAFSGNSICNARFAGIDHIEPEIQ  59

Query  58   SYINLNLHKSYQYLLLSSFYNSYQKNRPGFNKLYRDLSDRSFDDAIDLIKHVTRRGGQVD  117
            SYIN NL KSY YLLL++ +NSYQKNRPGF KLY+ LSDRSF+D+I LIK VTRRGG VD
Sbjct  60   SYINANLAKSYDYLLLATHFNSYQKNRPGFQKLYQGLSDRSFEDSIALIKQVTRRGGIVD  119

Query  118  FRAISQHPNSIAQSRLKLEEDELHSLGIALDIEKTLTADAGHVHYQSTHGR--PHDPQTA  175
            F    +   S++  R+ LE DELHSL +ALD EK L   A HVH ++TH      DP+ A
Sbjct  120  FNTRHESSGSVSTKRVTLEVDELHSLALALDTEKQLATGATHVHSRATHATDAERDPELA  179

Query  176  HYIEEKFLHKQADSVRKVSGFVNDLSKIMNQPDPSLGIYLFDQYLEKQ  223
            HY EE FL KQA+SVRK+SG+ NDL+K+M  PDPSL +YLFD+YL+KQ
Sbjct  180  HYFEENFLGKQAESVRKLSGYANDLAKLMKVPDPSLSVYLFDEYLQKQ  227


>Q9VA83_DROME unnamed protein product
Length=227

 Score = 258 bits (660),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/228 (58%), Positives = 162/228 (71%), Gaps = 6/228 (3%)

Query  1    MKPFTALTLFA--GIIALASADNYACHSNVTVGCSNSA-STPVVCHSRYGGIENVESTIQ  57
            MK F AL LFA  G +ALA  D Y C + V   CS SA S   +C++R+ GI+++E  IQ
Sbjct  1    MKFFVALALFACLGSLALAKDDEY-CQNTVITACSTSAFSANSICNARFAGIDHIEPEIQ  59

Query  58   SYINLNLHKSYQYLLLSSFYNSYQKNRPGFNKLYRDLSDRSFDDAIDLIKHVTRRGGQVD  117
            SYIN NL KSY YLLL++ +NSYQKNRPGF KLY+ LSDRSF+D+I LIK VTRRGG VD
Sbjct  60   SYINANLAKSYDYLLLATHFNSYQKNRPGFQKLYQGLSDRSFEDSIALIKQVTRRGGIVD  119

Query  118  FRAISQHPNSIAQSRLKLEEDELHSLGIALDIEKTLTADAGHVHYQSTHGR--PHDPQTA  175
            F    +   S++  R  LE DELHSL +ALD EK L   A HVH ++TH      DP+ A
Sbjct  120  FNTRHESSGSVSTKRGTLEVDELHSLALALDTEKQLATGATHVHSRATHATDAERDPELA  179

Query  176  HYIEEKFLHKQADSVRKVSGFVNDLSKIMNQPDPSLGIYLFDQYLEKQ  223
            HY EE FL KQA+SVRK+SG+ NDL+K+M  PDPSL +YLFD+YL+KQ
Sbjct  180  HYFEENFLGKQAESVRKLSGYANDLAKLMKVPDPSLSVYLFDEYLQKQ  227


>Q9U7A3_DROME unnamed protein product
Length=227

 Score = 257 bits (656),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 131/228 (57%), Positives = 161/228 (71%), Gaps = 6/228 (3%)

Query  1    MKPFTALTLFA--GIIALASADNYACHSNVTVGCSNSA-STPVVCHSRYGGIENVESTIQ  57
            MK F AL LFA  G +ALA  D Y C + V   CS SA S   +C++R+ GI+++E  IQ
Sbjct  1    MKFFVALALFACLGSLALAKDDEY-CQNTVITACSTSAFSANSICNARFAGIDHIEPEIQ  59

Query  58   SYINLNLHKSYQYLLLSSFYNSYQKNRPGFNKLYRDLSDRSFDDAIDLIKHVTRRGGQVD  117
            SYIN NL KSY YLLL++ +NSYQKNRPGF KLY+ LSDRSF+D+I LIK VTRRGG VD
Sbjct  60   SYINANLAKSYDYLLLATHFNSYQKNRPGFQKLYQGLSDRSFEDSIALIKQVTRRGGIVD  119

Query  118  FRAISQHPNSIAQSRLKLEEDELHSLGIALDIEKTLTADAGHVHYQSTHGR--PHDPQTA  175
            F    +   S++  R  LE DELHSL +ALD EK L   A HVH ++TH      DP+ A
Sbjct  120  FNTRHESSGSVSTKRGTLEVDELHSLALALDTEKQLATGATHVHSRATHATDAERDPELA  179

Query  176  HYIEEKFLHKQADSVRKVSGFVNDLSKIMNQPDPSLGIYLFDQYLEKQ  223
            HY EE FL KQA+SVRK+SG+ ND +K+M  PDPSL +YLFD+YL+KQ
Sbjct  180  HYFEENFLGKQAESVRKLSGYANDFAKLMKVPDPSLSVYLFDEYLQKQ  227



Lambda      K        H
   0.323    0.139    0.422 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2140775808


Query= NP_001306716.1 dnaJ protein homolog 1 [Bactrocera dorsalis]

Length=345
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DNAJ1_DROME  unnamed protein product                                  466     8e-166
Q8I489_PLAF7  unnamed protein product                                 211     7e-65 
Q38AB7_TRYB2  unnamed protein product                                 206     6e-64 


>DNAJ1_DROME unnamed protein product
Length=334

 Score = 466 bits (1198),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 240/346 (69%), Positives = 277/346 (80%), Gaps = 13/346 (4%)

Query  1    MGKDFYKILGINKSANDDEIKKAYRKLALKYHPDKNKTPQAEERFKEIAEAYEVLSDKKK  60
            MGKDFYKILG+ + A+DDEIKKAYRKLALKYHPDKNK+PQAEERFKEIAEAYEVLSDKKK
Sbjct  1    MGKDFYKILGLERKASDDEIKKAYRKLALKYHPDKNKSPQAEERFKEIAEAYEVLSDKKK  60

Query  61   RDIYDQYGEEGLKGGVPGGPNEQGGGNYSYQFHGDPRATFAQFFGSSDPFGIFFSSSDPS  120
            RDI+D YGE+GLKGG PG       G Y+YQFHGDPRATFAQFFGSSDPFG FF+  D  
Sbjct  61   RDIFDNYGEDGLKGGQPGPDGGGQPGAYTYQFHGDPRATFAQFFGSSDPFGAFFTGGD--  118

Query  121  RMFGDSQNIFMSGGNDDDIYTQMGGGGGAFRSQSFNAQ-PNRKRQIQDPPIEHDLYVSLE  179
             MF   Q     GGN ++I+  +GG        +FNAQ P+RKRQ QDPPIEHDL+VSLE
Sbjct  119  NMFSGGQ-----GGNTNEIFWNIGGDDMF----AFNAQAPSRKRQ-QDPPIEHDLFVSLE  168

Query  180  EVDKGCVKKMKISRMSMATGQPRKEEKVLNITVKPGWKAGTKITFQKEGDQTPGKVPADI  239
            EVDKGC+KKMKISRM+  +  P KEEKVL ITVKPGWKAGTKITF +EGD  P K PADI
Sbjct  169  EVDKGCIKKMKISRMATGSNGPYKEEKVLRITVKPGWKAGTKITFPQEGDSAPNKTPADI  228

Query  240  IFIIRDKPHQLFKREGSDIKYNARVSLKEALCGTVVKVPTLQGDRITLNSVGEVIKPNTV  299
            +FIIRDKPH LFKREG D+KY A++SLK+ALCG +V VPTLQG RI +N   E+IKP T 
Sbjct  229  VFIIRDKPHSLFKREGIDLKYTAQISLKQALCGALVSVPTLQGSRIQVNPNHEIIKPTTT  288

Query  300  KRIPGKGLPFPKEPTRRGDLLVAFDIKFPDSLPPATRELLADVLPN  345
            +RI G GLP PKEP+RRGDL+V+FDIKFPD+L P+ +  L+++LPN
Sbjct  289  RRINGLGLPVPKEPSRRGDLIVSFDIKFPDTLAPSLQNQLSELLPN  334


>Q8I489_PLAF7 unnamed protein product
Length=402

 Score = 211 bits (536),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 128/349 (37%), Positives = 185/349 (53%), Gaps = 35/349 (10%)

Query  4    DFYKILGINKSANDDEIKKAYRKLALKYHPDKNKTPQ----AEERFKEIAEAYEVLSDKK  59
            D+Y +LG+ K    D+IKKAYRKLA+K+HPDK+   +    AE +FK I EAYEVLSD++
Sbjct  80   DYYAVLGLTKDCTQDDIKKAYRKLAMKWHPDKHLNDEDKVEAERKFKLIGEAYEVLSDEE  139

Query  60   KRDIYDQYGEEGLKGGVPGGPNEQGGGNYSYQFHGDPRATFAQFFGSSDPFGIFFSSSD-  118
            KR  YD +G+ GL     GG        Y+Y  + DP   F++FF S D    F    D 
Sbjct  140  KRKNYDLFGQSGL-----GGTTTNDEAYYTYS-NIDPNELFSRFF-SHDASSFFSQGFDD  192

Query  119  -PSRMFGDSQNIFMSGGNDDDIYTQMGGGGGAFRSQSFNAQPNRKRQIQDPPIEHDLYVS  177
             PS     S N      +  +I+++  G   +F                    E  L V+
Sbjct  193  FPSFQGFASMNSRRPRSSRSNIFSRSFGRAASF--------------------EVPLQVT  232

Query  178  LEEVDKGCVKKMKISRMSMATGQPRKEEKVLNITVKPGWKAGTKITFQKEGDQ-TPGKVP  236
            LEE+  GC KK+K++R         ++   + + VKPGW  GTKI F  EG+Q +P + P
Sbjct  233  LEELYTGCRKKLKVTRKRFVGLNSYEDNTFITVDVKPGWSEGTKINFHGEGEQSSPNEQP  292

Query  237  ADIIFIIRDKPHQLFKREGSDIKYNARVSLKEALCGTVVKVPTLQGDRITLNSVGEVIKP  296
             D++FII+ KPH  F REG+++ Y   + L +AL G    + +L    I +  V ++I P
Sbjct  293  GDLVFIIKTKPHDRFIREGNNLIYKCYLPLDKALTGFQFSIKSLDNRDINVR-VDDIINP  351

Query  297  NTVKRIPGKGLPFPKEPTRRGDLLVAFDIKFPDSLPPATRELLADVLPN  345
            N+ K I  +G+P+ K P+ +GDL + FDI FP  L P  +  L + L N
Sbjct  352  NSKKIITNEGMPYSKSPSVKGDLFIEFDIVFPKKLSPEQKRTLKETLEN  400


>Q38AB7_TRYB2 unnamed protein product
Length=336

 Score = 206 bits (524),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 136/354 (38%), Positives = 190/354 (54%), Gaps = 38/354 (11%)

Query  1    MGKDFYKILGINKSANDDEIKKAYRKLALKYHPDK--NKTPQAEERFKEIAEAYEVLSDK  58
            MG D+YK+LG+++ A+  +IKKAY +LALKYHPDK      +AE  FKE+AEAY+VLSD+
Sbjct  1    MGIDYYKVLGVSRDASPSDIKKAYHQLALKYHPDKASGNREEAERLFKEVAEAYDVLSDE  60

Query  59   KKRDIYDQYGEEGLKGGVP---------GGPNEQGGGNYSYQFHG-DPRATFAQFFGSSD  108
            KK+ IYD YGEEGLKGGVP          G +    G  +Y F   D    F  FFGS+D
Sbjct  61   KKKKIYDSYGEEGLKGGVPDGSSGGPGGAGFHGFSSGGGTYNFSNRDAFKVFESFFGSND  120

Query  109  PFGIFFSSSDPSRMFGDSQNIFMSGGNDDDIYTQMGGGGGAFRSQSFNAQPNRKRQIQDP  168
            PF           +      +F              G GG     S    P      + P
Sbjct  121  PFAGGDMFGGGPGL----HRVFR-------------GFGGPHGFMSGFGSPEMSPAHEVP  163

Query  169  PIEHDLYVSLEEVDKGCVKKMKISRMSMATGQPRKEEKVLNITVKPGWKAGTKITFQKEG  228
            P+E+    +LEE+  GC KK  + R  + TG+   E+K+  + V PG+K GTK+ F  EG
Sbjct  164  PLEYTFSCTLEEIYSGCTKKFNVLR-PLPTGE---EKKLFEVAVLPGYKKGTKVRFVGEG  219

Query  229  DQTPGKVP---ADIIFIIRDKPHQLFKREGSDIKYNARVSLKEALCGTVVKVPTLQGDRI  285
                G  P   AD++F++ +KPH  FKR+G+D+    +++LK+AL GT + V  L G   
Sbjct  220  GIVQGYPPNVMADLVFVLDEKPHPRFKRDGADVLTTVQINLKQALLGTTISVLCLDGTTQ  279

Query  286  TLNSVGEVIKPNTVKRIPGKGLPFPKEPTRRGDLLVAFDIKFPDSLPPATRELL  339
            +L   G V K     R+ GKGLP  ++  + GD+ V  ++  P SL  AT+ L+
Sbjct  280  SLPLTG-VSKNGRKLRVSGKGLP-NRKTKQNGDMYVTIEVVMPTSLNEATKRLV  331



Lambda      K        H
   0.323    0.139    0.422 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2140775808


Query= NP_001306717.1 NADPH--cytochrome P450 reductase [Bactrocera
dorsalis]

Length=672
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

NCPR_DROME  unnamed protein product                                   1234    0.0   
Q09590_CAEEL  unnamed protein product                                 648     0.0   
Q384I1_TRYB2  unnamed protein product                                 384     9e-125


>NCPR_DROME unnamed protein product
Length=679

 Score = 1234 bits (3194),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 587/662 (89%), Positives = 627/662 (95%), Gaps = 1/662 (0%)

Query  12   GDEPFLGTLDIAILVALIAGATWYFMRSRKKEEEPIRSYSIQPTTVSTTISSDNSFIKKL  71
            GDEPFLG LD+A+L  LI GA +YF+RSRKKEEEP RSYSIQPTTV TT +SDNSFIKKL
Sbjct  18   GDEPFLGLLDVALLAVLIGGAAFYFLRSRKKEEEPTRSYSIQPTTVCTTSASDNSFIKKL  77

Query  72   KASGRSLVVFYGSQTGTGEEFAGRLAKEGLRYRMKGMVADPEECDMEELLQLKDIPNSLA  131
            KASGRSLVVFYGSQTGTGEEFAGRLAKEG+RYR+KGMVADPEECDMEELLQLKDI NSLA
Sbjct  78   KASGRSLVVFYGSQTGTGEEFAGRLAKEGIRYRLKGMVADPEECDMEELLQLKDIDNSLA  137

Query  132  VFCLATYGEGDPTDNAMEFFEWLSNGDADLNGLNYAVFGLGNKTYEHYNKMAIYVDQRLE  191
            VFCLATYGEGDPTDNAMEF+EW+++GD DL+GLNYAVFGLGNKTYEHYNK+AIYVD+RLE
Sbjct  138  VFCLATYGEGDPTDNAMEFYEWITSGDVDLSGLNYAVFGLGNKTYEHYNKVAIYVDKRLE  197

Query  192  ELGATRVFELGLGDDDANIEDDFITWKDRFWPAVCDFFGIEGGGEEVLMRQYRLLEQPNV  251
            ELGA RVFELGLGDDDANIEDDFITWKDRFWPAVCD FGIEGGGEEVL+RQYRLLEQP+V
Sbjct  198  ELGANRVFELGLGDDDANIEDDFITWKDRFWPAVCDHFGIEGGGEEVLIRQYRLLEQPDV  257

Query  252  QPDRIYTGEIARLHSLQNQRPPFDAKNPFLAPIIVNRELHKGGDRSCMHIELDINGSKMR  311
            QPDRIYTGEIARLHS+QNQRPPFDAKNPFLAPI VNRELHKGG RSCMHIEL I GSKMR
Sbjct  258  QPDRIYTGEIARLHSIQNQRPPFDAKNPFLAPIKVNRELHKGGGRSCMHIELSIEGSKMR  317

Query  312  YDAGDHVAMYPINDTELVEKLGKLCNADLDTVFSLINTDTDSSKKHPFPCPTTYRTALKH  371
            YDAGDHVAM+P+ND  LVEKLG+LCNADLDTVFSLINTDTDSSKKHPFPCPTTYRTAL H
Sbjct  318  YDAGDHVAMFPVNDKSLVEKLGQLCNADLDTVFSLINTDTDSSKKHPFPCPTTYRTALTH  377

Query  372  YLEITAIPRTHILKELAEYCTDEADKEFLRSMSSISPEGKEKYQSWIQDACRNIVHILED  431
            YLEITAIPRTHILKELAEYCTDE +KE LRSM+SISPEGKEKYQSWIQDACRNIVHILED
Sbjct  378  YLEITAIPRTHILKELAEYCTDEKEKELLRSMASISPEGKEKYQSWIQDACRNIVHILED  437

Query  432  IKSCKPPIDHICELLPRLQPRYYSISSSSKLHPNHVHVTAVLVQYKTPTGRINNGVATTY  491
            IKSC+PPIDH+CELLPRLQPRYYSISSS+KLHP  VHVTAVLV+YKTPTGRIN GVATTY
Sbjct  438  IKSCRPPIDHVCELLPRLQPRYYSISSSAKLHPTDVHVTAVLVEYKTPTGRINKGVATTY  497

Query  492  LKKKQP-GGEDVRVPVFIRKSQFRLPTKPEIPIIMVGPGTGLAPFRGFIQERQYLRDEGK  550
            LK KQP G E+V+VPVFIRKSQFRLPTKPE PIIMVGPGTGLAPFRGFIQERQ+LRDEGK
Sbjct  498  LKNKQPQGSEEVKVPVFIRKSQFRLPTKPETPIIMVGPGTGLAPFRGFIQERQFLRDEGK  557

Query  551  NVGDTILYFGCRKRSEDYIYEEELEEFIKKGTLTMKAAFSRDQNEKVYVSHLIEKDADLI  610
             VG++ILYFGCRKRSEDYIYE ELEE++KKGTL +KAAFSRDQ +KVYV HL+E+DADLI
Sbjct  558  TVGESILYFGCRKRSEDYIYESELEEWVKKGTLNLKAAFSRDQGKKVYVQHLLEQDADLI  617

Query  611  WNVIGESKGHFYICGDAKNMAVDVRNILIKILVTKGGMSEADAVQYLKKMEAQKRYSADV  670
            WNVIGE+KGHFYICGDAKNMAVDVRNIL+KIL TKG MSEADAVQY+KKMEAQKRYSADV
Sbjct  618  WNVIGENKGHFYICGDAKNMAVDVRNILVKILSTKGNMSEADAVQYIKKMEAQKRYSADV  677

Query  671  WS  672
            WS
Sbjct  678  WS  679


>Q09590_CAEEL unnamed protein product
Length=662

 Score = 648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/663 (48%), Positives = 441/663 (67%), Gaps = 16/663 (2%)

Query  17   LGTLDIAILVALIAGATWYFMRSRKKEEEPIRSYSIQPTTVSTTIS-----SDNSFIKKL  71
            L T D+ +L  L  GA  +       ++     YS  PT  S T S     S+ SFI ++
Sbjct  9    LDTSDLVVLTLLAGGAIIFLFMKVFNQQPSSSRYS--PTVASVTTSAAASKSNQSFIDRM  66

Query  72   KASGRSLVVFYGSQTGTGEEFAGRLAKEGLRYRMKGMVADPEECDMEELLQLKDIPNSLA  131
            K   R +++ YGSQTGT EE +GRLAK+  RY  K +V DPE+ + E+L +L ++ ++L 
Sbjct  67   KNENRQVLIMYGSQTGTAEEMSGRLAKDLTRYTKKAVVVDPEDIECEDLNRLSEVEDALL  126

Query  132  VFCLATYGEGDPTDNAMEFFEWLSNGDADLNGLNYAVFGLGNKTYEHYNKMAIYVDQRLE  191
            V C+ATYGEGDPTDNA+   E+L+ GD DL+G+ +AVFGLGNKTYEH+N++ I +D++LE
Sbjct  127  VLCIATYGEGDPTDNAVTLVEYLNAGDCDLSGVRFAVFGLGNKTYEHFNEIGIQMDKQLE  186

Query  192  ELGATRVFELGLGDDDANIEDDFITWKDRFWPAVCDFFGIEGGGEEVLMRQYRLLEQPNV  251
            +LGA R+F LGLGDDDAN+E+DF+ W++ F P V + FG E   E   MRQY+L  +P  
Sbjct  187  KLGAKRIFHLGLGDDDANLEEDFMIWREAFLPKVAEEFGWELNTEAETMRQYQL--EPVE  244

Query  252  QPDRIYTGEIARLHSLQNQRPPFDAKNPFLAPIIVNRELH-KGGDRSCMHIELDINGSKM  310
            +   ++ GE  RL + +  RPPFD KNP+LA + +N ELH +  DRSC HIE  + GS++
Sbjct  245  EGKALFKGEFGRLGAYERPRPPFDVKNPYLATVAINDELHTEHSDRSCRHIEFSVEGSRI  304

Query  311  RYDAGDHVAMYPINDTELVEKLGKLCNADLDTVFSLINTDTDSSKKHPFPCPTTYRTALK  370
            RY+AGDH+A++P ND  LV++L  +   D D  F L+N D D+SK+HPFPCPTT+RTAL 
Sbjct  305  RYEAGDHLAVFPTNDPVLVDRLINMLQFDPDHAFRLVNVDEDASKRHPFPCPTTFRTALS  364

Query  371  HYLEITAIPRTHILKELAEYCTDEADKEFLRSMSSISPEGKEKYQSWIQDACRNIVHILE  430
            HY++I A  ++H+LK ++EYCTD+ +KEFL  +S+ + EG ++Y  +I    R+IV +L 
Sbjct  365  HYVDICAPVKSHVLKAISEYCTDDTEKEFLNKLSTANEEGLKEYARYIVKERRSIVDVLT  424

Query  431  DIKSCKPPIDHICELLPRLQPRYYSISSSSKLHPNHVHVTAVLVQYKTPTGRINNGVATT  490
            D K+CKPPI+++ ELLPRLQ RYYSI+SS +L+   + + AV+ +Y      I NGV T 
Sbjct  425  DQKTCKPPIEYLLELLPRLQARYYSIASSPRLNEEKIAICAVVTKYSIGDRDI-NGVCTR  483

Query  491  YLKKKQPGGEDVRVPVFIRKSQFRLPTKPEIPIIMVGPGTGLAPFRGFIQERQYLRDEGK  550
            YL  K  G    + PVF+RKS  RLP +    +IM+GPGTG APFRGF+Q+RQ+ ++ GK
Sbjct  484  YLTTKDAGS---KSPVFVRKSTMRLPHRTTTQVIMIGPGTGFAPFRGFLQDRQFHKNAGK  540

Query  551  NVGDTILYFGCRKRSEDYIYEEELEEFIKKGTLT-MKAAFSRDQNEKVYVSHLIEKDADL  609
             +G   LY+GCR    DYIY++EL +F +   LT +  AFSR Q  K+YV   + +  D 
Sbjct  541  EIGAMHLYYGCRHPDHDYIYKDELAKFQEDEVLTHLVCAFSRAQEHKIYVQDRLWETRDR  600

Query  610  IWNVIGESKGHFYICGDAKNMAVDVRNILIKILVTKGGMSEADAVQYLKKMEAQKRYSAD  669
            IW+ I     H YICGDA+NMA DV+  L KI    GG SE +AV Y K ME  KRY AD
Sbjct  601  IWDAINVG-AHVYICGDARNMARDVQATLQKIFREIGGKSETEAVAYFKDMEKTKRYQAD  659

Query  670  VWS  672
            VWS
Sbjct  660  VWS  662


>Q384I1_TRYB2 unnamed protein product
Length=635

 Score = 384 bits (986),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 236/675 (35%), Positives = 357/675 (53%), Gaps = 64/675 (9%)

Query  19   TLDIAILVALIAGA---TWYFMR--SRKKEEEPIRSYSIQPTTVSTTISSDNSFIKKLKA  73
            T  I +LV    G    TW F+   +RK +++ + +   +P      + S ++  K ++ 
Sbjct  3    TKAIMLLVVSAIGVVMLTWLFVSICTRKSKDDDMHN---EP------LLSKHANSKLMEV  53

Query  74   SGRSLVVFYGSQTGTGEEFAGRLAKEGLRYRMKGMVADPEECDMEELLQLKDIPNSLAVF  133
             GR LV+ YGSQTGT E FA  L +EG R      V D E+     L++ K +     + 
Sbjct  54   DGRVLVL-YGSQTGTAEMFARNLTREGSRRGFPLKVLDIEKYQASNLVKEKRV-----II  107

Query  134  CLATYGEGDPTDNAMEFFEWLSNGD----ADLNGLNYAVFGLGNKTYEHYNKMAIYVDQR  189
              ATYG+G+PTD  +EF +WL +       +L+G+ Y VFGLG++ Y ++ +  I VD+R
Sbjct  108  VCATYGDGEPTDPMVEFHDWLMSDSRVMGEELSGVRYTVFGLGDRQYVNFCREGITVDRR  167

Query  190  LEELGATRVFELGLGDDDANIEDDFITWKDRFWPAVCDFFGIEGGGEEVLMRQYRLLEQP  249
            + ELGA R + LG GD   +IE+DF  W+   WPA+     ++    E         E P
Sbjct  168  MSELGAQRFYPLGRGDYSDDIEEDFDKWRSGLWPALSTELALDVKSGE---------EGP  218

Query  250  NVQPDRIYTGEIARLHSLQNQRPPFDAKNPFL---------APIIVNREL-HKGGDRSCM  299
             V P+      +  L S      PF   +P L         AP+ VN+EL      RS  
Sbjct  219  -VAPECC----MKALESSDEAPLPFPKADPGLEPTQRLPSWAPVKVNKELLSNATGRSTR  273

Query  300  HIELDINGSKMRYDAGDHVAMYPINDTELVEKLGKLCNADLDTVFSLINTDTDSSKKHPF  359
             IE D + + + Y AGDH+ + P N +E+V    ++          +I+ +  ++ +  F
Sbjct  274  LIEFDTSETVISYQAGDHLGVLPSNPSEMVNTYLRVLGVSEQESSQVISLENKNTGECVF  333

Query  360  PCPTTYRTALKHYLEITAIPRTHILKELAEYCTDEADKEFLRSMSSISPEGKEKYQSWIQ  419
            PC  + RTAL  Y+++   P+   L+  A YCTD  +K+ L  + S  PE  E Y   + 
Sbjct  334  PCRASIRTALTWYIDLAGPPKKSTLRAFAHYCTDPVEKDTLLKLLSTEPESVEAYGKLVL  393

Query  420  DACRNIVHILEDIKSCKPPIDHICELLPRLQPRYYSISSSSKLHPNHVHVTAVLVQYKTP  479
            +  R ++  L+  KS  PP+    E++PR+ PRY+SISS S  HP  V +T  +V+    
Sbjct  394  E-LRTVLGFLQRFKSMSPPLSFFLEMMPRIAPRYFSISSDSLTHPTSVAITVAVVE----  448

Query  480  TGRINNGVATTYLKKKQPGGEDVRVPVFIRKSQFRLPTKPE-IPIIMVGPGTGLAPFRGF  538
                  G+ T  L++   G     +PVF+RKS F LP + E  PIIM+GPGTG+APF GF
Sbjct  449  -----GGLCTNLLQQAAVGQN---IPVFVRKSNFHLPLQAEDRPIIMIGPGTGVAPFIGF  500

Query  539  IQERQYLRDEGKNVGDTILYFGCRKRSEDYIYEEELEEFIKKGTLTMK-AAFSRDQNEKV  597
            +  R    ++G  VGD +L+FGCR+R ED+IY + +E+ +  G L+++  A+SR+Q +KV
Sbjct  501  LHRRSAWLEKGNKVGDALLFFGCRRREEDHIYADFMEKCLSNGALSVRDVAYSREQADKV  560

Query  598  YVSHLIEKDADLIWNVIGESKGHFYICGDAKNMAVDVRNILIKILVTKGGMSEADAVQYL  657
            YV H +      +W +I    G+ Y+CGDAKNMA DV   L+ I    G M E +A   L
Sbjct  561  YVQHRLAARGKEVWEIISRG-GNVYVCGDAKNMARDVERQLLDIAQKYGAMKEDEATALL  619

Query  658  KKMEAQKRYSADVWS  672
            +K+   +RY  DVW+
Sbjct  620  EKLATDERYLKDVWT  634



Lambda      K        H
   0.323    0.139    0.422 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2140775808


Query= NP_001306718.1 RAB1A, member RAS oncogene family [Bactrocera
dorsalis]

Length=205
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O18332_DROME  unnamed protein product                                 411     1e-148
RAB1A_DICDI  unnamed protein product                                  315     1e-110
RAB1B_DICDI  unnamed protein product                                  315     2e-110


>O18332_DROME unnamed protein product
Length=205

 Score = 411 bits (1056),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 196/205 (96%), Positives = 202/205 (99%), Gaps = 0/205 (0%)

Query  1    MSAMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTI  60
            MS++NPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTI
Sbjct  1    MSSVNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTI  60

Query  61   KLQIWDTAGQERFRTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNKL  120
            KLQIWDTAGQERFRTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNKL
Sbjct  61   KLQIWDTAGQERFRTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNKL  120

Query  121  LVGNKCDLTTKKVVDTNTAAEYASQLGIPFLETSAKNATNVEQAFLTMAAEIKNRVGPPS  180
            LVGNK DLTTKKVVD  TAAEYA+QLGIPFLETSAK+ATNVEQAF+TMAAEIKNRVGPPS
Sbjct  121  LVGNKSDLTTKKVVDHTTAAEYAAQLGIPFLETSAKSATNVEQAFMTMAAEIKNRVGPPS  180

Query  181  SATENASKVKIDQGRPVENTKSGCC  205
            SAT+NASKVKIDQGRPVENTKSGCC
Sbjct  181  SATDNASKVKIDQGRPVENTKSGCC  205


>RAB1A_DICDI unnamed protein product
Length=202

 Score = 315 bits (806),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 173/204 (85%), Gaps = 4/204 (2%)

Query  4    MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQ  63
            MNP+Y YLFKLLLIGDSGVGKSCLLLRFADDTY+ES+ISTIGVDFKIRTIEL+GKTIKLQ
Sbjct  1    MNPDYHYLFKLLLIGDSGVGKSCLLLRFADDTYSESFISTIGVDFKIRTIELNGKTIKLQ  60

Query  64   IWDTAGQERFRTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNKLLVG  123
            IWDTAGQERFRTITSSYYRGAHGIIVVYD TD+ +F NV+QWL+EI+R+ACENVNKLLVG
Sbjct  61   IWDTAGQERFRTITSSYYRGAHGIIVVYDVTDKLTFENVRQWLQEIDRFACENVNKLLVG  120

Query  124  NKCDLTTKKVVDTNTAAEYASQLGIPFLETSAKNATNVEQAFLTMAAEIKNRVGPPSSAT  183
            NK DL  KKVVD NTA  +A  L IPFLETSAK +TNVEQAF+TMA EIKNR+   S  T
Sbjct  121  NKSDLVAKKVVDFNTAKAFADSLQIPFLETSAKQSTNVEQAFMTMATEIKNRL-TASQPT  179

Query  184  ENASKVKIDQGR--PVENTKSGCC  205
            +   K K+  G   P+ + KSGCC
Sbjct  180  QTVDKNKVVPGSSAPI-SPKSGCC  202


>RAB1B_DICDI unnamed protein product
Length=206

 Score = 315 bits (806),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 153/201 (76%), Positives = 170/201 (85%), Gaps = 3/201 (1%)

Query  4    MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQ  63
            MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTI LDGK IKLQ
Sbjct  1    MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTINLDGKIIKLQ  60

Query  64   IWDTAGQERFRTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNKLLVG  123
            IWDTAGQERFRTITSSYYRGAHGIIVVYD TD  SFNNVKQW++EI+RYAC++V +LLVG
Sbjct  61   IWDTAGQERFRTITSSYYRGAHGIIVVYDVTDHVSFNNVKQWMQEIQRYACDSVTRLLVG  120

Query  124  NKCDLTTKKVVDTNTAAEYASQLGIPFLETSAKNATNVEQAFLTMAAEIKNRVG---PPS  180
            NKCDL  KK+VDT+TA EYA  +GIPFLETSAK++ NVEQAF+ MA+EIK   G   P +
Sbjct  121  NKCDLIEKKIVDTSTAREYADSVGIPFLETSAKSSANVEQAFMIMASEIKKLQGGIQPNN  180

Query  181  SATENASKVKIDQGRPVENTK  201
            ++T NA  VK     P+   K
Sbjct  181  NSTYNAHVVKPTGFTPIGKKK  201



Lambda      K        H
   0.323    0.139    0.422 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2140775808


Query= NP_001306719.1 RAB35, member RAS oncogene family [Bactrocera
dorsalis]

Length=201
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9W5X0_DROME  unnamed protein product                                 364     2e-130
F0JAF7_DROME  unnamed protein product                                 327     9e-116
Q9U2C3_CAEEL  unnamed protein product                                 268     3e-92 


>Q9W5X0_DROME unnamed protein product
Length=201

 Score = 364 bits (935),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 173/200 (87%), Positives = 186/200 (93%), Gaps = 0/200 (0%)

Query  1    MARGFDHLFKLLIIGDSGVGKSSLLIRFSDDTFAGTYITTIGVDFKIRTVVIDGLRIKLQ  60
            MARGFDHLFKLLIIGDSGVGKSSLLIRFSDDTF+G+YITTIGVDFKIRTV I+G+R+KLQ
Sbjct  1    MARGFDHLFKLLIIGDSGVGKSSLLIRFSDDTFSGSYITTIGVDFKIRTVDIEGMRVKLQ  60

Query  61   IWDTAGQERFRTITSTYYRGTHGVIIVYDVTNGESFANVRRWLDEIQNNCDVVNKVLVGN  120
            IWDTAGQERFRTITSTYYRGTHGVI+VYDVTNGESFANVRRWL+EIQNNCDVV KVLVGN
Sbjct  61   IWDTAGQERFRTITSTYYRGTHGVIVVYDVTNGESFANVRRWLEEIQNNCDVVKKVLVGN  120

Query  121  KNDDPDRKVVITEDAQRFARQMDIELFETSAKDNINVEEMFLAITRQVLQHKLRNAQNEQ  180
            KNDDPDRKVVITEDAQRFA+QMDIELFETSAKDNINVE MFL+ITRQVL HKLR + NEQ
Sbjct  121  KNDDPDRKVVITEDAQRFAKQMDIELFETSAKDNINVENMFLSITRQVLDHKLRTSPNEQ  180

Query  181  QKDSITLKKQQKNKRKSKCC  200
            QKD++ LK   K  +  KCC
Sbjct  181  QKDTLHLKPNPKGSKGGKCC  200


>F0JAF7_DROME unnamed protein product
Length=190

 Score = 327 bits (838),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 156/186 (84%), Positives = 170/186 (91%), Gaps = 0/186 (0%)

Query  15   GDSGVGKSSLLIRFSDDTFAGTYITTIGVDFKIRTVVIDGLRIKLQIWDTAGQERFRTIT  74
            G + VGKSSLLIRFSDDTF+G+YITTIGVDFKIRTV I+G+R+KLQIWDTAGQERFRTIT
Sbjct  4    GLTCVGKSSLLIRFSDDTFSGSYITTIGVDFKIRTVDIEGMRVKLQIWDTAGQERFRTIT  63

Query  75   STYYRGTHGVIIVYDVTNGESFANVRRWLDEIQNNCDVVNKVLVGNKNDDPDRKVVITED  134
            STYYRGTHGVI+VYDVTNGESFANVRRWL+EIQNNCDVV KVLVGNKNDDPDRKVVITED
Sbjct  64   STYYRGTHGVIVVYDVTNGESFANVRRWLEEIQNNCDVVKKVLVGNKNDDPDRKVVITED  123

Query  135  AQRFARQMDIELFETSAKDNINVEEMFLAITRQVLQHKLRNAQNEQQKDSITLKKQQKNK  194
            AQRFA+QMDIELFETSAKDNINVE MFL+ITRQVL HKLR + NEQQKD++ LK   K  
Sbjct  124  AQRFAKQMDIELFETSAKDNINVENMFLSITRQVLDHKLRTSPNEQQKDTLHLKPNPKGS  183

Query  195  RKSKCC  200
            +  KCC
Sbjct  184  KGGKCC  189


>Q9U2C3_CAEEL unnamed protein product
Length=209

 Score = 268 bits (685),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 161/204 (79%), Gaps = 7/204 (3%)

Query  3    RGFDHLFKLLIIGDSGVGKSSLLIRFSDDTFAGTYITTIGVDFKIRTVVIDGLRIKLQIW  62
            R +DHLFKLLIIGDSGVGKSSLL+RF+D+TF+  YITTIGVDFKIRT+ I+G R+KLQIW
Sbjct  5    RDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSENYITTIGVDFKIRTMDINGQRVKLQIW  64

Query  63   DTAGQERFRTITSTYYRGTHGVIIVYDVTNGESFANVRRWLDEIQNNCDVVNKVLVGNKN  122
            DTAGQERFRTITSTYYRGTHGV++VYDVTNGESF NV+RWL EI+NNCD V KVLVGNK 
Sbjct  65   DTAGQERFRTITSTYYRGTHGVVVVYDVTNGESFGNVKRWLQEIENNCDSVQKVLVGNKC  124

Query  123  DDPDRKVVITEDAQRFARQMDIELFETSAKDNINVEEMFLAITRQVLQHKLRNAQNEQQK  182
            ++ +R+VV+  DA+ +A+ M+I  FETSAK++ NVE MF  IT  VL  KL N Q+  + 
Sbjct  125  EENERRVVLESDARNYAQSMNISFFETSAKEDKNVEPMFTCITSLVLTAKLANPQSASKD  184

Query  183  DS----ITLKKQQKN---KRKSKC  199
             S    ++LK    +   K+K KC
Sbjct  185  QSRTGGVSLKDNSGSTNQKKKCKC  208



Lambda      K        H
   0.323    0.139    0.422 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2140775808


Query= NP_001306720.1 RAB5B, member RAS oncogene family [Bactrocera
dorsalis]

Length=221
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9V3I2_DROME  unnamed protein product                                 410     8e-148
I7FXD3_CAEEL  unnamed protein product                                 319     4e-112
P91857_CAEEL  unnamed protein product                                 319     4e-112


>Q9V3I2_DROME unnamed protein product
Length=219

 Score = 410 bits (1054),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 199/221 (90%), Positives = 204/221 (92%), Gaps = 2/221 (1%)

Query  1    MATTARSGGNASGSTAQRPNGTQQNKNCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQES  60
            MATT RSGG +   TAQRPNGT QNK+CQFKLVLLGESAVGKSSLVLRFVKGQFHEYQES
Sbjct  1    MATTPRSGGASGTGTAQRPNGTSQNKSCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQES  60

Query  61   TIGAAFLTQTICIEDTVVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRA  120
            TIGAAFLTQTICIEDTVVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRA
Sbjct  61   TIGAAFLTQTICIEDTVVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRA  120

Query  121  KTWVKELHKQASPNIVIALAGNKADLSNIRVVEYEEAKQYAEENGLLFMETSAKTGMNVN  180
            KTWVKELHKQASPNIVIALAGNKADLSNIRVVE++EAKQYAEENGLLFMETSAKTGMNVN
Sbjct  121  KTWVKELHKQASPNIVIALAGNKADLSNIRVVEFDEAKQYAEENGLLFMETSAKTGMNVN  180

Query  181  DIFLAIAKKLPKNDGAHNQGAPAGRRLNDNENNRQTNNCCK  221
            DIFLAIAKKLPKNDGA+NQG     R    E NR TNNCCK
Sbjct  181  DIFLAIAKKLPKNDGANNQGTSI--RPTGTETNRPTNNCCK  219


>I7FXD3_CAEEL unnamed protein product
Length=207

 Score = 319 bits (818),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 157/217 (72%), Positives = 174/217 (80%), Gaps = 11/217 (5%)

Query  5    ARSGGNASGSTAQRPNGTQQNKNCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGA  64
            AR+ G A      RP G   N+ CQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGA
Sbjct  2    ARNAGTA------RPGGP--NRTCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGA  53

Query  65   AFLTQTICIEDTVVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWV  124
            AFLTQT+C++D  +KFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDI NQ+SFQ+AK WV
Sbjct  54   AFLTQTVCLDDATIKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQESFQKAKNWV  113

Query  125  KELHKQASPNIVIALAGNKADLSNIRVVEYEEAKQYAEENGLLFMETSAKTGMNVNDIFL  184
            KEL +QASPNIV+ALAGNKAD++N R VEYEEA  YAE+N LLFMETSAKT MNVNDIF+
Sbjct  114  KELQRQASPNIVMALAGNKADVANKRTVEYEEANAYAEDNALLFMETSAKTSMNVNDIFM  173

Query  185  AIAKKLPKNDGAHNQGAPAGRRLNDNENNRQTNNCCK  221
            AIAKKLP       QG P G    +    +Q  +CCK
Sbjct  174  AIAKKLPIGPA---QGEPTGTVDMNQPQQQQKGSCCK  207


>P91857_CAEEL unnamed protein product
Length=208

 Score = 319 bits (818),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 157/217 (72%), Positives = 174/217 (80%), Gaps = 11/217 (5%)

Query  5    ARSGGNASGSTAQRPNGTQQNKNCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGA  64
            AR+ G A      RP G   N+ CQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGA
Sbjct  3    ARNAGTA------RPGGP--NRTCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGA  54

Query  65   AFLTQTICIEDTVVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWV  124
            AFLTQT+C++D  +KFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDI NQ+SFQ+AK WV
Sbjct  55   AFLTQTVCLDDATIKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQESFQKAKNWV  114

Query  125  KELHKQASPNIVIALAGNKADLSNIRVVEYEEAKQYAEENGLLFMETSAKTGMNVNDIFL  184
            KEL +QASPNIV+ALAGNKAD++N R VEYEEA  YAE+N LLFMETSAKT MNVNDIF+
Sbjct  115  KELQRQASPNIVMALAGNKADVANKRTVEYEEANAYAEDNALLFMETSAKTSMNVNDIFM  174

Query  185  AIAKKLPKNDGAHNQGAPAGRRLNDNENNRQTNNCCK  221
            AIAKKLP       QG P G    +    +Q  +CCK
Sbjct  175  AIAKKLPIGPA---QGEPTGTVDMNQPQQQQKGSCCK  208



Lambda      K        H
   0.323    0.139    0.422 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2140775808


Query= NP_001351866.1 cytochrome P450 309a2-like [Bactrocera dorsalis]

Length=531
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

C6A13_DROME  unnamed protein product                                  192     1e-54
CP6A2_DROME  unnamed protein product                                  182     4e-51
CP6A8_DROME  unnamed protein product                                  182     4e-51


>C6A13_DROME unnamed protein product
Length=493

 Score = 192 bits (487),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 134/508 (26%), Positives = 243/508 (48%), Gaps = 23/508 (5%)

Query  29   MEAILITLALLAILVYKYLTWHHGVFKKLGLDGPKPNIFLGNFPSAITGKQPLFYEAD-E  87
            M  +L+ +  + +L+Y  L WH+  + + G+ G +P  F GN      G+   + + +  
Sbjct  1    MLTLLVLVFTVGLLLYVKLRWHYSYWSRRGVAGERPVYFRGNMSG--LGRDLHWTDINLR  58

Query  88   IYNKYKKTHRAIGVFMTRNPQILILDPQLAQDVLVKNFGKFRGNLAANWIYDRKLDKLAA  147
            IY K++   R  G F      + I+D +L +D+++++F  F    A   ++    D    
Sbjct  59   IYRKFRGVERYCGYFTFMTKSLFIMDLELIRDIMIRDFSSF----ADRGLFHNVRDDPLT  114

Query  148  VSPFFTSDDSWKTKRSDLVTGLTQNKLNAAYPIIKGCAEKLSKYLEKRTEQGNAVIETKN  207
             +  F     W+  R +L    T  K+   +P +    EKL++    R + G   IE K+
Sbjct  115  GNLLFLDGPEWRWLRQNLTQVFTSGKMKFMFPNMVEVGEKLTQAC--RLQVGE--IEAKD  170

Query  208  LGFCFTSNVLGEFLWGIETNALAKPDEPNIYLQMQTKWLQFIVNSLDAYFKLLPLPWLRR  267
            L   FT++V+G   +G+E N+L  P+  + + +M     Q  ++S+     +   P L R
Sbjct  171  LCARFTTDVIGSCAFGLECNSLQDPE--SQFRRMGRSVTQEPLHSVLVQAFMFAQPELAR  228

Query  268  FAQKRLFSEETNNFFSQLTKDALDLRAKDASSQSRVDFLNHLRQLQE---KKGLSHDDMV  324
              + RLF  E + FF    +  LD R ++  +  R D +  L +L E   K  LS + + 
Sbjct  229  KLRFRLFRPEVSEFFLDTVRQTLDYRRRE--NIHRNDLIQLLMELGEEGVKDALSFEQIA  286

Query  325  GHILTTMLNGYETSATVLFHTIFYLAHHPEYQEKLRAEILENIEEDGF-VSYQKLSSLPY  383
               L   L G++TS+T +   ++ LA +P+ QE+LR E+L  ++ +   ++Y  +  +PY
Sbjct  287  AQALVFFLAGFDTSSTTMSFCLYELALNPDVQERLRVEVLAVLKRNNQKLTYDSVQEMPY  346

Query  384  LDQCFHESIRLITVVSFYARICTEPTELDVGNGHIIPIRVGDVVSVPIFSYHHNPDYFPK  443
            LDQ   E++R   ++    R  T+  E  + N ++I +  G  + +P+ S HH+P+ +P 
Sbjct  347  LDQVVAETLRKYPILPHLLRRSTK--EYQIPNSNLI-LEPGSKIIIPVHSIHHDPELYPD  403

Query  444  PSEYNPDRFNNAAHVDLIKKGIFMPFGCGPRICAGIHLATMEVKACLVEIFKSYRVKCCA  503
            P +++P RF     +       ++PFG GPR C G     ++VK  LV + + ++     
Sbjct  404  PEKFDPSRF-EPEEIKARHPFAYLPFGEGPRNCIGERFGKLQVKVGLVYLLRDFKFSRSE  462

Query  504  KTIPEKRHDSPTFIVGIDGEFWLEYERL  531
            KT    +  S  F++       L  E L
Sbjct  463  KTQIPLKFSSRNFLISTQEGVHLRMEGL  490


>CP6A2_DROME unnamed protein product
Length=506

 Score = 182 bits (462),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 134/523 (26%), Positives = 242/523 (46%), Gaps = 44/523 (8%)

Query  32   ILITLALLAILVYKYLTWHHGVFKKLGLDGPKPNIFLGNFPSAITGK--QPLFYEADEIY  89
            I + +A+ ++L Y Y   +   + + G+    P+   GN       +     FY+    Y
Sbjct  5    IYLLIAISSLLAYLY-HRNFNYWNRRGVPHDAPHPLYGNMVGFRKNRVMHDFFYD---YY  60

Query  90   NKYKKTHRA-IGVFMTRNPQILILDPQLAQDVLVKNFGKFRGNLAANWIYDRKLDKLAAV  148
            NKY+K+    +G +    P   I+D QLA+++L+K+F     N A    +    D     
Sbjct  61   NKYRKSGFPFVGFYFLHKPAAFIVDTQLAKNILIKDFS----NFADRGQFHNGRDDPLTQ  116

Query  149  SPFFTSDDSWKTKRSDLVTGLTQNKLNAAYPIIKGCAEKLSKYLEKRT--EQGNAVIETK  206
              F      WK  R  L    T  K+   +P +   +E+  K + ++    Q  AV+E K
Sbjct  117  HLFNLDGKKWKDMRQRLTPTFTSGKMKFMFPTVIKVSEEFVKVITEQVPAAQNGAVLEIK  176

Query  207  NLGFCFTSNVLGEFLWGIETNALAKPDEPNIYLQMQTKWLQFIVNSLDAYFKLLPLPWLR  266
             L   FT++V+G   +GIE N L  P     +  M  K    + +       +   P L 
Sbjct  177  ELMARFTTDVIGTCAFGIECNTLRTPVSD--FRTMGQKVFTDMRHGKLLTMFVFSFPKLA  234

Query  267  RFAQKRLFSEETNNFFSQLTKDALDLRAKDASSQSRVDFLNHLRQLQEK-----------  315
               + R+  E+ + FF +L  D + LR ++  +  R DF+N L +L++K           
Sbjct  235  SRLRMRMMPEDVHQFFMRLVNDTIALRERE--NFKRNDFMNLLIELKQKGRVTLDNGEVI  292

Query  316  KGLSHDDMVGHILTTMLNGYETSATVLFHTIFYLAHHPEYQEKLRAEILENIEE-DGFVS  374
            +G+   ++   +    + G+ETS++ + + ++ LA + + Q++LR EI   +EE +G ++
Sbjct  293  EGMDIGELAAQVFVFYVAGFETSSSTMSYCLYELAQNQDIQDRLRNEIQTVLEEQEGQLT  352

Query  375  YQKLSSLPYLDQCFHESIRLITVVSFYARICTEPTELDVGNGHIIP------IRVGDVVS  428
            Y+ + ++ YL+Q   E++RL T+V    R           N +++P      I  G  V 
Sbjct  353  YESIKAMTYLNQVISETLRLYTLVPHLERKAL--------NDYVVPGHEKLVIEKGTQVI  404

Query  429  VPIFSYHHNPDYFPKPSEYNPDRFNNAAHVDLIKKGIFMPFGCGPRICAGIHLATMEVKA  488
            +P  +YH + D +P P  ++P+RF+    V   +   ++PFG GPR C G+    M+ + 
Sbjct  405  IPACAYHRDEDLYPNPETFDPERFS-PEKVAARESVEWLPFGDGPRNCIGMRFGQMQARI  463

Query  489  CLVEIFKSYRVKCCAKTIPEKRHDSPTFIVGIDGEFWLEYERL  531
             L +I   +RV  C  T    ++   + ++G  G  +L  ER+
Sbjct  464  GLAQIISRFRVSVCDTTEIPLKYSPMSIVLGTVGGIYLRVERI  506


>CP6A8_DROME unnamed protein product
Length=506

 Score = 182 bits (462),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 133/511 (26%), Positives = 250/511 (49%), Gaps = 31/511 (6%)

Query  34   ITLALLAILVYKYLTWHHGVFKKLGLDGPKPNIFLGNFPSAITGKQPLFYEADEIYNKYK  93
            + +ALLAIL Y Y+      FK+ G+    P++  GN       K       D  YNK++
Sbjct  10   VAVALLAILTY-YIHRKLTYFKRRGIPFVAPHLIRGNMEELQKTKNIHEIFQDH-YNKFR  67

Query  94   KTHRA-IGVFMTRNPQILILDPQLAQDVLVKNFGKFRGNLAANWIYDRKLDKLAAVSPFF  152
            ++    +G F  ++P   ++D +LA+ +L+K+F  F         Y+ K D ++A    F
Sbjct  68   ESKAPFVGFFFFQSPAAFVIDLELAKQILIKDFSNFSNK---GIFYNEKDDPISA--HLF  122

Query  153  TSDDS-WKTKRSDLVTGLTQNKLNAAYPIIKGCAEKLSKYLEKRTEQGNAVIETKNLGFC  211
              D + W+  R+ L +  T  K+   YP +   A +    + ++  + N+V+E ++L   
Sbjct  123  NLDGAQWRLLRNKLSSTFTSGKMKLMYPTVVSVANEFMTVMHEKVPK-NSVLEIRDLVAR  181

Query  212  FTSNVLGEFLWGIETNALAKPDEPNIYLQMQTKWLQFIVNSLDAYFKLLPLPWLRRFAQK  271
            FT +V+G   +GI+ N+L       +Y   ++   +     L+ + +  P    R+    
Sbjct  182  FTVDVIGTCAFGIQCNSLRDEKAEFLYFGKRSLVDKRHGTLLNGFMRSYP-KLARKLGMV  240

Query  272  RLFSEETNNFFSQLTKDALDLRAKDASSQSRVDFLNHLRQLQEKK-----------GLSH  320
            R  +     F+S++  + + +R K+     R DF++ L +L+ +K           GL+ 
Sbjct  241  RT-APHIQEFYSRIVTETVAVREKE--HIKRNDFMDMLIELKNQKEMTLENGDVVRGLTM  297

Query  321  DDMVGHILTTMLNGYETSATVLFHTIFYLAHHPEYQEKLRAEILENIEE-DGFVSYQKLS  379
            ++++       + G+ETS++ +   ++ LA +P+ Q+K+RAE+ E IE+ D   +Y+   
Sbjct  298  EEVLAQAFVFFIAGFETSSSTMGFALYELAKNPDIQDKVRAEVEEVIEQHDQNFTYECTK  357

Query  380  SLPYLDQCFHESIRLITVVSFYARICTEPTELDVGNGHI-IPIRVGDVVSVPIFSYHHNP  438
             L YL+Q   E++RL T+V    R+  +     V  GH    I  G  V +P  + HH+P
Sbjct  358  DLKYLNQVLDETLRLYTIVPNLDRMAAKRY---VVPGHPNFVIEAGQSVIIPSSAIHHDP  414

Query  439  DYFPKPSEYNPDRFNNAAHVDLIKKGIFMPFGCGPRICAGIHLATMEVKACLVEIFKSYR  498
              +P+P E+ P+RF+            ++PFG GPR C G+    M+ +  L  + ++++
Sbjct  415  SIYPEPFEFRPERFSPEESAGRPSVA-WLPFGDGPRNCIGLRFGQMQARIGLALLIRNFK  473

Query  499  VKCCAKTIPEKRHDSPTFIVGIDGEFWLEYE  529
               C+KT     +D  +F++G+    +L+ E
Sbjct  474  FSTCSKTPNPLVYDPKSFVLGVKDGIYLKVE  504



Lambda      K        H
   0.323    0.139    0.422 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2140775808


Query= NP_001351874.1 Cytochrome P450 Cyp309a1-like [Bactrocera dorsalis]

Length=502
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CP6A8_DROME  unnamed protein product                                  206     2e-60
C6A13_DROME  unnamed protein product                                  200     3e-58
CP6A2_DROME  unnamed protein product                                  200     5e-58


>CP6A8_DROME unnamed protein product
Length=506

 Score = 206 bits (525),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 142/517 (27%), Positives = 257/517 (50%), Gaps = 44/517 (9%)

Query  6    VTLALLAAVAFLIHKYLTWHYDTFKKLGIAGPEPKIWRGN---LSGKQHIAYDYDDIYNK  62
            V +ALLA + + IH+ LT+    FK+ GI    P + RGN   L   ++I   + D YNK
Sbjct  10   VAVALLAILTYYIHRKLTY----FKRRGIPFVAPHLIRGNMEELQKTKNIHEIFQDHYNK  65

Query  63   YKQ-KHQIVGMFVSRDPQFLILDPKLAHEVLVTNFKSFRDNLGSKFLYDREVDTVAALNP  121
            +++ K   VG F  + P   ++D +LA ++L+ +F +F +       Y+ + D ++A   
Sbjct  66   FRESKAPFVGFFFFQSPAAFVIDLELAKQILIKDFSNFSNK---GIFYNEKDDPISA--H  120

Query  122  FFNV-GEEWKTKRSDVMSGLTQHKLTSAYPIWKTCTQKLGKLLKAETVKGSSIIETKNLL  180
             FN+ G +W+  R+ + S  T  K+   YP   +   +   ++  E V  +S++E ++L+
Sbjct  121  LFNLDGAQWRLLRNKLSSTFTSGKMKLMYPTVVSVANEFMTVMH-EKVPKNSVLEIRDLV  179

Query  181  LRYTSNILGEFLWGIETKTLESLDEPNPYLEVAQRNMFQ-----VFQGFMSYFKCIPFPW  235
             R+T +++G   +GI+  +L   DE   +L   +R++       +  GFM       +P 
Sbjct  180  ARFTVDVIGTCAFGIQCNSLR--DEKAEFLYFGKRSLVDKRHGTLLNGFMR-----SYPK  232

Query  236  YRRFTNYRIFTAESDQLFSQFTKDAYALRERDASKKNQADFLNYVRQLQEKK--------  287
              R            + +S+   +  A+RE++  K+N  DF++ + +L+ +K        
Sbjct  233  LARKLGMVRTAPHIQEFYSRIVTETVAVREKEHIKRN--DFMDMLIELKNQKEMTLENGD  290

Query  288  ---NLTHNEVVGYLATVFVDGFDTAATVAFHTLFYLTHHPEYQEKLRKEILSNLEA-DGH  343
                LT  EV+      F+ GF+T+++     L+ L  +P+ Q+K+R E+   +E  D +
Sbjct  291  VVRGLTMEEVLAQAFVFFIAGFETSSSTMGFALYELAKNPDIQDKVRAEVEEVIEQHDQN  350

Query  344  INYQALSLLPYLDQCVHETLRMISPLTFTSRICTEPTELVLDDGRRIPIEKGQVATVPVF  403
              Y+    L YL+Q + ETLR+ + +    R+  +    V+       IE GQ   +P  
Sbjct  351  FTYECTKDLKYLNQVLDETLRLYTIVPNLDRMAAK--RYVVPGHPNFVIEAGQSVIIPSS  408

Query  404  SYLHDPEYFEEPMEFKPERFENVDISELTKRGIFLPFGDGPRICLGRHLGVLQVKTAIVE  463
            +  HDP  + EP EF+PERF   + S       +LPFGDGPR C+G   G +Q +  +  
Sbjct  409  AIHHDPSIYPEPFEFRPERFSPEE-SAGRPSVAWLPFGDGPRNCIGLRFGQMQARIGLAL  467

Query  464  VLKNYRLKVCDKTPPIAKLESQTLIVGVDGDLLFEYE  500
            +++N++   C KTP     + ++ ++GV   +  + E
Sbjct  468  LIRNFKFSTCSKTPNPLVYDPKSFVLGVKDGIYLKVE  504


>C6A13_DROME unnamed protein product
Length=493

 Score = 200 bits (509),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 141/500 (28%), Positives = 235/500 (47%), Gaps = 35/500 (7%)

Query  4    LLVTLALLAAVAFLIHKYLTWHYDTFKKLGIAGPEPKIWRGNLSGKQHIAYDYD---DIY  60
            +L  L L+  V  L++  L WHY  + + G+AG  P  +RGN+SG     +  D    IY
Sbjct  1    MLTLLVLVFTVGLLLYVKLRWHYSYWSRRGVAGERPVYFRGNMSGLGRDLHWTDINLRIY  60

Query  61   NKYKQKHQIVGMFVSRDPQFLILDPKLAHEVLVTNFKSFRDNLGSKFLYDREVDTVAALN  120
             K++   +  G F        I+D +L  ++++ +F SF D    + L+    D     N
Sbjct  61   RKFRGVERYCGYFTFMTKSLFIMDLELIRDIMIRDFSSFAD----RGLFHNVRDDPLTGN  116

Query  121  PFFNVGEEWKTKRSDVMSGLTQHKLTSAYPIWKTCTQKLGKLLKAETVKGSSIIETKNLL  180
              F  G EW+  R ++    T  K+   +P      +KL +  + +  +    IE K+L 
Sbjct  117  LLFLDGPEWRWLRQNLTQVFTSGKMKFMFPNMVEVGEKLTQACRLQVGE----IEAKDLC  172

Query  181  LRYTSNILGEFLWGIETKTLESLDEPNPYLEVAQRNMFQ------VFQGFMSYFKCIPFP  234
             R+T++++G   +G+E     SL +P        R++ Q      + Q FM        P
Sbjct  173  ARFTTDVIGSCAFGLECN---SLQDPESQFRRMGRSVTQEPLHSVLVQAFM-----FAQP  224

Query  235  WYRRFTNYRIFTAESDQLFSQFTKDAYALRERDASKKNQADFLNYVRQLQE---KKNLTH  291
               R   +R+F  E  + F    +     R R+   +N  D +  + +L E   K  L+ 
Sbjct  225  ELARKLRFRLFRPEVSEFFLDTVRQTLDYRRRENIHRN--DLIQLLMELGEEGVKDALSF  282

Query  292  NEVVGYLATVFVDGFDTAATVAFHTLFYLTHHPEYQEKLRKEILSNLEADGH-INYQALS  350
             ++       F+ GFDT++T     L+ L  +P+ QE+LR E+L+ L+ +   + Y ++ 
Sbjct  283  EQIAAQALVFFLAGFDTSSTTMSFCLYELALNPDVQERLRVEVLAVLKRNNQKLTYDSVQ  342

Query  351  LLPYLDQCVHETLRMISPLTFTSRICTEPTELVLDDGRRIPIEKGQVATVPVFSYLHDPE  410
             +PYLDQ V ETLR    L    R  T+  ++       + +E G    +PV S  HDPE
Sbjct  343  EMPYLDQVVAETLRKYPILPHLLRRSTKEYQI---PNSNLILEPGSKIIIPVHSIHHDPE  399

Query  411  YFEEPMEFKPERFENVDISELTKRGIFLPFGDGPRICLGRHLGVLQVKTAIVEVLKNYRL  470
             + +P +F P RFE  +I        +LPFG+GPR C+G   G LQVK  +V +L++++ 
Sbjct  400  LYPDPEKFDPSRFEPEEIKARHPFA-YLPFGEGPRNCIGERFGKLQVKVGLVYLLRDFKF  458

Query  471  KVCDKTPPIAKLESQTLIVG  490
               +KT    K  S+  ++ 
Sbjct  459  SRSEKTQIPLKFSSRNFLIS  478


>CP6A2_DROME unnamed protein product
Length=506

 Score = 200 bits (509),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 141/520 (27%), Positives = 256/520 (49%), Gaps = 35/520 (7%)

Query  4    LLVTLALLAAVAFLIHKYLTWHYDTFKKLGIAGPEPKIWRGNLSG--KQHIAYDY-DDIY  60
            + V + LL A++ L+      +++ + + G+    P    GN+ G  K  + +D+  D Y
Sbjct  1    MFVLIYLLIAISSLLAYLYHRNFNYWNRRGVPHDAPHPLYGNMVGFRKNRVMHDFFYDYY  60

Query  61   NKY-KQKHQIVGMFVSRDPQFLILDPKLAHEVLVTNFKSFRDNLGSKFLYDREVDTVAAL  119
            NKY K     VG +    P   I+D +LA  +L+ +F +F D    +F   R+      L
Sbjct  61   NKYRKSGFPFVGFYFLHKPAAFIVDTQLAKNILIKDFSNFADR--GQFHNGRDDPLTQHL  118

Query  120  NPFFNV-GEEWKTKRSDVMSGLTQHKLTSAYPIWKTCTQKLGKLLKAE--TVKGSSIIET  176
               FN+ G++WK  R  +    T  K+   +P     +++  K++  +    +  +++E 
Sbjct  119  ---FNLDGKKWKDMRQRLTPTFTSGKMKFMFPTVIKVSEEFVKVITEQVPAAQNGAVLEI  175

Query  177  KNLLLRYTSNILGEFLWGIETKTLESLDEPNPYLEVAQRNMFQVFQGFMSYFKCIPFPWY  236
            K L+ R+T++++G   +GIE  TL +    + +  + Q+    +  G +       FP  
Sbjct  176  KELMARFTTDVIGTCAFGIECNTLRT--PVSDFRTMGQKVFTDMRHGKLLTMFVFSFPKL  233

Query  237  RRFTNYRIFTAESDQLFSQFTKDAYALRERDASKKNQADFLNYVRQLQEKKNLT--HNEV  294
                  R+   +  Q F +   D  ALRER+  K+N  DF+N + +L++K  +T  + EV
Sbjct  234  ASRLRMRMMPEDVHQFFMRLVNDTIALRERENFKRN--DFMNLLIELKQKGRVTLDNGEV  291

Query  295  V-----GYLAT----VFVDGFDTAATVAFHTLFYLTHHPEYQEKLRKEILSNLE-ADGHI  344
            +     G LA      +V GF+T+++   + L+ L  + + Q++LR EI + LE  +G +
Sbjct  292  IEGMDIGELAAQVFVFYVAGFETSSSTMSYCLYELAQNQDIQDRLRNEIQTVLEEQEGQL  351

Query  345  NYQALSLLPYLDQCVHETLRMISPLTFTSRICTEPTELVLDDGRRIPIEKGQVATVPVFS  404
             Y+++  + YL+Q + ETLR+ + +    R      + V+    ++ IEKG    +P  +
Sbjct  352  TYESIKAMTYLNQVISETLRLYTLVPHLERKAL--NDYVVPGHEKLVIEKGTQVIIPACA  409

Query  405  YLHDPEYFEEPMEFKPERF--ENVDISELTKRGIFLPFGDGPRICLGRHLGVLQVKTAIV  462
            Y  D + +  P  F PERF  E V   E  +   +LPFGDGPR C+G   G +Q +  + 
Sbjct  410  YHRDEDLYPNPETFDPERFSPEKVAARESVE---WLPFGDGPRNCIGMRFGQMQARIGLA  466

Query  463  EVLKNYRLKVCDKTPPIAKLESQTLIVGVDGDLLFEYERL  502
            +++  +R+ VCD T    K    ++++G  G +    ER+
Sbjct  467  QIISRFRVSVCDTTEIPLKYSPMSIVLGTVGGIYLRVERI  506



Lambda      K        H
   0.323    0.139    0.422 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2140775808


Query= XP_011197157.1 sodium/hydrogen exchanger 6 isoform X2 [Bactrocera
dorsalis]

Length=811
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8IPJ4_DROME  unnamed protein product                                 1018    0.0  
M9PB53_DROME  unnamed protein product                                 1004    0.0  
Q9VM99_DROME  unnamed protein product                                 1003    0.0  


>Q8IPJ4_DROME unnamed protein product
Length=711

 Score = 1018 bits (2633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 533/702 (76%), Positives = 590/702 (84%), Gaps = 27/702 (4%)

Query  86   LAALTHTANATATDIALDAKATLTHRIDSLNLLVYTFLLTLTVLTIWLFKHHRVSWLHET  145
            L  L    +AT TDIALDAKATL HRI SL+LLV+ FLL LTVLTIWLFKHHRVSWLHET
Sbjct  9    LCVLAPGCSATDTDIALDAKATLNHRIQSLDLLVFVFLLALTVLTIWLFKHHRVSWLHET  68

Query  146  GLAVIYGLIVGAVIRYAGTSTPLVHLEVDPAGDPKFNQSLPPDTLWMKFPGKLAPNTTDK  205
            GLAVIYGLIVGA+IRYAGTS  LVH++V+P G P ++  LPPDTLW ++P      T  K
Sbjct  69   GLAVIYGLIVGAIIRYAGTSATLVHMQVEPQGVPTYSDKLPPDTLWFRYPVNQTNGT--K  126

Query  206  DPIPNKTYAYVFRGIVYDVDENEIDLKATFDPEIFFNIILPPIIFHAGYSLKKKYFFRNL  265
             P   KTYAYVFRG V+DVDENEIDLKATFDPE+FFNIILPPIIF+AGYSLKKKYFFRNL
Sbjct  127  PPEGIKTYAYVFRGQVHDVDENEIDLKATFDPEVFFNIILPPIIFYAGYSLKKKYFFRNL  186

Query  266  GAILMFAILGTTLSSFLIGAIMYGCVKLMPEYLSSSFTFLDTLYFGALISPTDPLTILAI  325
            GAIL FAI+GTTLS+FLIG  MYGCVKLMP+YLSSSFTFLD+LYFGALISPTDPLTILAI
Sbjct  187  GAILTFAIVGTTLSAFLIGGFMYGCVKLMPKYLSSSFTFLDSLYFGALISPTDPLTILAI  246

Query  326  FHDLHVDVNLYALVFGESVLNDAVAIVLSGAIQNYGEHYSSTGGFETNAFFRSLSDFFCI  385
            F+DL VDVNLYALV GESVLNDAVAIVLSGAIQNYGEHYS+TG FET AF RSLSDFF I
Sbjct  247  FNDLRVDVNLYALVLGESVLNDAVAIVLSGAIQNYGEHYSNTGEFETTAFLRSLSDFFSI  306

Query  386  FMLSLLIGATMGCFTALLTKFTRVREFPLLESALFVLMSYSTFLIAEASELTGVVAVLFC  445
            F+LSL+IGA MGC TAL+TKFTRVR+FPLLESALFVLMSYSTFL+AEA+ELTGVVAVLFC
Sbjct  307  FLLSLMIGAAMGCLTALMTKFTRVRDFPLLESALFVLMSYSTFLLAEATELTGVVAVLFC  366

Query  446  GICQAHYTYNNLSENSRTRTKEIFELLNFLAENFIFSYIGVSMFTFPKHHFDAVFIITGF  505
            GICQAHYTYNNLSE+SR RTK+IFELLNFLAENFIFSYIGVSMFTFPKHHFDA FIIT F
Sbjct  367  GICQAHYTYNNLSEDSRQRTKQIFELLNFLAENFIFSYIGVSMFTFPKHHFDAGFIITAF  426

Query  506  VTAAIGRAVNIYPLSWLLNLNRKPKISSNFQHMLFFAGLRGAMSFALAIRNTVSEARQTM  565
            + AAIGRAVN+YPLSWLLN+ RKPKIS+NFQHMLFFAGLRGAMSFALAIRNTVS+ RQTM
Sbjct  427  ICAAIGRAVNVYPLSWLLNIKRKPKISTNFQHMLFFAGLRGAMSFALAIRNTVSDERQTM  486

Query  566  LTATSLIVIFTVVIQGGASNFLLNWLKIPVGVDEETEQLNNYRVRSVYNSMENTAAASID  625
            LTATSLIVIFTVVIQGGA+NFLLNWLKIPVGVD+ETEQLNNY+V SVYNSM+N+   + D
Sbjct  487  LTATSLIVIFTVVIQGGAANFLLNWLKIPVGVDDETEQLNNYQVHSVYNSMDNSHPQTSD  546

Query  626  --------TGLNLGQLPMSRRRSSLDVDVDVEGA-GGIGDASAQTAMNVKRNEKAFLARI  676
                     G+N  ++ +S    + ++D  V+G  G +G AS     N   +EKA LARI
Sbjct  547  GYLQDVEGGGVNRNKMRLSGGTDT-NLDTPVDGTNGSLGGASGGRRRN--SHEKAILARI  603

Query  677  WGNFDTKYMKPLLTHSRPTLLETLPVCCNPVARLLTTTEQLTQDGGGLRRSDSDSDICID  736
            WGNFDTKYMKPLLTHSRPTLLETLPVCCNP+ARLLTTT+QLTQDG   RR DSDSDICID
Sbjct  604  WGNFDTKYMKPLLTHSRPTLLETLPVCCNPIARLLTTTQQLTQDGSEFRRVDSDSDICID  663

Query  737  DENFGASSTNGAAGGLNGGSGSGSGGSAGMGPRRNSINRQHH  778
            ++              NG S  GSG + G+G RRNS++R  H
Sbjct  664  NDTG------------NGLSQDGSGAAPGVG-RRNSLSRSVH  692


>M9PB53_DROME unnamed protein product
Length=682

 Score = 1004 bits (2597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 525/691 (76%), Positives = 582/691 (84%), Gaps = 23/691 (3%)

Query  86   LAALTHTANATATDIALDAKATLTHRIDSLNLLVYTFLLTLTVLTIWLFKHHRVSWLHET  145
            L  L    +AT TDIALDAKATL HRI SL+LLV+ FLL LTVLTIWLFKHHRVSWLHET
Sbjct  9    LCVLAPGCSATDTDIALDAKATLNHRIQSLDLLVFVFLLALTVLTIWLFKHHRVSWLHET  68

Query  146  GLAVIYGLIVGAVIRYAGTSTPLVHLEVDPAGDPKFNQSLPPDTLWMKFPGKLAPNTTDK  205
            GLAVIYGLIVGA+IRYAGTS  LVH++V+P G P ++  LPPDTLW ++P      T  K
Sbjct  69   GLAVIYGLIVGAIIRYAGTSATLVHMQVEPQGVPTYSDKLPPDTLWFRYPVNQTNGT--K  126

Query  206  DPIPNKTYAYVFRGIVYDVDENEIDLKATFDPEIFFNIILPPIIFHAGYSLKKKYFFRNL  265
             P   KTYAYVFRG V+DVDENEIDLKATFDPE+FFNIILPPIIF+AGYSLKKKYFFRNL
Sbjct  127  PPEGIKTYAYVFRGQVHDVDENEIDLKATFDPEVFFNIILPPIIFYAGYSLKKKYFFRNL  186

Query  266  GAILMFAILGTTLSSFLIGAIMYGCVKLMPEYLSSSFTFLDTLYFGALISPTDPLTILAI  325
            GAIL FAI+GTTLS+FLIG  MYGCVKLMP+YLSSSFTFLD+LYFGALISPTDPLTILAI
Sbjct  187  GAILTFAIVGTTLSAFLIGGFMYGCVKLMPKYLSSSFTFLDSLYFGALISPTDPLTILAI  246

Query  326  FHDLHVDVNLYALVFGESVLNDAVAIVLSGAIQNYGEHYSSTGGFETNAFFRSLSDFFCI  385
            F+DL VDVNLYALV GESVLNDAVAIVLSGAIQNYGEHYS+TG FET AF RSLSDFF I
Sbjct  247  FNDLRVDVNLYALVLGESVLNDAVAIVLSGAIQNYGEHYSNTGEFETTAFLRSLSDFFSI  306

Query  386  FMLSLLIGATMGCFTALLTKFTRVREFPLLESALFVLMSYSTFLIAEASELTGVVAVLFC  445
            F+LSL+IGA MGC TAL+TKFTRVR+FPLLESALFVLMSYSTFL+AEA+ELTGVVAVLFC
Sbjct  307  FLLSLMIGAAMGCLTALMTKFTRVRDFPLLESALFVLMSYSTFLLAEATELTGVVAVLFC  366

Query  446  GICQAHYTYNNLSENSRTRTKEIFELLNFLAENFIFSYIGVSMFTFPKHHFDAVFIITGF  505
            GICQAHYTYNNLSE+SR RTK+IFELLNFLAENFIFSYIGVSMFTFPKHHFDA FIIT F
Sbjct  367  GICQAHYTYNNLSEDSRQRTKQIFELLNFLAENFIFSYIGVSMFTFPKHHFDAGFIITAF  426

Query  506  VTAAIGRAVNIYPLSWLLNLNRKPKISSNFQHMLFFAGLRGAMSFALAIRNTVSEARQTM  565
            + AAIGRAVN+YPLSWLLN+ RKPKIS+NFQHMLFFAGLRGAMSFALAIRNTVS+ RQTM
Sbjct  427  ICAAIGRAVNVYPLSWLLNIKRKPKISTNFQHMLFFAGLRGAMSFALAIRNTVSDERQTM  486

Query  566  LTATSLIVIFTVVIQGGASNFLLNWLKIPVGVDEETEQLNNYRVRSVYNSMENTAAASID  625
            LTATSLIVIFTVVIQGGA+NFLLNWLKIPVGVD+ETEQLNNY+V S    +++       
Sbjct  487  LTATSLIVIFTVVIQGGAANFLLNWLKIPVGVDDETEQLNNYQVHSSDGYLQDVEGG---  543

Query  626  TGLNLGQLPMSRRRSSLDVDVDVEGA-GGIGDASAQTAMNVKRNEKAFLARIWGNFDTKY  684
             G+N  ++ +S    + ++D  V+G  G +G AS     N   +EKA LARIWGNFDTKY
Sbjct  544  -GVNRNKMRLSGGTDT-NLDTPVDGTNGSLGGASGGRRRN--SHEKAILARIWGNFDTKY  599

Query  685  MKPLLTHSRPTLLETLPVCCNPVARLLTTTEQLTQDGGGLRRSDSDSDICIDDENFGASS  744
            MKPLLTHSRPTLLETLPVCCNP+ARLLTTT+QLTQDG   RR DSDSDICID++      
Sbjct  600  MKPLLTHSRPTLLETLPVCCNPIARLLTTTQQLTQDGSEFRRVDSDSDICIDNDTG----  655

Query  745  TNGAAGGLNGGSGSGSGGSAGMGPRRNSINR  775
                    NG S  GSG + G+G RRNS++R
Sbjct  656  --------NGLSQDGSGAAPGVG-RRNSLSR  677


>Q9VM99_DROME unnamed protein product
Length=687

 Score = 1003 bits (2593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 525/691 (76%), Positives = 582/691 (84%), Gaps = 23/691 (3%)

Query  86   LAALTHTANATATDIALDAKATLTHRIDSLNLLVYTFLLTLTVLTIWLFKHHRVSWLHET  145
            L  L    +AT TDIALDAKATL HRI SL+LLV+ FLL LTVLTIWLFKHHRVSWLHET
Sbjct  9    LCVLAPGCSATDTDIALDAKATLNHRIQSLDLLVFVFLLALTVLTIWLFKHHRVSWLHET  68

Query  146  GLAVIYGLIVGAVIRYAGTSTPLVHLEVDPAGDPKFNQSLPPDTLWMKFPGKLAPNTTDK  205
            GLAVIYGLIVGA+IRYAGTS  LVH++V+P G P ++  LPPDTLW ++P      T  K
Sbjct  69   GLAVIYGLIVGAIIRYAGTSATLVHMQVEPQGVPTYSDKLPPDTLWFRYPVNQTNGT--K  126

Query  206  DPIPNKTYAYVFRGIVYDVDENEIDLKATFDPEIFFNIILPPIIFHAGYSLKKKYFFRNL  265
             P   KTYAYVFRG V+DVDENEIDLKATFDPE+FFNIILPPIIF+AGYSLKKKYFFRNL
Sbjct  127  PPEGIKTYAYVFRGQVHDVDENEIDLKATFDPEVFFNIILPPIIFYAGYSLKKKYFFRNL  186

Query  266  GAILMFAILGTTLSSFLIGAIMYGCVKLMPEYLSSSFTFLDTLYFGALISPTDPLTILAI  325
            GAIL FAI+GTTLS+FLIG  MYGCVKLMP+YLSSSFTFLD+LYFGALISPTDPLTILAI
Sbjct  187  GAILTFAIVGTTLSAFLIGGFMYGCVKLMPKYLSSSFTFLDSLYFGALISPTDPLTILAI  246

Query  326  FHDLHVDVNLYALVFGESVLNDAVAIVLSGAIQNYGEHYSSTGGFETNAFFRSLSDFFCI  385
            F+DL VDVNLYALV GESVLNDAVAIVLSGAIQNYGEHYS+TG FET AF RSLSDFF I
Sbjct  247  FNDLRVDVNLYALVLGESVLNDAVAIVLSGAIQNYGEHYSNTGEFETTAFLRSLSDFFSI  306

Query  386  FMLSLLIGATMGCFTALLTKFTRVREFPLLESALFVLMSYSTFLIAEASELTGVVAVLFC  445
            F+LSL+IGA MGC TAL+TKFTRVR+FPLLESALFVLMSYSTFL+AEA+ELTGVVAVLFC
Sbjct  307  FLLSLMIGAAMGCLTALMTKFTRVRDFPLLESALFVLMSYSTFLLAEATELTGVVAVLFC  366

Query  446  GICQAHYTYNNLSENSRTRTKEIFELLNFLAENFIFSYIGVSMFTFPKHHFDAVFIITGF  505
            GICQAHYTYNNLSE+SR RTK+IFELLNFLAENFIFSYIGVSMFTFPKHHFDA FIIT F
Sbjct  367  GICQAHYTYNNLSEDSRQRTKQIFELLNFLAENFIFSYIGVSMFTFPKHHFDAGFIITAF  426

Query  506  VTAAIGRAVNIYPLSWLLNLNRKPKISSNFQHMLFFAGLRGAMSFALAIRNTVSEARQTM  565
            + AAIGRAVN+YPLSWLLN+ RKPKIS+NFQHMLFFAGLRGAMSFALAIRNTVS+ RQTM
Sbjct  427  ICAAIGRAVNVYPLSWLLNIKRKPKISTNFQHMLFFAGLRGAMSFALAIRNTVSDERQTM  486

Query  566  LTATSLIVIFTVVIQGGASNFLLNWLKIPVGVDEETEQLNNYRVRSVYNSMENTAAASID  625
            LTATSLIVIFTVVIQGGA+NFLLNWLKIPVGVD+ETEQLNNY+V S    +++       
Sbjct  487  LTATSLIVIFTVVIQGGAANFLLNWLKIPVGVDDETEQLNNYQVHSSDGYLQDVEGG---  543

Query  626  TGLNLGQLPMSRRRSSLDVDVDVEGA-GGIGDASAQTAMNVKRNEKAFLARIWGNFDTKY  684
             G+N  ++ +S    + ++D  V+G  G +G AS     N   +EKA LARIWGNFDTKY
Sbjct  544  -GVNRNKMRLSGGTDT-NLDTPVDGTNGSLGGASGGRRRN--SHEKAILARIWGNFDTKY  599

Query  685  MKPLLTHSRPTLLETLPVCCNPVARLLTTTEQLTQDGGGLRRSDSDSDICIDDENFGASS  744
            MKPLLTHSRPTLLETLPVCCNP+ARLLTTT+QLTQDG   RR DSDSDICID++      
Sbjct  600  MKPLLTHSRPTLLETLPVCCNPIARLLTTTQQLTQDGSEFRRVDSDSDICIDNDTG----  655

Query  745  TNGAAGGLNGGSGSGSGGSAGMGPRRNSINR  775
                    NG S  GSG + G+G RRNS++R
Sbjct  656  --------NGLSQDGSGAAPGVG-RRNSLSR  677



Lambda      K        H
   0.323    0.139    0.422 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2140775808


Query= XP_011197158.1 sodium/hydrogen exchanger 6 isoform X4 [Bactrocera
dorsalis]

Length=806
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A8DYW5_DROME  unnamed protein product                                 1047    0.0  
Q8IPJ4_DROME  unnamed protein product                                 1019    0.0  
M9PB53_DROME  unnamed protein product                                 1006    0.0  


>A8DYW5_DROME unnamed protein product
Length=696

 Score = 1047 bits (2708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 549/722 (76%), Positives = 604/722 (84%), Gaps = 35/722 (5%)

Query  86   LAALTHTANATATDIALDAKATLTHRIDSLNLLVYTFLLTLTVLTIWLFKHHRVSWLHET  145
            L  L    +AT TDIALDAKATL HRI SL+LLV+ FLL LTVLTIWLFKHHRVSWLHET
Sbjct  9    LCVLAPGCSATDTDIALDAKATLNHRIQSLDLLVFVFLLALTVLTIWLFKHHRVSWLHET  68

Query  146  GLAVIYGLIVGAVIRYAGTSTPLVHLEVDPAGDPKFNQSLPPDTLWMKFPGKLAPNTTDK  205
            GLAVIYGLIVGA+IRYAGTS  LVH++V+P G P ++  LPPDTLW ++P      T  K
Sbjct  69   GLAVIYGLIVGAIIRYAGTSATLVHMQVEPQGVPTYSDKLPPDTLWFRYPVNQTNGT--K  126

Query  206  DPIPNKTYAYVFRGIVYDVDENEIDLKATFDPEIFFNIILPPIIFHAGYSLKKKYFFRNL  265
             P   KTYAYVFRG V+DVDENEIDLKATFDPE+FFNIILPPIIF+AGYSLKKKYFFRNL
Sbjct  127  PPEGIKTYAYVFRGQVHDVDENEIDLKATFDPEVFFNIILPPIIFYAGYSLKKKYFFRNL  186

Query  266  GAILMFAILGTTLSSFLIGAIMYGCVKLMPEYLSSSFTFLDTLYFGALISPTDPLTILAI  325
            GAIL FAI+GTTLS+FLIG  MYGCVKLMP+YLSSSFTFLD+LYFGALISPTDPLTILAI
Sbjct  187  GAILTFAIVGTTLSAFLIGGFMYGCVKLMPKYLSSSFTFLDSLYFGALISPTDPLTILAI  246

Query  326  FHDLHVDVNLYALVFGESVLNDAVAIVLSGAIQNYGEHYSSTGGFETNAFFRSLSDFFCI  385
            F+DL VDVNLYALV GESVLNDAVAIVLSGAIQNYGEHYS+TG FET AF RSLSDFF I
Sbjct  247  FNDLRVDVNLYALVLGESVLNDAVAIVLSGAIQNYGEHYSNTGEFETTAFLRSLSDFFSI  306

Query  386  FMLSLLIGATMGCFTALLTKFTRVREFPLLESALFVLMSYSTFLIAEASELTGVVAVLFC  445
            F+LSL+IGA MGC TAL+TKFTRVR+FPLLESALFVLMSYSTFL+AEA+ELTGVVAVLFC
Sbjct  307  FLLSLMIGAAMGCLTALMTKFTRVRDFPLLESALFVLMSYSTFLLAEATELTGVVAVLFC  366

Query  446  GICQAHYTYNNLSENSRTRTKEIFELLNFLAENFIFSYIGVSMFTFPKHHFDAVFIITGF  505
            GICQAHYTYNNLSE+SR RTK+IFELLNFLAENFIFSYIGVSMFTFPKHHFDA FIIT F
Sbjct  367  GICQAHYTYNNLSEDSRQRTKQIFELLNFLAENFIFSYIGVSMFTFPKHHFDAGFIITAF  426

Query  506  VTAAIGRAVNIYPLSWLLNLNRKPKISSNFQHMLFFAGLRGAMSFALAIRNTVSEARQTM  565
            + AAIGRAVN+YPLSWLLN+ RKPKIS+NFQHMLFFAGLRGAMSFALAIRNTVS+ RQTM
Sbjct  427  ICAAIGRAVNVYPLSWLLNIKRKPKISTNFQHMLFFAGLRGAMSFALAIRNTVSDERQTM  486

Query  566  LTATSLIVIFTVVIQGGASNFLLNWLKIPVGVDEETEQLNNYRVRSVYNSMENTAAASID  625
            LTATSLIVIFTVVIQGGA+NFLLNWLKIPVGVD+ETEQLNNY+V S            ++
Sbjct  487  LTATSLIVIFTVVIQGGAANFLLNWLKIPVGVDDETEQLNNYQVHS-----------DVE  535

Query  626  TGLNLGQLPMSRRRSSLSDAYLQDVDVDVEGA-GGIGDASAQTAMNVKRNEKAFLARIWG  684
             G       ++R +  LS     ++D  V+G  G +G AS     N   +EKA LARIWG
Sbjct  536  GG------GVNRNKMRLSGGTDTNLDTPVDGTNGSLGGASGGRRRN--SHEKAILARIWG  587

Query  685  NFDTKYMKPLLTHSRPTLLETLPVCCNPVARLLTTTEQLTQDGGGLRRSDSDSDICIDDE  744
            NFDTKYMKPLLTHSRPTLLETLPVCCNP+ARLLTTT+QLTQDG   RR DSDSDICID++
Sbjct  588  NFDTKYMKPLLTHSRPTLLETLPVCCNPIARLLTTTQQLTQDGSEFRRVDSDSDICIDND  647

Query  745  NFGASSTNGAAGGLNGGSGSGSGGSAGMGPRRNSINRMEIMEHVQSPVSTRIRLLGFYGK  804
                          NG S  GSG + G+G RRNS++RMEI+EHVQSPVSTRIRLLGFYGK
Sbjct  648  TG------------NGLSQDGSGAAPGVG-RRNSLSRMEILEHVQSPVSTRIRLLGFYGK  694

Query  805  NL  806
             L
Sbjct  695  KL  696


>Q8IPJ4_DROME unnamed protein product
Length=711

 Score = 1019 bits (2635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 533/698 (76%), Positives = 590/698 (85%), Gaps = 19/698 (3%)

Query  86   LAALTHTANATATDIALDAKATLTHRIDSLNLLVYTFLLTLTVLTIWLFKHHRVSWLHET  145
            L  L    +AT TDIALDAKATL HRI SL+LLV+ FLL LTVLTIWLFKHHRVSWLHET
Sbjct  9    LCVLAPGCSATDTDIALDAKATLNHRIQSLDLLVFVFLLALTVLTIWLFKHHRVSWLHET  68

Query  146  GLAVIYGLIVGAVIRYAGTSTPLVHLEVDPAGDPKFNQSLPPDTLWMKFPGKLAPNTTDK  205
            GLAVIYGLIVGA+IRYAGTS  LVH++V+P G P ++  LPPDTLW ++P      T  K
Sbjct  69   GLAVIYGLIVGAIIRYAGTSATLVHMQVEPQGVPTYSDKLPPDTLWFRYPVNQTNGT--K  126

Query  206  DPIPNKTYAYVFRGIVYDVDENEIDLKATFDPEIFFNIILPPIIFHAGYSLKKKYFFRNL  265
             P   KTYAYVFRG V+DVDENEIDLKATFDPE+FFNIILPPIIF+AGYSLKKKYFFRNL
Sbjct  127  PPEGIKTYAYVFRGQVHDVDENEIDLKATFDPEVFFNIILPPIIFYAGYSLKKKYFFRNL  186

Query  266  GAILMFAILGTTLSSFLIGAIMYGCVKLMPEYLSSSFTFLDTLYFGALISPTDPLTILAI  325
            GAIL FAI+GTTLS+FLIG  MYGCVKLMP+YLSSSFTFLD+LYFGALISPTDPLTILAI
Sbjct  187  GAILTFAIVGTTLSAFLIGGFMYGCVKLMPKYLSSSFTFLDSLYFGALISPTDPLTILAI  246

Query  326  FHDLHVDVNLYALVFGESVLNDAVAIVLSGAIQNYGEHYSSTGGFETNAFFRSLSDFFCI  385
            F+DL VDVNLYALV GESVLNDAVAIVLSGAIQNYGEHYS+TG FET AF RSLSDFF I
Sbjct  247  FNDLRVDVNLYALVLGESVLNDAVAIVLSGAIQNYGEHYSNTGEFETTAFLRSLSDFFSI  306

Query  386  FMLSLLIGATMGCFTALLTKFTRVREFPLLESALFVLMSYSTFLIAEASELTGVVAVLFC  445
            F+LSL+IGA MGC TAL+TKFTRVR+FPLLESALFVLMSYSTFL+AEA+ELTGVVAVLFC
Sbjct  307  FLLSLMIGAAMGCLTALMTKFTRVRDFPLLESALFVLMSYSTFLLAEATELTGVVAVLFC  366

Query  446  GICQAHYTYNNLSENSRTRTKEIFELLNFLAENFIFSYIGVSMFTFPKHHFDAVFIITGF  505
            GICQAHYTYNNLSE+SR RTK+IFELLNFLAENFIFSYIGVSMFTFPKHHFDA FIIT F
Sbjct  367  GICQAHYTYNNLSEDSRQRTKQIFELLNFLAENFIFSYIGVSMFTFPKHHFDAGFIITAF  426

Query  506  VTAAIGRAVNIYPLSWLLNLNRKPKISSNFQHMLFFAGLRGAMSFALAIRNTVSEARQTM  565
            + AAIGRAVN+YPLSWLLN+ RKPKIS+NFQHMLFFAGLRGAMSFALAIRNTVS+ RQTM
Sbjct  427  ICAAIGRAVNVYPLSWLLNIKRKPKISTNFQHMLFFAGLRGAMSFALAIRNTVSDERQTM  486

Query  566  LTATSLIVIFTVVIQGGASNFLLNWLKIPVGVDEETEQLNNYRVRSVYNSMENTAAASID  625
            LTATSLIVIFTVVIQGGA+NFLLNWLKIPVGVD+ETEQLNNY+V SVYNSM+N+   + D
Sbjct  487  LTATSLIVIFTVVIQGGAANFLLNWLKIPVGVDDETEQLNNYQVHSVYNSMDNSHPQTSD  546

Query  626  TGL-NLGQLPMSRRRSSLSDAYLQDVDVDVEGA-GGIGDASAQTAMNVKRNEKAFLARIW  683
              L ++    ++R +  LS     ++D  V+G  G +G AS     N   +EKA LARIW
Sbjct  547  GYLQDVEGGGVNRNKMRLSGGTDTNLDTPVDGTNGSLGGASGGRRRN--SHEKAILARIW  604

Query  684  GNFDTKYMKPLLTHSRPTLLETLPVCCNPVARLLTTTEQLTQDGGGLRRSDSDSDICIDD  743
            GNFDTKYMKPLLTHSRPTLLETLPVCCNP+ARLLTTT+QLTQDG   RR DSDSDICID+
Sbjct  605  GNFDTKYMKPLLTHSRPTLLETLPVCCNPIARLLTTTQQLTQDGSEFRRVDSDSDICIDN  664

Query  744  ENFGASSTNGAAGGLNGGSGSGSGGSAGMGPRRNSINR  781
            +              NG S  GSG + G+G RRNS++R
Sbjct  665  DTG------------NGLSQDGSGAAPGVG-RRNSLSR  689


>M9PB53_DROME unnamed protein product
Length=682

 Score = 1006 bits (2602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 526/699 (75%), Positives = 581/699 (83%), Gaps = 29/699 (4%)

Query  86   LAALTHTANATATDIALDAKATLTHRIDSLNLLVYTFLLTLTVLTIWLFKHHRVSWLHET  145
            L  L    +AT TDIALDAKATL HRI SL+LLV+ FLL LTVLTIWLFKHHRVSWLHET
Sbjct  9    LCVLAPGCSATDTDIALDAKATLNHRIQSLDLLVFVFLLALTVLTIWLFKHHRVSWLHET  68

Query  146  GLAVIYGLIVGAVIRYAGTSTPLVHLEVDPAGDPKFNQSLPPDTLWMKFPGKLAPNTTDK  205
            GLAVIYGLIVGA+IRYAGTS  LVH++V+P G P ++  LPPDTLW ++P      T  K
Sbjct  69   GLAVIYGLIVGAIIRYAGTSATLVHMQVEPQGVPTYSDKLPPDTLWFRYPVNQTNGT--K  126

Query  206  DPIPNKTYAYVFRGIVYDVDENEIDLKATFDPEIFFNIILPPIIFHAGYSLKKKYFFRNL  265
             P   KTYAYVFRG V+DVDENEIDLKATFDPE+FFNIILPPIIF+AGYSLKKKYFFRNL
Sbjct  127  PPEGIKTYAYVFRGQVHDVDENEIDLKATFDPEVFFNIILPPIIFYAGYSLKKKYFFRNL  186

Query  266  GAILMFAILGTTLSSFLIGAIMYGCVKLMPEYLSSSFTFLDTLYFGALISPTDPLTILAI  325
            GAIL FAI+GTTLS+FLIG  MYGCVKLMP+YLSSSFTFLD+LYFGALISPTDPLTILAI
Sbjct  187  GAILTFAIVGTTLSAFLIGGFMYGCVKLMPKYLSSSFTFLDSLYFGALISPTDPLTILAI  246

Query  326  FHDLHVDVNLYALVFGESVLNDAVAIVLSGAIQNYGEHYSSTGGFETNAFFRSLSDFFCI  385
            F+DL VDVNLYALV GESVLNDAVAIVLSGAIQNYGEHYS+TG FET AF RSLSDFF I
Sbjct  247  FNDLRVDVNLYALVLGESVLNDAVAIVLSGAIQNYGEHYSNTGEFETTAFLRSLSDFFSI  306

Query  386  FMLSLLIGATMGCFTALLTKFTRVREFPLLESALFVLMSYSTFLIAEASELTGVVAVLFC  445
            F+LSL+IGA MGC TAL+TKFTRVR+FPLLESALFVLMSYSTFL+AEA+ELTGVVAVLFC
Sbjct  307  FLLSLMIGAAMGCLTALMTKFTRVRDFPLLESALFVLMSYSTFLLAEATELTGVVAVLFC  366

Query  446  GICQAHYTYNNLSENSRTRTKEIFELLNFLAENFIFSYIGVSMFTFPKHHFDAVFIITGF  505
            GICQAHYTYNNLSE+SR RTK+IFELLNFLAENFIFSYIGVSMFTFPKHHFDA FIIT F
Sbjct  367  GICQAHYTYNNLSEDSRQRTKQIFELLNFLAENFIFSYIGVSMFTFPKHHFDAGFIITAF  426

Query  506  VTAAIGRAVNIYPLSWLLNLNRKPKISSNFQHMLFFAGLRGAMSFALAIRNTVSEARQTM  565
            + AAIGRAVN+YPLSWLLN+ RKPKIS+NFQHMLFFAGLRGAMSFALAIRNTVS+ RQTM
Sbjct  427  ICAAIGRAVNVYPLSWLLNIKRKPKISTNFQHMLFFAGLRGAMSFALAIRNTVSDERQTM  486

Query  566  LTATSLIVIFTVVIQGGASNFLLNWLKIPVGVDEETEQLNNYRVRSVYNSMENTAAASID  625
            LTATSLIVIFTVVIQGGA+NFLLNWLKIPVGVD+ETEQLNNY+V S    +++     ++
Sbjct  487  LTATSLIVIFTVVIQGGAANFLLNWLKIPVGVDDETEQLNNYQVHSSDGYLQDVEGGGVN  546

Query  626  TGLNLGQLPMSRRRSSLSDAYLQDVDVDVEGA-GGIGDASAQTAMNVKRNEKAFLARIWG  684
                       R +  LS     ++D  V+G  G +G AS     N   +EKA LARIWG
Sbjct  547  -----------RNKMRLSGGTDTNLDTPVDGTNGSLGGASGGRRRN--SHEKAILARIWG  593

Query  685  NFDTKYMKPLLTHSRPTLLETLPVCCNPVARLLTTTEQLTQDGGGLRRSDSDSDICIDDE  744
            NFDTKYMKPLLTHSRPTLLETLPVCCNP+ARLLTTT+QLTQDG   RR DSDSDICID++
Sbjct  594  NFDTKYMKPLLTHSRPTLLETLPVCCNPIARLLTTTQQLTQDGSEFRRVDSDSDICIDND  653

Query  745  NFGASSTNGAAGGLNGGSGSGSGGSAGMGPRRNSINRME  783
                          NG S  GSG + G+G RRNS++R E
Sbjct  654  TG------------NGLSQDGSGAAPGVG-RRNSLSRTE  679



Lambda      K        H
   0.323    0.139    0.422 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2140775808


Query= XP_011197159.1 sodium/hydrogen exchanger 6 isoform X3 [Bactrocera
dorsalis]

Length=806
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A8DYW5_DROME  unnamed protein product                                 1008    0.0  
B7Z029_DROME  unnamed protein product                                 1008    0.0  
Q8IPJ4_DROME  unnamed protein product                                 1007    0.0  


>A8DYW5_DROME unnamed protein product
Length=696

 Score = 1008 bits (2606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 526/688 (76%), Positives = 580/688 (84%), Gaps = 24/688 (3%)

Query  86   LAALTHTANATATDIALDAKATLTHRIDSLNLLVYTFLLTLTVLTIWLFKHHRVSWLHET  145
            L  L    +AT TDIALDAKATL HRI SL+LLV+ FLL LTVLTIWLFKHHRVSWLHET
Sbjct  9    LCVLAPGCSATDTDIALDAKATLNHRIQSLDLLVFVFLLALTVLTIWLFKHHRVSWLHET  68

Query  146  GLAVIYGLIVGAVIRYAGTSTPLVHLEVDPAGDPKFNQSLPPDTLWMKFPGKLAPNTTDK  205
            GLAVIYGLIVGA+IRYAGTS  LVH++V+P G P ++  LPPDTLW ++P      T  K
Sbjct  69   GLAVIYGLIVGAIIRYAGTSATLVHMQVEPQGVPTYSDKLPPDTLWFRYPVNQTNGT--K  126

Query  206  DPIPNKTYAYVFRGIVYDVDENEIDLKATFDPEIFFNIILPPIIFHAGYSLKKKYFFRNL  265
             P   KTYAYVFRG V+DVDENEIDLKATFDPE+FFNIILPPIIF+AGYSLKKKYFFRNL
Sbjct  127  PPEGIKTYAYVFRGQVHDVDENEIDLKATFDPEVFFNIILPPIIFYAGYSLKKKYFFRNL  186

Query  266  GAILMFAILGTTLSSFLIGAIMYGCVKLMPEYLSSSFTFLDTLYFGALISPTDPLTILAI  325
            GAIL FAI+GTTLS+FLIG  MYGCVKLMP+YLSSSFTFLD+LYFGALISPTDPLTILAI
Sbjct  187  GAILTFAIVGTTLSAFLIGGFMYGCVKLMPKYLSSSFTFLDSLYFGALISPTDPLTILAI  246

Query  326  FHDLHVDVNLYALVFGESVLNDAVAIVLSGAIQNYGEHYSSTGGFETNAFFRSLSDFFCI  385
            F+DL VDVNLYALV GESVLNDAVAIVLSGAIQNYGEHYS+TG FET AF RSLSDFF I
Sbjct  247  FNDLRVDVNLYALVLGESVLNDAVAIVLSGAIQNYGEHYSNTGEFETTAFLRSLSDFFSI  306

Query  386  FMLSLLIGATMGCFTALLTKFTRVREFPLLESALFVLMSYSTFLIAEASELTGVVAVLFC  445
            F+LSL+IGA MGC TAL+TKFTRVR+FPLLESALFVLMSYSTFL+AEA+ELTGVVAVLFC
Sbjct  307  FLLSLMIGAAMGCLTALMTKFTRVRDFPLLESALFVLMSYSTFLLAEATELTGVVAVLFC  366

Query  446  GICQAHYTYNNLSENSRTRTKEIFELLNFLAENFIFSYIGVSMFTFPKHHFDAVFIITGF  505
            GICQAHYTYNNLSE+SR RTK+IFELLNFLAENFIFSYIGVSMFTFPKHHFDA FIIT F
Sbjct  367  GICQAHYTYNNLSEDSRQRTKQIFELLNFLAENFIFSYIGVSMFTFPKHHFDAGFIITAF  426

Query  506  VTAAIGRAVNIYPLSWLLNLNRKPKISSNFQHMLFFAGLRGAMSFALAIRNTVSEARQTM  565
            + AAIGRAVN+YPLSWLLN+ RKPKIS+NFQHMLFFAGLRGAMSFALAIRNTVS+ RQTM
Sbjct  427  ICAAIGRAVNVYPLSWLLNIKRKPKISTNFQHMLFFAGLRGAMSFALAIRNTVSDERQTM  486

Query  566  LTATSLIVIFTVVIQGGASNFLLNWLKIPVGVDEETEQLNNYRVRSSIDTGLNLGQLPMS  625
            LTATSLIVIFTVVIQGGA+NFLLNWLKIPVGVD+ETEQLNNY+V S ++ G       ++
Sbjct  487  LTATSLIVIFTVVIQGGAANFLLNWLKIPVGVDDETEQLNNYQVHSDVEGG------GVN  540

Query  626  RRRSSLSDAYLQDVDVDVEGA-GGIGDASAQTAMNVKRNEKAFLARIWGNFDTKYMKPLL  684
            R +  LS     ++D  V+G  G +G AS     N   +EKA LARIWGNFDTKYMKPLL
Sbjct  541  RNKMRLSGGTDTNLDTPVDGTNGSLGGASGGRRRN--SHEKAILARIWGNFDTKYMKPLL  598

Query  685  THSRPTLLETLPVCCNPVARLLTTTEQLTQDGGGLRRSDSDSDICIDDENFGASSTNGAA  744
            THSRPTLLETLPVCCNP+ARLLTTT+QLTQDG   RR DSDSDICID++           
Sbjct  599  THSRPTLLETLPVCCNPIARLLTTTQQLTQDGSEFRRVDSDSDICIDNDTG---------  649

Query  745  GGLNGGSGSGSGGSAGMGPRRNSINRQH  772
               NG S  GSG + G+G RRNS++R  
Sbjct  650  ---NGLSQDGSGAAPGVG-RRNSLSRME  673


>B7Z029_DROME unnamed protein product
Length=681

 Score = 1008 bits (2605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 526/686 (77%), Positives = 580/686 (85%), Gaps = 24/686 (3%)

Query  86   LAALTHTANATATDIALDAKATLTHRIDSLNLLVYTFLLTLTVLTIWLFKHHRVSWLHET  145
            L  L    +AT TDIALDAKATL HRI SL+LLV+ FLL LTVLTIWLFKHHRVSWLHET
Sbjct  9    LCVLAPGCSATDTDIALDAKATLNHRIQSLDLLVFVFLLALTVLTIWLFKHHRVSWLHET  68

Query  146  GLAVIYGLIVGAVIRYAGTSTPLVHLEVDPAGDPKFNQSLPPDTLWMKFPGKLAPNTTDK  205
            GLAVIYGLIVGA+IRYAGTS  LVH++V+P G P ++  LPPDTLW ++P      T  K
Sbjct  69   GLAVIYGLIVGAIIRYAGTSATLVHMQVEPQGVPTYSDKLPPDTLWFRYPVNQTNGT--K  126

Query  206  DPIPNKTYAYVFRGIVYDVDENEIDLKATFDPEIFFNIILPPIIFHAGYSLKKKYFFRNL  265
             P   KTYAYVFRG V+DVDENEIDLKATFDPE+FFNIILPPIIF+AGYSLKKKYFFRNL
Sbjct  127  PPEGIKTYAYVFRGQVHDVDENEIDLKATFDPEVFFNIILPPIIFYAGYSLKKKYFFRNL  186

Query  266  GAILMFAILGTTLSSFLIGAIMYGCVKLMPEYLSSSFTFLDTLYFGALISPTDPLTILAI  325
            GAIL FAI+GTTLS+FLIG  MYGCVKLMP+YLSSSFTFLD+LYFGALISPTDPLTILAI
Sbjct  187  GAILTFAIVGTTLSAFLIGGFMYGCVKLMPKYLSSSFTFLDSLYFGALISPTDPLTILAI  246

Query  326  FHDLHVDVNLYALVFGESVLNDAVAIVLSGAIQNYGEHYSSTGGFETNAFFRSLSDFFCI  385
            F+DL VDVNLYALV GESVLNDAVAIVLSGAIQNYGEHYS+TG FET AF RSLSDFF I
Sbjct  247  FNDLRVDVNLYALVLGESVLNDAVAIVLSGAIQNYGEHYSNTGEFETTAFLRSLSDFFSI  306

Query  386  FMLSLLIGATMGCFTALLTKFTRVREFPLLESALFVLMSYSTFLIAEASELTGVVAVLFC  445
            F+LSL+IGA MGC TAL+TKFTRVR+FPLLESALFVLMSYSTFL+AEA+ELTGVVAVLFC
Sbjct  307  FLLSLMIGAAMGCLTALMTKFTRVRDFPLLESALFVLMSYSTFLLAEATELTGVVAVLFC  366

Query  446  GICQAHYTYNNLSENSRTRTKEIFELLNFLAENFIFSYIGVSMFTFPKHHFDAVFIITGF  505
            GICQAHYTYNNLSE+SR RTK+IFELLNFLAENFIFSYIGVSMFTFPKHHFDA FIIT F
Sbjct  367  GICQAHYTYNNLSEDSRQRTKQIFELLNFLAENFIFSYIGVSMFTFPKHHFDAGFIITAF  426

Query  506  VTAAIGRAVNIYPLSWLLNLNRKPKISSNFQHMLFFAGLRGAMSFALAIRNTVSEARQTM  565
            + AAIGRAVN+YPLSWLLN+ RKPKIS+NFQHMLFFAGLRGAMSFALAIRNTVS+ RQTM
Sbjct  427  ICAAIGRAVNVYPLSWLLNIKRKPKISTNFQHMLFFAGLRGAMSFALAIRNTVSDERQTM  486

Query  566  LTATSLIVIFTVVIQGGASNFLLNWLKIPVGVDEETEQLNNYRVRSSIDTGLNLGQLPMS  625
            LTATSLIVIFTVVIQGGA+NFLLNWLKIPVGVD+ETEQLNNY+V S ++ G       ++
Sbjct  487  LTATSLIVIFTVVIQGGAANFLLNWLKIPVGVDDETEQLNNYQVHSDVEGG------GVN  540

Query  626  RRRSSLSDAYLQDVDVDVEGA-GGIGDASAQTAMNVKRNEKAFLARIWGNFDTKYMKPLL  684
            R +  LS     ++D  V+G  G +G AS     N   +EKA LARIWGNFDTKYMKPLL
Sbjct  541  RNKMRLSGGTDTNLDTPVDGTNGSLGGASGGRRRN--SHEKAILARIWGNFDTKYMKPLL  598

Query  685  THSRPTLLETLPVCCNPVARLLTTTEQLTQDGGGLRRSDSDSDICIDDENFGASSTNGAA  744
            THSRPTLLETLPVCCNP+ARLLTTT+QLTQDG   RR DSDSDICID++           
Sbjct  599  THSRPTLLETLPVCCNPIARLLTTTQQLTQDGSEFRRVDSDSDICIDNDTG---------  649

Query  745  GGLNGGSGSGSGGSAGMGPRRNSINR  770
               NG S  GSG + G+G RRNS++R
Sbjct  650  ---NGLSQDGSGAAPGVG-RRNSLSR  671


>Q8IPJ4_DROME unnamed protein product
Length=711

 Score = 1007 bits (2603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 531/709 (75%), Positives = 580/709 (82%), Gaps = 46/709 (6%)

Query  86   LAALTHTANATATDIALDAKATLTHRIDSLNLLVYTFLLTLTVLTIWLFKHHRVSWLHET  145
            L  L    +AT TDIALDAKATL HRI SL+LLV+ FLL LTVLTIWLFKHHRVSWLHET
Sbjct  9    LCVLAPGCSATDTDIALDAKATLNHRIQSLDLLVFVFLLALTVLTIWLFKHHRVSWLHET  68

Query  146  GLAVIYGLIVGAVIRYAGTSTPLVHLEVDPAGDPKFNQSLPPDTLWMKFPGKLAPNTTDK  205
            GLAVIYGLIVGA+IRYAGTS  LVH++V+P G P ++  LPPDTLW ++P      T  K
Sbjct  69   GLAVIYGLIVGAIIRYAGTSATLVHMQVEPQGVPTYSDKLPPDTLWFRYPVNQTNGT--K  126

Query  206  DPIPNKTYAYVFRGIVYDVDENEIDLKATFDPEIFFNIILPPIIFHAGYSLKKKYFFRNL  265
             P   KTYAYVFRG V+DVDENEIDLKATFDPE+FFNIILPPIIF+AGYSLKKKYFFRNL
Sbjct  127  PPEGIKTYAYVFRGQVHDVDENEIDLKATFDPEVFFNIILPPIIFYAGYSLKKKYFFRNL  186

Query  266  GAILMFAILGTTLSSFLIGAIMYGCVKLMPEYLSSSFTFLDTLYFGALISPTDPLTILAI  325
            GAIL FAI+GTTLS+FLIG  MYGCVKLMP+YLSSSFTFLD+LYFGALISPTDPLTILAI
Sbjct  187  GAILTFAIVGTTLSAFLIGGFMYGCVKLMPKYLSSSFTFLDSLYFGALISPTDPLTILAI  246

Query  326  FHDLHVDVNLYALVFGESVLNDAVAIVLSGAIQNYGEHYSSTGGFETNAFFRSLSDFFCI  385
            F+DL VDVNLYALV GESVLNDAVAIVLSGAIQNYGEHYS+TG FET AF RSLSDFF I
Sbjct  247  FNDLRVDVNLYALVLGESVLNDAVAIVLSGAIQNYGEHYSNTGEFETTAFLRSLSDFFSI  306

Query  386  FMLSLLIGATMGCFTALLTKFTRVREFPLLESALFVLMSYSTFLIAEASELTGVVAVLFC  445
            F+LSL+IGA MGC TAL+TKFTRVR+FPLLESALFVLMSYSTFL+AEA+ELTGVVAVLFC
Sbjct  307  FLLSLMIGAAMGCLTALMTKFTRVRDFPLLESALFVLMSYSTFLLAEATELTGVVAVLFC  366

Query  446  GICQAHYTYNNLSENSRTRTKEIFELLNFLAENFIFSYIGVSMFTFPKHHFDAVFIITGF  505
            GICQAHYTYNNLSE+SR RTK+IFELLNFLAENFIFSYIGVSMFTFPKHHFDA FIIT F
Sbjct  367  GICQAHYTYNNLSEDSRQRTKQIFELLNFLAENFIFSYIGVSMFTFPKHHFDAGFIITAF  426

Query  506  VTAAIGRAVNIYPLSWLLNLNRKPKISSNFQHMLFFAGLRGAMSFALAIRNTVSEARQTM  565
            + AAIGRAVN+YPLSWLLN+ RKPKIS+NFQHMLFFAGLRGAMSFALAIRNTVS+ RQTM
Sbjct  427  ICAAIGRAVNVYPLSWLLNIKRKPKISTNFQHMLFFAGLRGAMSFALAIRNTVSDERQTM  486

Query  566  LTATSLIVIFTVVIQGGASNFLLNWLKIPVGVDEETEQLNNYRVRSSIDTGLNLGQLPMS  625
            LTATSLIVIFTVVIQGGA+NFLLNWLKIPVGVD+ETEQLNNY+V S  ++        M 
Sbjct  487  LTATSLIVIFTVVIQGGAANFLLNWLKIPVGVDDETEQLNNYQVHSVYNS--------MD  538

Query  626  RRRSSLSDAYLQDV--------------------DVDVEGA-GGIGDASAQTAMNVKRNE  664
                  SD YLQDV                    D  V+G  G +G AS     N   +E
Sbjct  539  NSHPQTSDGYLQDVEGGGVNRNKMRLSGGTDTNLDTPVDGTNGSLGGASGGRRRN--SHE  596

Query  665  KAFLARIWGNFDTKYMKPLLTHSRPTLLETLPVCCNPVARLLTTTEQLTQDGGGLRRSDS  724
            KA LARIWGNFDTKYMKPLLTHSRPTLLETLPVCCNP+ARLLTTT+QLTQDG   RR DS
Sbjct  597  KAILARIWGNFDTKYMKPLLTHSRPTLLETLPVCCNPIARLLTTTQQLTQDGSEFRRVDS  656

Query  725  DSDICIDDENFGASSTNGAAGGLNGGSGSGSGGSAGMGPRRNSINRQHH  773
            DSDICID++              NG S  GSG + G+G RRNS++R  H
Sbjct  657  DSDICIDNDTG------------NGLSQDGSGAAPGVG-RRNSLSRSVH  692



Lambda      K        H
   0.323    0.139    0.422 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2140775808


Query= XP_011197160.1 sodium/hydrogen exchanger 6 isoform X6 [Bactrocera
dorsalis]

Length=800
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A8DYW5_DROME  unnamed protein product                                 1005    0.0  
B7Z029_DROME  unnamed protein product                                 1005    0.0  
M9PB53_DROME  unnamed protein product                                 1002    0.0  


>A8DYW5_DROME unnamed protein product
Length=696

 Score = 1005 bits (2599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 525/683 (77%), Positives = 581/683 (85%), Gaps = 20/683 (3%)

Query  86   LAALTHTANATATDIALDAKATLTHRIDSLNLLVYTFLLTLTVLTIWLFKHHRVSWLHET  145
            L  L    +AT TDIALDAKATL HRI SL+LLV+ FLL LTVLTIWLFKHHRVSWLHET
Sbjct  9    LCVLAPGCSATDTDIALDAKATLNHRIQSLDLLVFVFLLALTVLTIWLFKHHRVSWLHET  68

Query  146  GLAVIYGLIVGAVIRYAGTSTPLVHLEVDPAGDPKFNQSLPPDTLWMKFPGKLAPNTTDK  205
            GLAVIYGLIVGA+IRYAGTS  LVH++V+P G P ++  LPPDTLW ++P      T  K
Sbjct  69   GLAVIYGLIVGAIIRYAGTSATLVHMQVEPQGVPTYSDKLPPDTLWFRYPVNQTNGT--K  126

Query  206  DPIPNKTYAYVFRGIVYDVDENEIDLKATFDPEIFFNIILPPIIFHAGYSLKKKYFFRNL  265
             P   KTYAYVFRG V+DVDENEIDLKATFDPE+FFNIILPPIIF+AGYSLKKKYFFRNL
Sbjct  127  PPEGIKTYAYVFRGQVHDVDENEIDLKATFDPEVFFNIILPPIIFYAGYSLKKKYFFRNL  186

Query  266  GAILMFAILGTTLSSFLIGAIMYGCVKLMPEYLSSSFTFLDTLYFGALISPTDPLTILAI  325
            GAIL FAI+GTTLS+FLIG  MYGCVKLMP+YLSSSFTFLD+LYFGALISPTDPLTILAI
Sbjct  187  GAILTFAIVGTTLSAFLIGGFMYGCVKLMPKYLSSSFTFLDSLYFGALISPTDPLTILAI  246

Query  326  FHDLHVDVNLYALVFGESVLNDAVAIVLSGAIQNYGEHYSSTGGFETNAFFRSLSDFFCI  385
            F+DL VDVNLYALV GESVLNDAVAIVLSGAIQNYGEHYS+TG FET AF RSLSDFF I
Sbjct  247  FNDLRVDVNLYALVLGESVLNDAVAIVLSGAIQNYGEHYSNTGEFETTAFLRSLSDFFSI  306

Query  386  FMLSLLIGATMGCFTALLTKFTRVREFPLLESALFVLMSYSTFLIAEASELTGVVAVLFC  445
            F+LSL+IGA MGC TAL+TKFTRVR+FPLLESALFVLMSYSTFL+AEA+ELTGVVAVLFC
Sbjct  307  FLLSLMIGAAMGCLTALMTKFTRVRDFPLLESALFVLMSYSTFLLAEATELTGVVAVLFC  366

Query  446  GICQAHYTYNNLSENSRTRTKEIFELLNFLAENFIFSYIGVSMFTFPKHHFDAVFIITGF  505
            GICQAHYTYNNLSE+SR RTK+IFELLNFLAENFIFSYIGVSMFTFPKHHFDA FIIT F
Sbjct  367  GICQAHYTYNNLSEDSRQRTKQIFELLNFLAENFIFSYIGVSMFTFPKHHFDAGFIITAF  426

Query  506  VTAAIGRAVNIYPLSWLLNLNRKPKISSNFQHMLFFAGLRGAMSFALAIRNTVSEARQTM  565
            + AAIGRAVN+YPLSWLLN+ RKPKIS+NFQHMLFFAGLRGAMSFALAIRNTVS+ RQTM
Sbjct  427  ICAAIGRAVNVYPLSWLLNIKRKPKISTNFQHMLFFAGLRGAMSFALAIRNTVSDERQTM  486

Query  566  LTATSLIVIFTVVIQGGASNFLLNWLKIPVGVDEETEQLNNYRVRSSID-TGLNLGQLPM  624
            LTATSLIVIFTVVIQGGA+NFLLNWLKIPVGVD+ETEQLNNY+V S ++  G+N  ++ +
Sbjct  487  LTATSLIVIFTVVIQGGAANFLLNWLKIPVGVDDETEQLNNYQVHSDVEGGGVNRNKMRL  546

Query  625  SRRRSSLDVDVDVEGA-GGIGDASAQTAMNVKRNEKAFLARIWGNFDTKYMKPLLTHSRP  683
            S    + ++D  V+G  G +G AS     N   +EKA LARIWGNFDTKYMKPLLTHSRP
Sbjct  547  SGGTDT-NLDTPVDGTNGSLGGASGGRRRN--SHEKAILARIWGNFDTKYMKPLLTHSRP  603

Query  684  TLLETLPVCCNPVARLLTTTEQLTQDGGGLRRSDSDSDICIDDENFGASSTNGAAGGLNG  743
            TLLETLPVCCNP+ARLLTTT+QLTQDG   RR DSDSDICID++              NG
Sbjct  604  TLLETLPVCCNPIARLLTTTQQLTQDGSEFRRVDSDSDICIDNDTG------------NG  651

Query  744  GSGSGSGGSAGMGPRRNSINRQH  766
             S  GSG + G+G RRNS++R  
Sbjct  652  LSQDGSGAAPGVG-RRNSLSRME  673


>B7Z029_DROME unnamed protein product
Length=681

 Score = 1005 bits (2598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 525/681 (77%), Positives = 581/681 (85%), Gaps = 20/681 (3%)

Query  86   LAALTHTANATATDIALDAKATLTHRIDSLNLLVYTFLLTLTVLTIWLFKHHRVSWLHET  145
            L  L    +AT TDIALDAKATL HRI SL+LLV+ FLL LTVLTIWLFKHHRVSWLHET
Sbjct  9    LCVLAPGCSATDTDIALDAKATLNHRIQSLDLLVFVFLLALTVLTIWLFKHHRVSWLHET  68

Query  146  GLAVIYGLIVGAVIRYAGTSTPLVHLEVDPAGDPKFNQSLPPDTLWMKFPGKLAPNTTDK  205
            GLAVIYGLIVGA+IRYAGTS  LVH++V+P G P ++  LPPDTLW ++P      T  K
Sbjct  69   GLAVIYGLIVGAIIRYAGTSATLVHMQVEPQGVPTYSDKLPPDTLWFRYPVNQTNGT--K  126

Query  206  DPIPNKTYAYVFRGIVYDVDENEIDLKATFDPEIFFNIILPPIIFHAGYSLKKKYFFRNL  265
             P   KTYAYVFRG V+DVDENEIDLKATFDPE+FFNIILPPIIF+AGYSLKKKYFFRNL
Sbjct  127  PPEGIKTYAYVFRGQVHDVDENEIDLKATFDPEVFFNIILPPIIFYAGYSLKKKYFFRNL  186

Query  266  GAILMFAILGTTLSSFLIGAIMYGCVKLMPEYLSSSFTFLDTLYFGALISPTDPLTILAI  325
            GAIL FAI+GTTLS+FLIG  MYGCVKLMP+YLSSSFTFLD+LYFGALISPTDPLTILAI
Sbjct  187  GAILTFAIVGTTLSAFLIGGFMYGCVKLMPKYLSSSFTFLDSLYFGALISPTDPLTILAI  246

Query  326  FHDLHVDVNLYALVFGESVLNDAVAIVLSGAIQNYGEHYSSTGGFETNAFFRSLSDFFCI  385
            F+DL VDVNLYALV GESVLNDAVAIVLSGAIQNYGEHYS+TG FET AF RSLSDFF I
Sbjct  247  FNDLRVDVNLYALVLGESVLNDAVAIVLSGAIQNYGEHYSNTGEFETTAFLRSLSDFFSI  306

Query  386  FMLSLLIGATMGCFTALLTKFTRVREFPLLESALFVLMSYSTFLIAEASELTGVVAVLFC  445
            F+LSL+IGA MGC TAL+TKFTRVR+FPLLESALFVLMSYSTFL+AEA+ELTGVVAVLFC
Sbjct  307  FLLSLMIGAAMGCLTALMTKFTRVRDFPLLESALFVLMSYSTFLLAEATELTGVVAVLFC  366

Query  446  GICQAHYTYNNLSENSRTRTKEIFELLNFLAENFIFSYIGVSMFTFPKHHFDAVFIITGF  505
            GICQAHYTYNNLSE+SR RTK+IFELLNFLAENFIFSYIGVSMFTFPKHHFDA FIIT F
Sbjct  367  GICQAHYTYNNLSEDSRQRTKQIFELLNFLAENFIFSYIGVSMFTFPKHHFDAGFIITAF  426

Query  506  VTAAIGRAVNIYPLSWLLNLNRKPKISSNFQHMLFFAGLRGAMSFALAIRNTVSEARQTM  565
            + AAIGRAVN+YPLSWLLN+ RKPKIS+NFQHMLFFAGLRGAMSFALAIRNTVS+ RQTM
Sbjct  427  ICAAIGRAVNVYPLSWLLNIKRKPKISTNFQHMLFFAGLRGAMSFALAIRNTVSDERQTM  486

Query  566  LTATSLIVIFTVVIQGGASNFLLNWLKIPVGVDEETEQLNNYRVRSSID-TGLNLGQLPM  624
            LTATSLIVIFTVVIQGGA+NFLLNWLKIPVGVD+ETEQLNNY+V S ++  G+N  ++ +
Sbjct  487  LTATSLIVIFTVVIQGGAANFLLNWLKIPVGVDDETEQLNNYQVHSDVEGGGVNRNKMRL  546

Query  625  SRRRSSLDVDVDVEGA-GGIGDASAQTAMNVKRNEKAFLARIWGNFDTKYMKPLLTHSRP  683
            S    + ++D  V+G  G +G AS     N   +EKA LARIWGNFDTKYMKPLLTHSRP
Sbjct  547  SGGTDT-NLDTPVDGTNGSLGGASGGRRRN--SHEKAILARIWGNFDTKYMKPLLTHSRP  603

Query  684  TLLETLPVCCNPVARLLTTTEQLTQDGGGLRRSDSDSDICIDDENFGASSTNGAAGGLNG  743
            TLLETLPVCCNP+ARLLTTT+QLTQDG   RR DSDSDICID++              NG
Sbjct  604  TLLETLPVCCNPIARLLTTTQQLTQDGSEFRRVDSDSDICIDNDTG------------NG  651

Query  744  GSGSGSGGSAGMGPRRNSINR  764
             S  GSG + G+G RRNS++R
Sbjct  652  LSQDGSGAAPGVG-RRNSLSR  671


>M9PB53_DROME unnamed protein product
Length=682

 Score = 1002 bits (2591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 526/687 (77%), Positives = 580/687 (84%), Gaps = 26/687 (4%)

Query  86   LAALTHTANATATDIALDAKATLTHRIDSLNLLVYTFLLTLTVLTIWLFKHHRVSWLHET  145
            L  L    +AT TDIALDAKATL HRI SL+LLV+ FLL LTVLTIWLFKHHRVSWLHET
Sbjct  9    LCVLAPGCSATDTDIALDAKATLNHRIQSLDLLVFVFLLALTVLTIWLFKHHRVSWLHET  68

Query  146  GLAVIYGLIVGAVIRYAGTSTPLVHLEVDPAGDPKFNQSLPPDTLWMKFPGKLAPNTTDK  205
            GLAVIYGLIVGA+IRYAGTS  LVH++V+P G P ++  LPPDTLW ++P      T  K
Sbjct  69   GLAVIYGLIVGAIIRYAGTSATLVHMQVEPQGVPTYSDKLPPDTLWFRYPVNQTNGT--K  126

Query  206  DPIPNKTYAYVFRGIVYDVDENEIDLKATFDPEIFFNIILPPIIFHAGYSLKKKYFFRNL  265
             P   KTYAYVFRG V+DVDENEIDLKATFDPE+FFNIILPPIIF+AGYSLKKKYFFRNL
Sbjct  127  PPEGIKTYAYVFRGQVHDVDENEIDLKATFDPEVFFNIILPPIIFYAGYSLKKKYFFRNL  186

Query  266  GAILMFAILGTTLSSFLIGAIMYGCVKLMPEYLSSSFTFLDTLYFGALISPTDPLTILAI  325
            GAIL FAI+GTTLS+FLIG  MYGCVKLMP+YLSSSFTFLD+LYFGALISPTDPLTILAI
Sbjct  187  GAILTFAIVGTTLSAFLIGGFMYGCVKLMPKYLSSSFTFLDSLYFGALISPTDPLTILAI  246

Query  326  FHDLHVDVNLYALVFGESVLNDAVAIVLSGAIQNYGEHYSSTGGFETNAFFRSLSDFFCI  385
            F+DL VDVNLYALV GESVLNDAVAIVLSGAIQNYGEHYS+TG FET AF RSLSDFF I
Sbjct  247  FNDLRVDVNLYALVLGESVLNDAVAIVLSGAIQNYGEHYSNTGEFETTAFLRSLSDFFSI  306

Query  386  FMLSLLIGATMGCFTALLTKFTRVREFPLLESALFVLMSYSTFLIAEASELTGVVAVLFC  445
            F+LSL+IGA MGC TAL+TKFTRVR+FPLLESALFVLMSYSTFL+AEA+ELTGVVAVLFC
Sbjct  307  FLLSLMIGAAMGCLTALMTKFTRVRDFPLLESALFVLMSYSTFLLAEATELTGVVAVLFC  366

Query  446  GICQAHYTYNNLSENSRTRTKEIFELLNFLAENFIFSYIGVSMFTFPKHHFDAVFIITGF  505
            GICQAHYTYNNLSE+SR RTK+IFELLNFLAENFIFSYIGVSMFTFPKHHFDA FIIT F
Sbjct  367  GICQAHYTYNNLSEDSRQRTKQIFELLNFLAENFIFSYIGVSMFTFPKHHFDAGFIITAF  426

Query  506  VTAAIGRAVNIYPLSWLLNLNRKPKISSNFQHMLFFAGLRGAMSFALAIRNTVSEARQTM  565
            + AAIGRAVN+YPLSWLLN+ RKPKIS+NFQHMLFFAGLRGAMSFALAIRNTVS+ RQTM
Sbjct  427  ICAAIGRAVNVYPLSWLLNIKRKPKISTNFQHMLFFAGLRGAMSFALAIRNTVSDERQTM  486

Query  566  LTATSLIVIFTVVIQGGASNFLLNWLKIPVGVDEETEQLNNYRVRSS-------IDTGLN  618
            LTATSLIVIFTVVIQGGA+NFLLNWLKIPVGVD+ETEQLNNY+V SS          G+N
Sbjct  487  LTATSLIVIFTVVIQGGAANFLLNWLKIPVGVDDETEQLNNYQVHSSDGYLQDVEGGGVN  546

Query  619  LGQLPMSRRRSSLDVDVDVEGA-GGIGDASAQTAMNVKRNEKAFLARIWGNFDTKYMKPL  677
              ++ +S    + ++D  V+G  G +G AS     N   +EKA LARIWGNFDTKYMKPL
Sbjct  547  RNKMRLSGGTDT-NLDTPVDGTNGSLGGASGGRRRN--SHEKAILARIWGNFDTKYMKPL  603

Query  678  LTHSRPTLLETLPVCCNPVARLLTTTEQLTQDGGGLRRSDSDSDICIDDENFGASSTNGA  737
            LTHSRPTLLETLPVCCNP+ARLLTTT+QLTQDG   RR DSDSDICID++          
Sbjct  604  LTHSRPTLLETLPVCCNPIARLLTTTQQLTQDGSEFRRVDSDSDICIDNDTG--------  655

Query  738  AGGLNGGSGSGSGGSAGMGPRRNSINR  764
                NG S  GSG + G+G RRNS++R
Sbjct  656  ----NGLSQDGSGAAPGVG-RRNSLSR  677



Lambda      K        H
   0.323    0.139    0.422 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2140775808


Query= XP_011197161.1 sodium/hydrogen exchanger 6 isoform X8 [Bactrocera
dorsalis]

Length=797
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8IPJ4_DROME  unnamed protein product                                 1022    0.0  
Q9VM99_DROME  unnamed protein product                                 1003    0.0  
M9PB53_DROME  unnamed protein product                                 1003    0.0  


>Q8IPJ4_DROME unnamed protein product
Length=711

 Score = 1022 bits (2642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 536/701 (76%), Positives = 585/701 (83%), Gaps = 39/701 (6%)

Query  86   LAALTHTANATATDIALDAKATLTHRIDSLNLLVYTFLLTLTVLTIWLFKHHRVSWLHET  145
            L  L    +AT TDIALDAKATL HRI SL+LLV+ FLL LTVLTIWLFKHHRVSWLHET
Sbjct  9    LCVLAPGCSATDTDIALDAKATLNHRIQSLDLLVFVFLLALTVLTIWLFKHHRVSWLHET  68

Query  146  GLAVIYGLIVGAVIRYAGTSTPLVHLEVDPAGDPKFNQSLPPDTLWMKFPGKLAPNTTDK  205
            GLAVIYGLIVGA+IRYAGTS  LVH++V+P G P ++  LPPDTLW ++P      T  K
Sbjct  69   GLAVIYGLIVGAIIRYAGTSATLVHMQVEPQGVPTYSDKLPPDTLWFRYPVNQTNGT--K  126

Query  206  DPIPNKTYAYVFRGIVYDVDENEIDLKATFDPEIFFNIILPPIIFHAGYSLKKKYFFRNL  265
             P   KTYAYVFRG V+DVDENEIDLKATFDPE+FFNIILPPIIF+AGYSLKKKYFFRNL
Sbjct  127  PPEGIKTYAYVFRGQVHDVDENEIDLKATFDPEVFFNIILPPIIFYAGYSLKKKYFFRNL  186

Query  266  GAILMFAILGTTLSSFLIGAIMYGCVKLMPEYLSSSFTFLDTLYFGALISPTDPLTILAI  325
            GAIL FAI+GTTLS+FLIG  MYGCVKLMP+YLSSSFTFLD+LYFGALISPTDPLTILAI
Sbjct  187  GAILTFAIVGTTLSAFLIGGFMYGCVKLMPKYLSSSFTFLDSLYFGALISPTDPLTILAI  246

Query  326  FHDLHVDVNLYALVFGESVLNDAVAIVLSGAIQNYGEHYSSTGGFETNAFFRSLSDFFCI  385
            F+DL VDVNLYALV GESVLNDAVAIVLSGAIQNYGEHYS+TG FET AF RSLSDFF I
Sbjct  247  FNDLRVDVNLYALVLGESVLNDAVAIVLSGAIQNYGEHYSNTGEFETTAFLRSLSDFFSI  306

Query  386  FMLSLLIGATMGCFTALLTKFTRVREFPLLESALFVLMSYSTFLIAEASELTGVVAVLFC  445
            F+LSL+IGA MGC TAL+TKFTRVR+FPLLESALFVLMSYSTFL+AEA+ELTGVVAVLFC
Sbjct  307  FLLSLMIGAAMGCLTALMTKFTRVRDFPLLESALFVLMSYSTFLLAEATELTGVVAVLFC  366

Query  446  GICQAHYTYNNLSENSRTRTKEIFELLNFLAENFIFSYIGVSMFTFPKHHFDAVFIITGF  505
            GICQAHYTYNNLSE+SR RTK+IFELLNFLAENFIFSYIGVSMFTFPKHHFDA FIIT F
Sbjct  367  GICQAHYTYNNLSEDSRQRTKQIFELLNFLAENFIFSYIGVSMFTFPKHHFDAGFIITAF  426

Query  506  VTAAIGRAVNIYPLSWLLNLNRKPKISSNFQHMLFFAGLRGAMSFALAIRNTVSEARQTM  565
            + AAIGRAVN+YPLSWLLN+ RKPKIS+NFQHMLFFAGLRGAMSFALAIRNTVS+ RQTM
Sbjct  427  ICAAIGRAVNVYPLSWLLNIKRKPKISTNFQHMLFFAGLRGAMSFALAIRNTVSDERQTM  486

Query  566  LTATSLIVIFTVVIQGGASNFLLNWLKIPVGVDEETEQLNNYRVRSVYNSMENT-AAASD  624
            LTATSLIVIFTVVIQGGA+NFLLNWLKIPVGVD+ETEQLNNY+V SVYNSM+N+    SD
Sbjct  487  LTATSLIVIFTVVIQGGAANFLLNWLKIPVGVDDETEQLNNYQVHSVYNSMDNSHPQTSD  546

Query  625  AYLQDV--------------------DVDVEGA-GGIGDASAQTAMNVKRNEKAFLARIW  663
             YLQDV                    D  V+G  G +G AS     N   +EKA LARIW
Sbjct  547  GYLQDVEGGGVNRNKMRLSGGTDTNLDTPVDGTNGSLGGASGGRRRN--SHEKAILARIW  604

Query  664  GNFDTKYMKPLLTHSRPTLLETLPVCCNPVARLLTTTEQLTQDGGGLRRSDSDSDICIDD  723
            GNFDTKYMKPLLTHSRPTLLETLPVCCNP+ARLLTTT+QLTQDG   RR DSDSDICID+
Sbjct  605  GNFDTKYMKPLLTHSRPTLLETLPVCCNPIARLLTTTQQLTQDGSEFRRVDSDSDICIDN  664

Query  724  ENFGASSTNGAAGGLNGGSGSGSGGSAGMGPRRNSINRQHH  764
            +              NG S  GSG + G+G RRNS++R  H
Sbjct  665  DTG------------NGLSQDGSGAAPGVG-RRNSLSRSVH  692


>Q9VM99_DROME unnamed protein product
Length=687

 Score = 1003 bits (2594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 529/697 (76%), Positives = 576/697 (83%), Gaps = 49/697 (7%)

Query  86   LAALTHTANATATDIALDAKATLTHRIDSLNLLVYTFLLTLTVLTIWLFKHHRVSWLHET  145
            L  L    +AT TDIALDAKATL HRI SL+LLV+ FLL LTVLTIWLFKHHRVSWLHET
Sbjct  9    LCVLAPGCSATDTDIALDAKATLNHRIQSLDLLVFVFLLALTVLTIWLFKHHRVSWLHET  68

Query  146  GLAVIYGLIVGAVIRYAGTSTPLVHLEVDPAGDPKFNQSLPPDTLWMKFPGKLAPNTTDK  205
            GLAVIYGLIVGA+IRYAGTS  LVH++V+P G P ++  LPPDTLW ++P      T  K
Sbjct  69   GLAVIYGLIVGAIIRYAGTSATLVHMQVEPQGVPTYSDKLPPDTLWFRYPVNQTNGT--K  126

Query  206  DPIPNKTYAYVFRGIVYDVDENEIDLKATFDPEIFFNIILPPIIFHAGYSLKKKYFFRNL  265
             P   KTYAYVFRG V+DVDENEIDLKATFDPE+FFNIILPPIIF+AGYSLKKKYFFRNL
Sbjct  127  PPEGIKTYAYVFRGQVHDVDENEIDLKATFDPEVFFNIILPPIIFYAGYSLKKKYFFRNL  186

Query  266  GAILMFAILGTTLSSFLIGAIMYGCVKLMPEYLSSSFTFLDTLYFGALISPTDPLTILAI  325
            GAIL FAI+GTTLS+FLIG  MYGCVKLMP+YLSSSFTFLD+LYFGALISPTDPLTILAI
Sbjct  187  GAILTFAIVGTTLSAFLIGGFMYGCVKLMPKYLSSSFTFLDSLYFGALISPTDPLTILAI  246

Query  326  FHDLHVDVNLYALVFGESVLNDAVAIVLSGAIQNYGEHYSSTGGFETNAFFRSLSDFFCI  385
            F+DL VDVNLYALV GESVLNDAVAIVLSGAIQNYGEHYS+TG FET AF RSLSDFF I
Sbjct  247  FNDLRVDVNLYALVLGESVLNDAVAIVLSGAIQNYGEHYSNTGEFETTAFLRSLSDFFSI  306

Query  386  FMLSLLIGATMGCFTALLTKFTRVREFPLLESALFVLMSYSTFLIAEASELTGVVAVLFC  445
            F+LSL+IGA MGC TAL+TKFTRVR+FPLLESALFVLMSYSTFL+AEA+ELTGVVAVLFC
Sbjct  307  FLLSLMIGAAMGCLTALMTKFTRVRDFPLLESALFVLMSYSTFLLAEATELTGVVAVLFC  366

Query  446  GICQAHYTYNNLSENSRTRTKEIFELLNFLAENFIFSYIGVSMFTFPKHHFDAVFIITGF  505
            GICQAHYTYNNLSE+SR RTK+IFELLNFLAENFIFSYIGVSMFTFPKHHFDA FIIT F
Sbjct  367  GICQAHYTYNNLSEDSRQRTKQIFELLNFLAENFIFSYIGVSMFTFPKHHFDAGFIITAF  426

Query  506  VTAAIGRAVNIYPLSWLLNLNRKPKISSNFQHMLFFAGLRGAMSFALAIRNTVSEARQTM  565
            + AAIGRAVN+YPLSWLLN+ RKPKIS+NFQHMLFFAGLRGAMSFALAIRNTVS+ RQTM
Sbjct  427  ICAAIGRAVNVYPLSWLLNIKRKPKISTNFQHMLFFAGLRGAMSFALAIRNTVSDERQTM  486

Query  566  LTATSLIVIFTVVIQGGASNFLLNWLKIPVGVDEETEQLNNYRVRSVYNSMENTAAASDA  625
            LTATSLIVIFTVVIQGGA+NFLLNWLKIPVGVD+ETEQLNNY+V S           SD 
Sbjct  487  LTATSLIVIFTVVIQGGAANFLLNWLKIPVGVDDETEQLNNYQVHS-----------SDG  535

Query  626  YLQDV--------------------DVDVEGA-GGIGDASAQTAMNVKRNEKAFLARIWG  664
            YLQDV                    D  V+G  G +G AS     N   +EKA LARIWG
Sbjct  536  YLQDVEGGGVNRNKMRLSGGTDTNLDTPVDGTNGSLGGASGGRRRN--SHEKAILARIWG  593

Query  665  NFDTKYMKPLLTHSRPTLLETLPVCCNPVARLLTTTEQLTQDGGGLRRSDSDSDICIDDE  724
            NFDTKYMKPLLTHSRPTLLETLPVCCNP+ARLLTTT+QLTQDG   RR DSDSDICID++
Sbjct  594  NFDTKYMKPLLTHSRPTLLETLPVCCNPIARLLTTTQQLTQDGSEFRRVDSDSDICIDND  653

Query  725  NFGASSTNGAAGGLNGGSGSGSGGSAGMGPRRNSINR  761
                          NG S  GSG + G+G RRNS++R
Sbjct  654  TG------------NGLSQDGSGAAPGVG-RRNSLSR  677


>M9PB53_DROME unnamed protein product
Length=682

 Score = 1003 bits (2593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 529/697 (76%), Positives = 576/697 (83%), Gaps = 49/697 (7%)

Query  86   LAALTHTANATATDIALDAKATLTHRIDSLNLLVYTFLLTLTVLTIWLFKHHRVSWLHET  145
            L  L    +AT TDIALDAKATL HRI SL+LLV+ FLL LTVLTIWLFKHHRVSWLHET
Sbjct  9    LCVLAPGCSATDTDIALDAKATLNHRIQSLDLLVFVFLLALTVLTIWLFKHHRVSWLHET  68

Query  146  GLAVIYGLIVGAVIRYAGTSTPLVHLEVDPAGDPKFNQSLPPDTLWMKFPGKLAPNTTDK  205
            GLAVIYGLIVGA+IRYAGTS  LVH++V+P G P ++  LPPDTLW ++P      T  K
Sbjct  69   GLAVIYGLIVGAIIRYAGTSATLVHMQVEPQGVPTYSDKLPPDTLWFRYPVNQTNGT--K  126

Query  206  DPIPNKTYAYVFRGIVYDVDENEIDLKATFDPEIFFNIILPPIIFHAGYSLKKKYFFRNL  265
             P   KTYAYVFRG V+DVDENEIDLKATFDPE+FFNIILPPIIF+AGYSLKKKYFFRNL
Sbjct  127  PPEGIKTYAYVFRGQVHDVDENEIDLKATFDPEVFFNIILPPIIFYAGYSLKKKYFFRNL  186

Query  266  GAILMFAILGTTLSSFLIGAIMYGCVKLMPEYLSSSFTFLDTLYFGALISPTDPLTILAI  325
            GAIL FAI+GTTLS+FLIG  MYGCVKLMP+YLSSSFTFLD+LYFGALISPTDPLTILAI
Sbjct  187  GAILTFAIVGTTLSAFLIGGFMYGCVKLMPKYLSSSFTFLDSLYFGALISPTDPLTILAI  246

Query  326  FHDLHVDVNLYALVFGESVLNDAVAIVLSGAIQNYGEHYSSTGGFETNAFFRSLSDFFCI  385
            F+DL VDVNLYALV GESVLNDAVAIVLSGAIQNYGEHYS+TG FET AF RSLSDFF I
Sbjct  247  FNDLRVDVNLYALVLGESVLNDAVAIVLSGAIQNYGEHYSNTGEFETTAFLRSLSDFFSI  306

Query  386  FMLSLLIGATMGCFTALLTKFTRVREFPLLESALFVLMSYSTFLIAEASELTGVVAVLFC  445
            F+LSL+IGA MGC TAL+TKFTRVR+FPLLESALFVLMSYSTFL+AEA+ELTGVVAVLFC
Sbjct  307  FLLSLMIGAAMGCLTALMTKFTRVRDFPLLESALFVLMSYSTFLLAEATELTGVVAVLFC  366

Query  446  GICQAHYTYNNLSENSRTRTKEIFELLNFLAENFIFSYIGVSMFTFPKHHFDAVFIITGF  505
            GICQAHYTYNNLSE+SR RTK+IFELLNFLAENFIFSYIGVSMFTFPKHHFDA FIIT F
Sbjct  367  GICQAHYTYNNLSEDSRQRTKQIFELLNFLAENFIFSYIGVSMFTFPKHHFDAGFIITAF  426

Query  506  VTAAIGRAVNIYPLSWLLNLNRKPKISSNFQHMLFFAGLRGAMSFALAIRNTVSEARQTM  565
            + AAIGRAVN+YPLSWLLN+ RKPKIS+NFQHMLFFAGLRGAMSFALAIRNTVS+ RQTM
Sbjct  427  ICAAIGRAVNVYPLSWLLNIKRKPKISTNFQHMLFFAGLRGAMSFALAIRNTVSDERQTM  486

Query  566  LTATSLIVIFTVVIQGGASNFLLNWLKIPVGVDEETEQLNNYRVRSVYNSMENTAAASDA  625
            LTATSLIVIFTVVIQGGA+NFLLNWLKIPVGVD+ETEQLNNY+V S           SD 
Sbjct  487  LTATSLIVIFTVVIQGGAANFLLNWLKIPVGVDDETEQLNNYQVHS-----------SDG  535

Query  626  YLQDV--------------------DVDVEGA-GGIGDASAQTAMNVKRNEKAFLARIWG  664
            YLQDV                    D  V+G  G +G AS     N   +EKA LARIWG
Sbjct  536  YLQDVEGGGVNRNKMRLSGGTDTNLDTPVDGTNGSLGGASGGRRRN--SHEKAILARIWG  593

Query  665  NFDTKYMKPLLTHSRPTLLETLPVCCNPVARLLTTTEQLTQDGGGLRRSDSDSDICIDDE  724
            NFDTKYMKPLLTHSRPTLLETLPVCCNP+ARLLTTT+QLTQDG   RR DSDSDICID++
Sbjct  594  NFDTKYMKPLLTHSRPTLLETLPVCCNPIARLLTTTQQLTQDGSEFRRVDSDSDICIDND  653

Query  725  NFGASSTNGAAGGLNGGSGSGSGGSAGMGPRRNSINR  761
                          NG S  GSG + G+G RRNS++R
Sbjct  654  TG------------NGLSQDGSGAAPGVG-RRNSLSR  677



Lambda      K        H
   0.323    0.139    0.422 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2140775808


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jan 6, 2022  1:11 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_011197162.1 sodium/hydrogen exchanger 6 isoform X9 [Bactrocera
dorsalis]

Length=791
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8IPJ4_DROME  unnamed protein product                                 1020    0.0  
Q9VM99_DROME  unnamed protein product                                 1007    0.0  
M9PB53_DROME  unnamed protein product                                 1006    0.0  


>Q8IPJ4_DROME unnamed protein product
Length=711

 Score = 1020 bits (2637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 535/708 (76%), Positives = 595/708 (84%), Gaps = 19/708 (3%)

Query  86   LAALTHTANATATDIALDAKATLTHRIDSLNLLVYTFLLTLTVLTIWLFKHHRVSWLHET  145
            L  L    +AT TDIALDAKATL HRI SL+LLV+ FLL LTVLTIWLFKHHRVSWLHET
Sbjct  9    LCVLAPGCSATDTDIALDAKATLNHRIQSLDLLVFVFLLALTVLTIWLFKHHRVSWLHET  68

Query  146  GLAVIYGLIVGAVIRYAGTSTPLVHLEVDPAGDPKFNQSLPPDTLWMKFPGKLAPNTTDK  205
            GLAVIYGLIVGA+IRYAGTS  LVH++V+P G P ++  LPPDTLW ++P      T  K
Sbjct  69   GLAVIYGLIVGAIIRYAGTSATLVHMQVEPQGVPTYSDKLPPDTLWFRYPVNQTNGT--K  126

Query  206  DPIPNKTYAYVFRGIVYDVDENEIDLKATFDPEIFFNIILPPIIFHAGYSLKKKYFFRNL  265
             P   KTYAYVFRG V+DVDENEIDLKATFDPE+FFNIILPPIIF+AGYSLKKKYFFRNL
Sbjct  127  PPEGIKTYAYVFRGQVHDVDENEIDLKATFDPEVFFNIILPPIIFYAGYSLKKKYFFRNL  186

Query  266  GAILMFAILGTTLSSFLIGAIMYGCVKLMPEYLSSSFTFLDTLYFGALISPTDPLTILAI  325
            GAIL FAI+GTTLS+FLIG  MYGCVKLMP+YLSSSFTFLD+LYFGALISPTDPLTILAI
Sbjct  187  GAILTFAIVGTTLSAFLIGGFMYGCVKLMPKYLSSSFTFLDSLYFGALISPTDPLTILAI  246

Query  326  FHDLHVDVNLYALVFGESVLNDAVAIVLSGAIQNYGEHYSSTGGFETNAFFRSLSDFFCI  385
            F+DL VDVNLYALV GESVLNDAVAIVLSGAIQNYGEHYS+TG FET AF RSLSDFF I
Sbjct  247  FNDLRVDVNLYALVLGESVLNDAVAIVLSGAIQNYGEHYSNTGEFETTAFLRSLSDFFSI  306

Query  386  FMLSLLIGATMGCFTALLTKFTRVREFPLLESALFVLMSYSTFLIAEASELTGVVAVLFC  445
            F+LSL+IGA MGC TAL+TKFTRVR+FPLLESALFVLMSYSTFL+AEA+ELTGVVAVLFC
Sbjct  307  FLLSLMIGAAMGCLTALMTKFTRVRDFPLLESALFVLMSYSTFLLAEATELTGVVAVLFC  366

Query  446  GICQAHYTYNNLSENSRTRTKEIFELLNFLAENFIFSYIGVSMFTFPKHHFDAVFIITGF  505
            GICQAHYTYNNLSE+SR RTK+IFELLNFLAENFIFSYIGVSMFTFPKHHFDA FIIT F
Sbjct  367  GICQAHYTYNNLSEDSRQRTKQIFELLNFLAENFIFSYIGVSMFTFPKHHFDAGFIITAF  426

Query  506  VTAAIGRAVNIYPLSWLLNLNRKPKISSNFQHMLFFAGLRGAMSFALAIRNTVSEARQTM  565
            + AAIGRAVN+YPLSWLLN+ RKPKIS+NFQHMLFFAGLRGAMSFALAIRNTVS+ RQTM
Sbjct  427  ICAAIGRAVNVYPLSWLLNIKRKPKISTNFQHMLFFAGLRGAMSFALAIRNTVSDERQTM  486

Query  566  LTATSLIVIFTVVIQGGASNFLLNWLKIPVGVDEETEQLNNYRVRSVYNSMENTAAASID  625
            LTATSLIVIFTVVIQGGA+NFLLNWLKIPVGVD+ETEQLNNY+V SVYNSM+N+   + D
Sbjct  487  LTATSLIVIFTVVIQGGAANFLLNWLKIPVGVDDETEQLNNYQVHSVYNSMDNSHPQTSD  546

Query  626  TGL-NLGQLPMSRRRSSLSDAYLQDVDVDVEGA-GGIGDASAQTAMNVKRNEKAFLARIW  683
              L ++    ++R +  LS     ++D  V+G  G +G AS     N   +EKA LARIW
Sbjct  547  GYLQDVEGGGVNRNKMRLSGGTDTNLDTPVDGTNGSLGGASGGRRRN--SHEKAILARIW  604

Query  684  GNFDTKYMKPLLTHSRPTLLETLPVCCNPVARLLTTTEQLTQDGGGLRRSDSDSDICIDD  743
            GNFDTKYMKPLLTHSRPTLLETLPVCCNP+ARLLTTT+QLTQDG   RR DSDSDICID+
Sbjct  605  GNFDTKYMKPLLTHSRPTLLETLPVCCNPIARLLTTTQQLTQDGSEFRRVDSDSDICIDN  664

Query  744  ENFGASSTNGAAGGLNGGSGSGSGGSAGMGPRRNSINRSENDLRTHHI  791
            +              NG S  GSG + G+G RRNS++RS +    +H+
Sbjct  665  DTG------------NGLSQDGSGAAPGVG-RRNSLSRSVHLNEANHL  699


>Q9VM99_DROME unnamed protein product
Length=687

 Score = 1007 bits (2603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 528/707 (75%), Positives = 584/707 (83%), Gaps = 29/707 (4%)

Query  86   LAALTHTANATATDIALDAKATLTHRIDSLNLLVYTFLLTLTVLTIWLFKHHRVSWLHET  145
            L  L    +AT TDIALDAKATL HRI SL+LLV+ FLL LTVLTIWLFKHHRVSWLHET
Sbjct  9    LCVLAPGCSATDTDIALDAKATLNHRIQSLDLLVFVFLLALTVLTIWLFKHHRVSWLHET  68

Query  146  GLAVIYGLIVGAVIRYAGTSTPLVHLEVDPAGDPKFNQSLPPDTLWMKFPGKLAPNTTDK  205
            GLAVIYGLIVGA+IRYAGTS  LVH++V+P G P ++  LPPDTLW ++P      T  K
Sbjct  69   GLAVIYGLIVGAIIRYAGTSATLVHMQVEPQGVPTYSDKLPPDTLWFRYPVNQTNGT--K  126

Query  206  DPIPNKTYAYVFRGIVYDVDENEIDLKATFDPEIFFNIILPPIIFHAGYSLKKKYFFRNL  265
             P   KTYAYVFRG V+DVDENEIDLKATFDPE+FFNIILPPIIF+AGYSLKKKYFFRNL
Sbjct  127  PPEGIKTYAYVFRGQVHDVDENEIDLKATFDPEVFFNIILPPIIFYAGYSLKKKYFFRNL  186

Query  266  GAILMFAILGTTLSSFLIGAIMYGCVKLMPEYLSSSFTFLDTLYFGALISPTDPLTILAI  325
            GAIL FAI+GTTLS+FLIG  MYGCVKLMP+YLSSSFTFLD+LYFGALISPTDPLTILAI
Sbjct  187  GAILTFAIVGTTLSAFLIGGFMYGCVKLMPKYLSSSFTFLDSLYFGALISPTDPLTILAI  246

Query  326  FHDLHVDVNLYALVFGESVLNDAVAIVLSGAIQNYGEHYSSTGGFETNAFFRSLSDFFCI  385
            F+DL VDVNLYALV GESVLNDAVAIVLSGAIQNYGEHYS+TG FET AF RSLSDFF I
Sbjct  247  FNDLRVDVNLYALVLGESVLNDAVAIVLSGAIQNYGEHYSNTGEFETTAFLRSLSDFFSI  306

Query  386  FMLSLLIGATMGCFTALLTKFTRVREFPLLESALFVLMSYSTFLIAEASELTGVVAVLFC  445
            F+LSL+IGA MGC TAL+TKFTRVR+FPLLESALFVLMSYSTFL+AEA+ELTGVVAVLFC
Sbjct  307  FLLSLMIGAAMGCLTALMTKFTRVRDFPLLESALFVLMSYSTFLLAEATELTGVVAVLFC  366

Query  446  GICQAHYTYNNLSENSRTRTKEIFELLNFLAENFIFSYIGVSMFTFPKHHFDAVFIITGF  505
            GICQAHYTYNNLSE+SR RTK+IFELLNFLAENFIFSYIGVSMFTFPKHHFDA FIIT F
Sbjct  367  GICQAHYTYNNLSEDSRQRTKQIFELLNFLAENFIFSYIGVSMFTFPKHHFDAGFIITAF  426

Query  506  VTAAIGRAVNIYPLSWLLNLNRKPKISSNFQHMLFFAGLRGAMSFALAIRNTVSEARQTM  565
            + AAIGRAVN+YPLSWLLN+ RKPKIS+NFQHMLFFAGLRGAMSFALAIRNTVS+ RQTM
Sbjct  427  ICAAIGRAVNVYPLSWLLNIKRKPKISTNFQHMLFFAGLRGAMSFALAIRNTVSDERQTM  486

Query  566  LTATSLIVIFTVVIQGGASNFLLNWLKIPVGVDEETEQLNNYRVRSVYNSMENTAAASID  625
            LTATSLIVIFTVVIQGGA+NFLLNWLKIPVGVD+ETEQLNNY+V S    +++     ++
Sbjct  487  LTATSLIVIFTVVIQGGAANFLLNWLKIPVGVDDETEQLNNYQVHSSDGYLQDVEGGGVN  546

Query  626  TGLNLGQLPMSRRRSSLSDAYLQDVDVDVEGA-GGIGDASAQTAMNVKRNEKAFLARIWG  684
                       R +  LS     ++D  V+G  G +G AS     N   +EKA LARIWG
Sbjct  547  -----------RNKMRLSGGTDTNLDTPVDGTNGSLGGASGGRRRN--SHEKAILARIWG  593

Query  685  NFDTKYMKPLLTHSRPTLLETLPVCCNPVARLLTTTEQLTQDGGGLRRSDSDSDICIDDE  744
            NFDTKYMKPLLTHSRPTLLETLPVCCNP+ARLLTTT+QLTQDG   RR DSDSDICID++
Sbjct  594  NFDTKYMKPLLTHSRPTLLETLPVCCNPIARLLTTTQQLTQDGSEFRRVDSDSDICIDND  653

Query  745  NFGASSTNGAAGGLNGGSGSGSGGSAGMGPRRNSINRSENDLRTHHI  791
                          NG S  GSG + G+G RRNS++R   D R  +I
Sbjct  654  TG------------NGLSQDGSGAAPGVG-RRNSLSRVGGDHRNAYI  687


>M9PB53_DROME unnamed protein product
Length=682

 Score = 1006 bits (2602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 526/699 (75%), Positives = 582/699 (83%), Gaps = 29/699 (4%)

Query  86   LAALTHTANATATDIALDAKATLTHRIDSLNLLVYTFLLTLTVLTIWLFKHHRVSWLHET  145
            L  L    +AT TDIALDAKATL HRI SL+LLV+ FLL LTVLTIWLFKHHRVSWLHET
Sbjct  9    LCVLAPGCSATDTDIALDAKATLNHRIQSLDLLVFVFLLALTVLTIWLFKHHRVSWLHET  68

Query  146  GLAVIYGLIVGAVIRYAGTSTPLVHLEVDPAGDPKFNQSLPPDTLWMKFPGKLAPNTTDK  205
            GLAVIYGLIVGA+IRYAGTS  LVH++V+P G P ++  LPPDTLW ++P      T  K
Sbjct  69   GLAVIYGLIVGAIIRYAGTSATLVHMQVEPQGVPTYSDKLPPDTLWFRYPVNQTNGT--K  126

Query  206  DPIPNKTYAYVFRGIVYDVDENEIDLKATFDPEIFFNIILPPIIFHAGYSLKKKYFFRNL  265
             P   KTYAYVFRG V+DVDENEIDLKATFDPE+FFNIILPPIIF+AGYSLKKKYFFRNL
Sbjct  127  PPEGIKTYAYVFRGQVHDVDENEIDLKATFDPEVFFNIILPPIIFYAGYSLKKKYFFRNL  186

Query  266  GAILMFAILGTTLSSFLIGAIMYGCVKLMPEYLSSSFTFLDTLYFGALISPTDPLTILAI  325
            GAIL FAI+GTTLS+FLIG  MYGCVKLMP+YLSSSFTFLD+LYFGALISPTDPLTILAI
Sbjct  187  GAILTFAIVGTTLSAFLIGGFMYGCVKLMPKYLSSSFTFLDSLYFGALISPTDPLTILAI  246

Query  326  FHDLHVDVNLYALVFGESVLNDAVAIVLSGAIQNYGEHYSSTGGFETNAFFRSLSDFFCI  385
            F+DL VDVNLYALV GESVLNDAVAIVLSGAIQNYGEHYS+TG FET AF RSLSDFF I
Sbjct  247  FNDLRVDVNLYALVLGESVLNDAVAIVLSGAIQNYGEHYSNTGEFETTAFLRSLSDFFSI  306

Query  386  FMLSLLIGATMGCFTALLTKFTRVREFPLLESALFVLMSYSTFLIAEASELTGVVAVLFC  445
            F+LSL+IGA MGC TAL+TKFTRVR+FPLLESALFVLMSYSTFL+AEA+ELTGVVAVLFC
Sbjct  307  FLLSLMIGAAMGCLTALMTKFTRVRDFPLLESALFVLMSYSTFLLAEATELTGVVAVLFC  366

Query  446  GICQAHYTYNNLSENSRTRTKEIFELLNFLAENFIFSYIGVSMFTFPKHHFDAVFIITGF  505
            GICQAHYTYNNLSE+SR RTK+IFELLNFLAENFIFSYIGVSMFTFPKHHFDA FIIT F
Sbjct  367  GICQAHYTYNNLSEDSRQRTKQIFELLNFLAENFIFSYIGVSMFTFPKHHFDAGFIITAF  426

Query  506  VTAAIGRAVNIYPLSWLLNLNRKPKISSNFQHMLFFAGLRGAMSFALAIRNTVSEARQTM  565
            + AAIGRAVN+YPLSWLLN+ RKPKIS+NFQHMLFFAGLRGAMSFALAIRNTVS+ RQTM
Sbjct  427  ICAAIGRAVNVYPLSWLLNIKRKPKISTNFQHMLFFAGLRGAMSFALAIRNTVSDERQTM  486

Query  566  LTATSLIVIFTVVIQGGASNFLLNWLKIPVGVDEETEQLNNYRVRSVYNSMENTAAASID  625
            LTATSLIVIFTVVIQGGA+NFLLNWLKIPVGVD+ETEQLNNY+V S    +++     ++
Sbjct  487  LTATSLIVIFTVVIQGGAANFLLNWLKIPVGVDDETEQLNNYQVHSSDGYLQDVEGGGVN  546

Query  626  TGLNLGQLPMSRRRSSLSDAYLQDVDVDVEGA-GGIGDASAQTAMNVKRNEKAFLARIWG  684
                       R +  LS     ++D  V+G  G +G AS     N   +EKA LARIWG
Sbjct  547  -----------RNKMRLSGGTDTNLDTPVDGTNGSLGGASGGRRRN--SHEKAILARIWG  593

Query  685  NFDTKYMKPLLTHSRPTLLETLPVCCNPVARLLTTTEQLTQDGGGLRRSDSDSDICIDDE  744
            NFDTKYMKPLLTHSRPTLLETLPVCCNP+ARLLTTT+QLTQDG   RR DSDSDICID++
Sbjct  594  NFDTKYMKPLLTHSRPTLLETLPVCCNPIARLLTTTQQLTQDGSEFRRVDSDSDICIDND  653

Query  745  NFGASSTNGAAGGLNGGSGSGSGGSAGMGPRRNSINRSE  783
                          NG S  GSG + G+G RRNS++R+E
Sbjct  654  TG------------NGLSQDGSGAAPGVG-RRNSLSRTE  679



Lambda      K        H
   0.323    0.137    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9813801108


Query= XP_011197163.1 sodium/hydrogen exchanger 6 isoform X10 [Bactrocera
dorsalis]

Length=791
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8IPJ4_DROME  unnamed protein product                                 1012    0.0  
A8DYW5_DROME  unnamed protein product                                 1003    0.0  
B7Z029_DROME  unnamed protein product                                 1001    0.0  


>Q8IPJ4_DROME unnamed protein product
Length=711

 Score = 1012 bits (2617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 532/699 (76%), Positives = 582/699 (83%), Gaps = 41/699 (6%)

Query  86   LAALTHTANATATDIALDAKATLTHRIDSLNLLVYTFLLTLTVLTIWLFKHHRVSWLHET  145
            L  L    +AT TDIALDAKATL HRI SL+LLV+ FLL LTVLTIWLFKHHRVSWLHET
Sbjct  9    LCVLAPGCSATDTDIALDAKATLNHRIQSLDLLVFVFLLALTVLTIWLFKHHRVSWLHET  68

Query  146  GLAVIYGLIVGAVIRYAGTSTPLVHLEVDPAGDPKFNQSLPPDTLWMKFPGKLAPNTTDK  205
            GLAVIYGLIVGA+IRYAGTS  LVH++V+P G P ++  LPPDTLW ++P      T  K
Sbjct  69   GLAVIYGLIVGAIIRYAGTSATLVHMQVEPQGVPTYSDKLPPDTLWFRYPVNQTNGT--K  126

Query  206  DPIPNKTYAYVFRGIVYDVDENEIDLKATFDPEIFFNIILPPIIFHAGYSLKKKYFFRNL  265
             P   KTYAYVFRG V+DVDENEIDLKATFDPE+FFNIILPPIIF+AGYSLKKKYFFRNL
Sbjct  127  PPEGIKTYAYVFRGQVHDVDENEIDLKATFDPEVFFNIILPPIIFYAGYSLKKKYFFRNL  186

Query  266  GAILMFAILGTTLSSFLIGAIMYGCVKLMPEYLSSSFTFLDTLYFGALISPTDPLTILAI  325
            GAIL FAI+GTTLS+FLIG  MYGCVKLMP+YLSSSFTFLD+LYFGALISPTDPLTILAI
Sbjct  187  GAILTFAIVGTTLSAFLIGGFMYGCVKLMPKYLSSSFTFLDSLYFGALISPTDPLTILAI  246

Query  326  FHDLHVDVNLYALVFGESVLNDAVAIVLSGAIQNYGEHYSSTGGFETNAFFRSLSDFFCI  385
            F+DL VDVNLYALV GESVLNDAVAIVLSGAIQNYGEHYS+TG FET AF RSLSDFF I
Sbjct  247  FNDLRVDVNLYALVLGESVLNDAVAIVLSGAIQNYGEHYSNTGEFETTAFLRSLSDFFSI  306

Query  386  FMLSLLIGATMGCFTALLTKFTRVREFPLLESALFVLMSYSTFLIAEASELTGVVAVLFC  445
            F+LSL+IGA MGC TAL+TKFTRVR+FPLLESALFVLMSYSTFL+AEA+ELTGVVAVLFC
Sbjct  307  FLLSLMIGAAMGCLTALMTKFTRVRDFPLLESALFVLMSYSTFLLAEATELTGVVAVLFC  366

Query  446  GICQAHYTYNNLSENSRTRTKEIFELLNFLAENFIFSYIGVSMFTFPKHHFDAVFIITGF  505
            GICQAHYTYNNLSE+SR RTK+IFELLNFLAENFIFSYIGVSMFTFPKHHFDA FIIT F
Sbjct  367  GICQAHYTYNNLSEDSRQRTKQIFELLNFLAENFIFSYIGVSMFTFPKHHFDAGFIITAF  426

Query  506  VTAAIGRAVNIYPLSWLLNLNRKPKISSNFQHMLFFAGLRGAMSFALAIRNTVSEARQTM  565
            + AAIGRAVN+YPLSWLLN+ RKPKIS+NFQHMLFFAGLRGAMSFALAIRNTVS+ RQTM
Sbjct  427  ICAAIGRAVNVYPLSWLLNIKRKPKISTNFQHMLFFAGLRGAMSFALAIRNTVSDERQTM  486

Query  566  LTATSLIVIFTVVIQGGASNFLLNWLKIPVGVDEETEQLNNYRVRSVYNSMENTAAADVD  625
            LTATSLIVIFTVVIQGGA+NFLLNWLKIPVGVD+ETEQLNNY+V SVYNSM+N+     D
Sbjct  487  LTATSLIVIFTVVIQGGAANFLLNWLKIPVGVDDETEQLNNYQVHSVYNSMDNSHPQTSD  546

Query  626  ---VDVEGAG---------GIGDASAQTAMN------------VKRN--EKAFLARIWGN  659
                DVEG G         G  D +  T ++             +RN  EKA LARIWGN
Sbjct  547  GYLQDVEGGGVNRNKMRLSGGTDTNLDTPVDGTNGSLGGASGGRRRNSHEKAILARIWGN  606

Query  660  FDTKYMKPLLTHSRPTLLETLPVCCNPVARLLTTTEQLTQDGGGLRRSDSDSDICIDDEN  719
            FDTKYMKPLLTHSRPTLLETLPVCCNP+ARLLTTT+QLTQDG   RR DSDSDICID++ 
Sbjct  607  FDTKYMKPLLTHSRPTLLETLPVCCNPIARLLTTTQQLTQDGSEFRRVDSDSDICIDNDT  666

Query  720  FGASSTNGAAGGLNGGSGSGSGGSAGMGPRRNSINRQHH  758
                         NG S  GSG + G+G RRNS++R  H
Sbjct  667  G------------NGLSQDGSGAAPGVG-RRNSLSRSVH  692


>A8DYW5_DROME unnamed protein product
Length=696

 Score = 1003 bits (2594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 525/682 (77%), Positives = 575/682 (84%), Gaps = 27/682 (4%)

Query  86   LAALTHTANATATDIALDAKATLTHRIDSLNLLVYTFLLTLTVLTIWLFKHHRVSWLHET  145
            L  L    +AT TDIALDAKATL HRI SL+LLV+ FLL LTVLTIWLFKHHRVSWLHET
Sbjct  9    LCVLAPGCSATDTDIALDAKATLNHRIQSLDLLVFVFLLALTVLTIWLFKHHRVSWLHET  68

Query  146  GLAVIYGLIVGAVIRYAGTSTPLVHLEVDPAGDPKFNQSLPPDTLWMKFPGKLAPNTTDK  205
            GLAVIYGLIVGA+IRYAGTS  LVH++V+P G P ++  LPPDTLW ++P      T  K
Sbjct  69   GLAVIYGLIVGAIIRYAGTSATLVHMQVEPQGVPTYSDKLPPDTLWFRYPVNQTNGT--K  126

Query  206  DPIPNKTYAYVFRGIVYDVDENEIDLKATFDPEIFFNIILPPIIFHAGYSLKKKYFFRNL  265
             P   KTYAYVFRG V+DVDENEIDLKATFDPE+FFNIILPPIIF+AGYSLKKKYFFRNL
Sbjct  127  PPEGIKTYAYVFRGQVHDVDENEIDLKATFDPEVFFNIILPPIIFYAGYSLKKKYFFRNL  186

Query  266  GAILMFAILGTTLSSFLIGAIMYGCVKLMPEYLSSSFTFLDTLYFGALISPTDPLTILAI  325
            GAIL FAI+GTTLS+FLIG  MYGCVKLMP+YLSSSFTFLD+LYFGALISPTDPLTILAI
Sbjct  187  GAILTFAIVGTTLSAFLIGGFMYGCVKLMPKYLSSSFTFLDSLYFGALISPTDPLTILAI  246

Query  326  FHDLHVDVNLYALVFGESVLNDAVAIVLSGAIQNYGEHYSSTGGFETNAFFRSLSDFFCI  385
            F+DL VDVNLYALV GESVLNDAVAIVLSGAIQNYGEHYS+TG FET AF RSLSDFF I
Sbjct  247  FNDLRVDVNLYALVLGESVLNDAVAIVLSGAIQNYGEHYSNTGEFETTAFLRSLSDFFSI  306

Query  386  FMLSLLIGATMGCFTALLTKFTRVREFPLLESALFVLMSYSTFLIAEASELTGVVAVLFC  445
            F+LSL+IGA MGC TAL+TKFTRVR+FPLLESALFVLMSYSTFL+AEA+ELTGVVAVLFC
Sbjct  307  FLLSLMIGAAMGCLTALMTKFTRVRDFPLLESALFVLMSYSTFLLAEATELTGVVAVLFC  366

Query  446  GICQAHYTYNNLSENSRTRTKEIFELLNFLAENFIFSYIGVSMFTFPKHHFDAVFIITGF  505
            GICQAHYTYNNLSE+SR RTK+IFELLNFLAENFIFSYIGVSMFTFPKHHFDA FIIT F
Sbjct  367  GICQAHYTYNNLSEDSRQRTKQIFELLNFLAENFIFSYIGVSMFTFPKHHFDAGFIITAF  426

Query  506  VTAAIGRAVNIYPLSWLLNLNRKPKISSNFQHMLFFAGLRGAMSFALAIRNTVSEARQTM  565
            + AAIGRAVN+YPLSWLLN+ RKPKIS+NFQHMLFFAGLRGAMSFALAIRNTVS+ RQTM
Sbjct  427  ICAAIGRAVNVYPLSWLLNIKRKPKISTNFQHMLFFAGLRGAMSFALAIRNTVSDERQTM  486

Query  566  LTATSLIVIFTVVIQGGASNFLLNWLKIPVGVDEETEQLNNYRVRSVY-------NSMEN  618
            LTATSLIVIFTVVIQGGA+NFLLNWLKIPVGVD+ETEQLNNY+V S         N M  
Sbjct  487  LTATSLIVIFTVVIQGGAANFLLNWLKIPVGVDDETEQLNNYQVHSDVEGGGVNRNKMRL  546

Query  619  TAAADVDVD--VEGA-GGIGDASAQTAMNVKRNEKAFLARIWGNFDTKYMKPLLTHSRPT  675
            +   D ++D  V+G  G +G AS     N   +EKA LARIWGNFDTKYMKPLLTHSRPT
Sbjct  547  SGGTDTNLDTPVDGTNGSLGGASGGRRRN--SHEKAILARIWGNFDTKYMKPLLTHSRPT  604

Query  676  LLETLPVCCNPVARLLTTTEQLTQDGGGLRRSDSDSDICIDDENFGASSTNGAAGGLNGG  735
            LLETLPVCCNP+ARLLTTT+QLTQDG   RR DSDSDICID++              NG 
Sbjct  605  LLETLPVCCNPIARLLTTTQQLTQDGSEFRRVDSDSDICIDNDTG------------NGL  652

Query  736  SGSGSGGSAGMGPRRNSINRQH  757
            S  GSG + G+G RRNS++R  
Sbjct  653  SQDGSGAAPGVG-RRNSLSRME  673


>B7Z029_DROME unnamed protein product
Length=681

 Score = 1001 bits (2589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 525/680 (77%), Positives = 575/680 (85%), Gaps = 27/680 (4%)

Query  86   LAALTHTANATATDIALDAKATLTHRIDSLNLLVYTFLLTLTVLTIWLFKHHRVSWLHET  145
            L  L    +AT TDIALDAKATL HRI SL+LLV+ FLL LTVLTIWLFKHHRVSWLHET
Sbjct  9    LCVLAPGCSATDTDIALDAKATLNHRIQSLDLLVFVFLLALTVLTIWLFKHHRVSWLHET  68

Query  146  GLAVIYGLIVGAVIRYAGTSTPLVHLEVDPAGDPKFNQSLPPDTLWMKFPGKLAPNTTDK  205
            GLAVIYGLIVGA+IRYAGTS  LVH++V+P G P ++  LPPDTLW ++P      T  K
Sbjct  69   GLAVIYGLIVGAIIRYAGTSATLVHMQVEPQGVPTYSDKLPPDTLWFRYPVNQTNGT--K  126

Query  206  DPIPNKTYAYVFRGIVYDVDENEIDLKATFDPEIFFNIILPPIIFHAGYSLKKKYFFRNL  265
             P   KTYAYVFRG V+DVDENEIDLKATFDPE+FFNIILPPIIF+AGYSLKKKYFFRNL
Sbjct  127  PPEGIKTYAYVFRGQVHDVDENEIDLKATFDPEVFFNIILPPIIFYAGYSLKKKYFFRNL  186

Query  266  GAILMFAILGTTLSSFLIGAIMYGCVKLMPEYLSSSFTFLDTLYFGALISPTDPLTILAI  325
            GAIL FAI+GTTLS+FLIG  MYGCVKLMP+YLSSSFTFLD+LYFGALISPTDPLTILAI
Sbjct  187  GAILTFAIVGTTLSAFLIGGFMYGCVKLMPKYLSSSFTFLDSLYFGALISPTDPLTILAI  246

Query  326  FHDLHVDVNLYALVFGESVLNDAVAIVLSGAIQNYGEHYSSTGGFETNAFFRSLSDFFCI  385
            F+DL VDVNLYALV GESVLNDAVAIVLSGAIQNYGEHYS+TG FET AF RSLSDFF I
Sbjct  247  FNDLRVDVNLYALVLGESVLNDAVAIVLSGAIQNYGEHYSNTGEFETTAFLRSLSDFFSI  306

Query  386  FMLSLLIGATMGCFTALLTKFTRVREFPLLESALFVLMSYSTFLIAEASELTGVVAVLFC  445
            F+LSL+IGA MGC TAL+TKFTRVR+FPLLESALFVLMSYSTFL+AEA+ELTGVVAVLFC
Sbjct  307  FLLSLMIGAAMGCLTALMTKFTRVRDFPLLESALFVLMSYSTFLLAEATELTGVVAVLFC  366

Query  446  GICQAHYTYNNLSENSRTRTKEIFELLNFLAENFIFSYIGVSMFTFPKHHFDAVFIITGF  505
            GICQAHYTYNNLSE+SR RTK+IFELLNFLAENFIFSYIGVSMFTFPKHHFDA FIIT F
Sbjct  367  GICQAHYTYNNLSEDSRQRTKQIFELLNFLAENFIFSYIGVSMFTFPKHHFDAGFIITAF  426

Query  506  VTAAIGRAVNIYPLSWLLNLNRKPKISSNFQHMLFFAGLRGAMSFALAIRNTVSEARQTM  565
            + AAIGRAVN+YPLSWLLN+ RKPKIS+NFQHMLFFAGLRGAMSFALAIRNTVS+ RQTM
Sbjct  427  ICAAIGRAVNVYPLSWLLNIKRKPKISTNFQHMLFFAGLRGAMSFALAIRNTVSDERQTM  486

Query  566  LTATSLIVIFTVVIQGGASNFLLNWLKIPVGVDEETEQLNNYRVRSVY-------NSMEN  618
            LTATSLIVIFTVVIQGGA+NFLLNWLKIPVGVD+ETEQLNNY+V S         N M  
Sbjct  487  LTATSLIVIFTVVIQGGAANFLLNWLKIPVGVDDETEQLNNYQVHSDVEGGGVNRNKMRL  546

Query  619  TAAADVDVD--VEGA-GGIGDASAQTAMNVKRNEKAFLARIWGNFDTKYMKPLLTHSRPT  675
            +   D ++D  V+G  G +G AS     N   +EKA LARIWGNFDTKYMKPLLTHSRPT
Sbjct  547  SGGTDTNLDTPVDGTNGSLGGASGGRRRN--SHEKAILARIWGNFDTKYMKPLLTHSRPT  604

Query  676  LLETLPVCCNPVARLLTTTEQLTQDGGGLRRSDSDSDICIDDENFGASSTNGAAGGLNGG  735
            LLETLPVCCNP+ARLLTTT+QLTQDG   RR DSDSDICID++              NG 
Sbjct  605  LLETLPVCCNPIARLLTTTQQLTQDGSEFRRVDSDSDICIDNDTG------------NGL  652

Query  736  SGSGSGGSAGMGPRRNSINR  755
            S  GSG + G+G RRNS++R
Sbjct  653  SQDGSGAAPGVG-RRNSLSR  671



Lambda      K        H
   0.323    0.137    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9813801108


Query= XP_011197164.1 sodium/hydrogen exchanger 6 isoform X11 [Bactrocera
dorsalis]

Length=786
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9PB53_DROME  unnamed protein product                                 1012    0.0  
Q9VM99_DROME  unnamed protein product                                 1010    0.0  
Q8IPJ4_DROME  unnamed protein product                                 1004    0.0  


>M9PB53_DROME unnamed protein product
Length=682

 Score = 1012 bits (2616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 529/686 (77%), Positives = 576/686 (84%), Gaps = 38/686 (6%)

Query  86   LAALTHTANATATDIALDAKATLTHRIDSLNLLVYTFLLTLTVLTIWLFKHHRVSWLHET  145
            L  L    +AT TDIALDAKATL HRI SL+LLV+ FLL LTVLTIWLFKHHRVSWLHET
Sbjct  9    LCVLAPGCSATDTDIALDAKATLNHRIQSLDLLVFVFLLALTVLTIWLFKHHRVSWLHET  68

Query  146  GLAVIYGLIVGAVIRYAGTSTPLVHLEVDPAGDPKFNQSLPPDTLWMKFPGKLAPNTTDK  205
            GLAVIYGLIVGA+IRYAGTS  LVH++V+P G P ++  LPPDTLW ++P      T  K
Sbjct  69   GLAVIYGLIVGAIIRYAGTSATLVHMQVEPQGVPTYSDKLPPDTLWFRYPVNQTNGT--K  126

Query  206  DPIPNKTYAYVFRGIVYDVDENEIDLKATFDPEIFFNIILPPIIFHAGYSLKKKYFFRNL  265
             P   KTYAYVFRG V+DVDENEIDLKATFDPE+FFNIILPPIIF+AGYSLKKKYFFRNL
Sbjct  127  PPEGIKTYAYVFRGQVHDVDENEIDLKATFDPEVFFNIILPPIIFYAGYSLKKKYFFRNL  186

Query  266  GAILMFAILGTTLSSFLIGAIMYGCVKLMPEYLSSSFTFLDTLYFGALISPTDPLTILAI  325
            GAIL FAI+GTTLS+FLIG  MYGCVKLMP+YLSSSFTFLD+LYFGALISPTDPLTILAI
Sbjct  187  GAILTFAIVGTTLSAFLIGGFMYGCVKLMPKYLSSSFTFLDSLYFGALISPTDPLTILAI  246

Query  326  FHDLHVDVNLYALVFGESVLNDAVAIVLSGAIQNYGEHYSSTGGFETNAFFRSLSDFFCI  385
            F+DL VDVNLYALV GESVLNDAVAIVLSGAIQNYGEHYS+TG FET AF RSLSDFF I
Sbjct  247  FNDLRVDVNLYALVLGESVLNDAVAIVLSGAIQNYGEHYSNTGEFETTAFLRSLSDFFSI  306

Query  386  FMLSLLIGATMGCFTALLTKFTRVREFPLLESALFVLMSYSTFLIAEASELTGVVAVLFC  445
            F+LSL+IGA MGC TAL+TKFTRVR+FPLLESALFVLMSYSTFL+AEA+ELTGVVAVLFC
Sbjct  307  FLLSLMIGAAMGCLTALMTKFTRVRDFPLLESALFVLMSYSTFLLAEATELTGVVAVLFC  366

Query  446  GICQAHYTYNNLSENSRTRTKEIFELLNFLAENFIFSYIGVSMFTFPKHHFDAVFIITGF  505
            GICQAHYTYNNLSE+SR RTK+IFELLNFLAENFIFSYIGVSMFTFPKHHFDA FIIT F
Sbjct  367  GICQAHYTYNNLSEDSRQRTKQIFELLNFLAENFIFSYIGVSMFTFPKHHFDAGFIITAF  426

Query  506  VTAAIGRAVNIYPLSWLLNLNRKPKISSNFQHMLFFAGLRGAMSFALAIRNTVSEARQTM  565
            + AAIGRAVN+YPLSWLLN+ RKPKIS+NFQHMLFFAGLRGAMSFALAIRNTVS+ RQTM
Sbjct  427  ICAAIGRAVNVYPLSWLLNIKRKPKISTNFQHMLFFAGLRGAMSFALAIRNTVSDERQTM  486

Query  566  LTATSLIVIFTVVIQGGASNFLLNWLKIPVGVDEETEQLNNYRVRSSDAYLQDV------  619
            LTATSLIVIFTVVIQGGA+NFLLNWLKIPVGVD+ETEQLNNY+V SSD YLQDV      
Sbjct  487  LTATSLIVIFTVVIQGGAANFLLNWLKIPVGVDDETEQLNNYQVHSSDGYLQDVEGGGVN  546

Query  620  --------------DVDVEGA-GGIGDASAQTAMNVKRNEKAFLARIWGNFDTKYMKPLL  664
                          D  V+G  G +G AS     N   +EKA LARIWGNFDTKYMKPLL
Sbjct  547  RNKMRLSGGTDTNLDTPVDGTNGSLGGASGGRRRN--SHEKAILARIWGNFDTKYMKPLL  604

Query  665  THSRPTLLETLPVCCNPVARLLTTTEQLTQDGGGLRRSDSDSDICIDDENFGASSTNGAA  724
            THSRPTLLETLPVCCNP+ARLLTTT+QLTQDG   RR DSDSDICID++           
Sbjct  605  THSRPTLLETLPVCCNPIARLLTTTQQLTQDGSEFRRVDSDSDICIDNDTG---------  655

Query  725  GGLNGGSGSGSGGSAGMGPRRNSINR  750
               NG S  GSG + G+G RRNS++R
Sbjct  656  ---NGLSQDGSGAAPGVG-RRNSLSR  677


>Q9VM99_DROME unnamed protein product
Length=687

 Score = 1010 bits (2612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 529/686 (77%), Positives = 576/686 (84%), Gaps = 38/686 (6%)

Query  86   LAALTHTANATATDIALDAKATLTHRIDSLNLLVYTFLLTLTVLTIWLFKHHRVSWLHET  145
            L  L    +AT TDIALDAKATL HRI SL+LLV+ FLL LTVLTIWLFKHHRVSWLHET
Sbjct  9    LCVLAPGCSATDTDIALDAKATLNHRIQSLDLLVFVFLLALTVLTIWLFKHHRVSWLHET  68

Query  146  GLAVIYGLIVGAVIRYAGTSTPLVHLEVDPAGDPKFNQSLPPDTLWMKFPGKLAPNTTDK  205
            GLAVIYGLIVGA+IRYAGTS  LVH++V+P G P ++  LPPDTLW ++P      T  K
Sbjct  69   GLAVIYGLIVGAIIRYAGTSATLVHMQVEPQGVPTYSDKLPPDTLWFRYPVNQTNGT--K  126

Query  206  DPIPNKTYAYVFRGIVYDVDENEIDLKATFDPEIFFNIILPPIIFHAGYSLKKKYFFRNL  265
             P   KTYAYVFRG V+DVDENEIDLKATFDPE+FFNIILPPIIF+AGYSLKKKYFFRNL
Sbjct  127  PPEGIKTYAYVFRGQVHDVDENEIDLKATFDPEVFFNIILPPIIFYAGYSLKKKYFFRNL  186

Query  266  GAILMFAILGTTLSSFLIGAIMYGCVKLMPEYLSSSFTFLDTLYFGALISPTDPLTILAI  325
            GAIL FAI+GTTLS+FLIG  MYGCVKLMP+YLSSSFTFLD+LYFGALISPTDPLTILAI
Sbjct  187  GAILTFAIVGTTLSAFLIGGFMYGCVKLMPKYLSSSFTFLDSLYFGALISPTDPLTILAI  246

Query  326  FHDLHVDVNLYALVFGESVLNDAVAIVLSGAIQNYGEHYSSTGGFETNAFFRSLSDFFCI  385
            F+DL VDVNLYALV GESVLNDAVAIVLSGAIQNYGEHYS+TG FET AF RSLSDFF I
Sbjct  247  FNDLRVDVNLYALVLGESVLNDAVAIVLSGAIQNYGEHYSNTGEFETTAFLRSLSDFFSI  306

Query  386  FMLSLLIGATMGCFTALLTKFTRVREFPLLESALFVLMSYSTFLIAEASELTGVVAVLFC  445
            F+LSL+IGA MGC TAL+TKFTRVR+FPLLESALFVLMSYSTFL+AEA+ELTGVVAVLFC
Sbjct  307  FLLSLMIGAAMGCLTALMTKFTRVRDFPLLESALFVLMSYSTFLLAEATELTGVVAVLFC  366

Query  446  GICQAHYTYNNLSENSRTRTKEIFELLNFLAENFIFSYIGVSMFTFPKHHFDAVFIITGF  505
            GICQAHYTYNNLSE+SR RTK+IFELLNFLAENFIFSYIGVSMFTFPKHHFDA FIIT F
Sbjct  367  GICQAHYTYNNLSEDSRQRTKQIFELLNFLAENFIFSYIGVSMFTFPKHHFDAGFIITAF  426

Query  506  VTAAIGRAVNIYPLSWLLNLNRKPKISSNFQHMLFFAGLRGAMSFALAIRNTVSEARQTM  565
            + AAIGRAVN+YPLSWLLN+ RKPKIS+NFQHMLFFAGLRGAMSFALAIRNTVS+ RQTM
Sbjct  427  ICAAIGRAVNVYPLSWLLNIKRKPKISTNFQHMLFFAGLRGAMSFALAIRNTVSDERQTM  486

Query  566  LTATSLIVIFTVVIQGGASNFLLNWLKIPVGVDEETEQLNNYRVRSSDAYLQDV------  619
            LTATSLIVIFTVVIQGGA+NFLLNWLKIPVGVD+ETEQLNNY+V SSD YLQDV      
Sbjct  487  LTATSLIVIFTVVIQGGAANFLLNWLKIPVGVDDETEQLNNYQVHSSDGYLQDVEGGGVN  546

Query  620  --------------DVDVEGA-GGIGDASAQTAMNVKRNEKAFLARIWGNFDTKYMKPLL  664
                          D  V+G  G +G AS     N   +EKA LARIWGNFDTKYMKPLL
Sbjct  547  RNKMRLSGGTDTNLDTPVDGTNGSLGGASGGRRRN--SHEKAILARIWGNFDTKYMKPLL  604

Query  665  THSRPTLLETLPVCCNPVARLLTTTEQLTQDGGGLRRSDSDSDICIDDENFGASSTNGAA  724
            THSRPTLLETLPVCCNP+ARLLTTT+QLTQDG   RR DSDSDICID++           
Sbjct  605  THSRPTLLETLPVCCNPIARLLTTTQQLTQDGSEFRRVDSDSDICIDNDTG---------  655

Query  725  GGLNGGSGSGSGGSAGMGPRRNSINR  750
               NG S  GSG + G+G RRNS++R
Sbjct  656  ---NGLSQDGSGAAPGVG-RRNSLSR  677


>Q8IPJ4_DROME unnamed protein product
Length=711

 Score = 1004 bits (2595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 530/701 (76%), Positives = 577/701 (82%), Gaps = 50/701 (7%)

Query  86   LAALTHTANATATDIALDAKATLTHRIDSLNLLVYTFLLTLTVLTIWLFKHHRVSWLHET  145
            L  L    +AT TDIALDAKATL HRI SL+LLV+ FLL LTVLTIWLFKHHRVSWLHET
Sbjct  9    LCVLAPGCSATDTDIALDAKATLNHRIQSLDLLVFVFLLALTVLTIWLFKHHRVSWLHET  68

Query  146  GLAVIYGLIVGAVIRYAGTSTPLVHLEVDPAGDPKFNQSLPPDTLWMKFPGKLAPNTTDK  205
            GLAVIYGLIVGA+IRYAGTS  LVH++V+P G P ++  LPPDTLW ++P      T  K
Sbjct  69   GLAVIYGLIVGAIIRYAGTSATLVHMQVEPQGVPTYSDKLPPDTLWFRYPVNQTNGT--K  126

Query  206  DPIPNKTYAYVFRGIVYDVDENEIDLKATFDPEIFFNIILPPIIFHAGYSLKKKYFFRNL  265
             P   KTYAYVFRG V+DVDENEIDLKATFDPE+FFNIILPPIIF+AGYSLKKKYFFRNL
Sbjct  127  PPEGIKTYAYVFRGQVHDVDENEIDLKATFDPEVFFNIILPPIIFYAGYSLKKKYFFRNL  186

Query  266  GAILMFAILGTTLSSFLIGAIMYGCVKLMPEYLSSSFTFLDTLYFGALISPTDPLTILAI  325
            GAIL FAI+GTTLS+FLIG  MYGCVKLMP+YLSSSFTFLD+LYFGALISPTDPLTILAI
Sbjct  187  GAILTFAIVGTTLSAFLIGGFMYGCVKLMPKYLSSSFTFLDSLYFGALISPTDPLTILAI  246

Query  326  FHDLHVDVNLYALVFGESVLNDAVAIVLSGAIQNYGEHYSSTGGFETNAFFRSLSDFFCI  385
            F+DL VDVNLYALV GESVLNDAVAIVLSGAIQNYGEHYS+TG FET AF RSLSDFF I
Sbjct  247  FNDLRVDVNLYALVLGESVLNDAVAIVLSGAIQNYGEHYSNTGEFETTAFLRSLSDFFSI  306

Query  386  FMLSLLIGATMGCFTALLTKFTRVREFPLLESALFVLMSYSTFLIAEASELTGVVAVLFC  445
            F+LSL+IGA MGC TAL+TKFTRVR+FPLLESALFVLMSYSTFL+AEA+ELTGVVAVLFC
Sbjct  307  FLLSLMIGAAMGCLTALMTKFTRVRDFPLLESALFVLMSYSTFLLAEATELTGVVAVLFC  366

Query  446  GICQAHYTYNNLSENSRTRTKEIFELLNFLAENFIFSYIGVSMFTFPKHHFDAVFIITGF  505
            GICQAHYTYNNLSE+SR RTK+IFELLNFLAENFIFSYIGVSMFTFPKHHFDA FIIT F
Sbjct  367  GICQAHYTYNNLSEDSRQRTKQIFELLNFLAENFIFSYIGVSMFTFPKHHFDAGFIITAF  426

Query  506  VTAAIGRAVNIYPLSWLLNLNRKPKISSNFQHMLFFAGLRGAMSFALAIRNTVSEARQTM  565
            + AAIGRAVN+YPLSWLLN+ RKPKIS+NFQHMLFFAGLRGAMSFALAIRNTVS+ RQTM
Sbjct  427  ICAAIGRAVNVYPLSWLLNIKRKPKISTNFQHMLFFAGLRGAMSFALAIRNTVSDERQTM  486

Query  566  LTATSLIVIFTVVIQGGASNFLLNWLKIPVGVDEETEQLNNYRVRS------------SD  613
            LTATSLIVIFTVVIQGGA+NFLLNWLKIPVGVD+ETEQLNNY+V S            SD
Sbjct  487  LTATSLIVIFTVVIQGGAANFLLNWLKIPVGVDDETEQLNNYQVHSVYNSMDNSHPQTSD  546

Query  614  AYLQDV--------------------DVDVEGA-GGIGDASAQTAMNVKRNEKAFLARIW  652
             YLQDV                    D  V+G  G +G AS     N   +EKA LARIW
Sbjct  547  GYLQDVEGGGVNRNKMRLSGGTDTNLDTPVDGTNGSLGGASGGRRRN--SHEKAILARIW  604

Query  653  GNFDTKYMKPLLTHSRPTLLETLPVCCNPVARLLTTTEQLTQDGGGLRRSDSDSDICIDD  712
            GNFDTKYMKPLLTHSRPTLLETLPVCCNP+ARLLTTT+QLTQDG   RR DSDSDICID+
Sbjct  605  GNFDTKYMKPLLTHSRPTLLETLPVCCNPIARLLTTTQQLTQDGSEFRRVDSDSDICIDN  664

Query  713  ENFGASSTNGAAGGLNGGSGSGSGGSAGMGPRRNSINRQHH  753
            +              NG S  GSG + G+G RRNS++R  H
Sbjct  665  DTG------------NGLSQDGSGAAPGVG-RRNSLSRSVH  692



Lambda      K        H
   0.323    0.137    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9813801108


Query= XP_011197165.1 sodium/hydrogen exchanger 6 isoform X13 [Bactrocera
dorsalis]

Length=780
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A8DYW5_DROME  unnamed protein product                                 1000    0.0  
B7Z029_DROME  unnamed protein product                                 999     0.0  
M9PB53_DROME  unnamed protein product                                 995     0.0  


>A8DYW5_DROME unnamed protein product
Length=696

 Score = 1000 bits (2585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 524/682 (77%), Positives = 571/682 (84%), Gaps = 38/682 (6%)

Query  86   LAALTHTANATATDIALDAKATLTHRIDSLNLLVYTFLLTLTVLTIWLFKHHRVSWLHET  145
            L  L    +AT TDIALDAKATL HRI SL+LLV+ FLL LTVLTIWLFKHHRVSWLHET
Sbjct  9    LCVLAPGCSATDTDIALDAKATLNHRIQSLDLLVFVFLLALTVLTIWLFKHHRVSWLHET  68

Query  146  GLAVIYGLIVGAVIRYAGTSTPLVHLEVDPAGDPKFNQSLPPDTLWMKFPGKLAPNTTDK  205
            GLAVIYGLIVGA+IRYAGTS  LVH++V+P G P ++  LPPDTLW ++P      T  K
Sbjct  69   GLAVIYGLIVGAIIRYAGTSATLVHMQVEPQGVPTYSDKLPPDTLWFRYPVNQTNGT--K  126

Query  206  DPIPNKTYAYVFRGIVYDVDENEIDLKATFDPEIFFNIILPPIIFHAGYSLKKKYFFRNL  265
             P   KTYAYVFRG V+DVDENEIDLKATFDPE+FFNIILPPIIF+AGYSLKKKYFFRNL
Sbjct  127  PPEGIKTYAYVFRGQVHDVDENEIDLKATFDPEVFFNIILPPIIFYAGYSLKKKYFFRNL  186

Query  266  GAILMFAILGTTLSSFLIGAIMYGCVKLMPEYLSSSFTFLDTLYFGALISPTDPLTILAI  325
            GAIL FAI+GTTLS+FLIG  MYGCVKLMP+YLSSSFTFLD+LYFGALISPTDPLTILAI
Sbjct  187  GAILTFAIVGTTLSAFLIGGFMYGCVKLMPKYLSSSFTFLDSLYFGALISPTDPLTILAI  246

Query  326  FHDLHVDVNLYALVFGESVLNDAVAIVLSGAIQNYGEHYSSTGGFETNAFFRSLSDFFCI  385
            F+DL VDVNLYALV GESVLNDAVAIVLSGAIQNYGEHYS+TG FET AF RSLSDFF I
Sbjct  247  FNDLRVDVNLYALVLGESVLNDAVAIVLSGAIQNYGEHYSNTGEFETTAFLRSLSDFFSI  306

Query  386  FMLSLLIGATMGCFTALLTKFTRVREFPLLESALFVLMSYSTFLIAEASELTGVVAVLFC  445
            F+LSL+IGA MGC TAL+TKFTRVR+FPLLESALFVLMSYSTFL+AEA+ELTGVVAVLFC
Sbjct  307  FLLSLMIGAAMGCLTALMTKFTRVRDFPLLESALFVLMSYSTFLLAEATELTGVVAVLFC  366

Query  446  GICQAHYTYNNLSENSRTRTKEIFELLNFLAENFIFSYIGVSMFTFPKHHFDAVFIITGF  505
            GICQAHYTYNNLSE+SR RTK+IFELLNFLAENFIFSYIGVSMFTFPKHHFDA FIIT F
Sbjct  367  GICQAHYTYNNLSEDSRQRTKQIFELLNFLAENFIFSYIGVSMFTFPKHHFDAGFIITAF  426

Query  506  VTAAIGRAVNIYPLSWLLNLNRKPKISSNFQHMLFFAGLRGAMSFALAIRNTVSEARQTM  565
            + AAIGRAVN+YPLSWLLN+ RKPKIS+NFQHMLFFAGLRGAMSFALAIRNTVS+ RQTM
Sbjct  427  ICAAIGRAVNVYPLSWLLNIKRKPKISTNFQHMLFFAGLRGAMSFALAIRNTVSDERQTM  486

Query  566  LTATSLIVIFTVVIQGGASNFLLNWLKIPVGVDEETEQLNNYRVRSDV------------  613
            LTATSLIVIFTVVIQGGA+NFLLNWLKIPVGVD+ETEQLNNY+V SDV            
Sbjct  487  LTATSLIVIFTVVIQGGAANFLLNWLKIPVGVDDETEQLNNYQVHSDVEGGGVNRNKMRL  546

Query  614  --------DVDVEGA-GGIGDASAQTAMNVKRNEKAFLARIWGNFDTKYMKPLLTHSRPT  664
                    D  V+G  G +G AS     N   +EKA LARIWGNFDTKYMKPLLTHSRPT
Sbjct  547  SGGTDTNLDTPVDGTNGSLGGASGGRRRN--SHEKAILARIWGNFDTKYMKPLLTHSRPT  604

Query  665  LLETLPVCCNPVARLLTTTEQLTQDGGGLRRSDSDSDICIDDENFGASSTNGAAGGLNGG  724
            LLETLPVCCNP+ARLLTTT+QLTQDG   RR DSDSDICID++              NG 
Sbjct  605  LLETLPVCCNPIARLLTTTQQLTQDGSEFRRVDSDSDICIDNDTG------------NGL  652

Query  725  SGSGSGGSAGMGPRRNSINRQH  746
            S  GSG + G+G RRNS++R  
Sbjct  653  SQDGSGAAPGVG-RRNSLSRME  673


>B7Z029_DROME unnamed protein product
Length=681

 Score = 999 bits (2584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 524/680 (77%), Positives = 571/680 (84%), Gaps = 38/680 (6%)

Query  86   LAALTHTANATATDIALDAKATLTHRIDSLNLLVYTFLLTLTVLTIWLFKHHRVSWLHET  145
            L  L    +AT TDIALDAKATL HRI SL+LLV+ FLL LTVLTIWLFKHHRVSWLHET
Sbjct  9    LCVLAPGCSATDTDIALDAKATLNHRIQSLDLLVFVFLLALTVLTIWLFKHHRVSWLHET  68

Query  146  GLAVIYGLIVGAVIRYAGTSTPLVHLEVDPAGDPKFNQSLPPDTLWMKFPGKLAPNTTDK  205
            GLAVIYGLIVGA+IRYAGTS  LVH++V+P G P ++  LPPDTLW ++P      T  K
Sbjct  69   GLAVIYGLIVGAIIRYAGTSATLVHMQVEPQGVPTYSDKLPPDTLWFRYPVNQTNGT--K  126

Query  206  DPIPNKTYAYVFRGIVYDVDENEIDLKATFDPEIFFNIILPPIIFHAGYSLKKKYFFRNL  265
             P   KTYAYVFRG V+DVDENEIDLKATFDPE+FFNIILPPIIF+AGYSLKKKYFFRNL
Sbjct  127  PPEGIKTYAYVFRGQVHDVDENEIDLKATFDPEVFFNIILPPIIFYAGYSLKKKYFFRNL  186

Query  266  GAILMFAILGTTLSSFLIGAIMYGCVKLMPEYLSSSFTFLDTLYFGALISPTDPLTILAI  325
            GAIL FAI+GTTLS+FLIG  MYGCVKLMP+YLSSSFTFLD+LYFGALISPTDPLTILAI
Sbjct  187  GAILTFAIVGTTLSAFLIGGFMYGCVKLMPKYLSSSFTFLDSLYFGALISPTDPLTILAI  246

Query  326  FHDLHVDVNLYALVFGESVLNDAVAIVLSGAIQNYGEHYSSTGGFETNAFFRSLSDFFCI  385
            F+DL VDVNLYALV GESVLNDAVAIVLSGAIQNYGEHYS+TG FET AF RSLSDFF I
Sbjct  247  FNDLRVDVNLYALVLGESVLNDAVAIVLSGAIQNYGEHYSNTGEFETTAFLRSLSDFFSI  306

Query  386  FMLSLLIGATMGCFTALLTKFTRVREFPLLESALFVLMSYSTFLIAEASELTGVVAVLFC  445
            F+LSL+IGA MGC TAL+TKFTRVR+FPLLESALFVLMSYSTFL+AEA+ELTGVVAVLFC
Sbjct  307  FLLSLMIGAAMGCLTALMTKFTRVRDFPLLESALFVLMSYSTFLLAEATELTGVVAVLFC  366

Query  446  GICQAHYTYNNLSENSRTRTKEIFELLNFLAENFIFSYIGVSMFTFPKHHFDAVFIITGF  505
            GICQAHYTYNNLSE+SR RTK+IFELLNFLAENFIFSYIGVSMFTFPKHHFDA FIIT F
Sbjct  367  GICQAHYTYNNLSEDSRQRTKQIFELLNFLAENFIFSYIGVSMFTFPKHHFDAGFIITAF  426

Query  506  VTAAIGRAVNIYPLSWLLNLNRKPKISSNFQHMLFFAGLRGAMSFALAIRNTVSEARQTM  565
            + AAIGRAVN+YPLSWLLN+ RKPKIS+NFQHMLFFAGLRGAMSFALAIRNTVS+ RQTM
Sbjct  427  ICAAIGRAVNVYPLSWLLNIKRKPKISTNFQHMLFFAGLRGAMSFALAIRNTVSDERQTM  486

Query  566  LTATSLIVIFTVVIQGGASNFLLNWLKIPVGVDEETEQLNNYRVRSDV------------  613
            LTATSLIVIFTVVIQGGA+NFLLNWLKIPVGVD+ETEQLNNY+V SDV            
Sbjct  487  LTATSLIVIFTVVIQGGAANFLLNWLKIPVGVDDETEQLNNYQVHSDVEGGGVNRNKMRL  546

Query  614  --------DVDVEGA-GGIGDASAQTAMNVKRNEKAFLARIWGNFDTKYMKPLLTHSRPT  664
                    D  V+G  G +G AS     N   +EKA LARIWGNFDTKYMKPLLTHSRPT
Sbjct  547  SGGTDTNLDTPVDGTNGSLGGASGGRRRN--SHEKAILARIWGNFDTKYMKPLLTHSRPT  604

Query  665  LLETLPVCCNPVARLLTTTEQLTQDGGGLRRSDSDSDICIDDENFGASSTNGAAGGLNGG  724
            LLETLPVCCNP+ARLLTTT+QLTQDG   RR DSDSDICID++              NG 
Sbjct  605  LLETLPVCCNPIARLLTTTQQLTQDGSEFRRVDSDSDICIDNDTG------------NGL  652

Query  725  SGSGSGGSAGMGPRRNSINR  744
            S  GSG + G+G RRNS++R
Sbjct  653  SQDGSGAAPGVG-RRNSLSR  671


>M9PB53_DROME unnamed protein product
Length=682

 Score = 995 bits (2572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 524/684 (77%), Positives = 572/684 (84%), Gaps = 40/684 (6%)

Query  86   LAALTHTANATATDIALDAKATLTHRIDSLNLLVYTFLLTLTVLTIWLFKHHRVSWLHET  145
            L  L    +AT TDIALDAKATL HRI SL+LLV+ FLL LTVLTIWLFKHHRVSWLHET
Sbjct  9    LCVLAPGCSATDTDIALDAKATLNHRIQSLDLLVFVFLLALTVLTIWLFKHHRVSWLHET  68

Query  146  GLAVIYGLIVGAVIRYAGTSTPLVHLEVDPAGDPKFNQSLPPDTLWMKFPGKLAPNTTDK  205
            GLAVIYGLIVGA+IRYAGTS  LVH++V+P G P ++  LPPDTLW ++P      T  K
Sbjct  69   GLAVIYGLIVGAIIRYAGTSATLVHMQVEPQGVPTYSDKLPPDTLWFRYPVNQTNGT--K  126

Query  206  DPIPNKTYAYVFRGIVYDVDENEIDLKATFDPEIFFNIILPPIIFHAGYSLKKKYFFRNL  265
             P   KTYAYVFRG V+DVDENEIDLKATFDPE+FFNIILPPIIF+AGYSLKKKYFFRNL
Sbjct  127  PPEGIKTYAYVFRGQVHDVDENEIDLKATFDPEVFFNIILPPIIFYAGYSLKKKYFFRNL  186

Query  266  GAILMFAILGTTLSSFLIGAIMYGCVKLMPEYLSSSFTFLDTLYFGALISPTDPLTILAI  325
            GAIL FAI+GTTLS+FLIG  MYGCVKLMP+YLSSSFTFLD+LYFGALISPTDPLTILAI
Sbjct  187  GAILTFAIVGTTLSAFLIGGFMYGCVKLMPKYLSSSFTFLDSLYFGALISPTDPLTILAI  246

Query  326  FHDLHVDVNLYALVFGESVLNDAVAIVLSGAIQNYGEHYSSTGGFETNAFFRSLSDFFCI  385
            F+DL VDVNLYALV GESVLNDAVAIVLSGAIQNYGEHYS+TG FET AF RSLSDFF I
Sbjct  247  FNDLRVDVNLYALVLGESVLNDAVAIVLSGAIQNYGEHYSNTGEFETTAFLRSLSDFFSI  306

Query  386  FMLSLLIGATMGCFTALLTKFTRVREFPLLESALFVLMSYSTFLIAEASELTGVVAVLFC  445
            F+LSL+IGA MGC TAL+TKFTRVR+FPLLESALFVLMSYSTFL+AEA+ELTGVVAVLFC
Sbjct  307  FLLSLMIGAAMGCLTALMTKFTRVRDFPLLESALFVLMSYSTFLLAEATELTGVVAVLFC  366

Query  446  GICQAHYTYNNLSENSRTRTKEIFELLNFLAENFIFSYIGVSMFTFPKHHFDAVFIITGF  505
            GICQAHYTYNNLSE+SR RTK+IFELLNFLAENFIFSYIGVSMFTFPKHHFDA FIIT F
Sbjct  367  GICQAHYTYNNLSEDSRQRTKQIFELLNFLAENFIFSYIGVSMFTFPKHHFDAGFIITAF  426

Query  506  VTAAIGRAVNIYPLSWLLNLNRKPKISSNFQHMLFFAGLRGAMSFALAIRNTVSEARQTM  565
            + AAIGRAVN+YPLSWLLN+ RKPKIS+NFQHMLFFAGLRGAMSFALAIRNTVS+ RQTM
Sbjct  427  ICAAIGRAVNVYPLSWLLNIKRKPKISTNFQHMLFFAGLRGAMSFALAIRNTVSDERQTM  486

Query  566  LTATSLIVIFTVVIQGGASNFLLNWLKIPVGVDEETEQLNNYRVRSDVDV--DVEGAG--  621
            LTATSLIVIFTVVIQGGA+NFLLNWLKIPVGVD+ETEQLNNY+V S      DVEG G  
Sbjct  487  LTATSLIVIFTVVIQGGAANFLLNWLKIPVGVDDETEQLNNYQVHSSDGYLQDVEGGGVN  546

Query  622  -------GIGDASAQTAMN------------VKRN--EKAFLARIWGNFDTKYMKPLLTH  660
                   G  D +  T ++             +RN  EKA LARIWGNFDTKYMKPLLTH
Sbjct  547  RNKMRLSGGTDTNLDTPVDGTNGSLGGASGGRRRNSHEKAILARIWGNFDTKYMKPLLTH  606

Query  661  SRPTLLETLPVCCNPVARLLTTTEQLTQDGGGLRRSDSDSDICIDDENFGASSTNGAAGG  720
            SRPTLLETLPVCCNP+ARLLTTT+QLTQDG   RR DSDSDICID++             
Sbjct  607  SRPTLLETLPVCCNPIARLLTTTQQLTQDGSEFRRVDSDSDICIDNDTG-----------  655

Query  721  LNGGSGSGSGGSAGMGPRRNSINR  744
             NG S  GSG + G+G RRNS++R
Sbjct  656  -NGLSQDGSGAAPGVG-RRNSLSR  677



Lambda      K        H
   0.323    0.137    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9813801108


Query= XP_011197166.1 sodium/hydrogen exchanger 6 isoform X14 [Bactrocera
dorsalis]

Length=735
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8IPJ4_DROME  unnamed protein product                                 984     0.0  
M9PB53_DROME  unnamed protein product                                 969     0.0  
Q9VM99_DROME  unnamed protein product                                 968     0.0  


>Q8IPJ4_DROME unnamed protein product
Length=711

 Score = 984 bits (2544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 498/632 (79%), Positives = 548/632 (87%), Gaps = 6/632 (1%)

Query  86   LAALTHTANATATDIALDAKATLTHRIDSLNLLVYTFLLTLTVLTIWLFKHHRVSWLHET  145
            L  L    +AT TDIALDAKATL HRI SL+LLV+ FLL LTVLTIWLFKHHRVSWLHET
Sbjct  9    LCVLAPGCSATDTDIALDAKATLNHRIQSLDLLVFVFLLALTVLTIWLFKHHRVSWLHET  68

Query  146  GLAVIYGLIVGAVIRYAGTSTPLVHLEVDPAGDPKFNQSLPPDTLWMKFPGKLAPNTTDK  205
            GLAVIYGLIVGA+IRYAGTS  LVH++V+P G P ++  LPPDTLW ++P      T  K
Sbjct  69   GLAVIYGLIVGAIIRYAGTSATLVHMQVEPQGVPTYSDKLPPDTLWFRYPVNQTNGT--K  126

Query  206  DPIPNKTYAYVFRGIVYDVDENEIDLKATFDPEIFFNIILPPIIFHAGYSLKKKYFFRNL  265
             P   KTYAYVFRG V+DVDENEIDLKATFDPE+FFNIILPPIIF+AGYSLKKKYFFRNL
Sbjct  127  PPEGIKTYAYVFRGQVHDVDENEIDLKATFDPEVFFNIILPPIIFYAGYSLKKKYFFRNL  186

Query  266  GAILMFAILGTTLSSFLIGAIMYGCVKLMPEYLSSSFTFLDTLYFGALISPTDPLTILAI  325
            GAIL FAI+GTTLS+FLIG  MYGCVKLMP+YLSSSFTFLD+LYFGALISPTDPLTILAI
Sbjct  187  GAILTFAIVGTTLSAFLIGGFMYGCVKLMPKYLSSSFTFLDSLYFGALISPTDPLTILAI  246

Query  326  FHDLHVDVNLYALVFGESVLNDAVAIVLSGAIQNYGEHYSSTGGFETNAFFRSLSDFFCI  385
            F+DL VDVNLYALV GESVLNDAVAIVLSGAIQNYGEHYS+TG FET AF RSLSDFF I
Sbjct  247  FNDLRVDVNLYALVLGESVLNDAVAIVLSGAIQNYGEHYSNTGEFETTAFLRSLSDFFSI  306

Query  386  FMLSLLIGATMGCFTALLTKFTRVREFPLLESALFVLMSYSTFLIAEASELTGVVAVLFC  445
            F+LSL+IGA MGC TAL+TKFTRVR+FPLLESALFVLMSYSTFL+AEA+ELTGVVAVLFC
Sbjct  307  FLLSLMIGAAMGCLTALMTKFTRVRDFPLLESALFVLMSYSTFLLAEATELTGVVAVLFC  366

Query  446  GICQAHYTYNNLSENSRTRTKEIFELLNFLAENFIFSYIGVSMFTFPKHHFDAVFIITGF  505
            GICQAHYTYNNLSE+SR RTK+IFELLNFLAENFIFSYIGVSMFTFPKHHFDA FIIT F
Sbjct  367  GICQAHYTYNNLSEDSRQRTKQIFELLNFLAENFIFSYIGVSMFTFPKHHFDAGFIITAF  426

Query  506  VTAAIGRAVNIYPLSWLLNLNRKPKISSNFQHMLFFAGLRGAMSFALAIRNTVSEARQTM  565
            + AAIGRAVN+YPLSWLLN+ RKPKIS+NFQHMLFFAGLRGAMSFALAIRNTVS+ RQTM
Sbjct  427  ICAAIGRAVNVYPLSWLLNIKRKPKISTNFQHMLFFAGLRGAMSFALAIRNTVSDERQTM  486

Query  566  LTATSLIVIFTVVIQGGASNFLLNWLKIPVGVDEETEQLNNYRVRSVYNSMENTAAASID  625
            LTATSLIVIFTVVIQGGA+NFLLNWLKIPVGVD+ETEQLNNY+V SVYNSM+N+   + D
Sbjct  487  LTATSLIVIFTVVIQGGAANFLLNWLKIPVGVDDETEQLNNYQVHSVYNSMDNSHPQTSD  546

Query  626  TGL-NLGQLPMSRRRSSLSDAYLQDVDVDVEGA-GGIGDASAQTAMNVKRNEKAFLARIW  683
              L ++    ++R +  LS     ++D  V+G  G +G AS     N   +EKA LARIW
Sbjct  547  GYLQDVEGGGVNRNKMRLSGGTDTNLDTPVDGTNGSLGGASGGRRRN--SHEKAILARIW  604

Query  684  GNFDTKYMKPLLTHSRPTLLETLPVCCNPVAR  715
            GNFDTKYMKPLLTHSRPTLLETLPVCCNP+AR
Sbjct  605  GNFDTKYMKPLLTHSRPTLLETLPVCCNPIAR  636


>M9PB53_DROME unnamed protein product
Length=682

 Score = 969 bits (2505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/631 (78%), Positives = 538/631 (85%), Gaps = 16/631 (3%)

Query  86   LAALTHTANATATDIALDAKATLTHRIDSLNLLVYTFLLTLTVLTIWLFKHHRVSWLHET  145
            L  L    +AT TDIALDAKATL HRI SL+LLV+ FLL LTVLTIWLFKHHRVSWLHET
Sbjct  9    LCVLAPGCSATDTDIALDAKATLNHRIQSLDLLVFVFLLALTVLTIWLFKHHRVSWLHET  68

Query  146  GLAVIYGLIVGAVIRYAGTSTPLVHLEVDPAGDPKFNQSLPPDTLWMKFPGKLAPNTTDK  205
            GLAVIYGLIVGA+IRYAGTS  LVH++V+P G P ++  LPPDTLW ++P      T  K
Sbjct  69   GLAVIYGLIVGAIIRYAGTSATLVHMQVEPQGVPTYSDKLPPDTLWFRYPVNQTNGT--K  126

Query  206  DPIPNKTYAYVFRGIVYDVDENEIDLKATFDPEIFFNIILPPIIFHAGYSLKKKYFFRNL  265
             P   KTYAYVFRG V+DVDENEIDLKATFDPE+FFNIILPPIIF+AGYSLKKKYFFRNL
Sbjct  127  PPEGIKTYAYVFRGQVHDVDENEIDLKATFDPEVFFNIILPPIIFYAGYSLKKKYFFRNL  186

Query  266  GAILMFAILGTTLSSFLIGAIMYGCVKLMPEYLSSSFTFLDTLYFGALISPTDPLTILAI  325
            GAIL FAI+GTTLS+FLIG  MYGCVKLMP+YLSSSFTFLD+LYFGALISPTDPLTILAI
Sbjct  187  GAILTFAIVGTTLSAFLIGGFMYGCVKLMPKYLSSSFTFLDSLYFGALISPTDPLTILAI  246

Query  326  FHDLHVDVNLYALVFGESVLNDAVAIVLSGAIQNYGEHYSSTGGFETNAFFRSLSDFFCI  385
            F+DL VDVNLYALV GESVLNDAVAIVLSGAIQNYGEHYS+TG FET AF RSLSDFF I
Sbjct  247  FNDLRVDVNLYALVLGESVLNDAVAIVLSGAIQNYGEHYSNTGEFETTAFLRSLSDFFSI  306

Query  386  FMLSLLIGATMGCFTALLTKFTRVREFPLLESALFVLMSYSTFLIAEASELTGVVAVLFC  445
            F+LSL+IGA MGC TAL+TKFTRVR+FPLLESALFVLMSYSTFL+AEA+ELTGVVAVLFC
Sbjct  307  FLLSLMIGAAMGCLTALMTKFTRVRDFPLLESALFVLMSYSTFLLAEATELTGVVAVLFC  366

Query  446  GICQAHYTYNNLSENSRTRTKEIFELLNFLAENFIFSYIGVSMFTFPKHHFDAVFIITGF  505
            GICQAHYTYNNLSE+SR RTK+IFELLNFLAENFIFSYIGVSMFTFPKHHFDA FIIT F
Sbjct  367  GICQAHYTYNNLSEDSRQRTKQIFELLNFLAENFIFSYIGVSMFTFPKHHFDAGFIITAF  426

Query  506  VTAAIGRAVNIYPLSWLLNLNRKPKISSNFQHMLFFAGLRGAMSFALAIRNTVSEARQTM  565
            + AAIGRAVN+YPLSWLLN+ RKPKIS+NFQHMLFFAGLRGAMSFALAIRNTVS+ RQTM
Sbjct  427  ICAAIGRAVNVYPLSWLLNIKRKPKISTNFQHMLFFAGLRGAMSFALAIRNTVSDERQTM  486

Query  566  LTATSLIVIFTVVIQGGASNFLLNWLKIPVGVDEETEQLNNYRVRSVYNSMENTAAASID  625
            LTATSLIVIFTVVIQGGA+NFLLNWLKIPVGVD+ETEQLNNY+V S    +++     ++
Sbjct  487  LTATSLIVIFTVVIQGGAANFLLNWLKIPVGVDDETEQLNNYQVHSSDGYLQDVEGGGVN  546

Query  626  TGLNLGQLPMSRRRSSLSDAYLQDVDVDVEGA-GGIGDASAQTAMNVKRNEKAFLARIWG  684
                       R +  LS     ++D  V+G  G +G AS     N   +EKA LARIWG
Sbjct  547  -----------RNKMRLSGGTDTNLDTPVDGTNGSLGGASGGRRRN--SHEKAILARIWG  593

Query  685  NFDTKYMKPLLTHSRPTLLETLPVCCNPVAR  715
            NFDTKYMKPLLTHSRPTLLETLPVCCNP+AR
Sbjct  594  NFDTKYMKPLLTHSRPTLLETLPVCCNPIAR  624


>Q9VM99_DROME unnamed protein product
Length=687

 Score = 968 bits (2502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/631 (78%), Positives = 538/631 (85%), Gaps = 16/631 (3%)

Query  86   LAALTHTANATATDIALDAKATLTHRIDSLNLLVYTFLLTLTVLTIWLFKHHRVSWLHET  145
            L  L    +AT TDIALDAKATL HRI SL+LLV+ FLL LTVLTIWLFKHHRVSWLHET
Sbjct  9    LCVLAPGCSATDTDIALDAKATLNHRIQSLDLLVFVFLLALTVLTIWLFKHHRVSWLHET  68

Query  146  GLAVIYGLIVGAVIRYAGTSTPLVHLEVDPAGDPKFNQSLPPDTLWMKFPGKLAPNTTDK  205
            GLAVIYGLIVGA+IRYAGTS  LVH++V+P G P ++  LPPDTLW ++P      T  K
Sbjct  69   GLAVIYGLIVGAIIRYAGTSATLVHMQVEPQGVPTYSDKLPPDTLWFRYPVNQTNGT--K  126

Query  206  DPIPNKTYAYVFRGIVYDVDENEIDLKATFDPEIFFNIILPPIIFHAGYSLKKKYFFRNL  265
             P   KTYAYVFRG V+DVDENEIDLKATFDPE+FFNIILPPIIF+AGYSLKKKYFFRNL
Sbjct  127  PPEGIKTYAYVFRGQVHDVDENEIDLKATFDPEVFFNIILPPIIFYAGYSLKKKYFFRNL  186

Query  266  GAILMFAILGTTLSSFLIGAIMYGCVKLMPEYLSSSFTFLDTLYFGALISPTDPLTILAI  325
            GAIL FAI+GTTLS+FLIG  MYGCVKLMP+YLSSSFTFLD+LYFGALISPTDPLTILAI
Sbjct  187  GAILTFAIVGTTLSAFLIGGFMYGCVKLMPKYLSSSFTFLDSLYFGALISPTDPLTILAI  246

Query  326  FHDLHVDVNLYALVFGESVLNDAVAIVLSGAIQNYGEHYSSTGGFETNAFFRSLSDFFCI  385
            F+DL VDVNLYALV GESVLNDAVAIVLSGAIQNYGEHYS+TG FET AF RSLSDFF I
Sbjct  247  FNDLRVDVNLYALVLGESVLNDAVAIVLSGAIQNYGEHYSNTGEFETTAFLRSLSDFFSI  306

Query  386  FMLSLLIGATMGCFTALLTKFTRVREFPLLESALFVLMSYSTFLIAEASELTGVVAVLFC  445
            F+LSL+IGA MGC TAL+TKFTRVR+FPLLESALFVLMSYSTFL+AEA+ELTGVVAVLFC
Sbjct  307  FLLSLMIGAAMGCLTALMTKFTRVRDFPLLESALFVLMSYSTFLLAEATELTGVVAVLFC  366

Query  446  GICQAHYTYNNLSENSRTRTKEIFELLNFLAENFIFSYIGVSMFTFPKHHFDAVFIITGF  505
            GICQAHYTYNNLSE+SR RTK+IFELLNFLAENFIFSYIGVSMFTFPKHHFDA FIIT F
Sbjct  367  GICQAHYTYNNLSEDSRQRTKQIFELLNFLAENFIFSYIGVSMFTFPKHHFDAGFIITAF  426

Query  506  VTAAIGRAVNIYPLSWLLNLNRKPKISSNFQHMLFFAGLRGAMSFALAIRNTVSEARQTM  565
            + AAIGRAVN+YPLSWLLN+ RKPKIS+NFQHMLFFAGLRGAMSFALAIRNTVS+ RQTM
Sbjct  427  ICAAIGRAVNVYPLSWLLNIKRKPKISTNFQHMLFFAGLRGAMSFALAIRNTVSDERQTM  486

Query  566  LTATSLIVIFTVVIQGGASNFLLNWLKIPVGVDEETEQLNNYRVRSVYNSMENTAAASID  625
            LTATSLIVIFTVVIQGGA+NFLLNWLKIPVGVD+ETEQLNNY+V S    +++     ++
Sbjct  487  LTATSLIVIFTVVIQGGAANFLLNWLKIPVGVDDETEQLNNYQVHSSDGYLQDVEGGGVN  546

Query  626  TGLNLGQLPMSRRRSSLSDAYLQDVDVDVEGA-GGIGDASAQTAMNVKRNEKAFLARIWG  684
                       R +  LS     ++D  V+G  G +G AS     N   +EKA LARIWG
Sbjct  547  -----------RNKMRLSGGTDTNLDTPVDGTNGSLGGASGGRRRN--SHEKAILARIWG  593

Query  685  NFDTKYMKPLLTHSRPTLLETLPVCCNPVAR  715
            NFDTKYMKPLLTHSRPTLLETLPVCCNP+AR
Sbjct  594  NFDTKYMKPLLTHSRPTLLETLPVCCNPIAR  624



Lambda      K        H
   0.323    0.137    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9813801108


Query= XP_011197168.1 sodium/hydrogen exchanger 6 isoform X12 [Bactrocera
dorsalis]

Length=770
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VM99_DROME  unnamed protein product                                 1011    0.0  
M9PB53_DROME  unnamed protein product                                 1011    0.0  
Q9U624_DROME  unnamed protein product                                 1005    0.0  


>Q9VM99_DROME unnamed protein product
Length=687

 Score = 1011 bits (2613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 530/687 (77%), Positives = 577/687 (84%), Gaps = 38/687 (6%)

Query  86   LAALTHTANATATDIALDAKATLTHRIDSLNLLVYTFLLTLTVLTIWLFKHHRVSWLHET  145
            L  L    +AT TDIALDAKATL HRI SL+LLV+ FLL LTVLTIWLFKHHRVSWLHET
Sbjct  9    LCVLAPGCSATDTDIALDAKATLNHRIQSLDLLVFVFLLALTVLTIWLFKHHRVSWLHET  68

Query  146  GLAVIYGLIVGAVIRYAGTSTPLVHLEVDPAGDPKFNQSLPPDTLWMKFPGKLAPNTTDK  205
            GLAVIYGLIVGA+IRYAGTS  LVH++V+P G P ++  LPPDTLW ++P      T  K
Sbjct  69   GLAVIYGLIVGAIIRYAGTSATLVHMQVEPQGVPTYSDKLPPDTLWFRYPVNQTNGT--K  126

Query  206  DPIPNKTYAYVFRGIVYDVDENEIDLKATFDPEIFFNIILPPIIFHAGYSLKKKYFFRNL  265
             P   KTYAYVFRG V+DVDENEIDLKATFDPE+FFNIILPPIIF+AGYSLKKKYFFRNL
Sbjct  127  PPEGIKTYAYVFRGQVHDVDENEIDLKATFDPEVFFNIILPPIIFYAGYSLKKKYFFRNL  186

Query  266  GAILMFAILGTTLSSFLIGAIMYGCVKLMPEYLSSSFTFLDTLYFGALISPTDPLTILAI  325
            GAIL FAI+GTTLS+FLIG  MYGCVKLMP+YLSSSFTFLD+LYFGALISPTDPLTILAI
Sbjct  187  GAILTFAIVGTTLSAFLIGGFMYGCVKLMPKYLSSSFTFLDSLYFGALISPTDPLTILAI  246

Query  326  FHDLHVDVNLYALVFGESVLNDAVAIVLSGAIQNYGEHYSSTGGFETNAFFRSLSDFFCI  385
            F+DL VDVNLYALV GESVLNDAVAIVLSGAIQNYGEHYS+TG FET AF RSLSDFF I
Sbjct  247  FNDLRVDVNLYALVLGESVLNDAVAIVLSGAIQNYGEHYSNTGEFETTAFLRSLSDFFSI  306

Query  386  FMLSLLIGATMGCFTALLTKFTRVREFPLLESALFVLMSYSTFLIAEASELTGVVAVLFC  445
            F+LSL+IGA MGC TAL+TKFTRVR+FPLLESALFVLMSYSTFL+AEA+ELTGVVAVLFC
Sbjct  307  FLLSLMIGAAMGCLTALMTKFTRVRDFPLLESALFVLMSYSTFLLAEATELTGVVAVLFC  366

Query  446  GICQAHYTYNNLSENSRTRTKEIFELLNFLAENFIFSYIGVSMFTFPKHHFDAVFIITGF  505
            GICQAHYTYNNLSE+SR RTK+IFELLNFLAENFIFSYIGVSMFTFPKHHFDA FIIT F
Sbjct  367  GICQAHYTYNNLSEDSRQRTKQIFELLNFLAENFIFSYIGVSMFTFPKHHFDAGFIITAF  426

Query  506  VTAAIGRAVNIYPLSWLLNLNRKPKISSNFQHMLFFAGLRGAMSFALAIRNTVSEARQTM  565
            + AAIGRAVN+YPLSWLLN+ RKPKIS+NFQHMLFFAGLRGAMSFALAIRNTVS+ RQTM
Sbjct  427  ICAAIGRAVNVYPLSWLLNIKRKPKISTNFQHMLFFAGLRGAMSFALAIRNTVSDERQTM  486

Query  566  LTATSLIVIFTVVIQGGASNFLLNWLKIPVGVDEETEQLNNYRVRSSDAYLQDV------  619
            LTATSLIVIFTVVIQGGA+NFLLNWLKIPVGVD+ETEQLNNY+V SSD YLQDV      
Sbjct  487  LTATSLIVIFTVVIQGGAANFLLNWLKIPVGVDDETEQLNNYQVHSSDGYLQDVEGGGVN  546

Query  620  --------------DVDVEGA-GGIGDASAQTAMNVKRNEKAFLARIWGNFDTKYMKPLL  664
                          D  V+G  G +G AS     N   +EKA LARIWGNFDTKYMKPLL
Sbjct  547  RNKMRLSGGTDTNLDTPVDGTNGSLGGASGGRRRN--SHEKAILARIWGNFDTKYMKPLL  604

Query  665  THSRPTLLETLPVCCNPVARLLTTTEQLTQDGGGLRRSDSDSDICIDDENFGASSTNGAA  724
            THSRPTLLETLPVCCNP+ARLLTTT+QLTQDG   RR DSDSDICID++           
Sbjct  605  THSRPTLLETLPVCCNPIARLLTTTQQLTQDGSEFRRVDSDSDICIDNDTG---------  655

Query  725  GGLNGGSGSGSGGSAGMGPRRNSINRV  751
               NG S  GSG + G+G RRNS++RV
Sbjct  656  ---NGLSQDGSGAAPGVG-RRNSLSRV  678


>M9PB53_DROME unnamed protein product
Length=682

 Score = 1011 bits (2613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 529/690 (77%), Positives = 577/690 (84%), Gaps = 38/690 (6%)

Query  86   LAALTHTANATATDIALDAKATLTHRIDSLNLLVYTFLLTLTVLTIWLFKHHRVSWLHET  145
            L  L    +AT TDIALDAKATL HRI SL+LLV+ FLL LTVLTIWLFKHHRVSWLHET
Sbjct  9    LCVLAPGCSATDTDIALDAKATLNHRIQSLDLLVFVFLLALTVLTIWLFKHHRVSWLHET  68

Query  146  GLAVIYGLIVGAVIRYAGTSTPLVHLEVDPAGDPKFNQSLPPDTLWMKFPGKLAPNTTDK  205
            GLAVIYGLIVGA+IRYAGTS  LVH++V+P G P ++  LPPDTLW ++P      T  K
Sbjct  69   GLAVIYGLIVGAIIRYAGTSATLVHMQVEPQGVPTYSDKLPPDTLWFRYPVNQTNGT--K  126

Query  206  DPIPNKTYAYVFRGIVYDVDENEIDLKATFDPEIFFNIILPPIIFHAGYSLKKKYFFRNL  265
             P   KTYAYVFRG V+DVDENEIDLKATFDPE+FFNIILPPIIF+AGYSLKKKYFFRNL
Sbjct  127  PPEGIKTYAYVFRGQVHDVDENEIDLKATFDPEVFFNIILPPIIFYAGYSLKKKYFFRNL  186

Query  266  GAILMFAILGTTLSSFLIGAIMYGCVKLMPEYLSSSFTFLDTLYFGALISPTDPLTILAI  325
            GAIL FAI+GTTLS+FLIG  MYGCVKLMP+YLSSSFTFLD+LYFGALISPTDPLTILAI
Sbjct  187  GAILTFAIVGTTLSAFLIGGFMYGCVKLMPKYLSSSFTFLDSLYFGALISPTDPLTILAI  246

Query  326  FHDLHVDVNLYALVFGESVLNDAVAIVLSGAIQNYGEHYSSTGGFETNAFFRSLSDFFCI  385
            F+DL VDVNLYALV GESVLNDAVAIVLSGAIQNYGEHYS+TG FET AF RSLSDFF I
Sbjct  247  FNDLRVDVNLYALVLGESVLNDAVAIVLSGAIQNYGEHYSNTGEFETTAFLRSLSDFFSI  306

Query  386  FMLSLLIGATMGCFTALLTKFTRVREFPLLESALFVLMSYSTFLIAEASELTGVVAVLFC  445
            F+LSL+IGA MGC TAL+TKFTRVR+FPLLESALFVLMSYSTFL+AEA+ELTGVVAVLFC
Sbjct  307  FLLSLMIGAAMGCLTALMTKFTRVRDFPLLESALFVLMSYSTFLLAEATELTGVVAVLFC  366

Query  446  GICQAHYTYNNLSENSRTRTKEIFELLNFLAENFIFSYIGVSMFTFPKHHFDAVFIITGF  505
            GICQAHYTYNNLSE+SR RTK+IFELLNFLAENFIFSYIGVSMFTFPKHHFDA FIIT F
Sbjct  367  GICQAHYTYNNLSEDSRQRTKQIFELLNFLAENFIFSYIGVSMFTFPKHHFDAGFIITAF  426

Query  506  VTAAIGRAVNIYPLSWLLNLNRKPKISSNFQHMLFFAGLRGAMSFALAIRNTVSEARQTM  565
            + AAIGRAVN+YPLSWLLN+ RKPKIS+NFQHMLFFAGLRGAMSFALAIRNTVS+ RQTM
Sbjct  427  ICAAIGRAVNVYPLSWLLNIKRKPKISTNFQHMLFFAGLRGAMSFALAIRNTVSDERQTM  486

Query  566  LTATSLIVIFTVVIQGGASNFLLNWLKIPVGVDEETEQLNNYRVRSSDAYLQDV------  619
            LTATSLIVIFTVVIQGGA+NFLLNWLKIPVGVD+ETEQLNNY+V SSD YLQDV      
Sbjct  487  LTATSLIVIFTVVIQGGAANFLLNWLKIPVGVDDETEQLNNYQVHSSDGYLQDVEGGGVN  546

Query  620  --------------DVDVEGA-GGIGDASAQTAMNVKRNEKAFLARIWGNFDTKYMKPLL  664
                          D  V+G  G +G AS     N   +EKA LARIWGNFDTKYMKPLL
Sbjct  547  RNKMRLSGGTDTNLDTPVDGTNGSLGGASGGRRRN--SHEKAILARIWGNFDTKYMKPLL  604

Query  665  THSRPTLLETLPVCCNPVARLLTTTEQLTQDGGGLRRSDSDSDICIDDENFGASSTNGAA  724
            THSRPTLLETLPVCCNP+ARLLTTT+QLTQDG   RR DSDSDICID++           
Sbjct  605  THSRPTLLETLPVCCNPIARLLTTTQQLTQDGSEFRRVDSDSDICIDNDTG---------  655

Query  725  GGLNGGSGSGSGGSAGMGPRRNSINRVSIR  754
               NG S  GSG + G+G RRNS++R   +
Sbjct  656  ---NGLSQDGSGAAPGVG-RRNSLSRTETQ  681


>Q9U624_DROME unnamed protein product
Length=687

 Score = 1005 bits (2599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 528/687 (77%), Positives = 575/687 (84%), Gaps = 38/687 (6%)

Query  86   LAALTHTANATATDIALDAKATLTHRIDSLNLLVYTFLLTLTVLTIWLFKHHRVSWLHET  145
            L  L    +AT TDIALDAKATL HRI SL+LLV+ FLL LTVLTIWLFKHHRVSWLHET
Sbjct  9    LCVLAPGCSATDTDIALDAKATLNHRIQSLDLLVFVFLLALTVLTIWLFKHHRVSWLHET  68

Query  146  GLAVIYGLIVGAVIRYAGTSTPLVHLEVDPAGDPKFNQSLPPDTLWMKFPGKLAPNTTDK  205
            GLAVIYGLIVGA+IRYAGTS  L H++V+P G P ++  LPPDTLW ++P      T  K
Sbjct  69   GLAVIYGLIVGAIIRYAGTSGTLDHMQVEPQGVPTYSDKLPPDTLWFRYPVNQTNGT--K  126

Query  206  DPIPNKTYAYVFRGIVYDVDENEIDLKATFDPEIFFNIILPPIIFHAGYSLKKKYFFRNL  265
             P   KTYAYVFRG V+DVDENEIDLKATFDPE+FFNIILPPIIF+AGY LKKKYFFRNL
Sbjct  127  PPEGIKTYAYVFRGQVHDVDENEIDLKATFDPEVFFNIILPPIIFYAGYCLKKKYFFRNL  186

Query  266  GAILMFAILGTTLSSFLIGAIMYGCVKLMPEYLSSSFTFLDTLYFGALISPTDPLTILAI  325
            GAIL FAI+GTTLS+FLIG  MYGCVKLMP+YLSSSFTFLD+LYFGALISPTDPLTILAI
Sbjct  187  GAILTFAIVGTTLSAFLIGGFMYGCVKLMPKYLSSSFTFLDSLYFGALISPTDPLTILAI  246

Query  326  FHDLHVDVNLYALVFGESVLNDAVAIVLSGAIQNYGEHYSSTGGFETNAFFRSLSDFFCI  385
            F+DL VDVNLYALV GESVLNDAVAIVLSGAIQNYGEHYS+TG FET AF RSLSDFF I
Sbjct  247  FNDLRVDVNLYALVLGESVLNDAVAIVLSGAIQNYGEHYSNTGEFETTAFLRSLSDFFSI  306

Query  386  FMLSLLIGATMGCFTALLTKFTRVREFPLLESALFVLMSYSTFLIAEASELTGVVAVLFC  445
            F+LSL+IGA MGC TAL+TKFTRVR+FPLLESALFVLMSYSTFL+AEA+ELTGVVAVLFC
Sbjct  307  FLLSLMIGAAMGCLTALMTKFTRVRDFPLLESALFVLMSYSTFLLAEATELTGVVAVLFC  366

Query  446  GICQAHYTYNNLSENSRTRTKEIFELLNFLAENFIFSYIGVSMFTFPKHHFDAVFIITGF  505
            GICQAHYTYNNLSE+SR RTK+IFELLNFLAENFIFSYIGVSMFTFPKHHFDA FIIT F
Sbjct  367  GICQAHYTYNNLSEDSRQRTKQIFELLNFLAENFIFSYIGVSMFTFPKHHFDAGFIITAF  426

Query  506  VTAAIGRAVNIYPLSWLLNLNRKPKISSNFQHMLFFAGLRGAMSFALAIRNTVSEARQTM  565
            + AAIGRAVN+YPLSWLLN+ RKPKIS+NFQHMLFFAGLRGAMSFALAIRNTVS+ RQTM
Sbjct  427  ICAAIGRAVNVYPLSWLLNIKRKPKISTNFQHMLFFAGLRGAMSFALAIRNTVSDERQTM  486

Query  566  LTATSLIVIFTVVIQGGASNFLLNWLKIPVGVDEETEQLNNYRVRSSDAYLQDV------  619
            LTATSLIVIFTVVIQGGA+NFLLNWLKIPVGVD+ETEQLNNY+V SSD YLQDV      
Sbjct  487  LTATSLIVIFTVVIQGGAANFLLNWLKIPVGVDDETEQLNNYQVHSSDGYLQDVEGGGVN  546

Query  620  --------------DVDVEGA-GGIGDASAQTAMNVKRNEKAFLARIWGNFDTKYMKPLL  664
                          D  V+G  G +G AS     N   +EKA LARIWGNFDTKYMKPLL
Sbjct  547  RNKMRLSGGTDTNLDTPVDGTNGSLGGASGGRRRN--SHEKAILARIWGNFDTKYMKPLL  604

Query  665  THSRPTLLETLPVCCNPVARLLTTTEQLTQDGGGLRRSDSDSDICIDDENFGASSTNGAA  724
            THSRPTLLETLPVCCNP+ARLLTTT+QLTQDG   RR DSDSDICID++           
Sbjct  605  THSRPTLLETLPVCCNPIARLLTTTQQLTQDGSEFRRVDSDSDICIDNDTG---------  655

Query  725  GGLNGGSGSGSGGSAGMGPRRNSINRV  751
               NG S  GSG + G+G RRNS++RV
Sbjct  656  ---NGLSQDGSGAAPGVG-RRNSLSRV  678



Lambda      K        H
   0.323    0.137    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9813801108


Query= XP_011197170.1 serine protease inhibitor 27A [Bactrocera dorsalis]

Length=362
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SP27A_DROME  unnamed protein product                                  103     4e-24
Q8MPN7_DROME  unnamed protein product                                 80.5    2e-16
Q8MPN5_DROME  unnamed protein product                                 79.7    2e-16


>SP27A_DROME unnamed protein product
Length=447

 Score = 103 bits (256),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 75/272 (28%), Positives = 135/272 (50%), Gaps = 21/272 (8%)

Query  107  TLEWFYDCKIQETSFTDKKKLITSINDWSENIADQTILKSSEMILKEENLQ---VLILNM  163
            TL+ FYD +++   FT+ +    +IN W+ NI    +    + ++  +N++   +L+ N+
Sbjct  177  TLKHFYDSEVEALDFTNPEAAADAINAWAANITQGRL----QQLVAPDNVRSSVMLLTNL  232

Query  164  LNFKETLQINFKYTLNATFHERPDSTIVLPAVETTEYLKYLDSQILDAKILELPYSNGYF  223
            + F    +  F  T   +F    D       +E T+Y  Y  S+ L A+IL LPY     
Sbjct  233  IYFNGLWRRQFATTFQGSFFRSKDDQSRAEFMEQTDYFYYTTSEKLKAQILRLPYKGKNS  292

Query  224  MYIILPHTKQGVIETINNLGYEQLTRIEWMMKERRVNVVMPTFKYHFITNMREHIQ----  279
            ++++LP+   G+ + + NL  ++L   +W M+E +V V +P F + +  N++E ++    
Sbjct  293  LFVLLPYALNGIHDLVKNLENDELKSAQWAMEEVKVKVTLPKFHFDYQQNLKETLRSLGV  352

Query  280  ----KNSAHRFDVDFEPAFGVETKKINIFQTTLVQFDGSG----RARVEDYEKI--RTTK  329
                ++SA    +        + K  NI Q   +  +  G     A V + E     +T 
Sbjct  353  REIFEDSASLPGLTRGADVAGKVKVSNILQKAGINVNEKGTEAYAATVVEIENKFGGSTA  412

Query  330  YERFHVDRPFAFYIKEKSTGRIVCIGKVLNPV  361
             E F+V+RPF F+I+E+STG I+  GKV +P 
Sbjct  413  IEEFNVNRPFVFFIEEESTGNILFAGKVHSPT  444


>Q8MPN7_DROME unnamed protein product
Length=406

 Score = 80.5 bits (197),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 69/243 (28%), Positives = 111/243 (46%), Gaps = 18/243 (7%)

Query  117  QETSFTDKKKLITSINDWSENIADQTI--LKSSEMILKEENLQVLILNMLNFKETLQINF  174
            Q   F+   +   +IN+W E   +  I  L  ++++  E  L  +++N ++FK T Q  F
Sbjct  153  QSVDFSKNVQAAATINNWVEQRTNHLIKDLVPADVLNSESRL--VLVNAIHFKGTWQHQF  210

Query  175  KYTLNA--TFHERPDSTIVLPAVETTEYLKYLDSQILDAKILELPYSNGYF-MYIILPHT  231
               L    TFH   + T+ +P +   E  +Y D   LDA  LELPY +    M I+LP+T
Sbjct  211  AKHLTRPDTFHLDGERTVQVPMMSLKERFRYADLPALDAMALELPYKDSDLSMLIVLPNT  270

Query  232  KQGVIETINNLGYEQLTRIEWMMKERRVNVVMPTFKYHFITNMREHIQKNSAHRFDVDFE  291
            K G+      L    L++I   + E +V + +P FK  F   + E  QK    R   D +
Sbjct  271  KTGLPALEEKLRLTTLSQITQSLYETKVALKLPRFKAEFQVELSEVFQKLGMSRMFSD-Q  329

Query  292  PAFG-----VETKKIN-IFQTTLVQF--DGSGRARVEDYEKIRTTKYERFH--VDRPFAF  341
              FG      E  K++ I     ++   +G+  A    +  +    + R H   + PFAF
Sbjct  330  AEFGKMLQSPEPLKVSAIIHKAFIEVNEEGTEAAAATVWRVMAVAAFSRKHFIANHPFAF  389

Query  342  YIK  344
            Y+K
Sbjct  390  YVK  392


>Q8MPN5_DROME unnamed protein product
Length=374

 Score = 79.7 bits (195),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 69/243 (28%), Positives = 111/243 (46%), Gaps = 18/243 (7%)

Query  117  QETSFTDKKKLITSINDWSENIADQTI--LKSSEMILKEENLQVLILNMLNFKETLQINF  174
            Q   F+   +   +IN+W E   +  I  L  ++++  E  L  +++N ++FK T Q  F
Sbjct  121  QSVDFSKNVQAAATINNWVEQRTNHLIKDLVPADVLNSESRL--VLVNAIHFKGTWQHQF  178

Query  175  KYTLNA--TFHERPDSTIVLPAVETTEYLKYLDSQILDAKILELPYSNGYF-MYIILPHT  231
               L    TFH   + T+ +P +   E  +Y D   LDA  LELPY +    M I+LP+T
Sbjct  179  AKHLTRPDTFHLDGERTVQVPMMSLKERFRYADLPALDAMALELPYKDSDLSMLIVLPNT  238

Query  232  KQGVIETINNLGYEQLTRIEWMMKERRVNVVMPTFKYHFITNMREHIQKNSAHRFDVDFE  291
            K G+      L    L++I   + E +V + +P FK  F   + E  QK    R   D +
Sbjct  239  KTGLPALEEKLRLTTLSQITQSLYETKVALKLPRFKAEFQVELSEVFQKLGMSRMFSD-Q  297

Query  292  PAFG-----VETKKIN-IFQTTLVQF--DGSGRARVEDYEKIRTTKYERFH--VDRPFAF  341
              FG      E  K++ I     ++   +G+  A    +  +    + R H   + PFAF
Sbjct  298  AEFGKMLQSPEPLKVSAIIHKAFIEVNEEGTEAAAATVWRVMAVAAFSRKHFIANHPFAF  357

Query  342  YIK  344
            Y+K
Sbjct  358  YVK  360



Lambda      K        H
   0.323    0.137    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9813801108


Query= XP_011197172.1 U1 small nuclear ribonucleoprotein 70 kDa [Bactrocera
dorsalis]

Length=434
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RU17_DROME  unnamed protein product                                   338     8e-113
TRA2_DROME  unnamed protein product                                   65.9    7e-12 
Q9XYZ6_DROME  unnamed protein product                                 67.0    1e-11 


>RU17_DROME unnamed protein product
Length=448

 Score = 338 bits (868),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 193/211 (91%), Positives = 202/211 (96%), Gaps = 0/211 (0%)

Query  1    MTQYLPPNLLALFAARDPIPYMPPVDKLPHEKKSRGYLGIGGFLSEFEDPKDTPPAKRVE  60
            MTQYLPPNLLALFAAR+PIP+MPPVDKLPHEKKSRGYLG+  F+++FEDPKDTP  K VE
Sbjct  1    MTQYLPPNLLALFAAREPIPFMPPVDKLPHEKKSRGYLGVAKFMADFEDPKDTPLPKTVE  60

Query  61   TRQERLDRRRREKAEQVAYKLEREIALWDPQEIKNSTEDPFRTLFIARINYDTSESKLRR  120
            TRQERL+RRRREKAEQVAYKLEREIALWDP EIKN+TEDPFRTLFIARINYDTSESKLRR
Sbjct  61   TRQERLERRRREKAEQVAYKLEREIALWDPTEIKNATEDPFRTLFIARINYDTSESKLRR  120

Query  121  EFEIYGPIKKIVMISDQESGKPKGYAFIEYEHERDMHAAYKHADGKKIDGKRVLVDVERA  180
            EFE YGPIKKIV+I DQESGKPKGYAFIEYEHERDMHAAYKHADGKKID KRVLVDVERA
Sbjct  121  EFEFYGPIKKIVLIHDQESGKPKGYAFIEYEHERDMHAAYKHADGKKIDSKRVLVDVERA  180

Query  181  RTVKGWLPRRLGGGLGGTRRGGNDVNIKHSG  211
            RTVKGWLPRRLGGGLGGTRRGGNDVNIKHSG
Sbjct  181  RTVKGWLPRRLGGGLGGTRRGGNDVNIKHSG  211


>TRA2_DROME unnamed protein product
Length=264

 Score = 65.9 bits (159),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 49/149 (33%), Positives = 75/149 (50%), Gaps = 10/149 (7%)

Query  102  RTLFIARINYDTSESKLRREFEIYGPIKKIVMISDQESGKPKGYAFIEYEHERDMHAAYK  161
            R + +  +N +TS+ K+R  F  YGPI++I M+ D ++ + +G+ FI +E   D  AA  
Sbjct  97   RCIGVFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKD  156

Query  162  HADGKKIDGKRVLVD---VERART-----VKGWLPRRLGGGLGGTRRGGNDVNIKHSGRE  213
               G ++DG+R+ VD    +RA T       G  PR         RRG    + + +   
Sbjct  157  SCSGIEVDGRRIRVDFSITQRAHTPTPGVYLGRQPRGKAPRSFSPRRGRRVYHDRSASPY  216

Query  214  DNERERERYRLEREREDRESARLVERNRF  242
            DN R+R  YR   +R DR   R   RNR+
Sbjct  217  DNYRDRYDYR--NDRYDRNLRRSPSRNRY  243


>Q9XYZ6_DROME unnamed protein product
Length=653

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 82/278 (29%), Positives = 131/278 (47%), Gaps = 32/278 (12%)

Query  100  PFRTLFIARINYDTSESKLRREFEIYGPIKKIVMISDQESGKPKGYAFIEYEHERDMHAA  159
            P   LF+ ++N  T++  L   F  +G +K   +I D+++G    YAF+E+E ++   AA
Sbjct  238  PENVLFVCKLNPVTTDDDLEIIFSSFGVLKGCEVIRDRKTGDSLQYAFVEFEDQKSCEAA  297

Query  160  YKHADGKKIDGKRVLVDVERARTVKGWLPRRLGGGLGGTRRGGNDVNIK--------HSG  211
            Y   D   ID +R+ VD  ++ +   W  R  G G+ G  R  +  N++        ++G
Sbjct  298  YFKMDNVLIDDRRIHVDFSQSVSKVTW--RGKGRGIEGDYRKLDFNNLRDDKDHRKPNNG  355

Query  212  REDNERERERYRLEREREDRESA--------RLVERNRFGAGDAVRRRSRSRER------  257
            R   E  +ER R E  R    SA        R  E++       ++RR+RS+E+      
Sbjct  356  RSRTEDHKERNRTEDFRNRMSSAERRKAREQRHQEQSERDVRKNLQRRTRSKEKDEKSVY  415

Query  258  -----LRERERERSRRSRSKSRERRRRRAGSREREYDEFEKRDRREKERERDR--ERERD  310
                   E  RE S R R+++ +R  R   +  R Y     R+ R   R RD+   R R 
Sbjct  416  RSKKSQNESVRENSNRERNRNEKRSSRSRDATHRRYSRSRDREERRPSRPRDQLGRRSRS  475

Query  311  RDKK-KRRSKSRERDSSRERRDKKRERDRRDKERDRGD  347
            RD+K +RRS+ RE++  R  R + +   R  + RDR D
Sbjct  476  RDQKERRRSRPREQNERRRSRSRDQTGKRPTQNRDRND  513



Lambda      K        H
   0.323    0.137    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9813801108


Query= XP_011197174.1 oxygen-dependent coproporphyrinogen-III oxidase
isoform X2 [Bactrocera dorsalis]

Length=386
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8IHU1_PLAF7  unnamed protein product                                 180     6e-52
ARF1_DICDI  unnamed protein product                                   31.6    0.71 
LINT_DROME  unnamed protein product                                   32.0    1.00 


>Q8IHU1_PLAF7 unnamed protein product
Length=470

 Score = 180 bits (456),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 122/460 (27%), Positives = 185/460 (40%), Gaps = 157/460 (34%)

Query  79   MRTKMELMIMRIQADVCRALEAEEYAGQKFKVDRWQRAEG-----GGGITCVLQDGEVFE  133
             R   E ++   Q ++C  +E+ +   +KF+ + W R  G     GGGIT +L+DG +FE
Sbjct  11   FRNLWENLLKSEQNNICSLIESLD--NKKFQEEVWYRKSGKNKNLGGGITRILEDGNIFE  68

Query  134  KAGVNISVVTGMLPPGAVQQMRTRGKN----------------------------LAEGK  165
            K  VN S + G +   + +QM     N                                +
Sbjct  69   KCAVNYSCIYGAIDKESAKQMCVNHYNKEFINTTKICHSDDINILISRVLNSHNIRIINE  128

Query  166  KLPFFAAGVSAVIHPRNPHVPTIHFNYRYFEV----------------------------  197
            K  F+A+G+S + HP NP+VPT+H N+R+F++                            
Sbjct  129  KYKFYASGISIIAHPVNPNVPTVHMNFRFFQIFIKTGKKKKKYNNLNNVNNNNLNNNLNN  188

Query  198  --------ESDGEKQWWFGGGTDLTPYYLNEKDAVHFHKTLKDACDEHDSSYYPRFKKWC  249
                     +    + WFGGG DL+P Y+       FH + K  CD+++  +Y  FK WC
Sbjct  189  NFVKNKIDNNYKSIKHWFGGGCDLSPCYIFPDLFTEFHNSFKLVCDKYNHLFYRHFKIWC  248

Query  250  DDYFRITHRKESRGIGGIFFD-------------------DVDTPNQEE-----------  279
            D YFRI HR  +RGIGGIFFD                   D++  N  +           
Sbjct  249  DLYFRIKHRNINRGIGGIFFDNLLNNIIKNKKVIRSGKLKDINKKNGNDPTINNNNNNNK  308

Query  280  -----------------AFKFVTSCANSVIPSYLPLVRQHKNDDYGDKERQWQLLRRGRY  322
                              + F+  C  +   SYL ++ +  N  Y D   +WQ + RGRY
Sbjct  309  DCKCYSCNNIMDKSYRMIYFFIQECIINFRKSYLHILLETVNFKYDDNMLKWQRVCRGRY  368

Query  323  VEFNLIYDRGTKFG---------------------------------------LYTPGAR  343
            VEFNL+YDRGTKFG                                       L     +
Sbjct  369  VEFNLLYDRGTKFGIELNRYKIYRRKKKQKKLENYSSTNFIKDEIFDEQVSDYLSDEHEK  428

Query  344  YESILMSLPLTARWEYMHTVPSNSKEGKLLEVLQNPKDWI  383
             +++  SLPL   ++Y + +   S+E + LE+L+ PK W+
Sbjct  429  IDNVFSSLPLKCDFQYKYKIEKYSREYETLEILKYPKKWV  468


>ARF1_DICDI unnamed protein product
Length=182

 Score = 31.6 bits (70),  Expect = 0.71, Method: Compositional matrix adjust.
 Identities = 25/112 (22%), Positives = 47/112 (42%), Gaps = 12/112 (11%)

Query  171  AAGVSAVIHPRN-----PHVPTIHFNYRYFEVESDGEKQWWFGGGTDLTPYYLNEKDAVH  225
            AAG + +++          +PTI FN    E ++     W  GG   + P +       H
Sbjct  27   AAGKTTILYKLKLGEIVTTIPTIGFNVETVEFKNINFTVWDVGGQDKIRPLWR------H  80

Query  226  FHKTLKDACDEHDSSYYPRFKKWCDDYFRITHRKESR-GIGGIFFDDVDTPN  276
            + +  +      DS+   R ++ CD+  ++ +  E R  +  +F +  D PN
Sbjct  81   YFQNTQGLIFVVDSNDRERIQEACDELTKMLNEDELRDAVLLVFCNKQDLPN  132


>LINT_DROME unnamed protein product
Length=1693

 Score = 32.0 bits (71),  Expect = 1.00, Method: Composition-based stats.
 Identities = 27/97 (28%), Positives = 41/97 (42%), Gaps = 15/97 (15%)

Query  64    EPITDTNTLIDNEDDMRTKMELMIMRIQADVCRALEAEEYAGQKFKVDRWQRAEGGGGIT  123
             +P T  N L   E D   + +  I+ I    C   +  ++ G+   V  W R + GGG+ 
Sbjct  1537  DPATFENDLALLELDSPVQFDTHIVPI----CMPNDVADFTGRMATVTGWGRLKYGGGVP  1592

Query  124   CVLQD-----------GEVFEKAGVNISVVTGMLPPG  149
              VLQ+            E+F  AG N  ++T  L  G
Sbjct  1593  SVLQEVQVPIIENSVCQEMFHTAGHNKKILTSFLCAG  1629



Lambda      K        H
   0.323    0.137    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9813801108


Query= XP_011197176.1 oxygen-dependent coproporphyrinogen-III oxidase
isoform X2 [Bactrocera dorsalis]

Length=386
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8IHU1_PLAF7  unnamed protein product                                 180     6e-52
ARF1_DICDI  unnamed protein product                                   31.6    0.71 
LINT_DROME  unnamed protein product                                   32.0    1.00 


>Q8IHU1_PLAF7 unnamed protein product
Length=470

 Score = 180 bits (456),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 122/460 (27%), Positives = 185/460 (40%), Gaps = 157/460 (34%)

Query  79   MRTKMELMIMRIQADVCRALEAEEYAGQKFKVDRWQRAEG-----GGGITCVLQDGEVFE  133
             R   E ++   Q ++C  +E+ +   +KF+ + W R  G     GGGIT +L+DG +FE
Sbjct  11   FRNLWENLLKSEQNNICSLIESLD--NKKFQEEVWYRKSGKNKNLGGGITRILEDGNIFE  68

Query  134  KAGVNISVVTGMLPPGAVQQMRTRGKN----------------------------LAEGK  165
            K  VN S + G +   + +QM     N                                +
Sbjct  69   KCAVNYSCIYGAIDKESAKQMCVNHYNKEFINTTKICHSDDINILISRVLNSHNIRIINE  128

Query  166  KLPFFAAGVSAVIHPRNPHVPTIHFNYRYFEV----------------------------  197
            K  F+A+G+S + HP NP+VPT+H N+R+F++                            
Sbjct  129  KYKFYASGISIIAHPVNPNVPTVHMNFRFFQIFIKTGKKKKKYNNLNNVNNNNLNNNLNN  188

Query  198  --------ESDGEKQWWFGGGTDLTPYYLNEKDAVHFHKTLKDACDEHDSSYYPRFKKWC  249
                     +    + WFGGG DL+P Y+       FH + K  CD+++  +Y  FK WC
Sbjct  189  NFVKNKIDNNYKSIKHWFGGGCDLSPCYIFPDLFTEFHNSFKLVCDKYNHLFYRHFKIWC  248

Query  250  DDYFRITHRKESRGIGGIFFD-------------------DVDTPNQEE-----------  279
            D YFRI HR  +RGIGGIFFD                   D++  N  +           
Sbjct  249  DLYFRIKHRNINRGIGGIFFDNLLNNIIKNKKVIRSGKLKDINKKNGNDPTINNNNNNNK  308

Query  280  -----------------AFKFVTSCANSVIPSYLPLVRQHKNDDYGDKERQWQLLRRGRY  322
                              + F+  C  +   SYL ++ +  N  Y D   +WQ + RGRY
Sbjct  309  DCKCYSCNNIMDKSYRMIYFFIQECIINFRKSYLHILLETVNFKYDDNMLKWQRVCRGRY  368

Query  323  VEFNLIYDRGTKFG---------------------------------------LYTPGAR  343
            VEFNL+YDRGTKFG                                       L     +
Sbjct  369  VEFNLLYDRGTKFGIELNRYKIYRRKKKQKKLENYSSTNFIKDEIFDEQVSDYLSDEHEK  428

Query  344  YESILMSLPLTARWEYMHTVPSNSKEGKLLEVLQNPKDWI  383
             +++  SLPL   ++Y + +   S+E + LE+L+ PK W+
Sbjct  429  IDNVFSSLPLKCDFQYKYKIEKYSREYETLEILKYPKKWV  468


>ARF1_DICDI unnamed protein product
Length=182

 Score = 31.6 bits (70),  Expect = 0.71, Method: Compositional matrix adjust.
 Identities = 25/112 (22%), Positives = 47/112 (42%), Gaps = 12/112 (11%)

Query  171  AAGVSAVIHPRN-----PHVPTIHFNYRYFEVESDGEKQWWFGGGTDLTPYYLNEKDAVH  225
            AAG + +++          +PTI FN    E ++     W  GG   + P +       H
Sbjct  27   AAGKTTILYKLKLGEIVTTIPTIGFNVETVEFKNINFTVWDVGGQDKIRPLWR------H  80

Query  226  FHKTLKDACDEHDSSYYPRFKKWCDDYFRITHRKESR-GIGGIFFDDVDTPN  276
            + +  +      DS+   R ++ CD+  ++ +  E R  +  +F +  D PN
Sbjct  81   YFQNTQGLIFVVDSNDRERIQEACDELTKMLNEDELRDAVLLVFCNKQDLPN  132


>LINT_DROME unnamed protein product
Length=1693

 Score = 32.0 bits (71),  Expect = 1.00, Method: Composition-based stats.
 Identities = 27/97 (28%), Positives = 41/97 (42%), Gaps = 15/97 (15%)

Query  64    EPITDTNTLIDNEDDMRTKMELMIMRIQADVCRALEAEEYAGQKFKVDRWQRAEGGGGIT  123
             +P T  N L   E D   + +  I+ I    C   +  ++ G+   V  W R + GGG+ 
Sbjct  1537  DPATFENDLALLELDSPVQFDTHIVPI----CMPNDVADFTGRMATVTGWGRLKYGGGVP  1592

Query  124   CVLQD-----------GEVFEKAGVNISVVTGMLPPG  149
              VLQ+            E+F  AG N  ++T  L  G
Sbjct  1593  SVLQEVQVPIIENSVCQEMFHTAGHNKKILTSFLCAG  1629



Lambda      K        H
   0.323    0.137    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9813801108


Query= XP_011197178.1 oxygen-dependent coproporphyrinogen-III oxidase
isoform X2 [Bactrocera dorsalis]

Length=386
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8IHU1_PLAF7  unnamed protein product                                 180     6e-52
ARF1_DICDI  unnamed protein product                                   31.6    0.71 
LINT_DROME  unnamed protein product                                   32.0    1.00 


>Q8IHU1_PLAF7 unnamed protein product
Length=470

 Score = 180 bits (456),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 122/460 (27%), Positives = 185/460 (40%), Gaps = 157/460 (34%)

Query  79   MRTKMELMIMRIQADVCRALEAEEYAGQKFKVDRWQRAEG-----GGGITCVLQDGEVFE  133
             R   E ++   Q ++C  +E+ +   +KF+ + W R  G     GGGIT +L+DG +FE
Sbjct  11   FRNLWENLLKSEQNNICSLIESLD--NKKFQEEVWYRKSGKNKNLGGGITRILEDGNIFE  68

Query  134  KAGVNISVVTGMLPPGAVQQMRTRGKN----------------------------LAEGK  165
            K  VN S + G +   + +QM     N                                +
Sbjct  69   KCAVNYSCIYGAIDKESAKQMCVNHYNKEFINTTKICHSDDINILISRVLNSHNIRIINE  128

Query  166  KLPFFAAGVSAVIHPRNPHVPTIHFNYRYFEV----------------------------  197
            K  F+A+G+S + HP NP+VPT+H N+R+F++                            
Sbjct  129  KYKFYASGISIIAHPVNPNVPTVHMNFRFFQIFIKTGKKKKKYNNLNNVNNNNLNNNLNN  188

Query  198  --------ESDGEKQWWFGGGTDLTPYYLNEKDAVHFHKTLKDACDEHDSSYYPRFKKWC  249
                     +    + WFGGG DL+P Y+       FH + K  CD+++  +Y  FK WC
Sbjct  189  NFVKNKIDNNYKSIKHWFGGGCDLSPCYIFPDLFTEFHNSFKLVCDKYNHLFYRHFKIWC  248

Query  250  DDYFRITHRKESRGIGGIFFD-------------------DVDTPNQEE-----------  279
            D YFRI HR  +RGIGGIFFD                   D++  N  +           
Sbjct  249  DLYFRIKHRNINRGIGGIFFDNLLNNIIKNKKVIRSGKLKDINKKNGNDPTINNNNNNNK  308

Query  280  -----------------AFKFVTSCANSVIPSYLPLVRQHKNDDYGDKERQWQLLRRGRY  322
                              + F+  C  +   SYL ++ +  N  Y D   +WQ + RGRY
Sbjct  309  DCKCYSCNNIMDKSYRMIYFFIQECIINFRKSYLHILLETVNFKYDDNMLKWQRVCRGRY  368

Query  323  VEFNLIYDRGTKFG---------------------------------------LYTPGAR  343
            VEFNL+YDRGTKFG                                       L     +
Sbjct  369  VEFNLLYDRGTKFGIELNRYKIYRRKKKQKKLENYSSTNFIKDEIFDEQVSDYLSDEHEK  428

Query  344  YESILMSLPLTARWEYMHTVPSNSKEGKLLEVLQNPKDWI  383
             +++  SLPL   ++Y + +   S+E + LE+L+ PK W+
Sbjct  429  IDNVFSSLPLKCDFQYKYKIEKYSREYETLEILKYPKKWV  468


>ARF1_DICDI unnamed protein product
Length=182

 Score = 31.6 bits (70),  Expect = 0.71, Method: Compositional matrix adjust.
 Identities = 25/112 (22%), Positives = 47/112 (42%), Gaps = 12/112 (11%)

Query  171  AAGVSAVIHPRN-----PHVPTIHFNYRYFEVESDGEKQWWFGGGTDLTPYYLNEKDAVH  225
            AAG + +++          +PTI FN    E ++     W  GG   + P +       H
Sbjct  27   AAGKTTILYKLKLGEIVTTIPTIGFNVETVEFKNINFTVWDVGGQDKIRPLWR------H  80

Query  226  FHKTLKDACDEHDSSYYPRFKKWCDDYFRITHRKESR-GIGGIFFDDVDTPN  276
            + +  +      DS+   R ++ CD+  ++ +  E R  +  +F +  D PN
Sbjct  81   YFQNTQGLIFVVDSNDRERIQEACDELTKMLNEDELRDAVLLVFCNKQDLPN  132


>LINT_DROME unnamed protein product
Length=1693

 Score = 32.0 bits (71),  Expect = 1.00, Method: Composition-based stats.
 Identities = 27/97 (28%), Positives = 41/97 (42%), Gaps = 15/97 (15%)

Query  64    EPITDTNTLIDNEDDMRTKMELMIMRIQADVCRALEAEEYAGQKFKVDRWQRAEGGGGIT  123
             +P T  N L   E D   + +  I+ I    C   +  ++ G+   V  W R + GGG+ 
Sbjct  1537  DPATFENDLALLELDSPVQFDTHIVPI----CMPNDVADFTGRMATVTGWGRLKYGGGVP  1592

Query  124   CVLQD-----------GEVFEKAGVNISVVTGMLPPG  149
              VLQ+            E+F  AG N  ++T  L  G
Sbjct  1593  SVLQEVQVPIIENSVCQEMFHTAGHNKKILTSFLCAG  1629



Lambda      K        H
   0.323    0.137    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9813801108


Query= XP_011197180.1 hydroxymethylglutaryl-CoA lyase, mitochondrial
[Bactrocera dorsalis]

Length=330
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

D6XFK6_TRYB2  unnamed protein product                                 126     6e-33
Q583A8_9TRYP  unnamed protein product                                 126     6e-33
Q86NV1_DROME  unnamed protein product                                 42.7    3e-04


>D6XFK6_TRYB2 unnamed protein product
Length=431

 Score = 126 bits (317),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 90/284 (32%), Positives = 139/284 (49%), Gaps = 25/284 (9%)

Query  27   NAVRIVEVGPRDGLQNEPKLLPASVKIALIDQLSETGLRTIEATSFVSPKWVPQMGDNTE  86
            +++R+VE  PRD +Q  P  +P   KI  +  L + G   ++  SFVSP+ VPQM D+TE
Sbjct  9    SSIRMVEC-PRDAMQGLPHFIPTEQKIRYLKALLKCGFYALDCGSFVSPRAVPQMRDSTE  67

Query  87   VLRGIQK-----RTGITYPVLTPNLKGFESALKA-GATEVAVFGAASDSFSMKNINCTAA  140
            V+    K     +      V+  +L GF+ AL+  G + +       + F  +N   + A
Sbjct  68   VIANCWKTMQEEKAAPKLSVVVASLAGFKQALETPGVSVIGYPIGCCERFQQRNAKKSIA  127

Query  141  ESIKRFQPVIEA-----AQRA------EVKVRG-----YVSTVVGCPYEGAVKPSAVAKI  184
             S+   + + EA     AQR+         V G     Y+S   G PY  +     V K+
Sbjct  128  MSLDEIRNIKEATDAFNAQRSSNPVAPNEDVNGRELLIYISMAFGNPYGESHSIDLVEKL  187

Query  185  VNALFSLGCYEVSLGDTIGVGTPGSMRRMLDEVVKVVPPKKLAVHCHDTYGQALANILVS  244
            V  L + G  ++SL DT GV  P  +     ++ K  P    A H H    +A   I+ +
Sbjct  188  VGELVASGARDISLADTTGVAQPPLIFDTFTQLRKKFPDVTFAGHFHSNAVEARGKIVAA  247

Query  245  LEYGISVVDSSVSGLGGCPYAR--GASGNVATEDVVYMLHGMGI  286
            L+ G +++DS++ G+GGCP+A+  G  GNVATE VV  L   G+
Sbjct  248  LDAGCTMIDSALCGMGGCPFAKDDGLVGNVATEVVVKALEERGV  291


>Q583A8_9TRYP unnamed protein product
Length=431

 Score = 126 bits (317),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 90/284 (32%), Positives = 139/284 (49%), Gaps = 25/284 (9%)

Query  27   NAVRIVEVGPRDGLQNEPKLLPASVKIALIDQLSETGLRTIEATSFVSPKWVPQMGDNTE  86
            +++R+VE  PRD +Q  P  +P   KI  +  L + G   ++  SFVSP+ VPQM D+TE
Sbjct  9    SSIRMVEC-PRDAMQGLPHFIPTEQKIRYLKALLKCGFYALDCGSFVSPRAVPQMRDSTE  67

Query  87   VLRGIQK-----RTGITYPVLTPNLKGFESALKA-GATEVAVFGAASDSFSMKNINCTAA  140
            V+    K     +      V+  +L GF+ AL+  G + +       + F  +N   + A
Sbjct  68   VIANCWKTMQEEKAAPKLSVVVASLAGFKQALETPGVSVIGYPIGCCERFQQRNAKKSIA  127

Query  141  ESIKRFQPVIEA-----AQRA------EVKVRG-----YVSTVVGCPYEGAVKPSAVAKI  184
             S+   + + EA     AQR+         V G     Y+S   G PY  +     V K+
Sbjct  128  MSLDEIRNIKEATDAFNAQRSSNPVAPNEDVNGRELLIYISMAFGNPYGESHSIDLVEKL  187

Query  185  VNALFSLGCYEVSLGDTIGVGTPGSMRRMLDEVVKVVPPKKLAVHCHDTYGQALANILVS  244
            V  L + G  ++SL DT GV  P  +     ++ K  P    A H H    +A   I+ +
Sbjct  188  VGELVASGARDISLADTTGVAQPPLIFDTFTQLRKKFPDVTFAGHFHSNAVEARGKIVAA  247

Query  245  LEYGISVVDSSVSGLGGCPYAR--GASGNVATEDVVYMLHGMGI  286
            L+ G +++DS++ G+GGCP+A+  G  GNVATE VV  L   G+
Sbjct  248  LDAGCTMIDSALCGMGGCPFAKDDGLVGNVATEVVVKALEERGV  291


>Q86NV1_DROME unnamed protein product
Length=736

 Score = 42.7 bits (99),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/118 (25%), Positives = 50/118 (42%), Gaps = 6/118 (5%)

Query  184  IVNALFSLGCYEVSLGDTIGVGTPGSMRRMLDEVVKVVPPKKLAVHCHDTYGQALANILV  243
            + + L   G + + + D  G+  P S R ++  +    P   + +H HDT G  +A++L 
Sbjct  284  LADELVKAGTHVLCIKDMAGLLKPESARLLITAIRDKHPDIPIHIHTHDTSGAGVASMLA  343

Query  244  SLEYGISVVDSSVSGLGGCPYARGASGNVATEDVVYMLHGMGIETGVDLEKLIAVGRY  301
                G  VVD +V  + G          VA+      L G  ++T +DL  +     Y
Sbjct  344  CANAGADVVDVAVDSMSGMTSQPSMGAVVAS------LQGTPLDTNLDLRTVSEYSAY  395



Lambda      K        H
   0.323    0.137    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9813801108


Query= XP_011197181.1 uncharacterized protein LOC105221771 isoform X2
[Bactrocera dorsalis]

Length=771
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7KTL5_DROME  unnamed protein product                                 319     2e-98
Q8SZ50_DROME  unnamed protein product                                 298     6e-91
Q9VM57_DROME  unnamed protein product                                 297     9e-91


>Q7KTL5_DROME unnamed protein product
Length=657

 Score = 319 bits (817),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 262/808 (32%), Positives = 394/808 (49%), Gaps = 188/808 (23%)

Query  1    MSGLEKFQANSAWRAKVKKLLFMQRTLTPISKTPVQSD-----RFSLDLTEDLQVFIEGK  55
            MSGL+KFQ    WR K+++ L  +R    + K PV+ D     R+SL++ EDL+  +E +
Sbjct  1    MSGLKKFQNTEEWRQKLRQFLMTER----LPKKPVKMDETKDMRYSLEIDEDLRRPLEAR  56

Query  56   TISFEEQNLNHSTRLEGTQNTEEKMFEIENDENKPINVNASIQHKTKSKKAYYDESMFED  115
                                  +K+  + +   + +N+               +++M+E 
Sbjct  57   A---------------------KKVLAVNSASQRTVNLG--------------EDTMYEA  81

Query  116  KQQAVQWQRSSDDSFMALEKMCDKTASDPNSTLFQYIHSDDKELIVEDVKKRSGNDFKTP  175
                ++     DDSF A E+MCDKT SDP+STLFQY+HS+D+  ++   +  S +D K  
Sbjct  82   GD--LEHLDDGDDSFSAFERMCDKTGSDPDSTLFQYLHSEDRSQVMARARDHSTDDQK--  137

Query  176  CKKELQEIDEEAKSLQRLLHDLCVQEQKQLEIDTPLKGIDVTQLEDIEAPSKLWDTTILG  235
                  EID    +L+R+L  +   E   LE ++P+KG + T LEDIEAPS+ WD T+ G
Sbjct  138  ------EID----ALRRMLEAVGT-EDDLLENESPVKGAECTHLEDIEAPSRFWDNTLAG  186

Query  236  --ETT----------LQTSPVKMVGLLRPSTIIEECDEEDDFNNASCVDDDLSSHVSFQS  283
              ET+           + SPVKMVGLLRPSTIIE+ + E           D+SSH SFQS
Sbjct  187  MDETSSDSGLTPKALTKVSPVKMVGLLRPSTIIEDSELESS---------DVSSHTSFQS  237

Query  284  AVKGSETSATSYYDTAHETTDASAVSKDSKTHEEYVSKEVEDLDSSLELIQLDKTLAAPQ  343
            A +  +T+A+S Y+TA +T+ +  +    +     ++K      S  E ++L   L    
Sbjct  238  A-RTLKTNASSSYETATDTSLSGTLLNVDELFYAAIAKAKPPGMSKGEELELLSDLHGSL  296

Query  344  QQLISVLDITSDDPKIVHNTKNQSPSPSSDESVGVIELLSDDESEELITSHNKANITVKD  403
            ++L S+     ++ +          S S DE V ++  +  +++  + + H K       
Sbjct  297  RELASLPKDEVEEEEDDIEDTIIELSSSDDEEVQLVPEVKQEDTSRVSSVHGK-------  349

Query  404  EFKRECDSVVEDHNKPDKYLYKSLYTSSGLKSTESDELENSLENDKENCGEVFDESGEQS  463
                       DH                   TE    E S+EN KEN           S
Sbjct  350  -----------DH-------------------TEQKPAEKSVEN-KEN-----------S  367

Query  464  MHFNDTMEEVEYMMKKGMQYMAATASPNVGLNIQTPIVKKVELVPATMTVKPLKEKERTF  523
            +HFNDTMEE+EYMM+KGM+YMA  A     +    P++ K               K+ TF
Sbjct  368  LHFNDTMEEMEYMMQKGMEYMAGGAPSVAAVKADCPVLPKT--------------KQSTF  413

Query  524  TYSPKKQNSNYSSPAKKALNAKPTAIVTGTKAKQLLSSPRRTPQSSAQKNKRFEMDLRPM  583
              SPK +     SPA   L  +P+  +  +      + P+    SS+   K   + L   
Sbjct  414  VVSPKPEPK---SPAVAFL--QPSIPLRSS------NQPQTVVGSSSTGRKPLNVGLTME  462

Query  584  PKFELFKRPASAIPTR----LKEPTGSKQFSHIVSPVGAYMKKTATTPLMTNLKQRTDRP  639
               + F   AS IP R    +K+P     +++IVSP+  Y +K+ T PLM+    R    
Sbjct  463  WTKKKFFSAASGIPQRRQNQIKQP-----YANIVSPIRTYTQKSGTAPLMSTF--RPTSS  515

Query  640  DVHNATVFRELEQETKVHQPK--FALKVNT------------GTKTSS--LPKKAYISSE  683
            D+ +     ELEQE+++  PK  FA K  T            G  +++  LPKKAYISSE
Sbjct  516  DMLSTLAISELEQESRLCHPKALFATKDETPKSSEAESLIINGIDSAADLLPKKAYISSE  575

Query  684  FKHIVDERTPVTIPGGKKIQKYLENAMLPTVVRHEGKLKMSANQVNHKETANKASFGNTT  743
             KH+VDERTP+ +P   +IQKYL +A+ PTV+RH+GK+KM    V +       S  +  
Sbjct  576  IKHVVDERTPLPMPKVPQIQKYLNSAVEPTVMRHDGKMKMPGEAVRN------PSSSHIP  629

Query  744  QRNNGSLANLSLMSGDISVYTMKDARKF  771
            +R N SLA+LSL SGD+S+YT++DA+KF
Sbjct  630  RRANHSLADLSLASGDVSLYTIRDAQKF  657


>Q8SZ50_DROME unnamed protein product
Length=625

 Score = 298 bits (763),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 242/727 (33%), Positives = 361/727 (50%), Gaps = 148/727 (20%)

Query  81   FEIENDENKPINVNA----SIQHKTKSKKAYYDESMFEDKQQAVQWQRSSDDSFMALEKM  136
             EI+ D  +P+   A    ++   ++      +++M+E     ++     DDSF A E+M
Sbjct  11   LEIDEDLRRPLEARAKKVLAVNSASQRTVNLGEDTMYEAGD--LEHLDDGDDSFSAFERM  68

Query  137  CDKTASDPNSTLFQYIHSDDKELIVEDVKKRSGNDFKTPCKKELQEIDEEAKSLQRLLHD  196
            CDKT SDP+STLFQY+HS+D+  ++   +  S +D K        EID    +L+R+L  
Sbjct  69   CDKTGSDPDSTLFQYLHSEDRSQVMARARDHSTDDQK--------EID----ALRRMLEA  116

Query  197  LCVQEQKQLEIDTPLKGIDVTQLEDIEAPSKLWDTTILG--ETT----------LQTSPV  244
            +   E   LE ++P+KG + T LEDIEAPS+ WD T+ G  ET+           + SPV
Sbjct  117  VGT-EDDLLENESPVKGAECTHLEDIEAPSRFWDNTLAGMDETSSDSGLTPKALTKVSPV  175

Query  245  KMVGLLRPSTIIEECDEEDDFNNASCVDDDLSSHVSFQSAVKGSETSATSYYDTAHETTD  304
            KMVGLLRPSTIIE+ + E           D+SSH SFQSA +  +T+A+S Y+TA +T+ 
Sbjct  176  KMVGLLRPSTIIEDSELESS---------DVSSHTSFQSA-RTLKTNASSSYETATDTSL  225

Query  305  ASAVSKDSKTHEEYVSKEVEDLDSSLELIQLDKTLAAPQQQLISVLDITSDDPKIVHNTK  364
            +  +    +     ++K      S  E ++L   L    ++L S+     ++ +      
Sbjct  226  SGTLLNVDELFYAAIAKAKPPGMSKGEELELLSDLHGSLRELASLPKDEVEEEEDDIEDT  285

Query  365  NQSPSPSSDESVGVIELLSDDESEELITSHNKANITVKDEFKRECDSVVEDHNKPDKYLY  424
                S S DE V ++  +  +++  + + H K                  DH        
Sbjct  286  IIELSSSDDEEVQLVPEVKQEDTSRVSSVHGK------------------DH--------  319

Query  425  KSLYTSSGLKSTESDELENSLENDKENCGEVFDESGEQSMHFNDTMEEVEYMMKKGMQYM  484
                       TE    E S+EN KEN           S+HFNDTMEE+EYMM+KGM+YM
Sbjct  320  -----------TEQKPAEKSVEN-KEN-----------SLHFNDTMEEMEYMMQKGMEYM  356

Query  485  AATASPNVGLNIQTPIVKKVELVPATMTVKPLKEKERTFTYSPKKQNSNYSSPAKKALNA  544
            A  A     +    P++ K               K+ TF  SPK +     SPA   L  
Sbjct  357  AGGAPSVAAVKADCPVLPKT--------------KQSTFVVSPKPEPK---SPAVAFL--  397

Query  545  KPTAIVTGTKAKQLLSSPRRTPQSSAQKNKRFEMDLRPMPKFELFKRPASAIPTR----L  600
            +P+  +  +      + P+    SS+   K   + L      + F   AS IP R    +
Sbjct  398  QPSIPLRSS------NQPQTVVGSSSTGRKPLNVGLTMEWTKKKFFSAASGIPQRRQNQI  451

Query  601  KEPTGSKQFSHIVSPVGAYMKKTATTPLMTNLKQRTDRPDVHNATVFRELEQETKVHQPK  660
            K+P     +++IVSP+  Y +K+ T PLM+    R    D+ +     ELEQE+++  PK
Sbjct  452  KQP-----YANIVSPIRTYTQKSGTAPLMSTF--RPTSSDMLSTLAISELEQESRLCHPK  504

Query  661  --FALKVNT------------GTKTSS--LPKKAYISSEFKHIVDERTPVTIPGGKKIQK  704
              FA K  T            G  +++  LPKKAYISSE KH+VDERTP+ +P   +IQK
Sbjct  505  ALFAAKDETPKSSEAESLIINGIDSAADLLPKKAYISSEIKHVVDERTPLPMPKVPQIQK  564

Query  705  YLENAMLPTVVRHEGKLKMSANQVNHKETANKASFGNTTQRNNGSLANLSLMSGDISVYT  764
            YL +A+ PTV+RH+GK+KM    V +       S  +  +R N SLA+LSL SGD+S+YT
Sbjct  565  YLNSAVEPTVMRHDGKMKMPGEAVRN------PSSSHIPRRANHSLADLSLASGDVSLYT  618

Query  765  MKDARKF  771
            ++DA+KF
Sbjct  619  IRDAQKF  625


>Q9VM57_DROME unnamed protein product
Length=625

 Score = 297 bits (761),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 242/727 (33%), Positives = 361/727 (50%), Gaps = 148/727 (20%)

Query  81   FEIENDENKPINVNA----SIQHKTKSKKAYYDESMFEDKQQAVQWQRSSDDSFMALEKM  136
             EI+ D  +P+   A    ++   ++      +++M+E     ++     DDSF A E+M
Sbjct  11   LEIDEDLRRPLEARAKKVLAVNSASQRTVNLGEDTMYEAGD--LEHLDDGDDSFSAFERM  68

Query  137  CDKTASDPNSTLFQYIHSDDKELIVEDVKKRSGNDFKTPCKKELQEIDEEAKSLQRLLHD  196
            CDKT SDP+STLFQY+HS+D+  ++   +  S +D K        EID    +L+R+L  
Sbjct  69   CDKTGSDPDSTLFQYLHSEDRSQVMARARDHSTDDQK--------EID----ALRRMLEA  116

Query  197  LCVQEQKQLEIDTPLKGIDVTQLEDIEAPSKLWDTTILG--ETT----------LQTSPV  244
            +   E   LE ++P+KG + T LEDIEAPS+ WD T+ G  ET+           + SPV
Sbjct  117  VGT-EDDLLENESPVKGAECTHLEDIEAPSRFWDNTLAGMDETSSDSGLTPKALTKVSPV  175

Query  245  KMVGLLRPSTIIEECDEEDDFNNASCVDDDLSSHVSFQSAVKGSETSATSYYDTAHETTD  304
            KMVGLLRPSTIIE+ + E           D+SSH SFQSA +  +T+A+S Y+TA +T+ 
Sbjct  176  KMVGLLRPSTIIEDSELESS---------DVSSHTSFQSA-RTLKTNASSSYETATDTSL  225

Query  305  ASAVSKDSKTHEEYVSKEVEDLDSSLELIQLDKTLAAPQQQLISVLDITSDDPKIVHNTK  364
            +  +    +     ++K      S  E ++L   L    ++L S+     ++ +      
Sbjct  226  SGTLLNVDELFYAAIAKAKPPGMSKGEELELLSDLHGSLRELASLPKDEVEEEEDDIEDT  285

Query  365  NQSPSPSSDESVGVIELLSDDESEELITSHNKANITVKDEFKRECDSVVEDHNKPDKYLY  424
                S S DE V ++  +  +++  + + H K                  DH        
Sbjct  286  IIELSSSDDEEVQLVPEVKQEDTSRVSSVHGK------------------DH--------  319

Query  425  KSLYTSSGLKSTESDELENSLENDKENCGEVFDESGEQSMHFNDTMEEVEYMMKKGMQYM  484
                       TE    E S+EN KEN           S+HFNDTMEE+EYMM+KGM+YM
Sbjct  320  -----------TEQKPAEKSVEN-KEN-----------SLHFNDTMEEMEYMMQKGMEYM  356

Query  485  AATASPNVGLNIQTPIVKKVELVPATMTVKPLKEKERTFTYSPKKQNSNYSSPAKKALNA  544
            A  A     +    P++ K               K+ TF  SPK +     SPA   L  
Sbjct  357  AGGAPSVAAVKADCPVLPKT--------------KQSTFVVSPKPEPK---SPAVAFL--  397

Query  545  KPTAIVTGTKAKQLLSSPRRTPQSSAQKNKRFEMDLRPMPKFELFKRPASAIPTR----L  600
            +P+  +  +      + P+    SS+   K   + L      + F   AS IP R    +
Sbjct  398  QPSIPLRSS------NQPQTVVGSSSTGRKPLNVGLTMEWTKKKFFSAASGIPQRRQNQI  451

Query  601  KEPTGSKQFSHIVSPVGAYMKKTATTPLMTNLKQRTDRPDVHNATVFRELEQETKVHQPK  660
            K+P     +++IVSP+  Y +K+ T PLM+    R    D+ +     ELEQE+++  PK
Sbjct  452  KQP-----YANIVSPIRTYTQKSGTAPLMSTF--RPTSSDMLSTLAISELEQESRLCHPK  504

Query  661  --FALKVNT------------GTKTSS--LPKKAYISSEFKHIVDERTPVTIPGGKKIQK  704
              FA K  T            G  +++  LPKKAYISSE KH+VDERTP+ +P   +IQK
Sbjct  505  ALFATKDETPKSSEAESLIINGIDSAADLLPKKAYISSEIKHVVDERTPLPMPKVPQIQK  564

Query  705  YLENAMLPTVVRHEGKLKMSANQVNHKETANKASFGNTTQRNNGSLANLSLMSGDISVYT  764
            YL +A+ PTV+RH+GK+KM    V +       S  +  +R N SLA+LSL SGD+S+YT
Sbjct  565  YLNSAVEPTVMRHDGKMKMPGEAVRN------PSSSHIPRRANHSLADLSLASGDVSLYT  618

Query  765  MKDARKF  771
            ++DA+KF
Sbjct  619  IRDAQKF  625



Lambda      K        H
   0.323    0.137    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9813801108


Query= XP_011197182.1 ubiquitin conjugation factor E4 A [Bactrocera
dorsalis]

Length=1004
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O44007_DICDI  unnamed protein product                                 298     2e-85
UBE4_CAEEL  unnamed protein product                                   172     1e-43
G5ECY6_CAEEL  unnamed protein product                                 48.1    1e-05


>O44007_DICDI unnamed protein product
Length=1089

 Score = 298 bits (763),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 244/853 (29%), Positives = 412/853 (48%), Gaps = 80/853 (9%)

Query  172   TTQEFFVQTVVKVMAEDDQIEALGALKAIFYPMLAEVQKQLANINLITIKKNTFWTLSYF  231
             TT+E   + + K ++E  +      L  IF P+  ++ K L+   L       +   S  
Sbjct  291   TTEELTDEFIFKFLSEYQE-----DLTPIFEPIFLDLIKILSTTTLTGNVFPYYKVFSRL  345

Query  232   VRDKRVPQLGEVLIDYVTPNPNAKGSEYMDTLLGQLLCLSIMPKKSNGPFEFFAEISLET  291
             V+ K V  L   L  + +PN N K  E  +T+LG L   S      +   ++F+  S   
Sbjct  346   VQFKAVSDLVVTLQCWNSPNFNGKEME-RNTILGSLFSPSSASDDGSTIKQYFSNASTMN  404

Query  292   QHSDP----SLWQL-MAIHQDAVFALIKQLLVLSATTKKKTLQWISNCLHANISRGHLWS  346
             +++      S+ Q+ M IH + +  L+K  L +    K+  L W+++ +  N+ R  L  
Sbjct  405   KNTIGDAFISIRQIQMNIH-NGLVDLLKGFLKVQQENKEAFLSWLASAVEKNLERNKL--  461

Query  347   NINLPFEQVINQNA-SDSFMIGLTAVLLRLCAPLCE-PSMKVLLVDPTYCAVADADRQAK  404
                    QV    A SD F + L AVL+ LC    +    KV +VD  +          K
Sbjct  462   -------QVDRTKACSDGFALNLCAVLVLLCEAFVDIDCSKVSMVDTNFLLSGKRHDITK  514

Query  405   QVSLLKAAEETCLLPIDEHETRIVAEKFNFVTELFYMTHKAFELGYRACIERYTRMTREL  464
                L   +EE      D    + +A   NF+TE F+ T +A  +G  +  E+   + R L
Sbjct  515   DTRLCATSEEADQWVKDGTIEKPLAHT-NFITETFFSTLRALHIGINSTYEKLKLIGRNL  573

Query  465   HSLQTAYHDVA------QTNPNNDLAKNLLRML--KEQMQQYLC--MRNGLMEPTNDTHI  514
               ++     +       Q  P   L +  L +L  KE M + +   +   L EPT     
Sbjct  574   QDIENNKRVLLDSKIKWQNTPQGRLFEGQLDLLTKKEDMLKGITYTIDAQLFEPTFLQKT  633

Query  515   LKFFEATTIWLTEIALITEDEFKSAVAKQDFAPHTRKERQIPDKCEFIPPYLKSVPENVI  574
               F    T W+ ++                   +T     +P   +F      ++PE  I
Sbjct  634   ASFLLFATNWILKVI---------------NPKNTPLPLPLPAPPQF-----AALPEFCI  673

Query  575   DNVVAYLSF--SRHFPPGQFIEIYQSSHDALFKMIVLFMGSAELVKNPHLRAKLAEALEF  632
             +++V + +F  +      Q+I++ Q     L K  +  + + E VKNP+L+AK+ E +  
Sbjct  674   EDIVDFFTFVITNFSQVLQYIKLEQ-----LMKFFITILATPEYVKNPYLKAKIIEIISQ  728

Query  633   LLPKQISGSMRNSFITRVFDSNADRLKVVRSLLNVFVSIEMTGQSVQFEQKFNYRRPMYA  692
              +P + S    N  +        D +  V +L+  +V IE TG   QF +KF+YR     
Sbjct  729   FVPSKYSKG--NPILLECNQDVKDHM--VLALMRFYVDIEFTGGHNQFYEKFSYRHYSSL  784

Query  693   IMEYLWTKEDQVQCFKDLAREAEENMEAIEPPLFLRFINLLINDAIFLLDESLSNLEQIR  752
             I++YLW+  D  + F +  ++          P+F++FIN+LIND+I++LDE+L+ L +I+
Sbjct  785   ILKYLWSIPDFRKKFTETPKD----------PIFIKFINMLINDSIYVLDEALAKLAKIK  834

Query  753   QLQEAQSRGEWDA-LSQNDRQQQLSSLHHLGQMARIDNILGRDTINILKLLTTE--IKSI  809
             + Q       WD  L+   R++++       ++ + +  L    I+++  L+++  I S 
Sbjct  835   ENQTLFDDPNWDKDLTPEQRKEKIEQNDLNERICKSNLSLANSNIDMMLFLSSDKTIISG  894

Query  810   FCHNSMVDRIAAMLNYFLLNLVGPQKERFKVKDKKEFEFDPAQTVLEICRIYINLSSSEQ  869
             F    ++DRI+AM+NYFL  +VGP+    KV++ +++ F+P   + ++  IY+N     +
Sbjct  895   FMRPELIDRISAMMNYFLALIVGPKCTNLKVREPEKYHFNPKVLLNQLTEIYVNFGRDPR  954

Query  870   FCLAISQDGRSYSSELFNYAENILIR--IGGGQLIGEISDFAAKVQRMEVQYREEQEFMA  927
             F  ++ +DGRS+ + LF   E IL R  +     + E S    K++++  +  + +E + 
Sbjct  955   FLQSVVRDGRSFKNSLFQTCEKILQRERLKNDHELDEFSKLVIKLEQVAKEEEQAEEDLG  1014

Query  928   DAPDEYLDPIMSTLMTDPVILPSSKVTVDRSTIARHLLSDQTDPFNRAPLTMDKVQPNNE  987
             D PDE+ DPI+STLMTDPVILPSSK  +DR TI RHLLSDQTDPFNR+ LT + +  + E
Sbjct  1015  DIPDEFCDPILSTLMTDPVILPSSKTVIDRQTILRHLLSDQTDPFNRSHLTPEMLIDDVE  1074

Query  988   LKQKIETWMTEKR  1000
              K+KI+ W+  K+
Sbjct  1075  TKKKIDEWLASKK  1087


>UBE4_CAEEL unnamed protein product
Length=984

 Score = 172 bits (436),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 129/408 (32%), Positives = 206/408 (50%), Gaps = 30/408 (7%)

Query  601   DALFKMIVLFMGSAELVKNPHLRAKLAEALEFLLPKQISGSMRNSFITRVFDSNADRLKV  660
             D + ++ VLF      +K+P L +KL   L  + P      +R     R+   N     +
Sbjct  601   DWISRLTVLFT-QYHYIKSPFLVSKLVRVLSSIQPPLWFNVVR----LRMAQEN-----L  650

Query  661   VRSLLNVFVSIEMTGQSVQFEQKFNYRRPMYAIMEYLWTKEDQVQCFKDLAREAEENMEA  720
             +  ++  +   E  G    F +KFN R  +  ++E +         F D+ARE       
Sbjct  651   LMCMIKFYSDFEDNGD---FYEKFNVRGNIQYMLEKMEEDMFYKGKFMDMARECGAE---  704

Query  721   IEPPLFLRFINLLINDAIFLLDESLSNLEQIRQLQEAQS-RGEWDALSQNDRQQQLSSLH  779
                  F+RF+N++INDA + +DESLS L+ I  +++  + + EWD   Q  R Q L    
Sbjct  705   -----FIRFVNMVINDATWCIDESLSGLKSIHDVEKKMANKVEWDNTDQEIRNQDLGVYE  759

Query  780   HLGQMARIDNILGRDTINILKLLTTEIKSI--FCHNSMVDRIAAMLNYFLLNLVGPQKER  837
                +  ++   LG    N+  LL+  + S   F    + +R+AAMLN+ L  L+G +   
Sbjct  760   EAKR--KVKGWLGTAKSNLKLLLSITVNSPEPFRTPVLGERLAAMLNHNLSQLIGSKASE  817

Query  838   FKVKDKKEFEFDPAQTVLEICRIYINLSSSEQFCLAISQDGRSYSSELFNYAENILIR--  895
              KVKD + + ++P + V  +  IY+ L+    F   I+ D R+YS E F+ A   + +  
Sbjct  818   LKVKDPRSYGWEPREFVSLLISIYLKLNMP-AFVKYIAYDERTYSPEFFHNAIECMRKNS  876

Query  896   IGGGQLIGEISDFAAKVQRMEVQYREEQEFMADAPDEYLDPIMSTLMTDPVILPSSKVTV  955
             I G   +      A  V++      E +E   D P+E+ DPIM  +M DPV LPS  V +
Sbjct  877   IVGFSQLESFEHLAEDVKKEYEAKAELEEEYDDVPEEFKDPIMDAIMVDPVKLPSGHV-M  935

Query  956   DRSTIARHLLSDQTDPFNRAPLTMDKVQPNNELKQKIETWMTEKRAAK  1003
             DR+ I RHLLS   +PFNRAPL+ +++ P++ELK KI+ W+ +KR +K
Sbjct  936   DRAVIERHLLSTPNNPFNRAPLSHNELSPDSELKAKIQEWICQKRNSK  983


>G5ECY6_CAEEL unnamed protein product
Length=266

 Score = 48.1 bits (113),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 42/77 (55%), Gaps = 2/77 (3%)

Query  928   DAPDEYLDPIMSTLMTDPVILPSSKVTVDRSTIARHLLS-DQTDPFNRAPLTMDKVQPNN  986
             + P+     I   LM +PVI+PS  +T DR  I +HL      DP  R PLT +++ PN 
Sbjct  184   EVPEMLCGKITLELMKEPVIVPSG-ITYDREEIVQHLRRIGHFDPVTRKPLTENEIIPNY  242

Query  987   ELKQKIETWMTEKRAAK  1003
              LK+ IE ++ +   AK
Sbjct  243   ALKEVIEKFLDDNPWAK  259



Lambda      K        H
   0.323    0.137    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9813801108


Query= XP_011197183.1 LOW QUALITY PROTEIN: uncharacterized protein
LOC105221773 [Bactrocera dorsalis]

Length=2187
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ROCO5_DICDI  unnamed protein product                                  40.8    0.017


>ROCO5_DICDI unnamed protein product
Length=2800

 Score = 40.8 bits (94),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 19/55 (35%), Positives = 34/55 (62%), Gaps = 0/55 (0%)

Query  511  NSILKELWLAHNDLDCKDAEAIGSLLKYNHYIELIDISNNNIRDMGLLYIVDALI  565
            N  +  L L+ N ++   A A+G +L+YNH +  +D+S N I D GL+ ++D ++
Sbjct  777  NKSITHLTLSQNSINDPCAVALGDMLRYNHSLIQMDLSENTIADKGLISLIDGIL  831



Lambda      K        H
   0.323    0.137    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9813801108


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jan 6, 2022  1:11 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_011197184.2 E3 ubiquitin-protein ligase TRAIP [Bactrocera
dorsalis]

Length=602
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9XZS4_DROME  unnamed protein product                                 68.2    3e-13
Q7K1R6_DROME  unnamed protein product                                 69.3    7e-13
Q7K2X1_DROME  unnamed protein product                                 70.5    1e-12


>Q9XZS4_DROME unnamed protein product
Length=158

 Score = 68.2 bits (165),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 27/57 (47%), Positives = 37/57 (65%), Gaps = 0/57 (0%)

Query  6   CVICSEVYRNSDVICSTSCGHVFHFQCLQQWQSRETSCPQCRFRNPQTHKLYIDFDE  62
           C ICSE +R SD I + SCGH FH  CL  W+ +  +CP CR ++    +LY+DF+E
Sbjct  8   CTICSERFRTSDNIQAGSCGHAFHEDCLDHWRKQSRTCPICRSQDAAYFQLYLDFEE  64


>Q7K1R6_DROME unnamed protein product
Length=263

 Score = 69.3 bits (168),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 43/64 (67%), Gaps = 7/64 (11%)

Query  6   CVICSEVYRNSDVICSTS-CGHVFHFQCLQQWQSRETSCPQCRFRNP----QTHKLYIDF  60
           C IC+E +R +D+I STS CGHVFH  CL +W +R  +CPQC  R+P    + H+LY++F
Sbjct  32  CAICNEFFRANDIIFSTSRCGHVFHKDCLTRWLNRSRTCPQC--RDPCDRRRVHRLYLNF  89

Query  61  DETA  64
            E  
Sbjct  90  AEAP  93


>Q7K2X1_DROME unnamed protein product
Length=435

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 48/91 (53%), Gaps = 11/91 (12%)

Query  1   MPGLSCVICSEVYRNSDVICSTSCGHVFHFQCLQQWQSRETSCPQCRFRNPQTHKLYIDF  60
           M  L+CVIC+E++  +D + +T CGH+FH  CL QW  R  +CPQCR +    +   + F
Sbjct  1   MLNLNCVICAELFGQADEVFATVCGHMFHHNCLNQWLDRSKTCPQCRNKCTTRNIFRVYF  60

Query  61  DETATDIKLNETKAQLDLTEKSRSELQLQLD  91
           +            A LD++      LQ QLD
Sbjct  61  N-----------LANLDVSHIDVGSLQEQLD  80



Lambda      K        H
   0.311    0.126    0.334 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7143864416


Query= XP_011197185.2 solute carrier organic anion transporter family
member 4A1 [Bactrocera dorsalis]

Length=740
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7KTG4_DROME  unnamed protein product                                 338     5e-102
Q9VLB3_DROME  unnamed protein product                                 338     2e-101
Q9VVH9_DROME  unnamed protein product                                 237     5e-67 


>Q7KTG4_DROME unnamed protein product
Length=1136

 Score = 338 bits (868),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 225/704 (32%), Positives = 338/704 (48%), Gaps = 95/704 (13%)

Query  81   KPKFLQRFCNAKWALFWLCWGGAMQGLIVNGFINVVITTIERRFGLRSRQTGLVASGYDI  140
            +P  +QRF   K  +  L     MQ  + +G+IN VITTIE+RF + S  +GL+AS Y+I
Sbjct  98   RPYGIQRFARIKIFVVLLSLLVMMQQALSSGYINSVITTIEKRFEIPSSYSGLIASSYEI  157

Query  141  ASFVCLVPVTYFGGRVGASKPKILAWGVILMGIGSLTFALPHFLVSSYRA----TMSDSN  196
             + + ++ V+Y G R     P  +  G ++MGIGSL F +PHF             +  N
Sbjct  158  GNVITVIFVSYLGSR--RHIPVWIGIGAVIMGIGSLVFMVPHFTGEPNPGIAIVNKTSDN  215

Query  197  VCQS---------------GATNGTHYETCSSEADTFAEQENLSWTVWLFFLAQLLHGAG  241
            +C+S               G +N         E +    + + +  V LF LAQLL G G
Sbjct  216  ICKSALVRDQDMDLGRLSSGLSNQPLAPHTLREDNCLEGKASTTGPVLLFVLAQLLLGCG  275

Query  242  ASPLFTLGVTYIDENVSTKMSSVYLGIFYTMAIIGPAVGYVLGGQLLLIYTEFMTVDASD  301
             SPLFTLG TY+D++V T+ SS+Y+G  Y+M   GP VG++LG  LL  + +  ++ ++ 
Sbjct  276  GSPLFTLGTTYVDDHVRTESSSMYIGFMYSMGAFGPVVGFLLGAYLLSFHMD--SLSSTT  333

Query  302  LGLTSSSKVWIGAWWIGFIFAAIACFLLSIPIFGYPSSLPGAK-----------------  344
            + +T   + W+G WW GF+   +   ++++P F +P  L   K                 
Sbjct  334  ISITPGDRRWVGMWWGGFLLCGVILLVVAVPFFSFPKVLAREKKKIRKSSVVQPVLPNNS  393

Query  345  -------ELQQQKVSE--AYNADGQQIEQPFT-------KLKDMPSALLSLLKNPTFFCL  388
                   E+ + K  E  A  +   Q + P          +KD+P ++L L+KNP +   
Sbjct  394  RATVATDEMGKVKKLEIVAVTSKEDQSQAPPKVDTGYGKDIKDIPQSMLRLVKNPVYIVT  453

Query  389  NMAGATEGLVIAGFAAFLPKQIENQFSISPVWSALLMGLITVPAGGGGTFLGGYLIKKLK  448
             +    E ++++GF  FLPK +E QFS+    + +  G I VP    G FLGG ++K+ +
Sbjct  454  CLGACMELMIVSGFVVFLPKYLETQFSLGKSQANIFTGSIAVPGACIGIFLGGCILKRFQ  513

Query  449  LNCANIIKMCLIMTTIS-AFFTSCFLLSCPNLAFAGVTTQYRREVLKDSAKEMTNLTDGV  507
            L     ++  LI   I  A +   F L C NL  AG T  Y       S  E        
Sbjct  514  LKPKGAVQFVLITNVICLACYAMLFFLGCDNLKMAGTTIPYYTSNKHGSTLEQP------  567

Query  508  GRSYLGMQLQSSCNVGCGCSKLNYEPICGADGILYYSPCFAGCLEEYHLNQVKIYTNCSC  567
                  + L ++CN GC C     EP+CG +G+ Y+SPC AGC      +    YTNC+C
Sbjct  568  ----FQVNLTAACNFGCECLTSEVEPVCGNNGLTYFSPCHAGCTAFSSTSNTN-YTNCAC  622

Query  568  IDKQLFDS----------------------GDAPDATNLMCKSTCHYLSYFVGLCFVLML  605
            +   +  S                         P AT   C + C  +  F+ L F +  
Sbjct  623  VRANISSSIYRGAGGSQAQALSANENFAEVTVVPVATAGPCATPCRTIYPFLILLFFMTF  682

Query  606  FTFLSTMPALSATLRCVRDDQRSFALGIQWIKVRLFGTIPAPMIFGKLIDDSCILWQETC  665
                + MP L   LR V +++RSFALG+Q++  RLFG IPAP++FG LID +CILW+ +C
Sbjct  683  LVASTQMPLLMIVLRSVSEEERSFALGMQFVIFRLFGYIPAPILFGNLIDSTCILWKSSC  742

Query  666  DEDGSGVGACLVYDNYNMS-KYMWLLALVGKTLSVIFFFGALWF  708
             E G   G CL+YD      KY+ L A V K ++++ F    W 
Sbjct  743  GEKG---GRCLIYDIEKFRYKYVGLCASV-KLIALVIFMVDWWL  782


>Q9VLB3_DROME unnamed protein product
Length=1197

 Score = 338 bits (866),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 226/704 (32%), Positives = 340/704 (48%), Gaps = 95/704 (13%)

Query  81   KPKFLQRFCNAKWALFWLCWGGAMQGLIVNGFINVVITTIERRFGLRSRQTGLVASGYDI  140
            +P  +QRF   K  +  L     MQ  + +G+IN VITTIE+RF + S  +GL+AS Y+I
Sbjct  159  RPYGIQRFARIKIFVVLLSLLVMMQQALSSGYINSVITTIEKRFEIPSSYSGLIASSYEI  218

Query  141  ASFVCLVPVTYFGGRVGASKPKILAWGVILMGIGSLTFALPHFLVSSYRA----TMSDSN  196
             + + ++ V+Y G R     P  +  G ++MGIGSL F +PHF             +  N
Sbjct  219  GNVITVIFVSYLGSR--RHIPVWIGIGAVIMGIGSLVFMVPHFTGEPNPGIAIVNKTSDN  276

Query  197  VCQS---------------GATNGTHYETCSSEADTFAEQENLSWTVWLFFLAQLLHGAG  241
            +C+S               G +N         E +    + + +  V LF LAQLL G G
Sbjct  277  ICKSALVRDQDMDLGRLSSGLSNQPLAPHTLREDNCLEGKASTTGPVLLFVLAQLLLGCG  336

Query  242  ASPLFTLGVTYIDENVSTKMSSVYLGIFYTMAIIGPAVGYVLGGQLLLIYTEFMTVDASD  301
             SPLFTLG TY+D++V T+ SS+Y+G  Y+M   GP VG++LG  LL  + +  ++ ++ 
Sbjct  337  GSPLFTLGTTYVDDHVRTESSSMYIGFMYSMGAFGPVVGFLLGAYLLSFHMD--SLSSTT  394

Query  302  LGLTSSSKVWIGAWWIGFIFAAIACFLLSIPIFGYPSSLPGAK-----------------  344
            + +T   + W+G WW GF+   +   ++++P F +P  L   K                 
Sbjct  395  ISITPGDRRWVGMWWGGFLLCGVILLVVAVPFFSFPKVLAREKKKIRKSSVVQPVLPNNS  454

Query  345  -------ELQQQKVSE--AYNADGQQIEQP-------FTKLKDMPSALLSLLKNPTFFCL  388
                   E+ + K  E  A  +   Q + P          +KD+P ++L L+KNP +   
Sbjct  455  RATVATDEMGKVKKLEIVAVTSKEDQSQAPPKVDTGYGKDIKDIPQSMLRLVKNPVYIVT  514

Query  389  NMAGATEGLVIAGFAAFLPKQIENQFSISPVWSALLMGLITVPAGGGGTFLGGYLIKKLK  448
             +    E ++++GF  FLPK +E QFS+    + +  G I VP    G FLGG ++K+ +
Sbjct  515  CLGACMELMIVSGFVVFLPKYLETQFSLGKSQANIFTGSIAVPGACIGIFLGGCILKRFQ  574

Query  449  LNCANIIKMCLIMTTIS-AFFTSCFLLSCPNLAFAGVTTQYRREVLKDSAKEMTNLTDGV  507
            L     ++  LI   I  A +   F L C NL  AG T  Y       S  E        
Sbjct  575  LKPKGAVQFVLITNVICLACYAMLFFLGCDNLKMAGTTIPYYTSNKHGSTLEQP------  628

Query  508  GRSYLGMQLQSSCNVGCGCSKLNYEPICGADGILYYSPCFAGCLEEYHLNQVKIYTNCSC  567
                  + L ++CN GC C     EP+CG +G+ Y+SPC AGC      +    YTNC+C
Sbjct  629  ----FQVNLTAACNFGCECLTSEVEPVCGNNGLTYFSPCHAGCTAFSSTSNTN-YTNCAC  683

Query  568  IDKQLFDS-----GDA-----------------PDATNLMCKSTCHYLSYFVGLCFVLML  605
            +   +  S     G +                 P AT   C + C  +  F+ L F +  
Sbjct  684  VRANISSSIYRGAGGSQAQALSANENFAEVTVVPVATAGPCATPCRTIYPFLILLFFMTF  743

Query  606  FTFLSTMPALSATLRCVRDDQRSFALGIQWIKVRLFGTIPAPMIFGKLIDDSCILWQETC  665
                + MP L   LR V +++RSFALG+Q++  RLFG IPAP++FG LID +CILW+ +C
Sbjct  744  LVASTQMPLLMIVLRSVSEEERSFALGMQFVIFRLFGYIPAPILFGNLIDSTCILWKSSC  803

Query  666  DEDGSGVGACLVYDNYNMS-KYMWLLALVGKTLSVIFFFGALWF  708
             E G   G CL+YD      KY+ L A V K ++++ F    W 
Sbjct  804  GEKG---GRCLIYDIEKFRYKYVGLCASV-KLIALVIFMVDWWL  843


>Q9VVH9_DROME unnamed protein product
Length=819

 Score = 237 bits (604),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 176/655 (27%), Positives = 291/655 (44%), Gaps = 82/655 (13%)

Query  81   KPKFLQRFCNAKWALFWLCWGGAMQGLIVNGFINVVITTIERRFGLRSRQTGLVASGYDI  140
            +P++ +RF +    +        +QG+ +  F++V ITTIE+ F ++S+ TG++ S  ++
Sbjct  163  RPRWARRFASTHVFMVVFLLAYILQGMYMTYFVSV-ITTIEKLFQIKSKTTGILLSASEM  221

Query  141  ASFVCLVPVTYFGGRVGASKPKILAWGVILMGIGSLTFALPHFL----------------  184
                  + +TYF GR    +P+ +A G++L  I + + ALPHF+                
Sbjct  222  GQICTAMLLTYFAGR--GHRPRWIACGMVLFSIAAFSCALPHFIFGEQLMHSSVILQQTQ  279

Query  185  VSSYRATMS-----------DSNVCQSGATNGTHYETCSSEADTFAEQENLSWTVW---L  230
            VS    + S           + N+C  G  N TH  +  +E     +  +   TV    +
Sbjct  280  VSPPNNSFSSHWLNASSEQVNPNLCILGG-NQTHSGSECNEERQLEQASHSKITVIVLCI  338

Query  231  FFLAQLLHGAGASPLFTLGVTYIDENVSTKMSSVYLGIFYTMAIIGPAVGYVLGGQLLLI  290
            FF + L  G G + + TLG+ YID+NV +K S +Y+ +   M I+GPA G++ G      
Sbjct  339  FFGSLLSSGIGQTAVATLGIPYIDDNVGSKQSPMYMAVTIGMRILGPASGFIFGSFCTRW  398

Query  291  YTEFMTVDASDLGLTSSSKVWIGAWWIGFIFAAIACFLLSIPIFGYPSSLPGAKELQQQK  350
            Y  F     S+ G  ++   WIGAWW+G +       L SI +F +P  L G ++   Q 
Sbjct  399  YVNF-----SNPGFDATDPRWIGAWWLGPVAIGSLMLLASIAMFSFPKQLRGKQKPPGQT  453

Query  351  VSEAYNADGQQIEQPFTKLKDMPSALLSLLKNPTFFCLNMAGATEGLVIAGFAAFLPKQI  410
             + A   + +  E+P  KLKD P  +   L N        +     L IAG   FLPK +
Sbjct  454  ATPAAPVEPE--EKP--KLKDFPKTVRRQLSNDILMFRTASCVFHLLPIAGLYTFLPKYL  509

Query  411  ENQFSISPVWSALLMGLITVPAGGGGTFLGGYLIKKLKLNCANIIK-MCLIMTTISAFFT  469
            E QF ++   + ++     +   G G  + G  I K K     +   +       SA   
Sbjct  510  ETQFRLATYDANMIAAFCGILVMGIGIVISGLFILKRKPTARGVAAWIAFTALVYSAGMI  569

Query  470  SCFLLSCPNLAFAGVTTQYRREVLKDSAKEMTNLTDGVGRSYLGMQLQSSCNVGCGCSKL  529
                + C    FAG                        G S   ++   S  + C C K 
Sbjct  570  ILMFIGCSMNDFAGYKPSD-------------------GNSPALIEPTCSAALNCTCDKE  610

Query  530  NYEPICGADGILYYSPCFAGCLEE--YHLNQVKIYTNCSCIDKQLFDSGDAPDATNLMCK  587
            N+ PIC ADG +Y S C AGC        +   +Y++C+CI        DAP+A N  C 
Sbjct  611  NFAPIC-ADGKMYISACHAGCSSSSLRPSDNRTLYSDCACIP-------DAPEAVNGYCD  662

Query  588  STCHYLSYFVGLCFVLMLFTFLSTMPALSATLRCVRDDQRSFALGIQWIKVRLFGTIPAP  647
            + C    YF+ +  + +     S + ++   +RC     ++ A+G+    + LFG +P P
Sbjct  663  NNCKNFIYFILIFAICVFMHSTSEVGSMLLVMRCTHPKDKAMAMGVIQSAIGLFGNVPCP  722

Query  648  MIFGKLIDDSCILWQETCDEDGSGVGACLVYDNYNMSKYMWLLALVGKTLSVIFF  702
            +I+G ++D +C++W+  C +     GAC +YD     +Y      +G T  ++F 
Sbjct  723  IIYGAVVDSACLIWKSVCGKH----GACSLYDADTFRQY-----FLGITAGIMFL  768



Lambda      K        H
   0.311    0.126    0.334 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7143864416


Query= XP_011197186.1 U6 snRNA-associated Sm-like protein LSm7 [Bactrocera
dorsalis]

Length=112
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VJI7_DROME  unnamed protein product                                 194     1e-65
Q23543_CAEEL  unnamed protein product                                 128     1e-39
RUXG_CAEEL  unnamed protein product                                   58.5    1e-12


>Q9VJI7_DROME unnamed protein product
Length=110

 Score = 194 bits (492),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 99/111 (89%), Positives = 103/111 (93%), Gaps = 2/111 (2%)

Query  1    MAEKPKTSGGNDGKEKRRKESILDLSKYLEKQIRVKFAGGREAAGILKGYDALLNLVLDN  60
            MA+K K  G NDGKEKRRKESILDLSKYLEKQIRVKFAGGREA+GILKGYDALLNLVLDN
Sbjct  1    MADK-KVGGNNDGKEKRRKESILDLSKYLEKQIRVKFAGGREASGILKGYDALLNLVLDN  59

Query  61   TVEYLRDVDEPFKLAEE-TRSLGLVVCRGTALVLICPQDGMESIPNPFITQ  110
            TVEYLRD DEP+KL EE TRSLGLVVCRGTALVLICPQDG+ESI NPFITQ
Sbjct  60   TVEYLRDSDEPYKLTEEQTRSLGLVVCRGTALVLICPQDGVESIANPFITQ  110


>Q23543_CAEEL unnamed protein product
Length=104

 Score = 128 bits (321),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 78/96 (81%), Gaps = 0/96 (0%)

Query  16   KRRKESILDLSKYLEKQIRVKFAGGREAAGILKGYDALLNLVLDNTVEYLRDVDEPFKLA  75
            KR+KES++DL+++L+K+IRVKF GGREA+G+L+G+D LLN+VLD+  EYLRD   P  + 
Sbjct  7    KRKKESVVDLTRFLDKEIRVKFQGGREASGVLRGFDQLLNMVLDDCREYLRDPQNPSVVG  66

Query  76   EETRSLGLVVCRGTALVLICPQDGMESIPNPFITQD  111
            +ETR LGL+V RGTA+ ++ P DG+E I NPF TQ+
Sbjct  67   DETRQLGLIVARGTAITVVSPADGLEQIANPFATQE  102


>RUXG_CAEEL unnamed protein product
Length=77

 Score = 58.5 bits (140),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 48/75 (64%), Gaps = 8/75 (11%)

Query  24  DLSKYLEKQIRVKFAGGREAAGILKGYDALLNLVLDNTVEYLRDVDEPFKLAEETRSLGL  83
           +L KY++K++ +K  G R  +GIL+G+D  +N+V+D  VEY +D          + +LG+
Sbjct  8   ELKKYMDKEMDLKLNGNRRVSGILRGFDPFMNMVIDEAVEYQKD--------GGSVNLGM  59

Query  84  VVCRGTALVLICPQD  98
            V RG ++V++ P++
Sbjct  60  TVIRGNSVVIMEPKE  74



Lambda      K        H
   0.311    0.126    0.334 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7143864416


Query= XP_011197187.1 uncharacterized protein So5a1 [Bactrocera dorsalis]

Length=1385
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VLB3_DROME  unnamed protein product                                 1621    0.0   
Q7KTG4_DROME  unnamed protein product                                 1617    0.0   
Q8IH70_DROME  unnamed protein product                                 404     3e-129


>Q9VLB3_DROME unnamed protein product
Length=1197

 Score = 1621 bits (4197),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 824/1124 (73%), Positives = 926/1124 (82%), Gaps = 88/1124 (8%)

Query  255   DDDELQSRDCGILNYRPGRIQKFARIKVFVLLLSILVTLQQALSSGYINSVITTIEKRFE  314
             D+++ +S DCGILN RP  IQ+FARIK+FV+LLS+LV +QQALSSGYINSVITTIEKRFE
Sbjct  144   DEEQFRSGDCGILNCRPYGIQRFARIKIFVVLLSLLVMMQQALSSGYINSVITTIEKRFE  203

Query  315   IPSSYSGLIASSYEIGNVITVIFVSYLGSRRHIPVWIGIGAAIMGIGSLVFMVPHFTGEP  374
             IPSSYSGLIASSYEIGNVITVIFVSYLGSRRHIPVWIGIGA IMGIGSLVFMVPHFTGEP
Sbjct  204   IPSSYSGLIASSYEIGNVITVIFVSYLGSRRHIPVWIGIGAVIMGIGSLVFMVPHFTGEP  263

Query  375   NPGVTIMNDSSDNICRSALVRDQDMDLGRLSSGLSNPPLAPHTLREDNCLEGKLSTFGPV  434
             NPG+ I+N +SDNIC+SALVRDQDMDLGRLSSGLSN PLAPHTLREDNCLEGK ST GPV
Sbjct  264   NPGIAIVNKTSDNICKSALVRDQDMDLGRLSSGLSNQPLAPHTLREDNCLEGKASTTGPV  323

Query  435   LLFVIAQLLLGCGGSPLFTLGTTYVDDHVKTESSSMYIGCMYSMAAFGPVLGFLLGAYLL  494
             LLFV+AQLLLGCGGSPLFTLGTTYVDDHV+TESSSMYIG MYSM AFGPV+GFLLGAYLL
Sbjct  324   LLFVLAQLLLGCGGSPLFTLGTTYVDDHVRTESSSMYIGFMYSMGAFGPVVGFLLGAYLL  383

Query  495   SFHMDSLSSTIISINPGDRRWVGMWWGGFLLCGVLLLIVAVPFFSFPKVLTTEKKKIRKS  554
             SFHMDSLSST ISI PGDRRWVGMWWGGFLLCGV+LL+VAVPFFSFPKVL  EKKKIRKS
Sbjct  384   SFHMDSLSSTTISITPGDRRWVGMWWGGFLLCGVILLVVAVPFFSFPKVLAREKKKIRKS  443

Query  555   SVIQPAVPNNSNSLPRGTDPAGKVKK-EIVAVSAKEDDE---PRVDTGYGKDIKDIPQSM  610
             SV+QP +PNNS +    TD  GKVKK EIVAV++KED     P+VDTGYGKDIKDIPQSM
Sbjct  444   SVVQPVLPNNSRAT-VATDEMGKVKKLEIVAVTSKEDQSQAPPKVDTGYGKDIKDIPQSM  502

Query  611   LRLVTNPVYIVTCLGACMELWIVSGFVVFLPKYLETQFSVGKSQASVFTGSIAVPGACIG  670
             LRLV NPVYIVTCLGACMEL IVSGFVVFLPKYLETQFS+GKSQA++FTGSIAVPGACIG
Sbjct  503   LRLVKNPVYIVTCLGACMELMIVSGFVVFLPKYLETQFSLGKSQANIFTGSIAVPGACIG  562

Query  671   IFIGGCILKRFQLKPKGAVQFVIISNAICLALYAMLFFLGCDNLKMAGTTIPYYRSAKHG  730
             IF+GGCILKRFQLKPKGAVQFV+I+N ICLA YAMLFFLGCDNLKMAGTTIPYY S KHG
Sbjct  563   IFLGGCILKRFQLKPKGAVQFVLITNVICLACYAMLFFLGCDNLKMAGTTIPYYTSNKHG  622

Query  731   --VIEPFQVNLTAACNFGCECLTTDVEPVCGNNGLTYFSPCHAGCTAFSSTS--NYTNCA  786
               + +PFQVNLTAACNFGCECLT++VEPVCGNNGLTYFSPCHAGCTAFSSTS  NYTNCA
Sbjct  623   STLEQPFQVNLTAACNFGCECLTSEVEPVCGNNGLTYFSPCHAGCTAFSSTSNTNYTNCA  682

Query  787   CVHSNISSSIYMGAGGSQAQALNANEDFAEVTVVPVATAGPCATPCRTIYPFLILLFFMT  846
             CV +NISSSIY GAGGSQAQAL+ANE+FAEVTVVPVATAGPCATPCRTIYPFLILLFFMT
Sbjct  683   CVRANISSSIYRGAGGSQAQALSANENFAEVTVVPVATAGPCATPCRTIYPFLILLFFMT  742

Query  847   FIVASTQMPLLMIVLRSVSEEERSFALGMQFVIFRLFGYIPAPILFGNLIDSTCLLWKST  906
             F+VASTQMPLLMIVLRSVSEEERSFALGMQFVIFRLFGYIPAPILFGNLIDSTC+LWKS+
Sbjct  743   FLVASTQMPLLMIVLRSVSEEERSFALGMQFVIFRLFGYIPAPILFGNLIDSTCILWKSS  802

Query  907   CGEKGGRCLIYDIEKFRYKYVGLCATVKIVALAIFIADWWLVRRRKQLEKLKPINANDPI  966
             CGEKGGRCLIYDIEKFRYKYVGLCA+VK++AL IF+ DWWLVRRRKQLEK+KP+NA+DPI
Sbjct  803   CGEKGGRCLIYDIEKFRYKYVGLCASVKLIALVIFMVDWWLVRRRKQLEKMKPLNASDPI  862

Query  967   IGSIISLDKLFEEKLTTNDTNPQY-GSNGEIILTSDALRHSRNDSRTIQLEYGYDKCNNA  1025
             IGSIISLDKLFEEKL+  + +  + G  GE+I+ +D LRHSRNDSRT+ ++Y YDKC   
Sbjct  863   IGSIISLDKLFEEKLSGAEPSTAFVGGGGELIIPTDILRHSRNDSRTMHMDYCYDKCGRV  922

Query  1026  INSSGL-SKPQTKSKKHFRSASCDVKMIRSFSKDQNIAPGTTSTDG--GMHEPIKIKSLK  1082
             +  +   ++PQTKSKKHFRSASCDVKMI+SF++D + + G     G   +    K K+LK
Sbjct  923   VTPANTCNQPQTKSKKHFRSASCDVKMIKSFARDHSSSSGPADAAGQDAVGASTKYKNLK  982

Query  1083  RFQTHSRNNSSDLNSDFRHKLTHSRTNSRDDAGALNIRYIQNQLKPQE--DEEDDDELTT  1140
             +FQ H+RN+S+DL+                   +  IRYIQNQL+PQ+  +E+DD+ELTT
Sbjct  983   KFQAHTRNHSTDLHDP-----------------SQPIRYIQNQLRPQDCPEEDDDEELTT  1025

Query  1141  GCGHFVKKHARNHSYDQIYMPNNIRFDADFFR--NHHNNKNKNVNVLKNVMNREENRVKN  1198
             GCGHFVKKH+RNHSYDQIYMPNNIRFDADF R  + H+N  KNVNVLKNV++ +  ++KN
Sbjct  1026  GCGHFVKKHSRNHSYDQIYMPNNIRFDADFLRHPHSHHNPKKNVNVLKNVVS-DVGKLKN  1084

Query  1199  SNETEAAAAAALAATAVSSRGHSRNNSKDLNTRTAATTTSNNSNATTPACIGGAAVGGGA  1258
             SNE EA  A         SRGHSRNNSKDLNT+ +         + TPA          +
Sbjct  1085  SNEIEAGGAG--------SRGHSRNNSKDLNTKIS---------SATPA----------S  1117

Query  1259  GAVVVGAAHNVAEAALNILRHRRTNSKDLNYTLCTGSERNDLGSSTACSSNASTPAHGSG  1318
             G VV  A    +   L++LRHRRTNSKDLNY +   S         A SS+ S  AH   
Sbjct  1118  GQVVTDA----STTGLSVLRHRRTNSKDLNYQVLPES---------AASSSVSGHAHPQ-  1163

Query  1319  GGAAAVLHLKHAHARKASHHKIQIDDERNELISSARDDEDDSNA  1362
                         H R  SHHKIQIDD+RNELI+   D+E++ +A
Sbjct  1164  ------------HTRNTSHHKIQIDDDRNELINDNDDEEEERSA  1195


 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 46/69 (67%), Gaps = 6/69 (9%)

Query  72   GTTASTGAEGNCTHVGEGVCRNHSTASSTTHRRGHRRQESMYQMTGLYSETNTSGDDSSV  131
            G  A  GA GN +    G   N +    T +R+GHRRQESMYQMTGLYSETN SGDDSS+
Sbjct  26   GGVADVGA-GNASSSSNGHIANDA---GTANRKGHRRQESMYQMTGLYSETN-SGDDSSI  80

Query  132  DAAT-QDSQ  139
            DAA   DSQ
Sbjct  81   DAALDHDSQ  89


>Q7KTG4_DROME unnamed protein product
Length=1136

 Score = 1617 bits (4188),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 824/1124 (73%), Positives = 926/1124 (82%), Gaps = 88/1124 (8%)

Query  255   DDDELQSRDCGILNYRPGRIQKFARIKVFVLLLSILVTLQQALSSGYINSVITTIEKRFE  314
             D+++ +S DCGILN RP  IQ+FARIK+FV+LLS+LV +QQALSSGYINSVITTIEKRFE
Sbjct  83    DEEQFRSGDCGILNCRPYGIQRFARIKIFVVLLSLLVMMQQALSSGYINSVITTIEKRFE  142

Query  315   IPSSYSGLIASSYEIGNVITVIFVSYLGSRRHIPVWIGIGAAIMGIGSLVFMVPHFTGEP  374
             IPSSYSGLIASSYEIGNVITVIFVSYLGSRRHIPVWIGIGA IMGIGSLVFMVPHFTGEP
Sbjct  143   IPSSYSGLIASSYEIGNVITVIFVSYLGSRRHIPVWIGIGAVIMGIGSLVFMVPHFTGEP  202

Query  375   NPGVTIMNDSSDNICRSALVRDQDMDLGRLSSGLSNPPLAPHTLREDNCLEGKLSTFGPV  434
             NPG+ I+N +SDNIC+SALVRDQDMDLGRLSSGLSN PLAPHTLREDNCLEGK ST GPV
Sbjct  203   NPGIAIVNKTSDNICKSALVRDQDMDLGRLSSGLSNQPLAPHTLREDNCLEGKASTTGPV  262

Query  435   LLFVIAQLLLGCGGSPLFTLGTTYVDDHVKTESSSMYIGCMYSMAAFGPVLGFLLGAYLL  494
             LLFV+AQLLLGCGGSPLFTLGTTYVDDHV+TESSSMYIG MYSM AFGPV+GFLLGAYLL
Sbjct  263   LLFVLAQLLLGCGGSPLFTLGTTYVDDHVRTESSSMYIGFMYSMGAFGPVVGFLLGAYLL  322

Query  495   SFHMDSLSSTIISINPGDRRWVGMWWGGFLLCGVLLLIVAVPFFSFPKVLTTEKKKIRKS  554
             SFHMDSLSST ISI PGDRRWVGMWWGGFLLCGV+LL+VAVPFFSFPKVL  EKKKIRKS
Sbjct  323   SFHMDSLSSTTISITPGDRRWVGMWWGGFLLCGVILLVVAVPFFSFPKVLAREKKKIRKS  382

Query  555   SVIQPAVPNNSNSLPRGTDPAGKVKK-EIVAVSAKEDDE---PRVDTGYGKDIKDIPQSM  610
             SV+QP +PNNS +    TD  GKVKK EIVAV++KED     P+VDTGYGKDIKDIPQSM
Sbjct  383   SVVQPVLPNNSRAT-VATDEMGKVKKLEIVAVTSKEDQSQAPPKVDTGYGKDIKDIPQSM  441

Query  611   LRLVTNPVYIVTCLGACMELWIVSGFVVFLPKYLETQFSVGKSQASVFTGSIAVPGACIG  670
             LRLV NPVYIVTCLGACMEL IVSGFVVFLPKYLETQFS+GKSQA++FTGSIAVPGACIG
Sbjct  442   LRLVKNPVYIVTCLGACMELMIVSGFVVFLPKYLETQFSLGKSQANIFTGSIAVPGACIG  501

Query  671   IFIGGCILKRFQLKPKGAVQFVIISNAICLALYAMLFFLGCDNLKMAGTTIPYYRSAKHG  730
             IF+GGCILKRFQLKPKGAVQFV+I+N ICLA YAMLFFLGCDNLKMAGTTIPYY S KHG
Sbjct  502   IFLGGCILKRFQLKPKGAVQFVLITNVICLACYAMLFFLGCDNLKMAGTTIPYYTSNKHG  561

Query  731   --VIEPFQVNLTAACNFGCECLTTDVEPVCGNNGLTYFSPCHAGCTAFSSTS--NYTNCA  786
               + +PFQVNLTAACNFGCECLT++VEPVCGNNGLTYFSPCHAGCTAFSSTS  NYTNCA
Sbjct  562   STLEQPFQVNLTAACNFGCECLTSEVEPVCGNNGLTYFSPCHAGCTAFSSTSNTNYTNCA  621

Query  787   CVHSNISSSIYMGAGGSQAQALNANEDFAEVTVVPVATAGPCATPCRTIYPFLILLFFMT  846
             CV +NISSSIY GAGGSQAQAL+ANE+FAEVTVVPVATAGPCATPCRTIYPFLILLFFMT
Sbjct  622   CVRANISSSIYRGAGGSQAQALSANENFAEVTVVPVATAGPCATPCRTIYPFLILLFFMT  681

Query  847   FIVASTQMPLLMIVLRSVSEEERSFALGMQFVIFRLFGYIPAPILFGNLIDSTCLLWKST  906
             F+VASTQMPLLMIVLRSVSEEERSFALGMQFVIFRLFGYIPAPILFGNLIDSTC+LWKS+
Sbjct  682   FLVASTQMPLLMIVLRSVSEEERSFALGMQFVIFRLFGYIPAPILFGNLIDSTCILWKSS  741

Query  907   CGEKGGRCLIYDIEKFRYKYVGLCATVKIVALAIFIADWWLVRRRKQLEKLKPINANDPI  966
             CGEKGGRCLIYDIEKFRYKYVGLCA+VK++AL IF+ DWWLVRRRKQLEK+KP+NA+DPI
Sbjct  742   CGEKGGRCLIYDIEKFRYKYVGLCASVKLIALVIFMVDWWLVRRRKQLEKMKPLNASDPI  801

Query  967   IGSIISLDKLFEEKLTTNDTNPQY-GSNGEIILTSDALRHSRNDSRTIQLEYGYDKCNNA  1025
             IGSIISLDKLFEEKL+  + +  + G  GE+I+ +D LRHSRNDSRT+ ++Y YDKC   
Sbjct  802   IGSIISLDKLFEEKLSGAEPSTAFVGGGGELIIPTDILRHSRNDSRTMHMDYCYDKCGRV  861

Query  1026  INSSG-LSKPQTKSKKHFRSASCDVKMIRSFSKDQNIAPGTTSTDG--GMHEPIKIKSLK  1082
             +  +   ++PQTKSKKHFRSASCDVKMI+SF++D + + G     G   +    K K+LK
Sbjct  862   VTPANTCNQPQTKSKKHFRSASCDVKMIKSFARDHSSSSGPADAAGQDAVGASTKYKNLK  921

Query  1083  RFQTHSRNNSSDLNSDFRHKLTHSRTNSRDDAGALNIRYIQNQLKPQE--DEEDDDELTT  1140
             +FQ H+RN+S+DL+                   +  IRYIQNQL+PQ+  +E+DD+ELTT
Sbjct  922   KFQAHTRNHSTDLHDP-----------------SQPIRYIQNQLRPQDCPEEDDDEELTT  964

Query  1141  GCGHFVKKHARNHSYDQIYMPNNIRFDADFFR--NHHNNKNKNVNVLKNVMNREENRVKN  1198
             GCGHFVKKH+RNHSYDQIYMPNNIRFDADF R  + H+N  KNVNVLKNV++ +  ++KN
Sbjct  965   GCGHFVKKHSRNHSYDQIYMPNNIRFDADFLRHPHSHHNPKKNVNVLKNVVS-DVGKLKN  1023

Query  1199  SNETEAAAAAALAATAVSSRGHSRNNSKDLNTRTAATTTSNNSNATTPACIGGAAVGGGA  1258
             SNE EA  A         SRGHSRNNSKDLNT+ +         + TPA          +
Sbjct  1024  SNEIEAGGAG--------SRGHSRNNSKDLNTKIS---------SATPA----------S  1056

Query  1259  GAVVVGAAHNVAEAALNILRHRRTNSKDLNYTLCTGSERNDLGSSTACSSNASTPAHGSG  1318
             G VV  A    +   L++LRHRRTNSKDLNY +   S         A SS+ S  AH   
Sbjct  1057  GQVVTDA----STTGLSVLRHRRTNSKDLNYQVLPES---------AASSSVSGHAHPQ-  1102

Query  1319  GGAAAVLHLKHAHARKASHHKIQIDDERNELISSARDDEDDSNA  1362
                         H R  SHHKIQIDD+RNELI+   D+E++ +A
Sbjct  1103  ------------HTRNTSHHKIQIDDDRNELINDNDDEEEERSA  1134


 Score = 44.3 bits (103),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 2/29 (7%)

Query  112  MYQMTGLYSETNTSGDDSSVDAAT-QDSQ  139
            MYQMTGLYSETN SGDDSS+DAA   DSQ
Sbjct  1    MYQMTGLYSETN-SGDDSSIDAALDHDSQ  28


>Q8IH70_DROME unnamed protein product
Length=381

 Score = 404 bits (1038),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 237/451 (53%), Positives = 298/451 (66%), Gaps = 81/451 (18%)

Query  921   KFRYKYVGLCATVKIVALAIFIADWWLVRRRKQLEKLKPINANDPIIGSIISLDKLFEEK  980
             KFRYKYVGLCA+VK++AL IF+ DWWLVRRRKQLEK+KP+NA+DPIIGSIISLDKLFEEK
Sbjct  1     KFRYKYVGLCASVKLIALVIFMVDWWLVRRRKQLEKMKPLNASDPIIGSIISLDKLFEEK  60

Query  981   LTTNDTNPQY-GSNGEIILTSDALRHSRNDSRTIQLEYGYDKCNNAINSSGL-SKPQTKS  1038
             L+  + +  + G  GE+I+ +D LRHSRNDSRT+ ++Y YDKC   +  +   ++PQTKS
Sbjct  61    LSGAEPSTAFVGGGGELIIPTDILRHSRNDSRTMHMDYCYDKCGRVVTPANTCNQPQTKS  120

Query  1039  KKHFRSASCDVKMIRSFSKDQNIAPGTTSTDG--GMHEPIKIKSLKRFQTHSRNNSSDLN  1096
             KKHFRSASCDVKMI+SF++D + + G     G   +    K K+LK+FQ H+RN+S+DL+
Sbjct  121   KKHFRSASCDVKMIKSFARDHSSSSGPADAAGQDAVGASTKYKNLKKFQAHTRNHSTDLH  180

Query  1097  SDFRHKLTHSRTNSRDDAGALNIRYIQNQLKPQE--DEEDDDELTTGCGHFVKKHARNHS  1154
                                +  IRYIQNQL+PQ+  +E+DD+ELTTGCGHFVKKH+RNHS
Sbjct  181   D-----------------PSQPIRYIQNQLRPQDCPEEDDDEELTTGCGHFVKKHSRNHS  223

Query  1155  YDQIYMPNNIRFDADFFRN---HHNNKNKNVNVLKNVMNREENRVKNSNETEAAAAAALA  1211
             YDQIYMPNNIRFDADF R+   HHN K KNVNVLKNV++ +  ++KNSNE EA  A    
Sbjct  224   YDQIYMPNNIRFDADFLRHPHSHHNPK-KNVNVLKNVVS-DVGKLKNSNEIEAGGAG---  278

Query  1212  ATAVSSRGHSRNNSKDLNTRTAATTTSNNSNATTPACIGGAAVGGGAGAVVVGAAHNVAE  1271
                  SRGHSRNNSKDLNT+ +         + TPA          +G VV  A    + 
Sbjct  279   -----SRGHSRNNSKDLNTKIS---------SATPA----------SGQVVTDA----ST  310

Query  1272  AALNILRHRRTNSKDLNYTLCTGSERNDLGSSTACSSNASTPAHGSGGGAAAVLHLKHAH  1331
               L++LRHRRTNSKDLNY +   S         A SS+ S  AH               H
Sbjct  311   TGLSVLRHRRTNSKDLNYQVLPES---------AASSSVSGHAHPQ-------------H  348

Query  1332  ARKASHHKIQIDDERNELISSARDDEDDSNA  1362
              R  SHHKIQIDD+RNELI+   D+E++ +A
Sbjct  349   TRNTSHHKIQIDDDRNELINDNDDEEEERSA  379



Lambda      K        H
   0.311    0.126    0.334 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7143864416


Query= XP_011197190.1 uncharacterized protein LOC105221777 [Bactrocera
dorsalis]

Length=287
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q22387_CAEEL  unnamed protein product                                 32.0    0.53 
H2L0I3_CAEEL  unnamed protein product                                 30.4    2.2  
H2L0I2_CAEEL  unnamed protein product                                 30.4    2.2  


>Q22387_CAEEL unnamed protein product
Length=445

 Score = 32.0 bits (71),  Expect = 0.53, Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 74/157 (47%), Gaps = 33/157 (21%)

Query  54   VEAKIEALRLEDERDQMYDNLERLKRKYNKLHTAYLEKVQRCKALEDTFKRQKTLSGLVM  113
            ++ ++E+++L+D+      N + L++K+N+    +LE +Q+   L+ T  RQK L    M
Sbjct  61   IKEQLESIQLKDK------NYKDLEKKFNEKQDEHLETIQK---LDSTLSRQK-LKYDDM  110

Query  114  KSALSQRAQVLADKTQTENLEKQVAKLQTALDEAHDIIDELEFELESIDYMEQEMQHMRN  173
            + ALS          +   LE + + LQ   D   D+ ++ E ++E              
Sbjct  111  RQALS---------VKIYTLENECSNLQ---DNYADLQNDFEVQIEKF-----------K  147

Query  174  ELSALKAKQRHTTSATVSAMPPTDLEEPLPAYTADVA  210
            +L  LK+ Q H  S  V+ +   +L E L  +  +++
Sbjct  148  KLQNLKSIQNHENSKNVNPLTLDELTEQLKQFKEELS  184


>H2L0I3_CAEEL unnamed protein product
Length=2350

 Score = 30.4 bits (67),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 51/93 (55%), Gaps = 7/93 (8%)

Query  10   SDQFLRAQLEVVTAQNARLQEENDLLRQKLLRLNGDSRS--AAAINVEAKIEALRLEDER  67
            SD++ R Q E    ++  L++END LR++  R   DS+      IN E  + A  L DE+
Sbjct  262  SDEY-RMQWENERQKSLSLEDENDRLRREFERYANDSKDKEKTFINRERNL-AQYLSDEQ  319

Query  68   DQMYD---NLERLKRKYNKLHTAYLEKVQRCKA  97
             +M D    L+R++++++ L T   E + + KA
Sbjct  320  RKMLDLWTELQRVRKQFSDLKTHTEEDLDKQKA  352


>H2L0I2_CAEEL unnamed protein product
Length=2396

 Score = 30.4 bits (67),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 51/93 (55%), Gaps = 7/93 (8%)

Query  10   SDQFLRAQLEVVTAQNARLQEENDLLRQKLLRLNGDSRS--AAAINVEAKIEALRLEDER  67
            SD++ R Q E    ++  L++END LR++  R   DS+      IN E  + A  L DE+
Sbjct  335  SDEY-RMQWENERQKSLSLEDENDRLRREFERYANDSKDKEKTFINRERNL-AQYLSDEQ  392

Query  68   DQMYD---NLERLKRKYNKLHTAYLEKVQRCKA  97
             +M D    L+R++++++ L T   E + + KA
Sbjct  393  RKMLDLWTELQRVRKQFSDLKTHTEEDLDKQKA  425



Lambda      K        H
   0.311    0.126    0.334 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7143864416


Query= XP_011197191.1 cuticle protein 8 [Bactrocera dorsalis]

Length=120
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O97061_DROME  unnamed protein product                                 71.2    3e-16
O96967_DROME  unnamed protein product                                 68.6    1e-14
Q9VKE2_DROME  unnamed protein product                                 68.6    1e-14


>O97061_DROME unnamed protein product
Length=199

 Score = 71.2 bits (173),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 51/88 (58%), Gaps = 9/88 (10%)

Query  10   IAVLHVHALV----ELRDPHEEHGPVAYEFQYAVHDPHTGDIKSQKESRKDDRVEGVYEL  65
            +AV H   ++    E  DPH +     Y++ Y V D  +GD KSQ E R  D V G Y L
Sbjct  40   VAVAHAQPVLAKAAEEYDPHPQ-----YKYAYDVQDSLSGDSKSQVEERDGDVVRGEYSL  94

Query  66   IDSDGHHRVVHYKADDHSGFEAVVSREP  93
            ID+DG+ R V Y AD  +GF AVV+REP
Sbjct  95   IDADGYKRTVQYTADPINGFNAVVNREP  122


>O96967_DROME unnamed protein product
Length=472

 Score = 68.6 bits (166),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 32/60 (53%), Positives = 39/60 (65%), Gaps = 0/60 (0%)

Query  33   YEFQYAVHDPHTGDIKSQKESRKDDRVEGVYELIDSDGHHRVVHYKADDHSGFEAVVSRE  92
            Y F Y V D  TGD K Q+E R  D V+G Y LI+ DG  R+V Y ADD SGF A+VS++
Sbjct  77   YSFAYDVRDSLTGDDKRQEEKRDGDLVKGQYSLIEPDGTRRIVEYTADDVSGFNAIVSKQ  136


>Q9VKE2_DROME unnamed protein product
Length=477

 Score = 68.6 bits (166),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 32/60 (53%), Positives = 39/60 (65%), Gaps = 0/60 (0%)

Query  33   YEFQYAVHDPHTGDIKSQKESRKDDRVEGVYELIDSDGHHRVVHYKADDHSGFEAVVSRE  92
            Y F Y V D  TGD K Q+E R  D V+G Y LI+ DG  R+V Y ADD SGF A+VS++
Sbjct  77   YSFAYDVRDSLTGDDKRQEEKRDGDLVKGQYSLIEPDGTRRIVEYTADDVSGFNAIVSKQ  136



Lambda      K        H
   0.311    0.126    0.334 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7143864416


Query= XP_011197192.1 uncharacterized protein LOC105221779 [Bactrocera
dorsalis]

Length=432
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A9UN61_DROME  unnamed protein product                                 87.0    2e-18


>A9UN61_DROME unnamed protein product
Length=426

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/161 (38%), Positives = 80/161 (50%), Gaps = 22/161 (14%)

Query  8    FYFFVLACAILAPAASAPNYHHYCPQCEEEVWEEVPCEEVATTSRPTTTTTARSKPPTYA  67
            F   ++A A+L  A    ++  YC +CE+EVWE+VPC EV TT  PTTT  +   PPT +
Sbjct  9    FMTMLMASALLTQA----HFPEYCAECEQEVWEQVPCSEVPTTVAPTTTGGSTLSPPTTS  64

Query  68   PTTQRPHTTVRPPAKKTTTTKPRRAHYTTPTPAVTTTVATTYNNCYCECKGGCKEFCRKV  127
             T+  P       A  T T                TT  + Y  CYCECK GCKEFCRKV
Sbjct  65   ATSPGPIYPTTTSAPPTPTD--------------YTTQPSEYKKCYCECKLGCKEFCRKV  110

Query  128  TVNGAAQAAQKQITQVTKTTHRVPNGQLNSEHVHQLRFVPD  168
              +   Q     +TQ++      P GQ+   HVHQ ++ P 
Sbjct  111  ISSEPKQP----LTQISSIGEYAPGGQVEYTHVHQRKYFPK  147



Lambda      K        H
   0.311    0.126    0.334 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7143864416


Query= XP_011197193.1 cuticle protein [Bactrocera dorsalis]

Length=139
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O97061_DROME  unnamed protein product                                 92.4    4e-24
O96967_DROME  unnamed protein product                                 76.3    5e-17
Q9VKE2_DROME  unnamed protein product                                 76.3    5e-17


>O97061_DROME unnamed protein product
Length=199

 Score = 92.4 bits (228),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 62/96 (65%), Gaps = 5/96 (5%)

Query  10   IGLGATTAIELGHAPLLLKPALVKTVEVEAP-AHYEFSYSVRDDHTGDIKSQTESRKGDV  68
            +   A   + + HA    +P L K  E   P   Y+++Y V+D  +GD KSQ E R GDV
Sbjct  32   VATYAQAPVAVAHA----QPVLAKAAEEYDPHPQYKYAYDVQDSLSGDSKSQVEERDGDV  87

Query  69   VQGQYSLVDADGYLRTVDYTSDAHNGFNALVRRDPL  104
            V+G+YSL+DADGY RTV YT+D  NGFNA+V R+PL
Sbjct  88   VRGEYSLIDADGYKRTVQYTADPINGFNAVVNREPL  123


>O96967_DROME unnamed protein product
Length=472

 Score = 76.3 bits (186),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 34/66 (52%), Positives = 46/66 (70%), Gaps = 0/66 (0%)

Query  42   HYEFSYSVRDDHTGDIKSQTESRKGDVVQGQYSLVDADGYLRTVDYTSDAHNGFNALVRR  101
             Y F+Y VRD  TGD K Q E R GD+V+GQYSL++ DG  R V+YT+D  +GFNA+V +
Sbjct  76   QYSFAYDVRDSLTGDDKRQEEKRDGDLVKGQYSLIEPDGTRRIVEYTADDVSGFNAIVSK  135

Query  102  DPLGQK  107
              L ++
Sbjct  136  QRLDEQ  141


>Q9VKE2_DROME unnamed protein product
Length=477

 Score = 76.3 bits (186),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 34/66 (52%), Positives = 46/66 (70%), Gaps = 0/66 (0%)

Query  42   HYEFSYSVRDDHTGDIKSQTESRKGDVVQGQYSLVDADGYLRTVDYTSDAHNGFNALVRR  101
             Y F+Y VRD  TGD K Q E R GD+V+GQYSL++ DG  R V+YT+D  +GFNA+V +
Sbjct  76   QYSFAYDVRDSLTGDDKRQEEKRDGDLVKGQYSLIEPDGTRRIVEYTADDVSGFNAIVSK  135

Query  102  DPLGQK  107
              L ++
Sbjct  136  QRLDEQ  141



Lambda      K        H
   0.311    0.126    0.334 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7143864416


Query= XP_011197194.1 cuticle protein 8 [Bactrocera dorsalis]

Length=112
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O97061_DROME  unnamed protein product                                 78.6    3e-19
O96967_DROME  unnamed protein product                                 80.1    9e-19
Q9VKE2_DROME  unnamed protein product                                 80.1    9e-19


>O97061_DROME unnamed protein product
Length=199

 Score = 78.6 bits (192),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 51/80 (64%), Gaps = 2/80 (3%)

Query  23   IGHGIPI-AIDLEENSP-PQYEFHYSVHDTHTGDVKDQFEHRHGDYVTGRYSLIEPDGQR  80
            + H  P+ A   EE  P PQY++ Y V D+ +GD K Q E R GD V G YSLI+ DG +
Sbjct  42   VAHAQPVLAKAAEEYDPHPQYKYAYDVQDSLSGDSKSQVEERDGDVVRGEYSLIDADGYK  101

Query  81   RVVEYNADPLLGFTAQVHRE  100
            R V+Y ADP+ GF A V+RE
Sbjct  102  RTVQYTADPINGFNAVVNRE  121


>O96967_DROME unnamed protein product
Length=472

 Score = 80.1 bits (196),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 37/65 (57%), Positives = 45/65 (69%), Gaps = 0/65 (0%)

Query  36   NSPPQYEFHYSVHDTHTGDVKDQFEHRHGDYVTGRYSLIEPDGQRRVVEYNADPLLGFTA  95
            ++ PQY F Y V D+ TGD K Q E R GD V G+YSLIEPDG RR+VEY AD + GF A
Sbjct  72   DTRPQYSFAYDVRDSLTGDDKRQEEKRDGDLVKGQYSLIEPDGTRRIVEYTADDVSGFNA  131

Query  96   QVHRE  100
             V ++
Sbjct  132  IVSKQ  136


>Q9VKE2_DROME unnamed protein product
Length=477

 Score = 80.1 bits (196),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 37/65 (57%), Positives = 45/65 (69%), Gaps = 0/65 (0%)

Query  36   NSPPQYEFHYSVHDTHTGDVKDQFEHRHGDYVTGRYSLIEPDGQRRVVEYNADPLLGFTA  95
            ++ PQY F Y V D+ TGD K Q E R GD V G+YSLIEPDG RR+VEY AD + GF A
Sbjct  72   DTRPQYSFAYDVRDSLTGDDKRQEEKRDGDLVKGQYSLIEPDGTRRIVEYTADDVSGFNA  131

Query  96   QVHRE  100
             V ++
Sbjct  132  IVSKQ  136



Lambda      K        H
   0.311    0.126    0.334 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7143864416


Query= XP_011197195.1 enoyl-CoA delta isomerase 1, mitochondrial
[Bactrocera dorsalis]

Length=285
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VL68_DROME  unnamed protein product                                 373     5e-131
Q57V74_TRYB2  unnamed protein product                                 175     1e-52 
Q584L4_TRYB2  unnamed protein product                                 176     2e-52 


>Q9VL68_DROME unnamed protein product
Length=281

 Score = 373 bits (957),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 168/259 (65%), Positives = 212/259 (82%), Gaps = 0/259 (0%)

Query  27   SSNELTKLEVNDKTGIAVLTLNRPPVNSLNLELLTDIRNSIKDAESNKCKGLILTSSSNS  86
            ++ +LT +EVNDKTGIA LT+NRPPVN LNLELL D+++SI + ESNK +GLILTSSS++
Sbjct  21   TATKLTTVEVNDKTGIATLTMNRPPVNGLNLELLQDLKSSIDEIESNKSRGLILTSSSST  80

Query  87   VFSAGLDFLEMYQPKEERLKSFWTALQSTWMTLYGSKIPTAAAINGHAPAGGCLLATSCE  146
            +FSAGLD LEMY+P ++R+++FWT LQ TW+ LYGS +PTAAAINGH+PAGGCLLATSCE
Sbjct  81   IFSAGLDILEMYKPDKDRIRAFWTQLQDTWLALYGSSVPTAAAINGHSPAGGCLLATSCE  140

Query  147  YRVMLPKFTIGLNETLIGIVAPNWFMNSYLNVLPRRVAELALTQGKMFTTAEAQQVGLVD  206
            YRVM+P FTIGLNET +GIVAP WFM S+L+VLP+R+AE AL QG+MFTT EA +VGL+D
Sbjct  141  YRVMVPNFTIGLNETQLGIVAPQWFMASFLSVLPQRIAERALNQGRMFTTEEALKVGLID  200

Query  207  DVVNTKEEAIAKCEEFIGLFKKINPYARALTKQQFRINHLQELEQNREQDLQAFTAAITN  266
            +  N KEEAI KC  FIG F K+NP AR+LTKQQFR   LQ+L+  R++DL+ F   +  
Sbjct  201  ETANNKEEAIEKCVAFIGTFAKVNPLARSLTKQQFRAADLQQLQNGRKEDLEKFLFFVNQ  260

Query  267  PSTQAAMGAYLENLKKRSK  285
            P+ Q  +G YLE LKK++K
Sbjct  261  PAVQKGLGIYLEGLKKKAK  279


>Q57V74_TRYB2 unnamed protein product
Length=358

 Score = 175 bits (444),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 102/267 (38%), Positives = 155/267 (58%), Gaps = 20/267 (7%)

Query  30   ELTKLEVNDKTGIAVLTLNRPPVNSLNLELLTDIRNSIKDAESNK-CKGLILTSSSNSVF  88
            ++ K++ +D+ GI  + LNR PVNSL+LEL  ++ + +    S++ C+ +ILTSS  +VF
Sbjct  91   KMLKVDTSDR-GITTVALNRAPVNSLSLELFEELNSWMLWLGSDESCRAVILTSSIPTVF  149

Query  89   SAGLDFLEMYQPKEERLKSFWTALQSTWMTLYGSKIPTAAAINGHAPAGGCLLATSCEYR  148
            SAGLD  E++ P+ ERL+ FW + Q  W+ L     P   A++G++PAGGC+LA  C++R
Sbjct  150  SAGLDINELHNPEPERLRRFWKSFQEAWLILNSFPKPIIGAVSGNSPAGGCVLALGCDFR  209

Query  149  VMLPK--------FTIGLNETLIGIVAPNWFMNSYLNVLPRRVAELALTQGKMFTTAEAQ  200
            VML          F IGLNET +GI  P W + +Y  VL  R AE  L  G   T  EA 
Sbjct  210  VMLRHPTDKPDRPFRIGLNETKLGITTPPWVVPAYAYVLGSRRAERMLQLGDTPTADEAL  269

Query  201  QVGLVDDVVNT----KEEAIAKCEEFIGLFKKINPYARALTKQQFRINHLQEL--EQNRE  254
            +VGLVD VV+     +E  + + E F+ + ++    +R + +   R  +LQ +  E++RE
Sbjct  270  RVGLVDLVVDGEQQLREAVLKEAERFLSVPQQ----SRWMLRDMLRREYLQVIGSEEDRE  325

Query  255  QDLQAFTAAITNPSTQAAMGAYLENLK  281
             D Q F   + NP  Q ++ A+   LK
Sbjct  326  YDTQFFVELMMNPDVQKSLEAFTARLK  352


>Q584L4_TRYB2 unnamed protein product
Length=400

 Score = 176 bits (447),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 104/269 (39%), Positives = 157/269 (58%), Gaps = 20/269 (7%)

Query  31   LTKLEVNDKTGIAVLTLNRPPVNSLNLELLTDIRNSIKDAESNK-CKGLILTSSSNSVFS  89
            L +L+ +D+ GI  + L+R PVNSL+LEL  +  + +    S++ CK +ILTSS  +VFS
Sbjct  134  LLRLDTSDR-GITTVALSRAPVNSLSLELFEEFNSWMLWLGSDESCKAIILTSSIPTVFS  192

Query  90   AGLDFLEMYQPKEERLKSFWTALQSTWMTLYGSKIPTAAAINGHAPAGGCLLATSCEYRV  149
            AGLD  EM+ P+ ERL+ FW + Q TW+ L     P   AI+G++PAGGC+LA  C+ RV
Sbjct  193  AGLDMSEMHNPEPERLRRFWKSFQETWLILNSFPKPIIGAISGNSPAGGCVLALGCDSRV  252

Query  150  MLPK--------FTIGLNETLIGIVAPNWFMNSYLNVLPRRVAELALTQGKMFTTAEAQQ  201
            M+          + IGLNET +GI  P W + +Y  VL  R AE  L  G+  T  EA +
Sbjct  253  MVRHPADKPDRPYRIGLNETKLGITTPPWVIPAYAYVLGSRRAERMLQLGETPTADEALR  312

Query  202  VGLVDDVVNT----KEEAIAKCEEFIGLFKKINPYARALTKQQFRINHLQEL--EQNREQ  255
            +GLVD VV+     +E A+ + E F+ + ++    +R +++   R   LQ +  E++RE 
Sbjct  313  MGLVDLVVDGEHQLREAAVKEVERFLSVPQQ----SRWMSRDMLRREFLQFIGSEEDREY  368

Query  256  DLQAFTAAITNPSTQAAMGAYLENLKKRS  284
            D Q F   + NP  Q ++ A+   LK ++
Sbjct  369  DTQFFVELMMNPEVQKSLEAFTARLKGKA  397



Lambda      K        H
   0.311    0.126    0.334 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7143864416


Query= XP_011197196.1 dynein regulatory complex subunit 3 [Bactrocera
dorsalis]

Length=565
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VL65_DROME  unnamed protein product                                 618     0.0  
Q9U3W5_DROME  unnamed protein product                                 80.1    4e-16
Q9VEK8_DROME  unnamed protein product                                 79.7    4e-16


>Q9VL65_DROME unnamed protein product
Length=566

 Score = 618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/547 (56%), Positives = 411/547 (75%), Gaps = 12/547 (2%)

Query  13   LDEIIYPEIEPGIISKQMIDKAYLEDGKQGEAARLHQMEPVVYERIFVLRLEFKNILRID  72
            L+EI  PE  PGII +QMI+ AYLE+GK+GEA RLHQ+EPVVY+RI  +RLEFKNILRID
Sbjct  26   LEEINCPE--PGIIDRQMIETAYLEEGKKGEARRLHQLEPVVYDRITTMRLEFKNILRID  83

Query  73   HLWIMPNLTKLSLNCNKIEVIEHIDMLIALKELDLSFNYIERIENIEKLVNLEVLSLFNN  132
            HLW+MPNLTKL LNCNKIEVIEH++ML ALK+L+LSFNYI RIEN+EKLV LE LSLF+N
Sbjct  84   HLWMMPNLTKLCLNCNKIEVIEHLEMLTALKDLNLSFNYITRIENLEKLVKLEKLSLFSN  143

Query  133  HITHIQNLDTLEKLVILSLGNNKIKTTVGIERFRFLKDLRVLNLEGNPIAKETNFQMDLY  192
             I  I+N+ TL+ LVILS+GNN I T  GIER RF+  L+VLNLEGNPIAK+ +F + LY
Sbjct  144  RIRKIENIHTLQNLVILSIGNNLIDTVEGIERLRFVSSLKVLNLEGNPIAKQPDFPLSLY  203

Query  193  VAAVLPGVKYYEYKTISEEMRHKGRERYYRELREIEANEEKEIIARAAKAKEEYDEKRLA  252
            V A+LP + YYEY  I  E R + ++R+YRELREIE  +E+EI     +A+E  +  RLA
Sbjct  204  VIAILPQLNYYEYVFIKTETREEAQKRFYRELREIEDKQEREIQGLETEAREMAEADRLA  263

Query  253  SSFVEYLNEHQLYESLWKGDEDGYALLKIGQPATDLAEEYDNDIYDVTQEIYKYGLQRYE  312
            SSFVE+L+  QLY+SLW+ DEDG  L+ +G PA +L EEY  D+Y++TQ+IY+ GL+R+ 
Sbjct  264  SSFVEHLDGMQLYDSLWRDDEDGRILMLVGAPAQELCEEYSKDVYELTQQIYRLGLERFG  323

Query  313  ERELEINEFKENLEEGQLQIQQMGQDVIEDFLRHKERIFERATAVLKALELRTLHGEDEE  372
            ER+ EI +F  NL EGQ ++Q  GQ  IEDFL +KERIF+         E+R    E ++
Sbjct  324  ERDEEIRDFNANLHEGQEELQAQGQRQIEDFLEYKERIFD---------EMRLKWRELDQ  374

Query  373  SPESLE-LMEQFDKITMQFDDIINEVWQQLMSQELHLHESIEESTVNFQRRIQEMMAKFV  431
              + LE L  Q D +T  F+D +NE+W+ LM+QELHLHE++E+ST+ F R+I ++M+ FV
Sbjct  375  RDDDLEQLQAQLDTLTANFEDSLNELWESLMAQELHLHEAVEDSTLKFNRKISDLMSNFV  434

Query  432  EQVQTYFGQLRDIAIHFSENMTEVATHYINTKLALQDFEDVPPELLHCMEDREAILNLIA  491
            EQ Q  F QLRD+  +F++NMT++   +++TKLA  +   +P EL  C++DREA+L L+ 
Sbjct  435  EQAQVIFLQLRDLCSYFADNMTDIVNQFLSTKLARNELNTIPEELKQCVDDREAVLQLVE  494

Query  492  GMKDAHIQRIDEREDRLMVRSRDFIENMIDELNNDELERNRAKILEINSFLELMSDSLAS  551
            GM+  H  R+D+REDRL  RSR FI++MI  LNN E++R+RAKILEINSF+E+M+++LA+
Sbjct  495  GMRTTHTSRVDKREDRLAQRSRQFIDDMITNLNNKEVDRHRAKILEINSFMEMMTEALAN  554

Query  552  LHTEIRE  558
            L  E+ +
Sbjct  555  LPGELHQ  561


>Q9U3W5_DROME unnamed protein product
Length=326

 Score = 80.1 bits (196),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 85/143 (59%), Gaps = 7/143 (5%)

Query  46   RLHQMEPVV-YERIFVLRLEFKNILRIDHLWIMPNLTKLSLNCNKIEVIEHIDMLIALKE  104
            +L   EP+   ER+F   L +  I +I++L  +  L +L L  N+I  IE++D L  L+ 
Sbjct  53   KLENFEPLTRIERLF---LRWNLIKKIENLSSLKTLIELELYDNQITKIENLDDLPHLEV  109

Query  105  LDLSFNYIERIENIEKLVNLEVLSLFNNHITHIQNLDTLEKLVILSLGNNKIKTTVGIER  164
            LD+SFN + +IEN++KLV LE +   +N IT I+NLD L  L +L LG+NK+K    IE 
Sbjct  110  LDISFNRLTKIENLDKLVKLEKVYFVSNRITQIENLDMLTNLTMLELGDNKLK---KIEN  166

Query  165  FRFLKDLRVLNLEGNPIAKETNF  187
               L +LR L L  N IAK  N 
Sbjct  167  IEMLVNLRQLFLGKNKIAKIENL  189


 Score = 67.8 bits (164),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 52/122 (43%), Positives = 71/122 (58%), Gaps = 3/122 (2%)

Query  60   VLRLEFKNILRIDHLWIMPNLTKLSLNCNKIEVIEHIDMLIALKELDLSFNYIERIENIE  119
            VL + F  + +I++L  +  L K+    N+I  IE++DML  L  L+L  N +++IENIE
Sbjct  109  VLDISFNRLTKIENLDKLVKLEKVYFVSNRITQIENLDMLTNLTMLELGDNKLKKIENIE  168

Query  120  KLVNLEVLSLFNNHITHIQNLDTLEKLVILSLGNNKIKTTVGIERFRFLKDLRVLNLEGN  179
             LVNL  L L  N I  I+NLDTL  L ILSL  N+I   V IE    L +LR L +  N
Sbjct  169  MLVNLRQLFLGKNKIAKIENLDTLVNLEILSLQANRI---VKIETLEKLANLRELYVSEN  225

Query  180  PI  181
             +
Sbjct  226  GV  227


 Score = 62.4 bits (150),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 68/235 (29%), Positives = 111/235 (47%), Gaps = 52/235 (22%)

Query  6    KLDNLKSLDEIIYPEIEPGIISK--QMIDKAYLE--DGKQGEAARLHQMEPVV-YERIFV  60
            K++NL SL  +I  E+    I+K   + D  +LE  D       ++  ++ +V  E+++ 
Sbjct  75   KIENLSSLKTLIELELYDNQITKIENLDDLPHLEVLDISFNRLTKIENLDKLVKLEKVYF  134

Query  61   LRLEFKNILRIDHLWIMPNLTKLSLNCNKIEVIEHIDMLIALKELDLSFNYIERIENIEK  120
            +      I +I++L ++ NLT L L  NK++ IE+I+ML+ L++L L  N I +IEN++ 
Sbjct  135  VS---NRITQIENLDMLTNLTMLELGDNKLKKIENIEMLVNLRQLFLGKNKIAKIENLDT  191

Query  121  LVNLEVLSLFNNHITHIQNLDTL----------------------EKLVILSLGNNKIKT  158
            LVNLE+LSL  N I  I+ L+ L                       KL  L L  N++K 
Sbjct  192  LVNLEILSLQANRIVKIETLEKLANLRELYVSENGVETIENLSENTKLETLDLAKNRLKG  251

Query  159  TVG----------------------IERFRFLKDLRVLNLEGNPIAKETNFQMDL  191
                                     IE  +  K L+ + LE NP+AK+  ++  L
Sbjct  252  IANLEKLELLEELWLNHNGVDDWKDIELLKVNKALQTIYLEYNPLAKDVRYRSKL  306


>Q9VEK8_DROME unnamed protein product
Length=326

 Score = 79.7 bits (195),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 85/143 (59%), Gaps = 7/143 (5%)

Query  46   RLHQMEPVV-YERIFVLRLEFKNILRIDHLWIMPNLTKLSLNCNKIEVIEHIDMLIALKE  104
            +L   EP+   ER+F   L +  I +I++L  +  L +L L  N+I  IE++D L  L+ 
Sbjct  53   KLENFEPLTRIERLF---LRWNLIKKIENLSSLKTLIELELYDNQITKIENLDDLPHLEV  109

Query  105  LDLSFNYIERIENIEKLVNLEVLSLFNNHITHIQNLDTLEKLVILSLGNNKIKTTVGIER  164
            LD+SFN + +IEN++KLV LE +   +N IT I+NLD L  L +L LG+NK+K    IE 
Sbjct  110  LDISFNRLTKIENLDKLVKLEKVYFVSNRITQIENLDMLTNLTMLELGDNKLK---KIEN  166

Query  165  FRFLKDLRVLNLEGNPIAKETNF  187
               L +LR L L  N IAK  N 
Sbjct  167  IEMLVNLRQLFLGKNKIAKIENL  189


 Score = 67.8 bits (164),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 68/114 (60%), Gaps = 0/114 (0%)

Query  60   VLRLEFKNILRIDHLWIMPNLTKLSLNCNKIEVIEHIDMLIALKELDLSFNYIERIENIE  119
            VL + F  + +I++L  +  L K+    N+I  IE++DML  L  L+L  N +++IENIE
Sbjct  109  VLDISFNRLTKIENLDKLVKLEKVYFVSNRITQIENLDMLTNLTMLELGDNKLKKIENIE  168

Query  120  KLVNLEVLSLFNNHITHIQNLDTLEKLVILSLGNNKIKTTVGIERFRFLKDLRV  173
             LVNL  L L  N I  I+NLDTL  L ILSL  N+I     +E+   L++L V
Sbjct  169  MLVNLRQLFLGKNKIAKIENLDTLVNLEILSLQANRIVKIENLEKLANLRELYV  222


 Score = 64.7 bits (156),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 69/235 (29%), Positives = 112/235 (48%), Gaps = 52/235 (22%)

Query  6    KLDNLKSLDEIIYPEIEPGIISK--QMIDKAYLE--DGKQGEAARLHQMEPVV-YERIFV  60
            K++NL SL  +I  E+    I+K   + D  +LE  D       ++  ++ +V  E+++ 
Sbjct  75   KIENLSSLKTLIELELYDNQITKIENLDDLPHLEVLDISFNRLTKIENLDKLVKLEKVYF  134

Query  61   LRLEFKNILRIDHLWIMPNLTKLSLNCNKIEVIEHIDMLIALKELDLSFNYIERIENIEK  120
            +      I +I++L ++ NLT L L  NK++ IE+I+ML+ L++L L  N I +IEN++ 
Sbjct  135  VS---NRITQIENLDMLTNLTMLELGDNKLKKIENIEMLVNLRQLFLGKNKIAKIENLDT  191

Query  121  LVNLEVLSLFNNHITHIQNLDTL----------------------EKLVILSLGNNKIKT  158
            LVNLE+LSL  N I  I+NL+ L                       KL  L L  N++K 
Sbjct  192  LVNLEILSLQANRIVKIENLEKLANLRELYVSENGVETIENLSENTKLETLDLAKNRLKG  251

Query  159  TVG----------------------IERFRFLKDLRVLNLEGNPIAKETNFQMDL  191
                                     IE  +  K L+ + LE NP+AK+  ++  L
Sbjct  252  IANLEKLELLEELWLNHNGVDDWKDIELLKVNKALQTIYLEYNPLAKDVRYRSKL  306



Lambda      K        H
   0.311    0.126    0.334 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7143864416


Query= XP_011197197.1 translocon-associated protein subunit gamma
[Bactrocera dorsalis]

Length=190
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VL69_DROME  unnamed protein product                                 348     2e-124
Q57X63_TRYB2  unnamed protein product                                 37.0    0.004 
PSA7_DICDI  unnamed protein product                                   28.9    2.4   


>Q9VL69_DROME unnamed protein product
Length=190

 Score = 348 bits (894),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 181/190 (95%), Gaps = 0/190 (0%)

Query  1    MGSGKQQKVQSSGFTKEEELLLQDFSRNVSTKSSALFYSNAFIVSAIPIWLFWRVHNMDL  60
            MGSGKQQKVQSSGFTKEEELLLQDFSRNVSTKSSALFY NAFIVSA+PIWLFWR+HNMDL
Sbjct  1    MGSGKQQKVQSSGFTKEEELLLQDFSRNVSTKSSALFYGNAFIVSAVPIWLFWRIHNMDL  60

Query  61   LSSAVFFVLLTGASTYLMAMAYRNIKFQIKHKIAVRREDAVTREINRQIGDDKKVTRKEK  120
              S++ FVL+T ASTYLMA AY+NIKFQ+KHKIA RRE+AVTRE+NRQ+GDDKKVTRKEK
Sbjct  61   WPSSILFVLVTAASTYLMATAYKNIKFQLKHKIAGRREEAVTREVNRQVGDDKKVTRKEK  120

Query  121  DERILWKKNEVADYEATTFSIFYNNALFLAIIIFISFFLLKNSSPLVNYIFSIGLASGAL  180
            DERILWKKNEVADYEATTFSIFYNNA++LA+IIFISFF+LKNS+P +NYIFS+G+ASGAL
Sbjct  121  DERILWKKNEVADYEATTFSIFYNNAIYLAVIIFISFFILKNSTPFINYIFSVGIASGAL  180

Query  181  ALFSTSTQTN  190
            +LFSTS QTN
Sbjct  181  SLFSTSAQTN  190


>Q57X63_TRYB2 unnamed protein product
Length=193

 Score = 37.0 bits (84),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 41/180 (23%), Positives = 87/180 (48%), Gaps = 35/180 (19%)

Query  14   FTKEEELLLQDFSRNVSTKSSALFYSNA--FIVSAI----PIWLFWRVHNMDLLS--SAV  65
             +KE+E +L D        ++ L Y      IV+AI    P++L   V+ +D ++  +A 
Sbjct  25   LSKEDERMLDD-----RINANTLVYPKQALIIVAAIASFQPVYLSHAVNGLDWINPINAF  79

Query  66   FFVLLTGASTYLMAMAYRNIKFQIKHKIAVRREDAVTREINRQIGDDKKVTRKEKDERIL  125
             ++++   + Y+++ AY  +               V  E  RQ     +V++   DE++L
Sbjct  80   LYLVIATFTAYMLSQAYTVM---------------VESEFWRQQRHYSEVSKG--DEKLL  122

Query  126  WK-KNEVADYEATTFSIFYNNALFLAIIIFISFFLLKNSSPLVNYIFSIGLASGALALFS  184
             K + +VA      +++F+ N++F  +   +  ++L++S P V+++ S  L +  L L +
Sbjct  123  HKYRLQVA----VGYTLFFVNSVFSLLCTLLHVYILRHSDPRVSFMLSPTLTAALLWLVA  178


>PSA7_DICDI unnamed protein product
Length=250

 Score = 28.9 bits (63),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 30/105 (29%), Positives = 48/105 (46%), Gaps = 16/105 (15%)

Query  93   IAVRREDAVTREINRQIGDDKKVTRKEKDERILWKKNEVADYEATTFSIFYNNALFL---  149
            + VR +D +       +G +KK T K +D R + K  ++ D+   TF+    ++  L   
Sbjct  36   VGVRGKDVIV------LGVEKKATAKLQDARSIRKIVKLDDHICLTFAGLTADSRVLISK  89

Query  150  AIIIFISFFLLKNSSPLVNYI--FSIGL-----ASGALALFSTST  187
            A++   S+ L    SP V YI  F  G+      SG +  F  ST
Sbjct  90   ALMECQSYRLTVEDSPSVEYISKFIAGIQQRYTQSGGVRPFGIST  134



Lambda      K        H
   0.311    0.126    0.334 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7143864416


Query= XP_011197198.2 LOW QUALITY PROTEIN: uncharacterized protein
LOC105221785 [Bactrocera dorsalis]

Length=287
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9W0B8_DROME  unnamed protein product                                 30.4    2.4  
O77285_DROME  unnamed protein product                                 30.0    2.4  
Q86JG3_DICDI  unnamed protein product                                 29.6    3.9  


>Q9W0B8_DROME unnamed protein product
Length=1234

 Score = 30.4 bits (67),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 1/62 (2%)

Query  107  KEISVAFQRRLS-GDHEQQLQYLKTVAQLLQDAIRFAKHWFSLLRNSLAEIFRLYNHYIP  165
            K++S  +Q  L  GD ++++  LK   QL    +  A H F  L  SL E      + +P
Sbjct  726  KDVSAQYQGALLLGDVKERVNILKNCGQLSLAYLTAATHGFDELTESLGESITSQGNSLP  785

Query  166  EV  167
            EV
Sbjct  786  EV  787


>O77285_DROME unnamed protein product
Length=1234

 Score = 30.0 bits (66),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 1/62 (2%)

Query  107  KEISVAFQRRLS-GDHEQQLQYLKTVAQLLQDAIRFAKHWFSLLRNSLAEIFRLYNHYIP  165
            K++S  +Q  L  GD ++++  LK   QL    +  A H F  L  SL E      + +P
Sbjct  726  KDVSAQYQGALLLGDVKERVNILKNCGQLSLAYLTAATHGFDELTESLGESITSQGNSLP  785

Query  166  EV  167
            EV
Sbjct  786  EV  787


>Q86JG3_DICDI unnamed protein product
Length=761

 Score = 29.6 bits (65),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 20/34 (59%), Gaps = 0/34 (0%)

Query  165  PEVLLGKCFGKYITTAYPDRNFYEYPFILLGEVI  198
            PE +L K  GK I  + P  + ++ P +L G++I
Sbjct  345  PERMLSKLIGKEIQVSVPRDDHFDEPLLLKGQLI  378



Lambda      K        H
   0.311    0.126    0.334 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7143864416


Query= XP_011197199.1 acanthoscurrin-2 [Bactrocera dorsalis]

Length=182


***** No hits found *****



Lambda      K        H
   0.311    0.126    0.334 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7143864416


Query= XP_011197200.1 uncharacterized protein LOC105221786 [Bactrocera
dorsalis]

Length=398
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VXC8_DROME  unnamed protein product                                 42.0    4e-04
Q9W453_DROME  unnamed protein product                                 37.7    0.011


>Q9VXC8_DROME unnamed protein product
Length=249

 Score = 42.0 bits (97),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 41/96 (43%), Gaps = 11/96 (11%)

Query  44   RAPPIHYCNGVIVQSSLILTTASCVYYQSSVIEESGAPVRIPSAKISVVPGVAGTYNVLN  103
            R    H C G I+  + ILTTA CV+    +I+ S    R+ S            Y    
Sbjct  44   RVDNAHVCGGSILSQTKILTTAHCVHRDGKLIDASRLACRVGSTN---------QYAGGK  94

Query  104  TFNVLEINIAPGFNYKTLTNNLALLRLDTTLPLGQR  139
              NV  + + P  +Y  L NNLA++ L + L    R
Sbjct  95   IVNVESVAVHP--DYYNLNNNLAVITLSSELTYTDR  128


>Q9W453_DROME unnamed protein product
Length=362

 Score = 37.7 bits (86),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 39/162 (24%), Positives = 71/162 (44%), Gaps = 12/162 (7%)

Query  49   HYCNGVIVQSSLILTTASCVYYQSSVIEESGAPVRIPSAKISVVPGVAGTYNVLN--TFN  106
            H C G +++   +LT A C  +   +I +      +P  +  VV G    YN  N  TF 
Sbjct  77   HLCGGSLIRPGWVLTAAHC--FVDQIIYDG---TFVPKEEFIVVMGNLDRYNRTNTLTFT  131

Query  107  VLE-INIAPGFNYKTLTNNLALLRLDTTLPLGQREDVQWIIMDDYVYEEKAL-YMAGFPS  164
            + E I     F+  T   ++ALL L+ T+P G    ++ I ++ +   E  +  + G+ +
Sbjct  132  IEERIMQLDKFDLSTYDKDIALLMLNGTVPTGH-PTIRPIALNRFAIPEGVVCQVTGWGN  190

Query  165  LNVD--QNAMLLENVQILPNEQCAQVATAAPIISNESICARY  204
                   + ++  +V ++  E C   +    +I    ICA Y
Sbjct  191  TEDGYVSDILMTVDVPMISEEHCINDSDLGHLIQPGMICAGY  232



Lambda      K        H
   0.311    0.126    0.334 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7143864416


Query= XP_011197201.1 ATP-dependent RNA helicase DHX33 [Bactrocera
dorsalis]

Length=735
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DHX8_DROME  unnamed protein product                                   569     0.0   
MOG5_CAEEL  unnamed protein product                                   552     0.0   
Q7K3M5_DROME  unnamed protein product                                 523     2e-176


>DHX8_DROME unnamed protein product
Length=1242

 Score = 569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/726 (42%), Positives = 460/726 (63%), Gaps = 28/726 (4%)

Query  17    VKSPHGGGTKTSVSISSFPIKRKLQS-----------PVNGIENVIIKAPKLNNGSATTT  65
             VK+P G   + ++  S+   +R+ Q            P +  +N I   P+  + S    
Sbjct  486   VKNPDGSLAQAAMMQSALSKERREQKMLQREQEIEAMPTSLNKNWIDPLPEDESRSLAAN  545

Query  66    SNGKSNVNTPTPNGGILHLNGKGIPSKQQLEL----QRQALPVYKVRQRLILEARRSETL  121
               G +      P      + GK     ++ +L    QRQ+LP+YK+R  LI     ++ L
Sbjct  546   MRGMAAAPPEVPEWKKHVIGGKKSSFGKKTDLTLVEQRQSLPIYKLRDDLIKAVTDNQIL  605

Query  122   LLMGETGSGKTTQIPQFLYESGFAQKGMIGITQPRRVAAITVARRVAQEQGCRLGETVGY  181
             +++GETGSGKTTQI Q+L E GF  +G IG TQPRRVAA++VA+RVA+E GCRLG+ VGY
Sbjct  606   IVIGETGSGKTTQITQYLGECGFTARGKIGCTQPRRVAAMSVAKRVAEEYGCRLGQEVGY  665

Query  182   TVRFEDCTSPQTRIRFLTDGCLLREAIADRLLRQYTVLILDEAHERTINTDVLFGIVKEA  241
             T+RFEDCTSP+T I+++TDG LLRE + +  L+ Y+V++LDEAHERTI+TDVLFG++K A
Sbjct  666   TIRFEDCTSPETIIKYMTDGMLLRECLMEAELKSYSVIMLDEAHERTIHTDVLFGLLKTA  725

Query  242   QKQRRQRGLTPLKIIITSATMDIDHFGKYFNVRGMY-LEGKTYPVKVMHTKETQPDYLNA  300
              ++R +     LK+I+TSAT+D   F +YF    ++ + G+T+PV+V++TKE + DYL+A
Sbjct  726   VQKRPE-----LKLIVTSATLDAVKFSQYFFKAPIFTIPGRTFPVEVLYTKEPETDYLDA  780

Query  301   ALVTLFQFHRAEPVNHDVLIFLTGQEEIEAMAHQIRQIAKTHDAELSPVRVFPLYAQLPQ  360
             +L+T+ Q H  EP   D+L+FLTGQEEI+     + +  K+   ++  + + P+Y+ LP 
Sbjct  781   SLITVMQIHLREPPG-DILLFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPS  839

Query  361   NKQLECFLPAHANSRKIVLATNIAETSVTIPGIRCVIDCGFVKRRVYNPSSGLDALRIVR  420
               Q   F PA A SRK+V+ATNIAETS+TI GI  V+D GFVK++VYN  +G+D+L +  
Sbjct  840   EMQTRIFDPAPAGSRKVVIATNIAETSLTIDGIFYVVDPGFVKQKVYNSKTGMDSLVVTP  899

Query  421   VSQAQAWQRCGRAGRDAPGTCYRTYTQ-AEMESFENMPKPEILRSNICSTVLQLLALGI-  478
             +SQA A QR GRAGR  PG  YR YT+ A  +     P PEI R+N+ +TVLQL  +GI 
Sbjct  900   ISQAAAKQRAGRAGRTGPGKTYRLYTERAYRDEMLPTPVPEIQRTNLATTVLQLKTMGIN  959

Query  479   DCRTFDFLDRPTPEAVDDAYRKLEALGAVRNYKIKPELTTLGQQMSQFPLDPRYSKLLLS  538
             D   FDF+D P  E++  A  +L +L A+ +  +   LT LG++M++FPL+P  SK+L+ 
Sbjct  960   DLLHFDFMDAPPVESLVMALEQLHSLSALDDEGL---LTRLGRRMAEFPLEPNLSKMLIM  1016

Query  539   ASAFGCMEEMLSLVAVLSGENVFVSSNEKRELAALAHAKFTSKHGDHLTLLNVFSAFLKT  598
             + A  C +E+L++V++LS +NVF    +K+ LA    AKF    GDHLTLL V++++   
Sbjct  1017  SVALQCSDEILTIVSMLSVQNVFYRPKDKQALADQKKAKFNQAEGDHLTLLAVYNSWKNN  1076

Query  599   EKVKLWCHDNFLNTRNLSYAREVRKQLQEIVERLDLPLNSCGNNQDQVRKCLLIGLFDNI  658
             +    WC++NF+  R L  +++VRKQL  I++R  L + S G N  +++K +  G F N 
Sbjct  1077  KFSNAWCYENFVQIRTLKRSQDVRKQLLGIMDRHKLDVVSAGKNSVRIQKAICSGFFRNA  1136

Query  659   AELQRDNTYLTITGRQRTRIHPSSVFHGKYRPEYVIFTEIVLTERNFLRQVSEINPDWIA  718
             A+      Y T+   Q   IHPSS    + +PE+VI+ E+V T + ++R+V+ I+P W+ 
Sbjct  1137  AKKDPQEGYRTLVDSQVVYIHPSSALFNR-QPEWVIYHELVQTTKEYMREVTTIDPKWLV  1195

Query  719   DVLPNY  724
             +  P++
Sbjct  1196  EFAPSF  1201


>MOG5_CAEEL unnamed protein product
Length=1200

 Score = 552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/630 (44%), Positives = 422/630 (67%), Gaps = 13/630 (2%)

Query  98    QRQALPVYKVRQRLILEARRSETLLLMGETGSGKTTQIPQFLYESGFAQKGMIGITQPRR  157
             QR++LP++ +++ L+     ++ L+++GETGSGKTTQ+ Q+  E+G  ++G IG TQPRR
Sbjct  536   QRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRGKIGCTQPRR  595

Query  158   VAAITVARRVAQEQGCRLGETVGYTVRFEDCTSPQTRIRFLTDGCLLREAIADRLLRQYT  217
             VAA++VA+RVA+E GC+LG  VGYT+RFEDCTS  T I+++TDG LLRE + D  L  Y+
Sbjct  596   VAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPDLSGYS  655

Query  218   VLILDEAHERTINTDVLFGIVKEAQKQRRQRGLTPLKIIITSATMDIDHFGKYFNVRGMY  277
             +++LDEAHERTI+TDVLFG++K A ++R +     LK+IITSAT+D   F +YF    ++
Sbjct  656   LIMLDEAHERTIHTDVLFGLLKAAARKRPE-----LKLIITSATLDSVKFSEYFLEAPIF  710

Query  278   -LEGKTYPVKVMHTKETQPDYLNAALVTLFQFHRAEPVNHDVLIFLTGQEEIEAMAHQIR  336
              + G+T+PV++++T+E + DYL AA +T+ Q H  EP   DVL+FLTGQEEI+     + 
Sbjct  711   TIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPG-DVLVFLTGQEEIDTSCEVLY  769

Query  337   QIAKTHDAELSPVRVFPLYAQLPQNKQLECFLPAHANSRKIVLATNIAETSVTIPGIRCV  396
             +  K+   ++  + + P+Y  LP   Q   F PA A  RK+V+ATNIAETS+TI GI  V
Sbjct  770   ERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDGIFYV  829

Query  397   IDCGFVKRRVYNPSSGLDALRIVRVSQAQAWQRCGRAGRDAPGTCYRTYTQ-AEMESFEN  455
             +D GFVK+++YNP SG+D+L +  +SQA A QR GRAGR  PG CYR YT+ A  +    
Sbjct  830   VDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEMLP  889

Query  456   MPKPEILRSNICSTVLQLLALGI-DCRTFDFLDRPTPEAVDDAYRKLEALGAVRNYKIKP  514
              P PEI R+N+ ST+LQL A+GI +   FDF+D P  +++  A   L  L A+    +  
Sbjct  890   TPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGL--  947

Query  515   ELTTLGQQMSQFPLDPRYSKLLLSASAFGCMEEMLSLVAVLSGENVFVSSNEKRELAALA  574
              LT LG++M++FPL+P  SKLL+ +   GC EE+L++VA+L+ +N+F    EK++ A   
Sbjct  948   -LTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHADQK  1006

Query  575   HAKFTSKHGDHLTLLNVFSAFLKTEKVKLWCHDNFLNTRNLSYAREVRKQLQEIVERLDL  634
              AKF    GDHLTLL V++++      + WC +NF+  R++  A+++RKQL  I++R  L
Sbjct  1007  KAKFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKL  1066

Query  635   PLNSCGNNQDQVRKCLLIGLFDNIAELQRDNTYLTITGRQRTRIHPSSVFHGKYRPEYVI  694
              + SCG +  +V+K +  G F N A+      Y T+T  Q   IHPSS    + +PE+V+
Sbjct  1067  LMVSCGRDVSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACF-QQQPEWVV  1125

Query  695   FTEIVLTERNFLRQVSEINPDWIADVLPNY  724
             + E+V+T + ++R+V+ I+P W+ +  P++
Sbjct  1126  YHELVMTTKEYMREVTAIDPKWLVEFAPSF  1155


>Q7K3M5_DROME unnamed protein product
Length=729

 Score = 523 bits (1346),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 282/651 (43%), Positives = 419/651 (64%), Gaps = 26/651 (4%)

Query  93   QQLELQRQALPVYKVRQRLILEARRSETLLLMGETGSGKTTQIPQFLYESGFAQKGMIGI  152
            Q L  +R ALPV++ +   +      + ++L+GETGSGKTTQIPQ+  +   + KG  G+
Sbjct  63   QNLYKKRIALPVFEYQADFMRLLSLHQCIVLVGETGSGKTTQIPQWCVDFAVS-KGRKGV  121

Query  153  --TQPRRVAAITVARRVAQEQGCRLGETVGYTVRFEDCTSPQTRIRFLTDGCLLREAIAD  210
              TQPRRVAA++VA+RV++E   +LGE VGY++RFEDC++ +T ++++TDG LLREA++D
Sbjct  122  SCTQPRRVAAMSVAQRVSEEMDVKLGEEVGYSIRFEDCSTAKTLLKYMTDGMLLREAMSD  181

Query  211  RLLRQYTVLILDEAHERTINTDVLFGIVKEAQKQRRQRGLTPLKIIITSATMDIDHFGKY  270
             +L QY V++LDEAHERT+ TD+L G++KE  +QR     + LK+++ SAT+D   F +Y
Sbjct  182  PMLDQYQVILLDEAHERTLATDILMGVLKEVIRQR-----SDLKLVVMSATLDAGKFQQY  236

Query  271  F-NVRGMYLEGKTYPVKVMHTKETQPDYLNAALVTLFQFHRAEPVNHDVLIFLTGQEEIE  329
            F N   M + G+T+PV++ +T E + DYL AA+ T+ Q H  E +  D+L+FLTGQEEIE
Sbjct  237  FDNAPLMKVPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMCEEIEGDILMFLTGQEEIE  296

Query  330  AMAHQIRQIAKTHDAELSPVRVFPLYAQLPQNKQLECFLPA---HAN---SRKIVLATNI  383
                +I++      +E+  ++  PLY+ LP N Q   F PA   +AN    RK+V++TNI
Sbjct  297  EACKRIKREIDNLGSEIGELKCIPLYSTLPPNLQQRIFEPAPPPNANGAIGRKVVVSTNI  356

Query  384  AETSVTIPGIRCVIDCGFVKRRVYNPSSGLDALRIVRVSQAQAWQRCGRAGRDAPGTCYR  443
            AETS+TI G+  VID GF K++VYNP   +++L +  +S+A A QR GRAGR  PG C+R
Sbjct  357  AETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVSPISKASAQQRSGRAGRTRPGKCFR  416

Query  444  TYTQAEMES-FENMPKPEILRSNICSTVLQLLALGIDCRT-FDFLDRPTPEAVDDAYRKL  501
             YT+   ++  ++   PEILRSN+ + VLQL  LGID    FDF+D P PE +    R L
Sbjct  417  LYTEKAFKNEMQDNTYPEILRSNLGTVVLQLKKLGIDDLVHFDFMDPPAPETL---MRAL  473

Query  502  EALGAVRNYKIKPELTTLGQQMSQFPLDPRYSKLLLSASAFGCMEEMLSLVAVLSGENVF  561
            E L  +        LT LG  MS+FPLDP+ +K+L+++    C  E+LS+ A+LS    F
Sbjct  474  ELLNYLAALDDDGNLTDLGAVMSEFPLDPQLAKMLIASCQHNCSNEILSITAMLSVPQCF  533

Query  562  VSSNEKRELAALAHAKFTSKHGDHLTLLNVFSAFLKTEKVKLWCHDNFLNTRNLSYAREV  621
            V  NE ++ A  A  +F    GDHLTLLNV+ AF ++ +   WC++NF+N R+L  A  V
Sbjct  534  VRPNEAKKAADEAKMRFAHIDGDHLTLLNVYHAFKQSSEDPNWCYENFINFRSLKSADNV  593

Query  622  RKQLQEIVERLDLPLNSCG-NNQD---QVRKCLLIGLFDNIAELQRDNTYLTITGRQRTR  677
            R+QL  I++R +L   S    ++D    +RK L+ G F  +A L+R   YLTI   Q  +
Sbjct  594  RQQLARIMDRFNLRRTSTEFTSKDYYVNIRKALVQGFFMQVAHLERTGYYLTIKDNQNVQ  653

Query  678  IHPSSVFHGKYRPEYVIFTEIVLTERNFLRQVSEINPDWIADVLPNYAHLN  728
            +HPS+     ++P++VI+ E VLT +N++R V+++ P+W+  + P Y  LN
Sbjct  654  LHPSTCL--DHKPDWVIYNEFVLTTKNYIRTVTDVKPEWLCCLAPQYYDLN  702



Lambda      K        H
   0.311    0.126    0.334 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7143864416


Query= XP_011197202.3 tetraspanin-6 [Bactrocera dorsalis]

Length=248
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9V3X2_DROME  unnamed protein product                                 89.7    3e-21
A0A0B4KH03_DROME  unnamed protein product                             89.7    4e-21
Q7KJ73_DROME  unnamed protein product                                 54.7    7e-09


>Q9V3X2_DROME unnamed protein product
Length=268

 Score = 89.7 bits (221),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 60/262 (23%), Positives = 115/262 (44%), Gaps = 35/262 (13%)

Query  17   IRGMLLLFNLLLWFAGLLIILTGIWLQTDFQNYLKISGGYSNY--VPYLLLIVGGILVFA  74
            ++ +++L N+L W  GL I++T +W+ TD    L ++  Y++Y    Y+ L +G ++   
Sbjct  10   VKYLMVLINILFWLIGLTIVVTSVWMLTDPTFMLSMTQNYNHYHIALYVFLAIGILITLG  69

Query  75   ASLACSCIVKVDPTMLVIYGGFLIAAMFTLILMSIYIYTYKDSVITGLPAGIEREVKNYN  134
            A   C  + +    +LV +   ++  M   I    + +  KD +   + A ++  V+   
Sbjct  70   AFFGCCGVCRESQCLLVSFFCVILIVMVAQIAAGAWAFHNKDKLDDIVRAAVKSSVQEEY  129

Query  135  AYKSDPFLANNATLIDYIQNNLECCGGKNHLDWPKD----------------------SL  172
               +   +++     D +Q NL+CCG     DW                         ++
Sbjct  130  GQST---MSSRTVTFDTLQKNLKCCGADGPGDWATSRFNNVDRTNIVEIAVSSMNVFYNI  186

Query  173  PNSCCWDNGENKRCS---DYQF-----EQLHEVGCLPKLIRLINTNLTSIGVMLSVLALF  224
            P SCC DN ++  C      +F       +++ GC+ KLI +I  N  +I  + + + L 
Sbjct  187  PESCCKDNLKDNECELSRRLKFGGPLNNAIYQQGCVDKLIEIIYENWVTIFAVTAAVILL  246

Query  225  PLFAMVFSYSLASASRRIGYQP  246
             L ++ F+ SL  A R   Y+ 
Sbjct  247  ELLSLTFALSLCCAVRNQHYKA  268


>A0A0B4KH03_DROME unnamed protein product
Length=284

 Score = 89.7 bits (221),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 60/262 (23%), Positives = 115/262 (44%), Gaps = 35/262 (13%)

Query  17   IRGMLLLFNLLLWFAGLLIILTGIWLQTDFQNYLKISGGYSNY--VPYLLLIVGGILVFA  74
            ++ +++L N+L W  GL I++T +W+ TD    L ++  Y++Y    Y+ L +G ++   
Sbjct  10   VKYLMVLINILFWLIGLTIVVTSVWMLTDPTFMLSMTQNYNHYHIALYVFLAIGILITLG  69

Query  75   ASLACSCIVKVDPTMLVIYGGFLIAAMFTLILMSIYIYTYKDSVITGLPAGIEREVKNYN  134
            A   C  + +    +LV +   ++  M   I    + +  KD +   + A ++  V+   
Sbjct  70   AFFGCCGVCRESQCLLVSFFCVILIVMVAQIAAGAWAFHNKDKLDDIVRAAVKSSVQEEY  129

Query  135  AYKSDPFLANNATLIDYIQNNLECCGGKNHLDWPKD----------------------SL  172
               +   +++     D +Q NL+CCG     DW                         ++
Sbjct  130  GQST---MSSRTVTFDTLQKNLKCCGADGPGDWATSRFNNVDRTNIVEIAVSSMNVFYNI  186

Query  173  PNSCCWDNGENKRCS---DYQF-----EQLHEVGCLPKLIRLINTNLTSIGVMLSVLALF  224
            P SCC DN ++  C      +F       +++ GC+ KLI +I  N  +I  + + + L 
Sbjct  187  PESCCKDNLKDNECELSRRLKFGGPLNNAIYQQGCVDKLIEIIYENWVTIFAVTAAVILL  246

Query  225  PLFAMVFSYSLASASRRIGYQP  246
             L ++ F+ SL  A R   Y+ 
Sbjct  247  ELLSLTFALSLCCAVRNQHYKA  268


>Q7KJ73_DROME unnamed protein product
Length=228

 Score = 54.7 bits (130),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 57/240 (24%), Positives = 111/240 (46%), Gaps = 27/240 (11%)

Query  15   NFIRGMLLLFNLLLWFAGLLIILTGIWLQTDFQNYLKISG--GY--SNYVPYLLLIVGGI  70
            + ++ +L +FN ++   G+L I+ G+ +       ++++G  G+     +P +L+ +G I
Sbjct  6    SMVKYILFIFNTIVSVIGILGIVYGVLILKSI-GVVEVNGQVGFPIQALMPIILISLGSI  64

Query  71   LVFAASLACSCIVKVDPTMLVIYGGFLIAAMFTLILMSIYIYTYKDSVITGLPAGIEREV  130
            +VF + L C   ++    M + Y  FL+  +   +   + ++T+++     +   IE   
Sbjct  65   VVFISFLGCCGAIRESVCMTMSYATFLLILLILQLTFVVLLFTHREEFENAMGNVIENAW  124

Query  131  KNYNAYKSDPFLANNATLIDYIQNNLECCGGKNHLDW--PKDSLPNSCCWDNGENKRCSD  188
             + + YK   F        D IQ +L CCG  + LD+    D +P SCC  +G     ++
Sbjct  125  NSEHTYKGGVF--------DTIQKSLHCCGSSSALDYIGKGDLVPPSCC--SGSCLIPTN  174

Query  189  YQFEQLHEVGCLPKLIRLINT---NLTSIGVMLSVLALFP-LFAMVFSYSLASASRRIGY  244
            Y        GC  K + L+ T   N   +G+ L  + L   +FA   + ++ +  RR  Y
Sbjct  175  YY------PGCRGKFVELMTTGSDNAKYVGIGLIGIELIGFIFACCLANNVRNYKRRNAY  228



Lambda      K        H
   0.311    0.126    0.334 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7143864416


Query= XP_011197203.1 G-protein coupled receptor Mth2 [Bactrocera dorsalis]

Length=743
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MTH_DROME  unnamed protein product                                    129     2e-31
MTH_DROYA  unnamed protein product                                    128     4e-31
MTH_DROSI  unnamed protein product                                    118     7e-28


>MTH_DROME unnamed protein product
Length=514

 Score = 129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 89/266 (33%), Positives = 143/266 (54%), Gaps = 19/266 (7%)

Query  426  ALTLGVYLSISRLRNLPGKILICLVSNLFAAYLGIALGQLVPINNDNMCFASGYFIYFCL  485
             LT+ VYL + +L+NL GK  IC +  LF  YL + L  L  I+  + C  +G+  YF +
Sbjct  230  VLTIAVYLFVKKLQNLHGKCFICYMVCLFMGYLFLLL-DLWQIS-ISFCKPAGFLGYFFV  287

Query  486  MAAFAWMNVMCFDIWQTF-GSAKKKRGFQTKDMGRFLLYSLYGWGLPTLMTTITVTLAKS  544
            MAAF W++V+   +W TF GS+ K   F  +   RFL Y+ Y WG+  ++T ITV     
Sbjct  288  MAAFFWLSVISLHLWNTFRGSSHKANRFLFEH--RFLAYNTYAWGMAVVLTGITV--LAD  343

Query  545  DLLTNENLRPNF-KQGRCWFTYGTFASANLLFFSGPIGVLSLFNFVLFLLTLRYCNRVKR  603
            +++ N++  P    +G CW    T A + +L+F GP+  L  FN  +F+LT +    VK+
Sbjct  344  NIVENQDWNPRVGHEGHCWIY--TQAWSAMLYFYGPMVFLIAFNITMFILTAKRILGVKK  401

Query  604  EIFRMQSSNVEKPIMRRRFFVDKARFAMNTKLFIVMGITWFMEILSIVLYDRK---KVFF  660
            +I     +   +   +++   DK  +    +LFI+MG++W +EI S      +    VF 
Sbjct  402  DI----QNFAHRQERKQKLNSDKQTYTFFLRLFIIMGLSWSLEIGSYFSQSNQTWANVF-  456

Query  661  WVVSDSFNVLLGVFVFFIFVFKKRIW  686
             +V+D  N   G+ +F +FV K+  W
Sbjct  457  -LVADYLNWSQGIIIFILFVLKRSTW  481


>MTH_DROYA unnamed protein product
Length=517

 Score = 128 bits (322),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 119/438 (27%), Positives = 194/438 (44%), Gaps = 64/438 (15%)

Query  271  VRTCQPRRVCQGVACIRRCCADGEFFTKGNKTSYCKRDESDVSFHSFES-LQIT------  323
            +R C    VC+   C+R CC            + C  D ++      +  L +T      
Sbjct  83   IRGC----VCKLKPCVRFCCPHNHIM----DMNVCAGDMTEEELEVLDPFLNVTLDDGSV  134

Query  324  --GNFTKPAVFGILRGLDCQRFLLNPDLYSSDAHIINSNDGSLYVASSTKNYTNNQYCVE  381
               +F K  +      + C       +   +D + +  N GS +           +YC++
Sbjct  135  VRRHFKKELIVQWDLPMSCDGMFSLDNREKTDQYTLFEN-GSFFRHHDRVTLNKREYCLQ  193

Query  382  KIRNSTFGEQKLYTFLCFDSKVVGNEKIRFKMYPIGLLISCSFYA-------------LT  428
             +           TF      V GNE    ++ P   LIS S                LT
Sbjct  194  HL-----------TF------VDGNES-SIRIAPHNCLISPSRMGQTVVMITSLVCMVLT  235

Query  429  LGVYLSISRLRNLPGKILICLVSNLFAAYLGIALGQLVPINNDNMCFASGYFIYFCLMAA  488
            + VYL + +L+NL GK  +C +  LF AYL + L       + N C  +G+  YF +MAA
Sbjct  236  ITVYLFVKKLQNLHGKCFMCYMVCLFMAYLLLLLNLWQM--SQNFCITAGFLGYFFVMAA  293

Query  489  FAWMNVMCFDIWQTF-GSAKKKRGFQTKDMGRFLLYSLYGWGLPTLMTTITVTLAKSDLL  547
            F W++V+   +W TF GSA     F ++   RFL Y+ Y WG+  ++T IT    K  ++
Sbjct  294  FLWLSVISLHLWNTFSGSAHNANRFLSEH--RFLAYNTYAWGMAVVLTGITYLADK--VV  349

Query  548  TNENLRPNFK-QGRCWFTYGTFASANLLFFSGPIGVLSLFNFVLFLLTLRYCNRVKREIF  606
             NE+  P     G CW    ++++  +L+F GP+  L  FN  +F+LT      VK++I 
Sbjct  350  ENEDWNPRMGFGGHCWICTQSWSA--MLYFYGPMVFLIAFNITMFILTANRIIGVKKDIQ  407

Query  607  RMQSSNVEKPIMRRRFFVDKARFAMNTKLFIVMGITWFMEILS-IVLYDRKKVFFWVVSD  665
            +       K    ++   DK  +    +LFI+MG+TW +EI S I  +++     ++V+D
Sbjct  408  KFAHRQERK----QKLNSDKQTYTFFLRLFIIMGLTWSLEIGSYISQFNQTWSNVFLVAD  463

Query  666  SFNVLLGVFVFFIFVFKK  683
              N   G+ +F +FV K+
Sbjct  464  YLNWSQGIIIFILFVLKR  481


>MTH_DROSI unnamed protein product
Length=515

 Score = 118 bits (296),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 78/228 (34%), Positives = 127/228 (56%), Gaps = 14/228 (6%)

Query  426  ALTLGVYLSISRLRNLPGKILICLVSNLFAAYLGIALGQLVPINNDNMCFASGYFIYFCL  485
             LT+ VYL + +L+NL GK  IC +  LF  YL + L  L  I+  + C  +G   YF +
Sbjct  230  VLTIAVYLFVKKLQNLHGKCFICYMVCLFMGYLFL-LFDLWQISI-SFCKPAGVLGYFFV  287

Query  486  MAAFAWMNVMCFDIWQTF-GSAKKKRGFQTKDMGRFLLYSLYGWGLPTLMTTITVTLAKS  544
            MAAF W++V+   +W TF GS+ K   F ++   RFL Y+ Y WG+  ++T ITV     
Sbjct  288  MAAFLWLSVISLHLWNTFRGSSHKASRFFSEH--RFLAYNTYAWGMSMVLTGITV--LAD  343

Query  545  DLLTNENLRPNF-KQGRCWFTYGTFASANLLFFSGPIGVLSLFNFVLFLLTLRYCNRVKR  603
            +++ +++  P   ++G CW    T A + +L+F GP+  L  FN  +F+LT R    VK+
Sbjct  344  NVVEDQDWNPRVGEEGHCWIY--TQAWSAMLYFYGPMVFLIAFNITMFILTARRIIGVKK  401

Query  604  EIFRMQSSNVEKPIMRRRFFVDKARFAMNTKLFIVMGITWFMEILSIV  651
            +I     +   +   +++   DK  +    +LFI+MG++W +EI S +
Sbjct  402  DI----QNFAHRQERKQKLNSDKQTYTFFLRLFIIMGLSWSLEIGSYI  445



Lambda      K        H
   0.311    0.126    0.334 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7143864416


Query= XP_011197204.1 uncharacterized protein LOC105221790 [Bactrocera
dorsalis]

Length=1195
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SCHI1_DROME  unnamed protein product                                  207     3e-56


>SCHI1_DROME unnamed protein product
Length=616

 Score = 207 bits (526),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 150/439 (34%), Positives = 223/439 (51%), Gaps = 76/439 (17%)

Query  743   MRPKYQKASYDERQLPPVAIEYKRCQQNSRNMRKSAGQNHEKSEKPTKASGGTKIGRNYS  802
             ++ K+ K S+DERQLPP   +YK   Q  + +   A Q     EK    S       N +
Sbjct  232   VKTKHPKPSHDERQLPPDTFDYKTYSQ-RKYIICDADQYSSVPEKNKNDSP------NLN  284

Query  803   KTGFTSRFFSSKRTNMGGSSRNSEENSNRRREEAEMHQYQQLISNKELILSNSRYTKMSA  862
             +    +   SS      GS +N +E++N+                    +++ +Y+  S 
Sbjct  285   QAEIPN--MSSLEIGGSGSQQNLDEDNNK--------------------VASRKYSNQSR  322

Query  863   WAEYLKNSVKNHGGKCASTDLASPSALDLFDAYKIGGDFDMETLQQHLKLAKEIEKKRRS  922
             W++YL++ +K       S D  S   L+ FDAYKI  D D+ETLQ H K  K+IEKKRR 
Sbjct  323   WSQYLEDPIK------YSKDPCSTMVLEQFDAYKIANDMDVETLQNHYKKVKQIEKKRRF  376

Query  923   DREEIRRRLAMGSEEPNQESKERNAWKTGIQSRLANAQLGRLNDPSSDTESHSSDSETCP  982
             +R+EIR+RLA+G ++      ++  + TG                 SD ES+SSDSETCP
Sbjct  377   NRDEIRKRLAIGDKDSLNNDIKKEEFLTG-----------------SDNESYSSDSETCP  419

Query  983   KLSKG--RQVDNMCALNISLADKPTYPYAGSGHASISSLSSAATANKYQIQQQMQRSHSK  1040
             KLS G  R+    C    +                     +     K QI Q    +H  
Sbjct  420   KLSSGVLRKQSEFCETKRN-----------------KEFENDKIFQKNQINQDKSMNHMN  462

Query  1041  QQSFQTPMSAFSSEDLECDFFTKQAKLQIEARMALAQAKEMAHMQMEIERQNRRVSPITD  1100
                  T     S E+L   FF  Q+KLQIE R+ALAQ+KE+A  QM+++ +   V+PI D
Sbjct  463   GNPIGT-TDYPSDENLF--FFANQSKLQIEVRIALAQSKEIA--QMKVKARKHGVTPIVD  517

Query  1101  IIRVSLRKVGVQMTADKRRVSRQMLTDMNIAQLQILVNSLHTHIEELNESLVHNLMERDD  1160
             +IR  L  VG++M ++ R +SRQ+LT + +  LQ+LVN+L  +IE LN +L+ +L ERDD
Sbjct  518   VIRSMLCDVGIKMNSNHRWISRQLLTGIQVPTLQLLVNNLQEYIENLNVTLLESLKERDD  577

Query  1161  LHVSQDSMLVDIEELTRYI  1179
             L+  QD +L D+E++  + 
Sbjct  578   LNSDQDDILHDLEKINNFF  596


 Score = 50.4 bits (119),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 26/43 (60%), Gaps = 5/43 (12%)

Query  288  FYFPRGIINPNYPGFQHLAHTLSEHFI-----GCTPSDSYDSD  325
             Y  +GI NPNYPGFQ  AHTLS+ +I      C  SD  DSD
Sbjct  3    IYITKGITNPNYPGFQKFAHTLSDDYIEYSDMECNESDLTDSD  45


 Score = 48.1 bits (113),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 42/73 (58%), Gaps = 9/73 (12%)

Query  577  NGKEDGVGFGITPVDIIGDFEQEVEREFGLLVSGYRRLVETNDEANEDDNEVGQPQPIEK  636
            N K +G   G +P+DI+GDF  EVEREF LL++GY+   E ++    +         ++K
Sbjct  141  NSKYEGQLQGQSPIDIVGDFGGEVEREFELLLTGYKNKKEADELKGSN---------LDK  191

Query  637  VSDAMLSSAKDLI  649
            + DA LS+  + +
Sbjct  192  ICDAELSNGTEAL  204



Lambda      K        H
   0.311    0.126    0.334 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7143864416


Query= XP_011197205.1 active regulator of SIRT1 [Bactrocera dorsalis]

Length=139
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q38C94_TRYB2  unnamed protein product                                 31.6    0.19 
G5EEK9_CAEEL  unnamed protein product                                 30.8    0.35 
C1P641_CAEEL  unnamed protein product                                 30.0    0.62 


>Q38C94_TRYB2 unnamed protein product
Length=846

 Score = 31.6 bits (70),  Expect = 0.19, Method: Composition-based stats.
 Identities = 32/133 (24%), Positives = 53/133 (40%), Gaps = 6/133 (5%)

Query  2    SLKLLKQSLDILDETTSNIEKATQKTAKTVPRNAHLSKSKRKQANNEQHQTLMSITKEKK  61
            S  L   SLD L +    I+ A  +  +++  N     +    A+NE+  T  S T   +
Sbjct  654  SSSLFHDSLDDLKQVEGYIQTAASQLKQSLQSNQGTQTTASSAADNEEGVTQHSFTLMTR  713

Query  62   NIE-DVRKELQPDQNKTNTNLKRLLALSQNTITPNDANKIIKRNNKGKTIKTAKKPKVLK  120
                D     +    +   +L R  A  Q  +TP+D     KR  +   ++   +PK L+
Sbjct  714  GTSLDCLPSAKELMLRHAVDLIRWAASEQLLLTPDD-----KREKQRGVLEAELEPKKLQ  768

Query  121  SIFTEEDFLAFER  133
                 ED +A  R
Sbjct  769  GKKLWEDAMAILR  781


>G5EEK9_CAEEL unnamed protein product
Length=873

 Score = 30.8 bits (68),  Expect = 0.35, Method: Composition-based stats.
 Identities = 13/42 (31%), Positives = 28/42 (67%), Gaps = 3/42 (7%)

Query  61   KNIEDVRKELQPDQNKTNTNLKRLLALSQNTITP---NDANK  99
            K++EDVRK ++    ++ +++K +L + + ++TP   N+ NK
Sbjct  331  KHVEDVRKAIEVGAERSGSSVKPVLNILETSVTPPTYNETNK  372


>C1P641_CAEEL unnamed protein product
Length=3663

 Score = 30.0 bits (66),  Expect = 0.62, Method: Composition-based stats.
 Identities = 34/135 (25%), Positives = 62/135 (46%), Gaps = 9/135 (7%)

Query  7     KQSLDILDETTSNIEKATQKTAKTVPRNAHLSKS--KRKQANNE-----QHQTLMSITKE  59
             K+ +D L +T S   K T+K  K + +   LS+   KRK+A           TL SI ++
Sbjct  2520  KEKIDALSKTVSQDLKETEKLKKQLEQLTELSEKLRKRKEAVKAGIPKYSKNTLDSIDEK  2579

Query  60    KKNIEDVRKELQPDQNKTNTNLKRLLALSQN-TITPNDANKIIKRNNKGKTIKTAKKPKV  118
              + +E ++ E+  +  +T   +  +   ++  T   N A + I R  +  +++  K   V
Sbjct  2580  VQEVEKLKAEIDANIEETRAKISEIAGKAEEITEKANSAMEGI-RLARRNSVQLNKLAPV  2638

Query  119   LKSIFTEEDFLAFER  133
             + S F E   L+  R
Sbjct  2639  IVSKFEELKKLSSAR  2653



Lambda      K        H
   0.311    0.126    0.334 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7143864416


Query= XP_011197206.1 protein daughterless [Bactrocera dorsalis]

Length=709
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DA_DROME  unnamed protein product                                     575     0.0  
Q86PA6_DROME  unnamed protein product                                 571     0.0  
G5EEG9_CAEEL  unnamed protein product                                 102     4e-23


>DA_DROME unnamed protein product
Length=710

 Score = 575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/770 (51%), Positives = 468/770 (61%), Gaps = 149/770 (19%)

Query  1    MATSDDEPMHLYEVFQNCFNKIANKQPS-TGGAERNGG--YQSPYGGLGMENGMYPNDDF  57
            MATSDDEPMHLYEVFQNCFNKIANKQP+ T GA+R GG  Y SPYG LG+ENGMYP+D F
Sbjct  1    MATSDDEPMHLYEVFQNCFNKIANKQPTGTVGADRGGGGGYHSPYGSLGVENGMYPSD-F  59

Query  58   NPMHDTP-GSSNRFADGGTGVNQYFDTNLGNGGGGVPPGAGGGPGGGWYS---STVGGYG  113
            N MHDT  G +NR+A+  T V+QYFD+            A  G GG W     S+   Y 
Sbjct  60   NSMHDTVNGGNNRYANAST-VDQYFDS------------AAAGSGGAWCQPQMSSANSYM  106

Query  114  NPNSYQNNGPLDPHHLTPQQHHNPEQQHHGMTGGNSMGGGLPIDSVGMHSPVPTSLPPMS  173
              ++YQN+GPL  H +  QQ    +Q H     G   GGG  + + GMH PV T LPP+S
Sbjct  107  GQSAYQNSGPLSGHSIDQQQ----QQVHQADGLGMGGGGGGGVGADGMHCPVTTGLPPIS  162

Query  174  SFRSGSNNM------QQISGPAAHSPATLYNSPQ-----------HNALATANAHGHHPL  216
            SFR  S  +      QQ       +P  ++NSPQ           H+AL+TA   GHH L
Sbjct  163  SFRPTSGGIGGPGAGQQAPVNVNVNPPAVFNSPQAHNHNHTVQAQHSALSTAGPLGHHSL  222

Query  217  SH-------------------------HSQQHSPAVQS-DAF-GVGVGVTGMGLGPKGPS  249
            +H                         HSQQ+SPAVQS DAF G G  V          +
Sbjct  223  NHTPHAHSHTLPLPHALPHGHTLPHPHHSQQNSPAVQSSDAFSGAGASVKV--------A  274

Query  250  ATAGNSTASLRQHMYMTAAAAAAADQSISSFSSNPSTPVNSPPPLTQSGLTQSLLDKSVV  309
                +S A+LRQ MYM       ADQSISSF SNPSTPVNSPPPLTQS          VV
Sbjct  275  GAGNSSAAALRQQMYM------PADQSISSFGSNPSTPVNSPPPLTQS----------VV  318

Query  310  GSNG-----GGAPWG-AVLNSAGGSVNSVGGGMGVGGSYGTDVGP-SGLHTMAAVFQGAR  362
            G  G     GG+ WG +VLN             G   SY +++ P S LHTMA+VFQG R
Sbjct  319  GGGGEPSVSGGSGWGHSVLNG------------GPSSSYASEMVPVSSLHTMASVFQGVR  366

Query  363  MEERLDDALNVLRNHCEPELLSGVGAALSAMDNMDGLSSFVPTSPPSHMVGGVGSTSG--  420
            MEERLDDALNVLRNHCEPE+L+GV  +L+++DN+D L+SFVP SP SH+  G  S S   
Sbjct  367  MEERLDDALNVLRNHCEPEMLAGVNQSLASIDNIDALTSFVPNSP-SHLGSGGNSGSVSN  425

Query  421  VSNLHSPHEVLAGNGPPLDAVGSGLNGSQSTVPQIKMERTTTTTSSATGTTSKSSKKRKE  480
             SN    HEVLA              G   ++  +K++R      SA+ +  K +KKRKE
Sbjct  426  TSNAALVHEVLALGAAAAAGTSGQSVGGAGSLASLKLDR------SASTSLPKQTKKRKE  479

Query  481  AAAAAAATSAMSAAAANSGGGASTSSMSGAMGGIVDGPDSKPTSSMEATHNN-QQGASGK  539
              A + +  A         G ++TSS++      +D  D+KPTSS+E++++  QQ + GK
Sbjct  480  HTAISNSVPA---------GVSTTSSLTS-----LDISDTKPTSSIESSNSGLQQHSQGK  525

Query  540  GSKRPRRYCSSAEDDDDVEPAVKAMREKERRQANNARERIRIRDINEALKELGRMCMTHL  599
            G+KRPRRYCSSA++DDD EPAVKA+REKERRQANNARERIRIRDINEALKELGRMCMTHL
Sbjct  526  GTKRPRRYCSSADEDDDAEPAVKAIREKERRQANNARERIRIRDINEALKELGRMCMTHL  585

Query  600  KSDKPQTKLGILNMAVEVIMTLEQQVRERNLNPKAACLKRREEEKAEDGPKLAAQHHMLP  659
            KSDKPQTKLGILNMAVEVIMTLEQQVRERNLNPKAACLKRREEEKAEDGPKL+AQHHM+P
Sbjct  586  KSDKPQTKLGILNMAVEVIMTLEQQVRERNLNPKAACLKRREEEKAEDGPKLSAQHHMIP  645

Query  660  QP------PGGGVYGQ-----PPMPQVSVPPGAGLPVPPQGSGVQLPPHL  698
            QP      PG   + Q     PP  Q        LPV    +G  LPPHL
Sbjct  646  QPQQVGGTPGSSYHSQPAQLVPPSSQTISTMTISLPVNQANNG--LPPHL  693


>Q86PA6_DROME unnamed protein product
Length=744

 Score = 571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/737 (52%), Positives = 456/737 (62%), Gaps = 142/737 (19%)

Query  1    MATSDDEPMHLYEVFQNCFNKIANKQPS-TGGAERNGG--YQSPYGGLGMENGMYPNDDF  57
            MATSDDEPMHLYEVFQNCFNKIANKQP+ T GA+R GG  Y SPYG LG+ENGMYP+D F
Sbjct  1    MATSDDEPMHLYEVFQNCFNKIANKQPTGTVGADRGGGGGYHSPYGSLGVENGMYPSD-F  59

Query  58   NPMHDTP-GSSNRFADGGTGVNQYFDTNLGNGGGGVPPGAGGGPGGGWYS---STVGGYG  113
            N MHDT  G +NR+A+  T V+QYFD+            A  G GG W     S+   Y 
Sbjct  60   NSMHDTVNGGNNRYANAST-VDQYFDS------------AAAGSGGAWCQPQMSSANSYM  106

Query  114  NPNSYQNNGPLDPHHLTPQQHHNPEQQHHGMTGGNSMGGGLPIDSVGMHSPVPTSLPPMS  173
              ++YQN+GPL  H +  QQ    +Q H     G   GGG  + + GMH PV T LPP+S
Sbjct  107  GQSAYQNSGPLSGHSIDQQQ----QQVHQADGLGMGGGGGGGVGADGMHCPVTTGLPPIS  162

Query  174  SFRSGSNNM------QQISGPAAHSPATLYNSPQ-----------HNALATANAHGHHPL  216
            SFR  S  +      QQ       +P  ++NSPQ           H+AL+TA   GHH L
Sbjct  163  SFRPTSGGIGGPGAGQQAPVNVNVNPPAVFNSPQAHNHNHTVQAQHSALSTAGPLGHHSL  222

Query  217  SH-------------------------HSQQHSPAVQS-DAF-GVGVGVTGMGLGPKGPS  249
            +H                         HSQQ+SPAVQS DAF G G  V          +
Sbjct  223  NHTPHAHSHTLPLPHALPHGHTLPHPHHSQQNSPAVQSSDAFSGAGASVKV--------A  274

Query  250  ATAGNSTASLRQHMYMTAAAAAAADQSISSFSSNPSTPVNSPPPLTQSGLTQSLLDKSVV  309
                +S A+LRQ MYM       ADQSISSF SNPSTPVNSPPPLTQS          VV
Sbjct  275  GAGNSSAAALRQQMYM------PADQSISSFGSNPSTPVNSPPPLTQS----------VV  318

Query  310  GSNG-----GGAPWG-AVLNSAGGSVNSVGGGMGVGGSYGTDVGP-SGLHTMAAVFQGAR  362
            G  G     GG+ WG +VLN             G   SY +++ P S LHTMA+VFQG R
Sbjct  319  GGGGEPSVSGGSGWGHSVLNG------------GPSSSYASEMVPVSSLHTMASVFQGVR  366

Query  363  MEERLDDALNVLRNHCEPELLSGVGAALSAMDNMDGLSSFVPTSPPSHMVGGVGSTSG--  420
            MEERLDDALNVLRNHCEPE+L+GV  +L+++DN+D L+SFVP SP SH+  G  S S   
Sbjct  367  MEERLDDALNVLRNHCEPEMLAGVNQSLASIDNIDALTSFVPNSP-SHLGSGGNSGSVSN  425

Query  421  VSNLHSPHEVLAGNGPPLDAVGSGLNGSQSTVPQIKMERTTTTTSSATGTTSKSSKKRKE  480
             SN    HEVLA              G   ++  +K++R      SA+ +  K +KKRKE
Sbjct  426  TSNAALVHEVLALGAAAAAGTSGQSVGGAGSLASLKLDR------SASTSLPKQTKKRKE  479

Query  481  AAAAAAATSAMSAAAANSGGGASTSSMSGAMGGIVDGPDSKPTSSMEATHNN-QQGASGK  539
              A + +  A         G ++TSS++      +D  D+KPTSS+E++++  QQ + GK
Sbjct  480  HTAISNSVPA---------GVSTTSSLTS-----LDISDTKPTSSIESSNSGLQQHSQGK  525

Query  540  GSKRPRRYCSSAEDDDDVEPAVKAMREKERRQANNARERIRIRDINEALKELGRMCMTHL  599
            G+KRPRRYCSSA++DDD EPAVKA+REKERRQANNARERIRIRDINEALKELGRMCMTHL
Sbjct  526  GTKRPRRYCSSADEDDDAEPAVKAIREKERRQANNARERIRIRDINEALKELGRMCMTHL  585

Query  600  KSDKPQTKLGILNMAVEVIMTLEQQVRERNLNPKAACLKRREEEKAEDGPKLAAQHHMLP  659
            KSDKPQTKLGILNMAVEVIMTLEQQVRERNLNPKAACLKRREEEKAEDGPKL+AQHHM+P
Sbjct  586  KSDKPQTKLGILNMAVEVIMTLEQQVRERNLNPKAACLKRREEEKAEDGPKLSAQHHMIP  645

Query  660  QP------PGGGVYGQP  670
            QP      PG   + QP
Sbjct  646  QPQQVGGTPGSSYHSQP  662


>G5EEG9_CAEEL unnamed protein product
Length=399

 Score = 102 bits (254),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 81/130 (62%), Gaps = 13/130 (10%)

Query  522  PTSSMEATHNNQQGASGKGSKR---------PRRYCSSAEDDDDVEPAVKAMREKERRQA  572
            P SS  +  N++  +     +R         P R+ SS+   D+   ++   ++ +RR  
Sbjct  249  PGSSASSVRNDKSASRATSRRRVQGPPSSGIPTRHSSSSRLSDNE--SMSDDKDTDRRSQ  306

Query  573  NNARERIRIRDINEALKELGRMCMTHLK-SDKPQTKLGILNMAVEVIMTLEQQVRERNLN  631
            NNARER+R+RDIN A KELGRMC  H + +++ QTKLGIL+ AV VI  LE+QVR+RN+N
Sbjct  307  NNARERVRVRDINSAFKELGRMCTQHNQNTERNQTKLGILHNAVSVITQLEEQVRQRNMN  366

Query  632  PKA-ACLKRR  640
            PK  A +KR+
Sbjct  367  PKVMAGMKRK  376



Lambda      K        H
   0.311    0.126    0.334 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7143864416


Query= XP_011197207.1 mitochondrial basic amino acids transporter isoform
X1 [Bactrocera dorsalis]

Length=411
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

COLT_DROME  unnamed protein product                                   169     3e-49
DIF1_CAEEL  unnamed protein product                                   154     3e-43
Q385N9_TRYB2  unnamed protein product                                 149     6e-42


>COLT_DROME unnamed protein product
Length=306

 Score = 169 bits (428),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 98/282 (35%), Positives = 150/282 (53%), Gaps = 26/282 (9%)

Query  40   DFVAGCLGGCAGVLVGHPFDTVKVHLQMQDV----KNPIYRGTFHCISSLVRTDGVKSLY  95
             F+ G  GG   VL GHP DT+KV LQ        + P+YRGTF C +  ++ +GV+ LY
Sbjct  18   SFLTGGFGGICNVLSGHPLDTIKVRLQTMPRPAPGEQPLYRGTFDCAAKTIKNEGVRGLY  77

Query  96   RGMSSPLMGISVVNAIVFGVYG---NVQRQMVDSNSLYSH-FIAGCVSGFAQSIVCSPME  151
            +GMS+PL G++ + A+ F  Y     +Q++  D+   Y   F+AG  SG   +++ +P E
Sbjct  78   KGMSAPLTGVAPIFAMCFAGYALGKRLQQRGEDAKLTYPQIFVAGSFSGLFSTLIMAPGE  137

Query  152  LAKTRMQLQHMDPKAPQYKSPIECIRHIIQTDGFKGGFRGLGMTALRDVPGFAAYFVSYE  211
              K  +Q Q       +Y   I+C   + +  G +  F+G   T LRD+P    YF+ YE
Sbjct  138  RIKVLLQTQQGQGGERKYNGMIDCAGKLYKEGGLRSVFKGSCATMLRDLPANGLYFLVYE  197

Query  212  WLMSLKEKP------SVPHALTAGGLAGIASWLISYPTDVIKTLLQADGMSSAPVYKGAW  265
             L  + +        S    + AGG+AG+A W++  P DV+K+ LQ     SAP  +G +
Sbjct  198  ALQDVAKSKSETGQISTASTIFAGGVAGMAYWILGMPADVLKSRLQ-----SAP--EGTY  250

Query  266  DCAVRNY-----NKDGLHFFFRGLNSTIIRAFPANAACFYVV  302
               +R+       KDG    +RG+   ++RAFPANAACF+ +
Sbjct  251  KHGIRSVFKDLIVKDGPLALYRGVTPIMLRAFPANAACFFGI  292


 Score = 79.7 bits (195),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 87/200 (44%), Gaps = 8/200 (4%)

Query  133  FIAGCVSGFAQSIVCSPMELAKTRMQL--QHMDPKAPQYKSPIECIRHIIQTDGFKGGFR  190
            F+ G   G    +   P++  K R+Q   +    + P Y+   +C    I+ +G +G ++
Sbjct  19   FLTGGFGGICNVLSGHPLDTIKVRLQTMPRPAPGEQPLYRGTFDCAAKTIKNEGVRGLYK  78

Query  191  GLGMTALRDVPGFAAYFVSYEWLMSLKE-----KPSVPHALTAGGLAGIASWLISYPTDV  245
            G+        P FA  F  Y     L++     K + P    AG  +G+ S LI  P + 
Sbjct  79   GMSAPLTGVAPIFAMCFAGYALGKRLQQRGEDAKLTYPQIFVAGSFSGLFSTLIMAPGER  138

Query  246  IKTLLQAD-GMSSAPVYKGAWDCAVRNYNKDGLHFFFRGLNSTIIRAFPANAACFYVVAC  304
            IK LLQ   G      Y G  DCA + Y + GL   F+G  +T++R  PAN   F V   
Sbjct  139  IKVLLQTQQGQGGERKYNGMIDCAGKLYKEGGLRSVFKGSCATMLRDLPANGLYFLVYEA  198

Query  305  ILGLTKRANLDMELQTTDQL  324
            +  + K  +   ++ T   +
Sbjct  199  LQDVAKSKSETGQISTASTI  218


 Score = 50.1 bits (118),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 43/89 (48%), Gaps = 3/89 (3%)

Query  214  MSLKEKPSVPHALTAGGLAGIASWLISYPTDVIKTLLQA---DGMSSAPVYKGAWDCAVR  270
            +S + K +   +   GG  GI + L  +P D IK  LQ          P+Y+G +DCA +
Sbjct  7    VSTERKANPVKSFLTGGFGGICNVLSGHPLDTIKVRLQTMPRPAPGEQPLYRGTFDCAAK  66

Query  271  NYNKDGLHFFFRGLNSTIIRAFPANAACF  299
                +G+   ++G+++ +    P  A CF
Sbjct  67   TIKNEGVRGLYKGMSAPLTGVAPIFAMCF  95


>DIF1_CAEEL unnamed protein product
Length=312

 Score = 154 bits (388),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 100/285 (35%), Positives = 150/285 (53%), Gaps = 32/285 (11%)

Query  39   FDFVAGCLGGCAGVLVGHPFDTVKVHLQMQDV----KNPIYRGTFHCISSLVRTDGVKSL  94
             +F+AG +GG   V+VGHPFDTVKV +Q   +    + P + G   C+   V  +G  +L
Sbjct  6    LNFIAGGVGGSCTVIVGHPFDTVKVRIQTMPMPKPGEKPQFTGALDCVKRTVSKEGFFAL  65

Query  95   YRGMSSPLMGISVVNAIVFG--VYGNVQRQMVDSNSLYSHFI----AGCVSGFAQSIVCS  148
            Y+GM++PL+G+S + A+ FG    G   +Q   S  +   FI    AG ++G   +IV  
Sbjct  66   YKGMAAPLVGVSPLFAVFFGGCAVGKWLQQTDPSQEM--TFIQNANAGALAGVFTTIVMV  123

Query  149  PMELAKTRMQLQHMDPKAP--QYKSPIECIRHIIQTDGFKGGFRGLGMTALRDVPGFAAY  206
            P E  K  +Q+Q          Y  P++ ++ + +  G    +RG G T LRD+P  AAY
Sbjct  124  PGERIKCLLQVQQAGSAGSGVHYDGPLDVVKKLYKQGGISSIYRGTGATLLRDIPASAAY  183

Query  207  FVSYEWLMSL-----KEKPSVPHA-LTAGGLAGIASWLISYPTDVIKTLLQADGMSSAPV  260
               YE+L         ++   P A L AGGLAGIA+W +  P DV+K+ LQ     +AP 
Sbjct  184  LSVYEYLKKKFSGEGAQRTLSPGATLMAGGLAGIANWGVCIPADVLKSRLQ-----TAP-  237

Query  261  YKGAWDCAVRN-----YNKDGLHFFFRGLNSTIIRAFPANAACFY  300
             +G +   +R        ++G    F+G    ++RAFPANAACF+
Sbjct  238  -EGKYPDGIRGVLREVLREEGPRALFKGFWPVMLRAFPANAACFF  281


>Q385N9_TRYB2 unnamed protein product
Length=282

 Score = 149 bits (376),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 102/273 (37%), Positives = 144/273 (53%), Gaps = 25/273 (9%)

Query  40   DFVAGCLGGCAGVLVGHPFDTVKVHLQMQDVKNPIYRGTFHCISSLVRTDGVKSLYRGMS  99
             F++G  GG + +LVGHPFDTVK  +Q    +   Y+ + HC   +V   G  +LY+G+ 
Sbjct  6    SFLSGWAGGISNLLVGHPFDTVKTLMQGNKGE---YKNSLHCAKRIVMEGGPFALYKGVI  62

Query  100  SPLMGISVVNAIVFGVYGNVQ---RQM--VDSNSLYSH---FIAGCVSGFAQSIVCSPME  151
            +P+ G  VV A+ F  Y   +   R++  VDS +  S     + G  +G   S+V  P E
Sbjct  63   APMTGTGVVMALYFVAYDATETLIRKLKGVDSLTPLSMGEIMLCGGSTGVLGSLVLGPAE  122

Query  152  LAKTRMQLQHMDPKAPQYKSPIECIRHIIQTDGFKGGFRGLGMTALRDVPGFAAYFVSYE  211
            L K R Q           +   + I +I + +G  G  RG+G T LRDVPG  A+F +YE
Sbjct  123  LLKVRQQTALSSGARGSLR---DVILNIYRKEGPLGFTRGIGATMLRDVPGSMAWFGAYE  179

Query  212  WLMSL----KEKPSVPHALTAGGLAGIASWLISYPTDVIKTLLQADGMSSAPVYKGAWDC  267
            +   L     + PSV  AL AGG+ GIA W  S P D IKT +QA  +   PV       
Sbjct  180  YTKLLLCKNPKDPSVGEALFAGGMGGIAVWSFSLPLDCIKTRVQASPVPLTPV------V  233

Query  268  AVRN-YNKDGLHFFFRGLNSTIIRAFPANAACF  299
            A R   ++ G+  F+RG+   ++RAFPANAACF
Sbjct  234  AFRAILSEHGIKGFYRGIGPALLRAFPANAACF  266


 Score = 45.8 bits (107),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 73/168 (43%), Gaps = 12/168 (7%)

Query  48   GCAGVLVGHPFDTVKVHLQMQDVKNPIYRGTFH-CISSLVRTDGVKSLYRGMSSPLMGIS  106
            G  G LV  P + +KV  + Q   +   RG+    I ++ R +G     RG+ + ++   
Sbjct  111  GVLGSLVLGPAELLKV--RQQTALSSGARGSLRDVILNIYRKEGPLGFTRGIGATMLRDV  168

Query  107  VVNAIVFGVYGNVQRQMVDSN---SLYSHFIAGCVSGFAQSIVCSPMELAKTRMQLQHMD  163
              +   FG Y   +  +  +    S+     AG + G A      P++  KTR+Q     
Sbjct  169  PGSMAWFGAYEYTKLLLCKNPKDPSVGEALFAGGMGGIAVWSFSLPLDCIKTRVQ-----  223

Query  164  PKAPQYKSPIECIRHIIQTDGFKGGFRGLGMTALRDVPGFAAYFVSYE  211
              +P   +P+   R I+   G KG +RG+G   LR  P  AA F + +
Sbjct  224  -ASPVPLTPVVAFRAILSEHGIKGFYRGIGPALLRAFPANAACFAARD  270



Lambda      K        H
   0.311    0.126    0.334 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7143864416


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jan 6, 2022  1:11 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_011197208.1 mitochondrial basic amino acids transporter isoform
X2 [Bactrocera dorsalis]

Length=375
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

COLT_DROME  unnamed protein product                                   169     2e-49
DIF1_CAEEL  unnamed protein product                                   153     1e-43
Q385N9_TRYB2  unnamed protein product                                 149     3e-42


>COLT_DROME unnamed protein product
Length=306

 Score = 169 bits (427),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 98/282 (35%), Positives = 150/282 (53%), Gaps = 26/282 (9%)

Query  4    DFVAGCLGGCAGVLVGHPFDTVKVHLQMQDV----KNPIYRGTFHCISSLVRTDGVKSLY  59
             F+ G  GG   VL GHP DT+KV LQ        + P+YRGTF C +  ++ +GV+ LY
Sbjct  18   SFLTGGFGGICNVLSGHPLDTIKVRLQTMPRPAPGEQPLYRGTFDCAAKTIKNEGVRGLY  77

Query  60   RGMSSPLMGISVVNAIVFGVYG---NVQRQMVDSNSLYSH-FIAGCVSGFAQSIVCSPME  115
            +GMS+PL G++ + A+ F  Y     +Q++  D+   Y   F+AG  SG   +++ +P E
Sbjct  78   KGMSAPLTGVAPIFAMCFAGYALGKRLQQRGEDAKLTYPQIFVAGSFSGLFSTLIMAPGE  137

Query  116  LAKTRMQLQHMDPKAPQYKSPIECIRHIIQTDGFKGGFRGLGMTALRDVPGFAAYFVSYE  175
              K  +Q Q       +Y   I+C   + +  G +  F+G   T LRD+P    YF+ YE
Sbjct  138  RIKVLLQTQQGQGGERKYNGMIDCAGKLYKEGGLRSVFKGSCATMLRDLPANGLYFLVYE  197

Query  176  WLMSLKEKP------SVPHALTAGGLAGIASWLISYPTDVIKTLLQADGMSSAPVYKGAW  229
             L  + +        S    + AGG+AG+A W++  P DV+K+ LQ     SAP  +G +
Sbjct  198  ALQDVAKSKSETGQISTASTIFAGGVAGMAYWILGMPADVLKSRLQ-----SAP--EGTY  250

Query  230  DCAVRNY-----NKDGLHFFFRGLNSTIIRAFPANAACFYVV  266
               +R+       KDG    +RG+   ++RAFPANAACF+ +
Sbjct  251  KHGIRSVFKDLIVKDGPLALYRGVTPIMLRAFPANAACFFGI  292


 Score = 79.7 bits (195),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 87/200 (44%), Gaps = 8/200 (4%)

Query  97   FIAGCVSGFAQSIVCSPMELAKTRMQL--QHMDPKAPQYKSPIECIRHIIQTDGFKGGFR  154
            F+ G   G    +   P++  K R+Q   +    + P Y+   +C    I+ +G +G ++
Sbjct  19   FLTGGFGGICNVLSGHPLDTIKVRLQTMPRPAPGEQPLYRGTFDCAAKTIKNEGVRGLYK  78

Query  155  GLGMTALRDVPGFAAYFVSYEWLMSLKE-----KPSVPHALTAGGLAGIASWLISYPTDV  209
            G+        P FA  F  Y     L++     K + P    AG  +G+ S LI  P + 
Sbjct  79   GMSAPLTGVAPIFAMCFAGYALGKRLQQRGEDAKLTYPQIFVAGSFSGLFSTLIMAPGER  138

Query  210  IKTLLQAD-GMSSAPVYKGAWDCAVRNYNKDGLHFFFRGLNSTIIRAFPANAACFYVVAC  268
            IK LLQ   G      Y G  DCA + Y + GL   F+G  +T++R  PAN   F V   
Sbjct  139  IKVLLQTQQGQGGERKYNGMIDCAGKLYKEGGLRSVFKGSCATMLRDLPANGLYFLVYEA  198

Query  269  ILGLTKRANLDMELQTTDQL  288
            +  + K  +   ++ T   +
Sbjct  199  LQDVAKSKSETGQISTASTI  218


 Score = 60.8 bits (146),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 81/181 (45%), Gaps = 16/181 (9%)

Query  5    FVAGCLGGCAGVLVGHPFDTVKVHLQMQDVKNP--IYRGTFHCISSLVRTDGVKSLYRGM  62
            FVAG   G    L+  P + +KV LQ Q  +     Y G   C   L +  G++S+++G 
Sbjct  119  FVAGSFSGLFSTLIMAPGERIKVLLQTQQGQGGERKYNGMIDCAGKLYKEGGLRSVFKGS  178

Query  63   SSPLMGISVVNAIVFGVYGNVQ-----RQMVDSNSLYSHFIAGCVSGFAQSIVCSPMELA  117
             + ++     N + F VY  +Q     +      S  S   AG V+G A  I+  P ++ 
Sbjct  179  CATMLRDLPANGLYFLVYEALQDVAKSKSETGQISTASTIFAGGVAGMAYWILGMPADVL  238

Query  118  KTRMQLQHMDPKAPQ--YKSPIECI-RHIIQTDGFKGGFRGLGMTALRDVPGFAAYFVSY  174
            K+R+Q       AP+  YK  I  + + +I  DG    +RG+    LR  P  AA F   
Sbjct  239  KSRLQ------SAPEGTYKHGIRSVFKDLIVKDGPLALYRGVTPIMLRAFPANAACFFGI  292

Query  175  E  175
            E
Sbjct  293  E  293


 Score = 50.4 bits (119),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 43/89 (48%), Gaps = 3/89 (3%)

Query  178  MSLKEKPSVPHALTAGGLAGIASWLISYPTDVIKTLLQA---DGMSSAPVYKGAWDCAVR  234
            +S + K +   +   GG  GI + L  +P D IK  LQ          P+Y+G +DCA +
Sbjct  7    VSTERKANPVKSFLTGGFGGICNVLSGHPLDTIKVRLQTMPRPAPGEQPLYRGTFDCAAK  66

Query  235  NYNKDGLHFFFRGLNSTIIRAFPANAACF  263
                +G+   ++G+++ +    P  A CF
Sbjct  67   TIKNEGVRGLYKGMSAPLTGVAPIFAMCF  95


>DIF1_CAEEL unnamed protein product
Length=312

 Score = 153 bits (387),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 100/285 (35%), Positives = 150/285 (53%), Gaps = 32/285 (11%)

Query  3    FDFVAGCLGGCAGVLVGHPFDTVKVHLQMQDV----KNPIYRGTFHCISSLVRTDGVKSL  58
             +F+AG +GG   V+VGHPFDTVKV +Q   +    + P + G   C+   V  +G  +L
Sbjct  6    LNFIAGGVGGSCTVIVGHPFDTVKVRIQTMPMPKPGEKPQFTGALDCVKRTVSKEGFFAL  65

Query  59   YRGMSSPLMGISVVNAIVFG--VYGNVQRQMVDSNSLYSHFI----AGCVSGFAQSIVCS  112
            Y+GM++PL+G+S + A+ FG    G   +Q   S  +   FI    AG ++G   +IV  
Sbjct  66   YKGMAAPLVGVSPLFAVFFGGCAVGKWLQQTDPSQEM--TFIQNANAGALAGVFTTIVMV  123

Query  113  PMELAKTRMQLQHMDPKAP--QYKSPIECIRHIIQTDGFKGGFRGLGMTALRDVPGFAAY  170
            P E  K  +Q+Q          Y  P++ ++ + +  G    +RG G T LRD+P  AAY
Sbjct  124  PGERIKCLLQVQQAGSAGSGVHYDGPLDVVKKLYKQGGISSIYRGTGATLLRDIPASAAY  183

Query  171  FVSYEWLMSL-----KEKPSVPHA-LTAGGLAGIASWLISYPTDVIKTLLQADGMSSAPV  224
               YE+L         ++   P A L AGGLAGIA+W +  P DV+K+ LQ     +AP 
Sbjct  184  LSVYEYLKKKFSGEGAQRTLSPGATLMAGGLAGIANWGVCIPADVLKSRLQ-----TAP-  237

Query  225  YKGAWDCAVRN-----YNKDGLHFFFRGLNSTIIRAFPANAACFY  264
             +G +   +R        ++G    F+G    ++RAFPANAACF+
Sbjct  238  -EGKYPDGIRGVLREVLREEGPRALFKGFWPVMLRAFPANAACFF  281


>Q385N9_TRYB2 unnamed protein product
Length=282

 Score = 149 bits (376),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 102/273 (37%), Positives = 144/273 (53%), Gaps = 25/273 (9%)

Query  4    DFVAGCLGGCAGVLVGHPFDTVKVHLQMQDVKNPIYRGTFHCISSLVRTDGVKSLYRGMS  63
             F++G  GG + +LVGHPFDTVK  +Q    +   Y+ + HC   +V   G  +LY+G+ 
Sbjct  6    SFLSGWAGGISNLLVGHPFDTVKTLMQGNKGE---YKNSLHCAKRIVMEGGPFALYKGVI  62

Query  64   SPLMGISVVNAIVFGVYGNVQ---RQM--VDSNSLYSH---FIAGCVSGFAQSIVCSPME  115
            +P+ G  VV A+ F  Y   +   R++  VDS +  S     + G  +G   S+V  P E
Sbjct  63   APMTGTGVVMALYFVAYDATETLIRKLKGVDSLTPLSMGEIMLCGGSTGVLGSLVLGPAE  122

Query  116  LAKTRMQLQHMDPKAPQYKSPIECIRHIIQTDGFKGGFRGLGMTALRDVPGFAAYFVSYE  175
            L K R Q           +   + I +I + +G  G  RG+G T LRDVPG  A+F +YE
Sbjct  123  LLKVRQQTALSSGARGSLR---DVILNIYRKEGPLGFTRGIGATMLRDVPGSMAWFGAYE  179

Query  176  WLMSL----KEKPSVPHALTAGGLAGIASWLISYPTDVIKTLLQADGMSSAPVYKGAWDC  231
            +   L     + PSV  AL AGG+ GIA W  S P D IKT +QA  +   PV       
Sbjct  180  YTKLLLCKNPKDPSVGEALFAGGMGGIAVWSFSLPLDCIKTRVQASPVPLTPV------V  233

Query  232  AVRN-YNKDGLHFFFRGLNSTIIRAFPANAACF  263
            A R   ++ G+  F+RG+   ++RAFPANAACF
Sbjct  234  AFRAILSEHGIKGFYRGIGPALLRAFPANAACF  266


 Score = 45.8 bits (107),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 73/168 (43%), Gaps = 12/168 (7%)

Query  12   GCAGVLVGHPFDTVKVHLQMQDVKNPIYRGTFH-CISSLVRTDGVKSLYRGMSSPLMGIS  70
            G  G LV  P + +KV  + Q   +   RG+    I ++ R +G     RG+ + ++   
Sbjct  111  GVLGSLVLGPAELLKV--RQQTALSSGARGSLRDVILNIYRKEGPLGFTRGIGATMLRDV  168

Query  71   VVNAIVFGVYGNVQRQMVDSN---SLYSHFIAGCVSGFAQSIVCSPMELAKTRMQLQHMD  127
              +   FG Y   +  +  +    S+     AG + G A      P++  KTR+Q     
Sbjct  169  PGSMAWFGAYEYTKLLLCKNPKDPSVGEALFAGGMGGIAVWSFSLPLDCIKTRVQ-----  223

Query  128  PKAPQYKSPIECIRHIIQTDGFKGGFRGLGMTALRDVPGFAAYFVSYE  175
              +P   +P+   R I+   G KG +RG+G   LR  P  AA F + +
Sbjct  224  -ASPVPLTPVVAFRAILSEHGIKGFYRGIGPALLRAFPANAACFAARD  270



Lambda      K        H
   0.324    0.139    0.427 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3946317176


Query= XP_011197211.1 uncharacterized protein LOC105221796 [Bactrocera
dorsalis]

Length=346
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VLB0_DROME  unnamed protein product                                 55.1    8e-09


>Q9VLB0_DROME unnamed protein product
Length=205

 Score = 55.1 bits (131),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 34/51 (67%), Gaps = 0/51 (0%)

Query  46   QDLRNEIHQGDAITYELGTPQYQILNADEPIEIITPDQPGYYESLKRYEAA  96
            Q L+N++  G+  T+ELGTP YQILN ++  E IT DQP Y E L+R  + 
Sbjct  58   QHLKNKVEHGEFTTFELGTPNYQILNPEDEPEYITADQPHYQEMLRRLTSG  108



Lambda      K        H
   0.324    0.139    0.427 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3946317176


Query= XP_011197212.1 probable serine/threonine-protein kinase DDB_G0268078
[Bactrocera dorsalis]

Length=753
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DYF5_CAEEL  unnamed protein product                                   445     2e-149
Q387N8_TRYB2  unnamed protein product                                 333     3e-107
Q57WV2_TRYB2  unnamed protein product                                 316     2e-98 


>DYF5_CAEEL unnamed protein product
Length=489

 Score = 445 bits (1145),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 189/309 (61%), Positives = 256/309 (83%), Gaps = 0/309 (0%)

Query  2    NRYITLSQLGDGTYGTVVLAQRKDTGEKVAIKRMKRKYYSWEEAMNLREVKSLKKLSHPN  61
            +RY+   +LGDGT+G V+LA++ DTG++VAIKRMK+K+YSWEEAM+LREVKSLKKL+HPN
Sbjct  9    DRYLMTKRLGDGTFGEVMLAKKIDTGDRVAIKRMKKKFYSWEEAMSLREVKSLKKLNHPN  68

Query  62   IVKLKEVIRENDTLYFVFEYMKENLYQMIKDRDTHLPEPTLKSILFQVLTGLAFMHRHGF  121
            I+KL+EVIREND LYFVFE+M+ENLY+++KDRD + PE  +++I++QVL GLAFMH++GF
Sbjct  69   IIKLREVIRENDILYFVFEFMQENLYELMKDRDRYFPESVIRNIIYQVLQGLAFMHKNGF  128

Query  122  FHRDLKPENLLCSGPELIKIADFGLAREVRSRPPFTDYVSTRWYRAPEVLLHSTNYGSSI  181
            FHRD+KPEN++C+G EL+KIADFGLARE+RS+PP+TDYVSTRWYRAPE+LL ST+Y S I
Sbjct  129  FHRDMKPENIMCNGTELVKIADFGLAREIRSKPPYTDYVSTRWYRAPEILLRSTSYNSPI  188

Query  182  DLWAMGCIMAELYTFRPLFPGSSEVDQLFKICSVLGTPEKGEWPEGYRLAATIHFRYPEC  241
            D+WA+GCIMAELY  RPLFPG+SE+DQLFKI S+LGTP K EWPEGY+LA+ ++FR+ + 
Sbjct  189  DMWALGCIMAELYILRPLFPGTSEMDQLFKIISILGTPNKDEWPEGYQLASAMNFRFQQV  248

Query  242  IKVPLNTIVTRCSQAGLDLLEDMLHYDPDKRPTAQQSLKYAYFHALKRISPTAAAKANVK  301
            +  P+  +V   S+ G+ L+ DM+ ++P+KRP A QSL+Y YF   +++     ++    
Sbjct  249  VATPMEQVVNTISKEGMKLMMDMMLWNPEKRPNANQSLRYKYFQVAEKLGAPVVSQPAPG  308

Query  302  LTAKYAAAA  310
               K +AA+
Sbjct  309  SIRKTSAAS  317


>Q387N8_TRYB2 unnamed protein product
Length=387

 Score = 333 bits (853),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 152/291 (52%), Positives = 206/291 (71%), Gaps = 8/291 (3%)

Query  1    MNRYITLSQLGDGTYGTVVLAQRKDTGEKVAIKRMKRKYYSWEEAMNLREVKSLKKLSHP  60
            MNRY  L QLGDG++G V  AQ   TGE VA+K+MK+++ +WEE + LREV+ L+K+ HP
Sbjct  1    MNRYTILGQLGDGSFGVVSKAQNTSTGEVVAVKKMKQRFSNWEECLQLREVQFLRKVHHP  60

Query  61   NIVKLKEVIRENDTLYFVFEYMKENLYQMIKDRDTHLP-------EPTLKSILFQVLTGL  113
            NIVKL+EV+REN+ L+ +FEYM+ NL+ + + R   +        +  ++SI+ Q L  +
Sbjct  61   NIVKLREVVRENNELFLIFEYMEMNLFGIQRMRSEQMGGVQSIFNDREIRSIMCQTLLAV  120

Query  114  AFMHRHGFFHRDLKPENLLCSGPELIKIADFGLAREVRSRPPFTDYVSTRWYRAPEVLLH  173
              MH++GF HRDLKPENLL  G +++K+ADFGLA+E+RSRPPFT+YVSTRWYRAPE++L 
Sbjct  121  QAMHKNGFMHRDLKPENLLTKG-DVVKVADFGLAKEIRSRPPFTEYVSTRWYRAPEIILR  179

Query  174  STNYGSSIDLWAMGCIMAELYTFRPLFPGSSEVDQLFKICSVLGTPEKGEWPEGYRLAAT  233
            ST+Y S +D+WA G I AELY  RPLFPGSS  DQLFKICS+LG P   EW EGY+L   
Sbjct  180  STHYNSPVDIWACGVIFAELYLNRPLFPGSSGNDQLFKICSILGAPTTAEWDEGYQLLRR  239

Query  234  IHFRYPECIKVPLNTIVTRCSQAGLDLLEDMLHYDPDKRPTAQQSLKYAYF  284
            ++ R+P     PL  ++       +DL+E ML ++P  R TA Q L++ YF
Sbjct  240  LNMRFPTVAPTPLRQLLAGAPPNAIDLMEQMLKFNPSDRLTATQCLRHPYF  290


>Q57WV2_TRYB2 unnamed protein product
Length=583

 Score = 316 bits (809),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 153/303 (50%), Positives = 206/303 (68%), Gaps = 19/303 (6%)

Query  1    MNRYITLSQLGDGTYGTVVLAQRKDTGEKVAIKRMKRKYYSWEEAMNLREVKSLKKL-SH  59
            M  Y  L+QLGDGT+G VV A  K +G+ VAIK+MK+KYYSW+E M L EV  ++++  H
Sbjct  1    MENYQLLNQLGDGTFGCVVKALHKSSGQFVAIKKMKQKYYSWDECMKLPEVVVVRRVHGH  60

Query  60   PNIVKLKEVIRENDTLYFVFEYMKENLYQMIK-----------DRDTHLPEPTLKSILFQ  108
            PNIVK++EVIRE + L+FVFE+M  +L  +I+                L  P +KS  FQ
Sbjct  61   PNIVKMREVIREKNELFFVFEFMDGDLLGVIRRAKQMQSYGSGTSGPALAYPKIKSYTFQ  120

Query  109  VLTGLAFMHRHGFFHRDLKPENLLC------SGPELIKIADFGLAREVRSRPPFTDYVST  162
            +L  LA++HR G+FHRD+KPENLL       S  E++K+ADFGL +E+R+RPP+TDYVST
Sbjct  121  ILQSLAYLHRAGYFHRDMKPENLLVRKDPSTSAQEIVKLADFGLVKEIRARPPYTDYVST  180

Query  163  RWYRAPEVLLHSTNYGSSIDLWAMGCIMAELYTFRPLFPGSSEVDQLFKICSVLGTPEKG  222
            RWYRAPE+LL    Y S +D+WA+GCI+AE+ T RPLF GS+EVDQL KI +VLG+P + 
Sbjct  181  RWYRAPELLLQDRCYSSPVDIWAVGCIIAEMITTRPLFAGSNEVDQLHKIMAVLGSPNES  240

Query  223  EWPEGYRLAATIHFRYPECIKVPLNTIV-TRCSQAGLDLLEDMLHYDPDKRPTAQQSLKY  281
             WP G  LA  I + +P    V L  ++        +DL++ ML+YDP +RPTAQQ L++
Sbjct  241  VWPNGMVLAKKIRYNFPSINGVGLERVMPPHVPPHAMDLMKQMLNYDPKRRPTAQQCLQH  300

Query  282  AYF  284
             YF
Sbjct  301  PYF  303



Lambda      K        H
   0.324    0.139    0.427 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3946317176


Query= XP_011197213.1 coiled-coil domain-containing protein 40-like
[Bactrocera dorsalis]

Length=302
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MYS2_DICDI  unnamed protein product                                   38.9    0.005
EPS15_DICDI  unnamed protein product                                  32.7    0.39 
SPD5_CAEEL  unnamed protein product                                   30.0    3.1  


>MYS2_DICDI unnamed protein product
Length=2116

 Score = 38.9 bits (89),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 62/110 (56%), Gaps = 6/110 (5%)

Query  83    TKEQLKNEIAEIKYQLKLKEAAREEQGAKLYDLQQGINRQNEQLEDYVQQIQTNMQKRVE  142
             T + L+     +K +L+ ++ A++    K   L+  +   NEQLE+  +Q ++N +++V+
Sbjct  1256  TNKHLETSFNNLKLELEAEQKAKQALEKKRLGLESELKHVNEQLEEEKKQKESNEKRKVD  1315

Query  143   MESEVTQLKAEYEQRLQTKKEQKQKYNKRMVELENMNTLEGHIRNWADEV  192
             +E EV++LK + E+ + +KK   +  NK+  EL+ +       R +AD V
Sbjct  1316  LEKEVSELKDQIEEEVASKKAVTEAKNKKESELDEIK------RQYADVV  1359


>EPS15_DICDI unnamed protein product
Length=1196

 Score = 32.7 bits (73),  Expect = 0.39, Method: Composition-based stats.
 Identities = 31/173 (18%), Positives = 79/173 (46%), Gaps = 17/173 (10%)

Query  124  EQLEDYVQQIQTNMQKRVEMESEVTQLKAEYEQRLQTKKEQKQKYNKRMVELENMNTLEG  183
            EQ     ++IQ  + + +++E+E+ Q  A+ +   Q   E ++   +  ++L ++     
Sbjct  529  EQERIRQEEIQVKLNQELQLEAELKQQLAQEQ---QQLDEVRENVKEEEIKLSSIKADNQ  585

Query  184  HIRNWADEVKDEVKNAKRIVHRDTQLQKQLSEDKKKSDMLFYHLDVEVKRKEHE------  237
             ++      + ++K+ K  + + + L ++ SE   + +    HL+ ++K K+ E      
Sbjct  586  SLKEQISTARVDIKSLKSQLEQQSSLLREKSELFDEQNEALSHLNDDLKEKQQELQKNKQ  645

Query  238  --------VELVRSELQDMRDITDVLKTSINDANTDLEVLQTEHKRLTQAWSE  282
                    +E ++    D+++    +   +ND+  +L+ L  E K+  Q  +E
Sbjct  646  QIEQLLSSIESIKQNRTDVKNQISTVTKQLNDSKLELKQLAEEQKQQKQKLAE  698


 Score = 29.6 bits (65),  Expect = 4.3, Method: Composition-based stats.
 Identities = 25/123 (20%), Positives = 61/123 (50%), Gaps = 7/123 (6%)

Query  55   EPVRLALLPPDHPLLQKFQANLKDYLLRTKEQLKNEIAEIKYQLKL---KEAAREEQGAK  111
            E ++L+ +  D+  L++  +  +  +   K QL+ + + ++ + +L   +  A       
Sbjct  573  EEIKLSSIKADNQSLKEQISTARVDIKSLKSQLEQQSSLLREKSELFDEQNEALSHLNDD  632

Query  112  LYDLQQGINRQNEQLEDYVQQIQTNMQKRVEMESEVT----QLKAEYEQRLQTKKEQKQK  167
            L + QQ + +  +Q+E  +  I++  Q R +++++++    QL     +  Q  +EQKQ+
Sbjct  633  LKEKQQELQKNKQQIEQLLSSIESIKQNRTDVKNQISTVTKQLNDSKLELKQLAEEQKQQ  692

Query  168  YNK  170
              K
Sbjct  693  KQK  695


 Score = 28.5 bits (62),  Expect = 8.2, Method: Composition-based stats.
 Identities = 22/111 (20%), Positives = 52/111 (47%), Gaps = 3/111 (3%)

Query  85   EQLKNEIAEIKYQLKLKEAAREEQGAKLYDLQQGINRQNEQLEDYVQQIQTNMQKRVEME  144
            + LK +I+  +  +K  ++  E+Q + L +  +  + QNE L      ++   Q+  + +
Sbjct  585  QSLKEQISTARVDIKSLKSQLEQQSSLLREKSELFDEQNEALSHLNDDLKEKQQELQKNK  644

Query  145  SEVTQLKAEYEQRLQTKKEQKQKYNKRMVELENMNTLEGHIRNWADEVKDE  195
             ++ QL +  E   Q + + K   N+     + +N  +  ++  A+E K +
Sbjct  645  QQIEQLLSSIESIKQNRTDVK---NQISTVTKQLNDSKLELKQLAEEQKQQ  692


>SPD5_CAEEL unnamed protein product
Length=1198

 Score = 30.0 bits (66),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 53/111 (48%), Gaps = 10/111 (9%)

Query  51   PEEPEPVRLALLPPDHPLLQKFQANLKDYLLRTKEQLKNEIAEIKYQLKLKE-----AAR  105
            P+  +    +LL   +  L KF +N  D +    E+L+NE++E+K +L++       +  
Sbjct  674  PDAEDVASSSLLNASYSPLFKFTSN-SDIV----EKLQNEVSELKNELEMARTRDMRSPL  728

Query  106  EEQGAKLYDLQQGINRQNEQLEDYVQQIQTNMQKRVEMESEVTQLKAEYEQ  156
                 +L D+Q   NR  E LE     +Q   ++   ++S+  +L+A   Q
Sbjct  729  NGSSGRLSDVQINTNRMFEDLEVSEATLQKAKEENSTLKSQFAELEANLHQ  779



Lambda      K        H
   0.324    0.139    0.427 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3946317176


Query= XP_011197214.1 P protein-like [Bactrocera dorsalis]

Length=742
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

INDY1_DROME  unnamed protein product                                  40.0    0.006
NAD1_CAEEL  unnamed protein product                                   32.7    1.3  


>INDY1_DROME unnamed protein product
Length=590

 Score = 40.0 bits (92),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 62/294 (21%), Positives = 116/294 (39%), Gaps = 37/294 (13%)

Query  413  FGNFMLHCVPCVTLVTLQTYFLLRY----IYRDESKLHIHGALNDSIQRLARRSERLTKM  468
            F  FM + VP + + TL T+  L++    ++R +SK          +QR    ++   K+
Sbjct  268  FPTFMFYSVPSMLVYTLLTFVFLQWHFMGLWRPKSKEA------QEVQRGREGADVAKKV  321

Query  469  ASAAGKDFNTASVKRKSERALMQLERQLKYTPEYPRVLANLKSMYGIKD----KPLLIKL  524
                 KD    S+       L      + +T   P +      +   KD     P +  +
Sbjct  322  IDQRYKDLGPMSIHEIQVMILFIFMVVMYFT-RKPGIFLGWADLLNSKDIRNSMPTIFVV  380

Query  525  SICFLFVLTL-FLSHSFHNLHQLPLGWAALTGVLLAFALVDITDFEALLLRIEWSTLIFF  583
             +CF+      FL +       +P G    T  L+ +  +          ++ W  +   
Sbjct  381  VMCFMLPANYAFLRYCTRRGGPVPTG---PTPSLITWKFIQT--------KVPWGLVFLL  429

Query  584  GSLFILMEVLAKIGMIGIIGEEVQDWIMLVDKKYRLCLAIMLILWVSAVASAFLDNIPVT  643
            G  F L E   + GM  +IG  +    +L +        +++++ V+   +AF  N+ + 
Sbjct  430  GGGFALAEGSKQSGMAKLIGNALIGLKVLPNSV-----LLLVVILVAVFLTAFSSNVAIA  484

Query  644  AMMLPIVVSMAQDRELQLPLHPLVWALAMG-ACFGGNGTLVAASANVVSAGIAN  696
             +++P++  M+    L + +HPL   L  G AC       V+   N + AG AN
Sbjct  485  NIIIPVLAEMS----LAIEIHPLYLILPAGLACSMAFHLPVSTPPNALVAGYAN  534


>NAD1_CAEEL unnamed protein product
Length=582

 Score = 32.7 bits (73),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 23/73 (32%), Positives = 35/73 (48%), Gaps = 11/73 (15%)

Query  334  LTSLCLFTAVVSAFLDNVTMMLLVAPIIIRLCEALTLDPVLMLTLMVIYSNIGAACTPIG  393
            LT++C  T + S F+          PI+  L  +L +DP L   L V  S   A   P+ 
Sbjct  454  LTNVCSNTVIASIFI----------PIVAELARSLEIDP-LNFMLPVTISASFAFLLPVA  502

Query  394  DPPNIIITTNDYI  406
             PPN I+ ++ Y+
Sbjct  503  TPPNAIVFSSGYL  515



Lambda      K        H
   0.324    0.139    0.427 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3946317176


Query= XP_011197215.1 LOW QUALITY PROTEIN: anamorsin homolog [Bactrocera
dorsalis]

Length=252
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DRE2_DROME  unnamed protein product                                   302     4e-104
CADH4_CAEEL  unnamed protein product                                  33.5    0.19  
GTR1_DROME  unnamed protein product                                   30.0    2.5   


>DRE2_DROME unnamed protein product
Length=248

 Score = 302 bits (773),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 165/252 (65%), Positives = 202/252 (80%), Gaps = 4/252 (2%)

Query  1    MEQFKGSEKTLFIWTQSSLVQASTEKLKEATGGEVILENINRLTFATYGESTFDLIVIEN  60
            ME FKG +K+L+IWT S+ +    E+LK ATGG+V LEN++RL+F++Y  S+FDLIVIE 
Sbjct  1    MENFKGLQKSLYIWTDSADLDKRVEQLKAATGGDVALENVHRLSFSSYANSSFDLIVIEC  60

Query  61   AQLTDAFDKLLRLLKPNGKLYLASIFGTPEVFQQELKLSGFINVSINKDDGTLTSQKPNY  120
            AQLTD++ KLL +LKP+GKL+L S  G      QE+KLSGFIN   +  D  LT++KP Y
Sbjct  61   AQLTDSYVKLLHMLKPSGKLHLVSYIGPAASLLQEIKLSGFINCREDSPDA-LTAEKPGY  119

Query  121  ETGSAIKLSFAKKDGKTPSVWKVNGDGDEELIDEDDLLDEEDKKKPDPESLRVCGTTGKR  180
            ETGS+ +LSFAKK+    +VWK++GD DEELIDE++LLDEEDK+KPDP  LRVC TTGKR
Sbjct  120  ETGSSARLSFAKKNASAVNVWKISGD-DEELIDEEELLDEEDKQKPDPAGLRVCSTTGKR  178

Query  181  KACKNCSCGLAEELESEAAQKSKADTANAKSSCGNCYLGDXFRCSSCPYLGMPAFKPGEK  240
            KACKNCSCGLAEELE+E  ++S+  T NAKSSCGNCYLGD FRCS+CPYLGMPAFKPGEK
Sbjct  179  KACKNCSCGLAEELETE--KQSQKATENAKSSCGNCYLGDAFRCSTCPYLGMPAFKPGEK  236

Query  241  VELAGNLLNDDI  252
            V+LA NLL  DI
Sbjct  237  VQLADNLLKSDI  248


>CADH4_CAEEL unnamed protein product
Length=4292

 Score = 33.5 bits (75),  Expect = 0.19, Method: Composition-based stats.
 Identities = 24/79 (30%), Positives = 43/79 (54%), Gaps = 4/79 (5%)

Query  88    TPEVFQQELKLSGFINVSINKDDGTLTSQKP-NYETGSAIKLSFAKKDGKTPSVWKVNGD  146
             T E + +   ++ F+N  +N   G LT  KP ++ET SA+KL+   KD   P + +    
Sbjct  3109  TIEYYLKPSDVTSFVN--LNAQTGILTLAKPLDFETLSALKLTVVAKDSGVPPL-ETEAQ  3165

Query  147   GDEELIDEDDLLDEEDKKK  165
              +  ++DE+D   + +K+K
Sbjct  3166  VEISVMDENDNAPKFEKEK  3184


>GTR1_DROME unnamed protein product
Length=1440

 Score = 30.0 bits (66),  Expect = 2.5, Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 3/58 (5%)

Query  114   TSQKPNYE-TGSAIKLSFAKKDGKTPSVWK-VNGDGDEELIDEDDLLDEEDKKKPDPE  169
             +S+ P Y  + S I+ SF   DG++PS  +   G G E   +E+D LD     +P+PE
Sbjct  983   SSELPEYACSPSPIRWSFLA-DGRSPSEMEGAVGGGPEREQEEEDKLDAWQVPEPEPE  1039



Lambda      K        H
   0.324    0.139    0.427 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3946317176


Query= XP_011197216.1 tubulin polyglutamylase TTLL7 [Bactrocera dorsalis]

Length=507
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q21279_CAEEL  unnamed protein product                                 360     2e-119
Q9VBX5_DROME  unnamed protein product                                 92.8    1e-19 
TTLL4_CAEEL  unnamed protein product                                  91.7    2e-19 


>Q21279_CAEEL unnamed protein product
Length=513

 Score = 360 bits (925),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 185/442 (42%), Positives = 277/442 (63%), Gaps = 28/442 (6%)

Query  82   HLHHVIEILGQMGYKQTSLN----NENWNLLWAHEYPFLK--MGTRIRNILPRQIVNHFP  135
            H+ H+ E+    GYK  + N    +  W+++W HEY F +    T I+N  P QIVNH P
Sbjct  84   HMMHIREMFEHTGYKIVTKNELSLDTKWDVMWHHEYSFTQEPFKTLIKNASPNQIVNHVP  143

Query  136  GIGFITSKVDLSTAAFP-FMPKAFRLPEQQAEFLKFAIDNPDSIFVEKNNKHRSIKILPL  194
            G GF TSKV L+T+     +PKAF+LP ++++ L++A  NPD ++V+K+N HR+IKI   
Sbjct  144  GSGFYTSKVQLATSDLSNGVPKAFQLPAEKSKLLEYAEKNPDVLWVQKDNTHRNIKIKST  203

Query  195  NSINLNATDCFLQEYVQNPFLVDGHKFDVGVYVVLTSIEPLTVYMYGGDILFRYCPEKYY  254
            N ++L+  + F+Q++V NP L+D  KFD+G+Y V+TS+ PL VY+Y GD+L R+CPE Y+
Sbjct  204  NDMDLSKNNSFVQKFVDNPLLIDNKKFDIGIYTVVTSLLPLRVYIYDGDVLIRFCPEDYH  263

Query  255  PFDAENINKYVIGNDYLPTWEVPSLIKYFERFGGSMRSSFDAYVRDQFLDPSVIWVQVEE  314
            PFDA N++KYV+G+DY P WE+ SL KYF     S +S+ D+Y+  Q +D S IW+Q+  
Sbjct  264  PFDANNVDKYVVGDDYTPIWEINSLKKYFNTQKMSFKSTIDSYLGMQGMDTSKIWLQIRN  323

Query  315  IIRQTILSKKNNILKAMQPFK-NGKYFELLRFDLIVDDKLQVYLMEVNMSPNLSSAHFKP  373
            II +   +++  +L ++Q  K N +YFEL RFD +VDD+L V+LME NMSPNLSS HFK 
Sbjct  324  IIGEVFRTQQTKMLMSLQNLKLNPQYFELSRFDFVVDDQLNVFLMEANMSPNLSSGHFKQ  383

Query  374  NALLYQQVLYNVLNLVGVGSPLRIDKRFFDYEKITSDKSIAVNLND-------CAKYACH  426
            N +LY+QVL N+ +L G+ +P+  +     ++  TS+++  VN  D       C +  C 
Sbjct  384  NQILYEQVLMNIFSLTGISTPITKEADIL-FKSRTSEQNPLVNSRDINLPLKFCVENKC-  441

Query  427  KSCNKS-ECDLCLSCLKASEVSILKTAHYEHLHKMEMKRIFPKAMVSPDYFNLQVEIQNL  485
            +SC+++ EC LC  C+      IL+    E+ ++ +MKRI        DY N       L
Sbjct  442  ESCDEAPECQLCGHCMNTETRKILEQTFVENSNRKQMKRI------QFDYENHHP----L  491

Query  486  STRDGWLTRWFYKKCKDERSWC  507
            +  D  LT W   KC+ + +WC
Sbjct  492  TKEDHLLTLWLSTKCQLDNTWC  513


>Q9VBX5_DROME unnamed protein product
Length=917

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 102/397 (26%), Positives = 175/397 (44%), Gaps = 52/397 (13%)

Query  11   GNEPKSTKNVPVRIILV---FLLITIVTAVLLEFG---IPDSRLWKTGKIIEVQPSEASE  64
            G EP ++     R++      + I + T +  E G   I  ++     ++IE    E SE
Sbjct  141  GEEPANSSENKSRVLKTSQNAINIKLATDLSNESGYESIAPAKTISNTEVIEEDQEETSE  200

Query  65   INYYKFAIYPPFKPSDKHLHHVIE------ILGQMGYKQTSLNNENWNLLWAHEYPFLKM  118
             +       P  K    +  H  E      +    G  +    N N+NLLW   +  L +
Sbjct  201  DDAECGINMPASKLKITYKFHQTETKLLRKLFNVHGLTEVQGENNNFNLLWTGVHMKLDI  260

Query  119  GTRIRNILPRQIVNHFPGIGFITSKVDL-----------STAAFPFMPKAFRLPEQQAEF  167
               +RN+ P Q VNHFP    +T K  L               F  +P+ F LP +  + 
Sbjct  261  ---VRNLAPYQRVNHFPRSYEMTRKDRLYKNIERMQHLRGMKHFDIVPQTFVLPIESRDL  317

Query  168  LKFAIDNPDSIFVEKNNKHRSIKILPLNSINLNATD--CFLQEYVQNPFLVDGHKFDVGV  225
            +     +     V+     R   I  +NS +    D    + +Y+ +P  +DGHK D+ V
Sbjct  318  VVAHNKHRGPWIVKPAASSRGRGIFIVNSPDQIPQDEQAVVSKYIVDPLCIDGHKCDLRV  377

Query  226  YVVLTSIEPLTVYMYGGDILFRYCPEKYYPFDAEN------------INKYVIGNDYLPT  273
            YV++TS +PL +Y+Y   I+ R    K Y   A+N            INKY   +DY+ +
Sbjct  378  YVLVTSFDPLIIYLYEEGIV-RLATVK-YDRHADNLWNPCMHLCNYSINKY--HSDYIRS  433

Query  274  WEVPSLIKYFERFGGS-MRSSFDAYVRDQFLDPSVIWVQVEEIIRQTILSKKNNILKAMQ  332
             +        E  G     S+   +++ Q  D   + + +E++I + +L+   +I+ A +
Sbjct  434  SDAQD-----EDVGHKWTLSALLRHLKLQSCDTRQLMLNIEDLIIKAVLACAQSIISACR  488

Query  333  PF-KNGKY-FELLRFDLIVDDKLQVYLMEVNMSPNLS  367
             F  NG   FEL  FD+++D+ L+ +L+E+N+SP++ 
Sbjct  489  MFVPNGNNCFELYGFDILIDNALKPWLLEINLSPSMG  525


>TTLL4_CAEEL unnamed protein product
Length=601

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 85/307 (28%), Positives = 131/307 (43%), Gaps = 47/307 (15%)

Query  123  RNILPRQIVNHFPGIGFITSKVDL----------STAAFPFMPKAFRLPEQQAEFLKF-A  171
            R + P Q VNHFPG   I  K  L              F  MP  + LP  + E LK+  
Sbjct  185  RALQPHQKVNHFPGAFHIGRKDRLWMHIRKQQERFEGEFDIMPFTYILPTDRQELLKYLE  244

Query  172  IDNPDSIFVEKNNKHRSIKILPLNSINLNATDCFL--QEYVQNPFLVDGHKFDVGVYVVL  229
             D    + V+     R   I          T   L  Q Y++ P  ++  KFD+ +Y  +
Sbjct  245  TDASRHVIVKPPASARGTGISVTRKPKDFPTTATLVAQHYIERPLTINRAKFDLRLYAYV  304

Query  230  TSIEPLTVYMYG-GDILFRYCP---------EKYYPFDAENINKYV----IGNDYLPTWE  275
             + EPL VY+Y  G + F   P          KY      +INK      + N  +P W 
Sbjct  305  PTFEPLRVYIYDQGLVRFASVPYSHSVSTISNKYMHLTNYSINKLAEADGVANKPVPKWT  364

Query  276  VPSLIKYFERFGGSMRSSFDAYVRDQFLDPSVIWVQVEEIIRQTILSKKNNILKAMQPFK  335
            +  L ++F+  G               +D   I  ++EE+I +  +S +  I + M  F 
Sbjct  365  LHHLWEHFDEMG---------------VDREKIQREIEEVIIKAFISTEKPIREHMSRFL  409

Query  336  NGKY--FELLRFDLIVDDKLQVYLMEVNMSPNLSSAHFKP-NALLYQQVLYNVLNLVGVG  392
              ++  +EL   D+I+D+  + +L+EVN+SP+L S    P +  +   +  +VLNL GV 
Sbjct  410  EQEFICYELFGIDIILDEDYKPWLLEVNISPSLHSG--TPLDVSVKAPLAKDVLNLAGVY  467

Query  393  SPLRIDK  399
             P   DK
Sbjct  468  VPPSFDK  474



Lambda      K        H
   0.324    0.139    0.427 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3946317176


Query= XP_011197217.1 protein yellow [Bactrocera dorsalis]

Length=432
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

YELL_DROME  unnamed protein product                                   324     6e-106
YELF2_DROME  unnamed protein product                                  318     9e-105
YELF_DROME  unnamed protein product                                   305     4e-100


>YELL_DROME unnamed protein product
Length=541

 Score = 324 bits (830),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 164/416 (39%), Positives = 254/416 (61%), Gaps = 37/416 (9%)

Query  20   KLEEKFSWKQLEFEWPNAQAEQEAISKGQYVPENNLPLGLERWNDKLFVTVPRWRAGVAA  79
            KL+E++SW QL+F +PN + + +A++ G Y+P+N LP+G+E + ++LFVTVPRWR G+ A
Sbjct  24   KLQERYSWSQLDFAFPNTRLKDQALASGDYIPQNALPVGVEHFGNRLFVTVPRWRDGIPA  83

Query  80   SLNYVDL-KTTDKSPKLRPYPSWEANTLPIDVEPQEAKPSAGGRLDADKPQSVETTLTDN  138
            +L Y+++ ++   SP+L PYP W +NT             AG                D 
Sbjct  84   TLTYINMDRSLTGSPELIPYPDWRSNT-------------AG----------------DC  114

Query  139  ATIIST-FRIQADVCDRLWVLDTGLADILGNPKQITPNSIVIFDLKTDKVLRRFPIPKDQ  197
            A  I+T +RI+ D C RLWVLDTG   I        P ++ +FDL TD  +RR+ +P   
Sbjct  115  ANSITTAYRIKVDECGRLWVLDTGTVGIGNTTTNPCPYAVNVFDLTTDTRIRRYELPGVD  174

Query  198  IKDDSFFANIVIDAERTECNDAYAYIPDLGAYGLVVYSFRDDRSYRVK-HNFFHFDPLQG  256
               ++F ANI +D  +  C+DAYAY  D   YGL+ YS+  ++S+R   H++F  DPL+G
Sbjct  175  TNPNTFIANIAVDIGK-NCDDAYAYFADELGYGLIAYSWELNKSWRFSAHSYFFPDPLRG  233

Query  257  DFNVGGVNFQW-TDGVFGLAVGPLKADHTKDIYFHALASTKEFKVSNRVLQNETHVTSPA  315
            DFNV G+NFQW  +G+FG+++ P+++D  + +YF  LAS ++F VS R+L++ET      
Sbjct  234  DFNVAGINFQWGEEGIFGMSLSPIRSDGYRTLYFSPLASHRQFAVSTRILRDETRTED--  291

Query  316  AYYDFEFVGDRGMNGQSTAEVYDKDTGVIFYTQVNKDAIACWNVKRPYDLESQGLIDSDS  375
            +Y+DF  + +RG N  +T+ V   D G+  +  ++++A+ CW+   PY  +  G++D D 
Sbjct  292  SYHDFVALDERGPNSHTTSRVMSDD-GIELFNLIDQNAVGCWHSSMPYSPQFHGIVDRDD  350

Query  376  HALVFPNDMKIDNEGTVWVLSDKMPTYLYKELDPSAVNYRVLSGNNRELIKGTPCE  431
              LVFP D+KID    VWVLSD+MP +L  +LD S  N+R+ +     LI+ T C+
Sbjct  351  VGLVFPADVKIDENKNVWVLSDRMPVFLLSDLDYSDTNFRIYTAPLATLIENTVCD  406


>YELF2_DROME unnamed protein product
Length=452

 Score = 318 bits (815),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 150/387 (39%), Positives = 225/387 (58%), Gaps = 30/387 (8%)

Query  47   GQYVPENNLPLGLERWNDKLFVTVPRWRAGVAASLNYVDLKT--TDKSPKLRPYPSWEAN  104
              Y+P NN+P+G   +  +LFVT+PR R G+ ++LNY+DL    +++SPKLR YP++  N
Sbjct  94   ASYIPYNNVPMGATHFRGRLFVTMPRRRVGIPSTLNYIDLAEDGSNRSPKLRAYPNFALN  153

Query  105  TLPIDVEPQEAKPSAGGRLDADKPQSVETTLTDNATIISTFRIQADVCDRLWVLDTGLAD  164
                  E                             ++S +R   D C RLW +DTG+ +
Sbjct  154  QFNASAE----------------------------NLVSVYRTSVDACQRLWFIDTGMLE  185

Query  165  ILGNPKQITPNSIVIFDLKTDKVLRRFPIPKDQIKDDSFFANIVIDAERTECNDAYAYIP  224
               N +QI   SI + DL TD+VL+RF +P+   +     A+I +D +  +C DAYAYIP
Sbjct  186  YPNNRQQIRRPSIWVVDLATDQVLKRFDVPESIAETGRGLASITVDVKAGQCGDAYAYIP  245

Query  225  DLGAYGLVVYSFRDDRSYRVKHNFFHFDPLQGDFNVGGVNFQWTDGVFGLAVGPLKADHT  284
            DL    L VY  R+DR +  +HN+F+FDPL GD ++GG  F+W DG+F + +G  K D +
Sbjct  246  DLVYRRLYVYHLRNDRIWSFEHNYFNFDPLSGDLSIGGQTFRWDDGIFSITLGAQKLDGS  305

Query  285  KDIYFHALASTKEFKVSNRVLQNETHVTSPAAYYDFEFVGDRGMNGQSTAEVYDKDTGVI  344
            +D YFH +AST EF VSNRVLQ E++        DF  +G RG + QST   YD  TGVI
Sbjct  306  RDAYFHPMASTNEFVVSNRVLQQESNAARSDHGNDFRVLGSRGPSTQSTMHAYDPGTGVI  365

Query  345  FYTQVNKDAIACWNVKRPYDLESQGLIDSDSHALVFPNDMKIDNEGTVWVLSDKMPTYLY  404
            F+ ++ ++ + CW   +P   E+ G +DS++  +++P+D+ ID +GT+WV+S+ MP ++Y
Sbjct  366  FFDEIQRNGVGCWKTSKPISAENYGSVDSNAEDMIYPSDLSIDEDGTIWVMSNSMPIFIY  425

Query  405  KELDPSAVNYRVLSGNNRELIKGTPCE  431
              LD S  N+R+         +GT CE
Sbjct  426  STLDTSIYNFRIWKQKASLAKRGTVCE  452


>YELF_DROME unnamed protein product
Length=429

 Score = 305 bits (781),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 163/450 (36%), Positives = 238/450 (53%), Gaps = 55/450 (12%)

Query  9    LLCA-----GIISCKAK-LEEKFSWKQLEF-------------------EWPNAQAEQEA  43
            LLCA      +IS     + E F WKQL+F                    + N++    +
Sbjct  8    LLCAISGFQLLISADGDPMIEVFKWKQLDFYNRGDGYKDLWNRICIPDSHFYNSRKCLGS  67

Query  44   ISKGQYVPENNLPLGLERWNDKLFVTVPRWRAGVAASLNYVDLKTT--DKSPKLRPYPSW  101
             S G ++  NN+P G+  +  +LFVTVPR + G+ ++LNY+DL      +SP LR YP+ 
Sbjct  68   SSSGSFIQYNNVPQGVTHFRGRLFVTVPRRQPGIPSTLNYIDLAKDGWSQSPHLRAYPNL  127

Query  102  EANTLPIDVEPQEAKPSAGGRLDADKPQSVETTLTDNATIISTFRIQADVCDRLWVLDTG  161
              N                                    ++S +R   DVC RLW +DTG
Sbjct  128  AVNQYN----------------------------ASEQNLVSVYRTSVDVCGRLWFVDTG  159

Query  162  LADILGNPKQITPNSIVIFDLKTDKVLRRFPIPKDQIKDDSFFANIVIDAERTECNDAYA  221
            + +   N +QI   SI + DL  D++L+RF IP+  ++     A+I ID     CNDAYA
Sbjct  160  MLEFPNNRQQIRHPSIWVIDLANDRLLKRFEIPQSIVEIGRGLASITIDVGARRCNDAYA  219

Query  222  YIPDLGAYGLVVYSFRDDRSYRVKHNFFHFDPLQGDFNVGGVNFQWTDGVFGLAVGPLKA  281
            YIPDL    L VY  R DR +  +H+FF+FDPL  + N+GG  F+W DG+F   +G  K 
Sbjct  220  YIPDLVNRRLHVYHLRSDRIWSFEHSFFNFDPLSDNLNIGGQTFRWDDGIFSATLGSYKP  279

Query  282  DHTKDIYFHALASTKEFKVSNRVLQNETHVTSPAAYYDFEFVGDRGMNGQSTAEVYDKDT  341
            D ++D++FH +AST EF VSNRVLQ E +        DF  +G RG + QST   YD  T
Sbjct  280  DGSRDVFFHPMASTNEFVVSNRVLQQEFNAARSDHGDDFHLLGTRGPSTQSTMHKYDPRT  339

Query  342  GVIFYTQVNKDAIACWNVKRPYDLESQGLIDSDSHALVFPNDMKIDNEGTVWVLSDKMPT  401
            GVIF+ +V K  + CW   +P+  E+ G + S+S  +++P+D+ ID EG +WV+S+ MP 
Sbjct  340  GVIFFAEVQKSGVGCWKTSKPFSTENHGSVYSNSSEMIYPSDLTIDEEGYIWVMSNSMPI  399

Query  402  YLYKELDPSAVNYRVLSGNNRELIKGTPCE  431
            ++Y +LD    N+R+   +     +GT CE
Sbjct  400  FVYSKLDVEKYNFRIWRQSTLLAKRGTVCE  429



Lambda      K        H
   0.324    0.139    0.427 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3946317176


Query= XP_011197218.1 60S ribosomal protein L21 [Bactrocera dorsalis]

Length=159
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9V9M7_DROME  unnamed protein product                                 286     6e-101
RL21_DICDI  unnamed protein product                                   150     3e-47 
Q8ILK3_PLAF7  unnamed protein product                                 137     6e-42 


>Q9V9M7_DROME unnamed protein product
Length=159

 Score = 286 bits (733),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 148/159 (93%), Gaps = 0/159 (0%)

Query  1    MTNSKGYRRGTRDMFSRPFRKHGTIPLSTYMRVFKNGDIVDIKGHGAVQKGMPYKAYHGK  60
            MTNSKGYRRGTRDMFSRPFRKHG IPLSTYMRVFK GDIVDIKGHGAVQKG+PYKAYHGK
Sbjct  1    MTNSKGYRRGTRDMFSRPFRKHGVIPLSTYMRVFKIGDIVDIKGHGAVQKGLPYKAYHGK  60

Query  61   TGRVYNVTPHAVGVIVNKRVRGKILPKRINVRIEHVHHSKCREDFLRRVKENELKLKEAK  120
            TGR++NVT HAVGVIVNKRVRGKIL KR+NVRIEH+HHSKCREDFLRRVKENE  LKEAK
Sbjct  61   TGRIFNVTQHAVGVIVNKRVRGKILAKRVNVRIEHIHHSKCREDFLRRVKENERLLKEAK  120

Query  121  AKGVYVNLKRQPKAPKPAHFVKQIEEPIQLAPIPYEFVA  159
             KG +V+LKRQP+ PK AHFVK++EEPI LAPIPYEF+A
Sbjct  121  EKGQWVSLKRQPEQPKKAHFVKKLEEPIALAPIPYEFIA  159


>RL21_DICDI unnamed protein product
Length=160

 Score = 150 bits (380),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 108/159 (68%), Gaps = 1/159 (1%)

Query  1    MTNSKGYRRGTRDMFSRPFRKHGTIPLSTYMRVFKNGDIVDIKGHGAVQKGMPYKAYHGK  60
            M +S G R  TR +FSR FR HG +  +T++R F+ GD VDIK  G V KGMP+K YHG+
Sbjct  1    MPHSFGLRARTRYLFSRGFRNHGLLQTTTFLRTFRLGDYVDIKATGNVHKGMPHKFYHGR  60

Query  61   TGRVYNVTPHAVGVIVNKRVRGKILPKRINVRIEHVHHSKCREDFLRRVKENELKLKEAK  120
            TGRV+NVTP AVGVI+NKRV  +I+ K+I+VR EHV  S      L+R++EN+  + EAK
Sbjct  61   TGRVWNVTPRAVGVIINKRVGPRIIAKKIHVRTEHVKPSNSMAAHLKRIQENKKAVVEAK  120

Query  121  AKGVYVNLKRQPKAPKPAHFVK-QIEEPIQLAPIPYEFV  158
              G +V+++R P APK   FV  +  E +++ P+ YE +
Sbjct  121  KAGKWVDVRRNPAAPKDGFFVNPRNTEFVEVKPVKYELL  159


>Q8ILK3_PLAF7 unnamed protein product
Length=161

 Score = 137 bits (345),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 102/154 (66%), Gaps = 3/154 (2%)

Query  4    SKGYRRGTRDMFSRPFRKHGTIPLSTYMRVFKNGDIVDIKGHGAVQKGMPYKAYHGKTGR  63
            S+G R GTR  FS+ FRKHG    + Y+     GD VDI      QKGMP+  YHGKTG+
Sbjct  5    SRGKRSGTRYKFSKKFRKHGECTANKYLEKLNYGDYVDIVCDSTQQKGMPFNYYHGKTGK  64

Query  64   VYNVTPHAVGVIVNKRVRGKILPKRINVRIEHVHHSKCREDF-LRRVKENELKLKEAKAK  122
            ++++T   VGV+VNKRV+ +I  K++ VRIEHV  S+C EDF LR++K  EL +KEAK K
Sbjct  65   IFHITKRGVGVLVNKRVKHRIEQKKVCVRIEHVRKSRCNEDFLLRKIKNAEL-IKEAKLK  123

Query  123  GVYVNLKRQPKAPKPAHFVK-QIEEPIQLAPIPY  155
              ++N+KR+ + PKPA  +K    + I + P+P+
Sbjct  124  NEHINIKRKTEGPKPAAMIKVPPSKIITIEPLPF  157



Lambda      K        H
   0.324    0.139    0.427 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3946317176


Query= XP_011197219.1 zinc finger protein 107 isoform X2 [Bactrocera
dorsalis]

Length=672
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9PCY3_DROME  unnamed protein product                                 122     9e-29
O61361_DROME  unnamed protein product                                 115     2e-26
O61360_DROME  unnamed protein product                                 115     2e-26


>M9PCY3_DROME unnamed protein product
Length=878

 Score = 122 bits (307),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 109/417 (26%), Positives = 170/417 (41%), Gaps = 67/417 (16%)

Query  248  AVYICEFCAKEFRKSYDYIRHRRVHTSERPYNCGLCERAFSTKSKLHEHMKIHRLDEQQG  307
              ++C+ C K F+  Y  I HRR H+  +P+ C +C + F+T   L  H KIH       
Sbjct  219  GTHVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIH-------  271

Query  308  IPAKYYPCAVCSKGFSSLRMLDKHMSTHEQIYQVAYRCKICEEMFKSSIALTYHKHKQID  367
            I    + C VC   F++   L++HM  H       + C IC++ F     L  H      
Sbjct  272  IGGPMFTCIVCFNVFANNTSLERHMKRHST--DKPFACTICQKTFARKEHLDNHFRSHTG  329

Query  368  ADSTFLQQLIPTPT-------EIYTNTYSTESSCEIPDCSAAVSPPETTNKLQHLKRRRV  420
                  Q    T T        +  +T  T   C+   CS   +  E  + L H+++   
Sbjct  330  ETPFRCQYCAKTFTRKEHMVNHVRKHTGETPHRCDF--CSKTFTRKE--HLLNHVRQHTG  385

Query  421  VSKWICITCERHFSNSSTLRDHRRIYHGSYSRKRRISASAFLRCFKCSYCARVFETKARC  480
             S   C  C + F+    L +H R + G                FKC+YC + F      
Sbjct  386  ESPHRCSYCMKTFTRKEHLVNHIRQHTGETP-------------FKCTYCTKAFTR----  428

Query  481  KTHMLTHLNCLLNTDKSNQQPNAINIINALVFVTSLTNPASVKVVEFNVITKRRATNMQH  540
            K HM+ H+        + + P+                        +   T  R  ++ +
Sbjct  429  KDHMVNHVR-----QHTGESPHKCT---------------------YCTKTFTRKEHLTN  462

Query  541  ISKKRAKNSPQLHKCHICKDKFRKQCDLKRHLVVHTGERLHKCATCDKSFSLSSTLKQHM  600
              ++   +SP  H+C  CK  F ++  L  H+ +HTG+  HKC  C K+F+    L  HM
Sbjct  463  HVRQHTGDSP--HRCSYCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHM  520

Query  601  LTHATERAKHICIVCTKTYLTKKALNVHL-RLHTGVQPFQCEHCEFAFRTSGQRIAH  656
              H+++   H C VC K +  K+ L  H+ R HTG +PF CE C  +F   G  + H
Sbjct  521  RQHSSDNP-HCCNVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFH  576


 Score = 89.4 bits (220),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 97/427 (23%), Positives = 164/427 (38%), Gaps = 69/427 (16%)

Query  246  GCAVYICEFCAKEFRKSYDYIRHRRVHTSERPYNCGLCERAFSTKSKLHEHMKIHRLDEQ  305
            G  ++ C  C   F  +    RH + H++++P+ C +C++ F+ K  L  H + H  +  
Sbjct  273  GGPMFTCIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETP  332

Query  306  QGIPAKYYPCAVCSKGFSSLRMLDKHMSTHEQIYQVAYRCKICEEMFKSSIALTYHKHKQ  365
                   + C  C+K F+    +  H+  H    +  +RC  C + F     L  H  + 
Sbjct  333  -------FRCQYCAKTFTRKEHMVNHVRKHTG--ETPHRCDFCSKTFTRKEHLLNHVRQH  383

Query  366  IDADSTFLQQLIPTPT-------EIYTNTYSTESSCEIPDCSAAVSPPETTNKLQHLKRR  418
                       + T T        I  +T  T   C    C+ A +     + + H+++ 
Sbjct  384  TGESPHRCSYCMKTFTRKEHLVNHIRQHTGETPFKCTY--CTKAFT--RKDHMVNHVRQH  439

Query  419  RVVSKWICITCERHFSNSSTLRDHRRIYHGSYSRKRRISASAFLRCFKCSYCARVFETKA  478
               S   C  C + F+    L +H R + G                 +CSYC + F  K 
Sbjct  440  TGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPH-------------RCSYCKKTFTRKE  486

Query  479  RCKTHMLTHLNCLLNTDKSNQQPNAINIINALVFVTSLTNPASVKVVEFNVITKRRATNM  538
                H+  H+   L+T  S  +                         E+   T  R  ++
Sbjct  487  ----HLTNHVR--LHTGDSPHK------------------------CEYCQKTFTRKEHL  516

Query  539  QHISKKRAKNSPQLHKCHICKDKFRKQCDLKRHLV-VHTGERLHKCATCDKSFSLSSTLK  597
             +  ++ + ++P  H C++C   F ++  L  H+   HTG+R   C TC KSF L   L 
Sbjct  517  NNHMRQHSSDNP--HCCNVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLL  574

Query  598  QHMLTHATERA---KHICIVCTKTYLTKKALNVHLRLHTGVQPFQCEHCEFAFRTSGQRI  654
             H  +H   +       C  C K ++ K  L  H+R H+G +P  C  C  AF   G   
Sbjct  575  FHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSKAFVERGNLK  634

Query  655  AHLKVKH  661
             H+K+ H
Sbjct  635  RHMKMNH  641


 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 61/238 (26%), Positives = 91/238 (38%), Gaps = 52/238 (22%)

Query  424  WICITCERHFSNSSTLRDHRRIYHGSYSRKRRISASAFLRCFKCSYCARVFETKARCKTH  483
            ++C  C + F+ S  L  H +I+ G                F C  C  VF      + H
Sbjct  249  FMCQVCGQGFTTSQDLTRHGKIHIGGPM-------------FTCIVCFNVFANNTSLERH  295

Query  484  MLTHLNCLLNTDKSNQQPNAINIINALVFVTSLTNPASVKVVEFNVITKRRATNMQHISK  543
            M  H     +TDK                      P +  + +     K    N      
Sbjct  296  MKRH-----STDK----------------------PFACTICQKTFARKEHLDN-----H  323

Query  544  KRAKNSPQLHKCHICKDKFRKQCDLKRHLVVHTGERLHKCATCDKSFSLSSTLKQHMLTH  603
             R+       +C  C   F ++  +  H+  HTGE  H+C  C K+F    T K+H+L H
Sbjct  324  FRSHTGETPFRCQYCAKTFTRKEHMVNHVRKHTGETPHRCDFCSKTF----TRKEHLLNH  379

Query  604  A---TERAKHICIVCTKTYLTKKALNVHLRLHTGVQPFQCEHCEFAFRTSGQRIAHLK  658
                T  + H C  C KT+  K+ L  H+R HTG  PF+C +C  AF      + H++
Sbjct  380  VRQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTRKDHMVNHVR  437


 Score = 48.1 bits (113),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 53/112 (47%), Gaps = 8/112 (7%)

Query  25   FVCLTCSKRFTKPSLLRRHEVMHLPNKPFECSECHKRFSQDSSLRRHYLEKHDLNLKRFQ  84
            F+C  C + FT    L RH  +H+    F C  C   F+ ++SL RH +++H  + K F 
Sbjct  249  FMCQVCGQGFTTSQDLTRHGKIHIGGPMFTCIVCFNVFANNTSLERH-MKRHSTD-KPFA  306

Query  85   CIKCPLSFAQKSNLRLHDEKVHPSKILEHAESYACDRCPSVYGNKQKLSRHI  136
            C  C  +FA+K +L  H  + H  +       + C  C   +  K+ +  H+
Sbjct  307  CTICQKTFARKEHLDNHF-RSHTGET-----PFRCQYCAKTFTRKEHMVNHV  352


 Score = 45.4 bits (106),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 49/112 (44%), Gaps = 8/112 (7%)

Query  25   FVCLTCSKRFTKPSLLRRHEVMHLPNKPFECSECHKRFSQDSSLRRHYLEKHDLNLKRFQ  84
            F C+ C   F   + L RH   H  +KPF C+ C K F++   L  H+  +       F+
Sbjct  277  FTCIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHF--RSHTGETPFR  334

Query  85   CIKCPLSFAQKSNLRLHDEKVHPSKILEHAESYACDRCPSVYGNKQKLSRHI  136
            C  C  +F +K ++  H  K H  +       + CD C   +  K+ L  H+
Sbjct  335  CQYCAKTFTRKEHMVNHVRK-HTGET-----PHRCDFCSKTFTRKEHLLNHV  380


 Score = 45.1 bits (105),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 29/54 (54%), Gaps = 0/54 (0%)

Query  250  YICEFCAKEFRKSYDYIRHRRVHTSERPYNCGLCERAFSTKSKLHEHMKIHRLD  303
            + CE C K F      + H R H+ E+P+ C LC +AF  +  L  HMK++  D
Sbjct  590  FACEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSKAFVERGNLKRHMKMNHPD  643


 Score = 43.9 bits (102),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 41/166 (25%), Positives = 72/166 (43%), Gaps = 12/166 (7%)

Query  27   CLTCSKRFT-KPSLLRRHEVMHLPNKPFECSECHKRFSQDSSL---RRHYLEKHDLNLKR  82
            C  C+K FT K  L+      H  ++PF C  C K F    +L   +R + +  ++  + 
Sbjct  531  CNVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQEME-RP  589

Query  83   FQCIKCPLSFAQKSNLRLHDEKVHPSKILEHAESYACDRCPSVYGNKQKLSRHINLVHKD  142
            F C KCP +F  K +L  H  + H  +     + +AC  C   +  +  L RH+ + H D
Sbjct  590  FACEKCPKNFICKGHLVSH-MRSHSGE-----KPHACTLCSKAFVERGNLKRHMKMNHPD  643

Query  143  GNKSKNAFDKIEEDDDLALTQSVLEQLKTFQMEMNSLQTPVLEVEE  188
                        +     LTQ V +++K   +  +S  T +  +++
Sbjct  644  AMMPPPPVHPHPQIPAGVLTQ-VKQEVKPIIIPHHSATTTMHTIQQ  688


 Score = 43.1 bits (100),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 34/115 (30%), Positives = 44/115 (38%), Gaps = 8/115 (7%)

Query  22   AGRFVCLTCSKRFTKPSLLRRHEVMHLPNKPFECSECHKRFSQDSSLRRHYLEKHDLNLK  81
             G  VC  C K F     L  H   H   KPF C  C + F+    L RH   K  +   
Sbjct  218  TGTHVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRH--GKIHIGGP  275

Query  82   RFQCIKCPLSFAQKSNLRLHDEKVHPSKILEHAESYACDRCPSVYGNKQKLSRHI  136
             F CI C   FA  ++L  H ++    K       +AC  C   +  K+ L  H 
Sbjct  276  MFTCIVCFNVFANNTSLERHMKRHSTDK------PFACTICQKTFARKEHLDNHF  324


 Score = 37.7 bits (86),  Expect = 0.037, Method: Compositional matrix adjust.
 Identities = 27/91 (30%), Positives = 38/91 (42%), Gaps = 6/91 (7%)

Query  25   FVCLTCSKRFTKPSLLRRHEVMHLPN----KPFECSECHKRFSQDSSLRRHYLEKHDLNL  80
            F C TC K F     L  H+  H       +PF C +C K F     L  H +  H    
Sbjct  558  FTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSH-MRSHS-GE  615

Query  81   KRFQCIKCPLSFAQKSNLRLHDEKVHPSKIL  111
            K   C  C  +F ++ NL+ H +  HP  ++
Sbjct  616  KPHACTLCSKAFVERGNLKRHMKMNHPDAMM  646


 Score = 37.4 bits (85),  Expect = 0.041, Method: Compositional matrix adjust.
 Identities = 19/55 (35%), Positives = 27/55 (49%), Gaps = 0/55 (0%)

Query  608  AKHICIVCTKTYLTKKALNVHLRLHTGVQPFQCEHCEFAFRTSGQRIAHLKVKHG  662
              H+C +C K +  +  L VH R H+  +PF C+ C   F TS     H K+  G
Sbjct  219  GTHVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIG  273


 Score = 37.0 bits (84),  Expect = 0.053, Method: Compositional matrix adjust.
 Identities = 30/112 (27%), Positives = 47/112 (42%), Gaps = 12/112 (11%)

Query  27   CLTCSKRFTKPSLLRRHEVMHLPNKPFECSECHKRFSQDSSLRRHYLEKHDLNLKRFQCI  86
            C  CSK FT+   L  H   H    P  CS C K F++   L  H + +H      F+C 
Sbjct  363  CDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNH-IRQHTGETP-FKCT  420

Query  87   KCPLSFAQKSNLRLHDEKVHPSKILEHA--ESYACDRCPSVYGNKQKLSRHI  136
             C  +F +K ++  H        + +H     + C  C   +  K+ L+ H+
Sbjct  421  YCTKAFTRKDHMVNH--------VRQHTGESPHKCTYCTKTFTRKEHLTNHV  464


 Score = 35.8 bits (81),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 47/112 (42%), Gaps = 8/112 (7%)

Query  25   FVCLTCSKRFTKPSLLRRHEVMHLPNKPFECSECHKRFSQDSSLRRHYLEKHDLNLKRFQ  84
            F C  C+K FT+   +  H   H    P +C+ C K F++   L  H  +    +  R  
Sbjct  417  FKCTYCTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPHR--  474

Query  85   CIKCPLSFAQKSNLRLHDEKVHPSKILEHAESYACDRCPSVYGNKQKLSRHI  136
            C  C  +F +K +L  H       ++      + C+ C   +  K+ L+ H+
Sbjct  475  CSYCKKTFTRKEHLTNH------VRLHTGDSPHKCEYCQKTFTRKEHLNNHM  520


 Score = 34.3 bits (77),  Expect = 0.39, Method: Compositional matrix adjust.
 Identities = 33/115 (29%), Positives = 48/115 (42%), Gaps = 10/115 (9%)

Query  27   CLTCSKRFTKPSLLRRHEVMHLPNKPFECSECHKRFSQDSSLRRHY-LEKHDLNLKRFQC  85
            C  C+K FT+   L  H   H  + P  CS C K F++   L  H  L   D   K   C
Sbjct  447  CTYCTKTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRLHTGDSPHK---C  503

Query  86   IKCPLSFAQKSNLRLHDEKVHPSKILEHAESYACDRCPSVYGNKQKLSRHINLVH  140
              C  +F +K +L  H  + H S        + C+ C   +  K+ L  H++  H
Sbjct  504  EYCQKTFTRKEHLNNHMRQ-HSSD-----NPHCCNVCNKPFTRKEHLINHMSRCH  552


>O61361_DROME unnamed protein product
Length=891

 Score = 115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 112/458 (24%), Positives = 178/458 (39%), Gaps = 65/458 (14%)

Query  248  AVYICEFCAKEFRKSYDYIRHRRVHTSERPYNCGLCERAFSTKSKLHEHMKIHRLDE---  304
              ++C+ C K F+  Y  I HRR H+  +P+ C +C + F+T   L  H KIH       
Sbjct  219  GTHVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFT  278

Query  305  ------------------QQGIPAKYYPCAVCSKGFSSLRMLDKHMSTHEQIYQVAYRCK  346
                              ++    K + C +C K F+    LD H  +H    +  +RC+
Sbjct  279  CIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRSHTG--ETPFRCQ  336

Query  347  ICEEMFKSSIALTYH--KHKQIDADSTFLQQLIPTPTEIYTNTY-----STESSCEIPDC  399
             C + F     +  H  KH         + +   T  E Y N Y      T   C++  C
Sbjct  337  YCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHYMWHTGQTPHQCDV--C  394

Query  400  SAAVSPPETTNKLQHLKRRRVVSKWICITCERHFSNSSTLRDHRRIYHGSYSRKRRISAS  459
                +  E  +   H++     + + C  C + FS      +H   + G    +    + 
Sbjct  395  GKKYTRKE--HLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTGETPHRCDFCSK  452

Query  460  AFLR---------------CFKCSYCARVFETKARCKTHMLTH-----LNCLLNTDKSNQ  499
             F R                 +CSYC + F  K     H+  H       C   T    +
Sbjct  453  TFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTR  512

Query  500  QPNAINIINALVFVTSLTNPASVKVVEFNVITKRRATNMQHISKKRAKNSPQLHKCHICK  559
            + + +N       V   T  +  K         R+     H+ ++   +SP  H+C  CK
Sbjct  513  KDHMVN------HVRQHTGESPHKCTYCTKTFTRKEHLTNHV-RQHTGDSP--HRCSYCK  563

Query  560  DKFRKQCDLKRHLVVHTGERLHKCATCDKSFSLSSTLKQHMLTHATERAKHICIVCTKTY  619
              F ++  L  H+ +HTG+  HKC  C K+F+    L  HM  H+++   H C VC K +
Sbjct  564  KTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNP-HCCNVCNKPF  622

Query  620  LTKKALNVHL-RLHTGVQPFQCEHCEFAFRTSGQRIAH  656
              K+ L  H+ R HTG +PF CE C  +F   G  + H
Sbjct  623  TRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFH  660


 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 104/411 (25%), Positives = 158/411 (38%), Gaps = 65/411 (16%)

Query  246  GCAVYICEFCAKEFRKSYDYIRHRRVHTSERPYNCGLCERAFSTKSKLHEHMKIHRLDEQ  305
            G   + C++CAK F +    + H R HT E P+ C +C+++F+ K    EH   H +   
Sbjct  329  GETPFRCQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRK----EHYVNHYMWHT  384

Query  306  QGIPAKYYPCAVCSKGFSSLRMLDKHMSTHEQIYQVAYRCKICEEMFKSSIALTYHKHKQ  365
               P +   C VC K ++    L  HM +H    +  +RC+IC + F      T H    
Sbjct  385  GQTPHQ---CDVCGKKYTRKEHLANHMRSHTN--ETPFRCEICGKSFSRKEHFTNH----  435

Query  366  IDADSTFLQQLIPTPTEIYTNTYSTESSCEIPDCSAAVSPPETTNKLQHLKRRRVVSKWI  425
                             I  +T  T   C+   CS   +  E  + L H+++    S   
Sbjct  436  -----------------ILWHTGETPHRCDF--CSKTFTRKE--HLLNHVRQHTGESPHR  474

Query  426  CITCERHFSNSSTLRDHRRIYHGSYSRKRRISASAFLRCFKCSYCARVFETKARCKTHML  485
            C  C + F+    L +H R + G                FKC+YC + F  K     H+ 
Sbjct  475  CSYCMKTFTRKEHLVNHIRQHTGETP-------------FKCTYCTKAFTRKDHMVNHVR  521

Query  486  THLN-----CLLNTDKSNQQPNAINIINALVFVTSLTNPASVKVVEFNVITKRRATNMQH  540
             H       C   T    ++ +  N +       +  +P      +     K   TN  H
Sbjct  522  QHTGESPHKCTYCTKTFTRKEHLTNHVRQH----TGDSPHRCSYCKKTFTRKEHLTN--H  575

Query  541  ISKKRAKNSPQLHKCHICKDKFRKQCDLKRHLVVHTGERLHKCATCDKSFSLSSTLKQHM  600
            + +    +SP  HKC  C+  F ++  L  H+  H+ +  H C  C+K F+    L  HM
Sbjct  576  V-RLHTGDSP--HKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHM  632

Query  601  LTHATERAKHICIVCTKTYLTKKALNVHLRLHTGVQ----PFQCEHCEFAF  647
                T      C  C K++  K  L  H R HT  Q    PF CE C   F
Sbjct  633  SRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNF  683


 Score = 92.4 bits (228),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 91/377 (24%), Positives = 151/377 (40%), Gaps = 75/377 (20%)

Query  308  IPAKYYPCAVCSKGFSSLRMLDKHMSTHEQIYQVAYRCKICEEMFKSSIALTYHKHKQID  367
            I    + C +C K F     L  H   H +  +  + C++C + F +S  LT  +H +I 
Sbjct  216  IATGTHVCDICGKMFQFRYQLIVHRRYHSE--RKPFMCQVCGQGFTTSQDLT--RHGKIH  271

Query  368  ADSTFLQQLIPTPTEIYTNTYSTESSCEIPDCSAAVSPPETTNKLQHLKRRRVVSKWICI  427
                    ++        N ++  +S E                 +H+KR      + C 
Sbjct  272  IGGPMFTCIV------CFNVFANNTSLE-----------------RHMKRHSTDKPFACT  308

Query  428  TCERHFSNSSTLRDHRRIYHGSYSRKRRISASAFLRCFKCSYCARVFETKARCKTHMLTH  487
             C++ F+    L +H R + G                F+C YCA+ F  K     HM+ H
Sbjct  309  ICQKTFARKEHLDNHFRSHTGETP-------------FRCQYCAKTFTRKE----HMVNH  351

Query  488  LNCLLNTDKSNQQPNAINI-----------INALVFVTSLTNPASVKVVEFNVITKRRAT  536
            +        + + P+  +I           +N  ++ T  T P    V        ++ T
Sbjct  352  VR-----KHTGETPHRCDICKKSFTRKEHYVNHYMWHTGQT-PHQCDVC------GKKYT  399

Query  537  NMQHISKK-RAKNSPQLHKCHICKDKFRKQCDLKRHLVVHTGERLHKCATCDKSFSLSST  595
              +H++   R+  +    +C IC   F ++     H++ HTGE  H+C  C K+F    T
Sbjct  400  RKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTF----T  455

Query  596  LKQHMLTHA---TERAKHICIVCTKTYLTKKALNVHLRLHTGVQPFQCEHCEFAFRTSGQ  652
             K+H+L H    T  + H C  C KT+  K+ L  H+R HTG  PF+C +C  AF     
Sbjct  456  RKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTRKDH  515

Query  653  RIAHLKVKHGIQKLKST  669
             + H++   G    K T
Sbjct  516  MVNHVRQHTGESPHKCT  532


 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 104/482 (22%), Positives = 176/482 (37%), Gaps = 85/482 (18%)

Query  25   FVCLTCSKRFTKPSLLRRHEVMHLPNKPFECSECHKRFSQDSSLRRHYLEKHDLNLKRFQ  84
            F+C  C + FT    L RH  +H+    F C  C   F+ ++SL RH +++H  + K F 
Sbjct  249  FMCQVCGQGFTTSQDLTRHGKIHIGGPMFTCIVCFNVFANNTSLERH-MKRHSTD-KPFA  306

Query  85   CIKCPLSFAQKSNLRLHDEKVHPSKILEHAESYACDRCPSVYGNKQKLSRHINLVHKDGN  144
            C  C  +FA+K +L  H  + H  +       + C  C   +  K+ +   +N V K   
Sbjct  307  CTICQKTFARKEHLDNHF-RSHTGET-----PFRCQYCAKTFTRKEHM---VNHVRKHTG  357

Query  145  KS-------KNAFDKIEE--DDDLALTQSVLEQLKTFQMEMNSLQTPVLEVEENLDATNI  195
            ++       K +F + E   +  +  T     Q      +    +     +  + + T  
Sbjct  358  ETPHRCDICKKSFTRKEHYVNHYMWHTGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPF  417

Query  196  NILDNSKNFIEVPTQQQEEERIINEVLLKDRLNAQGIEYYLGVQRTIRKDGCAVYICEFC  255
                  K+F         +E   N +L                       G   + C+FC
Sbjct  418  RCEICGKSF-------SRKEHFTNHILWHT--------------------GETPHRCDFC  450

Query  256  AKEFRKSYDYIRHRRVHTSERPYNCGLCERAFSTKSKLHEHMKIHRLDEQQGIPAKYYPC  315
            +K F +    + H R HT E P+ C  C + F+ K  L  H++ H  +         + C
Sbjct  451  SKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGETP-------FKC  503

Query  316  AVCSKGFSSLRMLDKHMSTHEQIYQVAYRCKICEEMFKSSIALTYHKHKQIDADS-----  370
              C+K F+    +  H+  H    +  ++C  C + F     LT H  +Q   DS     
Sbjct  504  TYCTKAFTRKDHMVNHVRQHTG--ESPHKCTYCTKTFTRKEHLTNHV-RQHTGDSPHRCS  560

Query  371  ----TFLQQLIPTPTEIYTNTYSTESSCEIPDCSAAVSPPETTNKLQHLKRRRVVSKWIC  426
                TF ++   T   +  +T  +   CE   C    +  E  N   H+++    +   C
Sbjct  561  YCKKTFTRKEHLT-NHVRLHTGDSPHKCEY--CQKTFTRKEHLN--NHMRQHSSDNPHCC  615

Query  427  ITCERHFSNSSTLRDH-RRIYHGSYSRKRRISASAFLRCFKCSYCARVFETKARCKTHML  485
              C + F+    L +H  R + G              R F C  C + F  K     H  
Sbjct  616  NVCNKPFTRKEHLINHMSRCHTGD-------------RPFTCETCGKSFPLKGNLLFHQR  662

Query  486  TH  487
            +H
Sbjct  663  SH  664


 Score = 44.7 bits (104),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 47/100 (47%), Gaps = 3/100 (3%)

Query  27   CLTCSKRFTKPSLLRRHEVMHLPNKPFECSECHKRFSQDSSLRRHYLEKHDLNLKRFQCI  86
            C  C K FT+   L  H   H  + P  C+ C+K F++   L  H    H  + + F C 
Sbjct  587  CEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGD-RPFTCE  645

Query  87   KCPLSFAQKSNLRLHDEKVHPSKILEHAESYACDRCPSVY  126
             C  SF  K NL  H ++ H +K  E    +AC++CP  +
Sbjct  646  TCGKSFPLKGNLLFH-QRSH-TKGQEMERPFACEKCPKNF  683


 Score = 42.7 bits (99),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 34/115 (30%), Positives = 44/115 (38%), Gaps = 8/115 (7%)

Query  22   AGRFVCLTCSKRFTKPSLLRRHEVMHLPNKPFECSECHKRFSQDSSLRRHYLEKHDLNLK  81
             G  VC  C K F     L  H   H   KPF C  C + F+    L RH   K  +   
Sbjct  218  TGTHVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRH--GKIHIGGP  275

Query  82   RFQCIKCPLSFAQKSNLRLHDEKVHPSKILEHAESYACDRCPSVYGNKQKLSRHI  136
             F CI C   FA  ++L  H ++    K       +AC  C   +  K+ L  H 
Sbjct  276  MFTCIVCFNVFANNTSLERHMKRHSTDK------PFACTICQKTFARKEHLDNHF  324


>O61360_DROME unnamed protein product
Length=962

 Score = 115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 112/458 (24%), Positives = 178/458 (39%), Gaps = 65/458 (14%)

Query  248  AVYICEFCAKEFRKSYDYIRHRRVHTSERPYNCGLCERAFSTKSKLHEHMKIHRLDE---  304
              ++C+ C K F+  Y  I HRR H+  +P+ C +C + F+T   L  H KIH       
Sbjct  219  GTHVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFT  278

Query  305  ------------------QQGIPAKYYPCAVCSKGFSSLRMLDKHMSTHEQIYQVAYRCK  346
                              ++    K + C +C K F+    LD H  +H    +  +RC+
Sbjct  279  CIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRSHTG--ETPFRCQ  336

Query  347  ICEEMFKSSIALTYH--KHKQIDADSTFLQQLIPTPTEIYTNTY-----STESSCEIPDC  399
             C + F     +  H  KH         + +   T  E Y N Y      T   C++  C
Sbjct  337  YCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHYMWHTGQTPHQCDV--C  394

Query  400  SAAVSPPETTNKLQHLKRRRVVSKWICITCERHFSNSSTLRDHRRIYHGSYSRKRRISAS  459
                +  E  +   H++     + + C  C + FS      +H   + G    +    + 
Sbjct  395  GKKYTRKE--HLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTGETPHRCDFCSK  452

Query  460  AFLR---------------CFKCSYCARVFETKARCKTHMLTH-----LNCLLNTDKSNQ  499
             F R                 +CSYC + F  K     H+  H       C   T    +
Sbjct  453  TFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTR  512

Query  500  QPNAINIINALVFVTSLTNPASVKVVEFNVITKRRATNMQHISKKRAKNSPQLHKCHICK  559
            + + +N       V   T  +  K         R+     H+ ++   +SP  H+C  CK
Sbjct  513  KDHMVN------HVRQHTGESPHKCTYCTKTFTRKEHLTNHV-RQHTGDSP--HRCSYCK  563

Query  560  DKFRKQCDLKRHLVVHTGERLHKCATCDKSFSLSSTLKQHMLTHATERAKHICIVCTKTY  619
              F ++  L  H+ +HTG+  HKC  C K+F+    L  HM  H+++   H C VC K +
Sbjct  564  KTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNP-HCCNVCNKPF  622

Query  620  LTKKALNVHL-RLHTGVQPFQCEHCEFAFRTSGQRIAH  656
              K+ L  H+ R HTG +PF CE C  +F   G  + H
Sbjct  623  TRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFH  660


 Score = 105 bits (261),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 110/440 (25%), Positives = 172/440 (39%), Gaps = 67/440 (15%)

Query  246  GCAVYICEFCAKEFRKSYDYIRHRRVHTSERPYNCGLCERAFSTKSKLHEHMKIHRLDEQ  305
            G   + C++CAK F +    + H R HT E P+ C +C+++F+ K    EH   H +   
Sbjct  329  GETPFRCQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRK----EHYVNHYMWHT  384

Query  306  QGIPAKYYPCAVCSKGFSSLRMLDKHMSTHEQIYQVAYRCKICEEMFKSSIALTYHKHKQ  365
               P +   C VC K ++    L  HM +H    +  +RC+IC + F      T H    
Sbjct  385  GQTPHQ---CDVCGKKYTRKEHLANHMRSHTN--ETPFRCEICGKSFSRKEHFTNH----  435

Query  366  IDADSTFLQQLIPTPTEIYTNTYSTESSCEIPDCSAAVSPPETTNKLQHLKRRRVVSKWI  425
                             I  +T  T   C+   CS   +  E  + L H+++    S   
Sbjct  436  -----------------ILWHTGETPHRCDF--CSKTFTRKE--HLLNHVRQHTGESPHR  474

Query  426  CITCERHFSNSSTLRDHRRIYHGSYSRKRRISASAFLR---------------CFKCSYC  470
            C  C + F+    L +H R + G    K      AF R                 KC+YC
Sbjct  475  CSYCMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTRKDHMVNHVRQHTGESPHKCTYC  534

Query  471  ARVFETKARCKTHMLTHLN-----CLLNTDKSNQQPNAINIINALVFVTSLTNPASVKVV  525
             + F  K     H+  H       C        ++ +  N +        L    S    
Sbjct  535  TKTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHVR-------LHTGDSPHKC  587

Query  526  EFNVITKRRATNMQHISKKRAKNSPQLHKCHICKDKFRKQCDLKRHLV-VHTGERLHKCA  584
            E+   T  R  ++ +  ++ + ++P  H C++C   F ++  L  H+   HTG+R   C 
Sbjct  588  EYCQKTFTRKEHLNNHMRQHSSDNP--HCCNVCNKPFTRKEHLINHMSRCHTGDRPFTCE  645

Query  585  TCDKSFSLSSTLKQHMLTHATERA---KHICIVCTKTYLTKKALNVHLRLHTGVQPFQCE  641
            TC KSF L   L  H  +H   +       C  C K ++ K  L  H+R H+G +P  C 
Sbjct  646  TCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSGEKPHACT  705

Query  642  HCEFAFRTSGQRIAHLKVKH  661
             C  AF   G    H+K+ H
Sbjct  706  LCSKAFVERGNLKRHMKMNH  725


 Score = 48.1 bits (113),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 66/279 (24%), Positives = 100/279 (36%), Gaps = 28/279 (10%)

Query  27   CLTCSKRFTKPSLLRRHEVMHLPNKPFECSECHKRFSQDSSLRRHYLEKHDLNLKRFQCI  86
            C  C K FT+   L  H   H    PF+C+ C K F++   +  H   +        +C 
Sbjct  475  CSYCMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTRKDHMVNHV--RQHTGESPHKCT  532

Query  87   KCPLSFAQKSNLRLHDEKVHPSKILEHA--ESYACDRCPSVYGNKQKLSRHINLVHKDGN  144
             C  +F +K +L  H        + +H     + C  C   +  K+ L+ H+ L      
Sbjct  533  YCTKTFTRKEHLTNH--------VRQHTGDSPHRCSYCKKTFTRKEHLTNHVRL------  578

Query  145  KSKNAFDKIEEDDDLALTQSVLEQLKTFQMEMNSLQTPVLEVEENLDATNINILDNSKNF  204
               +  D   + +    T +  E L    M  +S   P      N   T    L N  + 
Sbjct  579  ---HTGDSPHKCEYCQKTFTRKEHLNN-HMRQHSSDNPHCCNVCNKPFTRKEHLINHMSR  634

Query  205  IEVPTQQQEEERIINEVLLKDRLNAQGIEYYLGVQRTIRKDGCAVYICEFCAKEFRKSYD  264
                 +    E       LK  L      +  G Q   R   C     E C K F     
Sbjct  635  CHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKG-QEMERPFAC-----EKCPKNFICKGH  688

Query  265  YIRHRRVHTSERPYNCGLCERAFSTKSKLHEHMKIHRLD  303
             + H R H+ E+P+ C LC +AF  +  L  HMK++  D
Sbjct  689  LVSHMRSHSGEKPHACTLCSKAFVERGNLKRHMKMNHPD  727


 Score = 48.1 bits (113),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 53/112 (47%), Gaps = 8/112 (7%)

Query  25   FVCLTCSKRFTKPSLLRRHEVMHLPNKPFECSECHKRFSQDSSLRRHYLEKHDLNLKRFQ  84
            F+C  C + FT    L RH  +H+    F C  C   F+ ++SL RH +++H  + K F 
Sbjct  249  FMCQVCGQGFTTSQDLTRHGKIHIGGPMFTCIVCFNVFANNTSLERH-MKRHSTD-KPFA  306

Query  85   CIKCPLSFAQKSNLRLHDEKVHPSKILEHAESYACDRCPSVYGNKQKLSRHI  136
            C  C  +FA+K +L  H  + H  +       + C  C   +  K+ +  H+
Sbjct  307  CTICQKTFARKEHLDNHF-RSHTGET-----PFRCQYCAKTFTRKEHMVNHV  352


 Score = 43.9 bits (102),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 41/166 (25%), Positives = 72/166 (43%), Gaps = 12/166 (7%)

Query  27   CLTCSKRFT-KPSLLRRHEVMHLPNKPFECSECHKRFSQDSSL---RRHYLEKHDLNLKR  82
            C  C+K FT K  L+      H  ++PF C  C K F    +L   +R + +  ++  + 
Sbjct  615  CNVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQEME-RP  673

Query  83   FQCIKCPLSFAQKSNLRLHDEKVHPSKILEHAESYACDRCPSVYGNKQKLSRHINLVHKD  142
            F C KCP +F  K +L  H  + H  +     + +AC  C   +  +  L RH+ + H D
Sbjct  674  FACEKCPKNFICKGHLVSH-MRSHSGE-----KPHACTLCSKAFVERGNLKRHMKMNHPD  727

Query  143  GNKSKNAFDKIEEDDDLALTQSVLEQLKTFQMEMNSLQTPVLEVEE  188
                        +     LTQ V +++K   +  +S  T +  +++
Sbjct  728  AMMPPPPVHPHPQIPAGVLTQ-VKQEVKPIIIPHHSATTTMHTIQQ  772


 Score = 43.1 bits (100),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 34/115 (30%), Positives = 44/115 (38%), Gaps = 8/115 (7%)

Query  22   AGRFVCLTCSKRFTKPSLLRRHEVMHLPNKPFECSECHKRFSQDSSLRRHYLEKHDLNLK  81
             G  VC  C K F     L  H   H   KPF C  C + F+    L RH   K  +   
Sbjct  218  TGTHVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRH--GKIHIGGP  275

Query  82   RFQCIKCPLSFAQKSNLRLHDEKVHPSKILEHAESYACDRCPSVYGNKQKLSRHI  136
             F CI C   FA  ++L  H ++    K       +AC  C   +  K+ L  H 
Sbjct  276  MFTCIVCFNVFANNTSLERHMKRHSTDK------PFACTICQKTFARKEHLDNHF  324


 Score = 41.6 bits (96),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 37/80 (46%), Gaps = 2/80 (3%)

Query  25   FVCLTCSKRFTKPSLLRRHEVMHLPNKPFECSECHKRFSQDSSLRRHYLEKHDLNLKRFQ  84
            F C+ C   F   + L RH   H  +KPF C+ C K F++   L  H+  +       F+
Sbjct  277  FTCIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHF--RSHTGETPFR  334

Query  85   CIKCPLSFAQKSNLRLHDEK  104
            C  C  +F +K ++  H  K
Sbjct  335  CQYCAKTFTRKEHMVNHVRK  354


 Score = 37.7 bits (86),  Expect = 0.037, Method: Compositional matrix adjust.
 Identities = 27/91 (30%), Positives = 38/91 (42%), Gaps = 6/91 (7%)

Query  25   FVCLTCSKRFTKPSLLRRHEVMHLPN----KPFECSECHKRFSQDSSLRRHYLEKHDLNL  80
            F C TC K F     L  H+  H       +PF C +C K F     L  H +  H    
Sbjct  642  FTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSH-MRSHS-GE  699

Query  81   KRFQCIKCPLSFAQKSNLRLHDEKVHPSKIL  111
            K   C  C  +F ++ NL+ H +  HP  ++
Sbjct  700  KPHACTLCSKAFVERGNLKRHMKMNHPDAMM  730


 Score = 37.7 bits (86),  Expect = 0.039, Method: Compositional matrix adjust.
 Identities = 19/55 (35%), Positives = 27/55 (49%), Gaps = 0/55 (0%)

Query  608  AKHICIVCTKTYLTKKALNVHLRLHTGVQPFQCEHCEFAFRTSGQRIAHLKVKHG  662
              H+C +C K +  +  L VH R H+  +PF C+ C   F TS     H K+  G
Sbjct  219  GTHVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIG  273


 Score = 35.8 bits (81),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 47/112 (42%), Gaps = 8/112 (7%)

Query  25   FVCLTCSKRFTKPSLLRRHEVMHLPNKPFECSECHKRFSQDSSLRRHYLEKHDLNLKRFQ  84
            F C  C+K FT+   +  H   H    P +C+ C K F++   L  H  +    +  R  
Sbjct  501  FKCTYCTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPHR--  558

Query  85   CIKCPLSFAQKSNLRLHDEKVHPSKILEHAESYACDRCPSVYGNKQKLSRHI  136
            C  C  +F +K +L  H       ++      + C+ C   +  K+ L+ H+
Sbjct  559  CSYCKKTFTRKEHLTNH------VRLHTGDSPHKCEYCQKTFTRKEHLNNHM  604


 Score = 35.0 bits (79),  Expect = 0.24, Method: Compositional matrix adjust.
 Identities = 30/112 (27%), Positives = 42/112 (38%), Gaps = 12/112 (11%)

Query  27   CLTCSKRFTKPSLLRRHEVMHLPNKPFECSECHKRFSQDSSLRRHYLEKHDLNLKRFQCI  86
            C  C K++T+   L  H   H    PF C  C K FS+      H L        R  C 
Sbjct  391  CDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTGETPHR--CD  448

Query  87   KCPLSFAQKSNLRLHDEKVHPSKILEHA--ESYACDRCPSVYGNKQKLSRHI  136
             C  +F +K +L  H        + +H     + C  C   +  K+ L  HI
Sbjct  449  FCSKTFTRKEHLLNH--------VRQHTGESPHRCSYCMKTFTRKEHLVNHI  492


 Score = 33.1 bits (74),  Expect = 0.85, Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 44/112 (39%), Gaps = 8/112 (7%)

Query  25   FVCLTCSKRFTKPSLLRRHEVMHLPNKPFECSECHKRFSQDSSLRRHYLEKHDLNLKRFQ  84
            F C  C+K FT+   +  H   H    P  C  C K F++      HY+          Q
Sbjct  333  FRCQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHYMW--HTGQTPHQ  390

Query  85   CIKCPLSFAQKSNLRLHDEKVHPSKILEHAESYACDRCPSVYGNKQKLSRHI  136
            C  C   + +K +L  H  + H ++       + C+ C   +  K+  + HI
Sbjct  391  CDVCGKKYTRKEHLANH-MRSHTNET-----PFRCEICGKSFSRKEHFTNHI  436


 Score = 31.6 bits (70),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 27/114 (24%), Positives = 42/114 (37%), Gaps = 12/114 (11%)

Query  25   FVCLTCSKRFTKPSLLRRHEVMHLPNKPFECSECHKRFSQDSSLRRHYLEKHDLNLKRFQ  84
            F C  C K F++      H + H    P  C  C K F++   L  H  +    +  R  
Sbjct  417  FRCEICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHR--  474

Query  85   CIKCPLSFAQKSNLRLHDEKVHPSKILEHA--ESYACDRCPSVYGNKQKLSRHI  136
            C  C  +F +K +L  H        I +H     + C  C   +  K  +  H+
Sbjct  475  CSYCMKTFTRKEHLVNH--------IRQHTGETPFKCTYCTKAFTRKDHMVNHV  520



Lambda      K        H
   0.324    0.139    0.427 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3946317176


Query= XP_011197220.1 RNA polymerase I-specific transcription initiation
factor RRN3 [Bactrocera dorsalis]

Length=627
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9V9M6_DROME  unnamed protein product                                 650     0.0  
M9PF57_DROME  unnamed protein product                                 31.2    3.6  
Q9VT55_DROME  unnamed protein product                                 30.8    4.1  


>Q9V9M6_DROME unnamed protein product
Length=611

 Score = 650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/622 (53%), Positives = 450/622 (72%), Gaps = 13/622 (2%)

Query  3    SVYSAKTGLSSILKAYSPAERERAKNIAINKVRFEIPKQKGILDAVEAVNAHNNFQPLNE  62
            S Y++KT ++SILK +S  +R +A  +AINKVRF  PK+KG+ ++V       NF  + E
Sbjct  2    SFYTSKTDVTSILKTFSGVKRNQANAVAINKVRFSTPKEKGLAESVRVALEERNFHLVKE  61

Query  63   FVAFLKETEISDNEFSQIMSDAHKLIYDLSPKFTNMVEALISLPWTKRQPAALQAYTEFY  122
            F  FL+E E+SD+E   I+ DA +++++L+P+F  +VEAL+SL W KR    ++AYTEF 
Sbjct  62   FTYFLREAELSDDEVVIIIKDAKRIVHNLTPEFVTVVEALLSLNWKKRSSEIIEAYTEFC  121

Query  123  IDIMVAHNKYVEFGIPKLISLWIPADADESMWPNGTPIDNVKIELDAIHHLLDRILTAIP  182
            I++MV HN+Y+  G+ KLI  WIP D DES W +G P ++V+ EL  IH +LDRILTA+P
Sbjct  122  IELMVTHNRYLPIGVSKLIVHWIPGDMDESDWVHGCPSEHVRNELKPIHKVLDRILTAVP  181

Query  183  MSFEVVLETIENKFPYFKKATHVIAGYVHNVLWLTEYKPIFTEFVMQLLIQKLVVLDVNA  242
            M+F+++++ I  KFPYFKK  HV AGY++NVLWL EYKPIF E V QL++QKL++LDVNA
Sbjct  182  MAFDIIIDAISAKFPYFKKPYHVTAGYLYNVLWLLEYKPIFEELVFQLVLQKLLLLDVNA  241

Query  243  PRSEIEETECEEDEDLEEENEDQEIFEMDD-CQKSSGVNQKDDDLLPMKHAIAHTLDICM  301
            P+ EIE     E  D EE+ E   +FE+DD C ++   ++K      + H +  TLD+C+
Sbjct  242  PKDEIEL----EMNDEEEKVEADTLFEIDDVCAENVPKSEKS-----VSHPVGKTLDVCL  292

Query  302  EKMFNFLDTRNPYALNVTAEQRLQLNKFWKVLLTAFDNVILPSHNTHHVQFLLFYHSSFK  361
              ++ F D +     N + EQR   N+ +K+LL  FD V+LPSHNTHHVQF+LFY +S +
Sbjct  293  FLLYKFFDGKCRLNENSSEEQRRTANRLFKMLLYLFDEVLLPSHNTHHVQFILFYATSLR  352

Query  362  NTIAEAFLQSLWDKIKNPNVSAVIRQAAVGYIASFLARAKFLPLQVLKYYLKELCDWAHQ  421
            +  +EAFL SLW K++NPNVSAVIR AAVGY+ASFL+RA+FLPL  + +YLKEL  WAH 
Sbjct  353  SVYSEAFLDSLWTKVQNPNVSAVIRHAAVGYMASFLSRARFLPLSTVTFYLKELTRWAHT  412

Query  422  YIQRCDQYRQNGSLKANIVFFSLCQAVFYVIAFRSRDLTADRKSLLFLQSLQLSAIVTCN  481
            YI   D Y+QN SLKAN+VF+S+CQAVFY+IAFR++DLTA  K LLFLQSLQLS +  C+
Sbjct  413  YIDDSDAYKQNCSLKANLVFYSVCQAVFYLIAFRAKDLTASSKDLLFLQSLQLSRLAMCH  472

Query  482  FNPLRVCLPAVATAFAGVTRAYQLAYCHAILERNARRKLATVYANDTATPEETLDTFFPF  541
             NPLR CL  VATAFAGVTR YQLAYCH +LERNARRKLATVY ++   P+ETL++FFPF
Sbjct  473  LNPLRYCLAPVATAFAGVTRTYQLAYCHTVLERNARRKLATVYGHEKCMPDETLESFFPF  532

Query  542  DPYLLKMSEKKITPHYLQYQASEAEEASVVATHMSPLRQRKRGDSEMCDDIDDFIVADKR  601
            DPY+LK+S+K I  +Y+ YQ+++ +E    +        RKRGDSEM ++ D+F++ DKR
Sbjct  533  DPYVLKLSKKYIETNYMVYQSNDTDEYVYGSNKYG--HSRKRGDSEMLEE-DEFLIVDKR  589

Query  602  QKIMELARSQEREAQFTYGLSP  623
             K  +L++SQE + QF +G SP
Sbjct  590  PKNFDLSKSQEFDKQFHFGSSP  611


>M9PF57_DROME unnamed protein product
Length=1385

 Score = 31.2 bits (69),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 26/90 (29%), Positives = 42/90 (47%), Gaps = 5/90 (6%)

Query  201   KATHVIAGYVHNVLWLTEYKPIFTEFVMQLLIQKLVVLDVNAPRSEIEETECE--EDEDL  258
             K THV     HN+  L +     TE + Q +     +L    PRS  + T  E    E  
Sbjct  1009  KFTHVPQLEGHNIGLLVK---TATEPLQQSMSASSTMLAATPPRSAAQPTPFEFPSLEQA  1065

Query  259   EEENEDQEIFEMDDCQKSSGVNQKDDDLLP  288
             EE+++ + +   D+ Q+  GVN+  D++ P
Sbjct  1066  EEQHKFKSLASFDEVQRDFGVNRSFDNVSP  1095


>Q9VT55_DROME unnamed protein product
Length=1339

 Score = 30.8 bits (68),  Expect = 4.1, Method: Compositional matrix adjust.
 Identities = 26/90 (29%), Positives = 42/90 (47%), Gaps = 5/90 (6%)

Query  201   KATHVIAGYVHNVLWLTEYKPIFTEFVMQLLIQKLVVLDVNAPRSEIEETECE--EDEDL  258
             K THV     HN+  L +     TE + Q +     +L    PRS  + T  E    E  
Sbjct  964   KFTHVPQLEGHNIGLLVK---TATEPLQQSMSASSTMLAATPPRSAAQPTPFEFPSLEQA  1020

Query  259   EEENEDQEIFEMDDCQKSSGVNQKDDDLLP  288
             EE+++ + +   D+ Q+  GVN+  D++ P
Sbjct  1021  EEQHKFKSLASFDEVQRDFGVNRSFDNVSP  1050



Lambda      K        H
   0.324    0.139    0.427 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3946317176


Query= XP_011197221.1 iron-sulfur protein NUBPL [Bactrocera dorsalis]

Length=295
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

NUBP1_CAEEL  unnamed protein product                                  151     1e-43
NUBP2_DROME  unnamed protein product                                  139     2e-39
Q57WQ0_TRYB2  unnamed protein product                                 137     1e-38


>NUBP1_CAEEL unnamed protein product
Length=313

 Score = 151 bits (381),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 94/271 (35%), Positives = 144/271 (53%), Gaps = 20/271 (7%)

Query  20   PKQQELMARGLPKRAPLPGVTNIVIVASGKGGVGKSTVAVNLAVSLA-NMGKHVGLLDAD  78
            PK Q+  +R          + + +++ SGKGGVGKST+  NLA +LA +  K V +LD D
Sbjct  48   PKIQDRFSR----------IKHKILILSGKGGVGKSTLTSNLARALASDPSKQVAILDVD  97

Query  79   IFGPSVPLMMNIHEEPLVDDNNFMIP-PINYGVKCLSMG-LLAKQTDAIIWRGPLVMSAV  136
            I GPS P MM + +E + +  +   P  I   +  +S+  LL  + DA+IWRG      +
Sbjct  98   ICGPSQPRMMGVEDEEVHNSADGWTPVGIQPNLTLMSIAFLLGDKNDAVIWRGARKNGMI  157

Query  137  QRLLKGAVWSPLDILIVDTPPGTGDVHLSLAQNV----PIAGVLLVSTPQKAALEVTLRG  192
            ++ LK   W  +D L++DTPPGT D H+SL Q +    P+ G L+VSTPQ+ +L    + 
Sbjct  158  KQFLKDVDWGEVDYLLIDTPPGTSDEHISLVQFLLQAGPLDGALIVSTPQEVSLLDVRKE  217

Query  193  AQMYRKLGIPIIGLTENMGHAICGNCQTRMEIFQNAT---DSFTKQIGTNVLASIPLDGN  249
                 K  +PI+G+ ENM   +C NC     +F  +T   +   K     +LA +PL+  
Sbjct  218  VSFCVKTKVPILGVVENMARFVCPNCAHTTLLFPTSTGGAEQMCKDSNLELLAQLPLEPA  277

Query  250  ITECCDKGVPSVIKYPETEYAKSYQKLAESL  280
            + +  D G       P++  AKS+  LAE +
Sbjct  278  LAKALDNGEDFFETNPDSTLAKSFLDLAEKV  308


>NUBP2_DROME unnamed protein product
Length=260

 Score = 139 bits (350),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 83/253 (33%), Positives = 134/253 (53%), Gaps = 8/253 (3%)

Query  36   LPGVTNIVIVASGKGGVGKSTVAVNLAVSLANMGKHVGLLDADIFGPSVPLMMNIHEEPL  95
            L  V N+++V SGKGGVGKSTV+  L+++L   G  VGLLD D+ GPSVP ++ +    +
Sbjct  2    LDKVKNVIVVLSGKGGVGKSTVSTQLSLALRKNGFKVGLLDIDLCGPSVPYLLGLEGRDI  61

Query  96   VDDNNFMIPPI---NYGVKCLSMGLLAK-QTDAIIWRGPLVMSAVQRLLKGAVWSPLDIL  151
               ++  +P     +  +  +S+G L K + D +IWRGP     +++ L    W  LD L
Sbjct  62   FQCDDGWVPVYTDESQTLAVMSIGFLLKNREDPVIWRGPKKTMMIRQFLTDVRWDELDYL  121

Query  152  IVDTPPGTGDVHLSLAQ---NVPIAGVLLVSTPQKAALEVTLRGAQMYRKLGIPIIGLTE  208
            I+DTPPGT D H+++ +    V   G ++V+TPQ+ AL+   +     +K GI I+G+ E
Sbjct  122  IIDTPPGTSDEHITVMECLKEVGCHGAIIVTTPQEVALDDVRKEITFCKKTGINILGIVE  181

Query  209  NMGHAICGNCQTRMEIF-QNATDSFTKQIGTNVLASIPLDGNITECCDKGVPSVIKYPET  267
            NM   +C +C +   IF  N   S         L ++P+D  +          + + P++
Sbjct  182  NMSGFVCPHCTSCTNIFSSNGGVSLATYAQVPHLGTLPIDPRVGILAGTTTSVLDELPDS  241

Query  268  EYAKSYQKLAESL  280
              A+    + E L
Sbjct  242  TTAEVLTHIVEKL  254


>Q57WQ0_TRYB2 unnamed protein product
Length=289

 Score = 137 bits (346),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 88/246 (36%), Positives = 129/246 (52%), Gaps = 28/246 (11%)

Query  36   LPGVTNIVIVASGKGGVGKSTVAVNLAVSLANM-GKHVGLLDADIFGPSVPLMMNI----  90
            L  V +I++V SGKGGVGKSTVA  LA++LAN+ GK VGLLD DI GPSVP +  +    
Sbjct  5    LSDVNHIILVLSGKGGVGKSTVACQLALALANVHGKKVGLLDVDICGPSVPTICGVTGKD  64

Query  91   --------------HEEPLVDDNNFMIPPINYGVKCLSMG-LLAKQTDAIIWRGPLVMSA  135
                          HE+   D            VK +S+  LL  + DA++WRGP   + 
Sbjct  65   VYRGDAGWEPVSLFHEQHEAD----TAASATGNVKIMSIAFLLPSENDAVVWRGPKKDAM  120

Query  136  VQRLLKGAVWSPLDILIVDTPPGTGDVHLSLAQNVP---IAGVLLVSTPQKAALEVTLRG  192
            +++ +    W  LD LI+DTPPGT D HL+L + +     AG ++V+TPQ  A +   + 
Sbjct  121  IRQFVTDVHWGALDYLIIDTPPGTSDEHLTLCEVLKPFNTAGAVIVTTPQDVATDDVKKE  180

Query  193  AQMYRKLGIPIIGLTENMGHAICGNCQTRMEIF-QNATDSFTKQIGTNVLASIPLDGNIT  251
              +  KL +  +G+ ENM   +C +C    +IF +       +      L +IP+D  ++
Sbjct  181  LSLCHKLELRCLGVVENMSGFVCPHCAHCTDIFSKGGGKKLAEMYEVEFLGAIPIDPTLS  240

Query  252  ECCDKG  257
               DKG
Sbjct  241  LAEDKG  246



Lambda      K        H
   0.324    0.139    0.427 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3946317176


Query= XP_011197222.1 deoxynucleotidyltransferase terminal-interacting
protein 2 [Bactrocera dorsalis]

Length=301
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7KML1_DROME  unnamed protein product                                 30.8    1.6  
Q9VQL7_DROME  unnamed protein product                                 30.4    2.1  
B7Z001_DROME  unnamed protein product                                 30.4    2.3  


>Q7KML1_DROME unnamed protein product
Length=898

 Score = 30.8 bits (68),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 29/95 (31%), Positives = 45/95 (47%), Gaps = 13/95 (14%)

Query  52   ENDDEDEDEDYFGLPPPNIDISQIIKEELAKIQTPKSDIEEKLDKLTERIDAVLLQMKEN  111
            +ND++     YFG+   NID   +++  L  I T     EEKL++  E +   + Q  E 
Sbjct  759  DNDNQSYGLAYFGIVLANIDYKALVRL-LIVIPT----WEEKLERFAELMSNEITQPVET  813

Query  112  PVKIRQGRYNKMDFSD-YNPATGKFDVELKVKTDV  145
              K     Y K++ +D Y P        LK+KT+V
Sbjct  814  IKKSATLFYKKLELADGYQPT-------LKLKTNV  841


>Q9VQL7_DROME unnamed protein product
Length=2438

 Score = 30.4 bits (67),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 29/95 (31%), Positives = 45/95 (47%), Gaps = 13/95 (14%)

Query  52    ENDDEDEDEDYFGLPPPNIDISQIIKEELAKIQTPKSDIEEKLDKLTERIDAVLLQMKEN  111
             +ND++     YFG+   NID   +++  L  I T     EEKL++  E +   + Q  E 
Sbjct  2299  DNDNQSYGLAYFGIVLANIDYKALVRL-LIVIPT----WEEKLERFAELMSNEITQPVET  2353

Query  112   PVKIRQGRYNKMDFSD-YNPATGKFDVELKVKTDV  145
               K     Y K++ +D Y P        LK+KT+V
Sbjct  2354  IKKSATLFYKKLELADGYQPT-------LKLKTNV  2381


>B7Z001_DROME unnamed protein product
Length=2540

 Score = 30.4 bits (67),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 29/95 (31%), Positives = 45/95 (47%), Gaps = 13/95 (14%)

Query  52    ENDDEDEDEDYFGLPPPNIDISQIIKEELAKIQTPKSDIEEKLDKLTERIDAVLLQMKEN  111
             +ND++     YFG+   NID   +++  L  I T     EEKL++  E +   + Q  E 
Sbjct  2401  DNDNQSYGLAYFGIVLANIDYKALVRL-LIVIPT----WEEKLERFAELMSNEITQPVET  2455

Query  112   PVKIRQGRYNKMDFSD-YNPATGKFDVELKVKTDV  145
               K     Y K++ +D Y P        LK+KT+V
Sbjct  2456  IKKSATLFYKKLELADGYQPT-------LKLKTNV  2483



Lambda      K        H
   0.324    0.139    0.427 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3946317176


Query= XP_011197223.1 sarcolemmal membrane-associated protein [Bactrocera
dorsalis]

Length=1270
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9W5R5_DROME  unnamed protein product                                 502     5e-160


>Q9W5R5_DROME unnamed protein product
Length=897

 Score = 502 bits (1292),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 287/606 (47%), Positives = 385/606 (64%), Gaps = 80/606 (13%)

Query  233  ITPQALSSALQSVMNASN---NVNAANAA-----VGNLQNTFLNTIGMDIGQAAKELGSA  284
            ++  A++ A+ SV+NA+N    V    A      +G L N+ L        + A E G+ 
Sbjct  128  VSQHAMNMAMNSVLNANNTGVGVRVTTACSLFSPLGVLNNSALQR------EVASECGTL  181

Query  285  FVSGLVEAQTNITNNGSNAVQNIGSSSNASMNLETAEN--NGQAKIILLCEANSHPFQTR  342
             VS +                   S  +  + LE+A     G AKI+LLCE  SH F+TR
Sbjct  182  QVSSVPPT----------------SGVDLDIGLESAPTPCKGAAKIVLLCEPKSHKFETR  225

Query  343  TINLTPNIECKVGRLIAKSKASESNAIFDCKVLSRNHAVLWYTDDCKFWVKDTKSSNGTF  402
            +I L PN +CKVGRLIAKSKA E NAIFDCKVLSRNHA+LWYT D KFWVKDTKSSNGTF
Sbjct  226  SILLQPNQDCKVGRLIAKSKAGEGNAIFDCKVLSRNHAILWYTPDGKFWVKDTKSSNGTF  285

Query  403  INENKLGTEAAELHFGDIVKFGVDVLENSRKEVHGCIIAFVKLYLPDGREAISIDATAQR  462
            IN+NKLG++ AELH+GDIVKFGV+V+ENSR+EVHGCI+A V L+LP+G+EAIS++A  ++
Sbjct  286  INDNKLGSDPAELHYGDIVKFGVEVIENSRQEVHGCILARVALFLPNGQEAISVEA--EQ  343

Query  463  SQYSGEGRISYEEMHRLNLYMQEVSQREKALKSKLFNIQNVLDATRKNSALCWQSLIAED  522
               +   RIS++E+ RL+ ++QE +QREK+LK+KL ++Q VLD TRKNSA+CWQS+I ED
Sbjct  344  MMLTVPNRISFDEVQRLSSFLQEAAQREKSLKAKLSSLQGVLDNTRKNSAMCWQSMITED  403

Query  523  QLLHRINSLEKKLQIMEKNVPESVLRNEVLKLLEDKNSYQLTAKEALRKVYQERCDALQM  582
            QLLH+IN LEKKLQ+MEKN+PE+ LRNE++KLLEDK +YQLTAKEALRKVYQERCDA+QM
Sbjct  404  QLLHKINILEKKLQMMEKNIPENALRNEIVKLLEDKTTYQLTAKEALRKVYQERCDAMQM  463

Query  583  LSKMELAYANSDGECKILRDQIMNTKQSLQDVNTRLQRLETDYNEYKEEAERKQQEIKEQ  642
            LSKME+AYA S+ EC ILR Q++  KQ+L D NTRL+ L+ +Y E+K+E+ R++QE KEQ
Sbjct  464  LSKMEMAYATSENECGILRAQVLTLKQTLTDFNTRLEELQQEYMEFKKESVRQEQEAKEQ  523

Query  643  DEQRLAEMSEKLHQREQECDDLRRRVSEFMLQRAEMVDE--EEKRAIEKLDAAIGDMDLG  700
            + + L  ++ KL  +E E  +LR +VS      +E   E  +E+  ++ LD     ++L 
Sbjct  524  ESRSLEVLNGKLTTQELELKELRLQVSRIHRDLSESDTEHLKERIVLKNLDT----INLD  579

Query  701  D-DDDDDNEVEENDDNEDKFDEGDGEHKEDGNEKDASKKELRSPRVTKSLEIMNGVGTKF  759
            D D   D  + E DDNE   D+                                      
Sbjct  580  DYDHAQDRALNERDDNESSDDD-------------------------------------I  602

Query  760  LHSNDEKEVLNSTSRSDVS-QKEDKQKSNAKESTILKWLQNSDLNQKEGSIDIFKAICND  818
            L  +  K VL+ T +  +     D ++ N K S +L+ L+NSDL + E    + KAI N 
Sbjct  603  LSVSPAKNVLSETKKRKLKLSNPDLEEGNYK-SNVLRLLKNSDLGKGEEGSSVLKAIFNG  661

Query  819  SDSSDE  824
             D + E
Sbjct  662  DDEAFE  667


 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 56/192 (29%), Positives = 96/192 (50%), Gaps = 45/192 (23%)

Query  1078  LEIMQIECDTYKEKLAELSKVVQKACEEKRELEKLLDKRAISVEKEQLQVEQNGATIDEP  1137
             ++++Q ECDTYK+K A L+  +     +   L+K L+K           V+ N AT    
Sbjct  746   IDMLQEECDTYKKKTAHLTSEIHFLQGQIELLKKQLEK----------GVDHNFAT----  791

Query  1138  SDAETKVPVSVAELSTEVGVKETAGTLPERNGVELQNADNKQYSATTLEADFEAQLHDDL  1197
                                ++E   +LP R  +EL   DN+  +        E   ++D+
Sbjct  792   ------------------NLQEEENSLP-RETLEL--IDNRDST--------EGVWNEDI  822

Query  1198  AALNSSALQREEELIVYKERLEKTQSDNLQLRNEIAELLLKSG--TQAQTHMVKQLLAYG  1255
             A +N+  ++ EEELIVYKE LE ++ +N+QLR EI+EL LK      ++  ++ + L  G
Sbjct  823   ATINNPNVENEEELIVYKELLENSELNNMQLRKEISELHLKHKHIPFSKQELLCRFLPLG  882

Query  1256  AVVVAIIVYFIT  1267
              V + +++YF++
Sbjct  883   CVAIGLLIYFLS  894


 Score = 33.5 bits (75),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query  1   MVLASNEWLNNSEDE-QKRTSGSTQTATTANTTNAGNR-DIADTTEVLARTTEITSTNNT  58
           MVL  NEWL N+ DE Q  +S S   A+ A  + A NR    DT   L +TT   S    
Sbjct  1   MVLVCNEWLKNNVDEDQTSSSLSPTPASGAVGSTALNRTGTTDTATELPQTTRYPSGEEP  60

Query  59  AI  60
           A+
Sbjct  61  AV  62



Lambda      K        H
   0.324    0.139    0.427 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3946317176


Query= XP_011197224.1 sarcolemmal membrane-associated protein [Bactrocera
dorsalis]

Length=1270
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9W5R5_DROME  unnamed protein product                                 502     5e-160


>Q9W5R5_DROME unnamed protein product
Length=897

 Score = 502 bits (1292),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 287/606 (47%), Positives = 385/606 (64%), Gaps = 80/606 (13%)

Query  233  ITPQALSSALQSVMNASN---NVNAANAA-----VGNLQNTFLNTIGMDIGQAAKELGSA  284
            ++  A++ A+ SV+NA+N    V    A      +G L N+ L        + A E G+ 
Sbjct  128  VSQHAMNMAMNSVLNANNTGVGVRVTTACSLFSPLGVLNNSALQR------EVASECGTL  181

Query  285  FVSGLVEAQTNITNNGSNAVQNIGSSSNASMNLETAEN--NGQAKIILLCEANSHPFQTR  342
             VS +                   S  +  + LE+A     G AKI+LLCE  SH F+TR
Sbjct  182  QVSSVPPT----------------SGVDLDIGLESAPTPCKGAAKIVLLCEPKSHKFETR  225

Query  343  TINLTPNIECKVGRLIAKSKASESNAIFDCKVLSRNHAVLWYTDDCKFWVKDTKSSNGTF  402
            +I L PN +CKVGRLIAKSKA E NAIFDCKVLSRNHA+LWYT D KFWVKDTKSSNGTF
Sbjct  226  SILLQPNQDCKVGRLIAKSKAGEGNAIFDCKVLSRNHAILWYTPDGKFWVKDTKSSNGTF  285

Query  403  INENKLGTEAAELHFGDIVKFGVDVLENSRKEVHGCIIAFVKLYLPDGREAISIDATAQR  462
            IN+NKLG++ AELH+GDIVKFGV+V+ENSR+EVHGCI+A V L+LP+G+EAIS++A  ++
Sbjct  286  INDNKLGSDPAELHYGDIVKFGVEVIENSRQEVHGCILARVALFLPNGQEAISVEA--EQ  343

Query  463  SQYSGEGRISYEEMHRLNLYMQEVSQREKALKSKLFNIQNVLDATRKNSALCWQSLIAED  522
               +   RIS++E+ RL+ ++QE +QREK+LK+KL ++Q VLD TRKNSA+CWQS+I ED
Sbjct  344  MMLTVPNRISFDEVQRLSSFLQEAAQREKSLKAKLSSLQGVLDNTRKNSAMCWQSMITED  403

Query  523  QLLHRINSLEKKLQIMEKNVPESVLRNEVLKLLEDKNSYQLTAKEALRKVYQERCDALQM  582
            QLLH+IN LEKKLQ+MEKN+PE+ LRNE++KLLEDK +YQLTAKEALRKVYQERCDA+QM
Sbjct  404  QLLHKINILEKKLQMMEKNIPENALRNEIVKLLEDKTTYQLTAKEALRKVYQERCDAMQM  463

Query  583  LSKMELAYANSDGECKILRDQIMNTKQSLQDVNTRLQRLETDYNEYKEEAERKQQEIKEQ  642
            LSKME+AYA S+ EC ILR Q++  KQ+L D NTRL+ L+ +Y E+K+E+ R++QE KEQ
Sbjct  464  LSKMEMAYATSENECGILRAQVLTLKQTLTDFNTRLEELQQEYMEFKKESVRQEQEAKEQ  523

Query  643  DEQRLAEMSEKLHQREQECDDLRRRVSEFMLQRAEMVDE--EEKRAIEKLDAAIGDMDLG  700
            + + L  ++ KL  +E E  +LR +VS      +E   E  +E+  ++ LD     ++L 
Sbjct  524  ESRSLEVLNGKLTTQELELKELRLQVSRIHRDLSESDTEHLKERIVLKNLDT----INLD  579

Query  701  D-DDDDDNEVEENDDNEDKFDEGDGEHKEDGNEKDASKKELRSPRVTKSLEIMNGVGTKF  759
            D D   D  + E DDNE   D+                                      
Sbjct  580  DYDHAQDRALNERDDNESSDDD-------------------------------------I  602

Query  760  LHSNDEKEVLNSTSRSDVS-QKEDKQKSNAKESTILKWLQNSDLNQKEGSIDIFKAICND  818
            L  +  K VL+ T +  +     D ++ N K S +L+ L+NSDL + E    + KAI N 
Sbjct  603  LSVSPAKNVLSETKKRKLKLSNPDLEEGNYK-SNVLRLLKNSDLGKGEEGSSVLKAIFNG  661

Query  819  SDSSDE  824
             D + E
Sbjct  662  DDEAFE  667


 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 56/192 (29%), Positives = 96/192 (50%), Gaps = 45/192 (23%)

Query  1078  LEIMQIECDTYKEKLAELSKVVQKACEEKRELEKLLDKRAISVEKEQLQVEQNGATIDEP  1137
             ++++Q ECDTYK+K A L+  +     +   L+K L+K           V+ N AT    
Sbjct  746   IDMLQEECDTYKKKTAHLTSEIHFLQGQIELLKKQLEK----------GVDHNFAT----  791

Query  1138  SDAETKVPVSVAELSTEVGVKETAGTLPERNGVELQNADNKQYSATTLEADFEAQLHDDL  1197
                                ++E   +LP R  +EL   DN+  +        E   ++D+
Sbjct  792   ------------------NLQEEENSLP-RETLEL--IDNRDST--------EGVWNEDI  822

Query  1198  AALNSSALQREEELIVYKERLEKTQSDNLQLRNEIAELLLKSG--TQAQTHMVKQLLAYG  1255
             A +N+  ++ EEELIVYKE LE ++ +N+QLR EI+EL LK      ++  ++ + L  G
Sbjct  823   ATINNPNVENEEELIVYKELLENSELNNMQLRKEISELHLKHKHIPFSKQELLCRFLPLG  882

Query  1256  AVVVAIIVYFIT  1267
              V + +++YF++
Sbjct  883   CVAIGLLIYFLS  894


 Score = 33.5 bits (75),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query  1   MVLASNEWLNNSEDE-QKRTSGSTQTATTANTTNAGNR-DIADTTEVLARTTEITSTNNT  58
           MVL  NEWL N+ DE Q  +S S   A+ A  + A NR    DT   L +TT   S    
Sbjct  1   MVLVCNEWLKNNVDEDQTSSSLSPTPASGAVGSTALNRTGTTDTATELPQTTRYPSGEEP  60

Query  59  AI  60
           A+
Sbjct  61  AV  62



Lambda      K        H
   0.324    0.139    0.427 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3946317176


Query= XP_011197227.1 uncharacterized protein LOC105221811 [Bactrocera
dorsalis]

Length=418
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8SY21_DROME  unnamed protein product                                 109     4e-26
A0A0B4KG94_DROME  unnamed protein product                             108     6e-26
Q9VGJ6_DROME  unnamed protein product                                 108     8e-26


>Q8SY21_DROME unnamed protein product
Length=415

 Score = 109 bits (272),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 99/419 (24%), Positives = 193/419 (46%), Gaps = 34/419 (8%)

Query  15   PAWLNVAFFENVLKNVETESAKITNLELKPGTLKNDNYSSVLLRAKVNYRLQSQPAQEKV  74
            PAWL+   FE +L+    +  KI +  L+P   K +NY+++LLRA  N+ L+     E+ 
Sbjct  14   PAWLDQQKFEPILERDFPDLKKIKSFRLEPTAGKGENYTTLLLRA--NFELELNDGSEQS  71

Query  75   SSFILKVEPFKEENKKEIMGDYRLFDTEITMYAKVLPMIEKVLRQYGDQTILGPKLIAYS  134
             S++ K+ P      +E +  +++F  E   Y + +P  E++ +  G +   GP+     
Sbjct  72   ISYMAKILP--NSGNRENVASWKVFYKERNTYGQYIPEFEQMYKDAGKKISFGPRYYESQ  129

Query  135  T-VAPAYVIFEDLALKGYSTIGYRHP-DLEEIKITLLKLAKLHAVSYKLCKEEEDNIITT  192
              +    ++ EDL  +G+  +  ++  D++  + TL KLA+ HA S           +  
Sbjct  130  IELDDELIVLEDLGKRGFRNVDRKNGLDIQHTEATLEKLAQFHAAS----------AVRF  179

Query  193  LNKGLMNSGDPNNLPAIKNGITFLKEVLSKHDDLKRFV--------PHIESVEHLLLAKT  244
              KG        NL ++ + +  L+E     + LK ++         H+ +      ++ 
Sbjct  180  ELKGSYPEEYNQNLCSVVDSLKELRE-----NQLKAYIDAFPLYDASHLTNDVQAYGSQA  234

Query  245  IDLFNEGSRGKRDGIFVLNHGDFHLKNIMIQKN-GDKLTDVMPLDYQISIFGSPAIDLHF  303
             D+F   +        VLNHGD    NIM Q +   KL +V  +D Q+S F SPA DL +
Sbjct  235  DDMFQSFAPKIEGEFRVLNHGDAWCNNIMYQYDEAGKLAEVNFVDLQMSRFSSPAQDLLY  294

Query  304  AFTVMFSPELRRDHHDELLYFYIKNFQDTLRKTEYKGHIPTHLEIRQELAKHRYWGLFLL  363
                    +++    D L+ FY +   ++L+  +Y   +P+   + Q +  +  W L ++
Sbjct  295  LILSSTELDIKIAKFDYLIKFYHEKLIESLKLLKYPKPLPSLRSLHQSIFIYGDWILPIV  354

Query  364  LVFLIFNYTFIKENIDITDVIE----NPEVQRRELENPRLLEELRELLPRFLYKGYFEI  418
             + L        ++ ++  +++      +++    +N R+++  +E+LP    +G FEI
Sbjct  355  SILLPLVLIDGGDDANMDSLMDGEGAGDKIRNNMFKNHRVIKHQKEILPWAHRRGAFEI  413


>A0A0B4KG94_DROME unnamed protein product
Length=415

 Score = 108 bits (271),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 99/419 (24%), Positives = 193/419 (46%), Gaps = 34/419 (8%)

Query  15   PAWLNVAFFENVLKNVETESAKITNLELKPGTLKNDNYSSVLLRAKVNYRLQSQPAQEKV  74
            PAWL+   FE +L+    +  KI +  L+P   K +NY+++LLRA  N+ L+     E+ 
Sbjct  14   PAWLDQQKFEPILERDFPDLKKIKSFRLEPTAGKGENYTTLLLRA--NFELELNDGSEQS  71

Query  75   SSFILKVEPFKEENKKEIMGDYRLFDTEITMYAKVLPMIEKVLRQYGDQTILGPKLIAYS  134
             S++ K+ P      +E +  +++F  E   Y + +P  E++ +  G +   GP+     
Sbjct  72   ISYMAKILP--NSGNRENVASWKVFYKERNTYGQYIPEFEQMYKDAGKKISFGPRYYESQ  129

Query  135  T-VAPAYVIFEDLALKGYSTIGYRHP-DLEEIKITLLKLAKLHAVSYKLCKEEEDNIITT  192
              +    ++ EDL  +G+  +  ++  D++  + TL KLA+ HA S           +  
Sbjct  130  IELDDELIVLEDLGKRGFRNVDRQNGLDIQHTEATLEKLAQFHAAS----------AVRF  179

Query  193  LNKGLMNSGDPNNLPAIKNGITFLKEVLSKHDDLKRFV--------PHIESVEHLLLAKT  244
              KG        NL ++ + +  L+E     + LK ++         H+ +      ++ 
Sbjct  180  ELKGSYPEEYNQNLCSVVDSLKELRE-----NQLKAYIDAFPLYDASHLTNDVQAYGSQA  234

Query  245  IDLFNEGSRGKRDGIFVLNHGDFHLKNIMIQKN-GDKLTDVMPLDYQISIFGSPAIDLHF  303
             D+F   +        VLNHGD    NIM Q +   KL +V  +D Q+S F SPA DL +
Sbjct  235  DDMFQSFAPKIEGEFRVLNHGDAWCNNIMYQYDEAGKLAEVNFVDLQMSRFSSPAQDLLY  294

Query  304  AFTVMFSPELRRDHHDELLYFYIKNFQDTLRKTEYKGHIPTHLEIRQELAKHRYWGLFLL  363
                    +++    D L+ FY +   ++L+  +Y   +P+   + Q +  +  W L ++
Sbjct  295  LILSSTELDIKIAKFDYLIKFYHEKLIESLKLLKYPKPLPSLRSLHQSIFIYGDWILPIV  354

Query  364  LVFLIFNYTFIKENIDITDVIE----NPEVQRRELENPRLLEELRELLPRFLYKGYFEI  418
             + L        ++ ++  +++      +++    +N R+++  +E+LP    +G FEI
Sbjct  355  SILLPLVLIDGGDDANMDSLMDGEGAGDKIRNNMFKNHRVIKHQKEILPWAHRRGAFEI  413


>Q9VGJ6_DROME unnamed protein product
Length=449

 Score = 108 bits (271),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 99/419 (24%), Positives = 193/419 (46%), Gaps = 34/419 (8%)

Query  15   PAWLNVAFFENVLKNVETESAKITNLELKPGTLKNDNYSSVLLRAKVNYRLQSQPAQEKV  74
            PAWL+   FE +L+    +  KI +  L+P   K +NY+++LLRA  N+ L+     E+ 
Sbjct  48   PAWLDQQKFEPILERDFPDLKKIKSFRLEPTAGKGENYTTLLLRA--NFELELNDGSEQS  105

Query  75   SSFILKVEPFKEENKKEIMGDYRLFDTEITMYAKVLPMIEKVLRQYGDQTILGPKLIAYS  134
             S++ K+ P      +E +  +++F  E   Y + +P  E++ +  G +   GP+     
Sbjct  106  ISYMAKILP--NSGNRENVASWKVFYKERNTYGQYIPEFEQMYKDAGKKISFGPRYYESQ  163

Query  135  T-VAPAYVIFEDLALKGYSTIGYRHP-DLEEIKITLLKLAKLHAVSYKLCKEEEDNIITT  192
              +    ++ EDL  +G+  +  ++  D++  + TL KLA+ HA S           +  
Sbjct  164  IELDDELIVLEDLGKRGFRNVDRQNGLDIQHTEATLEKLAQFHAAS----------AVRF  213

Query  193  LNKGLMNSGDPNNLPAIKNGITFLKEVLSKHDDLKRFV--------PHIESVEHLLLAKT  244
              KG        NL ++ + +  L+E     + LK ++         H+ +      ++ 
Sbjct  214  ELKGSYPEEYNQNLCSVVDSLKELRE-----NQLKAYIDAFPLYDASHLTNDVQAYGSQA  268

Query  245  IDLFNEGSRGKRDGIFVLNHGDFHLKNIMIQKN-GDKLTDVMPLDYQISIFGSPAIDLHF  303
             D+F   +        VLNHGD    NIM Q +   KL +V  +D Q+S F SPA DL +
Sbjct  269  DDMFQSFAPKIEGEFRVLNHGDAWCNNIMYQYDEAGKLAEVNFVDLQMSRFSSPAQDLLY  328

Query  304  AFTVMFSPELRRDHHDELLYFYIKNFQDTLRKTEYKGHIPTHLEIRQELAKHRYWGLFLL  363
                    +++    D L+ FY +   ++L+  +Y   +P+   + Q +  +  W L ++
Sbjct  329  LILSSTELDIKIAKFDYLIKFYHEKLIESLKLLKYPKPLPSLRSLHQSIFIYGDWILPIV  388

Query  364  LVFLIFNYTFIKENIDITDVIE----NPEVQRRELENPRLLEELRELLPRFLYKGYFEI  418
             + L        ++ ++  +++      +++    +N R+++  +E+LP    +G FEI
Sbjct  389  SILLPLVLIDGGDDANMDSLMDGEGAGDKIRNNMFKNHRVIKHQKEILPWAHRRGAFEI  447



Lambda      K        H
   0.324    0.139    0.427 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3946317176


Query= XP_011197228.2 uncharacterized protein LOC105221810 [Bactrocera
dorsalis]

Length=450
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9V4E6_DROME  unnamed protein product                                 318     2e-101
Q8SZQ4_DROME  unnamed protein product                                 278     2e-86 
DECA_DROME  unnamed protein product                                   74.7    4e-14 


>Q9V4E6_DROME unnamed protein product
Length=701

 Score = 318 bits (814),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 190/465 (41%), Positives = 265/465 (57%), Gaps = 59/465 (13%)

Query  10   INISQREYVTKYREYLRRVHDRKRRELAQLTYAIRNKVEQELESAPLRIVSIAPNVTK--  67
            +NISQ EY +KY EYL R+   + +  +     +     ++L       +SI  N     
Sbjct  272  VNISQAEYSSKYIEYLSRLRSNQEKGNSYFNNFMGASFTRDLH-----FLSITTNGFNDI  326

Query  68   YDTYLRQKRNTQTFLNNFPHTKHEVTDAETVSNNFVLPRQQRNNNRKFRQKQTTM--ILH  125
             +  LR +R+ +                  ++ N   P++ +N     R +Q TM  +LH
Sbjct  327  SNKRLRHRRSLKKI--------------NRLNQN---PKKHQNYGDLLRGEQDTMNILLH  369

Query  126  FALETNA--AQLQPGDVEEANIRLMVIHSSALAVK----PNKRKQKSKNRSCGSSVEK-S  178
            F L TNA  A      ++EAN+RLM+++SS+LA      P  RK K    S   ++E+  
Sbjct  370  FPL-TNAQDANFHHDKIDEANVRLMLLYSSSLATNFRRGPGSRKNKISQISGNDNIERHC  428

Query  179  GKGHANTTAANDKQKHLLNLKVYQRLGNGKRVCLDSSKVNIEIDHSRKYDTHSQWVQFDV  238
              G  N   +N      L LKVYQ L   +R  + S K  IE  +    +T +QW++FDV
Sbjct  429  NFGDVNLNQSNKNSSQQLTLKVYQLLSANRRRKITSRK--IEFGNVGFQETRTQWIEFDV  486

Query  239  TKAVETWLREERSNLGLEVQCDNCQRVGARILNDMS--SPTNVDDVDADGAQLMPILNII  296
            TKAV +WL +   NLG+E+QCD C+ +GARIL+D S  +P        +   LMP+LNII
Sbjct  487  TKAVRSWLNKSHENLGIEIQCDKCKSIGARILSDFSPSTPPRSTASSDEHLNLMPVLNII  546

Query  297  GHLGVSYKE---------IRSNKHSNSVEKSRHYHNVATFLNGQQRPSGAIDKLS--CHK  345
            GH  ++ ++         + +N  S+     R  H+           +   DK +  C+K
Sbjct  547  GHGTLNSQQHGDADIHQIMLTNNRSDQYVHHRSNHD----------STWRKDKWTNNCYK  596

Query  346  FNQRCCRHTMEVIFKEIKGFEFIIQPKVFDAGYCHGRCPPRYNPAHHHAMLQSLIWKQNR  405
             +QRCCR+ ++V FK IKGFEFI+QPKVFDAGYCHGRCPPR+NPAHHHA+LQSLIW+++ 
Sbjct  597  LHQRCCRNQLDVAFKSIKGFEFILQPKVFDAGYCHGRCPPRHNPAHHHALLQSLIWQEDH  656

Query  406  ERAPRPCCAPSKLVELEVLHVDEKDSEKLKISTWTDMRVVECACS  450
            +RAPRPCC PSKL  LE+LHVDE  S+KLKISTW+DM+VVECACS
Sbjct  657  KRAPRPCCTPSKLEMLEILHVDENHSDKLKISTWSDMQVVECACS  701


>Q8SZQ4_DROME unnamed protein product
Length=695

 Score = 278 bits (711),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 174/449 (39%), Positives = 245/449 (55%), Gaps = 59/449 (13%)

Query  12   ISQREYVTKYREYLRRVHDRKRRELAQLTYAIRNKVEQELESAPLRIVSIAPNVTK--YD  69
            ISQ EY +KY EYL R+   + +  +     +     ++L       +SI  N      +
Sbjct  274  ISQAEYSSKYIEYLSRLRSNQEKGNSYFNNFMGASFTRDLH-----FLSITTNGFNDISN  328

Query  70   TYLRQKRNTQTFLNNFPHTKHEVTDAETVSNNFVLPRQQRNNNRKFRQKQTTM--ILHFA  127
              LR +R+ +                  ++ N   P++ +N     R +Q TM  +LHF 
Sbjct  329  KRLRHRRSLKKI--------------NRLNQN---PKKHQNYGDLLRGEQDTMNILLHFP  371

Query  128  LETNA--AQLQPGDVEEANIRLMVIHSSALAVK----PNKRKQKSKNRSCGSSVEK-SGK  180
            L TNA  A      ++EAN+RLM+++SS+LA      P  RK K    S   ++E+    
Sbjct  372  L-TNAQDANFHHDKIDEANVRLMLLYSSSLATNFRRGPGSRKNKISQVSGNDNIERHCNF  430

Query  181  GHANTTAANDKQKHLLNLKVYQRLGNGKRVCLDSSKVNIEIDHSRKYDTHSQWVQFDVTK  240
            G  N   +N      L LKVYQ L   +R  + S K  IE  +    +T +QW++FDVTK
Sbjct  431  GDVNLNQSNKNSSQQLTLKVYQLLSANRRRKITSRK--IEFGNVGFQETRTQWIEFDVTK  488

Query  241  AVETWLREERSNLGLEVQCDNCQRVGARILNDMS--SPTNVDDVDADGAQLMPILNIIGH  298
            AV +WL +   NLG+E+QCD C+ +GARIL+D S  +P        +   LMP+LNIIGH
Sbjct  489  AVRSWLNKSHENLGIEIQCDKCKSIGARILSDFSPSTPPRSTASSDEHLNLMPVLNIIGH  548

Query  299  LGVSYKE---------IRSNKHSNSVEKSRHYHNVATFLNGQQRPSGAIDKLS--CHKFN  347
              ++ ++         + +N  S+     R  H+           +   DK +  C+K +
Sbjct  549  GTLNSQQHGDADIRQIMLTNNRSDQYVHHRSNHD----------STWRKDKWTNNCYKLH  598

Query  348  QRCCRHTMEVIFKEIKGFEFIIQPKVFDAGYCHGRCPPRYNPAHHHAMLQSLIWKQNRER  407
            QRCCR+ ++V FK IKGFEFI+QPKVFDAGYCHGRCPPR+NPAHHHA+LQSLIW+++ +R
Sbjct  599  QRCCRNQLDVAFKSIKGFEFILQPKVFDAGYCHGRCPPRHNPAHHHALLQSLIWQEDHKR  658

Query  408  APRPCCAPSKLVELEVLHVDEKDSEKLKI  436
            APRPCC PSKL  LE+LHVDE  S   K 
Sbjct  659  APRPCCTPSKLEMLEILHVDENHSTNSKF  687


>DECA_DROME unnamed protein product
Length=588

 Score = 74.7 bits (182),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 63/105 (60%), Gaps = 9/105 (9%)

Query  350  CCRHTMEVIFKEIKGFEFIIQPKVFDAGYCHGRCPPRYNPAHH-----HAMLQSLIWKQN  404
            C RH++ V F ++   ++I+ P  +DA YCHG+CP  +  A H     HA++Q+L+   N
Sbjct  487  CRRHSLYVDFSDVGWDDWIVAPLGYDAYYCHGKCP--FPLADHFNSTNHAVVQTLVNNMN  544

Query  405  RERAPRPCCAPSKLVELEVLHVDEKDSEKLKISTWTDMRVVECAC  449
              + P+ CC P++L  + +L+++++ +  LK   + +M VV C C
Sbjct  545  PGKVPKACCVPTQLDSVAMLYLNDQSTVVLK--NYQEMTVVGCGC  587



Lambda      K        H
   0.324    0.139    0.427 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3946317176


Query= XP_011197229.1 serine/threonine-protein kinase GL21140 [Bactrocera
dorsalis]

Length=747
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DCLK_CAEEL  unnamed protein product                                   400     7e-128
CMK1_CAEEL  unnamed protein product                                   226     2e-67 
MYLKA_DICDI  unnamed protein product                                  212     7e-63 


>DCLK_CAEEL unnamed protein product
Length=802

 Score = 400 bits (1027),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 238/674 (35%), Positives = 369/674 (55%), Gaps = 91/674 (14%)

Query  78   SNGSLSGASTTSSTTGLTTSVTTAAAAAGIKTTSSTEALINGNGADATNTTINTLAVSQV  137
            S GS+  + T ++   +T+SV                    G   D    + + ++  Q 
Sbjct  150  SQGSMPNSGTNTAEASMTSSVCAMET--------------EGTNGDELAESRDMVSEMQR  195

Query  138  KKRISSSRTP-TRKARRIKFYRNGDRFYPGITIPVSNERYRSFESLFEDLTR-LLEDNVK  195
            + RI  S  P   KA+R++FYRNGD+++ GI   + ++R +S + L EDL + ++ D+  
Sbjct  196  RCRIGPSGYPHLLKAKRLRFYRNGDQYFKGIQYALQSDRVKSMQPLMEDLMKTVICDSTA  255

Query  196  IPGAVRTIYTMCG-KKISTLDELEDGQSYICSCNNENFKKIEYNTSSQPLANLTLSNKTN  254
            +P  +R I+T+ G ++I+++D+ EDG  Y+CS + + FK ++Y+ +++P   LTL+N+ N
Sbjct  256  LPHGIRHIFTIDGAQRITSVDQFEDGGGYVCS-STDAFKPVDYSRAAEPSWRLTLANRYN  314

Query  255  NRLSKAYRPSSPLKNGTATYNSGGGGVAGGGVTGNGTNATAGATNGSPVLKLSERDRVVH  314
              L                                 T   A     S V    E    V 
Sbjct  315  RHLE--------------------------------TKKLAL----SVVEPCHENTDFVF  338

Query  315  PRIVTLIRNGTKPRTIMRLLLNKRNSPSFDHVLTAITQVVRLDTGYVRKVFTLSGSPVVQ  374
            PRI+ +IRNG KPR I R LLNK+ + SFD VL  +T VV+LD+G +RK+FTLSG PV+ 
Sbjct  339  PRIIKVIRNGVKPRRISRHLLNKKTARSFDQVLRDLTFVVKLDSGAIRKLFTLSGRPVLS  398

Query  375  LADFFGPDDIFFAYGTERVNNPDDFKLEPDEHKAIQA-----IRKSLRTAGTTYKGPKPK  429
            L DFF  DD+F AYG       DD  +  +EHK++ +     +R++ R         +  
Sbjct  399  LQDFFRDDDVFVAYGGNEKMAADDLLVASEEHKSVGSGTSSNMRRTSR---------RST  449

Query  430  MPVKSKNLNSAKHQQNHQQEPCDQIVDEDLAALNESGIDASELPGVIRERYALGQIIGDG  489
            MP ++++L   +H ++    P DQ              D   LP ++ E++ L ++IGDG
Sbjct  450  MPNRNESL---RHDRSGSVIP-DQ--------------DQQRLPPLLDEKFQLVRLIGDG  491

Query  490  NFAVVLKIKDRQSGLPY-ALKIIDKSKCKGKEHYIDAEVRVMKKLQHPHIISLIMDVDQQ  548
            N AVV ++ D+ +     A+K+I +    GKEH I+ E+ +++K+ H  I+ L       
Sbjct  492  NTAVVYEVIDKTNNDDRKAMKVIARENVIGKEHLIEMELAILQKIDHTFIVQLYDHWFVD  551

Query  549  ANMYLVLEYVSGGDLFDAITRVTRFSENQSRVMIKHLASAMAYLHSMSIVHRDIKPENLL  608
             + YL LE +  GDLF+ +  V R  E  +  M+  L  A+ Y+H + IVHRD+K ENLL
Sbjct  552  DSYYLSLELIEMGDLFEHLRIVRRVPERDAVRMMTCLGQALEYIHELGIVHRDVKLENLL  611

Query  609  VELDANGYVTELKLADFGLACEVTEP---LFAVCGTPTYVAPEILMETGYGLKIDVWAAG  665
            +  D  G +  +KLADFGLA E+ +    L  +CGTPTYVAPE+L +TGYG K+D+WAAG
Sbjct  612  IVKDEFGELG-VKLADFGLAAEMPKDFGVLSTICGTPTYVAPEVLNKTGYGCKVDIWAAG  670

Query  666  IILYILLCGFPPFVSPDNQQEPLFDAIISGVYEFPEPYWSDIGDGVRDLIANMLQSDPEV  725
            +ILY +L GFPPF S D  ++ LF AI+SG + FP P W D+   VR LI  ++ +DP  
Sbjct  671  VILYAILVGFPPFQSSDGSEQDLFSAIMSGEFSFPSPSWDDVSWSVRHLIMCLIHTDPFH  730

Query  726  RFTSEDILDHYWTL  739
            R+++ ++L+  W +
Sbjct  731  RYSAGELLNDEWMV  744


>CMK1_CAEEL unnamed protein product
Length=348

 Score = 226 bits (577),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/270 (41%), Positives = 165/270 (61%), Gaps = 8/270 (3%)

Query  474  GVIRERYALGQIIGDGNFAVVLKIKDR-QSGLPYALKIIDKSKCKGKEHYIDAEVRVMKK  532
              IRE+Y    ++G G F+ V   + +  +G  YA+K IDK   KGKE  ++ E++V++K
Sbjct  16   ATIREKYDFRDVLGTGAFSKVFLAESKSDAGQMYAVKCIDKKALKGKEESLENEIKVLRK  75

Query  533  LQHPHIISLIMDVDQQANMYLVLEYVSGGDLFDAITRVTRFSENQSRVMIKHLASAMAYL  592
            L+H +I+ L    D++  +YLV+E V+GG+LFD I     ++E  +  +I+ +  A+ ++
Sbjct  76   LRHNNIVQLFDTYDEKQFVYLVMELVTGGELFDRIVAKGSYTEQDASNLIRQVLEAVGFM  135

Query  593  HSMSIVHRDIKPENLL-VELDANGYVTELKLADFGLA-CEVTEPLFAVCGTPTYVAPEIL  650
            H   +VHRD+KPENLL    D +   +++ ++DFGL+  E +  +   CGTP YVAPE+L
Sbjct  136  HDNGVVHRDLKPENLLYYNQDED---SKIMISDFGLSKTEDSGVMATACGTPGYVAPEVL  192

Query  651  METGYGLKIDVWAAGIILYILLCGFPPFVSPDNQQEPLFDAIISGVYEFPEPYWSDIGDG  710
             +  YG  +DVW+ G+I YILLCG+PPF   D     LF  II G YEF  PYW  I D 
Sbjct  193  QQKPYGKAVDVWSIGVIAYILLCGYPPFY--DESDANLFAQIIKGEYEFDAPYWDQISDS  250

Query  711  VRDLIANMLQSDPEVRFTSEDILDHYWTLG  740
             +D I +++  DPE RFT +D L H W  G
Sbjct  251  AKDFITHLMCCDPEARFTCQDALSHPWISG  280


>MYLKA_DICDI unnamed protein product
Length=295

 Score = 212 bits (540),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 109/265 (41%), Positives = 164/265 (62%), Gaps = 7/265 (3%)

Query  476  IRERYALGQIIGDGNFAVVLKIKDRQSGLPYALKIIDKSKC-KGKEHYIDAEVRVMKKLQ  534
            + + Y   + +G G F++V   +++Q+   YA+K+I+KS+  K  E  +  EV ++KK+ 
Sbjct  4    VEKIYEFKEELGRGAFSIVYLGENKQTKQRYAIKVINKSELGKDYEKNLKMEVDILKKVN  63

Query  535  HPHIISLIMDVDQQANMYLVLEYVSGGDLFDAITRVTRFSENQSRVMIKHLASAMAYLHS  594
            HP+II+L    D    +YLV+E V+GG+LFD I     +SE  +  ++K + SA+ YLH 
Sbjct  64   HPNIIALKELFDTPEKLYLVMELVTGGELFDKIVEKGSYSEADAANLVKKIVSAVGYLHG  123

Query  595  MSIVHRDIKPENLLVELDANGYVTELKLADFGLACEVTEPLF--AVCGTPTYVAPEILME  652
            ++IVHRD+KPENLL++   N    E+ +ADFGL+  + + L     CGTP+YVAPE+L  
Sbjct  124  LNIVHRDLKPENLLLKSKENH--LEVAIADFGLSKIIGQTLVMQTACGTPSYVAPEVLNA  181

Query  653  TGYGLKIDVWAAGIILYILLCGFPPFVSPDNQQEPLFDAIISGVYEFPEPYWSDIGDGVR  712
            TGY  ++D+W+ G+I YILLCGFPPF   D   E +F+ I+   YEFPE YW  I    +
Sbjct  182  TGYDKEVDMWSIGVITYILLCGFPPFYG-DTVPE-IFEQIMEANYEFPEEYWGGISKEAK  239

Query  713  DLIANMLQSDPEVRFTSEDILDHYW  737
            D I  +L  D   R  + + L+H W
Sbjct  240  DFIGKLLVVDVSKRLNATNALNHPW  264



Lambda      K        H
   0.324    0.139    0.427 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3946317176


Query= XP_011197230.1 serine/threonine-protein kinase GL21140 [Bactrocera
dorsalis]

Length=747
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DCLK_CAEEL  unnamed protein product                                   400     7e-128
CMK1_CAEEL  unnamed protein product                                   226     2e-67 
MYLKA_DICDI  unnamed protein product                                  212     7e-63 


>DCLK_CAEEL unnamed protein product
Length=802

 Score = 400 bits (1027),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 238/674 (35%), Positives = 369/674 (55%), Gaps = 91/674 (14%)

Query  78   SNGSLSGASTTSSTTGLTTSVTTAAAAAGIKTTSSTEALINGNGADATNTTINTLAVSQV  137
            S GS+  + T ++   +T+SV                    G   D    + + ++  Q 
Sbjct  150  SQGSMPNSGTNTAEASMTSSVCAMET--------------EGTNGDELAESRDMVSEMQR  195

Query  138  KKRISSSRTP-TRKARRIKFYRNGDRFYPGITIPVSNERYRSFESLFEDLTR-LLEDNVK  195
            + RI  S  P   KA+R++FYRNGD+++ GI   + ++R +S + L EDL + ++ D+  
Sbjct  196  RCRIGPSGYPHLLKAKRLRFYRNGDQYFKGIQYALQSDRVKSMQPLMEDLMKTVICDSTA  255

Query  196  IPGAVRTIYTMCG-KKISTLDELEDGQSYICSCNNENFKKIEYNTSSQPLANLTLSNKTN  254
            +P  +R I+T+ G ++I+++D+ EDG  Y+CS + + FK ++Y+ +++P   LTL+N+ N
Sbjct  256  LPHGIRHIFTIDGAQRITSVDQFEDGGGYVCS-STDAFKPVDYSRAAEPSWRLTLANRYN  314

Query  255  NRLSKAYRPSSPLKNGTATYNSGGGGVAGGGVTGNGTNATAGATNGSPVLKLSERDRVVH  314
              L                                 T   A     S V    E    V 
Sbjct  315  RHLE--------------------------------TKKLAL----SVVEPCHENTDFVF  338

Query  315  PRIVTLIRNGTKPRTIMRLLLNKRNSPSFDHVLTAITQVVRLDTGYVRKVFTLSGSPVVQ  374
            PRI+ +IRNG KPR I R LLNK+ + SFD VL  +T VV+LD+G +RK+FTLSG PV+ 
Sbjct  339  PRIIKVIRNGVKPRRISRHLLNKKTARSFDQVLRDLTFVVKLDSGAIRKLFTLSGRPVLS  398

Query  375  LADFFGPDDIFFAYGTERVNNPDDFKLEPDEHKAIQA-----IRKSLRTAGTTYKGPKPK  429
            L DFF  DD+F AYG       DD  +  +EHK++ +     +R++ R         +  
Sbjct  399  LQDFFRDDDVFVAYGGNEKMAADDLLVASEEHKSVGSGTSSNMRRTSR---------RST  449

Query  430  MPVKSKNLNSAKHQQNHQQEPCDQIVDEDLAALNESGIDASELPGVIRERYALGQIIGDG  489
            MP ++++L   +H ++    P DQ              D   LP ++ E++ L ++IGDG
Sbjct  450  MPNRNESL---RHDRSGSVIP-DQ--------------DQQRLPPLLDEKFQLVRLIGDG  491

Query  490  NFAVVLKIKDRQSGLPY-ALKIIDKSKCKGKEHYIDAEVRVMKKLQHPHIISLIMDVDQQ  548
            N AVV ++ D+ +     A+K+I +    GKEH I+ E+ +++K+ H  I+ L       
Sbjct  492  NTAVVYEVIDKTNNDDRKAMKVIARENVIGKEHLIEMELAILQKIDHTFIVQLYDHWFVD  551

Query  549  ANMYLVLEYVSGGDLFDAITRVTRFSENQSRVMIKHLASAMAYLHSMSIVHRDIKPENLL  608
             + YL LE +  GDLF+ +  V R  E  +  M+  L  A+ Y+H + IVHRD+K ENLL
Sbjct  552  DSYYLSLELIEMGDLFEHLRIVRRVPERDAVRMMTCLGQALEYIHELGIVHRDVKLENLL  611

Query  609  VELDANGYVTELKLADFGLACEVTEP---LFAVCGTPTYVAPEILMETGYGLKIDVWAAG  665
            +  D  G +  +KLADFGLA E+ +    L  +CGTPTYVAPE+L +TGYG K+D+WAAG
Sbjct  612  IVKDEFGELG-VKLADFGLAAEMPKDFGVLSTICGTPTYVAPEVLNKTGYGCKVDIWAAG  670

Query  666  IILYILLCGFPPFVSPDNQQEPLFDAIISGVYEFPEPYWSDIGDGVRDLIANMLQSDPEV  725
            +ILY +L GFPPF S D  ++ LF AI+SG + FP P W D+   VR LI  ++ +DP  
Sbjct  671  VILYAILVGFPPFQSSDGSEQDLFSAIMSGEFSFPSPSWDDVSWSVRHLIMCLIHTDPFH  730

Query  726  RFTSEDILDHYWTL  739
            R+++ ++L+  W +
Sbjct  731  RYSAGELLNDEWMV  744


>CMK1_CAEEL unnamed protein product
Length=348

 Score = 226 bits (577),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/270 (41%), Positives = 165/270 (61%), Gaps = 8/270 (3%)

Query  474  GVIRERYALGQIIGDGNFAVVLKIKDR-QSGLPYALKIIDKSKCKGKEHYIDAEVRVMKK  532
              IRE+Y    ++G G F+ V   + +  +G  YA+K IDK   KGKE  ++ E++V++K
Sbjct  16   ATIREKYDFRDVLGTGAFSKVFLAESKSDAGQMYAVKCIDKKALKGKEESLENEIKVLRK  75

Query  533  LQHPHIISLIMDVDQQANMYLVLEYVSGGDLFDAITRVTRFSENQSRVMIKHLASAMAYL  592
            L+H +I+ L    D++  +YLV+E V+GG+LFD I     ++E  +  +I+ +  A+ ++
Sbjct  76   LRHNNIVQLFDTYDEKQFVYLVMELVTGGELFDRIVAKGSYTEQDASNLIRQVLEAVGFM  135

Query  593  HSMSIVHRDIKPENLL-VELDANGYVTELKLADFGLA-CEVTEPLFAVCGTPTYVAPEIL  650
            H   +VHRD+KPENLL    D +   +++ ++DFGL+  E +  +   CGTP YVAPE+L
Sbjct  136  HDNGVVHRDLKPENLLYYNQDED---SKIMISDFGLSKTEDSGVMATACGTPGYVAPEVL  192

Query  651  METGYGLKIDVWAAGIILYILLCGFPPFVSPDNQQEPLFDAIISGVYEFPEPYWSDIGDG  710
             +  YG  +DVW+ G+I YILLCG+PPF   D     LF  II G YEF  PYW  I D 
Sbjct  193  QQKPYGKAVDVWSIGVIAYILLCGYPPFY--DESDANLFAQIIKGEYEFDAPYWDQISDS  250

Query  711  VRDLIANMLQSDPEVRFTSEDILDHYWTLG  740
             +D I +++  DPE RFT +D L H W  G
Sbjct  251  AKDFITHLMCCDPEARFTCQDALSHPWISG  280


>MYLKA_DICDI unnamed protein product
Length=295

 Score = 212 bits (540),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 109/265 (41%), Positives = 164/265 (62%), Gaps = 7/265 (3%)

Query  476  IRERYALGQIIGDGNFAVVLKIKDRQSGLPYALKIIDKSKC-KGKEHYIDAEVRVMKKLQ  534
            + + Y   + +G G F++V   +++Q+   YA+K+I+KS+  K  E  +  EV ++KK+ 
Sbjct  4    VEKIYEFKEELGRGAFSIVYLGENKQTKQRYAIKVINKSELGKDYEKNLKMEVDILKKVN  63

Query  535  HPHIISLIMDVDQQANMYLVLEYVSGGDLFDAITRVTRFSENQSRVMIKHLASAMAYLHS  594
            HP+II+L    D    +YLV+E V+GG+LFD I     +SE  +  ++K + SA+ YLH 
Sbjct  64   HPNIIALKELFDTPEKLYLVMELVTGGELFDKIVEKGSYSEADAANLVKKIVSAVGYLHG  123

Query  595  MSIVHRDIKPENLLVELDANGYVTELKLADFGLACEVTEPLF--AVCGTPTYVAPEILME  652
            ++IVHRD+KPENLL++   N    E+ +ADFGL+  + + L     CGTP+YVAPE+L  
Sbjct  124  LNIVHRDLKPENLLLKSKENH--LEVAIADFGLSKIIGQTLVMQTACGTPSYVAPEVLNA  181

Query  653  TGYGLKIDVWAAGIILYILLCGFPPFVSPDNQQEPLFDAIISGVYEFPEPYWSDIGDGVR  712
            TGY  ++D+W+ G+I YILLCGFPPF   D   E +F+ I+   YEFPE YW  I    +
Sbjct  182  TGYDKEVDMWSIGVITYILLCGFPPFYG-DTVPE-IFEQIMEANYEFPEEYWGGISKEAK  239

Query  713  DLIANMLQSDPEVRFTSEDILDHYW  737
            D I  +L  D   R  + + L+H W
Sbjct  240  DFIGKLLVVDVSKRLNATNALNHPW  264



Lambda      K        H
   0.324    0.139    0.427 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3946317176


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jan 6, 2022  1:11 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_011197233.1 beta-1,3-galactosyltransferase 6 [Bactrocera
dorsalis]

Length=389
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A1Z7G9_DROME  unnamed protein product                                 403     1e-139
SQV2_CAEEL  unnamed protein product                                   150     3e-42 
A1Z8R6_DROME  unnamed protein product                                 57.0    1e-08 


>A1Z7G9_DROME unnamed protein product
Length=382

 Score = 403 bits (1035),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 202/390 (52%), Positives = 279/390 (72%), Gaps = 11/390 (3%)

Query  1    MRRMNNLITLFTAMVAFFFGCFLSNMLNNAEKCLTHKSGVSRIDPHPDIFLMILVISAPQ  60
            MRR+NNL+T FTA+ AFFFG FL+ +L++ ++C  H+S +  ++PHP++FLM+LV+SAP 
Sbjct  1    MRRLNNLVTFFTAITAFFFGSFLTKILSSVDQCPAHRSRIPHLEPHPNLFLMVLVLSAPH  60

Query  61   NVNRRLTMRQTWL-RLGQPLDMTYYPENLVYMPKYDESGHLQMETVSDQSNRLAAYLHWY  119
            N + R  MR+TWL   GQ +   Y PE L+Y+P ++  GHLQ+E V++Q++RL  Y +W 
Sbjct  61   NADERNAMRRTWLANAGQSIAQPYLPEELIYLPTFNAQGHLQVELVAEQASRLRQYTNWQ  120

Query  120  DNNLN-NPESTRRIIKVKHFFAIGTADMPAGLRAELDREQKLYGDMLLLPRLKDNFENLT  178
             + L   P  T+R+I VKH F+IGT D+ +   AEL++EQ    D+LLL R  D ++NLT
Sbjct  121  QSLLTEGPPRTKRLITVKHVFSIGTLDLSSSALAELEKEQNQNNDLLLLNRHHDTYKNLT  180

Query  179  EKMLHSIEALTHHYEYSYLLKTDDDTYVKLDILLNELISYDRKLVRKTQEYEGQPLPALY  238
             K++ S+  L  HYE+SY+LK DDDTYVKLD L+N L+SYDRKL+RK  EY    LP LY
Sbjct  181  AKLMQSLYILRRHYEFSYMLKVDDDTYVKLDSLVNTLVSYDRKLLRKRSEYRDHVLPQLY  240

Query  239  WGYFLGRANVKTKGKWRDLNYHLSTHYITYALGGGYVISRKICEHISANAQYLSAYTNED  298
            WGYF GR+ +KTKG+W++ +Y+LS +Y+ YALGGGYV+SR +C++I  N+Q LS Y +ED
Sbjct  241  WGYFNGRSTIKTKGQWKESSYYLSKNYLPYALGGGYVLSRSLCDYIVNNSQLLSHYGSED  300

Query  299  ISMGLWVAPFRDVYRRHDPRFDTQYKPRKCRRYHIVLHKLNEEEMQQIDNGSICVRGDKE  358
            +S+G W+AP R VYR HDPRFDT Y PRKCR YH+VLHK N + M+ I +G +C      
Sbjct  301  VSVGTWLAPLRHVYRWHDPRFDTSYAPRKCRSYHMVLHKRNGQMMRDIHDGELC------  354

Query  359  EEKDNEQSTSLRPYFYDWTKSADKCCDTYV  388
                   S+ L  Y+YDWT++ADKCCD+ V
Sbjct  355  ---SGIGSSILSDYYYDWTRTADKCCDSLV  381


>SQV2_CAEEL unnamed protein product
Length=330

 Score = 150 bits (380),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 102/343 (30%), Positives = 162/343 (47%), Gaps = 82/343 (24%)

Query  47   PDIFLMILVISAPQNVNRRLTMRQTWLRLGQPLDMTYYPENLVYMPKYDESGHLQMETVS  106
            P+ FL I ++++P    RR  +R TW RL      T  P   V++ K             
Sbjct  56   PETFLYISILTSPNETERRQNVRDTWFRLS-----TKGPS--VFIAK-------------  95

Query  107  DQSNRLAAYLHWYDNNLNNPESTRRIIKVKHFFAIGTADMPAGLRAELDREQKLYGDMLL  166
                                            FA+GT  + A  R  L  E + +GD+ L
Sbjct  96   --------------------------------FAVGTMGLAAEDRRLLAEENEKFGDLAL  123

Query  167  LPRLKDNFENLTEKMLHSIEALTHHYEYSYLLKTDDDTYVKLDILLNELISYDRKLVRKT  226
            L R ++++E L +K L        ++++ + LKTD D++V++  L+  L        ++ 
Sbjct  124  LDRHEESYERLAKKTLACFVHAFANFKFKFFLKTDIDSFVRITPLIINL--------KQI  175

Query  227  QEYEGQPLPALYWGYFLGRANVKTKGKWRDLNYHLSTHYITYALGGGYVISRKICEHISA  286
            Q+      P LYWG+  GRA    KGKW++  ++L   Y+ Y LGGGYV+S ++   ++ 
Sbjct  176  QD------PMLYWGFLDGRAKPFRKGKWKEPEWNLCDRYLPYQLGGGYVLSYELIRFLAI  229

Query  287  NAQYLSAYTNEDISMGLWVAPFRDVYRRHDPRFDTQYKPRKCRRYHIVLHKLNEEEMQQI  346
            NAQ    Y NED+S+G W+    DV   HDPRFDT+++ R C   +++ HK  E+EMQ++
Sbjct  230  NAQLFRHYRNEDVSVGAWIGGL-DVKYVHDPRFDTEWRSRGCNNEYLITHKHTEQEMQEM  288

Query  347  -----DNGSICVRGDKEEEKDNEQSTSLRPYFYDWTKSADKCC  384
                   G +C    KE +K          Y YD++K+  +CC
Sbjct  289  FENLKKTGKLCA---KEFQKHPS-------YVYDFSKAPSECC  321


>A1Z8R6_DROME unnamed protein product
Length=466

 Score = 57.0 bits (136),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 82/321 (26%), Positives = 129/321 (40%), Gaps = 47/321 (15%)

Query  50   FLMILVISAPQNVNRRLTMRQTWLRLGQPLDMTYYPENLVYMPKYDE-SGHLQMETVSDQ  108
            FL+I V +   N  +R T+R+TW   G   +  Y        P + +  GHL+   +   
Sbjct  134  FLVIAVCTGVDNFIQRHTIRETW---GNTTEFNY--------PAFGKLHGHLKGHYLPPL  182

Query  109  SNRLAAYLHWYDNNLNNPESTRRIIKVKHFFAIGTADMPAGLRAE-LDR---EQKLYGDM  164
             +RL  Y  +      +  ++ RI+     F +G     A L  E L+R   E + Y D 
Sbjct  183  PDRLKMYGDYLSGEGQSLTASVRIV-----FIVGRQKDEAMLGNETLNRIHIESEKYND-  236

Query  165  LLLPRLKDNFENLTEKMLHSIEALTHHYEYS-----YLLKTDDDTYVKLDILLNELIS--  217
            ++     D++ NLT   L S+ AL H          Y LK DDDT+V +  LLN L+   
Sbjct  237  IIQENFVDSYNNLT---LKSVMALKHISRSCFNTAVYFLKCDDDTFVNIPNLLNFLLGGT  293

Query  218  ----------YDRK--LVRKTQEYEGQPLPALYWGYFLGRANV-KTKGKWRDLNY-HLST  263
                      +DR   LV   Q         LY   F     V +   KW   +Y +   
Sbjct  294  IPLYNDTLDYHDRSTYLVTAPQTRLKASSDVLYGHQFCNVVPVSEVSSKWYMPSYMYKPE  353

Query  264  HYITYALGGGYVISRKICEHISANAQYLSAYTNEDISMGLWVAPFRDVYRRHDPRFDTQY  323
             Y  Y  G GY++S  + + +   +   +    ED+ +    A    + R H P F   +
Sbjct  354  SYPKYLSGAGYLMSIDVVQRLFEASLNTTLVYLEDVYITGLCAQKAKINRHHHPLFSFAH  413

Query  324  KPRKCR-RYHIVLHKLNEEEM  343
              + C  +  I  H+L ++ M
Sbjct  414  SKQMCAFKGTITQHQLKDDSM  434



Lambda      K        H
   0.322    0.137    0.423 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4150185960


Query= XP_011197234.1 vacuolar protein sorting-associated protein 41
homolog [Bactrocera dorsalis]

Length=851
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O76248_DROME  unnamed protein product                                 1115    0.0  
Q7PL76_DROME  unnamed protein product                                 1114    0.0  
Q8MT46_DROME  unnamed protein product                                 680     0.0  


>O76248_DROME unnamed protein product
Length=841

 Score = 1115 bits (2884),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 557/839 (66%), Positives = 673/839 (80%), Gaps = 9/839 (1%)

Query  1    MAEQEAVNNSDTETES-TEDEIEPKFKYQRIANDLKKVLNSDVVTCSAVHPKFLIFGTFL  59
            MA+   + + D+  +S  E+++EPKFKY R+ANDLK +LN+DV+TCSAVH KFLIFGTF 
Sbjct  1    MAKALPLISCDSWADSINEEDVEPKFKYHRLANDLKYMLNADVITCSAVHLKFLIFGTFR  60

Query  60   GRVYIFDHQGNSVTSHLSDGPNDFSHTVAVNHIDVDAKAEYVATCSDDGKVNITGLFSNE  119
            GRV IFDHQGNSV S+LS      +H VAVN+IDVD K EYVATCSDDGKVNITGLFS++
Sbjct  61   GRVCIFDHQGNSVYSNLS-ASERHTHQVAVNNIDVDHKGEYVATCSDDGKVNITGLFSSD  119

Query  120  NNQNLKFGKSIKAVALDPDPKAVAGKRFVVGDDKLTLYERNFLKKLKTTVLSSAEGYVLS  179
            NN +L FGK IK V+L+PD KA   KRFVVGDDKL LYERN LKKLK   L S EG VLS
Sbjct  120  NNHSLSFGKFIKVVSLEPDSKAHI-KRFVVGDDKLILYERNLLKKLKPVELCSVEGSVLS  178

Query  180  VCWNDSFVAWASYLGVRVYDLNEKCSLGLMKWEEPVNARLENFRCNFRWSNATTLLIGWV  239
            +CW+ +F+AWAS++GVRVYDLNE+CSLGL+KWE P   RLENFRC+ RWSN  TLLIGWV
Sbjct  179  ICWHGNFIAWASHIGVRVYDLNERCSLGLIKWEVPPQERLENFRCHLRWSNKHTLLIGWV  238

Query  240  DTIRICVIRKRNSIEVASRDLPGFIVDPISTFQTTFYISGLAPLTSNQLVVLGCPKEKDA  299
            DTIR+CVIRKRNSIE ++ +LP +IVDPISTFQTTFY+ GLAPL++ QLVVLG  KEK +
Sbjct  239  DTIRVCVIRKRNSIEASTGNLPVYIVDPISTFQTTFYVCGLAPLSAKQLVVLGFRKEKSS  298

Query  300  ERKSLRPVLCVMEYKLNSSEEICTDSLSLRGYQEYTVNDYSLGCIIEENRYFIVAPKDIV  359
              K+LRPVLCV+EYK+N+SEEICTDSL+LRG++EYTVNDYSLG IIEENR++IVAPKDIV
Sbjct  299  CFKALRPVLCVIEYKMNNSEEICTDSLTLRGFEEYTVNDYSLGGIIEENRFYIVAPKDIV  358

Query  360  VASLYETDDRVKWLVDHRKFEEAMEVISTHGGSWSLLSVAKLYINHLLALNQFDDAAKLC  419
            VASL ETDDR++WL+ H KFEEAME+IS +GG+  +LSVAKLYINHLLAL ++DDAAKLC
Sbjct  359  VASLIETDDRIEWLIKHSKFEEAMELISANGGNVPVLSVAKLYINHLLALKKYDDAAKLC  418

Query  420  LRVLGNKKSLWEEEVFKFFERHQLRSVSAYLPTSDDCKLDPHIYELVLYEYLKHDAKGFL  479
            LR+LGN K LWEEEVFKF +  QLRSVSAYLPTSD+CKLDPH+YE+VLYE+LK D  GFL
Sbjct  419  LRMLGNDKVLWEEEVFKFVKCQQLRSVSAYLPTSDECKLDPHVYEMVLYEFLKFDVCGFL  478

Query  480  NLIKEWPSNLYDCAAVINAIHDNFRKPNANELLEALAILYLHQRDYESALRMYLKLQNED  539
            NLIKEWPS+LYD  AVINAIHDNFRK +AN+LLE+LA+LY +Q D+ESALRMYLKLQN+D
Sbjct  479  NLIKEWPSHLYDGLAVINAIHDNFRKHHANQLLESLALLYSYQGDFESALRMYLKLQNKD  538

Query  540  VFEMIRRYDLYDAIHKMIIPLIQLNRERAFKVLFEKNKISPEIVVQQLEQNQEYLYWYLD  599
            VF++IRRY+LYD I K+IIPLIQL+R+ AF++L +K KI  EIVV QLE NQEYLYWYLD
Sbjct  539  VFQLIRRYELYDVISKLIIPLIQLDRDCAFEILLDKKKIKTEIVVHQLEHNQEYLYWYLD  598

Query  600  ALDKVDKSGKYHWKLVNLYAKYEPEKLLPFLKRSNHYPMQEALDVCKRELFYPEMVYLLG  659
            +L K D S  +  KL++LYA ++  KLLPFLKRS  Y +QEAL +CK+E FYPE+VYLLG
Sbjct  599  SLLKKDPSNVFQKKLISLYAIFDRNKLLPFLKRSKDYDIQEALVICKQENFYPEIVYLLG  658

Query  660  QMGN--TIEALNIIIEKIQDIEMAIEFCKEHNDSDLWNILIDESVKEPTIVLKLLSGIVD  717
             MG     EALNIII +I+DIEMAIEFCKEH+DSDLWN LI+E  K P IV K+L GIVD
Sbjct  659  CMGGVEASEALNIIIHRIRDIEMAIEFCKEHDDSDLWNALINEFSKHPEIVTKVLDGIVD  718

Query  718  YVDPVAVVEKIKLGQNIPGLRDAVVKLLWDYRLQVKIRKSAQKMQWEFYYERHARVVKRQ  777
            Y  P  VV KIK+GQNIP LR +++K+L  Y LQ +I  SAQ++Q   Y+E H+ +V  Q
Sbjct  719  YFSPAVVVGKIKMGQNIPNLRQSLIKMLRHYNLQGEILSSAQQIQLNDYFEIHSEIVTTQ  778

Query  778  NRGRCIPSSERCLECNRPLISMNEHIPPLNDVVAFLCGHVYHTNCVPGGPDNEHCELCN  836
             RG+ +   + C  C+RP++    H   L  ++   CGHVYH  C+ G    ++C  CN
Sbjct  779  RRGQQVSYEQLCSLCHRPVLMAGTH---LYCIIRLECGHVYHKPCIQGEL-LKNCNECN  833


>Q7PL76_DROME unnamed protein product
Length=841

 Score = 1114 bits (2881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 557/839 (66%), Positives = 672/839 (80%), Gaps = 9/839 (1%)

Query  1    MAEQEAVNNSDTETES-TEDEIEPKFKYQRIANDLKKVLNSDVVTCSAVHPKFLIFGTFL  59
            MA+   + + D+  +S  E+++EPKFKY R+ANDLK +LN+DV+TCSAVH KFLIFGTF 
Sbjct  1    MAKALPLISCDSWADSINEEDVEPKFKYHRLANDLKYMLNADVITCSAVHLKFLIFGTFR  60

Query  60   GRVYIFDHQGNSVTSHLSDGPNDFSHTVAVNHIDVDAKAEYVATCSDDGKVNITGLFSNE  119
            GRV IFDHQGNSV S+LS      +H VAVN+IDVD K EYVATCSDDGKVNITGLFS++
Sbjct  61   GRVCIFDHQGNSVYSNLS-ASERHTHQVAVNNIDVDHKGEYVATCSDDGKVNITGLFSSD  119

Query  120  NNQNLKFGKSIKAVALDPDPKAVAGKRFVVGDDKLTLYERNFLKKLKTTVLSSAEGYVLS  179
            NN +L FGK IK V+L+PD KA   KRFVVGDDKL LYERN LKKLK   L S EG VLS
Sbjct  120  NNHSLSFGKFIKVVSLEPDSKAHI-KRFVVGDDKLILYERNLLKKLKPVELCSVEGSVLS  178

Query  180  VCWNDSFVAWASYLGVRVYDLNEKCSLGLMKWEEPVNARLENFRCNFRWSNATTLLIGWV  239
            +CW+ +F+AWAS++GVRVYDLNE+CSLGL+KWE P   RLENFRC+ RWSN  TLLIGWV
Sbjct  179  ICWHGNFIAWASHIGVRVYDLNERCSLGLIKWEVPPQERLENFRCHLRWSNKHTLLIGWV  238

Query  240  DTIRICVIRKRNSIEVASRDLPGFIVDPISTFQTTFYISGLAPLTSNQLVVLGCPKEKDA  299
            DTIR+CVIRKRNSIE ++ +LP +IVDPISTFQTTFY+ GLAPL++ QLVVLG  KEK +
Sbjct  239  DTIRVCVIRKRNSIEASTGNLPVYIVDPISTFQTTFYVCGLAPLSAKQLVVLGFRKEKSS  298

Query  300  ERKSLRPVLCVMEYKLNSSEEICTDSLSLRGYQEYTVNDYSLGCIIEENRYFIVAPKDIV  359
              K+LRPVLCV+EYK+N+SEEICTDSL+LRG++EYTVNDYSLG IIEENR++IVAPKDIV
Sbjct  299  CFKALRPVLCVIEYKMNNSEEICTDSLTLRGFEEYTVNDYSLGGIIEENRFYIVAPKDIV  358

Query  360  VASLYETDDRVKWLVDHRKFEEAMEVISTHGGSWSLLSVAKLYINHLLALNQFDDAAKLC  419
            VASL ETDDR++WL+ H KFEEAME+IS +GG+  +LSVAKLYINHLLAL ++DDAAKLC
Sbjct  359  VASLIETDDRIEWLIKHSKFEEAMELISANGGNVPVLSVAKLYINHLLALKKYDDAAKLC  418

Query  420  LRVLGNKKSLWEEEVFKFFERHQLRSVSAYLPTSDDCKLDPHIYELVLYEYLKHDAKGFL  479
            LR+LGN K LWEEEVFKF +  QLRSVSAYLPTSD+CKLDPH+YE+VLYE+LK D  GFL
Sbjct  419  LRMLGNDKVLWEEEVFKFVKCQQLRSVSAYLPTSDECKLDPHVYEMVLYEFLKFDVCGFL  478

Query  480  NLIKEWPSNLYDCAAVINAIHDNFRKPNANELLEALAILYLHQRDYESALRMYLKLQNED  539
            NLIKEWPS+LYD  AVINAIHDNFRK  AN+LLE+LA+LY +Q D+ESALRMYLKLQN+D
Sbjct  479  NLIKEWPSHLYDGLAVINAIHDNFRKHYANQLLESLALLYSYQGDFESALRMYLKLQNKD  538

Query  540  VFEMIRRYDLYDAIHKMIIPLIQLNRERAFKVLFEKNKISPEIVVQQLEQNQEYLYWYLD  599
            VF++IRRY+LYD I K+IIPLIQL+R+ AF++L +K KI  EIVV QLE NQEYLYWYLD
Sbjct  539  VFQLIRRYELYDVISKLIIPLIQLDRDCAFEILLDKKKIKTEIVVHQLEHNQEYLYWYLD  598

Query  600  ALDKVDKSGKYHWKLVNLYAKYEPEKLLPFLKRSNHYPMQEALDVCKRELFYPEMVYLLG  659
            +L K D S  +  KL++LYA ++  KLLPFLKRS  Y +QEAL +CK+E FYPE+VYLLG
Sbjct  599  SLLKKDPSNVFQKKLISLYAIFDRNKLLPFLKRSKDYDIQEALVICKQENFYPEIVYLLG  658

Query  660  QMGN--TIEALNIIIEKIQDIEMAIEFCKEHNDSDLWNILIDESVKEPTIVLKLLSGIVD  717
             MG     EALNIII +I+DIEMAIEFCKEH+DSDLWN LI+E  K P IV K+L GIVD
Sbjct  659  CMGGVEASEALNIIIHRIRDIEMAIEFCKEHDDSDLWNALINEFSKHPEIVTKVLDGIVD  718

Query  718  YVDPVAVVEKIKLGQNIPGLRDAVVKLLWDYRLQVKIRKSAQKMQWEFYYERHARVVKRQ  777
            Y  P  VV KIK+GQNIP LR +++K+L  Y LQ +I  SAQ++Q   Y+E H+ +V  Q
Sbjct  719  YFSPAVVVGKIKMGQNIPNLRQSLIKMLRHYNLQGEILSSAQQIQLNDYFEIHSEIVTTQ  778

Query  778  NRGRCIPSSERCLECNRPLISMNEHIPPLNDVVAFLCGHVYHTNCVPGGPDNEHCELCN  836
             RG+ +   + C  C+RP++    H   L  ++   CGHVYH  C+ G    ++C  CN
Sbjct  779  RRGQQVSYEQLCSLCHRPVLMAGTH---LYCIIRLECGHVYHKPCIQGEL-LKNCNECN  833


>Q8MT46_DROME unnamed protein product
Length=528

 Score = 680 bits (1755),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/524 (65%), Positives = 415/524 (79%), Gaps = 6/524 (1%)

Query  315  LNSSEEICTDSLSLRGYQEYTVNDYSLGCIIEENRYFIVAPKDIVVASLYETDDRVKWLV  374
            +N+SEEICTDSL+LRG++EYTVNDYSLG IIEENR++IVAPKDIVVASL ETDDR++WL+
Sbjct  1    MNNSEEICTDSLTLRGFEEYTVNDYSLGGIIEENRFYIVAPKDIVVASLIETDDRIEWLI  60

Query  375  DHRKFEEAMEVISTHGGSWSLLSVAKLYINHLLALNQFDDAAKLCLRVLGNKKSLWEEEV  434
             H KFEEAME+IS +GG+  +LSVAKLYINHLLAL ++DDAAKLCLR+LGN K LWEEEV
Sbjct  61   KHSKFEEAMELISANGGNVPVLSVAKLYINHLLALKKYDDAAKLCLRMLGNDKVLWEEEV  120

Query  435  FKFFERHQLRSVSAYLPTSDDCKLDPHIYELVLYEYLKHDAKGFLNLIKEWPSNLYDCAA  494
            FKF +  QLRSVSAYLPTSD+CKLDPH+YE+VLYE+LK D  GFLNLIKEWPS+LYD  A
Sbjct  121  FKFVKCQQLRSVSAYLPTSDECKLDPHVYEMVLYEFLKFDVCGFLNLIKEWPSHLYDGLA  180

Query  495  VINAIHDNFRKPNANELLEALAILYLHQRDYESALRMYLKLQNEDVFEMIRRYDLYDAIH  554
            VINAIHDNFRK  AN+LLE+LA+LY +Q D+ESALRMYLKLQN+DVF++IRRY+LYD I 
Sbjct  181  VINAIHDNFRKHYANQLLESLALLYSYQGDFESALRMYLKLQNKDVFQLIRRYELYDVIS  240

Query  555  KMIIPLIQLNRERAFKVLFEKNKISPEIVVQQLEQNQEYLYWYLDALDKVDKSGKYHWKL  614
            K+IIPLIQL+R+ AF++L +K KI  EIVV QLE NQEYLYWYLD+L K D S  +  KL
Sbjct  241  KLIIPLIQLDRDCAFEILLDKKKIKTEIVVHQLEHNQEYLYWYLDSLLKKDPSNVFQKKL  300

Query  615  VNLYAKYEPEKLLPFLKRSNHYPMQEALDVCKRELFYPEMVYLLGQMGN--TIEALNIII  672
            ++LYA ++  KLLPFLKRS  Y +QEAL +CK+E FYPE+VYLLG MG     EALNIII
Sbjct  301  ISLYAIFDRNKLLPFLKRSKDYDIQEALVICKQENFYPEIVYLLGCMGGVEASEALNIII  360

Query  673  EKIQDIEMAIEFCKEHNDSDLWNILIDESVKEPTIVLKLLSGIVDYVDPVAVVEKIKLGQ  732
             +I+DIEMAIEFCKEH+DSDLWN LI+E  K P IV K+L GIVDY  P  VV KIK+GQ
Sbjct  361  HRIRDIEMAIEFCKEHDDSDLWNALINEFSKHPEIVTKVLDGIVDYFSPAVVVGKIKMGQ  420

Query  733  NIPGLRDAVVKLLWDYRLQVKIRKSAQKMQWEFYYERHARVVKRQNRGRCIPSSERCLEC  792
            NIP LR +++K+L  Y LQ +I  SAQ++Q   Y+E H+ +V  Q RG+ +   + C  C
Sbjct  421  NIPNLRQSLIKMLRHYNLQGEILSSAQQIQLNDYFEIHSEIVTTQRRGQQVSYEQLCSLC  480

Query  793  NRPLISMNEHIPPLNDVVAFLCGHVYHTNCVPGGPDNEHCELCN  836
            +RP++    H   L  ++   CGHVYH  C+ G    ++C  CN
Sbjct  481  HRPVLMAGTH---LYCIIRLECGHVYHKPCIQGEL-LKNCNECN  520



Lambda      K        H
   0.322    0.137    0.423 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4150185960


Query= XP_011197235.1 60S ribosomal protein L5 [Bactrocera dorsalis]

Length=298
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RL5_DROME  unnamed protein product                                    566     0.0   
RL5_DICDI  unnamed protein product                                    325     6e-112
Q38CY8_TRYB2  unnamed protein product                                 321     5e-110


>RL5_DROME unnamed protein product
Length=299

 Score = 566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/299 (90%), Positives = 285/299 (95%), Gaps = 1/299 (0%)

Query  1    MGFVKVVKNKQYFKRYQVKFRRRREGKTDYYARKRLIFQDKNKYNTPKYRLIVRLSNKDI  60
            MGFVKVVKNKQYFKRYQVKFRRRREGKTDYYARKRL FQDKNKYNTPKYRLIVRLSNKDI
Sbjct  1    MGFVKVVKNKQYFKRYQVKFRRRREGKTDYYARKRLTFQDKNKYNTPKYRLIVRLSNKDI  60

Query  61   TVQIAYARIEGDRVVCAAYSHELPNYGVKVGLTNYAAAYCTGLLVARRILNKLGLDTLYG  120
            TVQIAYARIEGDRVVCAAYSHELP YG++VGLTNYAAAYCTGLLVARR+LNKLGLD+LY 
Sbjct  61   TVQIAYARIEGDRVVCAAYSHELPKYGIQVGLTNYAAAYCTGLLVARRVLNKLGLDSLYA  120

Query  121  GCTEVTGEEYNVEPVDDGPGAFRCYLDVGLARTTTGARVFGAMKGAVDGGLNIPHSVKRF  180
            GCTEVTGEE+NVEPVDDGPGAFRC+LDVGLARTTTGARVFGAMKGAVDGGLNIPHSVKRF
Sbjct  121  GCTEVTGEEFNVEPVDDGPGAFRCFLDVGLARTTTGARVFGAMKGAVDGGLNIPHSVKRF  180

Query  181  PGYNAEAKNFNADVHRAHIFGQHVADYMRTLEENDEESFKRQFSRYIKLGIRADDLETIY  240
            PGY+AE K+FNADVHRAHIFGQHVADYMR+LEE DEESFKRQFSRYIKLGIRADDLE IY
Sbjct  181  PGYSAETKSFNADVHRAHIFGQHVADYMRSLEEEDEESFKRQFSRYIKLGIRADDLEDIY  240

Query  241  KKAHQAIRSDPTHKKKDQK-SGVVKKRWNAKKLTNEQRKVKVAEHKAAYIAKLKSESEA  298
            KKAHQAIR+DPTHK   +K S V KKRWNAKKLTNEQRK K+A HKAAY+AKL+SE+EA
Sbjct  241  KKAHQAIRNDPTHKVTAKKSSAVTKKRWNAKKLTNEQRKTKIAAHKAAYVAKLQSETEA  299


>RL5_DICDI unnamed protein product
Length=292

 Score = 325 bits (834),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 170/292 (58%), Positives = 216/292 (74%), Gaps = 0/292 (0%)

Query  1    MGFVKVVKNKQYFKRYQVKFRRRREGKTDYYARKRLIFQDKNKYNTPKYRLIVRLSNKDI  60
            MGFVKVVK K Y+ RYQV+FRRRREGKTDY  R RLI QDKNKYN+PKYRL+ R++N D+
Sbjct  1    MGFVKVVKTKAYYSRYQVQFRRRREGKTDYQQRHRLITQDKNKYNSPKYRLVARITNTDV  60

Query  61   TVQIAYARIEGDRVVCAAYSHELPNYGVKVGLTNYAAAYCTGLLVARRILNKLGLDTLYG  120
              Q+ Y++I GD V+CAAY+HELP +GVKVGLTNYA+ Y TGLL+ARR+L KL L  LY 
Sbjct  61   IAQVVYSKIVGDFVLCAAYAHELPRFGVKVGLTNYASCYATGLLLARRLLAKLKLADLYK  120

Query  121  GCTEVTGEEYNVEPVDDGPGAFRCYLDVGLARTTTGARVFGAMKGAVDGGLNIPHSVKRF  180
            G  +V G+ + V+PVDD P  F+  LDVGLART+TGA+VF  +KGAVDGG+ +PH   RF
Sbjct  121  GAEKVDGKVFLVKPVDDKPRPFKANLDVGLARTSTGAKVFAVLKGAVDGGIYVPHGETRF  180

Query  181  PGYNAEAKNFNADVHRAHIFGQHVADYMRTLEENDEESFKRQFSRYIKLGIRADDLETIY  240
             GYNAE+K  NA+  R +IFG+HVA YM  L+  DE+++K+ FS+YIK G+   D+ETIY
Sbjct  181  AGYNAESKKLNAETLRGYIFGKHVASYMTLLQTEDEDAYKKIFSQYIKNGVAPKDIETIY  240

Query  241  KKAHQAIRSDPTHKKKDQKSGVVKKRWNAKKLTNEQRKVKVAEHKAAYIAKL  292
              AH+AIR++P    K  KS    K  N  K T +Q+K +VA  KA+Y A+L
Sbjct  241  ANAHKAIRANPAPAAKSTKSYKDIKSKNLSKRTLKQKKARVASIKASYKARL  292


>Q38CY8_TRYB2 unnamed protein product
Length=308

 Score = 321 bits (823),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 162/289 (56%), Positives = 207/289 (72%), Gaps = 15/289 (5%)

Query  1    MGFVKVVKNKQYFKRYQVKFRRRREGKTDYYARKRLIFQDKNKYNTPKYRLIVRLSNKDI  60
            M FVKVVKNK Y+KR+QVK+RRRREGKTDY+AR+R++ QDK K+ TPKYRL+VR++N+D+
Sbjct  1    MTFVKVVKNKAYYKRFQVKYRRRREGKTDYHARRRMVLQDKTKFGTPKYRLVVRITNRDV  60

Query  61   TVQIAYARIEGDRVVCAAYSHELPNYGVKVGLTNYAAAYCTGLLVARRILNKLGLDTLYG  120
              QI +A++ GD VV AAYSHELP +G++ GLTNYAAAY TGLLVARR+L KLGL   + 
Sbjct  61   IAQIVHAKVVGDEVVMAAYSHELPLFGIEHGLTNYAAAYATGLLVARRMLAKLGLAEKFV  120

Query  121  GCTEVTGEEYNVEPVDDGPG------AFRCYLDVGLARTTTGARVFGAMKGAVDGGLNIP  174
            G  EV G    V   DD  G       F+  LDVGLARTTTGARVFG +KGAVDGGL +P
Sbjct  121  GVKEVDGSYAAVRTKDDDQGDDESRFPFKAILDVGLARTTTGARVFGVLKGAVDGGLAVP  180

Query  175  HSVKRFPGYNAEAKNFNADVHRAHIFGQHVADYMRTLEEN-----DEESFKRQFSRYIKL  229
            H   RFPGYN E+   NA VHR  IFG+HVADY++ + E      DE++   QFS++I  
Sbjct  181  HRPNRFPGYNKESDALNAKVHRDRIFGRHVADYLKQVREEASSNPDEKTC--QFSKFIAA  238

Query  230  GIRADDLETIYKKAHQAIRSDPTHK--KKDQKSGVVKKRWNAKKLTNEQ  276
             +  DD+E +YK+AH AIR+DPT +  KK++ +    K++N  KLT  +
Sbjct  239  KVSPDDMEGMYKRAHAAIRADPTKRRAKKERPAEAKPKKYNTVKLTGAE  287



Lambda      K        H
   0.322    0.137    0.423 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4150185960


Query= XP_011197236.1 protein-associating with the carboxyl-terminal domain
of ezrin [Bactrocera dorsalis]

Length=774
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VAR0_DROME  unnamed protein product                                 62.8    8e-10
Q38CA8_TRYB2  unnamed protein product                                 62.0    1e-09
Q7KXY9_DROME  unnamed protein product                                 32.7    1.2  


>Q9VAR0_DROME unnamed protein product
Length=835

 Score = 62.8 bits (151),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 96/434 (22%), Positives = 171/434 (39%), Gaps = 59/434 (14%)

Query  2    GNDTSRLKGLVIDKSSVEANDFWTLYNAESPTTSNEDGRQLLSIFQGEAVVNGQLW----  57
            GN+ +R   ++    +      W +YN    +T  E     + +F+ +++   + W    
Sbjct  24   GNNVTREYEVLEQVCTAGVGLMWKVYNGHKKSTKQEVS---VFVFEKKSL---ERWSKDD  77

Query  58   --VIQVPLERAIKNLKIYRHPYILKYVTTWEQGGQK-HLATERV-RPLTMVLSTQ-----  108
               +   L R ++ L   RHP++L      E+       ATE V   L  V+        
Sbjct  78   RETMLETLRRGVQQLTKIRHPHVLTVQHPLEESRDSLAFATEPVFASLANVVGDNVRSEK  137

Query  109  --SNLQVCLGLRTILCSLIFLVEKALGRHLNICISSIYVTDDGSWRLAGFEYV-------  159
               ++++  GL  +   L FL + A   H NI   +I +  + SW+L GF++        
Sbjct  138  KLYDVEIRHGLLQLFDGLQFLHQDAKIVHRNISAETIVINKNRSWKLFGFDFCIANQPAT  197

Query  160  -----WKHKEITKSLLDLVK-TYRYSA---AVDANEYKDNSSDAIEQFAFATLCEEVLNK  210
                 W  +E T SL  L + +  Y+A   A+++    D+   ++    F     + L  
Sbjct  198  DGTPHWPFREYTTSLHVLAQPSLEYTAPELALNSVNTPDSDLFSLGVLIFTIYAGKPLKM  257

Query  211  CSKKESTETPHAQEF--RNYCATH------------LKHSNVQLRPRLSAVLLHPYFNHE  256
                 S+   +A +   R Y   +            L H +  LRP+L  +    YF   
Sbjct  258  FGSDYSSFRRYANDLNQRKYPPMNAVPSELTESLKALLHPSANLRPKLHELKQIAYFQDV  317

Query  257  FVLIHSFLFELPLKGIQEKQDFFTGLIDRLRYFNEEVVGAQLAADLLSRMVLLDPTAQLC  316
             V   S+L  L      +K  F+ GL   +      V    +   L+   V         
Sbjct  318  GVKTLSYLDSLYQWDNLQKSKFYKGLPQIIPTLPHRVNLHSILPYLVKEFV------NSP  371

Query  317  VTPYVLKTKIDHSAALFSNHTYQRYIMPHIKKMFRLRDA-QIRLILLEYFMEFVRLLSKD  375
            + P+VL   +   A + S   Y  +I+PH+K +F+L D  QI LI ++     ++L   +
Sbjct  372  MIPFVLPN-VLLIAEMSSQREYCDHILPHLKPIFKLTDPIQILLIFMQKMDLLLKLTPAE  430

Query  376  ELLECILPYLLEGM  389
            E+ + +LP L   +
Sbjct  431  EVKQSVLPLLYRSL  444


>Q38CA8_TRYB2 unnamed protein product
Length=715

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 84/348 (24%), Positives = 134/348 (39%), Gaps = 56/348 (16%)

Query  63   LERAIKNLKIYRHPYILKYVTTWEQGGQKHLATERVRPLTMVLSTQS-------------  109
            +  A+K  K    P IL+     E     +LATE   PL+ +   Q              
Sbjct  69   VRHAMKRAKSLLLPGILRCYGAAEHRDTVYLATEPCEPLSKMKCGQMGSPLATSGDDDDE  128

Query  110  ----NLQVCLGLRTILCSLIFLVEKALGRHLNICISSIYVTDDGSWRLAGFEYVWKHKEI  165
                N  V LGL+ +  ++  L +  L  H N+   S++V   G WRL G E V    ++
Sbjct  129  GEAFNDIVALGLKAVGSAVSALHKNKL-IHGNVGRDSVFVISTGEWRLFGLELVSGFDDV  187

Query  166  TKSLLD---LVKTYRYSAAVDANEYKDNSSD-AIEQFAFATLCEEVLN-------KCSKK  214
              S L    L+  YR         Y+      AI+ +  A L  EVL        K S+ 
Sbjct  188  GSSYLSYCSLLPAYRRPPETQHTNYESGGKTCAIDSWGLACLIYEVLGVNDQTSGKLSQS  247

Query  215  ESTE-------TPHAQE--FRNYCATHLKHSNVQLRPRLSAVLLHPYF--NHEFVLIHSF  263
             STE        P   +  F   CA      N ++R  +   L    F  + ++V     
Sbjct  248  CSTEDLRSCRTLPRTLQSGFSGLCAV-----NPKMRHDVDRFLRTSDFIISSDYVQSMQM  302

Query  264  LFELPLKGIQEKQDFFTGLIDRLRYFNEEVVGAQLAADLLSRMVL--LDPTAQLCVTPYV  321
            L +  LK   E++ F   L + +  F           D    +VL  L  +    + P V
Sbjct  303  LDDYSLKDAAERERFMEHLANVVHTFPR---------DACKHLVLQKLRASFTFGILPGV  353

Query  322  LKTKIDHSAALFSNHTYQRYIMPHIKKMFRLRDAQIRLILLEYFMEFV  369
            + T +  +A + S   Y  ++ P I  +FR ++  +RL +L++  E +
Sbjct  354  VDTVVKIAARMPSPEEYATHVSPVIVALFRSKERMVRLRILQHAAELL  401


>Q7KXY9_DROME unnamed protein product
Length=751

 Score = 32.7 bits (73),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 35/59 (59%), Gaps = 3/59 (5%)

Query  628  STTLPLNSVEDAALQAKSKIASEITRDNKLEPSSKEARKLKINDDLNAFDIIVQKTAST  686
            S  LP++S  + A QA+S++      D   +P  KEA+K + +DD + F+I++++   T
Sbjct  593  SVQLPVSSEANNAGQAQSQVQ---INDQLGKPQHKEAKKEETSDDYDPFEIMLKRPVIT  648



Lambda      K        H
   0.322    0.137    0.423 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4150185960


Query= XP_011197237.1 protein-associating with the carboxyl-terminal domain
of ezrin [Bactrocera dorsalis]

Length=774
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VAR0_DROME  unnamed protein product                                 62.8    8e-10
Q38CA8_TRYB2  unnamed protein product                                 62.0    1e-09
Q7KXY9_DROME  unnamed protein product                                 32.7    1.2  


>Q9VAR0_DROME unnamed protein product
Length=835

 Score = 62.8 bits (151),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 96/434 (22%), Positives = 171/434 (39%), Gaps = 59/434 (14%)

Query  2    GNDTSRLKGLVIDKSSVEANDFWTLYNAESPTTSNEDGRQLLSIFQGEAVVNGQLW----  57
            GN+ +R   ++    +      W +YN    +T  E     + +F+ +++   + W    
Sbjct  24   GNNVTREYEVLEQVCTAGVGLMWKVYNGHKKSTKQEVS---VFVFEKKSL---ERWSKDD  77

Query  58   --VIQVPLERAIKNLKIYRHPYILKYVTTWEQGGQK-HLATERV-RPLTMVLSTQ-----  108
               +   L R ++ L   RHP++L      E+       ATE V   L  V+        
Sbjct  78   RETMLETLRRGVQQLTKIRHPHVLTVQHPLEESRDSLAFATEPVFASLANVVGDNVRSEK  137

Query  109  --SNLQVCLGLRTILCSLIFLVEKALGRHLNICISSIYVTDDGSWRLAGFEYV-------  159
               ++++  GL  +   L FL + A   H NI   +I +  + SW+L GF++        
Sbjct  138  KLYDVEIRHGLLQLFDGLQFLHQDAKIVHRNISAETIVINKNRSWKLFGFDFCIANQPAT  197

Query  160  -----WKHKEITKSLLDLVK-TYRYSA---AVDANEYKDNSSDAIEQFAFATLCEEVLNK  210
                 W  +E T SL  L + +  Y+A   A+++    D+   ++    F     + L  
Sbjct  198  DGTPHWPFREYTTSLHVLAQPSLEYTAPELALNSVNTPDSDLFSLGVLIFTIYAGKPLKM  257

Query  211  CSKKESTETPHAQEF--RNYCATH------------LKHSNVQLRPRLSAVLLHPYFNHE  256
                 S+   +A +   R Y   +            L H +  LRP+L  +    YF   
Sbjct  258  FGSDYSSFRRYANDLNQRKYPPMNAVPSELTESLKALLHPSANLRPKLHELKQIAYFQDV  317

Query  257  FVLIHSFLFELPLKGIQEKQDFFTGLIDRLRYFNEEVVGAQLAADLLSRMVLLDPTAQLC  316
             V   S+L  L      +K  F+ GL   +      V    +   L+   V         
Sbjct  318  GVKTLSYLDSLYQWDNLQKSKFYKGLPQIIPTLPHRVNLHSILPYLVKEFV------NSP  371

Query  317  VTPYVLKTKIDHSAALFSNHTYQRYIMPHIKKMFRLRDA-QIRLILLEYFMEFVRLLSKD  375
            + P+VL   +   A + S   Y  +I+PH+K +F+L D  QI LI ++     ++L   +
Sbjct  372  MIPFVLPN-VLLIAEMSSQREYCDHILPHLKPIFKLTDPIQILLIFMQKMDLLLKLTPAE  430

Query  376  ELLECILPYLLEGM  389
            E+ + +LP L   +
Sbjct  431  EVKQSVLPLLYRSL  444


>Q38CA8_TRYB2 unnamed protein product
Length=715

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 84/348 (24%), Positives = 134/348 (39%), Gaps = 56/348 (16%)

Query  63   LERAIKNLKIYRHPYILKYVTTWEQGGQKHLATERVRPLTMVLSTQS-------------  109
            +  A+K  K    P IL+     E     +LATE   PL+ +   Q              
Sbjct  69   VRHAMKRAKSLLLPGILRCYGAAEHRDTVYLATEPCEPLSKMKCGQMGSPLATSGDDDDE  128

Query  110  ----NLQVCLGLRTILCSLIFLVEKALGRHLNICISSIYVTDDGSWRLAGFEYVWKHKEI  165
                N  V LGL+ +  ++  L +  L  H N+   S++V   G WRL G E V    ++
Sbjct  129  GEAFNDIVALGLKAVGSAVSALHKNKL-IHGNVGRDSVFVISTGEWRLFGLELVSGFDDV  187

Query  166  TKSLLD---LVKTYRYSAAVDANEYKDNSSD-AIEQFAFATLCEEVLN-------KCSKK  214
              S L    L+  YR         Y+      AI+ +  A L  EVL        K S+ 
Sbjct  188  GSSYLSYCSLLPAYRRPPETQHTNYESGGKTCAIDSWGLACLIYEVLGVNDQTSGKLSQS  247

Query  215  ESTE-------TPHAQE--FRNYCATHLKHSNVQLRPRLSAVLLHPYF--NHEFVLIHSF  263
             STE        P   +  F   CA      N ++R  +   L    F  + ++V     
Sbjct  248  CSTEDLRSCRTLPRTLQSGFSGLCAV-----NPKMRHDVDRFLRTSDFIISSDYVQSMQM  302

Query  264  LFELPLKGIQEKQDFFTGLIDRLRYFNEEVVGAQLAADLLSRMVL--LDPTAQLCVTPYV  321
            L +  LK   E++ F   L + +  F           D    +VL  L  +    + P V
Sbjct  303  LDDYSLKDAAERERFMEHLANVVHTFPR---------DACKHLVLQKLRASFTFGILPGV  353

Query  322  LKTKIDHSAALFSNHTYQRYIMPHIKKMFRLRDAQIRLILLEYFMEFV  369
            + T +  +A + S   Y  ++ P I  +FR ++  +RL +L++  E +
Sbjct  354  VDTVVKIAARMPSPEEYATHVSPVIVALFRSKERMVRLRILQHAAELL  401


>Q7KXY9_DROME unnamed protein product
Length=751

 Score = 32.7 bits (73),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 35/59 (59%), Gaps = 3/59 (5%)

Query  628  STTLPLNSVEDAALQAKSKIASEITRDNKLEPSSKEARKLKINDDLNAFDIIVQKTAST  686
            S  LP++S  + A QA+S++      D   +P  KEA+K + +DD + F+I++++   T
Sbjct  593  SVQLPVSSEANNAGQAQSQVQ---INDQLGKPQHKEAKKEETSDDYDPFEIMLKRPVIT  648



Lambda      K        H
   0.322    0.137    0.423 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4150185960


Query= XP_011197238.1 CCR4-NOT transcription complex subunit 3 isoform X1
[Bactrocera dorsalis]

Length=1007
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7K126_DROME  unnamed protein product                                 613     0.0  
G5EFX8_CAEEL  unnamed protein product                                 201     5e-54
Q57ZB9_TRYB2  unnamed protein product                                 113     1e-25


>Q7K126_DROME unnamed protein product
Length=844

 Score = 613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/613 (60%), Positives = 433/613 (71%), Gaps = 73/613 (12%)

Query  1    MAATRKLQGEIDRCLKKVAEGVETFEDIWKKVHNATNSNQK-----EKYEADLKKEIKKL  55
            MAATRKLQGEIDRCLKKVAEGVETFEDIWKKVHNATN+NQK     EKYEADLKKEIKKL
Sbjct  1    MAATRKLQGEIDRCLKKVAEGVETFEDIWKKVHNATNTNQKQKHLQEKYEADLKKEIKKL  60

Query  56   QRLRDQIKSWIASGEIKDKSQLLENRRLIETQMERFKIVERETKTKAYSKEGLGAAQKTD  115
            QRLRDQIKSWIAS EIKDKS LLENRRLIETQMERFK+VERETKTKAYSKEGLGAAQK D
Sbjct  61   QRLRDQIKSWIASAEIKDKSSLLENRRLIETQMERFKVVERETKTKAYSKEGLGAAQKMD  120

Query  116  PAQRKKDEARNWLTSSISSLQLQIDQYESEIESLLAAKKKRLDRDKQDRMDEFRAKLDRN  175
            PAQR KD+ARNWLTSSISSLQ+QIDQYESEIESLLA KKKRLDRDKQ+RMD+ R KLDR+
Sbjct  121  PAQRIKDDARNWLTSSISSLQIQIDQYESEIESLLAGKKKRLDRDKQERMDDLRGKLDRH  180

Query  176  KFHVMKLETVLRLLDNDGVEAEQVNKIKDDVEYYIESSQEPNFEENEFLYDDIIGLDDVE  235
            KFH+ KLET+LRLLDNDGVEAEQVNKIKDDVEYYI+SSQEP+FEENEF+YDDIIGLD+VE
Sbjct  181  KFHITKLETLLRLLDNDGVEAEQVNKIKDDVEYYIDSSQEPDFEENEFIYDDIIGLDEVE  240

Query  236  LSGTGVSLGIPSSATTDSNNSNETSGSPSSITSGGSPVQSPAPATGTQQQQQVQQQSAAT  295
            LSGT         ATTDSNNSNETSGSPSS+TSGGSP QSP         QQ+   S+  
Sbjct  241  LSGT---------ATTDSNNSNETSGSPSSVTSGGSPSQSPVTV------QQILNTSSQG  285

Query  296  AAAAATTTLTSTINTTAAAVTTAQQQQQQQSNNSNSMNYAAEAAAAAAA-------ATAT  348
            AA++ ++  ++ +          QQQ     +N N++ YA++ +AA+++       A  T
Sbjct  286  AASSGSSAASAAL---------FQQQLTAAQSNGNNVGYASDTSAASSSATTSTDPAGGT  336

Query  349  ATNNTDVTASDKRNK-NESNSSSKTKQP---VKPTAVRAANSTGKSSSGTTSETSSNKAV  404
               N     +DKRNK +ESN+     QP   +KPT VRA      +    +S+T  NK V
Sbjct  337  VAVNCVGGLADKRNKSSESNALKLKPQPHQLIKPTPVRAT-----AKLPLSSDTQVNKIV  391

Query  405  SSTPNKNHNQQQQQQPTAAAIVAASMGGQAAPTSVTSTANSIVGGAPTLAATVAAMAAGH  464
            SSTP+KN    QQQ PTAA+IVA S    A  +  +  + S  GG     +  +    G+
Sbjct  392  SSTPSKN----QQQLPTAASIVATS----AMQSQSSIGSCSSTGGTGASQSASSGNNPGN  443

Query  465  SPALQQHAPAPSLNATNATATVGGGATTVAAAVVANNGSSNSNNNIQGQSVIQATPTIAF  524
            +PA+Q +AP P  +   A A     +T V +A +       S+ N+QGQSVIQ TPTIAF
Sbjct  444  NPAVQPNAPTPGQSGIAAAA----ASTNVVSATIV------SSANVQGQSVIQPTPTIAF  493

Query  525  AAVAKNNTSHLENGPVHPATSYAMTAPTVA------TNSQHQQQQQLSNLQTNSSHLQNA  578
            AAVAK+NTS LENGPV      A+T PTVA      T +Q +    LSNLQTNS H+QN 
Sbjct  494  AAVAKHNTSLLENGPVL-QQQLAVT-PTVAAIVGAGTQAQQKHVPPLSNLQTNSPHIQNG  551

Query  579  H--NNTSNNNASN  589
               ++++N+N+ N
Sbjct  552  LPVSDSTNDNSCN  564


 Score = 394 bits (1013),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 234/463 (51%), Positives = 277/463 (60%), Gaps = 91/463 (20%)

Query  582   TSNNNASNSLA---NAVQQGSAAVAAAAAAAGVVVNNVGSNNLV---NCISP--------  627
             +S NN  N+ A   NA   G + +AAAAA+  VV   + S+  V   + I P        
Sbjct  436   SSGNNPGNNPAVQPNAPTPGQSGIAAAAASTNVVSATIVSSANVQGQSVIQPTPTIAFAA  495

Query  628   ----------NG------------MSQVIGAQQQQQQQQQQQVIGVTNNGSRVSPGLLSP  665
                       NG            ++ ++GA  Q QQ+    +  +  N         SP
Sbjct  496   VAKHNTSLLENGPVLQQQLAVTPTVAAIVGAGTQAQQKHVPPLSNLQTN---------SP  546

Query  666   KHMNGMPVSAPNINNNNNNNNNNNSMDAISLKTMAQEAINRSVIDTNSLTQGPGQQIDNR  725
                NG+PVS      ++ N+N+ N +D ISLKTMAQ+AINRS ID NSL Q     ID R
Sbjct  547   HIQNGLPVS------DSTNDNSCNVVDTISLKTMAQDAINRSAIDPNSLNQQQTSSIDLR  600

Query  726   QQQQQQQQQQAPQSQQ-VLQHFSTDTTANQQQQQQQQQQQQQQSGGLAAAAVAFAAAAAA  784
             Q          PQSQ+ +LQHF+++T  NQQQ                        + AA
Sbjct  601   Q----------PQSQKSLLQHFNSETNTNQQQLTS------------QQQQQLQNNSLAA  638

Query  785   TNGPASAGAGPVGSAVQSGLGGMTNTAVGQPGAGNSGVNAPVGSKPLQQQQQQQQQPTNE  844
             T G  +      G++  SGL  + N A GQP +GN+  +A           Q QQ  T E
Sbjct  639   TTGSNN------GTSTGSGLMNVAN-ATGQPISGNAKTHAC----------QPQQMATTE  681

Query  845   AHITPLLGVAPLGTLPLHKDHQLQFKMMEAAYYHLPTPADSERLNIYLPRTPVPTPLHFP  904
             AHI  LLGV PLG  PL K+HQ+QF+MMEAAYYHLP P D+E+L  Y  R PV TP H+P
Sbjct  682   AHIPTLLGVTPLGPTPLQKEHQMQFQMMEAAYYHLPQPMDTEKLQTYFHRAPVLTPSHYP  741

Query  905   QQQLPLYDTVEFYQRLSTETLFFVFYYMEGSKAQYLAAKALKKQSWRFHTKYMMWFQRHE  964
             Q Q+P+YDTVEFYQRLSTETLFFVFYYMEGSKAQYLAAKALKKQSWRFHTKYMMWFQRHE
Sbjct  742   QAQMPIYDTVEFYQRLSTETLFFVFYYMEGSKAQYLAAKALKKQSWRFHTKYMMWFQRHE  801

Query  965   EPKIINDDYEQGTYIYFDYEKWSQRKKEGFTFEYKYLEDKELN  1007
             EPKIINDDYEQGTYIYFDYEKWSQRKKEGFTFEYKYLEDKELN
Sbjct  802   EPKIINDDYEQGTYIYFDYEKWSQRKKEGFTFEYKYLEDKELN  844


>G5EFX8_CAEEL unnamed protein product
Length=701

 Score = 201 bits (511),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 124/322 (39%), Positives = 186/322 (58%), Gaps = 35/322 (11%)

Query  1    MAATRKLQGEIDRCLKKVAEGVETFEDIWKKVHNATNSNQKEKYEADLKKEIKKLQRLRD  60
            MA  RKL  EID+C KK+ EGVE FE+  +K+H A + NQ++KY+ DLKKEIKKLQRLRD
Sbjct  1    MAEKRKLLAEIDKCFKKIDEGVELFEETMEKMHEANSDNQRDKYQDDLKKEIKKLQRLRD  60

Query  61   QIKSWIASGEIKDKSQLLENRRLIETQMERFKIVERETKTKAYSKEGLGAAQKTDPAQRK  120
            Q+K+W  + EIKDK +L   R+LIE +ME+FK VERE KTK +SK GL A +K DP +++
Sbjct  61   QVKNWQNASEIKDKDKLNSYRKLIEQRMEQFKDVERENKTKPHSKLGLSAEEKLDPKEKE  120

Query  121  KDEARNWLTSSISSLQLQIDQYESEIESLL---AAKKKRLDR-------DKQDRMDEFRA  170
            K E  +W+   I SL  ++D+ E ++ESL      K KR  +       +++ R++  + 
Sbjct  121  KAETMDWIQHQIRSLNEEVDRTEMQLESLSNTDTGKGKRGKKEDAKTKNEREKRVEGLKH  180

Query  171  KLDRNKFHVMKLETVLRLLDNDGVEAEQV-NKIKDDVEYYIESSQEPNFEENEFL-----  224
             L+R  FH+ KLE  +R++ N+ + A+ V   +K+ +E Y+E   E + EE +       
Sbjct  181  HLERINFHIEKLEICMRMISNESLNAKMVLETLKEPIETYVEMMNEEDSEEADNYDPDDA  240

Query  225  YDDI--------IG------LDDVELSGTGVSLGIPSSATTDSNNSNETSGS----PSSI  266
            YD++        IG      +DD E    G  LGI ++ +   + S  TSG     PS  
Sbjct  241  YDELNLEKLCQQIGGVNVASVDD-EHRENGHELGIDTAESGAVSGSRHTSGENGQPPSPA  299

Query  267  TSGGSPVQSPAPATGTQQQQQV  288
                 P+  P+P   T + +++
Sbjct  300  GRRIVPLSMPSPHAVTPELKRL  321


 Score = 196 bits (497),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 105/205 (51%), Positives = 129/205 (63%), Gaps = 9/205 (4%)

Query  804   LGGMTNTAVGQPGAG-NSGVNAPVGSKPLQQQQQQQQQPTNEAHITPLLGVAPLGTLPLH  862
             LGGM +T    P A   + +N    S      QQ        AHI   LG +PLG   + 
Sbjct  505   LGGMMST--DDPAAALQAALNMAAAS------QQAVATGPKRAHIPAWLGASPLGRTSMT  556

Query  863   KDHQLQFKMMEAAYYHLPTPADSERLNIYLPRTPVPTPLHFPQQQLPLYDTVEFYQRLST  922
             ++   Q   +E A      P DSE+   YL +   P P  + Q      D++E+Y RL+ 
Sbjct  557   QEFDGQLAALELACAKATFPLDSEKPRNYLSKVSFPVPSWYGQTAPNTSDSLEYYLRLAP  616

Query  923   ETLFFVFYYMEGSKAQYLAAKALKKQSWRFHTKYMMWFQRHEEPKIINDDYEQGTYIYFD  982
             +TLFF+FYYMEG++AQ LAAKALKK SWRFHTKY+ WFQRHEEPK I DDYEQGTY+YFD
Sbjct  617   DTLFFIFYYMEGTRAQLLAAKALKKLSWRFHTKYLTWFQRHEEPKQITDDYEQGTYVYFD  676

Query  983   YEKWSQRKKEGFTFEYKYLEDKELN  1007
             +EKWSQRKKE FTFEYK+LEDKE +
Sbjct  677   FEKWSQRKKESFTFEYKFLEDKEFD  701


>Q57ZB9_TRYB2 unnamed protein product
Length=604

 Score = 113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/164 (35%), Positives = 95/164 (58%), Gaps = 10/164 (6%)

Query  845   AHITPLLGVAPLGTLPLHKD---HQLQFKMMEAAYYHLPTPADSERLNIYLPRTPVPTPL  901
             +H++P    AP+ T   H D        ++++ +  +LP   D +R   + P  P     
Sbjct  445   SHVSP----APVSTA--HDDFLDRNTMLQLIDMSLANLPHTQDVDRQRPFEPSNPTVHVP  498

Query  902   HFPQQQLPLYDTVEFYQRLSTETLFFVFYYMEGSKAQYLAAKALKKQSWRFHTKYMMWFQ  961
              FPQQ LP   + E Y+    ETLFF+FYY + +  QY AA  +K++S+R+HT+   WF+
Sbjct  499   FFPQQVLPALASPEIYRTFELETLFFIFYYHQNTYQQYCAAGQIKERSFRYHTQLNTWFK  558

Query  962   RHEEPKIINDDYEQGTYIYFDYEK-WSQRKKEGFTFEYKYLEDK  1004
             R+  PK   +  E+G++ +F++E+ W+  +KE F F+YKYLE++
Sbjct  559   RNGPPKESLEGSERGSFQFFNFEEGWNLEEKEDFVFDYKYLENE  602



Lambda      K        H
   0.322    0.137    0.423 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4150185960


Query= XP_011197241.2 neuropeptides capa receptor, partial [Bactrocera
dorsalis]

Length=366
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CAPAR_DROME  unnamed protein product                                  397     2e-136
O17239_CAEEL  unnamed protein product                                 144     2e-39 
PK1R_DROME  unnamed protein product                                   137     2e-36 


>CAPAR_DROME unnamed protein product
Length=477

 Score = 397 bits (1020),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 204/346 (59%), Positives = 256/346 (74%), Gaps = 20/346 (6%)

Query  23   DSSTYVSVLTIVAFSMERFLAICHPLHLTAMSGFKRAVRIIAALWILSLLGAIPFGLLTD  82
            ++ TYVSV TIVAFSMERFLAICHPLHL AM GFKRA+RII ALWI+S + AIPFGLL+D
Sbjct  150  EACTYVSVFTIVAFSMERFLAICHPLHLYAMVGFKRAIRIITALWIVSFISAIPFGLLSD  209

Query  83   IQYLNYPLTETTIPESAFCSMS-HYPEEFPLFEISFCFFFVIPMLLIIILYGKMGAQIRF  141
            IQYLNYPL  + I ESAFCSMS     E P+FE+SFC FFVIPM+LII+LYG+MGA+IR 
Sbjct  210  IQYLNYPLDHSRIEESAFCSMSPKIVNEIPVFEVSFCIFFVIPMILIILLYGRMGAKIRS  269

Query  142  STTLQLGVQQGSMHRESRHQQSRK-AVIRMLAAVVVTFFICWLPFHMQRLWFLYAKEQNN  200
             T  +LGVQQG+ +RE+R+ Q RK  VIRMLAAVV+TFF+CW PFH+QRL FLYAK  +N
Sbjct  270  RTNQKLGVQQGTNNRETRNSQMRKKTVIRMLAAVVITFFVCWFPFHLQRLIFLYAKNMDN  329

Query  201  FQEINEWMFSIAGFTYYVSCTINPILYNVMSHRYRVAFKDILWGKRRSVYYNNGFARDQS  260
            + +INE +FSIAGF YYVSCT+NPI+Y+VMS RYRVAF+++L GK    YYN+GFARD S
Sbjct  330  YLDINEALFSIAGFAYYVSCTVNPIVYSVMSRRYRVAFRELLCGKAVGAYYNSGFARDHS  389

Query  261  SFRETIASSLGGNNSTYDRVHSVRVRSMRHTNNYRDRNSIKTKNVLWTKDIDYTVPLKKD  320
            SFRE+         S YDRVHSV VR+ +H N + + +S     VL  K   Y++PL K+
Sbjct  390  SFRES---------SAYDRVHSVHVRASQHPNKF-ETDSSSANRVLIKK--TYSLPLPKN  437

Query  321  TLDSKLKYSTNVVVVVDNGGINGRPKVFTENEAEATLMSKDNETCI  366
              DS +  +T++V+V++N        V  E + E  +  ++ ETCI
Sbjct  438  A-DSTVLSTTDIVIVLENSH-----TVCEEPKVENDIWIENEETCI  477


>O17239_CAEEL unnamed protein product
Length=403

 Score = 144 bits (363),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 96/285 (34%), Positives = 143/285 (50%), Gaps = 27/285 (9%)

Query  22   IDSSTYVSVLTIVAFSMERFLAICHPLHLTAMSGFKRAVRIIAALWILSLLGAIPFGLLT  81
            I+ ++Y S++ I  FS ER+LAICHPL     S   RA  +I   W +S + A+P   + 
Sbjct  113  IEFTSYASIMIICCFSFERWLAICHPLRSKIFSTLWRANVLIILAWTISFVCALPIAFIV  172

Query  82   DIQYLNYPLTETTIP-------------ESAFCSMSHY-PEEFPLFEI-SFCFFFVIPML  126
             I  L  P      P              + FC+M+   P++  +  I +F  FFVIP +
Sbjct  173  QINKLPLPEDAKYQPWTNKVSTDGIFVLHTEFCAMNQSRPDQQKMIIIFAFTVFFVIPAI  232

Query  127  LIIILYGKMGAQIRFSTTLQLGVQQGSMHRESRHQQSRKAVIRMLAAVVVTFFICWLPFH  186
             I+I+Y  +  Q+  S+ + L   +G    + R  +S + V++ML +VV+TFFICWLPFH
Sbjct  233  AIVIMYAHIAVQLE-SSEIDL---KGDKMVKKRRNKSNRTVLKMLLSVVITFFICWLPFH  288

Query  187  MQRLWFLYAKEQNN------FQEINEWMFSIAGFTYYVSCTINPILYNVMSHRYRVAFKD  240
            +QRL  +Y             Q ++  +F I+GF YY +   NPILYN++S +YR AF  
Sbjct  289  IQRLLSVYTTWSETTTISPPVQFLSMIVFYISGFCYYSNSAANPILYNILSQKYRSAFCR  348

Query  241  ILWGKRRSVYYNNGFARDQSSFRETIASSLGGNNSTYDRVHSVRV  285
             + G   + +   G  R   S R   +SS      T     SVRV
Sbjct  349  TILGDHIANFVFKGHQRPGQSKR--CSSSTEAEQRTLMTRGSVRV  391


>PK1R_DROME unnamed protein product
Length=430

 Score = 137 bits (344),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 90/278 (32%), Positives = 141/278 (51%), Gaps = 63/278 (23%)

Query  23   DSSTYVSVLTIVAFSMERFLAICHPLHLTAMSGFKRAVRIIAALWILSLLGAIPFGLLTD  82
            ++S   +VLTI AF++ER++AICHP    AMS   RA+RII  +WI++++ AIP      
Sbjct  102  ETSANATVLTITAFTVERYIAICHPFLGQAMSKLSRAIRIIVLVWIMAIVTAIPQAAQFG  161

Query  83   IQYLNYPLTETTIPESAFCSMSHYPEEFPLFEISFCFFFVIPMLLIIILYGKMGAQIRFS  142
            I++  Y   E        C +     +   F++S   FF+ PM +I++LY  +G  +  S
Sbjct  162  IEH--YSGVEQ-------CGIVRVIVKHS-FQLSTFIFFLAPMSIILVLYLLIGVHLYRS  211

Query  143  TTLQ-----------------------------------------------LGVQQGSMH  155
            T ++                                                G Q  S+ 
Sbjct  212  TLVEGPASVARRQQLKSVPSDTILYRYGGSGTAMSFNGGGSGAGTAGLMGGSGAQLSSVR  271

Query  156  RESRHQQSRKAVIRMLAAVVVTFFICWLPFHMQRLWFLYAKEQN-NFQEINEWMFSI---  211
                H  +R+ V+RML AVVV FF+CW PFH QRL  +YA  +    ++ +E+++++   
Sbjct  272  GRLNHYGTRR-VLRMLVAVVVCFFLCWAPFHAQRLIAIYAPARGAKLRDQHEFVYTVMTY  330

Query  212  -AGFTYYVSCTINPILYNVMSHRYRVAFKDILWGKRRS  248
             +G  YY+S  INP+LYN+MSH++R AFK +L+GK+ S
Sbjct  331  VSGVLYYLSTCINPLLYNIMSHKFREAFKAVLFGKKVS  368



Lambda      K        H
   0.322    0.137    0.423 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4150185960


Query= XP_011197244.1 2-oxoglutarate and iron-dependent oxygenase
domain-containing protein 3 [Bactrocera dorsalis]

Length=334
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8I0C2_DROME  unnamed protein product                                 33.1    0.26 
Q8SX21_DROME  unnamed protein product                                 33.5    0.26 
Q9VN98_DROME  unnamed protein product                                 32.7    0.35 


>Q8I0C2_DROME unnamed protein product
Length=278

 Score = 33.1 bits (74),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 26/80 (33%), Positives = 36/80 (45%), Gaps = 2/80 (3%)

Query  237  HVDKDTYESFHYTSLLYLNTYQKDYKGGRFIFIDGSNANLTKSAIEPKKTRVSAFTSGAE  296
            HVD    +    T++ YLN      + G  + I  +    T + IEPK  R+  F S   
Sbjct  122  HVDNPQKDGRVITAIYYLNINWDARESGGILRIRPT-PGTTVADIEPKFDRLIFFWSDIR  180

Query  297  NLHHVEQVTEGERYAITISF  316
            N H V Q     RYAIT+ +
Sbjct  181  NPHEV-QPAHRTRYAITVWY  199


>Q8SX21_DROME unnamed protein product
Length=478

 Score = 33.5 bits (75),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 26/80 (33%), Positives = 36/80 (45%), Gaps = 2/80 (3%)

Query  237  HVDKDTYESFHYTSLLYLNTYQKDYKGGRFIFIDGSNANLTKSAIEPKKTRVSAFTSGAE  296
            HVD    +    T++ YLN      + G  + I  +    T + IEPK  R+  F S   
Sbjct  322  HVDNPQKDGRVITAIYYLNINWDARESGGILRIRPT-PGTTVADIEPKFDRLIFFWSDIR  380

Query  297  NLHHVEQVTEGERYAITISF  316
            N H V Q     RYAIT+ +
Sbjct  381  NPHEV-QPAHRTRYAITVWY  399


>Q9VN98_DROME unnamed protein product
Length=325

 Score = 32.7 bits (73),  Expect = 0.35, Method: Compositional matrix adjust.
 Identities = 26/80 (33%), Positives = 36/80 (45%), Gaps = 2/80 (3%)

Query  237  HVDKDTYESFHYTSLLYLNTYQKDYKGGRFIFIDGSNANLTKSAIEPKKTRVSAFTSGAE  296
            HVD    +    T++ YLN      + G  + I  +    T + IEPK  R+  F S   
Sbjct  169  HVDNPQKDGRVITAIYYLNINWDARESGGILRIRPT-PGTTVADIEPKFDRLIFFWSDIR  227

Query  297  NLHHVEQVTEGERYAITISF  316
            N H V Q     RYAIT+ +
Sbjct  228  NPHEV-QPAHRTRYAITVWY  246



Lambda      K        H
   0.322    0.137    0.423 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4150185960


Query= XP_011197245.1 splicing factor 45 [Bactrocera dorsalis]

Length=413
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7PL83_DROME  unnamed protein product                                 474     3e-167
Q8SYI1_DROME  unnamed protein product                                 431     2e-150
Q7PL82_DROME  unnamed protein product                                 411     6e-143


>Q7PL83_DROME unnamed protein product
Length=403

 Score = 474 bits (1221),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 260/422 (62%), Positives = 305/422 (72%), Gaps = 28/422 (7%)

Query  1    MDLYDDIDTKPRASQIDGWSSGIKMLQTQLAIKKAQGPKEPPKKPLMTPVVNLRAKKVAA  60
            MDLYD IDT+ R+SQIDGWSSGIKMLQTQLA+K A       KKPLMTPVVNLR+K++A 
Sbjct  1    MDLYDGIDTRARSSQIDGWSSGIKMLQTQLAVKMAV------KKPLMTPVVNLRSKRLAD  54

Query  61   EAEANHLNNTKIETPQMTPKPVITAKPLEPVIENAKSDDCWDFVDEYYPAWPNEYEKLKD  120
                     T +       KP+I+ K L  ++E     D WD  DEY P  PNEYEKLK+
Sbjct  55   PEVTCFAPITTV-----VSKPLISGKALPSILERINRGD-WDVADEYDPQRPNEYEKLKE  108

Query  121  KNQNKEKDHKGSSSTGSGRGSERKRGRGRNSARD------SSPPVKFSGFGQRQTEEESY  174
            K+   +K+  G S        E+ R RGR   R+      S+P +K SGFG RQ +++ Y
Sbjct  109  KSNGSDKNRAGVSDREDRDDKEKDRKRGRVGRREFYRDEVSAPNLKLSGFGHRQNDDDMY  168

Query  175  SPPPQGSVSSKGGAAIAPPPSLQEISINNENGDGSSNVTIPYSASSVAAKIMAKYGFKDG  234
             P P G V+ +GGA IAPPPSLQE+SI++  G  ++N T+PYSASSVAAKIMAKYGFKDG
Sbjct  169  LPSP-GLVAKQGGATIAPPPSLQEMSIDS--GCEATN-TMPYSASSVAAKIMAKYGFKDG  224

Query  235  QGLGKQEQGMSMALQVEKTSKRGGRIIHEKDVFLPPPPAPNSPPASMAPPATPAPNTPSL  294
            QGLGK EQGM++ALQVEKTSKRGGRIIHEKDVFLPP     SPP S+      +P+  ++
Sbjct  225  QGLGKSEQGMAIALQVEKTSKRGGRIIHEKDVFLPPLAL--SPP-SIGSQIGTSPSHKAM  281

Query  295  ---TLAQAVAEVPPSEPSITEIMKEPSKVVLLRNMVGPGDVDEDLEPEVKDECNTKYGDV  351
                +    AE      SITEIMK PSKVVLLRNMVGPGDVDE+LEPEVKDECNTKYG+V
Sbjct  282  PPPQMVDTAAESGDIGYSITEIMKSPSKVVLLRNMVGPGDVDEELEPEVKDECNTKYGEV  341

Query  352  ANVIIHEAFGTTPEEAVKIFVEFKRIESAIKAVVDLNGRFFGGRQVRAGFYNFDKFKSFQ  411
             +VIIHE+FGT PE+AVKIFVEF+RIESAIKAVVDLNGRFFGGRQVRAGFYN+DKFK FQ
Sbjct  342  NSVIIHESFGTVPEDAVKIFVEFRRIESAIKAVVDLNGRFFGGRQVRAGFYNYDKFKCFQ  401

Query  412  LH  413
            LH
Sbjct  402  LH  403


>Q8SYI1_DROME unnamed protein product
Length=379

 Score = 431 bits (1108),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 240/398 (60%), Positives = 283/398 (71%), Gaps = 28/398 (7%)

Query  25   MLQTQLAIKKAQGPKEPPKKPLMTPVVNLRAKKVAAEAEANHLNNTKIETPQMTPKPVIT  84
            MLQTQLA+K A       KKPLMTPVVNLR+K++A          T +       KP+I+
Sbjct  1    MLQTQLAVKMAV------KKPLMTPVVNLRSKRLADPEVTCFAPITTV-----VSKPLIS  49

Query  85   AKPLEPVIENAKSDDCWDFVDEYYPAWPNEYEKLKDKNQNKEKDHKGSSSTGSGRGSERK  144
             K L  ++E     D WD  DEY P  PNEYEKLK+K+   +K+  G S        E+ 
Sbjct  50   GKALPSILERINRGD-WDVADEYDPQRPNEYEKLKEKSNGSDKNRAGVSDREDRDDKEKD  108

Query  145  RGRGRNSARD------SSPPVKFSGFGQRQTEEESYSPPPQGSVSSKGGAAIAPPPSLQE  198
            R RGR   R+      S+P +K SGFG RQ +++ Y P P G V+ +GGA IAPPPSLQE
Sbjct  109  RKRGRVGRREFYRDEVSAPNLKLSGFGHRQNDDDMYLPSP-GLVAKQGGATIAPPPSLQE  167

Query  199  ISINNENGDGSSNVTIPYSASSVAAKIMAKYGFKDGQGLGKQEQGMSMALQVEKTSKRGG  258
            +SI++  G  ++N T+PYSASSVAAKIMAKYGFKDGQGLGK EQGM++ALQVEKTSKRGG
Sbjct  168  MSIDS--GCEATN-TMPYSASSVAAKIMAKYGFKDGQGLGKSEQGMAIALQVEKTSKRGG  224

Query  259  RIIHEKDVFLPPPPAPNSPPASMAPPATPAPNTPSL---TLAQAVAEVPPSEPSITEIMK  315
            RIIHEKDVFLPP     SPP S+      +P+  ++    +    AE      SITEIMK
Sbjct  225  RIIHEKDVFLPPLAL--SPP-SIGSQIGTSPSHKAMPPPQMVDTAAESGDIGYSITEIMK  281

Query  316  EPSKVVLLRNMVGPGDVDEDLEPEVKDECNTKYGDVANVIIHEAFGTTPEEAVKIFVEFK  375
             PSKVVLLRNMVGPGDVDE+LEPEVKDECNTKYG+V +VIIHE+FGT PE+AVKIFVEF+
Sbjct  282  SPSKVVLLRNMVGPGDVDEELEPEVKDECNTKYGEVNSVIIHESFGTVPEDAVKIFVEFR  341

Query  376  RIESAIKAVVDLNGRFFGGRQVRAGFYNFDKFKSFQLH  413
            RIESAIKAVVDLNGRFFGGRQVRAGFYN+DKFK FQLH
Sbjct  342  RIESAIKAVVDLNGRFFGGRQVRAGFYNYDKFKCFQLH  379


>Q7PL82_DROME unnamed protein product
Length=363

 Score = 411 bits (1057),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 227/376 (60%), Positives = 269/376 (72%), Gaps = 22/376 (6%)

Query  47   MTPVVNLRAKKVAAEAEANHLNNTKIETPQMTPKPVITAKPLEPVIENAKSDDCWDFVDE  106
            MTPVVNLR+K++A          T +       KP+I+ K L  ++E     D WD  DE
Sbjct  1    MTPVVNLRSKRLADPEVTCFAPITTV-----VSKPLISGKALPSILERINRGD-WDVADE  54

Query  107  YYPAWPNEYEKLKDKNQNKEKDHKGSSSTGSGRGSERKRGRGRNSARD------SSPPVK  160
            Y P  PNEYEKLK+K+   +K+  G S        E+ R RGR   R+      S+P +K
Sbjct  55   YDPQRPNEYEKLKEKSNGSDKNRAGVSDREDRDDKEKDRKRGRVGRREFYRDEVSAPNLK  114

Query  161  FSGFGQRQTEEESYSPPPQGSVSSKGGAAIAPPPSLQEISINNENGDGSSNVTIPYSASS  220
             SGFG RQ +++ Y P P G V+ +GGA IAPPPSLQE+SI++  G  ++N T+PYSASS
Sbjct  115  LSGFGHRQNDDDMYLPSP-GLVAKQGGATIAPPPSLQEMSIDS--GCEATN-TMPYSASS  170

Query  221  VAAKIMAKYGFKDGQGLGKQEQGMSMALQVEKTSKRGGRIIHEKDVFLPPPPAPNSPPAS  280
            VAAKIMAKYGFKDGQGLGK EQGM++ALQVEKTSKRGGRIIHEKDVFLPP     SPP S
Sbjct  171  VAAKIMAKYGFKDGQGLGKSEQGMAIALQVEKTSKRGGRIIHEKDVFLPPLAL--SPP-S  227

Query  281  MAPPATPAPNTPSL---TLAQAVAEVPPSEPSITEIMKEPSKVVLLRNMVGPGDVDEDLE  337
            +      +P+  ++    +    AE      SITEIMK PSKVVLLRNMVGPGDVDE+LE
Sbjct  228  IGSQIGTSPSHKAMPPPQMVDTAAESGDIGYSITEIMKSPSKVVLLRNMVGPGDVDEELE  287

Query  338  PEVKDECNTKYGDVANVIIHEAFGTTPEEAVKIFVEFKRIESAIKAVVDLNGRFFGGRQV  397
            PEVKDECNTKYG+V +VIIHE+FGT PE+AVKIFVEF+RIESAIKAVVDLNGRFFGGRQV
Sbjct  288  PEVKDECNTKYGEVNSVIIHESFGTVPEDAVKIFVEFRRIESAIKAVVDLNGRFFGGRQV  347

Query  398  RAGFYNFDKFKSFQLH  413
            RAGFYN+DKFK FQLH
Sbjct  348  RAGFYNYDKFKCFQLH  363



Lambda      K        H
   0.322    0.137    0.423 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4150185960


Query= XP_011197246.1 probable cytosolic Fe-S cluster assembly factor
GI11683 [Bactrocera dorsalis]

Length=482
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q389R3_TRYB2  unnamed protein product                                 191     3e-55
O46094_DROME  unnamed protein product                                 31.6    1.6  
Q557E6_DICDI  unnamed protein product                                 29.3    7.0  


>Q389R3_TRYB2 unnamed protein product
Length=475

 Score = 191 bits (486),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 144/424 (34%), Positives = 206/424 (49%), Gaps = 57/424 (13%)

Query  4    FSGALQLTDLDDFITPSQECVKPVPIEKTKSKTGAKITIQGDGYYEETETGKQKLQKVEI  63
            FS +L L  +D +I PS+ C+ P  ++   S    K    G+             + V+I
Sbjct  6    FSASLMLAGMD-YIAPSEACILPTKLQGGTSDDSVKRHGAGN-------------EAVKI  51

Query  64   TLQDCLACSGCITSAEGVLITQQSQEELLRVLQENKALKTQNASEGVRTIVVTISPQPVI  123
            TLQDCLACSGC+T+AE +LIT QS+EELL+    ++AL      +  R   VTIS Q   
Sbjct  52   TLQDCLACSGCVTTAETILITSQSREELLK----DRAL------DPTRPFFVTISDQSAA  101

Query  124  SLAQRYNLKPEDAAKHLSGYFRSLGADYVLNTKIADDL--ALLECRNEFVERFRDSKSGD  181
            S+A       + A   +SG+FR+     VLN +   DL  AL     +  E +       
Sbjct  102  SIAAFLKTDVQRAFHIVSGFFRA-----VLNARYVSDLHWALRISVEKTAEEYCRRVR--  154

Query  182  AAGVTPMPMLSSSCPGWVCYAEKTHGNFILPYIATTRSPQQIMGVLVKQWLARKLDCAAE  241
                  +P++ S+CPGWVCY EK  G  ILP +    SPQ I G   K  +         
Sbjct  155  -CERERLPLIVSACPGWVCYCEK-QGAAILPLLCPVMSPQGIAGCYSKTLI--------P  204

Query  242  RIYHVTVMPCYDKKLEASREDFYSDANNSRDVDCVITSIEIEQMLISADTPLHTYTPSEI  301
            ++ HV+V PC+D+KLEA+R+   S  +  R  D V+++ E+   ++  D  L    P + 
Sbjct  205  QMCHVSVQPCFDRKLEAARDG--SSVSGERYTDFVLSTQELLDWMLEVDPSLPWQAPLDS  262

Query  302  DWPWHSGTPEASV---WAHEFSTSGGYADHVFKYAAKELFDENVEV--LEYKNLRNPDFR  356
            D       P       +A     SGGY  +    AA EL    +    + Y+  RN +  
Sbjct  263  DLEPLPILPPEEPKRSFAATMEGSGGYHRYAMHRAACELHGLELAPRDIHYEMKRNANHH  322

Query  357  EITLQHD-GQVVLKFAIANGFRNIQNLVQKLKR---GKAPYDFVEVMACPSGCINGGAQV  412
              T   + G+V   F +A GF+ IQN V+ +KR     A Y F+E+MACP GC+NGG Q 
Sbjct  323  LTTSPSNPGEV---FCVAYGFQQIQNTVRGIKRKLASVASYTFIELMACPEGCLNGGGQA  379

Query  413  RPPT  416
            R  T
Sbjct  380  RNGT  383


>O46094_DROME unnamed protein product
Length=850

 Score = 31.6 bits (70),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 16/56 (29%), Positives = 29/56 (52%), Gaps = 2/56 (4%)

Query  355  FREITLQHDGQVVLKFAIANGFRNIQNLVQKLKRGKAPYDFVE--VMACPSGCING  408
            F+    QHD + VL F   N +R I  + Q+LK+ ++ Y   +  ++ C +  +N 
Sbjct  141  FKSTMAQHDPETVLNFRWLNDYRQIGEVKQELKKRESEYIVYKDIIIYCATWNVNN  196


>Q557E6_DICDI unnamed protein product
Length=351

 Score = 29.3 bits (64),  Expect = 7.0, Method: Compositional matrix adjust.
 Identities = 35/135 (26%), Positives = 60/135 (44%), Gaps = 17/135 (13%)

Query  46   GYYEETETGKQKLQKVEIT--------LQDCLACSGCITSAEGVLITQQSQEELLRVLQE  97
            G+   T+  K + + ++IT        L D    SG IT   G   T ++Q  +   L  
Sbjct  95   GFRTATDINKARAEIIQITTGSKEFDSLLDGGIESGSITEIFGEFRTGKTQ--ICHTLCV  152

Query  98   NKALK-TQNASEGVRTIVV----TISPQPVISLAQRYNLKPEDAAKHLSGYFRSLGADYV  152
               L  +Q   EG R + +    T  P+ ++++A+RYNL  E    ++S Y R+  +D+ 
Sbjct  153  TCQLGYSQGGGEG-RALYIDTEGTFRPERLLAIAERYNLNGEHVLDNVS-YARAYNSDHQ  210

Query  153  LNTKIADDLALLECR  167
            L   +     + E R
Sbjct  211  LELLVQASAMMSESR  225



Lambda      K        H
   0.322    0.137    0.423 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4150185960


Query= XP_011197248.1 transmembrane protein 53 [Bactrocera dorsalis]

Length=415
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9TZH8_CAEEL  unnamed protein product                                 79.7    3e-16
Q54YR8_DICDI  unnamed protein product                                 70.1    2e-13


>Q9TZH8_CAEEL unnamed protein product
Length=325

 Score = 79.7 bits (195),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 73/267 (27%), Positives = 127/267 (48%), Gaps = 29/267 (11%)

Query  131  YNDSNVPIVMLLGWAGCQDRYLMKYSKIYEDRGLITVRYTAPVD--TLFWKRTA--MIPI  186
            ++D   P+++++GWAG   +++ KY K+Y D G   V    P    ++   R    M P+
Sbjct  63   HHDEKKPVILMVGWAGANPKHIDKYIKVYNDEGYRVVSLCPPCYHYSIPNSRVGFYMSPL  122

Query  187  GEKILKLMYDM-NFDSHPVIVHIFS-NG--GAYLYQHISLAMRKHKTPIQIRGMIFDSAP  242
               I     D  +F   P+IVH FS NG  G   +   + A  K +   +I+G+IFDSAP
Sbjct  123  FRAIDAKPGDFRSFAKCPIIVHSFSMNGVRGLISFWKWTEAEEKPQLRERIKGIIFDSAP  182

Query  243  ----GERRILGLYRAVTAIYGKERKKCHSVTALIITLTLSIMWFVE-------ETFAAFK  291
                G++    +  +   I   ER         ++T  L++  +++           +F 
Sbjct  183  SRPYGKQDATAMVISTPPIDAFERWISEQTRISVLTWFLNLRAYLQIPLLTMVPFLRSFV  242

Query  292  SLFFKSEPVQTNPFSDLKNEATQFPQLFVYSKGDVVIPYQDIEKFIKIRQERGVDVSAAC  351
            S+++    +QT+        A    QL++YSK D +I  + +EKFI+ ++E+G  V+A  
Sbjct  243  SIYYY---LQTH-------IALPRDQLYLYSKADTMIKAKHVEKFIEKQKEKGNSVTAID  292

Query  352  FEDAEHVKIYTKYPSQYIHCVCSFINN  378
            F D+EHV     +P  Y     +F+ +
Sbjct  293  FVDSEHVAHIRTHPKDYRTACLNFVRH  319


>Q54YR8_DICDI unnamed protein product
Length=270

 Score = 70.1 bits (170),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 69/278 (25%), Positives = 118/278 (42%), Gaps = 43/278 (15%)

Query  123  GDSDFVFVYNDSNVPIVMLLGWAGCQDRYLMKYSKIYEDRGLITVRYTA-PVDTLF----  177
             ++D    Y   + P+V++LGW GC+  +L+KY   +  RG  T  + + P+  L     
Sbjct  14   AENDSPLPYEGEDRPLVVVLGWMGCRREHLLKYVDQWRKRGFNTFSFCSKPIQLLVPGVI  73

Query  178  -WKRTAMIPIGEKILKLMYDMNFDSHPVIVHIFSNGGAYLYQHISLAMR-----KHKTPI  231
              K   M+   +K LK     N +   VI + FSNGG + Y H+   +      K   P+
Sbjct  74   QNKGDEMLEQIKKYLK----ENRNCKSVIFNAFSNGGGFYYAHMIRQIHEREDCKWMAPL  129

Query  232  QIRGMIFDSAPGERRILGLYRAVTAIYGKERKKCHSVTALIITLTLSIMWFVEETFAAFK  291
             ++G + DS P  R  L +Y A              + AL++ L + + W      ++++
Sbjct  130  -VKGTVLDSLPAIRP-LSIYSAFRLT--SPNMFVTFLLALVVPLFVVLFW---SKMSSYQ  182

Query  292  SLFFKSEPVQTNPFSDLKNEATQFPQLFVYSKGDVVIPYQDIEKFIKIRQERGVDVSA--  349
             +              L ++  Q+  L  YSK D ++   DI+  +   +    DV+   
Sbjct  183  QI--------------LTSKKNQWQHLIFYSKADTIVHSDDIDNLVGKIKNNLSDVNHLD  228

Query  350  -ACFEDAEHVKIYTKYPSQYI----HCVCSFINNCLSR  382
              CF+D+ HV     +P  Y     H V S  N+ L +
Sbjct  229  YKCFDDSPHVLHMRSHPKIYEDKLNHFVTSIKNSNLKK  266



Lambda      K        H
   0.322    0.137    0.423 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4150185960


Query= XP_011197249.1 transmembrane protein 53 [Bactrocera dorsalis]

Length=415
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9TZH8_CAEEL  unnamed protein product                                 79.7    3e-16
Q54YR8_DICDI  unnamed protein product                                 70.1    2e-13


>Q9TZH8_CAEEL unnamed protein product
Length=325

 Score = 79.7 bits (195),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 73/267 (27%), Positives = 127/267 (48%), Gaps = 29/267 (11%)

Query  131  YNDSNVPIVMLLGWAGCQDRYLMKYSKIYEDRGLITVRYTAPVD--TLFWKRTA--MIPI  186
            ++D   P+++++GWAG   +++ KY K+Y D G   V    P    ++   R    M P+
Sbjct  63   HHDEKKPVILMVGWAGANPKHIDKYIKVYNDEGYRVVSLCPPCYHYSIPNSRVGFYMSPL  122

Query  187  GEKILKLMYDM-NFDSHPVIVHIFS-NG--GAYLYQHISLAMRKHKTPIQIRGMIFDSAP  242
               I     D  +F   P+IVH FS NG  G   +   + A  K +   +I+G+IFDSAP
Sbjct  123  FRAIDAKPGDFRSFAKCPIIVHSFSMNGVRGLISFWKWTEAEEKPQLRERIKGIIFDSAP  182

Query  243  ----GERRILGLYRAVTAIYGKERKKCHSVTALIITLTLSIMWFVE-------ETFAAFK  291
                G++    +  +   I   ER         ++T  L++  +++           +F 
Sbjct  183  SRPYGKQDATAMVISTPPIDAFERWISEQTRISVLTWFLNLRAYLQIPLLTMVPFLRSFV  242

Query  292  SLFFKSEPVQTNPFSDLKNEATQFPQLFVYSKGDVVIPYQDIEKFIKIRQERGVDVSAAC  351
            S+++    +QT+        A    QL++YSK D +I  + +EKFI+ ++E+G  V+A  
Sbjct  243  SIYYY---LQTH-------IALPRDQLYLYSKADTMIKAKHVEKFIEKQKEKGNSVTAID  292

Query  352  FEDAEHVKIYTKYPSQYIHCVCSFINN  378
            F D+EHV     +P  Y     +F+ +
Sbjct  293  FVDSEHVAHIRTHPKDYRTACLNFVRH  319


>Q54YR8_DICDI unnamed protein product
Length=270

 Score = 70.1 bits (170),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 69/278 (25%), Positives = 118/278 (42%), Gaps = 43/278 (15%)

Query  123  GDSDFVFVYNDSNVPIVMLLGWAGCQDRYLMKYSKIYEDRGLITVRYTA-PVDTLF----  177
             ++D    Y   + P+V++LGW GC+  +L+KY   +  RG  T  + + P+  L     
Sbjct  14   AENDSPLPYEGEDRPLVVVLGWMGCRREHLLKYVDQWRKRGFNTFSFCSKPIQLLVPGVI  73

Query  178  -WKRTAMIPIGEKILKLMYDMNFDSHPVIVHIFSNGGAYLYQHISLAMR-----KHKTPI  231
              K   M+   +K LK     N +   VI + FSNGG + Y H+   +      K   P+
Sbjct  74   QNKGDEMLEQIKKYLK----ENRNCKSVIFNAFSNGGGFYYAHMIRQIHEREDCKWMAPL  129

Query  232  QIRGMIFDSAPGERRILGLYRAVTAIYGKERKKCHSVTALIITLTLSIMWFVEETFAAFK  291
             ++G + DS P  R  L +Y A              + AL++ L + + W      ++++
Sbjct  130  -VKGTVLDSLPAIRP-LSIYSAFRLT--SPNMFVTFLLALVVPLFVVLFW---SKMSSYQ  182

Query  292  SLFFKSEPVQTNPFSDLKNEATQFPQLFVYSKGDVVIPYQDIEKFIKIRQERGVDVSA--  349
             +              L ++  Q+  L  YSK D ++   DI+  +   +    DV+   
Sbjct  183  QI--------------LTSKKNQWQHLIFYSKADTIVHSDDIDNLVGKIKNNLSDVNHLD  228

Query  350  -ACFEDAEHVKIYTKYPSQYI----HCVCSFINNCLSR  382
              CF+D+ HV     +P  Y     H V S  N+ L +
Sbjct  229  YKCFDDSPHVLHMRSHPKIYEDKLNHFVTSIKNSNLKK  266



Lambda      K        H
   0.322    0.137    0.423 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4150185960


Query= XP_011197250.1 transmembrane protein 53 [Bactrocera dorsalis]

Length=415
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9TZH8_CAEEL  unnamed protein product                                 79.7    3e-16
Q54YR8_DICDI  unnamed protein product                                 70.1    2e-13


>Q9TZH8_CAEEL unnamed protein product
Length=325

 Score = 79.7 bits (195),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 73/267 (27%), Positives = 127/267 (48%), Gaps = 29/267 (11%)

Query  131  YNDSNVPIVMLLGWAGCQDRYLMKYSKIYEDRGLITVRYTAPVD--TLFWKRTA--MIPI  186
            ++D   P+++++GWAG   +++ KY K+Y D G   V    P    ++   R    M P+
Sbjct  63   HHDEKKPVILMVGWAGANPKHIDKYIKVYNDEGYRVVSLCPPCYHYSIPNSRVGFYMSPL  122

Query  187  GEKILKLMYDM-NFDSHPVIVHIFS-NG--GAYLYQHISLAMRKHKTPIQIRGMIFDSAP  242
               I     D  +F   P+IVH FS NG  G   +   + A  K +   +I+G+IFDSAP
Sbjct  123  FRAIDAKPGDFRSFAKCPIIVHSFSMNGVRGLISFWKWTEAEEKPQLRERIKGIIFDSAP  182

Query  243  ----GERRILGLYRAVTAIYGKERKKCHSVTALIITLTLSIMWFVE-------ETFAAFK  291
                G++    +  +   I   ER         ++T  L++  +++           +F 
Sbjct  183  SRPYGKQDATAMVISTPPIDAFERWISEQTRISVLTWFLNLRAYLQIPLLTMVPFLRSFV  242

Query  292  SLFFKSEPVQTNPFSDLKNEATQFPQLFVYSKGDVVIPYQDIEKFIKIRQERGVDVSAAC  351
            S+++    +QT+        A    QL++YSK D +I  + +EKFI+ ++E+G  V+A  
Sbjct  243  SIYYY---LQTH-------IALPRDQLYLYSKADTMIKAKHVEKFIEKQKEKGNSVTAID  292

Query  352  FEDAEHVKIYTKYPSQYIHCVCSFINN  378
            F D+EHV     +P  Y     +F+ +
Sbjct  293  FVDSEHVAHIRTHPKDYRTACLNFVRH  319


>Q54YR8_DICDI unnamed protein product
Length=270

 Score = 70.1 bits (170),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 69/278 (25%), Positives = 118/278 (42%), Gaps = 43/278 (15%)

Query  123  GDSDFVFVYNDSNVPIVMLLGWAGCQDRYLMKYSKIYEDRGLITVRYTA-PVDTLF----  177
             ++D    Y   + P+V++LGW GC+  +L+KY   +  RG  T  + + P+  L     
Sbjct  14   AENDSPLPYEGEDRPLVVVLGWMGCRREHLLKYVDQWRKRGFNTFSFCSKPIQLLVPGVI  73

Query  178  -WKRTAMIPIGEKILKLMYDMNFDSHPVIVHIFSNGGAYLYQHISLAMR-----KHKTPI  231
              K   M+   +K LK     N +   VI + FSNGG + Y H+   +      K   P+
Sbjct  74   QNKGDEMLEQIKKYLK----ENRNCKSVIFNAFSNGGGFYYAHMIRQIHEREDCKWMAPL  129

Query  232  QIRGMIFDSAPGERRILGLYRAVTAIYGKERKKCHSVTALIITLTLSIMWFVEETFAAFK  291
             ++G + DS P  R  L +Y A              + AL++ L + + W      ++++
Sbjct  130  -VKGTVLDSLPAIRP-LSIYSAFRLT--SPNMFVTFLLALVVPLFVVLFW---SKMSSYQ  182

Query  292  SLFFKSEPVQTNPFSDLKNEATQFPQLFVYSKGDVVIPYQDIEKFIKIRQERGVDVSA--  349
             +              L ++  Q+  L  YSK D ++   DI+  +   +    DV+   
Sbjct  183  QI--------------LTSKKNQWQHLIFYSKADTIVHSDDIDNLVGKIKNNLSDVNHLD  228

Query  350  -ACFEDAEHVKIYTKYPSQYI----HCVCSFINNCLSR  382
              CF+D+ HV     +P  Y     H V S  N+ L +
Sbjct  229  YKCFDDSPHVLHMRSHPKIYEDKLNHFVTSIKNSNLKK  266



Lambda      K        H
   0.322    0.137    0.423 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4150185960


Query= XP_011197251.1 coatomer subunit epsilon [Bactrocera dorsalis]

Length=306
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9Y0Y5_DROME  unnamed protein product                                 514     0.0  
COPE_CAEEL  unnamed protein product                                   124     3e-33
Q381U5_TRYB2  unnamed protein product                                 58.9    1e-09


>Q9Y0Y5_DROME unnamed protein product
Length=306

 Score = 514 bits (1324),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 244/301 (81%), Positives = 270/301 (90%), Gaps = 0/301 (0%)

Query  6    QNEEDTNSTLFYARNEYYIGNFMGSINFVLPEQGTATTELLSYMYLSYLAIDSGRLIATD  65
            QNEEDTNS LF ARNEYYIGNFMGSINFVLPEQGTA  ELLSYMYLSYLAIDSGR++A+D
Sbjct  5    QNEEDTNSVLFDARNEYYIGNFMGSINFVLPEQGTAGPELLSYMYLSYLAIDSGRIVASD  64

Query  66   IKENNNTALLALRYVNEAFEQPAKIESILEKLTDKVASEEDETNIWHIATAIVYCYDGQF  125
            IKE N+T L ALR V+EAFEQP++ E +LEKLTDKVA EEDETNIWH+ATAIVYC+DGQF
Sbjct  65   IKEGNSTPLQALRLVHEAFEQPSRTEELLEKLTDKVAGEEDETNIWHLATAIVYCHDGQF  124

Query  126  ENALKILHGSTNLESMALSVQCLLRLNRIDLAKQLVAKMQEISDDATLTQLAQAWIALSL  185
            ENALKILHGSTNLESMALSVQCLLRL R+DLAKQLVAKMQEISDDATLTQLAQAW+AL+ 
Sbjct  125  ENALKILHGSTNLESMALSVQCLLRLQRVDLAKQLVAKMQEISDDATLTQLAQAWVALAQ  184

Query  186  GTEQMQDAFHIFQEFCEKHNPTPLLLNGQAVVHLGLERYEEAEAVLRDALTKKHNDYDTL  245
            GTEQMQDAFHI+QEFCEK  PTP LLNGQAVVHLGLERYEEA++VLR++L KKHNDYDTL
Sbjct  185  GTEQMQDAFHIYQEFCEKFKPTPALLNGQAVVHLGLERYEEADSVLRESLLKKHNDYDTL  244

Query  246  INMMVLAHLTGKSHETIARYWEQLKQFHPKSEFVADLEKKSTEFDKLCLQYSLSGDEAVQ  305
            IN+MV AHLTGK  E I R  EQL+QF+PKS+FV DL+KKS EFD+LCLQY + G E + 
Sbjct  245  INLMVHAHLTGKPTEAITRNLEQLRQFYPKSDFVTDLDKKSAEFDRLCLQYDVEGGEKLL  304

Query  306  A  306
            A
Sbjct  305  A  305


>COPE_CAEEL unnamed protein product
Length=292

 Score = 124 bits (310),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 87/283 (31%), Positives = 142/283 (50%), Gaps = 4/283 (1%)

Query  15   LFYARNEYYIGNFMGSINFVL---PEQGTATTELLSYMYLSYLAIDSGRLIATDIKENNN  71
            LF  RN +++G++   I   L    +      E   Y+Y SY+A     +   +I     
Sbjct  5    LFSIRNYFFLGSYQSCIGEALKFSSKNEEEKQEKDVYLYRSYIAQGQAFIPLKEIPAATK  64

Query  72   TA-LLALRYVNEAFEQPAKIESILEKLTDKVASEEDETNIWHIATAIVYCYDGQFENALK  130
            +A L A+R   E    PA  + IL ++ ++VAS   ++ I  +  A +       ++A +
Sbjct  65   SADLAAVRRYAEFRNNPAAKKKILAEVQEEVASRNIKSEIAAVLAATILNEADLSQDAFR  124

Query  131  ILHGSTNLESMALSVQCLLRLNRIDLAKQLVAKMQEISDDATLTQLAQAWIALSLGTEQM  190
             +     LE+ A  V  L+++N+  LA   V KM +I +DATL+QLA A +     + ++
Sbjct  125  AVSRFEGLEARASKVFILIKMNKRKLAIGEVKKMNQIDEDATLSQLANALVTSFGASGKV  184

Query  191  QDAFHIFQEFCEKHNPTPLLLNGQAVVHLGLERYEEAEAVLRDALTKKHNDYDTLINMMV  250
            +DA +I+ E  +K+  T  L   QAVV +  + Y  AE +L  AL + + D D LIN +V
Sbjct  185  KDALYIYSEMSDKYGRTTDLEMHQAVVSILTQDYAAAEELLESALERDNKDADVLINSIV  244

Query  251  LAHLTGKSHETIARYWEQLKQFHPKSEFVADLEKKSTEFDKLC  293
             A L  K  + + R+  QLK  HP   +V D  +K  EFD++ 
Sbjct  245  SAQLNEKDDDVVERFISQLKHEHPNHPWVIDFNEKEAEFDRVA  287


>Q381U5_TRYB2 unnamed protein product
Length=324

 Score = 58.9 bits (141),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/146 (31%), Positives = 68/146 (47%), Gaps = 7/146 (5%)

Query  126  ENALKILHGSTNLESMALSVQCLLRLNRIDLAKQLVAKMQEISDDATLTQLAQAWIALSL  185
            EN+L  LH    +E   + V+ LLR+ R ++A+  V  M++  +++ LT L      L  
Sbjct  153  ENSLLRLH----MELRVIVVEALLRMGRTEMARSEVKAMEQADEESMLTVLCSGITNLYE  208

Query  186  GT---EQMQDAFHIFQEFCEKHNPTPLLLNGQAVVHLGLERYEEAEAVLRDALTKKHNDY  242
            G    E  Q A   F+E       + L  N  A+  + L  Y EAE  L D L  K  D 
Sbjct  209  GIKTKEAYQTALRRFKELTMSCGQSVLASNLTALAQIQLGEYTEAERTLLDVLAMKSGDS  268

Query  243  DTLINMMVLAHLTGKSHETIARYWEQ  268
            DT  N+ V++  +GK  ++   Y  Q
Sbjct  269  DTTANLAVISAHSGKGLDSTGLYTRQ  294



Lambda      K        H
   0.322    0.137    0.423 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4150185960


Query= XP_011197252.1 PHD finger-like domain-containing protein 5A
[Bactrocera dorsalis]

Length=111
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PHF5A_DROME  unnamed protein product                                  221     2e-76
G5EBY6_CAEEL  unnamed protein product                                 207     6e-71
Q38AM4_TRYB2  unnamed protein product                                 70.9    4e-17


>PHF5A_DROME unnamed protein product
Length=111

 Score = 221 bits (562),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 109/111 (98%), Positives = 109/111 (98%), Gaps = 0/111 (0%)

Query  1    MAKHHPDLIFCRKQPGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVI  60
            MAKHHPDLIFCRKQPGVAIGRLCEK DGKCVICDSYVRPCTLVRICDECNYGSYQGRCVI
Sbjct  1    MAKHHPDLIFCRKQPGVAIGRLCEKDDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVI  60

Query  61   CGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKQNY  111
            CGGPGVSDAYYCK CTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKQNY
Sbjct  61   CGGPGVSDAYYCKSCTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKQNY  111


>G5EBY6_CAEEL unnamed protein product
Length=110

 Score = 207 bits (526),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)

Query  1    MAKHHPDLIFCRKQPGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVI  60
            MAKHHPDLIFCRKQPG+AIGRLCEKCDG+CVICDS+VRPCTLVRIC+ECNYGSYQGRCVI
Sbjct  1    MAKHHPDLIFCRKQPGIAIGRLCEKCDGRCVICDSHVRPCTLVRICEECNYGSYQGRCVI  60

Query  61   CGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKQN  110
            CGG GVSDAYYCKECTI EKDRDGCPKIVNLGS+KTDLFYERKK+G K++
Sbjct  61   CGGAGVSDAYYCKECTILEKDRDGCPKIVNLGSAKTDLFYERKKFGSKKS  110


>Q38AM4_TRYB2 unnamed protein product
Length=110

 Score = 70.9 bits (172),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 55/87 (63%), Gaps = 6/87 (7%)

Query  10  FCRKQPGVAIGRLCEKCDGKCVICD---SYVRPCTL-VRICDECNYGSY-QGRCVICGGP  64
            CRK PGV IG +C++ +G+CVICD     V P    VRIC +C +G     RCV+C   
Sbjct  11  MCRKLPGVDIGYVCQQHEGRCVICDLQFDEVLPTMREVRICSDCGFGREGDERCVMCNAS  70

Query  65  GVSD-AYYCKECTIQEKDRDGCPKIVN  90
             ++ AYYC+ C   EKDRDGCP+++N
Sbjct  71  KPTEVAYYCQYCVALEKDRDGCPRVLN  97



Lambda      K        H
   0.322    0.137    0.423 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4150185960


Query= XP_011197253.1 kynurenine formamidase [Bactrocera dorsalis]

Length=315
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

KFA_DROME  unnamed protein product                                    234     1e-75
Q7JR83_DROME  unnamed protein product                                 36.2    0.039
Q960T4_DROME  unnamed protein product                                 35.4    0.057


>KFA_DROME unnamed protein product
Length=300

 Score = 234 bits (596),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/300 (40%), Positives = 180/300 (60%), Gaps = 16/300 (5%)

Query  14   DLNKEYSPTKNSKRFLEAAEPDKAVIEQFLKVTTKQTAEARAKYKVRRD-VSYGKSFKHN  72
            DL+++Y P+ ++ RF +  EP+ AV+E F++VT +   E   K  +  D + YG+     
Sbjct  8    DLDRDYFPSYHTTRFQDQPEPNLAVLEHFVRVTKQHGRELTEKQGITVDHLRYGEG----  63

Query  73   INTVDNQIVDIYYKD-TENGTPIFVYIHGGYWQELDRSTSGSFVEPLVEQGFRVIAADYN  131
                  Q+VD++Y + T N  P+FV++HGGYWQE+D S S S V PLV +G+RV   DYN
Sbjct  64   -----RQLVDVFYSEKTTNQAPLFVFVHGGYWQEMDMSMSCSIVGPLVRRGYRVAVMDYN  118

Query  132  LCPSVSLATLNEQLKHFFEWLYAYASDTKASKISISGHSAGAYMIT-LLFNSGLLKLPFA  190
            LCP V+L  L  Q  HF  W++ Y   TK S ++ +GHSAGA+++  +L    ++    +
Sbjct  119  LCPQVTLEQLMTQFTHFLNWIFDYTEMTKVSSLTFAGHSAGAHLLAQILMRPNVITAQRS  178

Query  191  DNTVSFFLISGVFDLRELWNLPSVNPANILNLDLVSAEELSPICWKLDEEFIELAKQIKL  250
                +   + GV+DLREL NL SVNP NIL L+  + E +SP+ W    E+ ++      
Sbjct  179  KMVWALIFLCGVYDLRELSNLESVNPKNILGLNERNIESVSPMLW----EYTDVTVWNST  234

Query  251  RIHVLVAENDSETFKGQSLAFAKKLRDTGLEIEFKIFEGYDHFDIIENVPVKGSEINTYL  310
            +I+V+ AE+DS TF  QS  +A  LR  G +  F +F+GYDHFDIIE   +  S+++ +L
Sbjct  235  KIYVVAAEHDSTTFIEQSRHYADVLRKKGYKASFTLFKGYDHFDIIEETAIDDSDVSRFL  294


>Q7JR83_DROME unnamed protein product
Length=881

 Score = 36.2 bits (82),  Expect = 0.039, Method: Compositional matrix adjust.
 Identities = 30/116 (26%), Positives = 55/116 (47%), Gaps = 12/116 (10%)

Query  204  DLRELWNLPSVNPANILNLDLVSAEELSPICWKLDEEFIELAKQIKLRIHVLVAENDSET  263
            D+R +  L + +P+     D+     LSP  W  DE   +L +   L +++    +D   
Sbjct  744  DVRNMDALIARSPSEEFAFDVPKDPFLSPY-WASDEWLSQLPETKILTLNMDPCLDDC--  800

Query  264  FKGQSLAFAKKLRDTGLEIEFKIFEGYDH----FDIIENVPVKGSEINTYLLKNLV  315
                 + FAKKL+  G +++ +I EG  H    F ++ N  ++GS+     L+ L+
Sbjct  801  -----VMFAKKLKRLGRQVDLEILEGLPHGFLNFTMLSNEAMEGSKKCIKSLQTLL  851


>Q960T4_DROME unnamed protein product
Length=507

 Score = 35.4 bits (80),  Expect = 0.057, Method: Compositional matrix adjust.
 Identities = 30/116 (26%), Positives = 55/116 (47%), Gaps = 12/116 (10%)

Query  204  DLRELWNLPSVNPANILNLDLVSAEELSPICWKLDEEFIELAKQIKLRIHVLVAENDSET  263
            D+R +  L + +P+     D+     LSP  W  DE   +L +   L +++    +D   
Sbjct  370  DVRNMDALIARSPSEEFAFDVPKDPFLSPY-WASDEWLSQLPETKILTLNMDPCLDDC--  426

Query  264  FKGQSLAFAKKLRDTGLEIEFKIFEGYDH----FDIIENVPVKGSEINTYLLKNLV  315
                 + FAKKL+  G +++ +I EG  H    F ++ N  ++GS+     L+ L+
Sbjct  427  -----VMFAKKLKRLGRQVDLEILEGLPHGFLNFTMLSNEAMEGSKKCIKSLQTLL  477



Lambda      K        H
   0.322    0.137    0.423 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4150185960


Query= XP_011197254.2 coiled-coil domain-containing protein lobo
[Bactrocera dorsalis]

Length=193
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DRC7_DROME  unnamed protein product                                   185     3e-54
Q57VW3_TRYB2  unnamed protein product                                 68.6    2e-13
Q9VYY7_DROME  unnamed protein product                                 28.1    5.9  


>DRC7_DROME unnamed protein product
Length=897

 Score = 185 bits (469),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 119/173 (69%), Gaps = 2/173 (1%)

Query  11   KKKDGIVRIDPKKHEEKLKEIEERLTADVLAAPEEALDEVLLDEEEMYEEENAVEEQYSE  70
            K K  +  IDP ++  K KEI+E+  +    +  +  DE+  + E   EE  + E   SE
Sbjct  8    KYKKVVSNIDPSRYSAKFKEIDEQRRSQ--GSESDFADEMEGEFEAEMEEMGSSEFSLSE  65

Query  71   IESPLAVGHIDLTFTETANEFANSPQCYPPSYYTLSPKERILLLYAENFRKQFVTLYPDR  130
             E  L +G IDL+F ET  EF NSPQCYPPSYYTLSPKER+LLLYAENFRKQ V  YP R
Sbjct  66   GEPSLNIGKIDLSFPETVEEFENSPQCYPPSYYTLSPKERLLLLYAENFRKQLVLSYPKR  125

Query  131  RPLVLALPNECNIQKFVCTTIRPTSFIYIPLIGSEIECAKFVADFIIYEPPED  183
            R +VLALPNEC +QKFVCTTIRPT+FIY  LI S  E AKFVADFI YEP +D
Sbjct  126  RAMVLALPNECKVQKFVCTTIRPTAFIYTQLISSVEEIAKFVADFIQYEPLQD  178


>Q57VW3_TRYB2 unnamed protein product
Length=1403

 Score = 68.6 bits (166),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 36/88 (41%), Positives = 50/88 (57%), Gaps = 5/88 (6%)

Query  98   YPPSYYTLSPKERILLLYAENFRKQFVTLYPDRRPLVLALPNECNIQKFVCTTIRPTSFI  157
            +PPSY  +SP E  +      F+  F   +P R P +LA  NEC  +K +CT IRPT F 
Sbjct  78   FPPSYTEISPAEESIFKATRRFQSHFHEYFPKRAPQLLAPLNECRTRKMICTFIRPTIFP  137

Query  158  YIPL--IGSEIECAKFVADFIIYEPPED  183
            +  L  +GS   CA+F+A ++ YE  ED
Sbjct  138  FDELFDVGS---CARFLAGYMRYEILED  162


>Q9VYY7_DROME unnamed protein product
Length=837

 Score = 28.1 bits (61),  Expect = 5.9, Method: Compositional matrix adjust.
 Identities = 14/22 (64%), Positives = 17/22 (77%), Gaps = 0/22 (0%)

Query  44   EEALDEVLLDEEEMYEEENAVE  65
            E+A +EVLLDE+E   EENA E
Sbjct  603  EDAREEVLLDEDEKNLEENAAE  624



Lambda      K        H
   0.322    0.137    0.423 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4150185960


Query= XP_011197256.1 FK506-binding protein 5 isoform X1 [Bactrocera
dorsalis]

Length=1267
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q95TR4_DROME  unnamed protein product                                 337     1e-98
Q5UDQ8_DROME  unnamed protein product                                 342     5e-97
Q8WSS9_DROME  unnamed protein product                                 342     6e-97


>Q95TR4_DROME unnamed protein product
Length=950

 Score = 337 bits (865),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 175/378 (46%), Positives = 242/378 (64%), Gaps = 31/378 (8%)

Query  618  KCTTPLANEKSGKTTEERLPLTSDYEELLKVCREADTSADMEKLVKTKLIKYYYNVHPDF  677
            +C  P+ N      +    P T++Y  LL++CRE D S  ME+LVK +L +YYY+    F
Sbjct  388  ECFPPIKNAAKAAPSVN-APFTTEYAALLRLCREVDKSTHMERLVKGELTQYYYSAPESF  446

Query  678  VRSKGFGKNLRTVITNIQNEPDLVYLHLKTIVDELKVRSKNK------------------  719
            V S GF   +   +  I++E  LVY+HLK ++DEL  R   K                  
Sbjct  447  VMSCGFRNLVTMAMARIRSESYLVYVHLKYVLDELASRRLTKMFPTVRAIPPASQFPLPP  506

Query  720  --ETLLPVSVKDEEKSDSPSGEKDKEKDTAVGGEDNGPPVEDIS-------STGNKHTDE  770
              +  LP ++   ++   P+  K   + T + G +    VE+++       S   +  DE
Sbjct  507  ASQFPLPPTLTTPKQ---PAIVKAPGQQTVMAGREQDDEVEEVTLVNVGTVSCEERRRDE  563

Query  771  QIKKLNKALYILTKRIEVLESAEVDWDEEDSSYLQVERFKKRACQIYEKICDLTGESKNA  830
            +I+   + L+ +TKRI++LE AEVD ++EDSSYLQ+ERFKKRACQIYEKICDL GESK+ 
Sbjct  564  RIRHFYRTLHAITKRIKMLEEAEVDLNDEDSSYLQLERFKKRACQIYEKICDLKGESKSV  623

Query  831  HRLVKKPIHFNGTTYTQFNKTLQAYINRTKEFPDYFDVLRMLEHCNRQYDYALANFEMKR  890
             R +KKPIHF  + Y  FN +L A++NR ++FPDY DVL++LE CN++ +  LA +EMKR
Sbjct  624  RRQLKKPIHFKDSDYPHFNNSLSAFVNRMQDFPDYHDVLQILEKCNKEKELGLAKYEMKR  683

Query  891  IAHDAFVKVGKLLQSRRKTDLYETVTHFTAHEKDPATIDASLQAKLSENQKKRTRISDVI  950
            IA+DAF KVG++LQSRRK DLYETVTH+TA+ KDPA+ D  L AKL EN KK+T+ISD++
Sbjct  684  IAYDAFNKVGRMLQSRRKNDLYETVTHYTANGKDPASSDPELLAKLKENNKKQTKISDIL  743

Query  951  EKYAREQDMIKEELKEAR  968
            EKYA EQD+  EE +EAR
Sbjct  744  EKYALEQDLNAEERQEAR  761


 Score = 41.2 bits (95),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 81/187 (43%), Gaps = 37/187 (20%)

Query  127  ERQTPTPPRHLTQTLNTKQHPQQQPVANKQQQQQQQLPHLSQLPQLQPSPSVLRKRLSTT  186
            ++Q+P  P  L  ++   Q P QQP      Q   +   + +LP LQ    +L K     
Sbjct  34   QQQSPKTP--LVNSVMGPQFPSQQPSLPVVNQITHKSMTIQRLPMLQTVQKILPK-----  86

Query  187  SSPTQQLQMPPQQQPQPPKLQKSKQQ----QHNPPKLQQQQLQKPQHTLKLDSQV---RK  239
                   Q+ PQQ P P  + + +        NPP   +  + +P    K+ S V    K
Sbjct  87   -------QIAPQQTPPPAHIVQKQTMPNAAMQNPPFAHRPPIVRPMTVAKI-SPVPTNNK  138

Query  240  ISTP-----PATISPSNITTT---------STSNTTLIPLISS-VQSMAAGATPPLQLLA  284
            +  P      + +SP++ T T         S   T+  P+ S+ VQ   A ATPP +LLA
Sbjct  139  VCIPMKPQMASYVSPTDPTMTAARTLPFRSSQRKTSEAPMTSTHVQGFTASATPPQRLLA  198

Query  285  TPPHSAA  291
            TPPH AA
Sbjct  199  TPPHCAA  205


>Q5UDQ8_DROME unnamed protein product
Length=1620

 Score = 342 bits (877),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 174/357 (49%), Positives = 238/357 (67%), Gaps = 26/357 (7%)

Query  637   PLTSDYEELLKVCREADTSADMEKLVKTKLIKYYYNVHPDFVRSKGFGKNLRTV-ITNIQ  695
             P T++Y  LL++CRE D S  ME+LVK +L +YYY+    FV S GF +NL T+ +  I+
Sbjct  1076  PFTTEYAALLRLCREVDKSTHMERLVKGELTQYYYSAPESFVMSCGF-RNLVTMAMARIR  1134

Query  696   NEPDLVYLHLKTIVDELK----------VRSKNKETLLPVSVKDEEK-------SDSPSG  738
             +E  LVY+HLK ++DEL           VR+    +  P+    +            P+ 
Sbjct  1135  SESYLVYVHLKYVLDELASRRLTKMFPTVRAIPPASQFPLPPASQFPLPPTLTTPKQPAI  1194

Query  739   EKDKEKDTAVGGEDNGPPVEDIS-------STGNKHTDEQIKKLNKALYILTKRIEVLES  791
              K   + T + G +    VE+++       S   +  DE+I+   + L+ +TKRI++LE 
Sbjct  1195  VKAPGQQTVMAGREQDDEVEEVTLVNVGTVSCEERRRDERIRHFYRTLHAITKRIKMLEE  1254

Query  792   AEVDWDEEDSSYLQVERFKKRACQIYEKICDLTGESKNAHRLVKKPIHFNGTTYTQFNKT  851
             AEVD ++EDSSYLQ+ERFKKRACQIYEKICDL GESK+  R +KKPIHF  + Y  FN +
Sbjct  1255  AEVDLNDEDSSYLQLERFKKRACQIYEKICDLKGESKSVRRQLKKPIHFKDSDYPHFNNS  1314

Query  852   LQAYINRTKEFPDYFDVLRMLEHCNRQYDYALANFEMKRIAHDAFVKVGKLLQSRRKTDL  911
             L A++NR ++FPDY DVL++LE CN++ +  LA +EMKRIA+DAF KVG++LQSRRK DL
Sbjct  1315  LSAFVNRMQDFPDYHDVLQILEKCNKEKELGLAKYEMKRIAYDAFNKVGRMLQSRRKNDL  1374

Query  912   YETVTHFTAHEKDPATIDASLQAKLSENQKKRTRISDVIEKYAREQDMIKEELKEAR  968
             YETVTH+TA+ KDPA+ D  L AKL EN KK+T+ISD++EKYA EQD+  EE +EAR
Sbjct  1375  YETVTHYTANGKDPASSDPELLAKLKENNKKQTKISDILEKYALEQDLNAEERQEAR  1431


>Q8WSS9_DROME unnamed protein product
Length=1645

 Score = 342 bits (877),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 177/376 (47%), Positives = 244/376 (65%), Gaps = 27/376 (7%)

Query  618   KCTTPLANEKSGKTTEERLPLTSDYEELLKVCREADTSADMEKLVKTKLIKYYYNVHPDF  677
             +C  P+ N      +    P T++Y  LL++CRE D S  ME+LVK +L +YYY+    F
Sbjct  1083  ECFPPIKNAAKAAPSVN-APFTTEYAALLRLCREVDKSTHMERLVKGELTQYYYSAPESF  1141

Query  678   VRSKGFGKNLRTV-ITNIQNEPDLVYLHLKTIVDELK----------VRSKNKETLLPVS  726
             V S GF +NL T+ +  I++E  LVY+HLK ++DEL           VR+    +  P+ 
Sbjct  1142  VMSCGF-RNLVTMAMARIRSESYLVYVHLKYVLDELASRRLTKMFPTVRAIPPASQFPLP  1200

Query  727   VKDEEK-------SDSPSGEKDKEKDTAVGGEDNGPPVEDIS-------STGNKHTDEQI  772
                +            P+  K   + T + G +    VE+++       S   +  DE+I
Sbjct  1201  PASQFPLPPTLTTPKQPAIVKAPGQQTVMAGREQDDEVEEVTLVNVGTVSCEERRRDERI  1260

Query  773   KKLNKALYILTKRIEVLESAEVDWDEEDSSYLQVERFKKRACQIYEKICDLTGESKNAHR  832
             +   + L+ +TKRI++LE AEVD ++EDSSYLQ+ERFKKRACQIYEKICDL GESK+  R
Sbjct  1261  RHFYRTLHAITKRIKMLEEAEVDLNDEDSSYLQLERFKKRACQIYEKICDLKGESKSVRR  1320

Query  833   LVKKPIHFNGTTYTQFNKTLQAYINRTKEFPDYFDVLRMLEHCNRQYDYALANFEMKRIA  892
              +KKPIHF  + Y  FN +L A++NR ++FPDY DVL++LE CN++ +  LA +EMKRIA
Sbjct  1321  QLKKPIHFKDSDYPHFNNSLSAFVNRMQDFPDYHDVLQILEKCNKEKELGLAKYEMKRIA  1380

Query  893   HDAFVKVGKLLQSRRKTDLYETVTHFTAHEKDPATIDASLQAKLSENQKKRTRISDVIEK  952
             +DAF KVG++LQSRRK DLYETVTH+TA+ KDPA+ D  L AKL EN KK+T+ISD++EK
Sbjct  1381  YDAFNKVGRMLQSRRKNDLYETVTHYTANGKDPASSDPELLAKLKENNKKQTKISDILEK  1440

Query  953   YAREQDMIKEELKEAR  968
             YA EQD+  EE +EAR
Sbjct  1441  YALEQDLNAEERQEAR  1456


 Score = 36.6 bits (83),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 25/38 (66%), Gaps = 1/38 (3%)

Query  255  TSTSNTTLIPLISS-VQSMAAGATPPLQLLATPPHSAA  291
            +S   T+  P+ S+ VQ   A ATPP +LLATPPH AA
Sbjct  863  SSQRKTSEAPMTSTHVQGFTASATPPQRLLATPPHCAA  900



Lambda      K        H
   0.322    0.137    0.423 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4150185960


Query= XP_011197257.1 FK506-binding protein 5 isoform X2 [Bactrocera
dorsalis]

Length=1254
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q95TR4_DROME  unnamed protein product                                 337     1e-98
Q8WSS9_DROME  unnamed protein product                                 342     3e-97
Q5UDQ8_DROME  unnamed protein product                                 342     4e-97


>Q95TR4_DROME unnamed protein product
Length=950

 Score = 337 bits (864),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 175/378 (46%), Positives = 242/378 (64%), Gaps = 31/378 (8%)

Query  605  KCTTPLANEKSGKTTEERLPLTSDYEELLKVCREADTSADMEKLVKTKLIKYYYNVHPDF  664
            +C  P+ N      +    P T++Y  LL++CRE D S  ME+LVK +L +YYY+    F
Sbjct  388  ECFPPIKNAAKAAPSVN-APFTTEYAALLRLCREVDKSTHMERLVKGELTQYYYSAPESF  446

Query  665  VRSKGFGKNLRTVITNIQNEPDLVYLHLKTIVDELKVRSKNK------------------  706
            V S GF   +   +  I++E  LVY+HLK ++DEL  R   K                  
Sbjct  447  VMSCGFRNLVTMAMARIRSESYLVYVHLKYVLDELASRRLTKMFPTVRAIPPASQFPLPP  506

Query  707  --ETLLPVSVKDEEKSDSPSGEKDKEKDTAVGGEDNGPPVEDIS-------STGNKHTDE  757
              +  LP ++   ++   P+  K   + T + G +    VE+++       S   +  DE
Sbjct  507  ASQFPLPPTLTTPKQ---PAIVKAPGQQTVMAGREQDDEVEEVTLVNVGTVSCEERRRDE  563

Query  758  QIKKLNKALYILTKRIEVLESAEVDWDEEDSSYLQVERFKKRACQIYEKICDLTGESKNA  817
            +I+   + L+ +TKRI++LE AEVD ++EDSSYLQ+ERFKKRACQIYEKICDL GESK+ 
Sbjct  564  RIRHFYRTLHAITKRIKMLEEAEVDLNDEDSSYLQLERFKKRACQIYEKICDLKGESKSV  623

Query  818  HRLVKKPIHFNGTTYTQFNKTLQAYINRTKEFPDYFDVLRMLEHCNRQYDYALANFEMKR  877
             R +KKPIHF  + Y  FN +L A++NR ++FPDY DVL++LE CN++ +  LA +EMKR
Sbjct  624  RRQLKKPIHFKDSDYPHFNNSLSAFVNRMQDFPDYHDVLQILEKCNKEKELGLAKYEMKR  683

Query  878  IAHDAFVKVGKLLQSRRKTDLYETVTHFTAHEKDPATIDASLQAKLSENQKKRTRISDVI  937
            IA+DAF KVG++LQSRRK DLYETVTH+TA+ KDPA+ D  L AKL EN KK+T+ISD++
Sbjct  684  IAYDAFNKVGRMLQSRRKNDLYETVTHYTANGKDPASSDPELLAKLKENNKKQTKISDIL  743

Query  938  EKYAREQDMIKEELKEAR  955
            EKYA EQD+  EE +EAR
Sbjct  744  EKYALEQDLNAEERQEAR  761


 Score = 41.2 bits (95),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 81/187 (43%), Gaps = 37/187 (20%)

Query  114  ERQTPTPPRHLTQTLNTKQHPQQQPVANKQQQQQQQLPHLSQLPQLQPSPSVLRKRLSTT  173
            ++Q+P  P  L  ++   Q P QQP      Q   +   + +LP LQ    +L K     
Sbjct  34   QQQSPKTP--LVNSVMGPQFPSQQPSLPVVNQITHKSMTIQRLPMLQTVQKILPK-----  86

Query  174  SSPTQQLQMPPQQQPQPPKLQKSKQQ----QHNPPKLQQQQLQKPQHTLKLDSQV---RK  226
                   Q+ PQQ P P  + + +        NPP   +  + +P    K+ S V    K
Sbjct  87   -------QIAPQQTPPPAHIVQKQTMPNAAMQNPPFAHRPPIVRPMTVAKI-SPVPTNNK  138

Query  227  ISTP-----PATISPSNITTT---------STSNTTLIPLISS-VQSMAAGATPPLQLLA  271
            +  P      + +SP++ T T         S   T+  P+ S+ VQ   A ATPP +LLA
Sbjct  139  VCIPMKPQMASYVSPTDPTMTAARTLPFRSSQRKTSEAPMTSTHVQGFTASATPPQRLLA  198

Query  272  TPPHSAA  278
            TPPH AA
Sbjct  199  TPPHCAA  205


>Q8WSS9_DROME unnamed protein product
Length=1645

 Score = 342 bits (878),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 177/376 (47%), Positives = 244/376 (65%), Gaps = 27/376 (7%)

Query  605   KCTTPLANEKSGKTTEERLPLTSDYEELLKVCREADTSADMEKLVKTKLIKYYYNVHPDF  664
             +C  P+ N      +    P T++Y  LL++CRE D S  ME+LVK +L +YYY+    F
Sbjct  1083  ECFPPIKNAAKAAPSVN-APFTTEYAALLRLCREVDKSTHMERLVKGELTQYYYSAPESF  1141

Query  665   VRSKGFGKNLRTV-ITNIQNEPDLVYLHLKTIVDELK----------VRSKNKETLLPVS  713
             V S GF +NL T+ +  I++E  LVY+HLK ++DEL           VR+    +  P+ 
Sbjct  1142  VMSCGF-RNLVTMAMARIRSESYLVYVHLKYVLDELASRRLTKMFPTVRAIPPASQFPLP  1200

Query  714   VKDEEK-------SDSPSGEKDKEKDTAVGGEDNGPPVEDIS-------STGNKHTDEQI  759
                +            P+  K   + T + G +    VE+++       S   +  DE+I
Sbjct  1201  PASQFPLPPTLTTPKQPAIVKAPGQQTVMAGREQDDEVEEVTLVNVGTVSCEERRRDERI  1260

Query  760   KKLNKALYILTKRIEVLESAEVDWDEEDSSYLQVERFKKRACQIYEKICDLTGESKNAHR  819
             +   + L+ +TKRI++LE AEVD ++EDSSYLQ+ERFKKRACQIYEKICDL GESK+  R
Sbjct  1261  RHFYRTLHAITKRIKMLEEAEVDLNDEDSSYLQLERFKKRACQIYEKICDLKGESKSVRR  1320

Query  820   LVKKPIHFNGTTYTQFNKTLQAYINRTKEFPDYFDVLRMLEHCNRQYDYALANFEMKRIA  879
              +KKPIHF  + Y  FN +L A++NR ++FPDY DVL++LE CN++ +  LA +EMKRIA
Sbjct  1321  QLKKPIHFKDSDYPHFNNSLSAFVNRMQDFPDYHDVLQILEKCNKEKELGLAKYEMKRIA  1380

Query  880   HDAFVKVGKLLQSRRKTDLYETVTHFTAHEKDPATIDASLQAKLSENQKKRTRISDVIEK  939
             +DAF KVG++LQSRRK DLYETVTH+TA+ KDPA+ D  L AKL EN KK+T+ISD++EK
Sbjct  1381  YDAFNKVGRMLQSRRKNDLYETVTHYTANGKDPASSDPELLAKLKENNKKQTKISDILEK  1440

Query  940   YAREQDMIKEELKEAR  955
             YA EQD+  EE +EAR
Sbjct  1441  YALEQDLNAEERQEAR  1456


 Score = 36.6 bits (83),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 25/38 (66%), Gaps = 1/38 (3%)

Query  242  TSTSNTTLIPLISS-VQSMAAGATPPLQLLATPPHSAA  278
            +S   T+  P+ S+ VQ   A ATPP +LLATPPH AA
Sbjct  863  SSQRKTSEAPMTSTHVQGFTASATPPQRLLATPPHCAA  900


>Q5UDQ8_DROME unnamed protein product
Length=1620

 Score = 342 bits (877),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 174/357 (49%), Positives = 238/357 (67%), Gaps = 26/357 (7%)

Query  624   PLTSDYEELLKVCREADTSADMEKLVKTKLIKYYYNVHPDFVRSKGFGKNLRTV-ITNIQ  682
             P T++Y  LL++CRE D S  ME+LVK +L +YYY+    FV S GF +NL T+ +  I+
Sbjct  1076  PFTTEYAALLRLCREVDKSTHMERLVKGELTQYYYSAPESFVMSCGF-RNLVTMAMARIR  1134

Query  683   NEPDLVYLHLKTIVDELK----------VRSKNKETLLPVSVKDEEK-------SDSPSG  725
             +E  LVY+HLK ++DEL           VR+    +  P+    +            P+ 
Sbjct  1135  SESYLVYVHLKYVLDELASRRLTKMFPTVRAIPPASQFPLPPASQFPLPPTLTTPKQPAI  1194

Query  726   EKDKEKDTAVGGEDNGPPVEDIS-------STGNKHTDEQIKKLNKALYILTKRIEVLES  778
              K   + T + G +    VE+++       S   +  DE+I+   + L+ +TKRI++LE 
Sbjct  1195  VKAPGQQTVMAGREQDDEVEEVTLVNVGTVSCEERRRDERIRHFYRTLHAITKRIKMLEE  1254

Query  779   AEVDWDEEDSSYLQVERFKKRACQIYEKICDLTGESKNAHRLVKKPIHFNGTTYTQFNKT  838
             AEVD ++EDSSYLQ+ERFKKRACQIYEKICDL GESK+  R +KKPIHF  + Y  FN +
Sbjct  1255  AEVDLNDEDSSYLQLERFKKRACQIYEKICDLKGESKSVRRQLKKPIHFKDSDYPHFNNS  1314

Query  839   LQAYINRTKEFPDYFDVLRMLEHCNRQYDYALANFEMKRIAHDAFVKVGKLLQSRRKTDL  898
             L A++NR ++FPDY DVL++LE CN++ +  LA +EMKRIA+DAF KVG++LQSRRK DL
Sbjct  1315  LSAFVNRMQDFPDYHDVLQILEKCNKEKELGLAKYEMKRIAYDAFNKVGRMLQSRRKNDL  1374

Query  899   YETVTHFTAHEKDPATIDASLQAKLSENQKKRTRISDVIEKYAREQDMIKEELKEAR  955
             YETVTH+TA+ KDPA+ D  L AKL EN KK+T+ISD++EKYA EQD+  EE +EAR
Sbjct  1375  YETVTHYTANGKDPASSDPELLAKLKENNKKQTKISDILEKYALEQDLNAEERQEAR  1431



Lambda      K        H
   0.322    0.137    0.423 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4150185960


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jan 6, 2022  1:11 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_011197258.1 carbohydrate sulfotransferase 4 [Bactrocera dorsalis]

Length=451
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TPST_DROME  unnamed protein product                                   32.3    0.82 
Q4QCH4_LEIMA  unnamed protein product                                 30.8    2.6  
SOX15_DROME  unnamed protein product                                  29.3    8.3  


>TPST_DROME unnamed protein product
Length=499

 Score = 32.3 bits (72),  Expect = 0.82, Method: Compositional matrix adjust.
 Identities = 27/115 (23%), Positives = 51/115 (44%), Gaps = 12/115 (10%)

Query  285  NVRMILLVRDPRGTMQSRKHRDWCAGNRDCENPHYVCQDLVDDYHAAVELLKEH-----P  339
            N + + +VRD R T+ S   R       D  +     Q     ++ A+E++ E       
Sbjct  177  NAKFLFMVRDGRATVHSIISRKVTITGFDLSSYRQCMQK----WNHAIEVMHEQCRDIGK  232

Query  340  SRFRTLRYEDLSLNTYDMTQEVLQFYGLPFDPLV---EEFLDTHTKVNIGGVSST  391
             R   + YE L L+  +  +++L+F  +P++  V   EEF++    V +  V  +
Sbjct  233  DRCMMVYYEQLVLHPEEWMRKILKFLDVPWNDAVLHHEEFINKPNGVPLSKVERS  287


>Q4QCH4_LEIMA unnamed protein product
Length=1242

 Score = 30.8 bits (68),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 19/64 (30%), Positives = 31/64 (48%), Gaps = 6/64 (9%)

Query  378   DTHTKVNIGGVSSTYRDSKSAPFHWKQDLRPDEIQYIQNN----CEEAMQLWGYRKIDNF  433
             +TH+   I G+ ST  +SK   + W+ D R  E Q++  +       A+ L G  ++D  
Sbjct  986   NTHSVGTIVGILSTPTESKLLSYFWRHDARGREAQHVAKHFRGILASAVALSG--RVDEV  1043

Query  434   TNFQ  437
               FQ
Sbjct  1044  VVFQ  1047


>SOX15_DROME unnamed protein product
Length=784

 Score = 29.3 bits (64),  Expect = 8.3, Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 38/83 (46%), Gaps = 5/83 (6%)

Query  80   GDISGIQTGYVDRHHVGTASVAYNMTATIADVLAAQRSKILTEMENFEYPQGRFGVDAEK  139
            GD+     GY++RH    A + Y    T +   +A+ S+I   M  F        ++ +K
Sbjct  178  GDLCAPNCGYLERHKPLPADLKYRPGGTQSK--SAKESRIRRPMNAFMV---WAKIERKK  232

Query  140  LSDMTPETNGTPVRSVIITTWRS  162
            L+D  P+ +   +  ++   WRS
Sbjct  233  LADENPDLHNADLSKMLGKKWRS  255



Lambda      K        H
   0.321    0.135    0.411 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5006522700


Query= XP_011197260.2 cyclin-dependent kinase-like 1 [Bactrocera dorsalis]

Length=419
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

X2J708_DROME  unnamed protein product                                 708     0.0  
Q9VMN3_DROME  unnamed protein product                                 707     0.0  
M9MRD8_DROME  unnamed protein product                                 707     0.0  


>X2J708_DROME unnamed protein product
Length=412

 Score = 708 bits (1827),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/420 (86%), Positives = 364/420 (87%), Gaps = 29/420 (7%)

Query  1    MDRYEKLSRLGEGSYGVVYKCRDRETGALVAVKRFVESEDDPAIRKIALREIRLLKNLKH  60
            MDRYEKLSRLGEGSYGVVYKCRDRETGALVAVKRFVESEDDPAIRKIALREIRLLKNLKH
Sbjct  21   MDRYEKLSRLGEGSYGVVYKCRDRETGALVAVKRFVESEDDPAIRKIALREIRLLKNLKH  80

Query  61   PNLVSLLEVFRRKRRLHLVFEFCELTVLHELERHPQGCPEHLTKQIVYQTLLGVAYCHKQ  120
            PNLVSLLEVFRRKRRLHLVFEFCELTVLHELERHPQGCPEHLTKQI YQTLLGVAYCHKQ
Sbjct  81   PNLVSLLEVFRRKRRLHLVFEFCELTVLHELERHPQGCPEHLTKQICYQTLLGVAYCHKQ  140

Query  121  NCLHRDIKPENILLTAQGQVKLCDFGFARMLSPGENYTDYVATRWYRAPELLVGDTQYGT  180
             CLHRDIKPENILLTAQGQVKLCDFGFARMLSPGENYTDYVATRWYRAPELLVGDTQYGT
Sbjct  141  GCLHRDIKPENILLTAQGQVKLCDFGFARMLSPGENYTDYVATRWYRAPELLVGDTQYGT  200

Query  181  AVDVWAIGCLFAELVRGEALWPGRSDVDQLYLIRKTLGDLLPRHIQIFSQNEYFKGITLP  240
             VDVWAIGCLFAELVRGEALWPGRSDVDQLYLIRKTLGDLLPRHIQIF QNEYFKGITLP
Sbjct  201  PVDVWAIGCLFAELVRGEALWPGRSDVDQLYLIRKTLGDLLPRHIQIFGQNEYFKGITLP  260

Query  241  VPPTLEPLEDKMPAKSLQNPLTIDFLKKCLDKDPAKRWSCEKLIKHSYFDDYVAKQRELE  300
            VPPTLEPLEDKMPAKS QNPLTIDFLKKCLDKDP KRWSCEKL KHSYFDDY+AKQRELE
Sbjct  261  VPPTLEPLEDKMPAKSQQNPLTIDFLKKCLDKDPTKRWSCEKLTKHSYFDDYIAKQRELE  320

Query  301  HVNSLEAAALQRQQQLLQQQQQLQQHLMLQPHSQQLQPQSQQHTPLQAQHHQQQQQQQQQ  360
            HVNSLEAA L RQQQL  QQ       ML   +QQLQ    Q                  
Sbjct  321  HVNSLEAANL-RQQQLASQQ------FMLATAAQQLQTGPAQAA----------------  357

Query  361  TPLLLAAQAARDKSKTSNTSLPLLTNTQLSHH-HADYVKLQPINKNATLLHRTEHHLPTI  419
                 A  AARDKSKTSNTSLPLL +TQ  HH H DYVKLQP+NKNA LLHRTEHHLPTI
Sbjct  358  -----AIAAARDKSKTSNTSLPLLPSTQHHHHPHQDYVKLQPLNKNANLLHRTEHHLPTI  412


>Q9VMN3_DROME unnamed protein product
Length=438

 Score = 707 bits (1826),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/420 (86%), Positives = 364/420 (87%), Gaps = 29/420 (7%)

Query  1    MDRYEKLSRLGEGSYGVVYKCRDRETGALVAVKRFVESEDDPAIRKIALREIRLLKNLKH  60
            MDRYEKLSRLGEGSYGVVYKCRDRETGALVAVKRFVESEDDPAIRKIALREIRLLKNLKH
Sbjct  47   MDRYEKLSRLGEGSYGVVYKCRDRETGALVAVKRFVESEDDPAIRKIALREIRLLKNLKH  106

Query  61   PNLVSLLEVFRRKRRLHLVFEFCELTVLHELERHPQGCPEHLTKQIVYQTLLGVAYCHKQ  120
            PNLVSLLEVFRRKRRLHLVFEFCELTVLHELERHPQGCPEHLTKQI YQTLLGVAYCHKQ
Sbjct  107  PNLVSLLEVFRRKRRLHLVFEFCELTVLHELERHPQGCPEHLTKQICYQTLLGVAYCHKQ  166

Query  121  NCLHRDIKPENILLTAQGQVKLCDFGFARMLSPGENYTDYVATRWYRAPELLVGDTQYGT  180
             CLHRDIKPENILLTAQGQVKLCDFGFARMLSPGENYTDYVATRWYRAPELLVGDTQYGT
Sbjct  167  GCLHRDIKPENILLTAQGQVKLCDFGFARMLSPGENYTDYVATRWYRAPELLVGDTQYGT  226

Query  181  AVDVWAIGCLFAELVRGEALWPGRSDVDQLYLIRKTLGDLLPRHIQIFSQNEYFKGITLP  240
             VDVWAIGCLFAELVRGEALWPGRSDVDQLYLIRKTLGDLLPRHIQIF QNEYFKGITLP
Sbjct  227  PVDVWAIGCLFAELVRGEALWPGRSDVDQLYLIRKTLGDLLPRHIQIFGQNEYFKGITLP  286

Query  241  VPPTLEPLEDKMPAKSLQNPLTIDFLKKCLDKDPAKRWSCEKLIKHSYFDDYVAKQRELE  300
            VPPTLEPLEDKMPAKS QNPLTIDFLKKCLDKDP KRWSCEKL KHSYFDDY+AKQRELE
Sbjct  287  VPPTLEPLEDKMPAKSQQNPLTIDFLKKCLDKDPTKRWSCEKLTKHSYFDDYIAKQRELE  346

Query  301  HVNSLEAAALQRQQQLLQQQQQLQQHLMLQPHSQQLQPQSQQHTPLQAQHHQQQQQQQQQ  360
            HVNSLEAA L RQQQL  QQ       ML   +QQLQ    Q                  
Sbjct  347  HVNSLEAANL-RQQQLASQQ------FMLATAAQQLQTGPAQAA----------------  383

Query  361  TPLLLAAQAARDKSKTSNTSLPLLTNTQLSHH-HADYVKLQPINKNATLLHRTEHHLPTI  419
                 A  AARDKSKTSNTSLPLL +TQ  HH H DYVKLQP+NKNA LLHRTEHHLPTI
Sbjct  384  -----AIAAARDKSKTSNTSLPLLPSTQHHHHPHQDYVKLQPLNKNANLLHRTEHHLPTI  438


>M9MRD8_DROME unnamed protein product
Length=435

 Score = 707 bits (1826),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/420 (86%), Positives = 364/420 (87%), Gaps = 29/420 (7%)

Query  1    MDRYEKLSRLGEGSYGVVYKCRDRETGALVAVKRFVESEDDPAIRKIALREIRLLKNLKH  60
            MDRYEKLSRLGEGSYGVVYKCRDRETGALVAVKRFVESEDDPAIRKIALREIRLLKNLKH
Sbjct  44   MDRYEKLSRLGEGSYGVVYKCRDRETGALVAVKRFVESEDDPAIRKIALREIRLLKNLKH  103

Query  61   PNLVSLLEVFRRKRRLHLVFEFCELTVLHELERHPQGCPEHLTKQIVYQTLLGVAYCHKQ  120
            PNLVSLLEVFRRKRRLHLVFEFCELTVLHELERHPQGCPEHLTKQI YQTLLGVAYCHKQ
Sbjct  104  PNLVSLLEVFRRKRRLHLVFEFCELTVLHELERHPQGCPEHLTKQICYQTLLGVAYCHKQ  163

Query  121  NCLHRDIKPENILLTAQGQVKLCDFGFARMLSPGENYTDYVATRWYRAPELLVGDTQYGT  180
             CLHRDIKPENILLTAQGQVKLCDFGFARMLSPGENYTDYVATRWYRAPELLVGDTQYGT
Sbjct  164  GCLHRDIKPENILLTAQGQVKLCDFGFARMLSPGENYTDYVATRWYRAPELLVGDTQYGT  223

Query  181  AVDVWAIGCLFAELVRGEALWPGRSDVDQLYLIRKTLGDLLPRHIQIFSQNEYFKGITLP  240
             VDVWAIGCLFAELVRGEALWPGRSDVDQLYLIRKTLGDLLPRHIQIF QNEYFKGITLP
Sbjct  224  PVDVWAIGCLFAELVRGEALWPGRSDVDQLYLIRKTLGDLLPRHIQIFGQNEYFKGITLP  283

Query  241  VPPTLEPLEDKMPAKSLQNPLTIDFLKKCLDKDPAKRWSCEKLIKHSYFDDYVAKQRELE  300
            VPPTLEPLEDKMPAKS QNPLTIDFLKKCLDKDP KRWSCEKL KHSYFDDY+AKQRELE
Sbjct  284  VPPTLEPLEDKMPAKSQQNPLTIDFLKKCLDKDPTKRWSCEKLTKHSYFDDYIAKQRELE  343

Query  301  HVNSLEAAALQRQQQLLQQQQQLQQHLMLQPHSQQLQPQSQQHTPLQAQHHQQQQQQQQQ  360
            HVNSLEAA L RQQQL  QQ       ML   +QQLQ    Q                  
Sbjct  344  HVNSLEAANL-RQQQLASQQ------FMLATAAQQLQTGPAQAA----------------  380

Query  361  TPLLLAAQAARDKSKTSNTSLPLLTNTQLSHH-HADYVKLQPINKNATLLHRTEHHLPTI  419
                 A  AARDKSKTSNTSLPLL +TQ  HH H DYVKLQP+NKNA LLHRTEHHLPTI
Sbjct  381  -----AIAAARDKSKTSNTSLPLLPSTQHHHHPHQDYVKLQPLNKNANLLHRTEHHLPTI  435



Lambda      K        H
   0.321    0.135    0.411 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5006522700


Query= XP_011197262.2 uncharacterized protein LOC105221833 [Bactrocera
dorsalis]

Length=309
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

D2KT99_CAEEL  unnamed protein product                                 29.3    4.9  
RBP2_DROME  unnamed protein product                                   29.3    5.3  
B2D6L4_CAEEL  unnamed protein product                                 28.9    6.2  


>D2KT99_CAEEL unnamed protein product
Length=460

 Score = 29.3 bits (64),  Expect = 4.9, Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 32/80 (40%), Gaps = 25/80 (31%)

Query  206  GYGTVENVRVLVTPRSGDVDEQKLRQTQRGPVNAAEMPVIAVLPANYKNTNTRVVQNKQL  265
            G+   ENV     P S D +EQ +                         TN R   + +L
Sbjct  85   GFAASENVIEASPPTSADTEEQPV-------------------------TNVRSRSHHKL  119

Query  266  SKLQQQPYSSYEEQQNDYNA  285
            ++ ++QP  +YEE+Q  Y A
Sbjct  120  NQKEKQPAPTYEERQAAYQA  139


>RBP2_DROME unnamed protein product
Length=2718

 Score = 29.3 bits (64),  Expect = 5.3, Method: Composition-based stats.
 Identities = 15/55 (27%), Positives = 31/55 (56%), Gaps = 0/55 (0%)

Query  229  LRQTQRGPVNAAEMPVIAVLPANYKNTNTRVVQNKQLSKLQQQPYSSYEEQQNDY  283
            L++TQ+   N  + P+IA +  + ++ N+R + N   S       S+YE+ ++D+
Sbjct  773  LQKTQKLIKNDDKHPLIAAMHRHQQDRNSRGIDNSFGSPDVHNNSSAYEDAEDDF  827


>B2D6L4_CAEEL unnamed protein product
Length=563

 Score = 28.9 bits (63),  Expect = 6.2, Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 32/80 (40%), Gaps = 25/80 (31%)

Query  206  GYGTVENVRVLVTPRSGDVDEQKLRQTQRGPVNAAEMPVIAVLPANYKNTNTRVVQNKQL  265
            G+   ENV     P S D +EQ +                         TN R   + +L
Sbjct  85   GFAASENVIEASPPTSADTEEQPV-------------------------TNVRSRSHHKL  119

Query  266  SKLQQQPYSSYEEQQNDYNA  285
            ++ ++QP  +YEE+Q  Y A
Sbjct  120  NQKEKQPAPTYEERQAAYQA  139



Lambda      K        H
   0.321    0.135    0.411 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5006522700


Query= XP_011197263.2 uncharacterized protein LOC105221834 [Bactrocera
dorsalis]

Length=229
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CPG1_CAEEL  unnamed protein product                                   33.9    0.090


>CPG1_CAEEL unnamed protein product
Length=584

 Score = 33.9 bits (76),  Expect = 0.090, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 48/123 (39%), Gaps = 12/123 (10%)

Query  95   TTAAPTVIIAESTATTPKTTTIITTTTTQRAT-----STATATEVTPITTKITATTINNS  149
            TT  P   + E+T T  +  T+   TTT+        ST T  E  P+  + TA+     
Sbjct  132  TTVNPYAPVEEATTTPAEDVTVPEETTTEAYAPVDDYSTTTPAEDVPVPVETTASPY---  188

Query  150  TTIKPLLTSTTTTDVQNIKSL----CRAGVFANYAYSRNCRYYYRCTNGYFLLQECGYLM  205
              I P  T     D    +S     C       Y++     +Y  C+NGY +  +C   +
Sbjct  189  APIVPYTTGAPAADEPVTRSAVTKSCVGKADGFYSFGECSDHYTACSNGYLIPMQCPARL  248

Query  206  LFD  208
             FD
Sbjct  249  AFD  251



Lambda      K        H
   0.321    0.135    0.411 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5006522700


Query= XP_011197264.1 septin-interacting protein 1 [Bactrocera dorsalis]

Length=849
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TFP11_DROME  unnamed protein product                                  999     0.0  
Q582H9_TRYB2  unnamed protein product                                 37.4    0.034
Q8SZM4_DROME  unnamed protein product                                 35.4    0.24 


>TFP11_DROME unnamed protein product
Length=839

 Score = 999 bits (2584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 528/865 (61%), Positives = 638/865 (74%), Gaps = 50/865 (6%)

Query  1    MSDNEYERFEITDYDLDNEFNPGRRRNL-SKNQQIYGIWADDSDNDSAEE--SSRRGRRG  57
            MSDN+YERFEITDYDLDNEFN  R R   S++QQIYGIWADDS+ +S  E  + RRGR  
Sbjct  1    MSDNDYERFEITDYDLDNEFNINRPRGRQSRHQQIYGIWADDSEEESGGEGGTKRRGRAA  60

Query  58   RVGLGGGGGGSKSKDYTAPVSFVAGGIQQAGKK---------NKKPVKDSAEQQITDEES  108
            R          K KDYT PV+FVAGGIQQAGKK          K   K+ AE    +E  
Sbjct  61   R----------KPKDYTMPVNFVAGGIQQAGKKKKKALQADDEKGSQKEGAEADQGEESD  110

Query  109  DEA-NARPAFGRKPKQVEAADGDTSDSATTSDDDERSQKQRAEVGRQQRSNNARQMGNPN  167
            D A + RPAFG+        D  +S+S++  +    S+KQ +    Q RS+ A +    N
Sbjct  111  DSAASGRPAFGQN-------DPGSSNSSSEEERPTLSRKQPSTTF-QHRSHIASER---N  159

Query  168  VGAWEQHTRGIGAKLLLQMGYKPGKGLGKDLQGISQPVQAHVRKGRGAIGAYGPEAAASV  227
            VGAWEQHTRGIGAKLLLQMGY+PGKGLGKDLQGIS PVQAHVRKGRGAIGAYGPE AAS+
Sbjct  160  VGAWEQHTRGIGAKLLLQMGYEPGKGLGKDLQGISHPVQAHVRKGRGAIGAYGPETAASI  219

Query  228  GGK-GPVVKEDEDVREAKEFKEKLNKWKKS----GDTRQDKSKRYYYRSVEEVIEKGKKG  282
            GGK    +K DEDVREAKEFK++LNKW+K      +  + + KRYYY+SVEEVI KG   
Sbjct  220  GGKTNKSIKVDEDVREAKEFKDQLNKWRKGSAGGAEPMERQGKRYYYKSVEEVIAKGHTS  279

Query  283  NFMLSEKISKKIGNVPVIDMTGPEKRVLSGYHALGQAKVADEE-LYDLEQAVASSSITAK  341
              +LSEK+SKK+GNV VIDMTGPEKRVLSGYHALGQAK+  EE LYD E     S+    
Sbjct  280  GHLLSEKLSKKLGNVRVIDMTGPEKRVLSGYHALGQAKITPEETLYDTEATEKGSA----  335

Query  342  KGSTFALPELMHNLQLIVNMCEQDIIALDKAEREATDRQEALEHERKNLDEIVHLEKNHI  401
                FA+PEL HNLQL+V+ CEQ IIA+D  ERE + +Q ALE E + L+EIV LE+NHI
Sbjct  336  PACVFAMPELTHNLQLLVSQCEQQIIAIDNQERECSSQQAALESEHRKLEEIVQLERNHI  395

Query  402  DTLEQALKLVEELTSSNDMTLQRAEQIFVTLQHDYAAEYKEFALGDLAAGVIAPLVKITL  461
             TLE++L+ VE L  + D++L +AE++F  L  DYAAE+ EF L DLAAGVIAPL+K  L
Sbjct  396  RTLEESLERVERLIDNPDLSLPQAERLFRELLVDYAAEFHEFGLADLAAGVIAPLLKREL  455

Query  462  ENWKPIEQPTQHVELIKKWRGILESNAEPQNESRNIFDPYSSLVWAGVIPSFRACAASWN  521
              W+P+E PT+ + LIKKWRG+L+     + + RN+FDPYSSL+WAGV+PSFR+ AA+W 
Sbjct  456  VQWQPLENPTEPLPLIKKWRGMLQQGDAAEQQPRNVFDPYSSLIWAGVMPSFRSSAAAWQ  515

Query  522  PKLHQPMAALLDCWAPLFPTWILDSVLEQLVLPQLSNGVRDWDPLTDTVPIHIWILPWNN  581
            PK H PMA+LLD WAPL P+W+LDSVLEQLVLP+L  GV++WDPLTDTVPI  W+LPW+ 
Sbjct  516  PKEHPPMASLLDAWAPLLPSWVLDSVLEQLVLPRLVAGVQEWDPLTDTVPIDSWVLPWHA  575

Query  582  ILGHKMEEFIFPTIREKLAAALQAWMPQDRSARAMLTPWKGAFNDVEMQRFLSQHIIPKL  641
            ILG K+EE ++P IR KL  AL+AW P DRSARAMLTPW+ AF + EMQ FL ++I+PKL
Sbjct  576  ILGSKLEEAVYPQIRSKLGIALRAWSPHDRSARAMLTPWQKAFPEEEMQEFLQRYIVPKL  635

Query  642  QLVLNEFIINPLQQQLELWNQVWEWHELVPTPQMAQLLDKYFFPKWMQVLVLWLNQSPDY  701
            Q  L E IINP+ Q LELW QVWEWHEL+    MAQLLD++FFP+WMQVLV+WLNQSPDY
Sbjct  636  QATLGELIINPMHQDLELWQQVWEWHELIDPMYMAQLLDRHFFPRWMQVLVVWLNQSPDY  695

Query  702  GEISRWYTGWKSMFSEEILREPAIKEHLRRALEMMHRATDVLAPPTLPSIPTPILTSTPP  761
             EISRWYTGWKSM SE +LREP++KEHLRRALE+MHRA+D     TL           P 
Sbjct  696  AEISRWYTGWKSMLSEPLLREPSVKEHLRRALEIMHRASD-----TLLQPTVTPTPPPPV  750

Query  762  PPPPPAMLDMQMVPPAQLEFKELVSQKCAERGILFAPLPGRRELGKQVYRVGKLYCYIDR  821
            PP P  M+D+ + PPAQLEFKELVSQ+CA+ GI+FAPLPGRRE+GKQ+YRVGKL+CYIDR
Sbjct  751  PPAPVIMMDL-IHPPAQLEFKELVSQQCADLGIIFAPLPGRREMGKQIYRVGKLFCYIDR  809

Query  822  NVCMLSDASMKNWLPTSVQQLLDHA  846
            +VCM+SD S  NW P S+  LL+ +
Sbjct  810  HVCMVSDGSFSNWKPVSLNHLLERS  834


>Q582H9_TRYB2 unnamed protein product
Length=271

 Score = 37.4 bits (85),  Expect = 0.034, Method: Compositional matrix adjust.
 Identities = 19/56 (34%), Positives = 29/56 (52%), Gaps = 0/56 (0%)

Query  165  NPNVGAWEQHTRGIGAKLLLQMGYKPGKGLGKDLQGISQPVQAHVRKGRGAIGAYG  220
            +PN   W +    +G  LLL+ G+  G GLGK+  G++  V+   + G   IG  G
Sbjct  4    DPNGTRWLKSENNVGRSLLLRGGWTEGSGLGKEKDGVTTHVKVRQKDGTMGIGYAG  59


>Q8SZM4_DROME unnamed protein product
Length=1004

 Score = 35.4 bits (80),  Expect = 0.24, Method: Compositional matrix adjust.
 Identities = 15/40 (38%), Positives = 26/40 (65%), Gaps = 0/40 (0%)

Query  178  IGAKLLLQMGYKPGKGLGKDLQGISQPVQAHVRKGRGAIG  217
            +G++LL +MG+  G+GLG+  QG +Q ++A  R     +G
Sbjct  938  VGSRLLQKMGWSEGQGLGRKNQGRTQIIEADGRSNYVGLG  977



Lambda      K        H
   0.321    0.135    0.411 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5006522700


Query= XP_011197266.1 phospholipase B1, membrane-associated [Bactrocera
dorsalis]

Length=454
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

COMF_DICDI  unnamed protein product                                   32.7    0.76 
Q9VQ78_DROME  unnamed protein product                                 31.6    1.6  
Q57VY5_TRYB2  unnamed protein product                                 30.4    3.3  


>COMF_DICDI unnamed protein product
Length=1106

 Score = 32.7 bits (73),  Expect = 0.76, Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 23/51 (45%), Gaps = 0/51 (0%)

Query  15    LVLCLICLQNTTQSWEFFRRLRQKKADKFWARLIGQKTVDDVHEAFNGNLL  65
             L L L+   NT  SWE F R+  K  D +W  +   +  +    + NG  L
Sbjct  1045  LFLKLVNFMNTGGSWESFDRVGIKIPDVYWTYIYNIRATNTAKPSVNGYFL  1095


>Q9VQ78_DROME unnamed protein product
Length=1189

 Score = 31.6 bits (70),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 14/44 (32%), Positives = 24/44 (55%), Gaps = 0/44 (0%)

Query  237  KDPNVDMENHWKLLTIFVGNNDVCSDMCHHDNATEFVRSHELDM  280
            +  N  M+  ++L+ ++V +ND CS M     A  F+RS   D+
Sbjct  180  QSKNTKMDRIFELIQLYVSSNDTCSSMAAFLAAKYFIRSDIKDL  223


>Q57VY5_TRYB2 unnamed protein product
Length=749

 Score = 30.4 bits (67),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 30/64 (47%), Gaps = 11/64 (17%)

Query  41   DKFWARLIGQKTVDDVHEAFNGNLLITDLDRNMR--------HLFVNIRRYGMERADMDQ  92
            DKFWA +    T + + E    +LL+ D+    R        H ++   RY  +RA + +
Sbjct  423  DKFWAAMDKYFTAESLEEV---SLLLADIPEETRIAYCSSIIHRYITTMRYADQRARLGE  479

Query  93   VFAK  96
            +F K
Sbjct  480  LFEK  483



Lambda      K        H
   0.321    0.135    0.411 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5006522700


Query= XP_011197267.1 neuroguidin [Bactrocera dorsalis]

Length=334
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VMM7_DROME  unnamed protein product                                 507     0.0  
Q8IGY8_DROME  unnamed protein product                                 507     0.0  
Q384L4_TRYB2  unnamed protein product                                 73.9    3e-14


>Q9VMM7_DROME unnamed protein product
Length=332

 Score = 507 bits (1306),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/310 (83%), Positives = 281/310 (91%), Gaps = 0/310 (0%)

Query  1    MVQALDYDCHVQQQDIPQAIQLLGEMNSNVKQVTDLVESMLQRVKRGELTTEYGLSFLEV  60
            MVQALDYDC  Q QDIPQAIQLLGEMNSNVKQVTDLVE MLQRVKRGELTTEYGLSFLEV
Sbjct  1    MVQALDYDCEAQGQDIPQAIQLLGEMNSNVKQVTDLVEGMLQRVKRGELTTEYGLSFLEV  60

Query  61   KYHMLLDYLINLTYVVLRKCSGETIEGDPSIERLIEIRTVLEKIRPIDHKLRYQIDKLVK  120
            KYHMLLDYLINLTYVVLRKCSGETIEGDPSIERLIEIRTVLEKIRPIDHKLRYQIDKLVK
Sbjct  61   KYHMLLDYLINLTYVVLRKCSGETIEGDPSIERLIEIRTVLEKIRPIDHKLRYQIDKLVK  120

Query  121  TATTGVSSSTDPILYKPNPDNMLTNAGGDDDADEDDEDASENSASESDGDDEEGEAGVKK  180
            TATTGVSSSTDPILYKPNPD+M+++AGG    ++D ED S+    + D +DE+     K 
Sbjct  121  TATTGVSSSTDPILYKPNPDDMMSSAGGAGRDEDDGEDDSDEEDEDDDEEDEDEAGAAKM  180

Query  181  PKKGATAGKTGIYVPPKIKPVYYDGDEKSADKDKKMIERAKKRAITASMLQDLKEEYLDA  240
            P+K ATAGK+G+YVPP+IKPVYYDGDE+ ADK+KK ++RAKKRAIT+SMLQDLKEEYLDA
Sbjct  181  PRKAATAGKSGVYVPPRIKPVYYDGDERDADKEKKALDRAKKRAITSSMLQDLKEEYLDA  240

Query  241  PTELSSGSRAQQLLSKQQKEKQEYEETYLTRLPVTKAEKHRQRKLTTLATLGDEILGEIS  300
            PTE+SSGSRAQQ+LS+ QKEKQEYEETYL RLPVTKAEKHRQRKLTTL TLGDEILGEIS
Sbjct  241  PTEISSGSRAQQMLSQAQKEKQEYEETYLMRLPVTKAEKHRQRKLTTLGTLGDEILGEIS  300

Query  301  RDPALRGEGS  310
            R+ ALRG+GS
Sbjct  301  RESALRGDGS  310


>Q8IGY8_DROME unnamed protein product
Length=332

 Score = 507 bits (1305),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/310 (83%), Positives = 280/310 (90%), Gaps = 0/310 (0%)

Query  1    MVQALDYDCHVQQQDIPQAIQLLGEMNSNVKQVTDLVESMLQRVKRGELTTEYGLSFLEV  60
            MVQALDYDC  Q QDIPQAIQLLGEMNSNVKQVTDLVE MLQRVKRGELTTEYGLSFLEV
Sbjct  1    MVQALDYDCEAQGQDIPQAIQLLGEMNSNVKQVTDLVEGMLQRVKRGELTTEYGLSFLEV  60

Query  61   KYHMLLDYLINLTYVVLRKCSGETIEGDPSIERLIEIRTVLEKIRPIDHKLRYQIDKLVK  120
            KYHMLLDYLINLTYVVLRKCSGETIEGDPSIERLIEIRTVLEKIRPIDHKLRYQIDKLVK
Sbjct  61   KYHMLLDYLINLTYVVLRKCSGETIEGDPSIERLIEIRTVLEKIRPIDHKLRYQIDKLVK  120

Query  121  TATTGVSSSTDPILYKPNPDNMLTNAGGDDDADEDDEDASENSASESDGDDEEGEAGVKK  180
            TATTGVSSSTDPILYKPNPD M+++AGG    ++D ED S+    + D +DE+     K 
Sbjct  121  TATTGVSSSTDPILYKPNPDEMMSSAGGAGRDEDDGEDDSDEEDEDDDEEDEDEAGAAKM  180

Query  181  PKKGATAGKTGIYVPPKIKPVYYDGDEKSADKDKKMIERAKKRAITASMLQDLKEEYLDA  240
            P+K ATAGK+G+YVPP+IKPVYYDGDE+ ADK+KK ++RAKKRAIT+SMLQDLKEEYLDA
Sbjct  181  PRKAATAGKSGVYVPPRIKPVYYDGDERDADKEKKALDRAKKRAITSSMLQDLKEEYLDA  240

Query  241  PTELSSGSRAQQLLSKQQKEKQEYEETYLTRLPVTKAEKHRQRKLTTLATLGDEILGEIS  300
            PTE+SSGSRAQQ+LS+ QKEKQEYEETYL RLPVTKAEKHRQRKLTTL TLGDEILGEIS
Sbjct  241  PTEISSGSRAQQMLSQAQKEKQEYEETYLMRLPVTKAEKHRQRKLTTLGTLGDEILGEIS  300

Query  301  RDPALRGEGS  310
            R+ ALRG+GS
Sbjct  301  RESALRGDGS  310


>Q384L4_TRYB2 unnamed protein product
Length=523

 Score = 73.9 bits (180),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 73/119 (61%), Gaps = 2/119 (2%)

Query  11   VQQQDIPQAIQLLGEMNSNVKQVTDLVESMLQRVKRGELTT--EYGLSFLEVKYHMLLDY  68
            + Q++ P+ I++L EM   + +V +L + + + + R  L++     + FLE K  ++L Y
Sbjct  145  IVQKESPEMIKMLEEMKRYLAEVRELGDPLHELLFRRRLSSADRSLVQFLETKVQLMLSY  204

Query  69   LINLTYVVLRKCSGETIEGDPSIERLIEIRTVLEKIRPIDHKLRYQIDKLVKTATTGVS  127
             +++T+ +L K  G+ I G P I+ L+EIR  LEK+  ++ KL+Y +++L+   TT V+
Sbjct  205  CMHVTFYLLMKTEGKKIAGHPVIDNLVEIRVYLEKLFHMEEKLQYSLNRLLSGKTTAVA  263



Lambda      K        H
   0.321    0.135    0.411 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5006522700


Query= XP_011197270.1 DNA polymerase delta subunit 3 [Bactrocera dorsalis]

Length=463
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9Y118_DROME  unnamed protein product                                 202     9e-60


>Q9Y118_DROME unnamed protein product
Length=431

 Score = 202 bits (513),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 177/499 (35%), Positives = 262/499 (53%), Gaps = 111/499 (22%)

Query  6    LEEALNDCVINFDKRVLLTDLINEYHMPIDEISSTLTKYLKQQEKEGTKYEKRFVIHGLE  65
            L++AL+DC+I+FD+ VL+TDL+ EY +   E++  L  Y+K+QE   TK+EKRF++HG  
Sbjct  3    LKKALDDCMIDFDRCVLVTDLLEEYKLSYKEVNDVLEAYIKEQE-PATKFEKRFLVHGKR  61

Query  66   K---EDANKEIFTIVKGEEKLKEWLSKLEDAESALYSVEIAGGAKAPAEDLKPVTWCAIK  122
            K    D+ ++++++V  E ++++WL+K++DAES LYSV+IAGG KAPA   KP+    +K
Sbjct  62   KTQGSDSGEDLYSVVL-ESRMQDWLAKVQDAESQLYSVKIAGGTKAPAAIFKPMQHLEVK  120

Query  123  IEDLQTRTGGAKQINGHVESTKNESGKLESKIDVKPAKGIANAFAKTKQSNTSDSSSATD  182
            +  ++ R G  K +     +T              P  G+     K++ + +  S SA  
Sbjct  121  LAKVEQRPGAGKIVPSANGTT--------------PHNGV-----KSEPTKSEPSKSAVK  161

Query  183  TKNKDAGSSKSKAAAKDKPSPQDKAKSELDAGKKSPQKTNEQKKISPKDKKAAAATASGQ  242
             +        SK++ K +P+   K+K+E     KS   + E KK SPK++ + A  A+ +
Sbjct  162  LE-------PSKSSLKSEPA---KSKAEKPVASKS---SPEDKKTSPKEQASKAKPAAAK  208

Query  243  KG-IGNFF---APKGKQSAETTSKAATGVIRQKSPKKLNDFFKKQL--------------  284
            KG I +FF   A K K    T SK+ +G +        ++FFKKQ               
Sbjct  209  KGSINSFFTAAASKPKDVKATPSKSTSGTV--------DNFFKKQPAGAKKSPPESEDKS  260

Query  285  --DNKETVKKEA------------DKANTSAQLFDDEDESKEESKMEEDEEAPVEVHVES  330
              D   + KKEA              ANTS QLFD+E     +                 
Sbjct  261  KKDASNSNKKEASKKKSPSPTKKPTTANTSMQLFDEESAESSDE----------------  304

Query  331  SDEEEEINKLRRKVIETEK---EEAATSSRKRLRIEDSDDEDDDVEQEEQPQPKQGKIDT  387
               EE+++ LRRKVIE++    +E A+SS++R RI DS+D       EEQP  K    +T
Sbjct  305  ---EEKLDMLRRKVIESDNDSDQEKASSSKRR-RISDSED-------EEQPPKKSADEET  353

Query  388  EEVTEIADTPPKSETYLDEDGFVITIKSKTHAKPAVARQKTPKKTSP---KKSPKESKSK  444
              + E  DT P +ETYLDEDGFVIT +  T A+PA  ++ +PK  +P   KKSP  +   
Sbjct  354  IALDEKMDTEPANETYLDEDGFVITQRKPTKAQPA-NKKVSPKAAAPVNKKKSPPSAAKA  412

Query  445  PTPAAKTKQGNIMNFFKKK  463
               A KTKQ  IMNFF KK
Sbjct  413  GKDAPKTKQAGIMNFFSKK  431



Lambda      K        H
   0.321    0.135    0.411 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5006522700


Query= XP_011197272.1 gamete and mating-type specific protein A [Bactrocera
dorsalis]

Length=224
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q45ZT6_STRPU  unnamed protein product                                 34.3    0.070
Q94269_CAEEL  unnamed protein product                                 31.2    0.78 
Q9VDD2_DROME  unnamed protein product                                 28.1    7.3  


>Q45ZT6_STRPU unnamed protein product
Length=983

 Score = 34.3 bits (77),  Expect = 0.070, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 34/78 (44%), Gaps = 15/78 (19%)

Query  86   SAPVPPITPATVAPTPSQPITPATHQQQLHHQQAQPITPPTVAP------SPAQPITPAT  139
            +AP+PP   A + PT + P+TP             P+TP   AP      +P  P   A 
Sbjct  217  TAPLPPTATAPLTPTATAPLTPTA---------TAPLTPTATAPLTPTATAPLTPTATAL  267

Query  140  IAPGPAQPITPAATTPAP  157
            + P     +TP AT P P
Sbjct  268  LTPTATASLTPTATAPLP  285


>Q94269_CAEEL unnamed protein product
Length=2314

 Score = 31.2 bits (69),  Expect = 0.78, Method: Compositional matrix adjust.
 Identities = 28/88 (32%), Positives = 46/88 (52%), Gaps = 7/88 (8%)

Query  85    PSAPVPPITPATVAPTPSQPITPATHQQQLHHQQAQPITPPTVA-PSPAQPITPATIAPG  143
             P+ P+  + P + APT S  ++  T+     +Q    + PP+VA   P  PI   T+ P 
Sbjct  2214  PTGPILTVVPVSSAPT-SGAVSSTTNTPSPTNQSPVTLPPPSVATAGPTGPIL--TVVPV  2270

Query  144   PAQPITPAAT---TPAPVQTTTETTATI  168
              + P + A +   T APV TTT+T++ +
Sbjct  2271  SSAPTSGAVSSTATAAPVITTTKTSSVL  2298


>Q9VDD2_DROME unnamed protein product
Length=1400

 Score = 28.1 bits (61),  Expect = 7.3, Method: Composition-based stats.
 Identities = 18/55 (33%), Positives = 26/55 (47%), Gaps = 8/55 (15%)

Query  105  ITPATHQQQLHHQQAQPITPPTVAPSPAQPITPA-----TIAPGPAQPITPAATT  154
            I P   +  LH Q+  P+ PP+  PSP  P +PA      +A     P+TP   +
Sbjct  292  ILPKALKALLHTQE--PVAPPS-RPSPVGPPSPAPTSSVIVAKETPVPVTPEPVS  343



Lambda      K        H
   0.321    0.135    0.411 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5006522700


Query= XP_011197273.1 fringe glycosyltransferase isoform X1 [Bactrocera
dorsalis]

Length=490
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

FNG_DROME  unnamed protein product                                    609     0.0  


>FNG_DROME unnamed protein product
Length=412

 Score = 609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/346 (84%), Positives = 307/346 (89%), Gaps = 9/346 (3%)

Query  146  PFVPSQAAPHTQ-TSYIIRKDIKSFNFSDIEINEEDATAAARLDDLARRSRNGELLHDLW  204
            P  P   AP    T+ IIRKDI+SFNFSDIE++E     A  L +LARRSRNGELL DL 
Sbjct  75   PTQPGAGAPAASPTTVIIRKDIRSFNFSDIEVSER--PTATLLTELARRSRNGELLRDLS  132

Query  205  QRAVTATPQPPITELDDIFISVKTTKNYHDTRLALIIKTWFQLARDQTWFFTDTDDAYYQ  264
            QRAVTATPQPP+TELDDIFISVKTTKNYHDTRLALIIKTWFQLARDQTWFFTDTDD YYQ
Sbjct  133  QRAVTATPQPPVTELDDIFISVKTTKNYHDTRLALIIKTWFQLARDQTWFFTDTDDHYYQ  192

Query  265  EKTKGHLINTNCSQGHFQEALCCKMSAELDVFLASGKKWFCHFDDDNYVNVPRLVKLLDE  324
            EKTKGHLINT CSQGHF++ALCCKMSAELDVFL SGKKWFCHFDDDNYVNVPRLVKLLDE
Sbjct  193  EKTKGHLINTKCSQGHFRKALCCKMSAELDVFLESGKKWFCHFDDDNYVNVPRLVKLLDE  252

Query  325  YSPSVDWYLGKPSIFSPLEIHLDSYPTTTHKNKTASEKISFWFATGGAGFCLSRALTMKM  384
            YSPSVDWYLGKPSI SPLEIHLDS      KN T ++KI+FWFATGGAGFCLSRALT+KM
Sbjct  253  YSPSVDWYLGKPSISSPLEIHLDS------KNTTTNKKITFWFATGGAGFCLSRALTLKM  306

Query  385  LPIAGGGKFISIGRKIRFPDDVTMGFIIEHLLKVPLRIVENFHSHLEPMEHIRPDTFPDQ  444
            LPIAGGGKFISIG KIRFPDDVTMGFIIEHLLKVPL +V+NFHSHLEPME IR DTF DQ
Sbjct  307  LPIAGGGKFISIGDKIRFPDDVTMGFIIEHLLKVPLTVVDNFHSHLEPMEFIRQDTFQDQ  366

Query  445  VSFSYAHMRNQWNVVKVDGFDLAKDPKRFYSLHCKLFPYFSFCPPR  490
            VSFSYAHM+NQWNV+KVDGFD+  DPKRFYSLHC+LFPYFSFCPPR
Sbjct  367  VSFSYAHMKNQWNVIKVDGFDMKTDPKRFYSLHCQLFPYFSFCPPR  412


 Score = 67.8 bits (164),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 53/92 (58%), Gaps = 4/92 (4%)

Query  1   MSVILLSLPHRYKRLLQAMTLAVAIIYTTLVLYQSAYGYPDLQ----QLPTQKHYIVETQ  56
           MS+ +LS P R+KR+LQAM LAVA++Y TL+LYQSAYGYP +Q    Q+       V T 
Sbjct  2   MSLTVLSPPQRFKRILQAMMLAVAVVYMTLLLYQSAYGYPGIQVPHSQVDALASEAVTTH  61

Query  57  TSPAAAAQTQSSTTSRSVAAAQQTSVHTKPLR  88
                    QSST ++  A A   S  T  +R
Sbjct  62  RDQLLQDYVQSSTPTQPGAGAPAASPTTVIIR  93



Lambda      K        H
   0.321    0.135    0.411 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5006522700


Query= XP_011197274.1 fringe glycosyltransferase isoform X2 [Bactrocera
dorsalis]

Length=489
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

FNG_DROME  unnamed protein product                                    609     0.0  
CHSSA_CAEEL  unnamed protein product                                  33.9    0.35 


>FNG_DROME unnamed protein product
Length=412

 Score = 609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/346 (84%), Positives = 307/346 (89%), Gaps = 9/346 (3%)

Query  145  PFVPSQAAPHTQ-TSYIIRKDIKSFNFSDIEINEEDATAAARLDDLARRSRNGELLHDLW  203
            P  P   AP    T+ IIRKDI+SFNFSDIE++E     A  L +LARRSRNGELL DL 
Sbjct  75   PTQPGAGAPAASPTTVIIRKDIRSFNFSDIEVSER--PTATLLTELARRSRNGELLRDLS  132

Query  204  QRAVTATPQPPITELDDIFISVKTTKNYHDTRLALIIKTWFQLARDQTWFFTDTDDAYYQ  263
            QRAVTATPQPP+TELDDIFISVKTTKNYHDTRLALIIKTWFQLARDQTWFFTDTDD YYQ
Sbjct  133  QRAVTATPQPPVTELDDIFISVKTTKNYHDTRLALIIKTWFQLARDQTWFFTDTDDHYYQ  192

Query  264  EKTKGHLINTNCSQGHFQEALCCKMSAELDVFLASGKKWFCHFDDDNYVNVPRLVKLLDE  323
            EKTKGHLINT CSQGHF++ALCCKMSAELDVFL SGKKWFCHFDDDNYVNVPRLVKLLDE
Sbjct  193  EKTKGHLINTKCSQGHFRKALCCKMSAELDVFLESGKKWFCHFDDDNYVNVPRLVKLLDE  252

Query  324  YSPSVDWYLGKPSIFSPLEIHLDSYPTTTHKNKTASEKISFWFATGGAGFCLSRALTMKM  383
            YSPSVDWYLGKPSI SPLEIHLDS      KN T ++KI+FWFATGGAGFCLSRALT+KM
Sbjct  253  YSPSVDWYLGKPSISSPLEIHLDS------KNTTTNKKITFWFATGGAGFCLSRALTLKM  306

Query  384  LPIAGGGKFISIGRKIRFPDDVTMGFIIEHLLKVPLRIVENFHSHLEPMEHIRPDTFPDQ  443
            LPIAGGGKFISIG KIRFPDDVTMGFIIEHLLKVPL +V+NFHSHLEPME IR DTF DQ
Sbjct  307  LPIAGGGKFISIGDKIRFPDDVTMGFIIEHLLKVPLTVVDNFHSHLEPMEFIRQDTFQDQ  366

Query  444  VSFSYAHMRNQWNVVKVDGFDLAKDPKRFYSLHCKLFPYFSFCPPR  489
            VSFSYAHM+NQWNV+KVDGFD+  DPKRFYSLHC+LFPYFSFCPPR
Sbjct  367  VSFSYAHMKNQWNVIKVDGFDMKTDPKRFYSLHCQLFPYFSFCPPR  412


 Score = 71.2 bits (173),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 56/95 (59%), Gaps = 11/95 (12%)

Query  1   MSVILLSLPHRYKRLLQAMTLAVAIIYTTLVLYQSAYGYPDLQLPTQKHYIVETQTSPAA  60
           MS+ +LS P R+KR+LQAM LAVA++Y TL+LYQSAYGYP +Q+P   H  V+   S A 
Sbjct  2   MSLTVLSPPQRFKRILQAMMLAVAVVYMTLLLYQSAYGYPGIQVP---HSQVDALASEAV  58

Query  61  AAQ--------TQSSTTSRSVAAAQQTSVHTKPLR  87
                       QSST ++  A A   S  T  +R
Sbjct  59  TTHRDQLLQDYVQSSTPTQPGAGAPAASPTTVIIR  93


>CHSSA_CAEEL unnamed protein product
Length=736

 Score = 33.9 bits (76),  Expect = 0.35, Method: Compositional matrix adjust.
 Identities = 39/182 (21%), Positives = 61/182 (34%), Gaps = 47/182 (26%)

Query  221  IFISVKTTKNYHDTRLALIIKTWFQLARDQTWFFT-----------------DTDDAYYQ  263
            I +++ T   Y DTR   + KTW Q    +   F                    DD Y  
Sbjct  84   ILVAIMTAAKYVDTRAYNVWKTWAQHIPGRVLIFVAEGTESVHEDMPLIRLKGVDDTYPP  143

Query  264  EKTKGHLINTNCSQGHFQEALCCKMSAELDVFLASGKKWFCHFDDDNYVNVPRLVKLLDE  323
            +K    ++          + L   M+ E D        WF   DDD Y+    L   L  
Sbjct  144  QKKSFAMV----------KWLAENMADEYD--------WFLRADDDLYIRGEELALFLRS  185

Query  324  YSPSVDWYLGKPSIFSPLEIHLDSYPTTTHKNKTASEKISFWFATGGAGFCLSRALTMKM  383
               S    +G+  + +  E  L +  +T +            +  GG G  +SR   +K+
Sbjct  186  VDSSKAHIIGQAGLGNSAEYGLLALGSTDN------------YCMGGPGIVMSRDTLLKV  233

Query  384  LP  385
             P
Sbjct  234  SP  235



Lambda      K        H
   0.321    0.135    0.411 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5006522700


Query= XP_011197275.1 uncharacterized protein LOC105221844 [Bactrocera
dorsalis]

Length=385
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

STX3_CAEEL  unnamed protein product                                   32.3    0.63 
M9PFL9_DROME  unnamed protein product                                 29.6    6.0  
M9PD87_DROME  unnamed protein product                                 29.6    6.0  


>STX3_CAEEL unnamed protein product
Length=306

 Score = 32.3 bits (72),  Expect = 0.63, Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 38/77 (49%), Gaps = 1/77 (1%)

Query  86   AITELESSIDEVKSKLDNHIQTARKFGHLSQMKYDLKDWENFKQNADSTCIPCVEENT-L  144
            A+ E ++  DEVKS+ D      R+ G L+QM +DL      +     + +  VE  T  
Sbjct  196  ALNEKKALYDEVKSRADELKNLERQMGELAQMFHDLHIMVVSQGEMVDSIVNSVENATEY  255

Query  145  ACYMIGNIDFLKKLQRR  161
            A    GN++  + LQ+R
Sbjct  256  AKQARGNVEEARNLQKR  272


>M9PFL9_DROME unnamed protein product
Length=2132

 Score = 29.6 bits (65),  Expect = 6.0, Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 30/39 (77%), Gaps = 1/39 (3%)

Query  86    AITELESSIDEVKSKLDNHI-QTARKFGHLSQMKYDLKD  123
             +ITEL+S + ++K++L+NH+ Q   K G++++++ D ++
Sbjct  1075  SITELQSQVSDLKAELENHLRQIQLKDGNIARLQTDFEE  1113


>M9PD87_DROME unnamed protein product
Length=2134

 Score = 29.6 bits (65),  Expect = 6.0, Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 30/39 (77%), Gaps = 1/39 (3%)

Query  86    AITELESSIDEVKSKLDNHI-QTARKFGHLSQMKYDLKD  123
             +ITEL+S + ++K++L+NH+ Q   K G++++++ D ++
Sbjct  1075  SITELQSQVSDLKAELENHLRQIQLKDGNIARLQTDFEE  1113



Lambda      K        H
   0.321    0.135    0.411 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5006522700


Query= XP_011197276.2 uncharacterized protein LOC105221845 [Bactrocera
dorsalis]

Length=379
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CL190_DROME  unnamed protein product                                  30.0    3.8  
Q580Q1_TRYB2  unnamed protein product                                 29.6    5.1  
I5P1_CAEEL  unnamed protein product                                   28.9    8.0  


>CL190_DROME unnamed protein product
Length=1690

 Score = 30.0 bits (66),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 26/113 (23%), Positives = 55/113 (49%), Gaps = 9/113 (8%)

Query  165   EPVIGPILNMRKRIEELHVHLLDYQRRLEEKSRRLAYIEYVANDVDKFSQLISLEKQSFQ  224
             E +I  +  +++ ++E H+ L + Q++ EE   +L   +     + + SQ    +    Q
Sbjct  1164  ERLIEKVTGIKEELKETHLQLDERQKKFEELEEKLKQAQQSEQKLQQESQTSKEKLTEIQ  1223

Query  225   QAMEELQRMMDGKMYKVVLPTLKK-------YIQTETEKINEVCAMLKKKESC  270
             Q+++ELQ  +  K  + ++  L++        I+ +  K+NE    L+ K SC
Sbjct  1224  QSLQELQDSV--KQKEELVQNLEEKVRESSSIIEAQNTKLNESNVQLENKTSC  1274


>Q580Q1_TRYB2 unnamed protein product
Length=835

 Score = 29.6 bits (65),  Expect = 5.1, Method: Compositional matrix adjust.
 Identities = 38/160 (24%), Positives = 66/160 (41%), Gaps = 29/160 (18%)

Query  54   QEAACLQSILRKSRIAPLPFNTDKVELLSDKMKKL-----------AHLRAHQKQLEDQL  102
            Q A  L   L++ ++ P   +  K E L  ++  L           A  +  Q+  E++L
Sbjct  656  QAAISLAESLKREKVDPYSRDKRKEEELQRQVDTLTRTVKERREAEARWKESQQATENEL  715

Query  103  NEHLDEVRACN----NKDSDMYSIKDWSKYCGPC--EWYCTNAETKADVCCNLLENYDFI  156
               L E+ A +    N   ++ S+++  K C P   E    NAE ++ V     EN +  
Sbjct  716  KSLLAELTASHKTIENLKHEVSSLREEQKACTPLKQEHSDENAELRSTVTAINTENEELR  775

Query  157  TKVKRIVEEPVIGPILNMRKRIEELHVHLLDYQRRLEEKS  196
             K            I  ++K +EEL    +D +R  EE++
Sbjct  776  EK------------IATLQKELEELRRRYIDLEREAEERN  803


>I5P1_CAEEL unnamed protein product
Length=409

 Score = 28.9 bits (63),  Expect = 8.0, Method: Compositional matrix adjust.
 Identities = 16/56 (29%), Positives = 25/56 (45%), Gaps = 0/56 (0%)

Query  35   FDILLKKLDCQYEKVEMDGQEAACLQSILRKSRIAPLPFNTDKVELLSDKMKKLAH  90
            FD+L   +D  YE +E     A C       S ++   F+T K E L+   + + H
Sbjct  74   FDLLRAYVDIDYEAIEYTALGALCFIKRSLWSNVSQFNFHTKKYEQLTSPKEVVTH  129



Lambda      K        H
   0.321    0.135    0.411 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5006522700


Query= XP_011197277.1 survival of motor neuron-related-splicing factor 30
[Bactrocera dorsalis]

Length=242
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q95RI7_DROME  unnamed protein product                                 325     1e-113
G7H806_DROME  unnamed protein product                                 298     5e-103
Q19328_CAEEL  unnamed protein product                                 38.5    0.004 


>Q95RI7_DROME unnamed protein product
Length=243

 Score = 325 bits (834),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 179/243 (74%), Positives = 201/243 (83%), Gaps = 1/243 (0%)

Query  1    MADDLQNYKLQLQQVEAGLLTDPANIELLKLKEGLLEVIELTNDLIKTQFEEQKKSLYVE  60
            MADDL NYKLQLQQVEA L TDP N ELLKL+  L EVI LT DLI+TQ EEQ KS YVE
Sbjct  1    MADDLHNYKLQLQQVEAALQTDPENEELLKLRSDLDEVITLTRDLIQTQLEEQNKSSYVE  60

Query  61   PVSG-VNISEYYDEIEAALIEAEKLVTAPQNWKVGDKCQARWIEDGKYYDAIIEDISSEG  119
            P S   + S Y+DEIEAAL+EAEKLV+A + WK GDKCQA+W ED +YYDA IEDISS G
Sbjct  61   PSSTKRDSSNYFDEIEAALLEAEKLVSAAKIWKKGDKCQAKWKEDRQYYDATIEDISSTG  120

Query  120  EVSVVFDTYQNRATTTVSELRDCTTRNEVFPSARRHHPNQKEYLKKRKQKKLQRFKELEE  179
            EV+V+FD YQNR+TT V+ELR+ T RNEVFPS +RH PNQKEYLKKRKQKK QRFK+LEE
Sbjct  121  EVNVIFDAYQNRSTTHVNELRERTIRNEVFPSNKRHRPNQKEYLKKRKQKKQQRFKDLEE  180

Query  180  EREYDKKKWLNFTSKNLKKPGMKVKSIFASPDTVTGRVGIGTCGVSGKGMTDYTVGEKYR  239
            ERE DK KWLNF +KN KK GMK +SIFASPD V+GRVG+GTCG +GKGMTD+TVGEKYR
Sbjct  181  ERESDKNKWLNFNNKNQKKNGMKARSIFASPDNVSGRVGVGTCGTAGKGMTDFTVGEKYR  240

Query  240  KGF  242
            KG 
Sbjct  241  KGL  243


>G7H806_DROME unnamed protein product
Length=230

 Score = 298 bits (763),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 166/229 (72%), Positives = 188/229 (82%), Gaps = 1/229 (0%)

Query  15   VEAGLLTDPANIELLKLKEGLLEVIELTNDLIKTQFEEQKKSLYVEPVSG-VNISEYYDE  73
            VEA L TDP N ELLKL+  L EVI LT DLI+TQ EEQ KS YVEP S   + S Y+DE
Sbjct  2    VEAALQTDPENEELLKLRSDLDEVITLTRDLIQTQLEEQNKSSYVEPSSTKRDSSNYFDE  61

Query  74   IEAALIEAEKLVTAPQNWKVGDKCQARWIEDGKYYDAIIEDISSEGEVSVVFDTYQNRAT  133
            IEAAL+EAEKLV+A + WK GDKCQA+W ED +YYDA IEDISS GEV+V+FD YQNR+T
Sbjct  62   IEAALLEAEKLVSAAKIWKKGDKCQAKWKEDRQYYDATIEDISSTGEVNVIFDAYQNRST  121

Query  134  TTVSELRDCTTRNEVFPSARRHHPNQKEYLKKRKQKKLQRFKELEEEREYDKKKWLNFTS  193
            T V+ELR+ T RNEVFPS +RH PNQKEYLKKRKQKK QRFK+LEEERE DK KWLNF +
Sbjct  122  THVNELRERTIRNEVFPSNKRHRPNQKEYLKKRKQKKQQRFKDLEEERESDKNKWLNFNN  181

Query  194  KNLKKPGMKVKSIFASPDTVTGRVGIGTCGVSGKGMTDYTVGEKYRKGF  242
            KN KK GMK +SIFASPD V+GRVG+GTCG +GKGMTD+TVGEKYRKG 
Sbjct  182  KNQKKNGMKARSIFASPDNVSGRVGVGTCGTAGKGMTDFTVGEKYRKGL  230


>Q19328_CAEEL unnamed protein product
Length=914

 Score = 38.5 bits (88),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 26/93 (28%), Positives = 43/93 (46%), Gaps = 2/93 (2%)

Query  64   GVNISEYYDEIEAALIEAEKLVTAPQNWKVGDKCQARWIEDGKYYDAIIEDISSEGEVSV  123
            G  I +   E+  AL E   L  +    K GD C A++ +DG++Y   +E + + G+  +
Sbjct  715  GPKIEKMTTEMRQALAEHPPLAGS-YTTKRGDLCVAKFSQDGQWYRCKVESVRA-GQAEI  772

Query  124  VFDTYQNRATTTVSELRDCTTRNEVFPSARRHH  156
            V+  Y NR T    +L         FP+  R +
Sbjct  773  VYIDYGNRETIEAVKLAQIPAGFANFPAGVREY  805



Lambda      K        H
   0.321    0.135    0.411 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5006522700


Query= XP_011197278.1 uncharacterized protein LOC105221847 [Bactrocera
dorsalis]

Length=100
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q95RS6_DROME  unnamed protein product                                 26.2    5.2  
TAF2_DROME  unnamed protein product                                   25.8    8.4  


>Q95RS6_DROME unnamed protein product
Length=421

 Score = 26.2 bits (56),  Expect = 5.2, Method: Composition-based stats.
 Identities = 16/58 (28%), Positives = 26/58 (45%), Gaps = 0/58 (0%)

Query  17   VTAQDSVCYTNGVNVTDSCRLREPCIPSFANPTEGKTIEYFNLCEERGEIGKTICPKS  74
            ++ Q +   T+G   T +C     C PS  + TE  + + F + + R      ICP S
Sbjct  64   ISQQSNFTSTSGKTATCNCVPYYKCDPSTKSFTEDGSFDGFGVIDIRFNDDDPICPAS  121


>TAF2_DROME unnamed protein product
Length=1221

 Score = 25.8 bits (55),  Expect = 8.4, Method: Composition-based stats.
 Identities = 12/25 (48%), Positives = 14/25 (56%), Gaps = 6/25 (24%)

Query  24   CYTNGVNVTDSCRLREPCIPSFANP  48
            CY N      S RL  PC+ SFA+P
Sbjct  173  CYEN------SSRLWFPCVDSFADP  191



Lambda      K        H
   0.321    0.135    0.411 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5006522700


Query= XP_011197279.1 PI-actitoxin-Avd5a [Bactrocera dorsalis]

Length=74
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

D1Z365_DROME  unnamed protein product                                 46.6    2e-08
Q8IPA4_DROME  unnamed protein product                                 33.5    0.002
G5EG68_CAEEL  unnamed protein product                                 32.0    0.022


>D1Z365_DROME unnamed protein product
Length=81

 Score = 46.6 bits (109),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 43/72 (60%), Gaps = 7/72 (10%)

Query  1   MKLIALIIVGLLLLGVVSAQTKNCTTLCTRNLDPVCGYNGETYKKYANSCLLESEKCET-  59
           MKL  L+I+  +L+G+  A  +NC   C + + P C Y+G+ Y +  ++C LE+EKC   
Sbjct  1   MKLFFLVILACMLIGI--AWGENCNKPCGKCILPTCNYDGKCYFEGTSACALENEKCRRK  58

Query  60  ----DKAIETVA  67
               D+ ++TV+
Sbjct  59  KNNLDQFVKTVS  70


>Q8IPA4_DROME unnamed protein product
Length=68

 Score = 33.5 bits (75),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 19/53 (36%), Positives = 27/53 (51%), Gaps = 5/53 (9%)

Query  1   MKLIALIIVGLLLLGVVSAQTKNCTTLCTRNLDPVCGYNGETYKKYANSCLLE  53
           +  IA  +  LL + V      +C   C RN DPVCG +  T   Y+N C+L+
Sbjct  4   LAFIAFCLSALLAMAVGQVFQYSCP--CPRNYDPVCGSDSVT---YSNQCVLD  51


>G5EG68_CAEEL unnamed protein product
Length=1473

 Score = 32.0 bits (71),  Expect = 0.022, Method: Composition-based stats.
 Identities = 16/48 (33%), Positives = 22/48 (46%), Gaps = 3/48 (6%)

Query  24   CTTLCTRNLDPVCGYNGETYKKYANSCLLESEKCETDKAIETVAMEKC  71
            C   C   + PVC  NGET+    N C ++ + CET   I+      C
Sbjct  401  CPNRCEDVMRPVCATNGETFD---NECEMKKKSCETKSMIKVKHQGTC  445


 Score = 31.2 bits (69),  Expect = 0.051, Method: Composition-based stats.
 Identities = 19/50 (38%), Positives = 24/50 (48%), Gaps = 3/50 (6%)

Query  14   LGVVSAQTKNCTTLCTRNLDPVCGYNGETYKKYANSCLLESEKCETDKAI  63
            LGV       C+  CT N   VCG +G+T   Y N C L+   C+  K I
Sbjct  317  LGVDRRPECKCSEQCTMNSAHVCGTDGKT---YLNECFLKLAACKEQKDI  363


 Score = 29.6 bits (65),  Expect = 0.18, Method: Composition-based stats.
 Identities = 17/48 (35%), Positives = 23/48 (48%), Gaps = 3/48 (6%)

Query  16   VVSAQTKNCTTLCTRNLDPVCGYNGETYKKYANSCLLESEKCETDKAI  63
            VV  + K     CT     VCG +G+T   Y+N C L++  C   K I
Sbjct  464  VVDGKPKCVCPSCTDEFKEVCGSDGKT---YSNECRLQNAACMAQKNI  508



Lambda      K        H
   0.321    0.135    0.411 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5006522700


Query= XP_011197280.1 zinc finger protein 184 isoform X1 [Bactrocera
dorsalis]

Length=464
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GLAS_DROME  unnamed protein product                                   77.0    8e-15
Q0PCD8_CAEEL  unnamed protein product                                 73.6    2e-14
CHE1_CAEEL  unnamed protein product                                   73.2    3e-14


>GLAS_DROME unnamed protein product
Length=604

 Score = 77.0 bits (188),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 54/105 (51%), Gaps = 1/105 (1%)

Query  255  CEICSRKFVNGKTLSKHVKAVHNKIKPFICNVCGKKMARKASLIIHMRQHTGEKPLHCKV  314
            C  C++ F     L+ HV+  H   KPF C +C ++ ++ +S+  HMR H+GE+P  C  
Sbjct  467  CPDCNKSFSQAANLTAHVR-THTGQKPFRCPICDRRFSQSSSVTTHMRTHSGERPYRCSS  525

Query  315  CKFSTRDPSVLHKHQLRHEKAEKLKCAHCDFTCIQTNAYKRHMRL  359
            CK S  D S L KH   H   +  +C  C     Q+    RHMR+
Sbjct  526  CKKSFSDSSTLTKHLRIHSGEKPYQCKLCLLRFSQSGNLNRHMRV  570


 Score = 68.9 bits (167),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 58/119 (49%), Gaps = 3/119 (3%)

Query  255  CEICSRKFVNGKTLSKHVKAVHNKIKPFICNVCGKKMARKASLIIHMRQHTGEKPLHCKV  314
            C +C + +    TL  H++  H+  +P+ C  C K  ++ A+L  H+R HTG+KP  C +
Sbjct  439  CRLCGKTYARPSTLKTHLR-THSGERPYRCPDCNKSFSQAANLTAHVRTHTGQKPFRCPI  497

Query  315  CKFSTRDPSVLHKHQLRHEKAEKLKCAHCDFTCIQTNAYKRHMRLNHSEEYKKIACDLC  373
            C       S +  H   H      +C+ C  +   ++   +H+R+ HS E K   C LC
Sbjct  498  CDRRFSQSSSVTTHMRTHSGERPYRCSSCKKSFSDSSTLTKHLRI-HSGE-KPYQCKLC  554


 Score = 62.4 bits (150),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 52/110 (47%), Gaps = 2/110 (2%)

Query  277  NKIKPFICNVCGKKMARKASLIIHMRQHTGEKPLHCKVCKFSTRDPSVLHKHQLRHEKAE  336
             ++KP +C +CGK  AR ++L  H+R H+GE+P  C  C  S    + L  H   H   +
Sbjct  432  GEMKPNLCRLCGKTYARPSTLKTHLRTHSGERPYRCPDCNKSFSQAANLTAHVRTHTGQK  491

Query  337  KLKCAHCDFTCIQTNAYKRHMRLNHSEEYKKIACDLCNYVTISSERLQAH  386
              +C  CD    Q+++   HMR  HS E +   C  C      S  L  H
Sbjct  492  PFRCPICDRRFSQSSSVTTHMR-THSGE-RPYRCSSCKKSFSDSSTLTKH  539


 Score = 48.1 bits (113),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/175 (22%), Positives = 65/175 (37%), Gaps = 45/175 (26%)

Query  130  CPYKFENEAKLALHTKCHTCPNASQKFKCYECNVELTNWRRCTAHLWKAHQIDVDLLQCP  189
            C   +   + L  H + H+     + ++C +CN   +     TAH+ + H       +CP
Sbjct  442  CGKTYARPSTLKTHLRTHS---GERPYRCPDCNKSFSQAANLTAHV-RTH-TGQKPFRCP  496

Query  190  QCEYKAHASVLVWRHMRAHKKWRMRVLRSLRAVQRKRLQQDLKNCDLNVVQAPPVNKNKY  249
             C+ +   S  V  HMR H   R                                     
Sbjct  497  ICDRRFSQSSSVTTHMRTHSGER-------------------------------------  519

Query  250  YAEKTCEICSRKFVNGKTLSKHVKAVHNKIKPFICNVCGKKMARKASLIIHMRQH  304
                 C  C + F +  TL+KH++ +H+  KP+ C +C  + ++  +L  HMR H
Sbjct  520  --PYRCSSCKKSFSDSSTLTKHLR-IHSGEKPYQCKLCLLRFSQSGNLNRHMRVH  571


>Q0PCD8_CAEEL unnamed protein product
Length=273

 Score = 73.6 bits (179),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 53/104 (51%), Gaps = 1/104 (1%)

Query  255  CEICSRKFVNGKTLSKHVKAVHNKIKPFICNVCGKKMARKASLIIHMRQHTGEKPLHCKV  314
            C+ C + F     L+ H K +H   KPF+C VC +  ++ +SL+ H R HTGE+P  C  
Sbjct  168  CQTCGKAFSQAANLTAH-KRIHTGEKPFMCPVCNRPFSQSSSLVTHRRTHTGERPYPCAQ  226

Query  315  CKFSTRDPSVLHKHQLRHEKAEKLKCAHCDFTCIQTNAYKRHMR  358
            C+ +  D S L KH   H   +   C+ C     Q+    RHM+
Sbjct  227  CEKAFTDSSTLTKHLRTHTGHKPYVCSICMMKFTQSGNLHRHMK  270


 Score = 64.3 bits (155),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 48/111 (43%), Gaps = 2/111 (2%)

Query  280  KPFICNVCGKKMARKASLIIHMRQHTGEKPLHCKVCKFSTRDPSVLHKHQLRHEKAEKLK  339
            KPF C  CGK  ++ A+L  H R HTGEKP  C VC       S L  H+  H       
Sbjct  164  KPFRCQTCGKAFSQAANLTAHKRIHTGEKPFMCPVCNRPFSQSSSLVTHRRTHTGERPYP  223

Query  340  CAHCDFTCIQTNAYKRHMRLNHSEEYKKIACDLCNYVTISSERLQAHKSDH  390
            CA C+     ++   +H+R +    +K   C +C      S  L  H   H
Sbjct  224  CAQCEKAFTDSSTLTKHLRTH--TGHKPYVCSICMMKFTQSGNLHRHMKTH  272


 Score = 53.1 bits (126),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/79 (32%), Positives = 37/79 (47%), Gaps = 1/79 (1%)

Query  255  CEICSRKFVNGKTLSKHVKAVHNKIKPFICNVCGKKMARKASLIIHMRQHTGEKPLHCKV  314
            C +C+R F    +L  H +  H   +P+ C  C K     ++L  H+R HTG KP  C +
Sbjct  196  CPVCNRPFSQSSSLVTH-RRTHTGERPYPCAQCEKAFTDSSTLTKHLRTHTGHKPYVCSI  254

Query  315  CKFSTRDPSVLHKHQLRHE  333
            C         LH+H   H+
Sbjct  255  CMMKFTQSGNLHRHMKTHK  273


 Score = 30.4 bits (67),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 35/86 (41%), Gaps = 8/86 (9%)

Query  124  CPVTNSCPYKFENEAKLALHTKCHTCPNASQKFKCYECNVELTNWRRCTAHLWKAHQIDV  183
            CPV   C   F   + L  H + HT     + + C +C    T+    T HL + H    
Sbjct  196  CPV---CNRPFSQSSSLVTHRRTHT---GERPYPCAQCEKAFTDSSTLTKHL-RTHTGHK  248

Query  184  DLLQCPQCEYKAHASVLVWRHMRAHK  209
              + C  C  K   S  + RHM+ HK
Sbjct  249  PYV-CSICMMKFTQSGNLHRHMKTHK  273


>CHE1_CAEEL unnamed protein product
Length=279

 Score = 73.2 bits (178),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 53/104 (51%), Gaps = 1/104 (1%)

Query  255  CEICSRKFVNGKTLSKHVKAVHNKIKPFICNVCGKKMARKASLIIHMRQHTGEKPLHCKV  314
            C+ C + F     L+ H K +H   KPF+C VC +  ++ +SL+ H R HTGE+P  C  
Sbjct  174  CQTCGKAFSQAANLTAH-KRIHTGEKPFMCPVCNRPFSQSSSLVTHRRTHTGERPYPCAQ  232

Query  315  CKFSTRDPSVLHKHQLRHEKAEKLKCAHCDFTCIQTNAYKRHMR  358
            C+ +  D S L KH   H   +   C+ C     Q+    RHM+
Sbjct  233  CEKAFTDSSTLTKHLRTHTGHKPYVCSICMMKFTQSGNLHRHMK  276


 Score = 64.3 bits (155),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 48/111 (43%), Gaps = 2/111 (2%)

Query  280  KPFICNVCGKKMARKASLIIHMRQHTGEKPLHCKVCKFSTRDPSVLHKHQLRHEKAEKLK  339
            KPF C  CGK  ++ A+L  H R HTGEKP  C VC       S L  H+  H       
Sbjct  170  KPFRCQTCGKAFSQAANLTAHKRIHTGEKPFMCPVCNRPFSQSSSLVTHRRTHTGERPYP  229

Query  340  CAHCDFTCIQTNAYKRHMRLNHSEEYKKIACDLCNYVTISSERLQAHKSDH  390
            CA C+     ++   +H+R +    +K   C +C      S  L  H   H
Sbjct  230  CAQCEKAFTDSSTLTKHLRTH--TGHKPYVCSICMMKFTQSGNLHRHMKTH  278


 Score = 53.1 bits (126),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/79 (32%), Positives = 37/79 (47%), Gaps = 1/79 (1%)

Query  255  CEICSRKFVNGKTLSKHVKAVHNKIKPFICNVCGKKMARKASLIIHMRQHTGEKPLHCKV  314
            C +C+R F    +L  H +  H   +P+ C  C K     ++L  H+R HTG KP  C +
Sbjct  202  CPVCNRPFSQSSSLVTH-RRTHTGERPYPCAQCEKAFTDSSTLTKHLRTHTGHKPYVCSI  260

Query  315  CKFSTRDPSVLHKHQLRHE  333
            C         LH+H   H+
Sbjct  261  CMMKFTQSGNLHRHMKTHK  279


 Score = 30.0 bits (66),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 35/86 (41%), Gaps = 8/86 (9%)

Query  124  CPVTNSCPYKFENEAKLALHTKCHTCPNASQKFKCYECNVELTNWRRCTAHLWKAHQIDV  183
            CPV   C   F   + L  H + HT     + + C +C    T+    T HL + H    
Sbjct  202  CPV---CNRPFSQSSSLVTHRRTHT---GERPYPCAQCEKAFTDSSTLTKHL-RTHTGHK  254

Query  184  DLLQCPQCEYKAHASVLVWRHMRAHK  209
              + C  C  K   S  + RHM+ HK
Sbjct  255  PYV-CSICMMKFTQSGNLHRHMKTHK  279



Lambda      K        H
   0.321    0.135    0.411 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5006522700


Query= XP_011197281.1 COP9 signalosome complex subunit 3 [Bactrocera
dorsalis]

Length=440
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CSN3_DROME  unnamed protein product                                   607     0.0  
CSN3_DICDI  unnamed protein product                                   222     8e-68
CSN3_CAEEL  unnamed protein product                                   84.3    2e-17


>CSN3_DROME unnamed protein product
Length=445

 Score = 607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/446 (66%), Positives = 356/446 (80%), Gaps = 7/446 (2%)

Query  1    MASALENYVNNVRTKSSEGNFRIMVEQLNESVDILSRYWDLLDNVLETLDFQQHSLGVLY  60
            M SALENYVN VRT S+ G++R + E+L ES+ +L+R W +LDNVLETLD QQHSLGVLY
Sbjct  1    MGSALENYVNQVRTLSASGSYRELAEELPESLSLLARNWSILDNVLETLDMQQHSLGVLY  60

Query  61   VLLVKFNGAANVNADLPQLFTLYKEFISQCNGEQVRYATYTYYDLCHMFTSLIVDHPHCI  120
            VLL K + A+  N +  QL  L ++F+ + N EQ+RYA   +Y+ CH+FT  +V     I
Sbjct  61   VLLAKLHSASTANPEPVQLIQLMRDFVQRNNNEQLRYAVCAFYETCHLFTEFVVQKNLSI  120

Query  121  QGIKVVAQAIEKIRLCDSQQTSIHSDLCQLSLKAKCFKTALSFLDVDITTIST-ASEIRG  179
             GI+++++AI++IR  ++Q T IH+DLC LSLKAK F   L +LD DIT IST A+E + 
Sbjct  121  LGIRIISRAIDQIRQLETQLTPIHADLCLLSLKAKNFSVVLPYLDADITDISTVAAECKT  180

Query  180  QSS-----ADTNNDAKYFLLYYYYGGMIYTAVKNFDRALYFFEVCISTPAAAMSHIMLEA  234
            Q       AD NNDAKYFLLY+YYGGMIYTAVKN++RALYFFEVCI+TPA AMSHIMLEA
Sbjct  181  QQQQQSQHADANNDAKYFLLYFYYGGMIYTAVKNYERALYFFEVCITTPAMAMSHIMLEA  240

Query  235  YKKFVLVSLILHGKVLPIPKSSAPVISRFMKPLAQSYHDLATAYATSSSDELRIIMNKSS  294
            YKKF++VSLI+ GK+  IPK++  VI RFMKP+A  YHDL   YA SSS+ELRII+ K S
Sbjct  241  YKKFLMVSLIVEGKIAYIPKNTQ-VIGRFMKPMANHYHDLVNVYANSSSEELRIIILKYS  299

Query  295  ETFIRDKNMGLVKQVVTSLYKKNIRRLTKTFLTLSLSDVASRAQLADAAEAERYIFNMIK  354
            E F RD NMGL KQV TSLYK+NI+RLTKTFLTLSLSDVASR QLA A EAERYI NMIK
Sbjct  300  EAFTRDNNMGLAKQVATSLYKRNIQRLTKTFLTLSLSDVASRVQLASAVEAERYILNMIK  359

Query  355  SGEIYATINKKDGMVVFKDDPEKYNSPEMFLKIQKDMAQTMDLIRQINKMEEDILLNPMY  414
            SGEIYA+IN+KDGMV+FKDDPEKYNSPEMFL +Q ++   +D +RQINKMEE+I+LNPMY
Sbjct  360  SGEIYASINQKDGMVLFKDDPEKYNSPEMFLNVQNNITHVLDQVRQINKMEEEIILNPMY  419

Query  415  VKKALGNQEDELTSQHPKSFSGDPTD  440
            VKKALG+Q+D+LTSQHPK+FSGDPTD
Sbjct  420  VKKALGSQDDDLTSQHPKTFSGDPTD  445


>CSN3_DICDI unnamed protein product
Length=418

 Score = 222 bits (565),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 141/401 (35%), Positives = 225/401 (56%), Gaps = 26/401 (6%)

Query  35   LSRYWDLLDNVLETLDFQQHSLGVLYVLLVKFNGAANVNADLPQLFTLYKEFISQCNGEQ  94
            L R    LDN+L  LD + HSLG L VL  K    ++   +          F   CN EQ
Sbjct  26   LERQHVSLDNILGALDVRNHSLGQLLVLKAK---GSDQGKNRSVFIDQCNNFFRNCNVEQ  82

Query  95   VRYATYTYYDLCHMFTSLIVDHPHCIQGIKVVAQAIEKIRLCDSQQTS----IHSDLCQL  150
            VR A      L   +T  + +    I+G+ V+  A+    L D++ T+    IH+D  QL
Sbjct  83   VRLAPAQLSQLSKFYTEALYELKQPIRGVAVLKDALN--ILSDNKPTTTLTPIHTDFLQL  140

Query  151  SLKAKCFKTALSFLDVDITTISTASEIRGQSSADTNNDAKYFLLYYYYGGMIYTAVKNFD  210
             + +KC+  AL  ++ +IT I+       QSS       K  L Y+YY G+I+TA K + 
Sbjct  141  CILSKCYHQALPLIESNITHINPE-----QSSIAI----KDILCYFYYSGIIFTAFKKYK  191

Query  211  RALYFFEVCISTPAAAMSHIMLEAYKKFVLVSLILHGKVLPIPKSSAPVISRFMKPLAQS  270
            +A+  F+  I+ PA+A+S I +EAYKK+++V LI  G V   PK +  V+ R +K   + 
Sbjct  192  KAIEAFKFVITAPASALSAITVEAYKKYLIVYLIQFGSVQHFPKCTPAVVQRNIKSHCKP  251

Query  271  YHDLATAYATSSSDELRIIMNKSS---ETFIRDKNMGLVKQVVTSLYKKNIRRLTKTFLT  327
            Y +   +++  + ++   IMNK+S   E F +D N GLVK  + S Y++NI++LT+TF+T
Sbjct  252  YTEFVQSFSNGNIND---IMNKASSGAEFFQKDSNWGLVKLSIKSTYRRNIKKLTQTFMT  308

Query  328  LSLSDVASRAQLADAAEAERYIFNMIKSGEIYATINKKDGMVVFKDDPEKYNSPEMFLKI  387
            LS++D+A +  L   A+AE+++  MI+ GEI+ATIN+KDGMV F +  E ++ P +   +
Sbjct  309  LSINDIAEKVSLP-KAKAEQFVLKMIEEGEIFATINQKDGMVTFDECFEDFSGPTILNDL  367

Query  388  QKDMAQTMDLIRQINKMEEDILLNPMYVKK-ALGNQEDELT  427
             +++   + L  +I +M+E I L+  Y+KK A G    +L+
Sbjct  368  DRNINNIVGLESKIKEMDEKISLSNNYLKKLASGKNTGQLS  408


>CSN3_CAEEL unnamed protein product
Length=501

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 62/261 (24%), Positives = 114/261 (44%), Gaps = 33/261 (13%)

Query  141  TSIHSDLCQLSLKAKCFKTALSFLDVDITTISTASEIRGQSSADTNN-------------  187
            TS H  L   +L+ K + +   F+D+ +  I+  + I+ Q  +D                
Sbjct  180  TSAHGVLFACALETKDYASVEPFIDLHVDEIANENCIQDQEKSDNRERDFGDVFLGRMKK  239

Query  188  ---------------DAKYFLLYYYYGGMIYTAVKNFDRALYFFEVCISTPAAAMSHIML  232
                             KY L Y Y G  I   +K F+ AL+  E+C+  PA ++    L
Sbjct  240  GAAFGSQPVAHNPHLHPKYVLDYLYNGACILIELKRFEDALFLLEICVGMPAFSVQDQHL  299

Query  233  EAYKKFVLVSLILHGKVLPIPKSSAPVISRF--MKPLAQSYHDLATAYATSSSDELRIIM  290
            +++KK+VL+SLIL GKV          I  F    P  + + ++  + ++++   +  ++
Sbjct  300  DSFKKYVLISLILKGKVDVTENGDKSAIRHFKTKSPEYKQFSEIRFSRSSNTHSAVESLV  359

Query  291  NKSSETFIRDKNMGLVKQVVTSLYKKNIRRLTKTFLTLSLSDVASRAQLADAAEAERYIF  350
              + +   +D N  + K +V  + KK I  LT+ F ++ +S++   A L    +    I 
Sbjct  360  KSAKDRLRKDGNTEIAKYLVVEMKKKTIMSLTRMFTSIRISEIEELAFLKSRDQVTELIG  419

Query  351  NMIKSGEIYATINKKDGMVVF  371
             +++   I   I   DG +VF
Sbjct  420  QLVEEQRITVRI---DGDMVF  437



Lambda      K        H
   0.321    0.135    0.411 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5006522700


Query= XP_011197282.1 uncharacterized protein LOC105221851 [Bactrocera
dorsalis]

Length=233
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q19733_CAEEL  unnamed protein product                                 28.1    8.8  


>Q19733_CAEEL unnamed protein product
Length=1318

 Score = 28.1 bits (61),  Expect = 8.8, Method: Composition-based stats.
 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 3/50 (6%)

Query  100  YVPVDTEKHVKSTDDFELNADYHEHK--MIKYYDRLSQIPITDHMSSCVS  147
            Y  +   +  K +DD E N D HE +   +  +DRLS   ++ H  SC S
Sbjct  647  YAKLVEAQKFKESDDIEDNGDEHEEETSTVGRHDRLSSRQVSFH-KSCES  695



Lambda      K        H
   0.321    0.135    0.411 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5006522700


Query= XP_011197283.1 protamine [Bactrocera dorsalis]

Length=201
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VJR1_DROME  unnamed protein product                                 55.8    4e-10
Q9V3S3_DROME  unnamed protein product                                 52.8    8e-09
Q8T3U9_DROME  unnamed protein product                                 52.8    8e-09


>Q9VJR1_DROME unnamed protein product
Length=144

 Score = 55.8 bits (133),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 34/51 (67%), Gaps = 0/51 (0%)

Query  33   KCHRPGPLMRNPYLNFLREFRKQNCGLTAVEIIKRGAQAWRAVPKEKRLRY  83
            KC + GP+  N YLNF+R FRK++C L   E+I   A+AW  +P+ ++ RY
Sbjct  74   KCSKQGPVTNNAYLNFVRFFRKKHCDLKPQELIAEAAKAWAELPEHRKDRY  124


>Q9V3S3_DROME unnamed protein product
Length=146

 Score = 52.8 bits (125),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 34/51 (67%), Gaps = 0/51 (0%)

Query  33   KCHRPGPLMRNPYLNFLREFRKQNCGLTAVEIIKRGAQAWRAVPKEKRLRY  83
            KC + GP+  N YLNF+R FRK++C L   E+I + A+AW  + + ++ RY
Sbjct  74   KCSKQGPVTNNAYLNFVRSFRKKHCNLKPRELIAKAAKAWARLSENRKDRY  124


>Q8T3U9_DROME unnamed protein product
Length=146

 Score = 52.8 bits (125),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 45/80 (56%), Gaps = 0/80 (0%)

Query  4    KSIESLAFTFSKSLCKLKNKRTEKSKGKGKCHRPGPLMRNPYLNFLREFRKQNCGLTAVE  63
            K I+S A    K+ C    +   K   + KC + GP+  N YLNF+R FRK++C L   E
Sbjct  45   KPIKSCAKPRRKAACAKATRPKVKCAPRQKCSKQGPVTNNAYLNFVRSFRKKHCNLKPRE  104

Query  64   IIKRGAQAWRAVPKEKRLRY  83
            +I + A+AW  + + ++ RY
Sbjct  105  LIAKAAKAWARLSENRKDRY  124



Lambda      K        H
   0.321    0.135    0.411 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5006522700


Query= XP_011197284.1 protamine-like protein 99C isoform X1 [Bactrocera
dorsalis]

Length=163
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VJR1_DROME  unnamed protein product                                 38.5    6e-04
PR99C_DROME  unnamed protein product                                  38.9    6e-04
Q9V3S3_DROME  unnamed protein product                                 36.2    0.004


>Q9VJR1_DROME unnamed protein product
Length=144

 Score = 38.5 bits (88),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 16/46 (35%), Positives = 26/46 (57%), Gaps = 0/46 (0%)

Query  31   GTLHRNPYLNFLREFRLRNTGLSAVEIIRRGAREWRSMPKEDKLQF  76
            G +  N YLNF+R FR ++  L   E+I   A+ W  +P+  K ++
Sbjct  79   GPVTNNAYLNFVRFFRKKHCDLKPQELIAEAAKAWAELPEHRKDRY  124


>PR99C_DROME unnamed protein product
Length=201

 Score = 38.9 bits (89),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/87 (29%), Positives = 40/87 (46%), Gaps = 5/87 (6%)

Query  36   NPYLNFLREFRLRNTGLSAVEIIRRGAREWRSMPKEDKLQFIEEAFYAPKKRKPPPPPPA  95
            N YLNF+ E++ R  GLS  +++   A++W  +   +K     EAF + K        PA
Sbjct  26   NGYLNFMTEYKKRFYGLSPQDMVHYAAKQWTQLSMAEK-----EAFKSKKPSTITLKSPA  80

Query  96   PIPAQPTQMRVAPFQDACIVCPNPCAK  122
               A   +  VA  Q +     +P A+
Sbjct  81   QYVACEMKSDVAGGQQSSCQRQSPSAR  107


 Score = 32.7 bits (73),  Expect = 0.093, Method: Compositional matrix adjust.
 Identities = 12/39 (31%), Positives = 25/39 (64%), Gaps = 0/39 (0%)

Query  38   YLNFLREFRLRNTGLSAVEIIRRGAREWRSMPKEDKLQF  76
            Y++FLR+F+ +NT L  +++++   R W  +P+  +  F
Sbjct  151  YIHFLRKFQRKNTELRTIDLLKTATRLWCRLPERHRHAF  189


>Q9V3S3_DROME unnamed protein product
Length=146

 Score = 36.2 bits (82),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 15/46 (33%), Positives = 26/46 (57%), Gaps = 0/46 (0%)

Query  31   GTLHRNPYLNFLREFRLRNTGLSAVEIIRRGAREWRSMPKEDKLQF  76
            G +  N YLNF+R FR ++  L   E+I + A+ W  + +  K ++
Sbjct  79   GPVTNNAYLNFVRSFRKKHCNLKPRELIAKAAKAWARLSENRKDRY  124



Lambda      K        H
   0.321    0.135    0.411 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5006522700


Query= XP_011197285.1 protamine isoform X2 [Bactrocera dorsalis]

Length=157
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PR99C_DROME  unnamed protein product                                  40.0    2e-04
Q9VJR1_DROME  unnamed protein product                                 38.9    4e-04
Q9V3S3_DROME  unnamed protein product                                 36.2    0.003


>PR99C_DROME unnamed protein product
Length=201

 Score = 40.0 bits (92),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/59 (34%), Positives = 30/59 (51%), Gaps = 3/59 (5%)

Query  36  NPYLNFLREFRLRNTGLSAVEIIRRGAREWRSMPKEDKLQFIEEKRKPPPPPPAPIPAQ  94
           N YLNF+ E++ R  GLS  +++   A++W  +   +K  F   K K P       PAQ
Sbjct  26  NGYLNFMTEYKKRFYGLSPQDMVHYAAKQWTQLSMAEKEAF---KSKKPSTITLKSPAQ  81


 Score = 32.3 bits (72),  Expect = 0.095, Method: Compositional matrix adjust.
 Identities = 12/39 (31%), Positives = 25/39 (64%), Gaps = 0/39 (0%)

Query  38   YLNFLREFRLRNTGLSAVEIIRRGAREWRSMPKEDKLQF  76
            Y++FLR+F+ +NT L  +++++   R W  +P+  +  F
Sbjct  151  YIHFLRKFQRKNTELRTIDLLKTATRLWCRLPERHRHAF  189


>Q9VJR1_DROME unnamed protein product
Length=144

 Score = 38.9 bits (89),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 16/46 (35%), Positives = 26/46 (57%), Gaps = 0/46 (0%)

Query  31   GTLHRNPYLNFLREFRLRNTGLSAVEIIRRGAREWRSMPKEDKLQF  76
            G +  N YLNF+R FR ++  L   E+I   A+ W  +P+  K ++
Sbjct  79   GPVTNNAYLNFVRFFRKKHCDLKPQELIAEAAKAWAELPEHRKDRY  124


>Q9V3S3_DROME unnamed protein product
Length=146

 Score = 36.2 bits (82),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 15/46 (33%), Positives = 26/46 (57%), Gaps = 0/46 (0%)

Query  31   GTLHRNPYLNFLREFRLRNTGLSAVEIIRRGAREWRSMPKEDKLQF  76
            G +  N YLNF+R FR ++  L   E+I + A+ W  + +  K ++
Sbjct  79   GPVTNNAYLNFVRSFRKKHCNLKPRELIAKAAKAWARLSENRKDRY  124



Lambda      K        H
   0.321    0.135    0.411 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5006522700


Query= XP_011197286.1 cAMP-dependent protein kinase type I regulatory
subunit isoform X1 [Bactrocera dorsalis]

Length=374
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

KAPR1_DROME  unnamed protein product                                  686     0.0   
KAPR_CAEEL  unnamed protein product                                   419     1e-146
KAPR_DICDI  unnamed protein product                                   311     1e-104


>KAPR1_DROME unnamed protein product
Length=376

 Score = 686 bits (1771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/374 (90%), Positives = 353/374 (94%), Gaps = 2/374 (1%)

Query  1    MANTLEEQQSLRECENYIQAHGIQRVLKDCIVQLCVSRPENPIQFLRQYFQKLEKEQVKL  60
            MA TLEEQ SLRECE+YIQ HGIQRVLKDCIVQLCV RPENP+QFLRQYFQKLE+EQVKL
Sbjct  5    MAKTLEEQ-SLRECEHYIQTHGIQRVLKDCIVQLCVCRPENPVQFLRQYFQKLEREQVKL  63

Query  61   DAHKQVTSPDDFEDLSPMPQTAAPPVRRRGGISAEPVTEEDATSYVKKVVPKDYKTMAAL  120
            DA +QV SPDD EDLSPMPQTAAPPVRRRGGISAEPVTEEDAT+YVKKVVPKDYKTM AL
Sbjct  64   DASRQVISPDDCEDLSPMPQTAAPPVRRRGGISAEPVTEEDATNYVKKVVPKDYKTMNAL  123

Query  121  SKAIAKNVLFSHLDENERSDIFDAMFPVTHLMGENIIQQGDEGDNFYVIDHGEVEVFVNS  180
            SKAIAKNVLF+HLDE+ERSDIFDAMFPV H+ GENIIQQGDEGDNFYVID GEV+VFVNS
Sbjct  124  SKAIAKNVLFAHLDESERSDIFDAMFPVNHIAGENIIQQGDEGDNFYVIDVGEVDVFVNS  183

Query  181  ELVTTIGEGGSFGELALIYGTPRAATVRAKTDVKLWGIDRDSYRRILMGSTIRKRKMYEE  240
            ELVTTI EGGSFGELALIYGTPRAATVRAKTDVKLWGIDRDSYRRILMGSTIRKRKMYEE
Sbjct  184  ELVTTISEGGSFGELALIYGTPRAATVRAKTDVKLWGIDRDSYRRILMGSTIRKRKMYEE  243

Query  241  FLSRVSILESLDKWERLTVADALEPVQFEDGETIVKQGEPGDDFYIILDGTAVVLQRRAE  300
            FLSRVSILESLDKWERLTVAD+LE   F+DGETIVKQG  GDDFYIIL+G AVVLQ+R+E
Sbjct  244  FLSRVSILESLDKWERLTVADSLETCSFDDGETIVKQGAAGDDFYIILEGCAVVLQQRSE  303

Query  301  QGDEPAEVGRLGPSDYFGEIALLLDRPRAATVVARGPLKCVKLDRARFERVLGLCADILK  360
             G++PAEVGRLG SDYFGEIALLLDRPRAATVVARGPLKCVKLDRARFERVLG CADILK
Sbjct  304  -GEDPAEVGRLGSSDYFGEIALLLDRPRAATVVARGPLKCVKLDRARFERVLGPCADILK  362

Query  361  RNITQYNSFVSLSV  374
            RNITQYNSFVSLSV
Sbjct  363  RNITQYNSFVSLSV  376


>KAPR_CAEEL unnamed protein product
Length=366

 Score = 419 bits (1078),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 212/370 (57%), Positives = 271/370 (73%), Gaps = 15/370 (4%)

Query  7    EQQSLRECENYIQAHGIQRVLKDCIVQLCVSRPENPIQFLRQYFQKLEKEQVKLDAHKQV  66
            E+  L +C+ Y+Q H IQ+++K+ IV LC+ +P+NP+ FL+ +F+KL +++ +   +   
Sbjct  6    EEDQLAQCQAYVQRHNIQQLVKEAIVVLCIHKPDNPVLFLKDHFEKLNEQRAQEGGNPDA  65

Query  67   TSPDDFEDLSPMPQTAAPPVR---RRGGISAEPVTEEDATSYVKKVVPKDYKTMAALSKA  123
                             PP R   RR GISAEP+ E+D T Y K V+PKD  T  +L  A
Sbjct  66   ADD--------DDIIVEPPKRSGGRRTGISAEPIKEDD-TEYKKVVIPKDDATRRSLESA  116

Query  124  IAKNVLFSHLDENERSDIFDAMFPVTHLMGENIIQQGDEGDNFYVIDHGEVEVFVNSELV  183
            + KN+LF+HL+E+E+  ++DAMFPV    GE II+QG+EGDNFYVID G V+V+VN E V
Sbjct  117  MRKNLLFAHLEEDEQKTMYDAMFPVEKSAGETIIEQGEEGDNFYVIDKGTVDVYVNHEYV  176

Query  184  TTIGEGGSFGELALIYGTPRAATVRAKTDVKLWGIDRDSYRRILMGSTIRKRKMYEEFLS  243
             TI EGGSFGELALIYGTPRAATV AKTDVKLW IDR +YRRILMGS  +KRKMY+EFLS
Sbjct  177  LTINEGGSFGELALIYGTPRAATVIAKTDVKLWAIDRLTYRRILMGSVTKKRKMYDEFLS  236

Query  244  RVSILESLDKWERLTVADALEPVQFEDGETIVKQGEPGDDFYIILDGTAVVLQRRAEQGD  303
            +V IL  LD+WER  VADALE   FE G  +V+QG+PGD+F+IIL+G A VLQ+R++  D
Sbjct  237  KVQILADLDQWERANVADALERCDFEPGTHVVEQGQPGDEFFIILEGEANVLQKRSD--D  294

Query  304  EPAE-VGRLGPSDYFGEIALLLDRPRAATVVARGPLKCVKLDRARFERVLGLCADILKRN  362
             P + VG LG SDYFGEIALLLDRPRAATVVA+  LKC+KLDR RFERV+G   +ILKR+
Sbjct  295  APFDVVGHLGMSDYFGEIALLLDRPRAATVVAKTHLKCIKLDRNRFERVMGPVREILKRD  354

Query  363  ITQYNSFVSL  372
            ++ YNS+V L
Sbjct  355  VSNYNSYVKL  364


>KAPR_DICDI unnamed protein product
Length=327

 Score = 311 bits (797),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 159/292 (54%), Positives = 209/292 (72%), Gaps = 10/292 (3%)

Query  87   RRRGGISAEPVTEEDATSYVKKVVPKDYKTMAALSKAIAKNVLFSHLDENERSDIFDAMF  146
            +RRG IS+EP+ ++ AT      +PK  +T   L +A++ N++FSHL+E ER+ +F AM 
Sbjct  26   KRRGAISSEPLGDKPATPLPN--IPKTVETQQRLEQALSNNIMFSHLEEEERNVVFLAMV  83

Query  147  PVTHLMGENIIQQGDEGDNFYVIDHGEVEVFV-----NSELVTTIGEGGSFGELALIYGT  201
             V +  G+ II+QGDEGD FYVID G  +++V     +  LV  + EGGSFGELALIYG+
Sbjct  84   EVLYKAGDIIIKQGDEGDLFYVIDSGICDIYVCQNGGSPTLVMEVFEGGSFGELALIYGS  143

Query  202  PRAATVRAKTDVKLWGIDRDSYRRILMGSTIRKRKMYEEFLSRVSILESLDKWERLTVAD  261
            PRAATV A+TDV+LW ++  +YRRILM  TI+KRK+YEEFL +VSIL  +DK+ER+++AD
Sbjct  144  PRAATVIARTDVRLWALNGATYRRILMDQTIKKRKLYEEFLEKVSILRHIDKYERVSLAD  203

Query  262  ALEPVQFEDGETIVKQGEPGDDFYIILDGTAVVLQRRAEQGDEPAE--VGRLGPSDYFGE  319
            ALEPV F+DGE IV+QG+PGD FYII++G  VV Q     GD      V  L PSDYFGE
Sbjct  204  ALEPVNFQDGEVIVRQGDPGDRFYIIVEGKVVVTQETVP-GDHSTSHVVSELHPSDYFGE  262

Query  320  IALLLDRPRAATVVARGPLKCVKLDRARFERVLGLCADILKRNITQYNSFVS  371
            IALL DRPRAATV + G  KCV+LDR RF R+ G    +L+RN+  YN F++
Sbjct  263  IALLTDRPRAATVTSIGYTKCVELDRQRFNRLCGPIDQMLRRNMETYNQFLN  314



Lambda      K        H
   0.321    0.135    0.411 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5006522700


Query= XP_011197287.1 cAMP-dependent protein kinase type I regulatory
subunit isoform X1 [Bactrocera dorsalis]

Length=374
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

KAPR1_DROME  unnamed protein product                                  686     0.0   
KAPR_CAEEL  unnamed protein product                                   419     1e-146
KAPR_DICDI  unnamed protein product                                   311     1e-104


>KAPR1_DROME unnamed protein product
Length=376

 Score = 686 bits (1771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/374 (90%), Positives = 353/374 (94%), Gaps = 2/374 (1%)

Query  1    MANTLEEQQSLRECENYIQAHGIQRVLKDCIVQLCVSRPENPIQFLRQYFQKLEKEQVKL  60
            MA TLEEQ SLRECE+YIQ HGIQRVLKDCIVQLCV RPENP+QFLRQYFQKLE+EQVKL
Sbjct  5    MAKTLEEQ-SLRECEHYIQTHGIQRVLKDCIVQLCVCRPENPVQFLRQYFQKLEREQVKL  63

Query  61   DAHKQVTSPDDFEDLSPMPQTAAPPVRRRGGISAEPVTEEDATSYVKKVVPKDYKTMAAL  120
            DA +QV SPDD EDLSPMPQTAAPPVRRRGGISAEPVTEEDAT+YVKKVVPKDYKTM AL
Sbjct  64   DASRQVISPDDCEDLSPMPQTAAPPVRRRGGISAEPVTEEDATNYVKKVVPKDYKTMNAL  123

Query  121  SKAIAKNVLFSHLDENERSDIFDAMFPVTHLMGENIIQQGDEGDNFYVIDHGEVEVFVNS  180
            SKAIAKNVLF+HLDE+ERSDIFDAMFPV H+ GENIIQQGDEGDNFYVID GEV+VFVNS
Sbjct  124  SKAIAKNVLFAHLDESERSDIFDAMFPVNHIAGENIIQQGDEGDNFYVIDVGEVDVFVNS  183

Query  181  ELVTTIGEGGSFGELALIYGTPRAATVRAKTDVKLWGIDRDSYRRILMGSTIRKRKMYEE  240
            ELVTTI EGGSFGELALIYGTPRAATVRAKTDVKLWGIDRDSYRRILMGSTIRKRKMYEE
Sbjct  184  ELVTTISEGGSFGELALIYGTPRAATVRAKTDVKLWGIDRDSYRRILMGSTIRKRKMYEE  243

Query  241  FLSRVSILESLDKWERLTVADALEPVQFEDGETIVKQGEPGDDFYIILDGTAVVLQRRAE  300
            FLSRVSILESLDKWERLTVAD+LE   F+DGETIVKQG  GDDFYIIL+G AVVLQ+R+E
Sbjct  244  FLSRVSILESLDKWERLTVADSLETCSFDDGETIVKQGAAGDDFYIILEGCAVVLQQRSE  303

Query  301  QGDEPAEVGRLGPSDYFGEIALLLDRPRAATVVARGPLKCVKLDRARFERVLGLCADILK  360
             G++PAEVGRLG SDYFGEIALLLDRPRAATVVARGPLKCVKLDRARFERVLG CADILK
Sbjct  304  -GEDPAEVGRLGSSDYFGEIALLLDRPRAATVVARGPLKCVKLDRARFERVLGPCADILK  362

Query  361  RNITQYNSFVSLSV  374
            RNITQYNSFVSLSV
Sbjct  363  RNITQYNSFVSLSV  376


>KAPR_CAEEL unnamed protein product
Length=366

 Score = 419 bits (1078),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 212/370 (57%), Positives = 271/370 (73%), Gaps = 15/370 (4%)

Query  7    EQQSLRECENYIQAHGIQRVLKDCIVQLCVSRPENPIQFLRQYFQKLEKEQVKLDAHKQV  66
            E+  L +C+ Y+Q H IQ+++K+ IV LC+ +P+NP+ FL+ +F+KL +++ +   +   
Sbjct  6    EEDQLAQCQAYVQRHNIQQLVKEAIVVLCIHKPDNPVLFLKDHFEKLNEQRAQEGGNPDA  65

Query  67   TSPDDFEDLSPMPQTAAPPVR---RRGGISAEPVTEEDATSYVKKVVPKDYKTMAALSKA  123
                             PP R   RR GISAEP+ E+D T Y K V+PKD  T  +L  A
Sbjct  66   ADD--------DDIIVEPPKRSGGRRTGISAEPIKEDD-TEYKKVVIPKDDATRRSLESA  116

Query  124  IAKNVLFSHLDENERSDIFDAMFPVTHLMGENIIQQGDEGDNFYVIDHGEVEVFVNSELV  183
            + KN+LF+HL+E+E+  ++DAMFPV    GE II+QG+EGDNFYVID G V+V+VN E V
Sbjct  117  MRKNLLFAHLEEDEQKTMYDAMFPVEKSAGETIIEQGEEGDNFYVIDKGTVDVYVNHEYV  176

Query  184  TTIGEGGSFGELALIYGTPRAATVRAKTDVKLWGIDRDSYRRILMGSTIRKRKMYEEFLS  243
             TI EGGSFGELALIYGTPRAATV AKTDVKLW IDR +YRRILMGS  +KRKMY+EFLS
Sbjct  177  LTINEGGSFGELALIYGTPRAATVIAKTDVKLWAIDRLTYRRILMGSVTKKRKMYDEFLS  236

Query  244  RVSILESLDKWERLTVADALEPVQFEDGETIVKQGEPGDDFYIILDGTAVVLQRRAEQGD  303
            +V IL  LD+WER  VADALE   FE G  +V+QG+PGD+F+IIL+G A VLQ+R++  D
Sbjct  237  KVQILADLDQWERANVADALERCDFEPGTHVVEQGQPGDEFFIILEGEANVLQKRSD--D  294

Query  304  EPAE-VGRLGPSDYFGEIALLLDRPRAATVVARGPLKCVKLDRARFERVLGLCADILKRN  362
             P + VG LG SDYFGEIALLLDRPRAATVVA+  LKC+KLDR RFERV+G   +ILKR+
Sbjct  295  APFDVVGHLGMSDYFGEIALLLDRPRAATVVAKTHLKCIKLDRNRFERVMGPVREILKRD  354

Query  363  ITQYNSFVSL  372
            ++ YNS+V L
Sbjct  355  VSNYNSYVKL  364


>KAPR_DICDI unnamed protein product
Length=327

 Score = 311 bits (797),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 159/292 (54%), Positives = 209/292 (72%), Gaps = 10/292 (3%)

Query  87   RRRGGISAEPVTEEDATSYVKKVVPKDYKTMAALSKAIAKNVLFSHLDENERSDIFDAMF  146
            +RRG IS+EP+ ++ AT      +PK  +T   L +A++ N++FSHL+E ER+ +F AM 
Sbjct  26   KRRGAISSEPLGDKPATPLPN--IPKTVETQQRLEQALSNNIMFSHLEEEERNVVFLAMV  83

Query  147  PVTHLMGENIIQQGDEGDNFYVIDHGEVEVFV-----NSELVTTIGEGGSFGELALIYGT  201
             V +  G+ II+QGDEGD FYVID G  +++V     +  LV  + EGGSFGELALIYG+
Sbjct  84   EVLYKAGDIIIKQGDEGDLFYVIDSGICDIYVCQNGGSPTLVMEVFEGGSFGELALIYGS  143

Query  202  PRAATVRAKTDVKLWGIDRDSYRRILMGSTIRKRKMYEEFLSRVSILESLDKWERLTVAD  261
            PRAATV A+TDV+LW ++  +YRRILM  TI+KRK+YEEFL +VSIL  +DK+ER+++AD
Sbjct  144  PRAATVIARTDVRLWALNGATYRRILMDQTIKKRKLYEEFLEKVSILRHIDKYERVSLAD  203

Query  262  ALEPVQFEDGETIVKQGEPGDDFYIILDGTAVVLQRRAEQGDEPAE--VGRLGPSDYFGE  319
            ALEPV F+DGE IV+QG+PGD FYII++G  VV Q     GD      V  L PSDYFGE
Sbjct  204  ALEPVNFQDGEVIVRQGDPGDRFYIIVEGKVVVTQETVP-GDHSTSHVVSELHPSDYFGE  262

Query  320  IALLLDRPRAATVVARGPLKCVKLDRARFERVLGLCADILKRNITQYNSFVS  371
            IALL DRPRAATV + G  KCV+LDR RF R+ G    +L+RN+  YN F++
Sbjct  263  IALLTDRPRAATVTSIGYTKCVELDRQRFNRLCGPIDQMLRRNMETYNQFLN  314



Lambda      K        H
   0.321    0.135    0.411 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5006522700


Query= XP_011197289.1 uncharacterized protein LOC105221854 [Bactrocera
dorsalis]

Length=468
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9MRD4_DROME  unnamed protein product                                 30.8    3.3  
M9MRD1_DROME  unnamed protein product                                 30.8    3.6  
M9PC84_DROME  unnamed protein product                                 30.8    3.6  


>M9MRD4_DROME unnamed protein product
Length=8382

 Score = 30.8 bits (68),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 19/81 (23%), Positives = 40/81 (49%), Gaps = 3/81 (4%)

Query  304   KNYDCLQKELK---STLSNHLKPSRKNKRLLPISQEVSNILPAKANQVLSSPLLNKSKIE  360
             + Y+ L K++    +T+ NH+       ++L  +Q+  N + ++A  +L+     K   E
Sbjct  3407  QEYNTLSKKISDRITTVGNHVVKHEAYDQVLEKAQDWLNTIKSEAIDILNETTFEKEGAE  3466

Query  361   SSRCLKENVVKHTSEGSFLLD  381
                 + EN+++H  EG  + D
Sbjct  3467  EKLLVVENLLQHKPEGDSIFD  3487


>M9MRD1_DROME unnamed protein product
Length=12345

 Score = 30.8 bits (68),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 19/81 (23%), Positives = 40/81 (49%), Gaps = 3/81 (4%)

Query  304   KNYDCLQKELK---STLSNHLKPSRKNKRLLPISQEVSNILPAKANQVLSSPLLNKSKIE  360
             + Y+ L K++    +T+ NH+       ++L  +Q+  N + ++A  +L+     K   E
Sbjct  3407  QEYNTLSKKISDRITTVGNHVVKHEAYDQVLEKAQDWLNTIKSEAIDILNETTFEKEGAE  3466

Query  361   SSRCLKENVVKHTSEGSFLLD  381
                 + EN+++H  EG  + D
Sbjct  3467  EKLLVVENLLQHKPEGDSIFD  3487


>M9PC84_DROME unnamed protein product
Length=12308

 Score = 30.8 bits (68),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 19/81 (23%), Positives = 40/81 (49%), Gaps = 3/81 (4%)

Query  304   KNYDCLQKELK---STLSNHLKPSRKNKRLLPISQEVSNILPAKANQVLSSPLLNKSKIE  360
             + Y+ L K++    +T+ NH+       ++L  +Q+  N + ++A  +L+     K   E
Sbjct  3407  QEYNTLSKKISDRITTVGNHVVKHEAYDQVLEKAQDWLNTIKSEAIDILNETTFEKEGAE  3466

Query  361   SSRCLKENVVKHTSEGSFLLD  381
                 + EN+++H  EG  + D
Sbjct  3467  EKLLVVENLLQHKPEGDSIFD  3487



Lambda      K        H
   0.321    0.135    0.411 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5006522700


Query= XP_011197292.1 small RNA degrading nuclease 5 [Bactrocera dorsalis]

Length=695
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VRX7_DROME  unnamed protein product                                 797     0.0  
O76875_DROME  unnamed protein product                                 109     6e-25
Q8IRW9_DROME  unnamed protein product                                 110     7e-25


>Q9VRX7_DROME unnamed protein product
Length=681

 Score = 797 bits (2058),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/684 (60%), Positives = 512/684 (75%), Gaps = 26/684 (4%)

Query  4    FSSKQEERKEKKKKKLLALAKLVQLNDNDRRDTA------TNQVVSEVGDTLATKDDDDG  57
             S+KQ ER EKKKKKL ALA L++LND DR   A        +V  E   T   +D DDG
Sbjct  5    MSTKQHERNEKKKKKLAALANLMELNDRDRLHEAELAKKRDAEVEVEEKSTAKAEDGDDG  64

Query  58   FVKVTHKKKSAKLMPPRSQTKKVITETAVEDEPETKRPK--LTKSESTDGSGSDTSQVSS  115
            F+ V  K+K      PR++ +    E   +  P T  P+  + K      +G D+  +  
Sbjct  65   FIVVGSKRK------PRNRRQNNELEADSQTAPGTSDPEEPVNKKIRNYDAGGDSLPLEI  118

Query  116  TTEEQQRLKLQLTEEQYKELRRQLRQRKRELENVPILRLREFGQRASLEMPQGQRTPIFL  175
             +         L+E+QY +L  +LR+RKRELENVP LRLRE GQRASLE PQ  RTPIFL
Sbjct  119  GS---------LSEDQYNQLSAELRRRKRELENVPALRLREMGQRASLETPQDARTPIFL  169

Query  176  TDIQHLLMSALIGKKSPCSPDRWCFLEKPLRLSHSVVLILEGLSLYHYLSNESKFIKTNE  235
            TDIQ+LLM ALIG+KSPC PDRWC +EK L LSHSVV+ILEGLSLYHYLSNE++F  TN 
Sbjct  170  TDIQNLLMCALIGQKSPCRPDRWCSVEKWLSLSHSVVVILEGLSLYHYLSNETQFEATNR  229

Query  236  IFQTRLEVVLPPLKEGS-IIEEMAQVPLTNVQAHKLIEQHGSLELAVEMTKDPTLLVKTI  294
            IF T+LE++LPP +EG  II+E+A++PLTN QA +LI++HGSLE AVE+ KDPTL VKTI
Sbjct  230  IFSTKLEMILPPQEEGQKIIDEIAKIPLTNAQARRLIDEHGSLESAVELNKDPTLFVKTI  289

Query  295  FPVGEAATAPKESNLPEGDKFPRTKLLLSALQMVDEGYPMPLRGELSNRFKDYVFTKDKY  354
            FP+   ++  +  ++ E DKFPRTKLLLSALQMVDEGYP+PL+GEL  RF+++ FTKD Y
Sbjct  290  FPI--ESSKSESDDMHEDDKFPRTKLLLSALQMVDEGYPIPLQGELHTRFQNFKFTKDLY  347

Query  355  EPVTDSSPMFGVDCEMCRTVVGHNELTRVSIVNENLETVYETLVMPTNKIVDYLTTYSGI  414
             PVT+ SPMFGVDCEMC T  G NELTR+SIVNEN ETVYETLV+P N+I DYLT YSGI
Sbjct  348  APVTNRSPMFGVDCEMCHTEAGCNELTRISIVNENYETVYETLVLPNNRITDYLTQYSGI  407

Query  415  TASIMKTVTKTIKDVQREVRELLPADAILVGQSLNFDLNAMKMMHPYVIDTSMCFNLSGV  474
            TA IM+ VTK +  VQ+EV ELLP DAILVGQSLN DLNAMKMMHPYVIDTS+CFN SGV
Sbjct  408  TAEIMEQVTKRLDVVQKEVSELLPPDAILVGQSLNSDLNAMKMMHPYVIDTSVCFNTSGV  467

Query  475  RRRKAKLQTLAMTFLKEAIQENVDGHDSVEDSLASLKLVKMKLANSLEYGDEILSQKKRL  534
            RRRK KL+ LA TFL+E IQEN+DGHDS+EDS A+LKLVK KLANS+E+GD+IL+Q K+L
Sbjct  468  RRRKTKLKDLAKTFLQEIIQENIDGHDSIEDSRATLKLVKKKLANSIEFGDQILTQHKQL  527

Query  535  HDIMRLASGDNIKNNLLAHASQRDRRTAIITNGTLQQQVKEIIAKTEDNDTRDTLKSVSF  594
             ++   +SGD I NNL AH ++RD+RTAI+T G LQ ++KE+I K  +   +D   SV  
Sbjct  528  QELANASSGDTISNNLFAHVAKRDKRTAIVTVGELQPRLKEVIEKAGEAAPKDQSTSVHV  587

Query  595  YELETNKSAINKAREIALENSLTITNLRLGVEEFQLDNAEKTVTKLDKWIGKLWQTVAHN  654
            +E+ T K AI K  E+ALEN+LTI NLR+  ++F LD+A+++V KLDK I +LW++VAHN
Sbjct  588  HEVSTAKEAIRKVNEVALENALTIANLRVPEQDFILDSAQRSVAKLDKTIDRLWKSVAHN  647

Query  655  GMFLVLMGGSTECASGVAKIAIKK  678
            G+FLV+MGGSTEC+ GVAKIAIK+
Sbjct  648  GLFLVIMGGSTECSKGVAKIAIKR  671


>O76875_DROME unnamed protein product
Length=515

 Score = 109 bits (273),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 66/180 (37%), Positives = 107/180 (59%), Gaps = 6/180 (3%)

Query  347  YVFTKDKYEPVTDSSP-MFGVDCEMCRTVVGHNELTRVSIVNENLETVYETLVMPTNKIV  405
            Y F + ++    +  P ++ +DCEM  T  G  ++T+VS+V  N + VYE  V P   I+
Sbjct  331  YDFVRTEHRGSGEDEPAVYALDCEMSYTGRG-LDVTKVSLVALNGQLVYEHFVRPVCDII  389

Query  406  DYLTTYSGITASIMKTVTKTIKDVQREVRELLPADAILVGQSLNFDLNAMKMMHPYVIDT  465
            DY T YSGIT + + +  K++ +VQR++ +L+ AD IL+G  L  DL A++++H  +IDT
Sbjct  390  DYNTQYSGITETDLCSGAKSLAEVQRDLLQLITADTILIGHGLENDLRALRLVHNTLIDT  449

Query  466  SMCF-NLSGVRRRKAKLQTLAMTFLKEAIQ--ENVDGHDSVEDSLASLKLVKMKLANSLE  522
            S+ F + +G   R+A L+ L    LK  IQ  +   GH S EDS A ++L+  ++   L+
Sbjct  450  SISFPHCNGFPYRRA-LRHLTKVHLKRDIQAGDGTTGHSSFEDSRACMELMLWRVNRELD  508


>Q8IRW9_DROME unnamed protein product
Length=742

 Score = 110 bits (275),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 66/180 (37%), Positives = 107/180 (59%), Gaps = 6/180 (3%)

Query  347  YVFTKDKYEPVTDSSP-MFGVDCEMCRTVVGHNELTRVSIVNENLETVYETLVMPTNKIV  405
            Y F + ++    +  P ++ +DCEM  T  G  ++T+VS+V  N + VYE  V P   I+
Sbjct  558  YDFVRTEHRGSGEDEPAVYALDCEMSYTGRGL-DVTKVSLVALNGQLVYEHFVRPVCDII  616

Query  406  DYLTTYSGITASIMKTVTKTIKDVQREVRELLPADAILVGQSLNFDLNAMKMMHPYVIDT  465
            DY T YSGIT + + +  K++ +VQR++ +L+ AD IL+G  L  DL A++++H  +IDT
Sbjct  617  DYNTQYSGITETDLCSGAKSLAEVQRDLLQLITADTILIGHGLENDLRALRLVHNTLIDT  676

Query  466  SMCF-NLSGVRRRKAKLQTLAMTFLKEAIQ--ENVDGHDSVEDSLASLKLVKMKLANSLE  522
            S+ F + +G   R+A L+ L    LK  IQ  +   GH S EDS A ++L+  ++   L+
Sbjct  677  SISFPHCNGFPYRRA-LRHLTKVHLKRDIQAGDGTTGHSSFEDSRACMELMLWRVNRELD  735



Lambda      K        H
   0.321    0.135    0.411 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5006522700


Query= XP_011197293.1 uncharacterized protein LOC105221857 [Bactrocera
dorsalis]

Length=347
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A0A0B4LFP7_DROME  unnamed protein product                             30.8    2.0  
A0A0B4LFW8_DROME  unnamed protein product                             30.8    2.0  
Q7JUV6_DROME  unnamed protein product                                 30.8    2.1  


>A0A0B4LFP7_DROME unnamed protein product
Length=1248

 Score = 30.8 bits (68),  Expect = 2.0, Method: Composition-based stats.
 Identities = 22/71 (31%), Positives = 36/71 (51%), Gaps = 3/71 (4%)

Query  76   EENFDVVLEKF-ENIDEMEKQLNETEAKLSEHLIGIRR-FLKRFETLEPFRFDDDDYYEL  133
            +EN D+ +     N D ++K +NET       L+  +  FLK  E L  F ++++DY   
Sbjct  208  KENLDLEITNITSNCDTVDKYMNETVEWDDCELMDTKEIFLKTVEFLRHFEYENNDYSRR  267

Query  134  CEDLCSTLDPD  144
               L S +DP+
Sbjct  268  VRFLVS-IDPN  277


>A0A0B4LFW8_DROME unnamed protein product
Length=1277

 Score = 30.8 bits (68),  Expect = 2.0, Method: Composition-based stats.
 Identities = 22/71 (31%), Positives = 36/71 (51%), Gaps = 3/71 (4%)

Query  76   EENFDVVLEKF-ENIDEMEKQLNETEAKLSEHLIGIRR-FLKRFETLEPFRFDDDDYYEL  133
            +EN D+ +     N D ++K +NET       L+  +  FLK  E L  F ++++DY   
Sbjct  208  KENLDLEITNITSNCDTVDKYMNETVEWDDCELMDTKEIFLKTVEFLRHFEYENNDYSRR  267

Query  134  CEDLCSTLDPD  144
               L S +DP+
Sbjct  268  VRFLVS-IDPN  277


>Q7JUV6_DROME unnamed protein product
Length=1353

 Score = 30.8 bits (68),  Expect = 2.1, Method: Composition-based stats.
 Identities = 22/71 (31%), Positives = 36/71 (51%), Gaps = 3/71 (4%)

Query  76   EENFDVVLEKF-ENIDEMEKQLNETEAKLSEHLIGIRR-FLKRFETLEPFRFDDDDYYEL  133
            +EN D+ +     N D ++K +NET       L+  +  FLK  E L  F ++++DY   
Sbjct  208  KENLDLEITNITSNCDTVDKYMNETVEWDDCELMDTKEIFLKTVEFLRHFEYENNDYSRR  267

Query  134  CEDLCSTLDPD  144
               L S +DP+
Sbjct  268  VRFLVS-IDPN  277



Lambda      K        H
   0.321    0.135    0.411 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5006522700


Query= XP_011197294.1 uncharacterized protein LOC105221858 [Bactrocera
dorsalis]

Length=297
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

LIPA_CAEEL  unnamed protein product                                   31.2    1.2  
Q54GL6_DICDI  unnamed protein product                                 31.2    1.3  
Q389U3_TRYB2  unnamed protein product                                 30.4    2.3  


>LIPA_CAEEL unnamed protein product
Length=1139

 Score = 31.2 bits (69),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 74/159 (47%), Gaps = 19/159 (12%)

Query  82   SENFAKVE-QLKERVGVLEDKLMAHFKQIRREEGIQSTHYSLRNFGKFAAACESFCSCPK  140
            +E+   VE +L++R+  L     A  K +  EE IQ      RN  + +A  E      +
Sbjct  375  AESLPSVEAELQQRMEAL---TAAEQKSVSAEERIQRLD---RNIQELSAELERAVQRER  428

Query  141  AEDEIACKLITNPHFIVHLIDSAITPLLNEMHGRRKRLSDLRVKFTDLKDRLNKELDELN  200
              +E + +L            S +  LL+E + R +     R++  D K+RL ++LD   
Sbjct  429  MNEEHSQRL-----------SSTVDKLLSESNDRLQLHLKERMQALDDKNRLTQQLDGTK  477

Query  201  ENYNRC-IITEKLREDFESDKITLEMTKTEIYNMLLAKL  238
            + Y++   I ++L+ D ES +  +E  + ++YN   A+ 
Sbjct  478  KIYDQAERIKDRLQRDNESLRQEIEALRQQLYNARTAQF  516


>Q54GL6_DICDI unnamed protein product
Length=1338

 Score = 31.2 bits (69),  Expect = 1.3, Method: Composition-based stats.
 Identities = 26/118 (22%), Positives = 49/118 (42%), Gaps = 15/118 (13%)

Query  178  LSDLRVKFTDLKDRLNKELDELNENYNRCIITEKLREDFESDKITLEMTKTEIYNMLLAK  237
            ++DL    T   +   K L+++   ++      +++E+F +  I    T     N L +K
Sbjct  819  IADLASNLTLASELGKKSLEKILNGFSVKDTLHRMKEEFCNSAIVTRYTTPMFTNKLFSK  878

Query  238  LDKTEVTFIKRRFHEQLRKIDR---EWNKVQALLKR--------KSEVKKNYCPRSMH  284
            L   +        HE  R ID     WN++ +L K+        + E+K+   P  +H
Sbjct  879  LSNEQAVL----GHEYERAIDELLPMWNQLTSLTKQLAPPPTLTEKEIKRKPSPYPLH  932


>Q389U3_TRYB2 unnamed protein product
Length=1175

 Score = 30.4 bits (67),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 23/70 (33%), Positives = 40/70 (57%), Gaps = 8/70 (11%)

Query  163  AITPLLNEMHGRRKRLSDLRVKFTDL-KDRLNKELDE-LNENYNRC--IITEKLREDFES  218
            A+T +LN++  RR RL     K+ +L  D++ K+L E L+    RC  ++ E+     E 
Sbjct  763  ALTTMLNDLQERRARLE----KYANLDSDKVRKDLQEQLSAAQKRCAALVHEEESGSAEF  818

Query  219  DKITLEMTKT  228
            +++  EMT+T
Sbjct  819  ERVEAEMTQT  828



Lambda      K        H
   0.321    0.135    0.411 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5006522700


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jan 6, 2022  1:11 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_011197297.1 general odorant-binding protein 56d [Bactrocera
dorsalis]

Length=133
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7K088_DROME  unnamed protein product                                 75.5    3e-18
OB56D_DROME  unnamed protein product                                  75.1    3e-18
A0A0B4LFW3_DROME  unnamed protein product                             73.9    9e-18


>Q7K088_DROME unnamed protein product
Length=132

 Score = 75.5 bits (184),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 67/129 (52%), Gaps = 0/129 (0%)

Query  1    MKSYILLVALISHSAVATHELKSNKSTQVHQFYEDCLKESGASAAQLDALKKGDFNAVDD  60
            MK + +  AL + S  +   L  ++  +  Q  + C+K+ G +  Q  AL+ G+F   D 
Sbjct  1    MKVFFVFAALAALSLASAVGLTDSQKAEAKQRAKACVKQEGITKEQAIALRSGNFADSDP  60

Query  61   KAKCFLKCLQNKKGILENGVPNEAAIHKVMTPAIGNSPPKNTLAKCNGLKGANECDTAFQ  120
            K KCF  C   + G++ NG      +   + P  G +  K   AKC+  KGA++CDT++ 
Sbjct  61   KVKCFANCFLEQTGLVANGQIKPDVVLAKLGPIAGEANVKEVQAKCDSTKGADKCDTSYL  120

Query  121  IYKCYRQEH  129
            +YKCY + H
Sbjct  121  LYKCYYENH  129


>OB56D_DROME unnamed protein product
Length=131

 Score = 75.1 bits (183),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 64/125 (51%), Gaps = 1/125 (1%)

Query  1    MKSYILLVALISHSAVATHELKSNKSTQVHQFYEDCLKESGASAAQLDALKKGDFNAVDD  60
            MK  I+L  +++ SA A  +L   +    H     C ++ G +  Q  AL+ G+F+  D 
Sbjct  1    MKFLIVLSVILAISA-AELQLSDEQKAVAHANGALCAQQEGITKDQAIALRNGNFDDSDP  59

Query  61   KAKCFLKCLQNKKGILENGVPNEAAIHKVMTPAIGNSPPKNTLAKCNGLKGANECDTAFQ  120
            K KCF  C   K G L NG      +   + P  G    K   AKC+  KGA++CDTA+Q
Sbjct  60   KVKCFANCFLEKIGFLINGEVQPDVVLAKLGPLAGEDAVKAVQAKCDATKGADKCDTAYQ  119

Query  121  IYKCY  125
            +++CY
Sbjct  120  LFECY  124


>A0A0B4LFW3_DROME unnamed protein product
Length=131

 Score = 73.9 bits (180),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 58/109 (53%), Gaps = 0/109 (0%)

Query  21   LKSNKSTQVHQFYEDCLKESGASAAQLDALKKGDFNAVDDKAKCFLKCLQNKKGILENGV  80
            L  ++  +  Q  + C+K+ G +  Q  AL+ G+F   D K KCF  C   + G++ NG 
Sbjct  20   LTDSQKAEAKQRAKACVKQEGITKEQAIALRSGNFADSDPKVKCFANCFLEQTGLVANGQ  79

Query  81   PNEAAIHKVMTPAIGNSPPKNTLAKCNGLKGANECDTAFQIYKCYRQEH  129
                 +   + P  G +  K   AKC+  KGA++CDT++ +YKCY + H
Sbjct  80   IKPDVVLAKLGPIAGEANVKEVQAKCDSTKGADKCDTSYLLYKCYYENH  128



Lambda      K        H
   0.316    0.131    0.384 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 625364460


Query= XP_011197298.1 general odorant-binding protein 69a [Bactrocera
dorsalis]

Length=138
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

OB56A_DROME  unnamed protein product                                  49.7    3e-08
OB69A_DROME  unnamed protein product                                  42.7    1e-05
Q7KE32_DROME  unnamed protein product                                 40.4    6e-05


>OB56A_DROME unnamed protein product
Length=139

 Score = 49.7 bits (117),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 68/135 (50%), Gaps = 19/135 (14%)

Query  1    MKSYGLYQLLFAVFMCSAI-TQLHAADD-----KAAREACIAEAKLTATDANQVRVAAVI  54
            M SY +  L  A+F+  A+ + L+ +D+     K  RE C  E KLT  +      A V 
Sbjct  1    MNSYFVIALS-ALFVTLAVGSSLNLSDEQKDLAKQHREQCAEEVKLTEEEK-----AKVN  54

Query  55   SKLIQNDSEALKCFQLCYYKQLGLIDAAGKTNAAKTLEYMSQVSGITDTSKLAAALGTCE  114
            +K   N +E +KCF  C+++++G +   G+   +  LE +  + G     K  AAL  C 
Sbjct  55   AKDFNNPTENIKCFANCFFEKVGTL-KDGELQESVVLEKLGALIG---EEKTKAALEKCR  110

Query  115  SVKGSSGCD---RLY  126
            ++KG + CD   +LY
Sbjct  111  TIKGENKCDTASKLY  125


>OB69A_DROME unnamed protein product
Length=148

 Score = 42.7 bits (99),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 42/86 (49%), Gaps = 5/86 (6%)

Query  52   AVISKLIQNDSEALKCFQLCYYKQLGLIDAAGKTNAAKTLEYMSQVSGITDTSKLAAALG  111
            +V ++++  D E +KCF  C +   GLID+    +    LE + +    T    +   + 
Sbjct  56   SVKNRILPTDPE-IKCFLYCMFDMFGLIDSQNIMHLEALLEVLPEEIHKT----INGLVS  110

Query  112  TCESVKGSSGCDRLYQFEKCALAKLG  137
            +C + KG  GCD  Y+  KC +A  G
Sbjct  111  SCGTQKGKDGCDTAYETVKCYIAVNG  136


>Q7KE32_DROME unnamed protein product
Length=125

 Score = 40.4 bits (93),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 36/75 (48%), Gaps = 5/75 (7%)

Query  59   QNDSEALKCFQLCYYKQLGLI--DAAGKTNAAKTLEYMSQVSGITDTSKLAAALGTCESV  116
            + DS   KCF  C  +  G+I  DA       K LE   +  GITDT +L  A   C S+
Sbjct  47   KEDSLQSKCFYHCLLEVKGVIANDAISSEQPRKVLE---KKYGITDTDELEKAEEKCHSI  103

Query  117  KGSSGCDRLYQFEKC  131
            K S  C+  Y+  KC
Sbjct  104  KASGKCELGYEILKC  118



Lambda      K        H
   0.316    0.131    0.384 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 625364460


Query= XP_011197299.1 general odorant-binding protein 56d [Bactrocera
dorsalis]

Length=138
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

OB56D_DROME  unnamed protein product                                  99.0    2e-27
A0A0B4LFW3_DROME  unnamed protein product                             85.1    4e-22
Q7K088_DROME  unnamed protein product                                 85.1    4e-22


>OB56D_DROME unnamed protein product
Length=131

 Score = 99.0 bits (245),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 77/130 (59%), Gaps = 7/130 (5%)

Query  1    MKFFAV-AVLLAFVAVAVAQEGVGKLTEEQKQKVHAAAAECFKETGASEDAVRALLKGDD  59
            MKF  V +V+LA  A  +      +L++EQK   HA  A C ++ G ++D   AL  G+ 
Sbjct  1    MKFLIVLSVILAISAAEL------QLSDEQKAVAHANGALCAQQEGITKDQAIALRNGNF  54

Query  60   SQVDGKVKCFAKCTLGKLDLLQNGKVNEEKVQKILGKLIGEEKAKAAQAKCNGLKGTDEC  119
               D KVKCFA C L K+  L NG+V  + V   LG L GE+  KA QAKC+  KG D+C
Sbjct  55   DDSDPKVKCFANCFLEKIGFLINGEVQPDVVLAKLGPLAGEDAVKAVQAKCDATKGADKC  114

Query  120  DTAYQIRQCY  129
            DTAYQ+ +CY
Sbjct  115  DTAYQLFECY  124


>A0A0B4LFW3_DROME unnamed protein product
Length=131

 Score = 85.1 bits (209),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 68/129 (53%), Gaps = 0/129 (0%)

Query  8    VLLAFVAVAVAQEGVGKLTEEQKQKVHAAAAECFKETGASEDAVRALLKGDDSQVDGKVK  67
            V   F A+A        LT+ QK +    A  C K+ G +++   AL  G+ +  D KVK
Sbjct  3    VFFVFAALAALSLASAGLTDSQKAEAKQRAKACVKQEGITKEQAIALRSGNFADSDPKVK  62

Query  68   CFAKCTLGKLDLLQNGKVNEEKVQKILGKLIGEEKAKAAQAKCNGLKGTDECDTAYQIRQ  127
            CFA C L +  L+ NG++  + V   LG + GE   K  QAKC+  KG D+CDT+Y + +
Sbjct  63   CFANCFLEQTGLVANGQIKPDVVLAKLGPIAGEANVKEVQAKCDSTKGADKCDTSYLLYK  122

Query  128  CYAAGHESF  136
            CY   H  F
Sbjct  123  CYYENHAQF  131


>Q7K088_DROME unnamed protein product
Length=132

 Score = 85.1 bits (209),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 63/112 (56%), Gaps = 0/112 (0%)

Query  25   LTEEQKQKVHAAAAECFKETGASEDAVRALLKGDDSQVDGKVKCFAKCTLGKLDLLQNGK  84
            LT+ QK +    A  C K+ G +++   AL  G+ +  D KVKCFA C L +  L+ NG+
Sbjct  21   LTDSQKAEAKQRAKACVKQEGITKEQAIALRSGNFADSDPKVKCFANCFLEQTGLVANGQ  80

Query  85   VNEEKVQKILGKLIGEEKAKAAQAKCNGLKGTDECDTAYQIRQCYAAGHESF  136
            +  + V   LG + GE   K  QAKC+  KG D+CDT+Y + +CY   H  F
Sbjct  81   IKPDVVLAKLGPIAGEANVKEVQAKCDSTKGADKCDTSYLLYKCYYENHAQF  132



Lambda      K        H
   0.316    0.131    0.384 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 625364460


Query= XP_011197300.1 general odorant-binding protein 56d [Bactrocera
dorsalis]

Length=138
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

OB56D_DROME  unnamed protein product                                  98.2    3e-27
A0A0B4LFW3_DROME  unnamed protein product                             90.1    6e-24
Q7K088_DROME  unnamed protein product                                 90.1    6e-24


>OB56D_DROME unnamed protein product
Length=131

 Score = 98.2 bits (243),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 81/129 (63%), Gaps = 5/129 (4%)

Query  1    MKFFAVAVLLAFVAVAAAQEGVNKLTEEQKQKARALGTECLKETGASEEAIRALIKGDDS  60
            MKF  + VL   +A++AA+    +L++EQK  A A G  C ++ G +++   AL  G+  
Sbjct  1    MKF--LIVLSVILAISAAEL---QLSDEQKAVAHANGALCAQQEGITKDQAIALRNGNFD  55

Query  61   QVDGKVKCFSKCMQEKLGFVENGKVNEEKVQNFLGKLIGEENAKATQAKCNDLKGTDECD  120
              D KVKCF+ C  EK+GF+ NG+V  + V   LG L GE+  KA QAKC+  KG D+CD
Sbjct  56   DSDPKVKCFANCFLEKIGFLINGEVQPDVVLAKLGPLAGEDAVKAVQAKCDATKGADKCD  115

Query  121  TAFQIRQCY  129
            TA+Q+ +CY
Sbjct  116  TAYQLFECY  124


>A0A0B4LFW3_DROME unnamed protein product
Length=131

 Score = 90.1 bits (222),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 71/126 (56%), Gaps = 0/126 (0%)

Query  8    VLLAFVAVAAAQEGVNKLTEEQKQKARALGTECLKETGASEEAIRALIKGDDSQVDGKVK  67
            V   F A+AA       LT+ QK +A+     C+K+ G ++E   AL  G+ +  D KVK
Sbjct  3    VFFVFAALAALSLASAGLTDSQKAEAKQRAKACVKQEGITKEQAIALRSGNFADSDPKVK  62

Query  68   CFSKCMQEKLGFVENGKVNEEKVQNFLGKLIGEENAKATQAKCNDLKGTDECDTAFQIRQ  127
            CF+ C  E+ G V NG++  + V   LG + GE N K  QAKC+  KG D+CDT++ + +
Sbjct  63   CFANCFLEQTGLVANGQIKPDVVLAKLGPIAGEANVKEVQAKCDSTKGADKCDTSYLLYK  122

Query  128  CYAAGH  133
            CY   H
Sbjct  123  CYYENH  128


>Q7K088_DROME unnamed protein product
Length=132

 Score = 90.1 bits (222),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 65/109 (60%), Gaps = 0/109 (0%)

Query  25   LTEEQKQKARALGTECLKETGASEEAIRALIKGDDSQVDGKVKCFSKCMQEKLGFVENGK  84
            LT+ QK +A+     C+K+ G ++E   AL  G+ +  D KVKCF+ C  E+ G V NG+
Sbjct  21   LTDSQKAEAKQRAKACVKQEGITKEQAIALRSGNFADSDPKVKCFANCFLEQTGLVANGQ  80

Query  85   VNEEKVQNFLGKLIGEENAKATQAKCNDLKGTDECDTAFQIRQCYAAGH  133
            +  + V   LG + GE N K  QAKC+  KG D+CDT++ + +CY   H
Sbjct  81   IKPDVVLAKLGPIAGEANVKEVQAKCDSTKGADKCDTSYLLYKCYYENH  129



Lambda      K        H
   0.316    0.131    0.384 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 625364460


Query= XP_011197301.1 uncharacterized protein LOC105221862, partial
[Bactrocera dorsalis]

Length=147
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DCTN5_DICDI  unnamed protein product                                  28.5    1.6  
KDM4_CAEEL  unnamed protein product                                   28.5    2.6  
Q20068_CAEEL  unnamed protein product                                 27.3    5.0  


>DCTN5_DICDI unnamed protein product
Length=198

 Score = 28.5 bits (62),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 19/83 (23%), Positives = 35/83 (42%), Gaps = 1/83 (1%)

Query  66   TTKPGIWSTRNV-SCKRKRLQTDNKNMPYEPIAKSLEGNEFIVPQDLSMRIKEKKPTSSE  124
              KPG+    ++ S    RL   ++N    P +K  +G+    PQ++   +   +     
Sbjct  41   IIKPGVIVRGDLASVNIGRLSIISENTVIRPSSKKFKGSLVYFPQNIGDHVLVGEGCVIS  100

Query  125  CGHTDTNVLTNNSSRMSKNCVQK  147
                 +NV   N+  +SK C+ K
Sbjct  101  AASIGSNVYIGNNCIISKRCILK  123


>KDM4_CAEEL unnamed protein product
Length=922

 Score = 28.5 bits (62),  Expect = 2.6, Method: Composition-based stats.
 Identities = 11/18 (61%), Positives = 14/18 (78%), Gaps = 0/18 (0%)

Query  65   ATTKPGIWSTRNVSCKRK  82
            AT KPG +  RNV+C+RK
Sbjct  154  ATEKPGAYFKRNVTCRRK  171


>Q20068_CAEEL unnamed protein product
Length=493

 Score = 27.3 bits (59),  Expect = 5.0, Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 30/68 (44%), Gaps = 17/68 (25%)

Query  4    DNKSVGLPSIRDKPQD--------YGDTKSQTLKKISGVRTVGTFFPGCNEVSGNPSDNK  55
            DN+SVG P   D PQ         YG+     L K   VR +  +FP   E+  N   N+
Sbjct  126  DNRSVGFPPSSDSPQFILCRELNLYGN----LLYKWKTVRQILEYFPRIQEL--NLRRNR  179

Query  56   LHHENCFD  63
            +    CF+
Sbjct  180  MQ---CFN  184



Lambda      K        H
   0.316    0.131    0.384 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 625364460


Query= XP_011197302.1 general odorant-binding protein 56d [Bactrocera
dorsalis]

Length=136
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

OB56D_DROME  unnamed protein product                                  95.1    5e-26
Q7K088_DROME  unnamed protein product                                 79.3    8e-20
A0A0B4LFW3_DROME  unnamed protein product                             79.3    9e-20


>OB56D_DROME unnamed protein product
Length=131

 Score = 95.1 bits (235),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 73/120 (61%), Gaps = 1/120 (1%)

Query  8    VLIVFVAVAAAQEGMLTPEQIQKVHTLSNECLKETGASEDAIRALIKGDDSQVDGKVKCY  67
            VL V +A++AA E  L+ EQ    H     C ++ G ++D   AL  G+    D KVKC+
Sbjct  6    VLSVILAISAA-ELQLSDEQKAVAHANGALCAQQEGITKDQAIALRNGNFDDSDPKVKCF  64

Query  68   AQCMLVKLGYVENGKVNEEKVQNILGKLIGEEKAKATQAKCNGLKGTDECDTAYQIRQCY  127
            A C L K+G++ NG+V  + V   LG L GE+  KA QAKC+  KG D+CDTAYQ+ +CY
Sbjct  65   ANCFLEKIGFLINGEVQPDVVLAKLGPLAGEDAVKAVQAKCDATKGADKCDTAYQLFECY  124


>Q7K088_DROME unnamed protein product
Length=132

 Score = 79.3 bits (194),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 62/112 (55%), Gaps = 0/112 (0%)

Query  23   LTPEQIQKVHTLSNECLKETGASEDAIRALIKGDDSQVDGKVKCYAQCMLVKLGYVENGK  82
            LT  Q  +    +  C+K+ G +++   AL  G+ +  D KVKC+A C L + G V NG+
Sbjct  21   LTDSQKAEAKQRAKACVKQEGITKEQAIALRSGNFADSDPKVKCFANCFLEQTGLVANGQ  80

Query  83   VNEEKVQNILGKLIGEEKAKATQAKCNGLKGTDECDTAYQIRQCYSAGYNGF  134
            +  + V   LG + GE   K  QAKC+  KG D+CDT+Y + +CY   +  F
Sbjct  81   IKPDVVLAKLGPIAGEANVKEVQAKCDSTKGADKCDTSYLLYKCYYENHAQF  132


>A0A0B4LFW3_DROME unnamed protein product
Length=131

 Score = 79.3 bits (194),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 62/112 (55%), Gaps = 0/112 (0%)

Query  23   LTPEQIQKVHTLSNECLKETGASEDAIRALIKGDDSQVDGKVKCYAQCMLVKLGYVENGK  82
            LT  Q  +    +  C+K+ G +++   AL  G+ +  D KVKC+A C L + G V NG+
Sbjct  20   LTDSQKAEAKQRAKACVKQEGITKEQAIALRSGNFADSDPKVKCFANCFLEQTGLVANGQ  79

Query  83   VNEEKVQNILGKLIGEEKAKATQAKCNGLKGTDECDTAYQIRQCYSAGYNGF  134
            +  + V   LG + GE   K  QAKC+  KG D+CDT+Y + +CY   +  F
Sbjct  80   IKPDVVLAKLGPIAGEANVKEVQAKCDSTKGADKCDTSYLLYKCYYENHAQF  131



Lambda      K        H
   0.316    0.131    0.384 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 625364460


Query= XP_011197303.1 angiopoietin-2 [Bactrocera dorsalis]

Length=196
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TL5A_TACTR  unnamed protein product                                   42.7    7e-05
TL5B_TACTR  unnamed protein product                                   37.0    0.005
SCA_DROME  unnamed protein product                                    33.9    0.075


>TL5A_TACTR unnamed protein product
Length=292

 Score = 42.7 bits (99),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 50/108 (46%), Gaps = 6/108 (6%)

Query  46   VDIFEVYCELGDLDKKPWLVIFLRKEPKTE----YGRWQDYTEGYHTLSGNYFIGLQRLY  101
            V    VYC++ + D   W VI  R          Y  W++Y  G+  +  ++++G  R++
Sbjct  96   VGTLNVYCDM-ETDGGGWTVIQRRGNYGNPSDYFYKPWKNYKLGFGNIEKDFWLGNDRIF  154

Query  102  AITNRQPHELMMQLRQRNGMQHYLHFAHFLIASETSSYGVVSSGAYVG  149
            A+TN++ + +   L+ +     Y  +  F I +E   Y  +  G Y G
Sbjct  155  ALTNQRNYMIRFDLKDKENDTRYAIYQDFWIENEDYLY-CLHIGNYSG  201


>TL5B_TACTR unnamed protein product
Length=316

 Score = 37.0 bits (84),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 23/93 (25%), Positives = 42/93 (45%), Gaps = 5/93 (5%)

Query  51   VYCELGDLDKKPWLVIFLRKE----PKTEYGRWQDYTEGYHTLSGNYFIGLQRLYAITNR  106
            V+C++ +     W VI  R +     +  Y  W+ Y  G+  L+  +++G   ++ +TN+
Sbjct  122  VFCDM-ETAGGGWTVIQRRGDFGQPIQNFYQTWESYKNGFGNLTKEFWLGNDIIFVLTNQ  180

Query  107  QPHELMMQLRQRNGMQHYLHFAHFLIASETSSY  139
                L + L    G + Y     FL+ SE   Y
Sbjct  181  DSVVLRVDLEDFEGGRRYAEAVEFLVRSEIELY  213


>SCA_DROME unnamed protein product
Length=799

 Score = 33.9 bits (76),  Expect = 0.075, Method: Composition-based stats.
 Identities = 18/78 (23%), Positives = 35/78 (45%), Gaps = 1/78 (1%)

Query  63   WLVIFLRKEPKTEYGR-WQDYTEGYHTLSGNYFIGLQRLYAITNRQPHELMMQLRQRNGM  121
            W  +  R +   ++ R W DY +G+    G ++IG ++L+ +T      L +Q++     
Sbjct  573  WTTVQRRFDGSADFNRSWADYAQGFGAPGGEFWIGNEQLHHLTLDNCSRLQVQMQDIYDN  632

Query  122  QHYLHFAHFLIASETSSY  139
                 +  F I+S    Y
Sbjct  633  VWVAEYKRFYISSRADGY  650



Lambda      K        H
   0.316    0.131    0.384 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 625364460


Query= XP_011197304.1 general odorant-binding protein 56h [Bactrocera
dorsalis]

Length=136
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

OB56H_DROME  unnamed protein product                                  96.3    2e-26
OB56A_DROME  unnamed protein product                                  58.5    1e-11
A1ZBQ3_DROME  unnamed protein product                                 55.1    2e-10


>OB56H_DROME unnamed protein product
Length=134

 Score = 96.3 bits (238),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 78/125 (62%), Gaps = 1/125 (1%)

Query  5    YILTIIAALVTLAVCQLPADLEKFHKACMDEAKVTDEQMRQFFQNGMKASDATENIKCQM  64
            + L  IA    L++ Q   D  +  + CM+  +VT+  +++F  +GM++S A EN+KC  
Sbjct  3    FTLFCIALAAFLSMGQCNPDFRQIMQQCMETNQVTEADLKEFMASGMQSS-AKENLKCYT  61

Query  65   KCMMQKQGIWKDGVFDADAKIKELVQNPKFKGKEADLTKAINNCKNEKGANECDTVFKIS  124
            KC+M+KQG   +G F+A A +  L   P+ K K  +++  +N CK+ KG N+CDT FK++
Sbjct  62   KCLMEKQGHLTNGQFNAQAMLDTLKNVPQIKDKMDEISSGVNACKDIKGTNDCDTAFKVT  121

Query  125  MCIKE  129
            MC+KE
Sbjct  122  MCLKE  126


>OB56A_DROME unnamed protein product
Length=139

 Score = 58.5 bits (140),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 65/140 (46%), Gaps = 19/140 (14%)

Query  1    MQKFYILTIIAALVTLAVCQL------PADLEKFHKA-CMDEAKVTDEQMRQFFQNGMKA  53
            M  ++++ + A  VTLAV           DL K H+  C +E K+T+E+  +   N    
Sbjct  1    MNSYFVIALSALFVTLAVGSSLNLSDEQKDLAKQHREQCAEEVKLTEEEKAKV--NAKDF  58

Query  54   SDATENIKCQMKCMMQKQGIWKDGVFDADA---KIKELVQNPKFKGKEADLTKAINNCKN  110
            ++ TENIKC   C  +K G  KDG         K+  L+   K K        A+  C+ 
Sbjct  59   NNPTENIKCFANCFFEKVGTLKDGELQESVVLEKLGALIGEEKTKA-------ALEKCRT  111

Query  111  EKGANECDTVFKISMCIKEF  130
             KG N+CDT  K+  C + F
Sbjct  112  IKGENKCDTASKLYDCFESF  131


>A1ZBQ3_DROME unnamed protein product
Length=131

 Score = 55.1 bits (131),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/131 (30%), Positives = 61/131 (47%), Gaps = 6/131 (5%)

Query  1    MQKFYILTIIAALVT--LAVCQLPADLEK-FHKACMDEAKVTDEQMRQFFQNGMKASDAT  57
            M+  + LT++   ++  LA   + + + K     C+ E  VT + +       +KA DA 
Sbjct  1    MRATFALTLLLGCLSGILAQANIDSSVSKELVTDCLKENGVTPQDLADLQSGKVKAEDAK  60

Query  58   ENIKCQMKCMMQKQGIWKDGVFDADAKIKELVQNPKFKGKEADLTKAINNCKNEKGANEC  117
            +N+KC  +C++ K G           KIK    N  FK     + K ++ C   KGAN C
Sbjct  61   DNVKCSSQCILVKSGFMDSTGKLLTDKIKSYYANSNFKDV---IEKDLDRCSAVKGANAC  117

Query  118  DTVFKISMCIK  128
            DT FKI  C +
Sbjct  118  DTAFKILSCFQ  128



Lambda      K        H
   0.316    0.131    0.384 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 625364460


Query= XP_011197305.1 general odorant-binding protein 56h [Bactrocera
dorsalis]

Length=123
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A1ZBQ3_DROME  unnamed protein product                                 74.7    3e-18
A1ZBQ4_DROME  unnamed protein product                                 74.3    5e-18
OB56H_DROME  unnamed protein product                                  66.2    7e-15


>A1ZBQ3_DROME unnamed protein product
Length=131

 Score = 74.7 bits (182),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 62/121 (51%), Gaps = 6/121 (5%)

Query  5    VTIALLVVGSAVVLCNPHDPEMRGYIEDCNKEHNVSPKDFHDFIEGKLTT--VPENMKCS  62
            +T+ L  +   +   N      +  + DC KE+ V+P+D  D   GK+      +N+KCS
Sbjct  7    LTLLLGCLSGILAQANIDSSVSKELVTDCLKENGVTPQDLADLQSGKVKAEDAKDNVKCS  66

Query  63   SQCIMVKQGIMDESGNFKPDAAKAKMK----EDKLVAAVDECKDLSGSTPCDTAFKITSC  118
            SQCI+VK G MD +G    D  K+       +D +   +D C  + G+  CDTAFKI SC
Sbjct  67   SQCILVKSGFMDSTGKLLTDKIKSYYANSNFKDVIEKDLDRCSAVKGANACDTAFKILSC  126

Query  119  M  119
             
Sbjct  127  F  127


>A1ZBQ4_DROME unnamed protein product
Length=132

 Score = 74.3 bits (181),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 54/96 (56%), Gaps = 6/96 (6%)

Query  30   IEDCNKEHNVSPKDFHDFIEGKLTT--VPENMKCSSQCIMVKQGIMDESGNFKPDAAKAK  87
            + DC KE+ V+P+D  D   GK+      +N+KCSSQCI+VK G MD +G    D  K+ 
Sbjct  33   VTDCLKENGVTPQDLADLQSGKVKAEDAKDNVKCSSQCILVKSGFMDSTGKLLTDKIKSY  92

Query  88   MK----EDKLVAAVDECKDLSGSTPCDTAFKITSCM  119
                  +D +   +D C  + G+  CDTAFKI SC 
Sbjct  93   YANSNFKDVIEKDLDRCSAVKGANACDTAFKILSCF  128


>OB56H_DROME unnamed protein product
Length=134

 Score = 66.2 bits (160),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 62/110 (56%), Gaps = 10/110 (9%)

Query  23   DPEMRGYIEDCNKEHNVSPKDFHDFI-EGKLTTVPENMKCSSQCIMVKQGIMDESGNFKP  81
            +P+ R  ++ C + + V+  D  +F+  G  ++  EN+KC ++C+M KQG +  +G F  
Sbjct  20   NPDFRQIMQQCMETNQVTEADLKEFMASGMQSSAKENLKCYTKCLMEKQGHL-TNGQFNA  78

Query  82   DAA--------KAKMKEDKLVAAVDECKDLSGSTPCDTAFKITSCMLSKK  123
             A         + K K D++ + V+ CKD+ G+  CDTAFK+T C+   K
Sbjct  79   QAMLDTLKNVPQIKDKMDEISSGVNACKDIKGTNDCDTAFKVTMCLKEHK  128



Lambda      K        H
   0.316    0.131    0.384 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 625364460


Query= XP_011197306.2 uncharacterized protein LOC105221870 [Bactrocera
dorsalis]

Length=315
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

OB56A_DROME  unnamed protein product                                  49.7    2e-07
Q7K088_DROME  unnamed protein product                                 43.5    3e-05
A0A0B4LFW3_DROME  unnamed protein product                             43.1    3e-05


>OB56A_DROME unnamed protein product
Length=139

 Score = 49.7 bits (117),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 48/92 (52%), Gaps = 11/92 (12%)

Query  137  NALDYEDPLTIRSDGKTDESLQCFAYCLYEQLGLISKGVYMDEELFGKLYAIVGRE--RH  194
            NA D+ +P          E+++CFA C +E++G +  G   +  +  KL A++G E  + 
Sbjct  54   NAKDFNNPT---------ENIKCFANCFFEKVGTLKDGELQESVVLEKLGALIGEEKTKA  104

Query  195  LVKECMNLNTNNKCESLYKMHLCYVRLKTLEE  226
             +++C  +   NKC++  K++ C+   K   E
Sbjct  105  ALEKCRTIKGENKCDTASKLYDCFESFKPAPE  136


>Q7K088_DROME unnamed protein product
Length=132

 Score = 43.5 bits (101),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/89 (27%), Positives = 43/89 (48%), Gaps = 4/89 (4%)

Query  134  VNNNALDYEDPLTIRSD--GKTDESLQCFAYCLYEQLGLISKGVYMDEELFGKLYAIVGR  191
            V    +  E  + +RS     +D  ++CFA C  EQ GL++ G    + +  KL  I G 
Sbjct  37   VKQEGITKEQAIALRSGNFADSDPKVKCFANCFLEQTGLVANGQIKPDVVLAKLGPIAGE  96

Query  192  E--RHLVKECMNLNTNNKCESLYKMHLCY  218
               + +  +C +    +KC++ Y ++ CY
Sbjct  97   ANVKEVQAKCDSTKGADKCDTSYLLYKCY  125


>A0A0B4LFW3_DROME unnamed protein product
Length=131

 Score = 43.1 bits (100),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/89 (27%), Positives = 43/89 (48%), Gaps = 4/89 (4%)

Query  134  VNNNALDYEDPLTIRSD--GKTDESLQCFAYCLYEQLGLISKGVYMDEELFGKLYAIVGR  191
            V    +  E  + +RS     +D  ++CFA C  EQ GL++ G    + +  KL  I G 
Sbjct  36   VKQEGITKEQAIALRSGNFADSDPKVKCFANCFLEQTGLVANGQIKPDVVLAKLGPIAGE  95

Query  192  E--RHLVKECMNLNTNNKCESLYKMHLCY  218
               + +  +C +    +KC++ Y ++ CY
Sbjct  96   ANVKEVQAKCDSTKGADKCDTSYLLYKCY  124



Lambda      K        H
   0.316    0.131    0.384 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 625364460


Query= XP_011197307.2 calcium-dependent secretion activator, partial
[Bactrocera dorsalis]

Length=529
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CAPS_DROME  unnamed protein product                                   805     0.0   
CAPS_CAEEL  unnamed protein product                                   440     7e-141
H9G2V3_CAEEL  unnamed protein product                                 439     9e-141


>CAPS_DROME unnamed protein product
Length=1447

 Score = 805 bits (2078),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/593 (70%), Positives = 462/593 (78%), Gaps = 83/593 (14%)

Query  2    RHEREEEDRKRRIQLYVFVSRCISYPFNAKQPTDMTKRQPK-------IVKQQLETIT--  52
            +HEREEE+RKRRIQLYVF+SRCISYPFNAKQPTDMTKRQ K       I+ Q+ +     
Sbjct  156  KHEREEEERKRRIQLYVFISRCISYPFNAKQPTDMTKRQTKISKQQLEIITQRFQAFLKG  215

Query  53   -------QRFQ--------AFLKGETQIMADEAFQNAVQSYHDVFLKS--ERVQKMVQSG  95
                   + FQ         FLK E  +   ++  ++   + +VF  +  +RV+ + +  
Sbjct  216  ETQIMADEAFQNAVQSYHDVFLKSERVLKMVQSGASSQHDFREVFRNNIEKRVRSLPEID  275

Query  96   ACSQH----DFREVFRNNIEKRVSEETKTDCNLRQ-------------------------  126
              S+      +   F   ++    E++K    ++Q                         
Sbjct  276  GLSKETVLTSWMAKFDIILKGTGEEDSKRPSRMQQSLNSELILSKEQLYDMFQQILLVKK  335

Query  127  ----------ILDSADEQAAAIRRELDGRMQRVSEMEKNRKLMPKFVLKEMESLYIEELK  176
                      +LDSADEQAAAIRRELDGRMQRV EMEKNRKLMPKFVLKEMESLY+EELK
Sbjct  336  FEHQILFNALMLDSADEQAAAIRRELDGRMQRVGEMEKNRKLMPKFVLKEMESLYVEELK  395

Query  177  SSINLLMANLESLPVSKGNMDSKYGLQKLKRYNHSTPSFLKMILRSHGSLSKLEGDADEG  236
            SSINLLMANLESLPVSKGNMDSKYGLQKLKRYNHSTPSFLK+ILRSHGSLSKLEGD+++G
Sbjct  396  SSINLLMANLESLPVSKGNMDSKYGLQKLKRYNHSTPSFLKLILRSHGSLSKLEGDSEDG  455

Query  237  ITQLTKLDVVLTFQLEVIVMEVKGLKSLAPNRIVYCTMEVENGEKLQTDQAEASKPMWDT  296
             TQLTKLDVVLTFQLEVIVMEV                  ENGEKLQTDQAEASKPMWDT
Sbjct  456  STQLTKLDVVLTFQLEVIVMEV------------------ENGEKLQTDQAEASKPMWDT  497

Query  297  QGDFTTTHPLPIVKVKLYTENPGMLALEDKELGKVTIKPTPLSSKSPEWHRLVVPKNLPD  356
            QGDFTTTHPLP+VKVKLYTENPGMLALEDKELGKVT+KPTPLSSKSPEWHR++VPKNLPD
Sbjct  498  QGDFTTTHPLPVVKVKLYTENPGMLALEDKELGKVTLKPTPLSSKSPEWHRMIVPKNLPD  557

Query  357  QDLRIKIACRLDKPLNMKHCGYLHAIGKSVWKKWKKRYFVLVQVSQYTFAMCSYKEKKSE  416
            QD+RIKIACRLDKPLNMKHCGYL+AIGKSVWKKWK+RYFVLVQVSQYTFAMCSYKEKKSE
Sbjct  558  QDIRIKIACRLDKPLNMKHCGYLYAIGKSVWKKWKRRYFVLVQVSQYTFAMCSYKEKKSE  617

Query  417  PSEMMQLDGYTVDYIEAASANLMFGIDLNGGRYFFNAVREGDSIVFACDDENECSLWVMA  476
            PSEMMQLDGYTVDYIEAASANLMFGIDLNGGRYFFNAVREGDSI FACDDENECSLWVMA
Sbjct  618  PSEMMQLDGYTVDYIEAASANLMFGIDLNGGRYFFNAVREGDSISFACDDENECSLWVMA  677

Query  477  MYRATGQSHKPTPPVTQDKNSAISKIQGDADKARKHGMEDYISADPCSFDHAS  529
            MYRATGQSHKPTPP+TQDKNSA+SKIQGDADKARKHGMED+IS DPC+FDHA+
Sbjct  678  MYRATGQSHKPTPPITQDKNSAMSKIQGDADKARKHGMEDFISTDPCTFDHAT  730


>CAPS_CAEEL unnamed protein product
Length=1378

 Score = 440 bits (1131),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 219/405 (54%), Positives = 296/405 (73%), Gaps = 18/405 (4%)

Query  128  LDSADEQAAAIRRELDGRMQRVSEMEKNRKLMPKFVLKEMESLYIEELKSSINLLMANLE  187
            LD+ DEQAAAIRRE   R + + +  K ++L PKFV+K+ME+LY++E++ SIN L+ NLE
Sbjct  326  LDNPDEQAAAIRREFATREEALKDPIKMKRLTPKFVVKDMETLYMDEVRMSINTLIGNLE  385

Query  188  SLPVSKGNMDSKYGLQKLKRYNHSTP--SFLKMILR--SHGSLSKLEGDADEGITQLTKL  243
            ++PV+     +  G +K K  + S    S    + R  S GSL+K  GD+++G   LTK 
Sbjct  386  TVPVT--TRGATVGKRKDKSRSRSIEDLSLFNSLKRRTSSGSLNK--GDSEDGDVTLTKS  441

Query  244  DVVLTFQLEVIVMEVKGLKSLAPNRIVYCTMEVENGEKLQTDQAEASKPMWDTQGDFTTT  303
            DV L   +EV+VMEV+GLKS+ P++IVYCTMEV +G KLQTD AEASKP WDTQGDF+T 
Sbjct  442  DVSLALSMEVVVMEVQGLKSVQPSKIVYCTMEV-DGHKLQTDHAEASKPKWDTQGDFSTK  500

Query  304  HPLPIVKVKLYTENPGMLALEDKELGKVTIKPTPLSSKSPEWHRLVVPKNLPDQDLRIKI  363
            +PLP+VKVKLYTE   M+A EDKELGKV I+PTP  ++SPEW+ + +PK+  DQ+L+I+I
Sbjct  501  NPLPVVKVKLYTEVKSMIAFEDKELGKVIIQPTPNCARSPEWYTMTLPKSSQDQNLKIRI  560

Query  364  ACRLDKPLNMKHCGYLHAIGKSVWKKWKKRYFVLVQVSQYTFAMCSYKEKKSEPSEMMQL  423
            A R++KP N+K+CGY + IG++ WKKWKKR+F LVQVSQY FA+CS+++KK++P+E +QL
Sbjct  561  AIRVEKPPNLKYCGYCYCIGRNAWKKWKKRFFCLVQVSQYAFAVCSFRQKKADPTEFIQL  620

Query  424  DGYTVDYIEAASANLMFGIDLNGGRYFFNAVREGDSIVFACDDENECSLWVMAMYRATGQ  483
            DG+T+DY+  +   L       GG++FF A++EGD + FA DDENE  LWV A+YRATGQ
Sbjct  621  DGFTIDYMPESDPEL----SAQGGKHFFTAIKEGDELKFATDDENERHLWVQALYRATGQ  676

Query  484  SHKPTPPVTQDKNSAIS-KIQGDADKARKHGMEDYISADPCSFDH  527
            ++KP PP    K S I+ K QG  DKA KHGM+  I AD  +FDH
Sbjct  677  AYKPVPP----KQSTIAPKAQGFQDKASKHGMDAMIQADSINFDH  717


 Score = 157 bits (398),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 90/113 (80%), Gaps = 0/113 (0%)

Query  2    RHEREEEDRKRRIQLYVFVSRCISYPFNAKQPTDMTKRQPKIVKQQLETITQRFQAFLKG  61
            + EREEED K+ +Q+Y+F++RCI+YPFN +Q  DM +RQ K+ KQ+L  I +RF  FLKG
Sbjct  131  KAEREEEDHKKNLQMYMFLARCIAYPFNGQQTGDMARRQMKVNKQELARIRERFTLFLKG  190

Query  62   ETQIMADEAFQNAVQSYHDVFLKSERVQKMVQSGACSQHDFREVFRNNIEKRV  114
            ET I ADEAF  A+QSY +VFLKSERVQK+V +G  SQHDFREVFR NIEKRV
Sbjct  191  ETNIAADEAFTKAIQSYFEVFLKSERVQKVVHAGGFSQHDFREVFRLNIEKRV  243


>H9G2V3_CAEEL unnamed protein product
Length=1366

 Score = 439 bits (1130),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 216/403 (54%), Positives = 292/403 (72%), Gaps = 26/403 (6%)

Query  128  LDSADEQAAAIRRELDGRMQRVSEMEKNRKLMPKFVLKEMESLYIEELKSSINLLMANLE  187
            LD+ DEQAAAIRRE   R + + +  K ++L PKFV+K+ME+LY++E++ SIN L+ NLE
Sbjct  326  LDNPDEQAAAIRREFATREEALKDPIKMKRLTPKFVVKDMETLYMDEVRMSINTLIGNLE  385

Query  188  SLPVSK--GNMDSKYGLQKLKRYNHSTPSFLKMILRSHGSLSKLEGDADEGITQLTKLDV  245
            ++PV+     +  +    +LKR   S            GSL+K  GD+++G   LTK DV
Sbjct  386  TVPVTTRGATVGKRKDKSRLKRRTSS------------GSLNK--GDSEDGDVTLTKSDV  431

Query  246  VLTFQLEVIVMEVKGLKSLAPNRIVYCTMEVENGEKLQTDQAEASKPMWDTQGDFTTTHP  305
             L   +EV+VMEV+GLKS+ P++IVYCTMEV +G KLQTD AEASKP WDTQGDF+T +P
Sbjct  432  SLALSMEVVVMEVQGLKSVQPSKIVYCTMEV-DGHKLQTDHAEASKPKWDTQGDFSTKNP  490

Query  306  LPIVKVKLYTENPGMLALEDKELGKVTIKPTPLSSKSPEWHRLVVPKNLPDQDLRIKIAC  365
            LP+VKVKLYTE   M+A EDKELGKV I+PTP  ++SPEW+ + +PK+  DQ+L+I+IA 
Sbjct  491  LPVVKVKLYTEVKSMIAFEDKELGKVIIQPTPNCARSPEWYTMTLPKSSQDQNLKIRIAI  550

Query  366  RLDKPLNMKHCGYLHAIGKSVWKKWKKRYFVLVQVSQYTFAMCSYKEKKSEPSEMMQLDG  425
            R++KP N+K+CGY + IG++ WKKWKKR+F LVQVSQY FA+CS+++KK++P+E +QLDG
Sbjct  551  RVEKPPNLKYCGYCYCIGRNAWKKWKKRFFCLVQVSQYAFAVCSFRQKKADPTEFIQLDG  610

Query  426  YTVDYIEAASANLMFGIDLNGGRYFFNAVREGDSIVFACDDENECSLWVMAMYRATGQSH  485
            +T+DY+  +   L       GG++FF A++EGD + FA DDENE  LWV A+YRATGQ++
Sbjct  611  FTIDYMPESDPEL----SAQGGKHFFTAIKEGDELKFATDDENERHLWVQALYRATGQAY  666

Query  486  KPTPPVTQDKNSAIS-KIQGDADKARKHGMEDYISADPCSFDH  527
            KP PP    K S I+ K QG  DKA KHGM+  I AD  +FDH
Sbjct  667  KPVPP----KQSTIAPKAQGFQDKASKHGMDAMIQADSINFDH  705


 Score = 158 bits (399),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 90/113 (80%), Gaps = 0/113 (0%)

Query  2    RHEREEEDRKRRIQLYVFVSRCISYPFNAKQPTDMTKRQPKIVKQQLETITQRFQAFLKG  61
            + EREEED K+ +Q+Y+F++RCI+YPFN +Q  DM +RQ K+ KQ+L  I +RF  FLKG
Sbjct  131  KAEREEEDHKKNLQMYMFLARCIAYPFNGQQTGDMARRQMKVNKQELARIRERFTLFLKG  190

Query  62   ETQIMADEAFQNAVQSYHDVFLKSERVQKMVQSGACSQHDFREVFRNNIEKRV  114
            ET I ADEAF  A+QSY +VFLKSERVQK+V +G  SQHDFREVFR NIEKRV
Sbjct  191  ETNIAADEAFTKAIQSYFEVFLKSERVQKVVHAGGFSQHDFREVFRLNIEKRV  243



Lambda      K        H
   0.316    0.131    0.384 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 625364460


Query= XP_011197309.1 tyrosine-protein kinase Dnt [Bactrocera dorsalis]

Length=557
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RYK2_DROME  unnamed protein product                                   866     0.0  
RYK1_DROME  unnamed protein product                                   523     0.0  
RYK_CAEEL  unnamed protein product                                    254     4e-77


>RYK2_DROME unnamed protein product
Length=584

 Score = 866 bits (2237),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/543 (79%), Positives = 480/543 (88%), Gaps = 13/543 (2%)

Query  27   VQAHLNVYLNPQEVMRLLGVSAEVYYVREGHVNNYALNFVVPVPANIRDITFTWQSLAGR  86
            V AHLNV+LNP EVMRLLGVSAEVYYVREGH+NNYALNF+VPVPAN++DI+FTWQSLAGR
Sbjct  43   VAAHLNVFLNPVEVMRLLGVSAEVYYVREGHINNYALNFIVPVPANVKDISFTWQSLAGR  102

Query  87   PLPYSINVITSEPEVLPRPLMVIPQIGEIPTSVQTFTIGLKCSGIRASEVDVSISLEVIL  146
             LPYSINV++S+ EVLPRP + +   GEIPT++QT++I LKCSG++A+EVDV++SLEV+L
Sbjct  103  GLPYSINVVSSDQEVLPRPAINVSHSGEIPTTIQTWSIALKCSGLKAAEVDVTVSLEVVL  162

Query  147  NRALNNVTHLVFRRKKMCLLVEPEED--NTVHGPVLLETAVPPPTGMLTIIVGSSLALAL  204
            NR+LNNVTHLVFRRKK+CL+ +  ED    V  P LLET + PPTG++T++VG S+A+  
Sbjct  163  NRSLNNVTHLVFRRKKICLMNDSAEDLSEDVDDPQLLETVMLPPTGLITLVVGVSVAMGS  222

Query  205  VIVLLLTAYCVRRSA-KRQNH---GQPMRTSSFQRLNTHASCQQS---ATYNGNPSIIAP  257
            V +LL+ AYCV+ +A KRQ+H   GQPMRTSSFQRLNTH  CQ S   A Y   PSIIAP
Sbjct  223  VCLLLMIAYCVKGAANKRQHHQHGGQPMRTSSFQRLNTHPPCQSSMGSAAYM-TPSIIAP  281

Query  258  IQ-SSLPRKV--QVEPQHPEELHRRISELTVERCRVRLSSLLQEGTFGRVYRGTYNDNQD  314
            I  SSLPRKV   VE QHPEELHRRISELTVERCRVRLSSLLQEGTFGRVYRGTYND QD
Sbjct  282  IHGSSLPRKVPVSVEQQHPEELHRRISELTVERCRVRLSSLLQEGTFGRVYRGTYNDTQD  341

Query  315  VLVKTVAQHASQMQVSLLLQEGMSLYGASHQGILSVLGVSIEDHTTPFVLYSAPNTTRNL  374
            VLVKTVAQHASQMQV LLLQEGM LYGASH GILSVLGVSIEDHTTPFVLY A N TRNL
Sbjct  342  VLVKTVAQHASQMQVLLLLQEGMLLYGASHPGILSVLGVSIEDHTTPFVLYPALNNTRNL  401

Query  375  KLFLLDPSCARTITTVQIVMMSTQLAQALVHLHSHGVVHKDIATRNCVIDDQLRVKLSDS  434
            K FLLDP+CART+TT+QIVMM++QL+ AL HLHSHGVVHKDIATRNCVIDDQLRVKLSDS
Sbjct  402  KQFLLDPACARTVTTIQIVMMASQLSMALDHLHSHGVVHKDIATRNCVIDDQLRVKLSDS  461

Query  435  SLSRDLFACDYNCLGDSENRPVKWLSLEALQHKQFSEASDSWAFGVLMWELCTYAKQPYS  494
            SLSRDLF  DYNCLGDSENRPVKW+SLEALQHKQFSEASDSWAFGVLMWELCT AKQPY+
Sbjct  462  SLSRDLFPSDYNCLGDSENRPVKWMSLEALQHKQFSEASDSWAFGVLMWELCTSAKQPYA  521

Query  495  EVDPFEMEHYLKDGYRLAQPFNCPDELFTIMAYCWALLPGERPSFAQLNACLSEFYAQVT  554
            EVDPFEMEHYLKDGYRLAQPFNCPDELFTIMAYCWALLP ERP+FAQL +CLSEFY+Q+T
Sbjct  522  EVDPFEMEHYLKDGYRLAQPFNCPDELFTIMAYCWALLPAERPTFAQLQSCLSEFYSQIT  581

Query  555  RYV  557
            RYV
Sbjct  582  RYV  584


>RYK1_DROME unnamed protein product
Length=610

 Score = 523 bits (1346),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/382 (65%), Positives = 301/382 (79%), Gaps = 3/382 (1%)

Query  178  PVLLETAVPPPTGMLTIIVGSSLALALVIVLLLTAYCVRRSAKRQ--NHGQPMRTSSFQR  235
            P+L E  VPP +G++T+IVG  LAL LV  L+L AYC +  +KR   N    ++TSSFQR
Sbjct  230  PMLRENLVPPASGLVTLIVGGILALVLVSTLILIAYCAKGPSKRHPSNGVHLIKTSSFQR  289

Query  236  LNTHASCQQSATYNGNPSIIAPIQSSLPRKVQVEPQHPEELHRRISELTVERCRVRLSSL  295
            L T +S   ++ Y   PS I P  ++L R  +     PEE +RR+ ELTV++CRVRLS L
Sbjct  290  LPTISSTAHNSIYVC-PSTITPTYATLTRPFREYEHEPEEFNRRLQELTVQKCRVRLSCL  348

Query  296  LQEGTFGRVYRGTYNDNQDVLVKTVAQHASQMQVSLLLQEGMSLYGASHQGILSVLGVSI  355
            +QEG FGR+YRGTYND Q+VLVKTVAQHASQ+QV+LLLQE M LY ASH  +LSVLG+SI
Sbjct  349  VQEGNFGRIYRGTYNDCQEVLVKTVAQHASQLQVNLLLQESMMLYEASHPNVLSVLGISI  408

Query  356  EDHTTPFVLYSAPNTTRNLKLFLLDPSCARTITTVQIVMMSTQLAQALVHLHSHGVVHKD  415
            ED+ TPFVLY+A  + RNLK FL DPS AR++TT+Q V+M +QLA A+ HLH+HGV+HKD
Sbjct  409  EDYATPFVLYAATGSVRNLKSFLQDPSYARSVTTIQTVLMGSQLAMAMEHLHNHGVIHKD  468

Query  416  IATRNCVIDDQLRVKLSDSSLSRDLFACDYNCLGDSENRPVKWLSLEALQHKQFSEASDS  475
            IA RNCVIDDQLRVKL+DS+LSRDLF  DYN LGD E RP+KWLSLEALQ   ++E SD 
Sbjct  469  IAARNCVIDDQLRVKLTDSALSRDLFPGDYNSLGDGEYRPIKWLSLEALQKSHYNEGSDV  528

Query  476  WAFGVLMWELCTYAKQPYSEVDPFEMEHYLKDGYRLAQPFNCPDELFTIMAYCWALLPGE  535
            W+FGVLMWE+CT  K PY+E+DP+EMEHYLKDGYRLAQPFNCPDELFTIMAYCWA +P E
Sbjct  529  WSFGVLMWEMCTLGKLPYAEIDPYEMEHYLKDGYRLAQPFNCPDELFTIMAYCWASMPAE  588

Query  536  RPSFAQLNACLSEFYAQVTRYV  557
            RPSF+QL  CLSEF+ Q+TRYV
Sbjct  589  RPSFSQLQICLSEFHTQITRYV  610


 Score = 201 bits (511),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 121/149 (81%), Gaps = 3/149 (2%)

Query  28   QAHLNVYLNPQEVMRLLGVSAEVYYVREGHVNNYALNFVVPVPANIRDITFTWQSLAGRP  87
            QAHLN++LN  EV+RL+GVSAE+YYVREG +N+YALNF VPVPANI D+TFTWQSL   P
Sbjct  19   QAHLNIFLNLHEVLRLIGVSAELYYVREGAINDYALNFAVPVPANISDVTFTWQSLVDHP  78

Query  88   LPYSINVITSEPEVLPRPLMVIPQIGEIPTSVQTFTIGLKCSGIRASEVDVSISLEVILN  147
            LPYSIN+ TS+ EVLPRP++ I +IG++P   QT+ I LKCSG R +EV V+I++EVIL+
Sbjct  79   LPYSINIATSDTEVLPRPILNISRIGDVPVEPQTWGIALKCSGTRNAEVTVTINVEVILD  138

Query  148  RALNNVTHLVFRRKKMCLLVEPEEDNTVH  176
            RA NN T+L+F+RKK+CL    EE ++ H
Sbjct  139  RATNNNTNLIFKRKKICLR---EEQDSAH  164


>RYK_CAEEL unnamed protein product
Length=583

 Score = 254 bits (649),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 176/582 (30%), Positives = 297/582 (51%), Gaps = 69/582 (12%)

Query  29   AHLNVYLNPQEVMRLLGVSAEVYYVREGHVNNYALNFVVPVPANIRDITFTWQSLAGRPL  88
            A++N++++ +E+ R  GV AE+ Y+  G+V++Y+  F   V ANI  ++FTW ++    +
Sbjct  18   ANVNMFISKEEMNRTFGVKAELNYIEMGNVSSYSTKFHYRVMANIDYLSFTWNAVG--IV  75

Query  89   PYSINVITSEPEVLPRPLMVIPQIGEIPTSVQTFTIGLKCSGIRASEVDVSISLEVILNR  148
             Y + V + +  VLP  ++ IP  G +P S+Q FT+  +C+G R+ +   ++SL      
Sbjct  76   HYEVYVESDDSSVLP--IVRIPLKGTVPESLQDFTVEYRCAGHRSGQF--AVSLYFTFKY  131

Query  149  ALNNVTHLVFRRKKMCLLVEPEE--DNTVHGPVLLETAVPPPTGMLTIIVGSSLALALVI  206
                   +  R++K+C   +     +    G  + +T        + I +    A A ++
Sbjct  132  GNKEPLKVKLRQEKICASRDGRRGLNGGYEGHEVDDTDSIDKAFFVIICI----AAAFLL  187

Query  207  VLLLTAYCVRRSAKRQNHGQPMRTSSFQR-LNTHASCQQ---SATYNGNPSIIAPIQSSL  262
            ++  T  C  + +K+++       +SF+  L +  S Q    S   +G P++ A   +  
Sbjct  188  IVAATLICYFKRSKKEDMIPTRLPTSFRNSLKSTKSAQPFLLSTPRDGPPTLSAISSAPC  247

Query  263  PRKVQ----VEPQHPEELHRRISELTVERCRVRLSSL--LQEGTFGRV-----------Y  305
                     + P  P  +  R + L + + R    SL    EGTFG V            
Sbjct  248  SSSSASGNSIIPSKPRNIDVRRALLQLYQDRDAFQSLPLDMEGTFGEVRYAIWRQVDDVL  307

Query  306  RGTYNDNQD-------VLVKTVAQHASQMQVSLLLQEGMSLYGAS-HQGILSVLGVSIED  357
             G  +D +D       V  KT+  +AS +Q+   L + +  Y  + HQ +  V  V+   
Sbjct  308  NGDVDDEEDTFCNQEAVYTKTLKNNASPIQLDRFLSDALLFYNITPHQNLSQVACVA---  364

Query  358  HTTPFVLYSAPNTTR-------------NLKLFLL------DPSCARTITTVQIVMMSTQ  398
                F  +  P T               NLK FL           A+T+ T Q+V ++TQ
Sbjct  365  ---SFGRFDRPETVTDFPLVCYRHQGFGNLKKFLTICRHGDKTKGAQTLRTHQLVSLATQ  421

Query  399  LAQALVHLHSHGVVHKDIATRNCVI---DDQLRVKLSDSSLSRDLFACDYNCLGDSENRP  455
            ++ A+ H+H + +VH DIA RNC+I   + +L+V+L DS+LSRDLF  DY+CLGD+ENRP
Sbjct  422  VSSAVAHIHKYRIVHNDIAARNCLIAEVNGRLQVQLCDSALSRDLFPADYHCLGDNENRP  481

Query  456  VKWLSLEALQHKQFSEASDSWAFGVLMWELCTYAKQPYSEVDPFEMEHYLKDGYRLAQPF  515
            +KW+S EA+ ++ +S A+D W+ GVL+WEL +    P++E+DP E+   +  G RL QP 
Sbjct  482  LKWMSPEAIANELYSSAADVWSLGVLLWELMSLGGSPHAEIDPEEVYTMILKGKRLQQPN  541

Query  516  NCPDELFTIMAYCWALLPGERPSFAQLNACLSEFYAQVTRYV  557
            NCPD+L+ +M  CW +L  +RPS  Q+   L +F  Q+++Y+
Sbjct  542  NCPDQLYEVMLCCWRVLSEDRPSSEQVVHGLRDFNIQLSQYI  583



Lambda      K        H
   0.316    0.131    0.384 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 625364460


Query= XP_011197310.1 skin secretory protein xP2 isoform X1 [Bactrocera
dorsalis]

Length=279
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

VTU2_DROME  unnamed protein product                                   65.1    1e-12
VTU1_DROME  unnamed protein product                                   57.4    3e-10
VTU4_DROME  unnamed protein product                                   50.1    7e-08


>VTU2_DROME unnamed protein product
Length=168

 Score = 65.1 bits (157),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 36/43 (84%), Gaps = 2/43 (5%)

Query  185  PAPPCPKNYIFSCQPSLSPVACSAPSSSGGYGSAAAYSQYVPS  227
            P+PPCPKNY+FSCQPSL PV CSAP+ S  YGSA AYSQYVP 
Sbjct  119  PSPPCPKNYLFSCQPSLQPVPCSAPAQS--YGSAGAYSQYVPQ  159


>VTU1_DROME unnamed protein product
Length=141

 Score = 57.4 bits (137),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 45/73 (62%), Gaps = 11/73 (15%)

Query  185  PAPPCPKNYIFSCQPSLSPVACSAPSSSGGYGSAAAYSQYVPSPSPKPAEPYAMPSYG-P  243
            PAPPCPKNY+FSCQP+L+PV CSAP+ S  YGSA AYS         P   Y  P+YG P
Sbjct  73   PAPPCPKNYLFSCQPNLAPVPCSAPAPS--YGSAGAYS--------SPVATYVAPNYGVP  122

Query  244  KPSYAPKSGYAPK  256
            +      S Y P+
Sbjct  123  QHQQQLYSAYVPQ  135


>VTU4_DROME unnamed protein product
Length=116

 Score = 50.1 bits (118),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 39/57 (68%), Gaps = 6/57 (11%)

Query  184  YPAPPCPKNYIFSCQPSLSPVACSAPSSSGGYGSAAAYSQ----YVPSPSPKPAEPY  236
            YPAPPCP NY+FSCQP+L+P  C+  + +  YGSA AY++    YV SP+ +  + +
Sbjct  37   YPAPPCPTNYLFSCQPNLAPAPCAQEAPA--YGSAGAYTEQVPHYVGSPNREQLQQF  91



Lambda      K        H
   0.316    0.131    0.384 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 625364460


Query= XP_011197312.1 TNF receptor-associated factor 3 [Bactrocera
dorsalis]

Length=468
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8IR14_DROME  unnamed protein product                                 583     0.0   
Q9VXG5_DROME  unnamed protein product                                 479     3e-168
A8DYU9_DROME  unnamed protein product                                 67.0    1e-11 


>Q8IR14_DROME unnamed protein product
Length=474

 Score = 583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/453 (61%), Positives = 358/453 (79%), Gaps = 13/453 (3%)

Query  21   TTTVLKYEKSSCLFCNEWFDSQTFTEHLIHCGQVLEQCPNSCNAFVPRIRMRTHLKECPR  80
            +TT++KYEKSSCLFCNEWFD+QTFTEHLIHCGQVLE+CPN C AF+PRIRMR+HLKECPR
Sbjct  30   STTIVKYEKSSCLFCNEWFDAQTFTEHLIHCGQVLEECPNGCQAFIPRIRMRSHLKECPR  89

Query  81   AKA----QPQQSNSLERLDQFMDNRINQLEKDLSALRSVLNEEIGQRLHLITDVGNLRKY  136
             +     Q + S S++RLD+  D R+  +E+D+  +RSVLNEEI QRLHLITDVGN+RK 
Sbjct  90   NQHNLSNQQRMSVSMDRLDRQSDQRLLVIEQDVGTIRSVLNEEIRQRLHLITDVGNIRKQ  149

Query  137  NQVLEDWKHEADESVRGVKALLNEEIVQRQFEVGEAYKDNVANFEMIKKVKADIQGEMDV  196
            NQV+EDW  E ++++  ++  + EE  ++ F + +   D     ++ + +K  ++  +D 
Sbjct  150  NQVVEDWTRETEKAMDDLRRQMEEETNRKAFAIEQNQLDVQYCCDITQSLKEQVESRLDE  209

Query  197  LQKNIQQLSLEVAEHVNHLNDNTMKLEEMILENEKKNLDKFIEIEEFLNVLDGDLKTKFV  256
             QK + QLS +V  H N LNDN +KLEE+I ENE+ N +KF +IEEFL  ++ D+KTK +
Sbjct  210  AQKLVNQLSADVTYHQNQLNDNILKLEELIFENERLNREKFFQIEEFLQQINEDIKTK-L  268

Query  257  ANSD-LNAKQANMDLEVKSMKNIVCETEERCEKLEGIVNQIDTKLHQTMQTLADLENHLA  315
             NSD + +KQA +D EVK++KNIVCETEERC+KL       D  LHQTMQ ++DLE  +A
Sbjct  269  GNSDYVTSKQATLDYEVKNVKNIVCETEERCDKL-------DRALHQTMQNISDLETQMA  321

Query  316  TQQRLTSIQNTRGHLIWRIKDFSKKLEEAKQYETILHSAMFSNKPYGYALRLDIHPNGKG  375
             QQR+ S+QN RGHLIWRIKD+SKKLEE+KQY+TILHSAMFSNK +GYALRLDI+ NGKG
Sbjct  322  MQQRIASVQNIRGHLIWRIKDYSKKLEESKQYDTILHSAMFSNKAFGYALRLDIYLNGKG  381

Query  376  TWKGRNLIACLNVIAGEYDALLSWPCRLQADIIIRAQFNNAEESQDYVKTILVRKKNDEF  435
            TWKGRN+IACLNV++GEYD LL+WPCRLQA+IIIR Q  N  +++DYVKTI VRKK+D+F
Sbjct  382  TWKGRNMIACLNVLSGEYDPLLAWPCRLQAEIIIRDQCTNVADAEDYVKTIFVRKKSDDF  441

Query  436  IQNNQYFHIPHKIITNSNFLRNDSLYVEVRVLK  468
            IQ+NQYFHIPHK+IT+ N+LRNDS+++EVRVLK
Sbjct  442  IQSNQYFHIPHKVITSRNYLRNDSMFIEVRVLK  474


>Q9VXG5_DROME unnamed protein product
Length=395

 Score = 479 bits (1233),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 235/403 (58%), Positives = 310/403 (77%), Gaps = 13/403 (3%)

Query  71   MRTHLKECPRAKA----QPQQSNSLERLDQFMDNRINQLEKDLSALRSVLNEEIGQRLHL  126
            MR+HLKECPR +     Q + S S++RLD+  D R+  +E+D+  +RSVLNEEI QRLHL
Sbjct  1    MRSHLKECPRNQHNLSNQQRMSVSMDRLDRQSDQRLLVIEQDVGTIRSVLNEEIRQRLHL  60

Query  127  ITDVGNLRKYNQVLEDWKHEADESVRGVKALLNEEIVQRQFEVGEAYKDNVANFEMIKKV  186
            ITDVGN+RK NQV+EDW  E ++++  ++  + EE  ++ F + +   D     ++ + +
Sbjct  61   ITDVGNIRKQNQVVEDWTRETEKAMDDLRRQMEEETNRKAFAIEQNQLDVQYCCDITQSL  120

Query  187  KADIQGEMDVLQKNIQQLSLEVAEHVNHLNDNTMKLEEMILENEKKNLDKFIEIEEFLNV  246
            K  ++  +D  QK + QLS +V  H N LNDN +KLEE+I ENE+ N +KF +IEEFL  
Sbjct  121  KEQVESRLDEAQKLVNQLSADVTYHQNQLNDNILKLEELIFENERLNREKFFQIEEFLQQ  180

Query  247  LDGDLKTKFVANSD-LNAKQANMDLEVKSMKNIVCETEERCEKLEGIVNQIDTKLHQTMQ  305
            ++ D+KTK + NSD + +KQA +D EVK++KNIVCETEERC+KL       D  LHQTMQ
Sbjct  181  INEDIKTK-LGNSDYVTSKQATLDYEVKNVKNIVCETEERCDKL-------DRALHQTMQ  232

Query  306  TLADLENHLATQQRLTSIQNTRGHLIWRIKDFSKKLEEAKQYETILHSAMFSNKPYGYAL  365
             ++DLE  +A QQR+ S+QN RGHLIWRIKD+SKKLEE+KQY+TILHSAMFSNK +GYAL
Sbjct  233  NISDLETQMAMQQRIASVQNIRGHLIWRIKDYSKKLEESKQYDTILHSAMFSNKAFGYAL  292

Query  366  RLDIHPNGKGTWKGRNLIACLNVIAGEYDALLSWPCRLQADIIIRAQFNNAEESQDYVKT  425
            RLDI+ NGKGTWKGRN+IACLNV++GEYD LL+WPCRLQA+IIIR Q  N  +++DYVKT
Sbjct  293  RLDIYLNGKGTWKGRNMIACLNVLSGEYDPLLAWPCRLQAEIIIRDQCTNVADAEDYVKT  352

Query  426  ILVRKKNDEFIQNNQYFHIPHKIITNSNFLRNDSLYVEVRVLK  468
            I VRKK+D+FIQ+NQYFHIPHK+IT+ N+LRNDS+++EVRVLK
Sbjct  353  IFVRKKSDDFIQSNQYFHIPHKVITSRNYLRNDSMFIEVRVLK  395


>A8DYU9_DROME unnamed protein product
Length=477

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/153 (29%), Positives = 70/153 (46%), Gaps = 13/153 (8%)

Query  325  NTRGHLIWRIKDFSKKLEEAKQYETI-LHSAMFSNKPYGYALRLDIHPNGKGTWKGRNLI  383
            N  G L+W+I D+S K+ EA+  + + L S  F    YGY L+  +  NG G  +  ++ 
Sbjct  319  NYTGTLLWKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVS  378

Query  384  ACLNVIAGEYDALLSWPCRLQADIIIRAQFNNAEESQDYVKTILVRKKNDEFIQNNQ---  440
              + V+ GEYDALL WP      I        A+  Q  V    V     E  Q      
Sbjct  379  VYIKVLPGEYDALLKWP--FSHSITFTLFEQGAQSGQGGVAESFVPDPTWENFQRPSNEP  436

Query  441  ---YFHIP----HKIITNSNFLRNDSLYVEVRV  466
                F  P    H+++ +  F++ D++++ V+V
Sbjct  437  DQLGFGFPRFISHELLHSRPFIKGDTVFLRVKV  469


 Score = 35.0 bits (79),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 26/58 (45%), Gaps = 5/58 (9%)

Query  20   GTTTVLKYEKSSCLFCNEWFDS-QTFTEHLIHCGQVLEQCPNSCNAFVPRIRMRTHLK  76
            G+     + K  C    +W D  +    HL  C     QCPN C A +PRI M  HL+
Sbjct  92   GSLVFCIHHKQGC----KWSDELRKLKGHLNACKHDATQCPNKCGAQIPRIMMTDHLQ  145


 Score = 32.3 bits (72),  Expect = 0.99, Method: Compositional matrix adjust.
 Identities = 16/49 (33%), Positives = 22/49 (45%), Gaps = 2/49 (4%)

Query  32   CLFCNEWFDSQTFTEHLIHCGQVLEQCPNSCNAF-VPRIRMRTHLK-EC  78
            C  C   F + T   H   C +    CP  C+A  +PR  +  HL+ EC
Sbjct  209  CAHCQREFSADTLPLHAAQCPRAPLACPQRCDAGPIPRGELEAHLRDEC  257



Lambda      K        H
   0.316    0.131    0.384 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 625364460


Query= XP_011197316.3 oxysterol-binding protein-related protein 2-like
[Bactrocera dorsalis]

Length=154
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VC05_DROME  unnamed protein product                                 150     1e-42
O18397_DROME  unnamed protein product                                 146     2e-41
OSB8_DICDI  unnamed protein product                                   90.9    5e-22


>Q9VC05_DROME unnamed protein product
Length=784

 Score = 150 bits (378),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 71/148 (48%), Positives = 96/148 (65%), Gaps = 3/148 (2%)

Query  8    NIMSVLKNCLGKELSKVTMPVTLNEPLSFLQRVCEYMEYAEILNKANKEEDPADRMKLVA  67
            ++  ++KNC+GK+LSK+ MP+  NEPLS LQR+ E  EY EIL+ A   +D  +++  +A
Sbjct  399  SLWGIMKNCIGKDLSKIPMPINFNEPLSMLQRLVEDYEYTEILDYAATCQDECEQLAYIA  458

Query  68   TFAVSALASNWERVGKPFNPLLGETYELQRND---FKILCEQVSHHPPISAFHAESSNYK  124
             F VSA A+   R GKPFNPLLGETYE  R D   ++ L EQVSHHPP++A H ES N+ 
Sbjct  459  AFTVSAYATTTNRTGKPFNPLLGETYECDRMDDYGWRCLAEQVSHHPPVAALHCESKNWT  518

Query  125  FYGSINPKIKFMGKSINIQPKGMVTVEL  152
             +   +   KF GK + I P G V V+ 
Sbjct  519  CWQEFSMTSKFRGKYVQINPLGGVYVQF  546


>O18397_DROME unnamed protein product
Length=784

 Score = 146 bits (369),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/148 (47%), Positives = 95/148 (64%), Gaps = 3/148 (2%)

Query  8    NIMSVLKNCLGKELSKVTMPVTLNEPLSFLQRVCEYMEYAEILNKANKEEDPADRMKLVA  67
            ++  ++KNC+GK+LSK+ MP+  NEPLS LQR+ E  EY EIL+ A   +D  +++  +A
Sbjct  399  SLWGIMKNCIGKDLSKIPMPINFNEPLSMLQRLVEDYEYTEILDYAATCQDECEQLAYIA  458

Query  68   TFAVSALASNWERVGKPFNPLLGETYELQRND---FKILCEQVSHHPPISAFHAESSNYK  124
               VSA A+   R GKPFNPLLGETYE  R D   ++ L EQVSHHPP++A H ES N+ 
Sbjct  459  AGTVSAYATTTNRTGKPFNPLLGETYECDRMDDYGWRCLAEQVSHHPPVAALHCESKNWT  518

Query  125  FYGSINPKIKFMGKSINIQPKGMVTVEL  152
             +   +   KF GK + I P G V V+ 
Sbjct  519  CWQEFSMTSKFRGKYVQINPLGGVYVQF  546


>OSB8_DICDI unnamed protein product
Length=402

 Score = 90.9 bits (224),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 85/143 (59%), Gaps = 4/143 (3%)

Query  7    RNIMSVLKNCLGKEL-SKVTMPVTLNEPLSFLQRVCEYMEYAEILNKANKEEDPADRMKL  65
            + ++  L + +GK++ S +++PV + EP+SFLQ + E ++Y  +L+KA+K++     +  
Sbjct  37   KGLLKQLSSYVGKDITSLISLPVWIFEPVSFLQVMSEPLQYNALLSKASKQDSEFLCLAY  96

Query  66   VATFAVSALASNWERVGKPFNPLLGETYEL--QRNDFKILCEQVSHHPPISAFHAESSNY  123
            +A F   AL S   R  KPFNP+LGET+E+  ++ +F+ L EQVSHHPPI      S +Y
Sbjct  97   LAAFNC-ALYSTAVRTRKPFNPILGETFEIVDKKGEFRFLAEQVSHHPPIGVSETISEDY  155

Query  124  KFYGSINPKIKFMGKSINIQPKG  146
                    K KF G S  ++  G
Sbjct  156  TLQLETLLKSKFYGNSSEVEIDG  178



Lambda      K        H
   0.316    0.131    0.384 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 625364460


Query= XP_011197317.1 glutathione hydrolase 1 proenzyme [Bactrocera
dorsalis]

Length=586
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VWT3_DROME  unnamed protein product                                 291     1e-90
Q9VMD0_DROME  unnamed protein product                                 31.2    3.0  
Q960X2_DROME  unnamed protein product                                 30.0    7.0  


>Q9VWT3_DROME unnamed protein product
Length=579

 Score = 291 bits (744),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 178/510 (35%), Positives = 277/510 (54%), Gaps = 24/510 (5%)

Query  53   VFENGAVCSDSDVCSRIGRDVMQKSGGSAVDAAIATLFCNGLLAMQSMGLGGGVLINIYS  112
            ++ +GAV S+   C+ +G + M   GGSAVDAAIATL C GLL   SMG+GGG +  IY+
Sbjct  37   LYISGAVVSNGIGCAAVGGE-MLTDGGSAVDAAIATLLCEGLLLPHSMGIGGGFVATIYT  95

Query  113  SSEQRGYSILSRERAPLEFRLPEGNVSTIFQSALGIAVPAEVAGYAVAHQHFGKLPWRQL  172
             S ++  ++++RE AP           T    A   AVP E+ GY   H+ +G LPW++L
Sbjct  96   RSSRKVETVIARESAPAAAHKDMFVGETSITGAKSGAVPGEILGYWEMHRRYGILPWKRL  155

Query  173  VEPTTRLCRQGYTLTKHQRDSVYINGNLLKENEVLRKMFVDPETGQVYRTGAHVRPPDVL  232
             EP+ +L R+G+ ++++   ++    + +K +  L  +F++  TG  +  G +++ P  L
Sbjct  156  FEPSIKLAREGHVVSRYLAAAIQSKLDNIKADPGLSAVFLNA-TGDPHLEGDYMKRP-AL  213

Query  233  CRTYEALARDGPSDFYNG-YLMEKVVKDLRDLGSPISEVDLSNLTAELTFSPNVTL---G  288
              T E +A +G  +FY+G     K V+D++ +G  I+E DL + T       +V+    G
Sbjct  214  ADTLERIAENGAKEFYDGGETGRKFVEDIQKMGGIITEQDLRDYTVRWESDGHVSAHVSG  273

Query  289  PYTLHFTPPPGSGYVVGFVMKILQKFSKKFAKESDIDASGIHHIVEALKFGFVQRWNL--  346
             YTL+ TP P SG V+ F++ ++          +D +      +VEA K  + QR NL  
Sbjct  274  TYTLYSTPMPSSGPVLAFILNLMADLY------TDNEPIYWQRVVEAFKHAYGQRTNLGD  327

Query  347  ------DVEMQEEELTNLTNSSYARHLAYLIDEERTFRDATSYGASESLVTRVEHGTAHI  400
                          L  +    +   +  LI +  T  D   YGA+       +HGTAH+
Sbjct  328  MYADPVSAASINATLEEMLKPEFLESVRKLIHDNSTSEDYLYYGAN--FTVEEDHGTAHM  385

Query  401  SVIGPNGDAVAATSSINFYFGSGKIGARTGILFNNAMSDFTIEGLQNYFDLPNMPYKNRI  460
            +V+  NGDAV+ TS+IN YFGS     +TGI+ N+ M DF+  G+ N F +P  P  N I
Sbjct  386  NVLATNGDAVSITSTINNYFGSKVASTQTGIILNDEMDDFSTPGVINGFGVPASP-ANYI  444

Query  461  KPGASPMSSMSPIIVTDQHGVVRLVTGAAGGTKIISVLVHILVRILWLEQNIKQAIDAPR  520
             PG  PMSSMSP I+ DQ G VRL+ GAAGGT+I + +  ++++ L  ++++  A++  R
Sbjct  445  YPGKRPMSSMSPCIIVDQEGNVRLLVGAAGGTRITTSVAAVIMKYLLRKESLTAAVNNGR  504

Query  521  FHHQLEPNILEYEYGILQNVVKALEAKGHR  550
             HHQL P  + YE  +  +V   L+  GH 
Sbjct  505  LHHQLAPMRVSYEQEVDSSVTDYLKQVGHE  534


>Q9VMD0_DROME unnamed protein product
Length=1659

 Score = 31.2 bits (69),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 47/102 (46%), Gaps = 13/102 (13%)

Query  106  VLINIYSSSEQRGYSILSRERAPLEFRLPEGNVS------TIFQSALGIAVPAEVAGYAV  159
            + +++ S S++   +   R   PL    P G  S       I +++LG A+   VA    
Sbjct  6    ICVDLSSESDEESPAKRRRLEDPLRLLTPSGRQSFPAKLLNIPKASLGSAMVVPVAETGP  65

Query  160  AHQHFGKL-PWRQLVEPTTRLCRQGYTLTKHQRDSVYINGNL  200
            A +    + P R +  P+      G T+TKHQ++ +  NGN+
Sbjct  66   ARETPVIVDPLRSMHIPS------GITITKHQKNVLATNGNM  101


>Q960X2_DROME unnamed protein product
Length=518

 Score = 30.0 bits (66),  Expect = 7.0, Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 47/102 (46%), Gaps = 13/102 (13%)

Query  106  VLINIYSSSEQRGYSILSRERAPLEFRLPEGNVS------TIFQSALGIAVPAEVAGYAV  159
            + +++ S S++   +   R   PL    P G  S       I +++LG A+   VA    
Sbjct  6    ICVDLSSESDEESPAKRRRLEDPLRLLTPSGRQSFPAKLLNIPKASLGSAMVVPVAETGP  65

Query  160  AHQHFGKL-PWRQLVEPTTRLCRQGYTLTKHQRDSVYINGNL  200
            A +    + P R +  P+      G T+TKHQ++ +  NGN+
Sbjct  66   ARETPVIVDPLRSMHIPS------GITITKHQKNVLATNGNM  101



Lambda      K        H
   0.316    0.131    0.384 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 625364460


Query= XP_011197318.2 scoloptoxin SSD14 [Bactrocera dorsalis]

Length=800
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VWT3_DROME  unnamed protein product                                 368     1e-117


>Q9VWT3_DROME unnamed protein product
Length=579

 Score = 368 bits (944),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 213/525 (41%), Positives = 309/525 (59%), Gaps = 23/525 (4%)

Query  263  VYEQAAVCSDREVCSEIGSHMLDQKGSAVDAAIATLLCNGILTMHSMGIGGGMLMNIFLK  322
            +Y   AV S+   C+ +G  ML   GSAVDAAIATLLC G+L  HSMGIGGG +  I+ +
Sbjct  37   LYISGAVVSNGIGCAAVGGEMLTDGGSAVDAAIATLLCEGLLLPHSMGIGGGFVATIYTR  96

Query  323  DTQHAYSIDAREVAPFAAFQEMFDGKLELSLNGGLSIAVPGELMGYHRAHERFGKLPWKT  382
             ++   ++ ARE AP AA ++MF G  E S+ G  S AVPGE++GY   H R+G LPWK 
Sbjct  97   SSRKVETVIARESAPAAAHKDMFVG--ETSITGAKSGAVPGEILGYWEMHRRYGILPWKR  154

Query  383  LVEPSVKLCHEGFYLTHHQWNALNYRWHHMKNNTVLTDVFVNATTGQLFPVGTKIKPQKV  442
            L EPS+KL  EG  ++ +   A+  +  ++K +  L+ VF+NAT G     G  +K +  
Sbjct  155  LFEPSIKLAREGHVVSRYLAAAIQSKLDNIKADPGLSAVFLNAT-GDPHLEGDYMK-RPA  212

Query  443  LCSTYELLAENGPLDFYNG-TLAQMVVEDLKDLGSTVTAYDLESYSADMVSS--ITMQL-  498
            L  T E +AENG  +FY+G    +  VED++ +G  +T  DL  Y+    S   ++  + 
Sbjct  213  LADTLERIAENGAKEFYDGGETGRKFVEDIQKMGGIITEQDLRDYTVRWESDGHVSAHVS  272

Query  499  GDDILYAVPPISSGTVVANVLSILEGFNLTKADFVGAENQAKTLHRFAEALKYGFAKRWE  558
            G   LY+ P  SSG V+A +L+++       AD    +N+     R  EA K+ + +R  
Sbjct  273  GTYTLYSTPMPSSGPVLAFILNLM-------ADLY-TDNEPIYWQRVVEAFKHAYGQRTN  324

Query  559  LGDLRFNDV-----RELVSRLTNPEYGMSIREKINDDKVHKAVFDYGAQFMGEDDAGTSH  613
            LGD+  + V        +  +  PE+  S+R+ I+D+   +    YGA F  E+D GT+H
Sbjct  325  LGDMYADPVSAASINATLEEMLKPEFLESVRKLIHDNSTSEDYLYYGANFTVEEDHGTAH  384

Query  614  TVVLAPNGDAVSVTSSVNEYFGASQAGRRTGIVFNSAMNDFSVEGTSNSFGLPAAPSNFI  673
              VLA NGDAVS+TS++N YFG+  A  +TGI+ N  M+DFS  G  N FG+PA+P+N+I
Sbjct  385  MNVLATNGDAVSITSTINNYFGSKVASTQTGIILNDEMDDFSTPGVINGFGVPASPANYI  444

Query  674  DARKRPMSSMSPMILADRKGNVRLAFGAAGGSKIISSVVEVAARYLWFGQDIKSAIDAPR  733
               KRPMSSMSP I+ D++GNVRL  GAAGG++I +SV  V  +YL   + + +A++  R
Sbjct  445  YPGKRPMSSMSPCIIVDQEGNVRLLVGAAGGTRITTSVAAVIMKYLLRKESLTAAVNNGR  504

Query  734  IHHQLVPNVLQYEFGRFSEEILTLLKQKGHELKPFKDIGSVVCAI  778
            +HHQL P  + YE       +   LKQ GHE+   + +GS   A+
Sbjct  505  LHHQLAPMRVSYE-QEVDSSVTDYLKQVGHEMYE-EPVGSSFAAV  547



Lambda      K        H
   0.316    0.131    0.384 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 625364460


Query= XP_011197319.1 uncharacterized protein LOC105221881 isoform X1
[Bactrocera dorsalis]

Length=678
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ITPR_CAEEL  unnamed protein product                                   33.1    1.1  


>ITPR_CAEEL unnamed protein product
Length=2892

 Score = 33.1 bits (74),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 34/63 (54%), Gaps = 5/63 (8%)

Query  372   VKPLPTSSEEHNLTVTTT----ETNGLTNNRRVPPEAICPKCGKIFLGRRLNRHFTQHPD  427
             +K L   +EEHN+T+  T    + +G T+ R+   +A       I +G+RLNR  T +P 
Sbjct  1683  IKRLTKWAEEHNITLPATLAGPQMSGQTSVRQKWQQA-ASSAKWIGIGKRLNRQNTLNPG  1741

Query  428   HML  430
             H L
Sbjct  1742  HRL  1744



Lambda      K        H
   0.316    0.131    0.384 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 625364460


Query= XP_011197320.1 protein yippee-like CG15309 [Bactrocera dorsalis]

Length=114
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

H2KZH1_CAEEL  unnamed protein product                                 27.7    2.6  
Q387M7_TRYB2  unnamed protein product                                 27.3    3.4  
Q38AY3_TRYB2  unnamed protein product                                 26.2    7.8  


>H2KZH1_CAEEL unnamed protein product
Length=901

 Score = 27.7 bits (60),  Expect = 2.6, Method: Composition-based stats.
 Identities = 14/40 (35%), Positives = 21/40 (53%), Gaps = 5/40 (13%)

Query  41   GPAYLFNSVVNV-----GCGQTEERVLLTGLHAVADIFCD  75
            GPA L +++ N+     GC  +   + L G   +A IFCD
Sbjct  397  GPAILISALTNIFADVAGCFTSSPEISLLGYGNMACIFCD  436


>Q387M7_TRYB2 unnamed protein product
Length=1051

 Score = 27.3 bits (59),  Expect = 3.4, Method: Compositional matrix adjust.
 Identities = 15/63 (24%), Positives = 27/63 (43%), Gaps = 1/63 (2%)

Query  21   CRAHLASHDELISKSFQGSQGPAYLFNSVVNVGCGQTEERVLLTGLHAVADIFCDCCKTP  80
             R  +A H  +++   +G + P  +   +++   G  E+RVL   L +    F       
Sbjct  318  ARKRIADHPVILALPPKGIR-PKEILRRLLHHSFGIEEDRVLFVTLRSTGGTFVTNVDVE  376

Query  81   LGW  83
            LGW
Sbjct  377  LGW  379


>Q38AY3_TRYB2 unnamed protein product
Length=690

 Score = 26.2 bits (56),  Expect = 7.8, Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 10/63 (16%)

Query  40   QGPAYLF-NSVVNVGCGQTEERVLLTGLHAVADIFCDCCKTPLGWKYEHAYESSQKYKEG  98
            QG  + F N  V VG G  +E +   G+         CC  P G KYE +++  +++  G
Sbjct  387  QGGVFTFPNGEVYVG-GWNDESLCREGI--------GCCTYPNGDKYEGSWKDDKRHGFG  437

Query  99   KYI  101
            K++
Sbjct  438  KFV  440



Lambda      K        H
   0.316    0.131    0.384 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 625364460


Query= XP_011197322.1 protein yippee-like CG15309 [Bactrocera dorsalis]

Length=114
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

H2KZH1_CAEEL  unnamed protein product                                 27.7    2.6  
Q387M7_TRYB2  unnamed protein product                                 27.3    3.4  
Q38AY3_TRYB2  unnamed protein product                                 26.2    7.8  


>H2KZH1_CAEEL unnamed protein product
Length=901

 Score = 27.7 bits (60),  Expect = 2.6, Method: Composition-based stats.
 Identities = 14/40 (35%), Positives = 21/40 (53%), Gaps = 5/40 (13%)

Query  41   GPAYLFNSVVNV-----GCGQTEERVLLTGLHAVADIFCD  75
            GPA L +++ N+     GC  +   + L G   +A IFCD
Sbjct  397  GPAILISALTNIFADVAGCFTSSPEISLLGYGNMACIFCD  436


>Q387M7_TRYB2 unnamed protein product
Length=1051

 Score = 27.3 bits (59),  Expect = 3.4, Method: Compositional matrix adjust.
 Identities = 15/63 (24%), Positives = 27/63 (43%), Gaps = 1/63 (2%)

Query  21   CRAHLASHDELISKSFQGSQGPAYLFNSVVNVGCGQTEERVLLTGLHAVADIFCDCCKTP  80
             R  +A H  +++   +G + P  +   +++   G  E+RVL   L +    F       
Sbjct  318  ARKRIADHPVILALPPKGIR-PKEILRRLLHHSFGIEEDRVLFVTLRSTGGTFVTNVDVE  376

Query  81   LGW  83
            LGW
Sbjct  377  LGW  379


>Q38AY3_TRYB2 unnamed protein product
Length=690

 Score = 26.2 bits (56),  Expect = 7.8, Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 10/63 (16%)

Query  40   QGPAYLF-NSVVNVGCGQTEERVLLTGLHAVADIFCDCCKTPLGWKYEHAYESSQKYKEG  98
            QG  + F N  V VG G  +E +   G+         CC  P G KYE +++  +++  G
Sbjct  387  QGGVFTFPNGEVYVG-GWNDESLCREGI--------GCCTYPNGDKYEGSWKDDKRHGFG  437

Query  99   KYI  101
            K++
Sbjct  438  KFV  440



Lambda      K        H
   0.316    0.131    0.384 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 625364460


Query= XP_011197324.1 cytochrome c oxidase subunit 4 isoform 1,
mitochondrial [Bactrocera dorsalis]

Length=179
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VIQ8_DROME  unnamed protein product                                 192     4e-63
Q9U329_CAEEL  unnamed protein product                                 130     1e-38


>Q9VIQ8_DROME unnamed protein product
Length=182

 Score = 192 bits (489),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 93/178 (52%), Positives = 120/178 (67%), Gaps = 8/178 (4%)

Query  10   RLANRFGIRLTMCRQTHSDQV--------MERIGKREIVGYGWNGSPCYHDRLDYPMPAI  61
            RL N   +R    +   S QV        +++IGKREIVGYGWNG+ CY DR+DYP+PA+
Sbjct  4    RLLNSAVLRQLASQLPKSAQVGSVAAVHTLDKIGKREIVGYGWNGTACYADRVDYPLPAV  63

Query  62   RFREPDPEICALREKETGDWRKLSIDEKKQLYRYSFRKTFAEMKAPTSDWKFSLGAALIA  121
            RFREP  EI ALR KE GDW+KLS  E K LYR SF +T AE++A + +WK  LG +L+ 
Sbjct  64   RFREPTNEINALRAKEQGDWKKLSTQEIKALYRASFCQTIAEVQAGSGEWKLHLGVSLLF  123

Query  122  VSIGIWLSQSYAHGIYPEYPETFDEKRRSAQLKRMIALEVNPVTGLASKWDYEKDRWK  179
             +  IW++      +Y E P TFDE+ + AQL+R+I LE+NPVTGL SKWDYE  +WK
Sbjct  124  CAAAIWVAVLMNIFVYDELPVTFDEEHQKAQLQRIIDLEINPVTGLTSKWDYENKKWK  181


>Q9U329_CAEEL unnamed protein product
Length=175

 Score = 130 bits (326),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 87/148 (59%), Gaps = 0/148 (0%)

Query  32   ERIGKREIVGYGWNGSPCYHDRLDYPMPAIRFREPDPEICALREKETGDWRKLSIDEKKQ  91
            ++   RE+VGYG NG   Y DRLDY  PAIRFR+ D  I  +R KE  DW+ LS +EKK 
Sbjct  28   DKAAGRELVGYGANGDNIYQDRLDYWYPAIRFRKEDSVIAPIRAKEQADWKNLSAEEKKL  87

Query  92   LYRYSFRKTFAEMKAPTSDWKFSLGAALIAVSIGIWLSQSYAHGIYPEYPETFDEKRRSA  151
            LYRYSFR+T +E +APT  WK      L  + +  + +      +YPE P TF  + + A
Sbjct  88   LYRYSFRQTLSEFEAPTGYWKVISAVILSVLGLCTYYAVLLNVCVYPELPPTFQNEYKEA  147

Query  152  QLKRMIALEVNPVTGLASKWDYEKDRWK  179
            Q++R + LE     G  + +DYE  +WK
Sbjct  148  QVERALVLEKGQFLGAPTHYDYENKKWK  175



Lambda      K        H
   0.316    0.131    0.384 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 625364460


Query= XP_011197325.1 suppressor protein SRP40-like [Bactrocera dorsalis]

Length=158


***** No hits found *****



Lambda      K        H
   0.316    0.131    0.384 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 625364460


Query= XP_011197326.1 uncharacterized protein LOC105221885 [Bactrocera
dorsalis]

Length=639
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RAC2_CAEEL  unnamed protein product                                   159     3e-45
CDC42_CAEEL  unnamed protein product                                  159     4e-45
RAC1_DROME  unnamed protein product                                   156     3e-44


>RAC2_CAEEL unnamed protein product
Length=195

 Score = 159 bits (402),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 81/184 (44%), Positives = 119/184 (65%), Gaps = 6/184 (3%)

Query  447  SIKCVLVGDGAVGKTNLILTYLKNRFNTEHVPTASDIYNADVLVNDNPVHLTICDTAGQD  506
            +IKCV+VGDGAVGKT L+L+Y  N F  E++ T  D Y+ +V+V+  P++L++ DTAGQD
Sbjct  3    AIKCVVVGDGAVGKTCLLLSYTTNAFPGEYILTVFDTYSTNVMVDGRPINLSLWDTAGQD  62

Query  507  TLDNLRQLCYPDSDVFVLCFSVVKPETFHAVKTKWAPKFSKS--KASLILVGTQADLRKN  564
              D  R L +P +DVF++CF++  P +F  V+ KW P+ S       +ILVGT+ADLR++
Sbjct  63   DYDQFRHLSFPQTDVFLVCFALNNPASFENVRAKWYPEVSHHCPNTPIILVGTKADLRED  122

Query  565  TKVLKNLQLNGESPISHADAWDLAASVGAT-YIETSSATQDKVKEVFDTAIWEGLTPTIL  623
               ++ L+     P+SH   + +A  + A  Y+E S+ TQ  +K+VFD AI  GLTP   
Sbjct  123  RDTIERLRERRLQPVSHTQGYVMAKEIKAVKYLECSALTQIGLKQVFDEAIRTGLTP---  179

Query  624  PPTP  627
            P TP
Sbjct  180  PQTP  183


>CDC42_CAEEL unnamed protein product
Length=191

 Score = 159 bits (402),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 111/177 (63%), Gaps = 3/177 (2%)

Query  447  SIKCVLVGDGAVGKTNLILTYLKNRFNTEHVPTASDIYNADVLVNDNPVHLTICDTAGQD  506
            +IKCV+VGDGAVGKT L+++Y  N+F +E+VPT  D Y   V++   P  L + DTAGQ+
Sbjct  3    TIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQE  62

Query  507  TLDNLRQLCYPDSDVFVLCFSVVKPETFHAVKTKWAPKFSK--SKASLILVGTQADLRKN  564
              D LR L YP +DVF++CFSVV P +F  V+ KW P+ S   SK   +LVGTQ DLR +
Sbjct  63   DYDRLRPLSYPQTDVFLVCFSVVAPASFENVREKWVPEISHHCSKTPFLLVGTQVDLRDD  122

Query  565  TKVLKNLQLNGESPISHADAWDLAASVGAT-YIETSSATQDKVKEVFDTAIWEGLTP  620
              +L+ L  N + P+S      LA  + A  Y+E S+ TQ  +K VFD AI   L P
Sbjct  123  PGMLEKLAKNKQKPVSTDVGEKLAKELKAVKYVECSALTQKGLKNVFDEAILAALDP  179


>RAC1_DROME unnamed protein product
Length=192

 Score = 156 bits (395),  Expect = 3e-44, Method: Composition-based stats.
 Identities = 80/183 (44%), Positives = 118/183 (64%), Gaps = 3/183 (2%)

Query  447  SIKCVLVGDGAVGKTNLILTYLKNRFNTEHVPTASDIYNADVLVNDNPVHLTICDTAGQD  506
            +IKCV+VGDGAVGKT L+++Y  N F  E++PT  D Y+A+V+V+  P++L + DTAGQ+
Sbjct  3    AIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQE  62

Query  507  TLDNLRQLCYPDSDVFVLCFSVVKPETFHAVKTKWAPKFSKSKAS--LILVGTQADLRKN  564
              D LR L YP +DVF++CFS+V P +F  V+ KW P+      S  +ILVGT+ DLR +
Sbjct  63   DYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLRDD  122

Query  565  TKVLKNLQLNGESPISHADAWDLAASVGAT-YIETSSATQDKVKEVFDTAIWEGLTPTIL  623
               ++ L+    +PI++     +A  +GA  Y+E S+ TQ  +K VFD AI   L P + 
Sbjct  123  KNTIEKLRDKKLAPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRSVLCPVLQ  182

Query  624  PPT  626
            P +
Sbjct  183  PKS  185



Lambda      K        H
   0.316    0.131    0.384 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 625364460


Query= XP_011197332.1 uncharacterized protein LOC105221891 [Bactrocera
dorsalis]

Length=1604


***** No hits found *****



Lambda      K        H
   0.316    0.131    0.384 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 625364460


Query= XP_011197335.1 zygotic gap protein knirps isoform X2 [Bactrocera
dorsalis]

Length=519
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

KNIR_DROME  unnamed protein product                                   340     2e-112
EGON_DROME  unnamed protein product                                   194     4e-57 
KNRL_DROME  unnamed protein product                                   200     1e-56 


>KNIR_DROME unnamed protein product
Length=429

 Score = 340 bits (872),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 248/541 (46%), Positives = 296/541 (55%), Gaps = 134/541 (25%)

Query  1    MNQTCKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNLSSISECKNNGKCVIDKKNRTTCKA  60
            MNQTCKVCGEPAAGFHFGAFTCEGCKSFFGRSYNN+S+ISECKN GKC+IDKKNRTTCKA
Sbjct  1    MNQTCKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNISTISECKNEGKCIIDKKNRTTCKA  60

Query  61   CRLRKCYTVGMSKGGSRYGRRSNWFKIHCLLQEQQQQAMDIANKAAAAGG-NVAGAPSAA  119
            CRLRKCY VGMSKGGSRYGRRSNWFKIHCLLQE +Q A         AGG +V GAPSA+
Sbjct  61   CRLRKCYNVGMSKGGSRYGRRSNWFKIHCLLQEHEQAAAAAGKAPPLAGGVSVGGAPSAS  120

Query  120  ---------GFGDMAA-AAAAAAAAKQHMQSLNPHMASAGGLLGYPGYQFPEMMAQAAPF  169
                     GFGDMAA         +Q     +PHM     LLGYP Y            
Sbjct  121  SPVGSPHTPGFGDMAAHLHHHHQQQQQQQVPRHPHMP----LLGYPSY------------  164

Query  170  MSAAARHPAADATFFNMMNSLPAMGAAQSAFQLPPHLLFPAAAAAAAYHPNAAAAAAAAA  229
                   P+A   FF+MM  +P     QS FQLPPHLLFP       YH +AAAAAA+AA
Sbjct  165  ----LSDPSAALPFFSMMGGVP----HQSPFQLPPHLLFP------GYHASAAAAAASAA  210

Query  230  DAAYRTEMYKHRQSVDSAASGDSAQRFSPQIAAAAAAAAVEQQMREQQEAARHSP-ELCV  288
            DAAYR EMYKHRQSVDS    +S  RFSP         A +  + +   +AR SP ++C+
Sbjct  211  DAAYRQEMYKHRQSVDSV---ESQNRFSP---------ASQPPVVQPTSSARQSPIDVCL  258

Query  289  SGGDEDEDDELDVHTPSSAIAQQQIYQQMQEQQHQQQHQIHSPVAIHASPLSNSPLCVPV  348
                  E+D   VH+                  HQ    +  P+AI A+           
Sbjct  259  ------EEDVHSVHS------------------HQSSASLLHPIAIRAT-----------  283

Query  349  PTSALTPNSEHSPAHQPSSPAPTVAETAALSFAAKMQSLSPVSVCSIGAENVSPQQQH-S  407
                                  T   ++ LSFAAKMQSLSPVSVCSIG E  S    H  
Sbjct  284  --------------------PTTPTSSSPLSFAAKMQSLSPVSVCSIGGETTSVVPVHPP  323

Query  408  AMDAQDGPMDLSMKPVSAASRPSTRHSGDCDMNCDLSEEEAAMLDTRRKYFVYNSDHSES  467
             + AQ+GPMDLSMK     SR S+ HS     N   SE++   +  RRK++   ++   +
Sbjct  324  TVSAQEGPMDLSMK----TSR-SSVHS----FNDSGSEDQEVEVAPRRKFYQLEAECLTT  374

Query  468  DTSSDGSSAAALAN--------KRQKMID-EGYNSAGYASSHGSTVSTSSATSMHGIFVC  518
             +SS   SAA   N        KRQK+   E  +  G+A +H      ++A++M GIFVC
Sbjct  375  SSSSSSHSAAHSPNTTTAHAEVKRQKLGGAEATHFGGFAVAH------NAASAMRGIFVC  428

Query  519  V  519
            V
Sbjct  429  V  429


>EGON_DROME unnamed protein product
Length=373

 Score = 194 bits (494),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 81/95 (85%), Positives = 88/95 (93%), Gaps = 0/95 (0%)

Query  1   MNQTCKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNLSSISECKNNGKCVIDKKNRTTCKA  60
           MNQ CKVCGEPAAGFHFGAFTCEGCKSFFGR+YNN+++I+ CK+NG CVI+KKNRT CKA
Sbjct  1   MNQLCKVCGEPAAGFHFGAFTCEGCKSFFGRTYNNIAAIAGCKHNGDCVINKKNRTACKA  60

Query  61  CRLRKCYTVGMSKGGSRYGRRSNWFKIHCLLQEQQ  95
           CRLRKC  VGMSK GSRYGRRSNWFKIHCLLQEQQ
Sbjct  61  CRLRKCLLVGMSKSGSRYGRRSNWFKIHCLLQEQQ  95


>KNRL_DROME unnamed protein product
Length=647

 Score = 200 bits (508),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 82/91 (90%), Positives = 87/91 (96%), Gaps = 0/91 (0%)

Query  1   MNQTCKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNLSSISECKNNGKCVIDKKNRTTCKA  60
           MNQTCKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNLSSIS+CKNNG+C+I+KKNRT CKA
Sbjct  10  MNQTCKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNLSSISDCKNNGECIINKKNRTACKA  69

Query  61  CRLRKCYTVGMSKGGSRYGRRSNWFKIHCLL  91
           CRL+KC  VGMSK GSRYGRRSNWFKIHCLL
Sbjct  70  CRLKKCLMVGMSKSGSRYGRRSNWFKIHCLL  100



Lambda      K        H
   0.316    0.131    0.384 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 625364460


Query= XP_011197336.1 uncharacterized protein LOC105221896 [Bactrocera
dorsalis]

Length=176
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q4GZ26_TRYB2  unnamed protein product                                 34.3    0.055
Q7KMS3_DROME  unnamed protein product                                 27.3    3.4  
Q7YU82_DROME  unnamed protein product                                 27.7    6.7  


>Q4GZ26_TRYB2 unnamed protein product
Length=2903

 Score = 34.3 bits (77),  Expect = 0.055, Method: Compositional matrix adjust.
 Identities = 17/52 (33%), Positives = 30/52 (58%), Gaps = 0/52 (0%)

Query  101  QSLSELLKRDQSYPASSINTDIFNKYISCTQDIPPSTSIDYSQFIEQLVDNT  152
            Q +  L++R   +   ++ +D F +YI+  QD  PS S D   +++QLV+ T
Sbjct  557  QPVEALVRRCLPHMVHAVLSDEFVRYITIIQDHLPSLSSDLQTYLDQLVNRT  608


>Q7KMS3_DROME unnamed protein product
Length=97

 Score = 27.3 bits (59),  Expect = 3.4, Method: Compositional matrix adjust.
 Identities = 16/60 (27%), Positives = 28/60 (47%), Gaps = 0/60 (0%)

Query  100  AQSLSELLKRDQSYPASSINTDIFNKYISCTQDIPPSTSIDYSQFIEQLVDNTAARQRDC  159
            +Q + E LKR QS+        + N+ I     +  +T++ Y+  + QL D   +  RD 
Sbjct  2    SQEVEETLKRIQSHKGVVGTIVVNNEGIPVKSTLDNTTTVQYAGLMSQLADKARSVVRDL  61


>Q7YU82_DROME unnamed protein product
Length=698

 Score = 27.7 bits (60),  Expect = 6.7, Method: Compositional matrix adjust.
 Identities = 14/18 (78%), Positives = 15/18 (83%), Gaps = 0/18 (0%)

Query  90   QKNKDKLLSSAQSLSELL  107
            Q   DKLL+SAQSLSELL
Sbjct  339  QAGFDKLLASAQSLSELL  356



Lambda      K        H
   0.316    0.131    0.384 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 625364460


Query= XP_011197337.2 protein lin-7 homolog C [Bactrocera dorsalis]

Length=195
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8IMT8_DROME  unnamed protein product                                 343     1e-121
Q9VBY7_DROME  unnamed protein product                                 338     3e-120
A5PEX5_CAEEL  unnamed protein product                                 245     3e-83 


>Q8IMT8_DROME unnamed protein product
Length=246

 Score = 343 bits (881),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 177/246 (72%), Positives = 187/246 (76%), Gaps = 51/246 (21%)

Query  1    MSVQVEPLTLSKDIKRAVELLDKLQCSGDFPTTKLSALQKVLQSDFLNAVREVYEHVYET  60
            M+   EPLTLS+D+KR++ELL+KLQ SGDFPTTKL+ALQKVL SDF+ +VREVYEHVYET
Sbjct  1    MADNAEPLTLSRDVKRSIELLEKLQASGDFPTTKLAALQKVLNSDFMTSVREVYEHVYET  60

Query  61   VDIQGSQDVRASATAKATVAAFAASEGHAHPRVVELPKTEEG------------------  102
            VDIQGS DVRASATAKATVAAFAASEGHAHPRVVELPKTEEG                  
Sbjct  61   VDIQGSHDVRASATAKATVAAFAASEGHAHPRVVELPKTEEGKTRPYELRIEGIPLYHKT  120

Query  103  ---------------------------------LGFNVMGGKEQNSPIYISRIIPGGVAD  129
                                             LGFNVMGGKEQNSPIYISRIIPGGVAD
Sbjct  121  NTLIVKVYRPRIYVSIIHLIWKALSIFNFCFSGLGFNVMGGKEQNSPIYISRIIPGGVAD  180

Query  130  RHGGLKRGDQLLSVNGVSVEGENHEKAVELLKQAVGSVKLVVRYTPKVLEEMELRFDKQR  189
            RHGGLKRGDQLLSVNGVSVEGENHEKAVELLKQAVGSVKLVVRYTPKVLEEME+RFDKQR
Sbjct  181  RHGGLKRGDQLLSVNGVSVEGENHEKAVELLKQAVGSVKLVVRYTPKVLEEMEMRFDKQR  240

Query  190  TTRRRQ  195
             TRRRQ
Sbjct  241  NTRRRQ  246


>Q9VBY7_DROME unnamed protein product
Length=195

 Score = 338 bits (868),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 177/195 (91%), Positives = 187/195 (96%), Gaps = 0/195 (0%)

Query  1    MSVQVEPLTLSKDIKRAVELLDKLQCSGDFPTTKLSALQKVLQSDFLNAVREVYEHVYET  60
            M+   EPLTLS+D+KR++ELL+KLQ SGDFPTTKL+ALQKVL SDF+ +VREVYEHVYET
Sbjct  1    MADNAEPLTLSRDVKRSIELLEKLQASGDFPTTKLAALQKVLNSDFMTSVREVYEHVYET  60

Query  61   VDIQGSQDVRASATAKATVAAFAASEGHAHPRVVELPKTEEGLGFNVMGGKEQNSPIYIS  120
            VDIQGS DVRASATAKATVAAFAASEGHAHPRVVELPKTEEGLGFNVMGGKEQNSPIYIS
Sbjct  61   VDIQGSHDVRASATAKATVAAFAASEGHAHPRVVELPKTEEGLGFNVMGGKEQNSPIYIS  120

Query  121  RIIPGGVADRHGGLKRGDQLLSVNGVSVEGENHEKAVELLKQAVGSVKLVVRYTPKVLEE  180
            RIIPGGVADRHGGLKRGDQLLSVNGVSVEGENHEKAVELLKQAVGSVKLVVRYTPKVLEE
Sbjct  121  RIIPGGVADRHGGLKRGDQLLSVNGVSVEGENHEKAVELLKQAVGSVKLVVRYTPKVLEE  180

Query  181  MELRFDKQRTTRRRQ  195
            ME+RFDKQR TRRRQ
Sbjct  181  MEMRFDKQRNTRRRQ  195


>A5PEX5_CAEEL unnamed protein product
Length=209

 Score = 245 bits (626),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 162/187 (87%), Gaps = 0/187 (0%)

Query  9    TLSKDIKRAVELLDKLQCSGDFPTTKLSALQKVLQSDFLNAVREVYEHVYETVDIQGSQD  68
             L +D++R +EL++ +Q +G+    KL++LQ+VLQS+F  AVREVYE VYE++D   + +
Sbjct  8    NLERDVQRILELMEHVQKTGEVNNAKLASLQQVLQSEFFGAVREVYETVYESIDADTTPE  67

Query  69   VRASATAKATVAAFAASEGHAHPRVVELPKTEEGLGFNVMGGKEQNSPIYISRIIPGGVA  128
            ++A+ATAKATVAAFAA+EGHAHPR+VELPKT++GLGFNVMGGKEQNSPIYISRIIPGGVA
Sbjct  68   IKAAATAKATVAAFAAAEGHAHPRIVELPKTDQGLGFNVMGGKEQNSPIYISRIIPGGVA  127

Query  129  DRHGGLKRGDQLLSVNGVSVEGENHEKAVELLKQAVGSVKLVVRYTPKVLEEMELRFDKQ  188
            DRHGGLKRGDQL++VNGV+VE E HEKAV+LLK AVGSVKLV+RY PK+L+EME RF++Q
Sbjct  128  DRHGGLKRGDQLIAVNGVNVEAECHEKAVDLLKSAVGSVKLVIRYMPKLLDEMERRFERQ  187

Query  189  RTTRRRQ  195
            R    +Q
Sbjct  188  RIRSTQQ  194



Lambda      K        H
   0.316    0.131    0.384 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 625364460


Query= XP_011197339.1 transient receptor potential protein [Bactrocera
dorsalis]

Length=1255
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TRP_DROME  unnamed protein product                                    1702    0.0  
TRPG_DROME  unnamed protein product                                   904     0.0  
TRPL_DROME  unnamed protein product                                   850     0.0  


>TRP_DROME unnamed protein product
Length=1275

 Score = 1702 bits (4409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 864/1148 (75%), Positives = 954/1148 (83%), Gaps = 49/1148 (4%)

Query  17    NYNISMGEEYMLNEIEKNFILAAERGDIQGVKKIIEDNKGQPDKFNINCVDPLNRSALIS  76
             +Y++ M EEY+L+++EKNFIL+ ERGD+ GVKKI+E+ +G  DKFNINC DP+NRSALIS
Sbjct  18    DYDLMMAEEYILSDVEKNFILSCERGDLPGVKKILEEYQGT-DKFNINCTDPMNRSALIS  76

Query  77    AIENENFDLIIVLLECGIEVGDALLHAISEEYVEAVEELLQWEETHHKEGQPYSWESVDR  136
             AIENENFDL+++LLE  IEVGDALLHAISEEYVEAVEELLQWEET+HKEGQPYSWE+VDR
Sbjct  77    AIENENFDLMVILLEHNIEVGDALLHAISEEYVEAVEELLQWEETNHKEGQPYSWEAVDR  136

Query  137   NKSTFTPDITPLILAAHRNNYEILKILLDRGATLPMPHDVKCGCDECVTSQETDSLRHSQ  196
             +KSTFT DITPLILAAHRNNYEILKILLDRGATLPMPHDVKCGCDECVTSQ TDSLRHSQ
Sbjct  137   SKSTFTVDITPLILAAHRNNYEILKILLDRGATLPMPHDVKCGCDECVTSQMTDSLRHSQ  196

Query  197   SRINAYRALSASSLIALSSRDPVLTAFELSWELKRLQAMESEFRAEYTEMRVGVQEFVSS  256
             SRINAYRALSASSLIALSSRDPVLTAF+LSWELKRLQAMESEFRAEYTEMR  VQ+F +S
Sbjct  197   SRINAYRALSASSLIALSSRDPVLTAFQLSWELKRLQAMESEFRAEYTEMRQMVQDFGTS  256

Query  257   LLDHARTSTELEVMLNFNHEPTTDIWMPGQRQTLERLKLAIRYKQKAFVAHPNVQQLLAA  316
             LLDHARTS ELEVMLNFNHEP+ DIW  GQRQTLERLKLAIRYKQK FVAHPNVQQLLAA
Sbjct  257   LLDHARTSMELEVMLNFNHEPSHDIWCLGQRQTLERLKLAIRYKQKTFVAHPNVQQLLAA  316

Query  317   IWYEGLPGFRRKQASQQIIEVVKLGTMFPINSMNYLLAPDSDAGKFMRKPFVKFISHSCS  376
             IWY+GLPGFRRKQASQQ+++VVKLG  FPI S+ Y+LAPDS+  KFMRKPFVKFI+HSCS
Sbjct  317   IWYDGLPGFRRKQASQQLMDVVKLGCSFPIYSLKYILAPDSEGAKFMRKPFVKFITHSCS  376

Query  377   YMFFLMLLGAASLRVVQLSFELLGFPWMLAMLEDWRKHERGSLPGPIELGIITYIASLVF  436
             YMFFLMLLGAASLRVVQ++FELL FPWML MLEDWRKHERGSLPGPIEL IITYI +L+F
Sbjct  377   YMFFLMLLGAASLRVVQITFELLAFPWMLTMLEDWRKHERGSLPGPIELAIITYIMALIF  436

Query  437   GELKTLYSDGLFEYIMDLWNIVDFVSNMFYVTWILCRATAWIIVHRDLWYRGIDPYFPRE  496
              ELK+LYSDGLFEYIMDLWNIVD++SNMFYVTWILCRATAW+IVHRDLW+RGIDPYFPRE
Sbjct  437   EELKSLYSDGLFEYIMDLWNIVDYISNMFYVTWILCRATAWVIVHRDLWFRGIDPYFPRE  496

Query  497   HWHPFDPMLLSEGAFAAGMVFSYLKLVHIFSINPHLGPLQVSLGRMIIDIIKFFFIYTLV  556
             HWHPFDPMLLSEGAFAAGMVFSYLKLVHIFSINPHLGPLQVSLGRMIIDIIKFFFIYTLV
Sbjct  497   HWHPFDPMLLSEGAFAAGMVFSYLKLVHIFSINPHLGPLQVSLGRMIIDIIKFFFIYTLV  556

Query  557   LFAFGCGLNQLLWYYAELEKNKCYHLHPDVADFDDQEKACTIWRRFSNLFETSQSLFWAS  616
             LFAFGCGLNQLLWYYAELEKNKCYHLHPDVADFDDQEKACTIWRRFSNLFETSQSLFWAS
Sbjct  557   LFAFGCGLNQLLWYYAELEKNKCYHLHPDVADFDDQEKACTIWRRFSNLFETSQSLFWAS  616

Query  617   FGLVDLVSFDLAGIKSFTRFWALLMFGSYSVINIIVLLNMLIAMMSNSYQIISERADVEW  676
             FGLVDLVSFDLAGIKSFTRFWALLMFGSYSVINIIVLLNMLIAMMSNSYQIISERAD EW
Sbjct  617   FGLVDLVSFDLAGIKSFTRFWALLMFGSYSVINIIVLLNMLIAMMSNSYQIISERADTEW  676

Query  677   KFARSQLWMSYFEDGGTVPPPFNIMPSVKLLRKTLGKEGPKRTKSFMRKTKERSQALHDK  736
             KFARSQLWMSYFEDGGT+PPPFN+ P++K+LRKTLG++ P RTKSFMRK+ ER+Q LHDK
Sbjct  677   KFARSQLWMSYFEDGGTIPPPFNLCPNMKMLRKTLGRKRPSRTKSFMRKSMERAQTLHDK  736

Query  737   VMKLLIRRFVTAEQRRRDDYGITEDDIIEVRQDISSLRFELLDIFQTNRFNVPDIEKKTA  796
             VMKLL+RR++TAEQRRRDDYGITEDDIIEVRQDISSLRFELL+IF  N ++VPDIEKK+ 
Sbjct  737   VMKLLVRRYITAEQRRRDDYGITEDDIIEVRQDISSLRFELLEIFTNNNWDVPDIEKKSQ  796

Query  797   AAAAGTKKGKVMERRILKDFQIGFVENLQHEMTVGDEGSKDIFSSLARVIGKKKSLKSGE  856
               A  T KGKVMERRILKDFQIGFVENL+ EM+  + G +DIFSSLA+VIG+KK+ K G+
Sbjct  797   GVAR-TTKGKVMERRILKDFQIGFVENLKQEMSESESG-RDIFSSLAKVIGRKKTQK-GD  853

Query  857   KDWNAIARQNTMTADPIGSKRSSIQRHSQRSLRRKIIDQANEGLKMNQNQLIEFNPNLGD  916
             KDWNAIAR+NT  +DPIGSKRSS+QRHSQRSLRRKII+QANEGL+MNQ QLIEFNPNLGD
Sbjct  854   KDWNAIARKNTFASDPIGSKRSSMQRHSQRSLRRKIIEQANEGLQMNQTQLIEFNPNLGD  913

Query  917   VTRATRVAYVKFMKKKMAADEDGAAAASAEAATTSATIKDEKATGGSKK-----------  965
             VTRATRVAYVKFM+KKMAADE   + A  E A      K      GSKK           
Sbjct  914   VTRATRVAYVKFMRKKMAADE--VSLADDEGAPNGEGEKKPLDASGSKKSITSGGTGGGA  971

Query  966   -----------VKPDDPKAASDEKADTVSKTSSTDTKS---------KESKP--GDSKPG  1003
                        VK  D K+ +D K  T+ K +               K+SKP  G  KPG
Sbjct  972   SMLAAAALRASVKNVDEKSGADGKPGTMGKPTDDKKAGDDKDKQQPPKDSKPSAGGPKPG  1031

Query  1004  DAKPAAPAPPGKPAAPG--AKPNDAAKKD---DATKPAAGAAAKSPPPAAAKPDTAAKKE  1058
             D KP   A   KP A G  +KP ++ KKD     TKP     A   P  +AKP+ AAKKE
Sbjct  1032  DQKPTPGAGAPKPQAAGTISKPGESQKKDAPAPPTKPGDTKPAAPKPGESAKPEAAAKKE  1091

Query  1059  -----DAAKPSGADAKPATAAKPGDSSSGGTAAAKPAVAKPGETTKPEAAAKKEDTAKTE  1113
                  +A+KP+  +    +AA    S +   +  KP  A   E TK    A K D  K+ 
Sbjct  1092  ESSKTEASKPAATNGAAKSAAPSAPSDAKPDSKLKPGAAGAPEATKATNGASKPDEKKSG  1151

Query  1114  AAKPGAAA  1121
               +P  AA
Sbjct  1152  PEEPKKAA  1159


>TRPG_DROME unnamed protein product
Length=1128

 Score = 904 bits (2337),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/813 (54%), Positives = 584/813 (72%), Gaps = 37/813 (5%)

Query  32   EKNFILAAERGDIQGVKKIIEDNKGQPDKF-NINCVDPLNRSALISAIENENFDLIIVLL  90
            EK F+LA ERGD+ G +++++  K Q  ++ N+NCVDPL R+AL+ AI+NEN +++ +L+
Sbjct  21   EKKFLLAVERGDMAGTRRMLQ--KAQDTEYINVNCVDPLGRTALLMAIDNENLEMVELLI  78

Query  91   ECGIEVGDALLHAISEEYVEAVEELLQWEE-THHKEGQPYSWESVDRNKSTFTPDITPLI  149
               ++  DALLH+ISEE+VEAVE LL  E  T H EG  +SWES   + STFTPDITPLI
Sbjct  79   NYNVDTKDALLHSISEEFVEAVEVLLDHENVTFHSEGN-HSWESASEDTSTFTPDITPLI  137

Query  150  LAAHRNNYEILKILLDRGATLPMPHDVKCGCDECVTSQETDSLRHSQSRINAYRALSASS  209
            LAAHR+NYEI+KILLDRGA LPMPHDV+CGCDECV S++ DSLRHS+SRINAYRAL++ S
Sbjct  138  LAAHRDNYEIIKILLDRGAVLPMPHDVRCGCDECVQSRQEDSLRHSRSRINAYRALASPS  197

Query  210  LIALSSRDPVLTAFELSWELKRLQAMESEFRAEYTEMRVGVQEFVSSLLDHARTSTELEV  269
            LIALSS+DP+LTAFELSWEL+RL  +E EF+ EY E+R   Q+F ++LLDH RTS ELE+
Sbjct  198  LIALSSKDPILTAFELSWELRRLSFLEHEFKNEYQELRKQCQDFATALLDHTRTSHELEI  257

Query  270  MLNFNHEPTTDIWMPGQRQTLERLKLAIRYKQKAFVAHPNVQQLLAAIWYEGLPGFRRKQ  329
            +L  NH+PT  ++  G+R  L RLKLAI+ +QK FVAH NVQQLLA+IWYEGLPGFRRK 
Sbjct  258  LL--NHDPTGPVYEHGERMHLNRLKLAIKLRQKKFVAHSNVQQLLASIWYEGLPGFRRKN  315

Query  330  ASQQIIEVVKLGTMFPINSMNYLLAPDSDAGKFMRKPFVKFISHSCSYMFFLMLLGAASL  389
             + Q ++++++G MFPI S+ Y+LAP S  G+ MRKPF+KFI HS SY  FL LL  AS 
Sbjct  316  MALQAVDIIRIGIMFPIFSLAYILAPYSSIGQTMRKPFIKFICHSASYFTFLFLLMLASQ  375

Query  390  RVVQLSFELLGFPWMLA----MLEDWRK--HERGSLPGPIELGIITYIASLVFGELKTLY  443
            R+     E     W  A    ML    +   +RG+ P  IE  I+ +++ L++ E+K L+
Sbjct  376  RI-----ETFIGGWFFADSSGMLNTMEELPTKRGAKPTFIEWLILAWVSGLIWSEVKQLW  430

Query  444  SDGLFEYIMDLWNIVDFVSNMFYVTWILCRATAWIIVHRDLWYRGIDPYFPREHWHPFDP  503
              GL EY+ D+WN++DFV+N  YV  +  R  ++  V +++ Y       PRE W  +DP
Sbjct  431  DVGLQEYLNDMWNVIDFVTNSLYVATVALRVVSFFQVQKEMIYNSHATDLPRERWDAWDP  490

Query  504  MLLSEGAFAAGMVFSYLKLVHIFSINPHLGPLQVSLGRMIIDIIKFFFIYTLVLFAFGCG  563
            ML+SEG F+A  +FS LKLV+IFS+NPHLGPLQVSL RM++DI+KFFF+Y LVLFAFG G
Sbjct  491  MLISEGLFSAANIFSSLKLVYIFSVNPHLGPLQVSLSRMVMDIMKFFFLYVLVLFAFGSG  550

Query  564  LNQLLWYYAELEKNKCYHLHPDVADFD----DQEKACTIWRRFSNLFETSQSLFWASFGL  619
            LNQLLWYYA+LEK +C  + P  A  +    +   AC +WRRFSNLFET+Q+LFWA FGL
Sbjct  551  LNQLLWYYADLEKKRCPEVSPMSALLNMNGTNDPNACIVWRRFSNLFETTQTLFWAVFGL  610

Query  620  VDLVSFDLAGIKSFTRFWALLMFGSYSVINIIVLLNMLIAMMSNSYQIISERADVEWKFA  679
            +DL SF+L GIK FTRFW +LMFG+YSVINI+VLLN+LIAMM++SYQ+ISERADVEWKFA
Sbjct  611  IDLDSFELDGIKIFTRFWGMLMFGTYSVINIVVLLNLLIAMMNHSYQLISERADVEWKFA  670

Query  680  RSQLWMSYFEDGGTVPPPFNIMPS-------VKLLRKTLGKEGPKRTKSFMRKTKERSQA  732
            RS+LW+SYFE+GGT PPPFNI+P+       +K +R+          +  ++  + ++Q 
Sbjct  671  RSKLWISYFEEGGTCPPPFNIIPTPKSIWYAIKWMRRVFCSGSSAARREHLKTIRRKAQQ  730

Query  733  LHDK------VMKLLIRRFVTAEQRRRDDYGITEDDIIEVRQDISSLRFELLDIFQTNRF  786
              D+      +M+ L+RR+VT EQR+ +  G+TEDD+ E++QDIS+ R EL++I + +  
Sbjct  731  ASDRDFKYQQIMRNLVRRYVTVEQRKAESQGVTEDDVNEIKQDISAFRCELVEILKNSGM  790

Query  787  NVPDIEKKTAAAAAGTKKGKVMERRILKDFQIG  819
            +             G KK +  ERR++K F I 
Sbjct  791  DTN--VTAGQGGGGGGKKNRQKERRLMKGFNIA  821


>TRPL_DROME unnamed protein product
Length=1124

 Score = 850 bits (2197),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/1020 (44%), Positives = 634/1020 (62%), Gaps = 52/1020 (5%)

Query  38    AAERGDIQGVKKIIEDNKGQPDKFNINCVDPLNRSALISAIENENFDLIIVLLECGIEVG  97
             A ERGD+  V++I++    +    NINC+DPL R AL  AI+NEN +++ +L+  G+E  
Sbjct  48    AVERGDMPNVRRILQ-KALRHQHININCMDPLGRRALTLAIDNENLEMVELLVVMGVETK  106

Query  98    DALLHAISEEYVEAVEELLQWEETHHKEGQPYSWESVDRNKSTFTPDITPLILAAHRNNY  157
             DALLHAI+ E+VEAVE LL+ EE  +KEG+PYSW+ VD N + F PDITPL+LAAH+NN+
Sbjct  107   DALLHAINAEFVEAVELLLEHEELIYKEGEPYSWQKVDINTAMFAPDITPLMLAAHKNNF  166

Query  158   EILKILLDRGATLPMPHDVKCGCDECVTSQETDSLRHSQSRINAYRALSASSLIALSSRD  217
             EIL+ILLDRGA +P+PHD++CGC+ECV     DSLRHS SR+N YRAL + SLI L+S D
Sbjct  167   EILRILLDRGAAVPVPHDIRCGCEECVRLTAEDSLRHSLSRVNIYRALCSPSLICLTSND  226

Query  218   PVLTAFELSWELKRLQAMESEFRAEYTEMRVGVQEFVSSLLDHARTSTELEVMLNFNHEP  277
             P++TAF+LSWEL+ L   E E ++EY ++R   Q+F   LLD  RTS EL ++LN+  +P
Sbjct  227   PIITAFQLSWELRNLALTEQECKSEYMDLRRQCQKFAVDLLDQTRTSNELAIILNY--DP  284

Query  278   TTDIWMPGQRQTLERLKLAIRYKQKAFVAHPNVQQLLAAIWYEGLPGFRRKQASQQIIEV  337
                 + PG R +L RL  AI YKQK FVAH N+QQLL++IWY+GLPGFRRK    ++I +
Sbjct  285   QMSSYEPGDRMSLTRLVQAISYKQKKFVAHSNIQQLLSSIWYDGLPGFRRKSIVDKVICI  344

Query  338   VKLGTMFPINSMNYLLAPDSDAGKFMRKPFVKFISHSCSYMFFLMLLGAASLRVVQLSFE  397
              ++  +FP+  + Y+ AP+   G+ MRKPF+KF+ H+ SY+FFL +L   S R       
Sbjct  345   AQVAVLFPLYCLIYMCAPNCRTGQLMRKPFMKFLIHASSYLFFLFILILVSQRADDDFVR  404

Query  398   LLGFPWMLAMLEDWRKHERGSLPGPIELGIITYIASLVFGELKTLYSDGLFEYIMDLWNI  457
             + G   M   L +    +RG  P  +EL ++ Y+   V+ E++ +++ G+  Y+ ++WN 
Sbjct  405   IFGTTRMKKELAEQELRQRGQTPSKLELIVVMYVIGFVWEEVQEIFAVGMKSYLRNMWNF  464

Query  458   VDFVSNMFYVTWILCRATAWIIVHRDLWYRGIDPYFPREHWHPFDPMLLSEGAFAAGMVF  517
             +DF+ N  YV+ +  RA A+I    ++       Y PRE WH FDP L++EG FAA  VF
Sbjct  465   IDFLRNSLYVSVMCLRAFAYIQQATEIARDPQMAYIPREKWHDFDPQLIAEGLFAAANVF  524

Query  518   SYLKLVHIFSINPHLGPLQVSLGRMIIDIIKFFFIYTLVLFAFGCGLNQLLWYYAELEKN  577
             S LKLVH+FSINPHLGPLQ+SLGRM+IDI+KFFFIYTLVLFAF CGLNQLLWY+A LEK+
Sbjct  525   SALKLVHLFSINPHLGPLQISLGRMVIDIVKFFFIYTLVLFAFACGLNQLLWYFAALEKS  584

Query  578   KCYHLHPDVADFDDQEKACTIWRRFSNLFETSQSLFWASFGLVDLVSFDLAGIKSFTRFW  637
             KCY L    AD+     +C  WRRF NLFE+SQSLFWASFG+V L  F+L+GIKS+TRFW
Sbjct  585   KCYVLPGGEADWGSHGDSCMKWRRFGNLFESSQSLFWASFGMVGLDDFELSGIKSYTRFW  644

Query  638   ALLMFGSYSVINIIVLLNMLIAMMSNSYQIISERADVEWKFARSQLWMSYFEDGGTVPPP  697
              LLMFGSYSVIN+IVLLN+LIAMMSNSY +I E +D EWKFAR++LWMSYFED  T+PPP
Sbjct  645   GLLMFGSYSVINVIVLLNLLIAMMSNSYAMIDEHSDTEWKFARTKLWMSYFEDSATLPPP  704

Query  698   FNIMPSVKLLRKTLGKEGPKRTKSFMRKTKERSQ-ALHDKVMKLLIRRFVTAEQRRRDDY  756
             FN++PSVK + +   K      +   +K KE+ Q + +D +M+ L+ R+V A  R+ ++ 
Sbjct  705   FNVLPSVKWVIRIFRKSSKTIDRQRSKKRKEQEQFSEYDNIMRSLVWRYVAAMHRKFENN  764

Query  757   GITEDDIIEVRQDISSLRFELLDIFQTNRFNVPDIEKKTAAAAAGTKKGKVMERRILKDF  816
              ++EDDI EV+ +I+++R+E+L+IF+ +  +V    KK        ++ KV ERR++K F
Sbjct  765   PVSEDDINEVKSEINTMRYEMLEIFENSGMDVSSANKKERQPRP--RRIKVWERRLMKGF  822

Query  817   QIGFVEN--------------LQHEMTV-------GDEGSKDIFSSLARVIGKKKSLKSG  855
             Q+  V+N                 E+ V         E +K+ F  +AR +     L+S 
Sbjct  823   QVAPVQNGCELDAFGNVNGQGEMQEIKVESIPSKPAKETAKERFQRVARTV----LLQST  878

Query  856   EKDWNAIAR--QNTMTADPIGSKRSSIQRHSQRSLRRKIIDQANEGLKMNQNQLIEFNPN  913
                WN + R  +++       ++R S+Q   +     K +   N G    +   I     
Sbjct  879   THKWNVVLRAAKDSQIGRCTKNERKSLQNLGRAIEEAKRLIMLNPGCPSGRESPIRI--E  936

Query  914   LGDVTRATRVAYVKFMKKKMAADED-----------GAAAASAEAATTSATIKDEKATGG  962
               D   +T +  +  +  +++  E                A A AA  + ++     T  
Sbjct  937   FEDEKTSTLLELLNQISAEISDSEKPKIRPIWRPPLKTVPARAMAANNTRSL-----TAP  991

Query  963   SKKVKPDDPKAASDEKADTVSKTSSTDTKSKESKPGDSK-PGDAKPAAPAPPGKPAAPGA  1021
               K+      A +      VS T+ +  +++E     SK   ++ P+AP  P K +AP A
Sbjct  992   ELKISRKSSPAPTPTPTPGVSHTALSQFRNRELPLCPSKLIANSAPSAPTAPPKKSAPTA  1051



Lambda      K        H
   0.316    0.131    0.384 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 625364460


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jan 6, 2022  1:11 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_011197340.1 cardio acceleratory peptide 2b isoform X1 [Bactrocera
dorsalis]

Length=163
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CP2B_DROME  unnamed protein product                                   149     1e-46
PBAN_BOMMO  unnamed protein product                                   31.2    0.28 
GEFE_DICDI  unnamed protein product                                   28.5    3.3  


>CP2B_DROME unnamed protein product
Length=151

 Score = 149 bits (376),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 106/156 (68%), Gaps = 11/156 (7%)

Query  9    VIICSTVVVVALAGFSDAELEQ-KNRRTAGGPSGLIAFPRVGRSDPNLVNNLHEADISAL  67
            +++   +V+  +A FS AE +  KNRR  G   GL AFPRVGRSDP+L N+L +   + +
Sbjct  4    MLVHIVLVIFIIAEFSTAETDHDKNRR--GANMGLYAFPRVGRSDPSLANSLRDGLEAGV  61

Query  68   GESIMYPASLEDY-EVEYPKSEMKRASLIPFPRVGRTDAELRKWAHIMALQQALNKATGP  126
             + I   AS EDY E ++ K   K + L+ FPRVGR DAELRKWAH++ALQQ L+K TGP
Sbjct  62   LDGIYGDASQEDYNEADFQK---KASGLVAFPRVGRGDAELRKWAHLLALQQVLDKRTGP  118

Query  127  SATSGLWFGPRLGKRSVDAQQQQQTHKSPASGQKEL  162
            SA+SGLWFGPRLGKRSVDA+      K    GQKEL
Sbjct  119  SASSGLWFGPRLGKRSVDAKSFADISK----GQKEL  150


>PBAN_BOMMO unnamed protein product
Length=192

 Score = 31.2 bits (69),  Expect = 0.28, Method: Compositional matrix adjust.
 Identities = 12/17 (71%), Positives = 13/17 (76%), Gaps = 0/17 (0%)

Query  127  SATSGLWFGPRLGKRSV  143
            S    LWFGPRLGKRS+
Sbjct  36   SERGALWFGPRLGKRSM  52


>GEFE_DICDI unnamed protein product
Length=1037

 Score = 28.5 bits (62),  Expect = 3.3, Method: Composition-based stats.
 Identities = 13/34 (38%), Positives = 18/34 (53%), Gaps = 0/34 (0%)

Query  86   KSEMKRASLIPFPRVGRTDAELRKWAHIMALQQA  119
            + E +R+   PFP VG T   L   AH++  Q A
Sbjct  364  RPEDRRSKTSPFPNVGTTTPPLSNSAHLVRTQSA  397



Lambda      K        H
   0.316    0.131    0.383 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1022168484


Query= XP_011197341.1 cardio acceleratory peptide 2b isoform X2 [Bactrocera
dorsalis]

Length=162
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CP2B_DROME  unnamed protein product                                   150     6e-47
PBAN_BOMMO  unnamed protein product                                   31.2    0.28 
GEFE_DICDI  unnamed protein product                                   28.5    3.2  


>CP2B_DROME unnamed protein product
Length=151

 Score = 150 bits (378),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 104/154 (68%), Gaps = 8/154 (5%)

Query  9    VIICSTVVVVALAGFSDAELEQ-KNRRTAGGPSGLIAFPRVGRSDPNLVNNLHEADISAL  67
            +++   +V+  +A FS AE +  KNRR  G   GL AFPRVGRSDP+L N+L +   + +
Sbjct  4    MLVHIVLVIFIIAEFSTAETDHDKNRR--GANMGLYAFPRVGRSDPSLANSLRDGLEAGV  61

Query  68   GESIMYPASLEDYEEYPKSEMKRASLIPFPRVGRTDAELRKWAHIMALQQALNKATGPSA  127
             + I   AS EDY E    + K + L+ FPRVGR DAELRKWAH++ALQQ L+K TGPSA
Sbjct  62   LDGIYGDASQEDYNE-ADFQKKASGLVAFPRVGRGDAELRKWAHLLALQQVLDKRTGPSA  120

Query  128  TSGLWFGPRLGKRSVDAQQQQQTHKSPASGQKEL  161
            +SGLWFGPRLGKRSVDA+      K    GQKEL
Sbjct  121  SSGLWFGPRLGKRSVDAKSFADISK----GQKEL  150


>PBAN_BOMMO unnamed protein product
Length=192

 Score = 31.2 bits (69),  Expect = 0.28, Method: Compositional matrix adjust.
 Identities = 12/17 (71%), Positives = 13/17 (76%), Gaps = 0/17 (0%)

Query  126  SATSGLWFGPRLGKRSV  142
            S    LWFGPRLGKRS+
Sbjct  36   SERGALWFGPRLGKRSM  52


>GEFE_DICDI unnamed protein product
Length=1037

 Score = 28.5 bits (62),  Expect = 3.2, Method: Composition-based stats.
 Identities = 13/34 (38%), Positives = 18/34 (53%), Gaps = 0/34 (0%)

Query  85   KSEMKRASLIPFPRVGRTDAELRKWAHIMALQQA  118
            + E +R+   PFP VG T   L   AH++  Q A
Sbjct  364  RPEDRRSKTSPFPNVGTTTPPLSNSAHLVRTQSA  397



Lambda      K        H
   0.316    0.131    0.383 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1022168484


Query= XP_011197343.1 endocuticle structural glycoprotein SgAbd-9
[Bactrocera dorsalis]

Length=123
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

LCP52_DROME  unnamed protein product                                  52.0    1e-09
LCP51_DROME  unnamed protein product                                  52.0    1e-09
A95EF_DROME  unnamed protein product                                  32.0    0.017


>LCP52_DROME unnamed protein product
Length=104

 Score = 52.0 bits (123),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 40/62 (65%), Gaps = 0/62 (0%)

Query  44   EGYRFNLEEPNGSKREEIGVIMNPGTEDEQLVVMGSYTVYDEKTDTETITMYTADKDGYK  103
            E +  ++E  +G+  ++ GV+ N GT++E  VV GS+T  DEKT  +    Y AD++GY+
Sbjct  33   EKWSSDVETSDGTSIKQEGVLKNAGTDNEAAVVHGSFTWVDEKTGEKFTITYVADENGYQ  92

Query  104  PR  105
            P+
Sbjct  93   PQ  94


>LCP51_DROME unnamed protein product
Length=104

 Score = 52.0 bits (123),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 40/62 (65%), Gaps = 0/62 (0%)

Query  44   EGYRFNLEEPNGSKREEIGVIMNPGTEDEQLVVMGSYTVYDEKTDTETITMYTADKDGYK  103
            E +  ++E  +G+  ++ GV+ N GT++E  VV GS+T  DEKT  +    Y AD++GY+
Sbjct  33   EKWSSDVETSDGTSIKQEGVLKNAGTDNEAAVVHGSFTWVDEKTGEKFTITYVADENGYQ  92

Query  104  PR  105
            P+
Sbjct  93   PQ  94


>A95EF_DROME unnamed protein product
Length=52

 Score = 32.0 bits (71),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 14/21 (67%), Positives = 17/21 (81%), Gaps = 0/21 (0%)

Query  103  KPRYMIKNRKLSPGALKSAAG  123
            KPR+  K+RKLS GAL+S AG
Sbjct  32   KPRFETKDRKLSAGALQSLAG  52



Lambda      K        H
   0.316    0.131    0.383 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1022168484


Query= XP_011197344.1 uncharacterized protein LOC105221901 [Bactrocera
dorsalis]

Length=123
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

LCP52_DROME  unnamed protein product                                  45.8    2e-07
LCP51_DROME  unnamed protein product                                  45.8    2e-07
MYOE_DICDI  unnamed protein product                                   29.6    0.68 


>LCP52_DROME unnamed protein product
Length=104

 Score = 45.8 bits (107),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 35/70 (50%), Gaps = 10/70 (14%)

Query  36   FYSQVPTKEGYRFKQEDPNGSSREEIGIIMNPDTPDEELVIMGMYKVYDEKTDTETITMY  95
            + S V T +G   KQE          G++ N  T +E  V+ G +   DEKT  +    Y
Sbjct  35   WSSDVETSDGTSIKQE----------GVLKNAGTDNEAAVVHGSFTWVDEKTGEKFTITY  84

Query  96   TADKNGYQPR  105
             AD+NGYQP+
Sbjct  85   VADENGYQPQ  94


>LCP51_DROME unnamed protein product
Length=104

 Score = 45.8 bits (107),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 35/70 (50%), Gaps = 10/70 (14%)

Query  36   FYSQVPTKEGYRFKQEDPNGSSREEIGIIMNPDTPDEELVIMGMYKVYDEKTDTETITMY  95
            + S V T +G   KQE          G++ N  T +E  V+ G +   DEKT  +    Y
Sbjct  35   WSSDVETSDGTSIKQE----------GVLKNAGTDNEAAVVHGSFTWVDEKTGEKFTITY  84

Query  96   TADKNGYQPR  105
             AD+NGYQP+
Sbjct  85   VADENGYQPQ  94


>MYOE_DICDI unnamed protein product
Length=1005

 Score = 29.6 bits (65),  Expect = 0.68, Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 37/79 (47%), Gaps = 13/79 (16%)

Query  54   NGSSREEIGIIMNPDTPDEELVIMGMYKV----------YDEKTDTE---TITMYTADKN  100
            NG++++   +I+     D+E + MG  KV          ++EK + E    +T+      
Sbjct  649  NGTAKQATELILQQHNIDKEEIRMGKTKVFIRNPTTLFYFEEKRELEMPRIVTLIQKTWR  708

Query  101  GYQPRFKLKNRKLSSKLLM  119
            GY+ R K   RK + K+ +
Sbjct  709  GYRARSKWNQRKAAIKIQL  727



Lambda      K        H
   0.316    0.131    0.383 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1022168484


Query= XP_011197348.1 LOW QUALITY PROTEIN: cleavage and polyadenylation
specificity factor 73 [Bactrocera dorsalis]

Length=684
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CPSF3_DROME  unnamed protein product                                  1247    0.0   
Q581U7_TRYB2  unnamed protein product                                 551     0.0   
INT11_DROME  unnamed protein product                                  336     2e-106


>CPSF3_DROME unnamed protein product
Length=684

 Score = 1247 bits (3226),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 591/678 (87%), Positives = 641/678 (95%), Gaps = 1/678 (0%)

Query  5    NDDRVPAEESDLLQIKPLGAGQEVGRSCIMLDFKGKKIMLDCGIHPGLSGMDALPYVDLI  64
             D R+P EESDLLQIKPLGAGQEVGRSCIML+FKGKKIMLDCGIHPGLSGMDALPYVDLI
Sbjct  6    GDARMPDEESDLLQIKPLGAGQEVGRSCIMLEFKGKKIMLDCGIHPGLSGMDALPYVDLI  65

Query  65   EADEVDLLFISHFHLDHCGALPWFLMKTSFRGRCFMTHATKAIYRWMLSDYIKISNISTE  124
            EADE+DLLFISHFHLDHCGALPWFLMKTSF+GRCFMTHATKAIYRWMLSDYIKISNISTE
Sbjct  66   EADEIDLLFISHFHLDHCGALPWFLMKTSFKGRCFMTHATKAIYRWMLSDYIKISNISTE  125

Query  125  QMLYTEADLEASMEKIETINFHEERDVMGVRFCAYNAGHVLGAAMFLIEIAGVKILYTGD  184
            QMLYTEADLEASMEKIETINFHEERDVMGVRFCAY AGHVLGAAMF+IEIAG+KILYTGD
Sbjct  126  QMLYTEADLEASMEKIETINFHEERDVMGVRFCAYIAGHVLGAAMFMIEIAGIKILYTGD  185

Query  185  FSRQEDRHLMAAEIPPVKPDVLITESTYGTHIHEKREDRENRFTSLVQKTVQQGGRCLIP  244
            FSRQEDRHLMAAE+PP+KPDVLITESTYGTHIHEKREDRENRFTSLVQK VQQGGRCLIP
Sbjct  186  FSRQEDRHLMAAEVPPMKPDVLITESTYGTHIHEKREDRENRFTSLVQKIVQQGGRCLIP  245

Query  245  VFALGRAQELLLILDEYWSQNPELHEIPIYYASSLAKKCMAVYQTYINAMNDKIRRQIAV  304
            VFALGRAQELLLILDE+WSQNP+LHEIPIYYASSLAKKCMAVYQTYINAMND+IRRQIAV
Sbjct  246  VFALGRAQELLLILDEFWSQNPDLHEIPIYYASSLAKKCMAVYQTYINAMNDRIRRQIAV  305

Query  305  NNPFVFRHISNLKGIDHFDDIGPCVVMASPGMMQSGLSRELFENWCTDPKNGVIIAGYCV  364
            NNPFVFRHISNLKGIDHF+DIGPCV+MASPGMMQSGLSRELFE+WCTDPKNGVIIAGYCV
Sbjct  306  NNPFVFRHISNLKGIDHFEDIGPCVIMASPGMMQSGLSRELFESWCTDPKNGVIIAGYCV  365

Query  365  EGTLAKTILSEPEEITTLAGQKLPLNMSVDYISFSAHTDYQQTSEFIRLLKPQHVVLVHG  424
            EGTLAK +LSEPEEITTL+GQKLPLNMSVDYISFSAHTDYQQTSEFIRLLKP HVVLVHG
Sbjct  366  EGTLAKAVLSEPEEITTLSGQKLPLNMSVDYISFSAHTDYQQTSEFIRLLKPTHVVLVHG  425

Query  425  EQNEMSRLKMALQREYEADTTTNIKFYNPRNTHSVELYFRGEKTAKVMGNLAATKPEVGN  484
            EQNEMSRLK+ALQREYEAD +T+IKFYNPRNTH+V+LYFRGEKTAKVMG+LAA   EVG+
Sbjct  426  EQNEMSRLKLALQREYEADASTDIKFYNPRNTHAVDLYFRGEKTAKVMGSLAAKNSEVGS  485

Query  485  KLSGVLVKRDFKYHLLAASDLSKYTDMSMSVVTQRQSIPWNSSLSTLKLLXDRIGGAGTT  544
            KLSGVLVKRDFKYHLLA SDL KYTDMSMSVVTQRQSIPW SSLSTL+LL DRI GAG  
Sbjct  486  KLSGVLVKRDFKYHLLAPSDLGKYTDMSMSVVTQRQSIPWGSSLSTLELLLDRI-GAGCV  544

Query  545  EVLEEEKRIRAFKCIDLSVEGKIIIMEWQATPVNDMFADSVLACIMQTEMGGTNIKGTTA  604
            EVLE E+++R F CI+L+VE KII+MEWQAT VND++AD+VLACIMQ+E+GGTN+KG T 
Sbjct  545  EVLEAERKLRVFGCIELTVEQKIIVMEWQATHVNDVYADAVLACIMQSELGGTNLKGATK  604

Query  605  IAKSDRTHFNECLVETLQDTFGEHSVPKMFKGDVLPVTVAGKRAEVNLETLQVHCPEDEN  664
              KS+ + F ECL+ETLQDTFG++ VPKMF+GD+LPVTV+GKRAE+NLETL + C ED+ 
Sbjct  605  QTKSEDSRFRECLIETLQDTFGDNCVPKMFEGDLLPVTVSGKRAEINLETLAISCAEDDV  664

Query  665  LRQIVNTAVQKLHQALVT  682
            LRQ++NT VQKLHQ LV+
Sbjct  665  LRQMLNTTVQKLHQTLVS  682


>Q581U7_TRYB2 unnamed protein product
Length=770

 Score = 551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/614 (46%), Positives = 410/614 (67%), Gaps = 45/614 (7%)

Query  14   SDLLQIKPLGAGQEVGRSCIMLDFKGKKIMLDCGIHPGLSGMDALPYVDLIEADEVDLLF  73
            +D ++I P+G+G EVGRSC+++ +KG+ +MLDCG HP  SG+D+LP+ D I  DE+DL+ 
Sbjct  36   TDEVEILPIGSGGEVGRSCVVVRYKGRSVMLDCGNHPAKSGLDSLPFFDSIRCDEIDLVL  95

Query  74   ISHFHLDHCGALPWFLMKTSFRGRCFMTHATKAIYRWMLSDYIKISNISTEQMLYTEADL  133
            I+HFHLDHCGALP+F  +TSFRGR FMT ATKA Y+ +++D+++I   S E ++  E  L
Sbjct  96   ITHFHLDHCGALPYFCEQTSFRGRIFMTSATKAFYKMVMNDFLRI-GASAEDIVNNEW-L  153

Query  134  EASMEKIETINFHEERDVMGVRFCAYNAGHVLGAAMFLIEIAGVKILYTGDFSRQEDRHL  193
            ++++EKIET+ +HEE  V G+ F  +NAGHVLGAA+F+++IAG+K+LYTGDFSR  DRHL
Sbjct  154  QSTIEKIETVEYHEEVTVNGIHFQPFNAGHVLGAALFMVDIAGMKLLYTGDFSRVPDRHL  213

Query  194  MAAEIPPVKPDVLITESTYGTHIHEKREDRENRFTSLVQKTVQQGGRCLIPVFALGRAQE  253
            + AE+PP  PD+LI EST G    E RE+RE+ FT+ V   V+ GGRCL+PVFALGRAQE
Sbjct  214  LGAEVPPYSPDILIAESTNGIRELESREERESLFTTWVHDVVKGGGRCLVPVFALGRAQE  273

Query  254  LLLILDEYWSQNPELHEIPIYYASSLAKKCMAVYQTYINAMNDKIRRQIAVN-NPFVFRH  312
            LLLIL+EYW  + EL  IPIYYASSLA++CM +YQT+++AMND++++Q   + NPFVF++
Sbjct  274  LLLILEEYWEAHKELQHIPIYYASSLAQRCMKLYQTFVSAMNDRVKKQHENHRNPFVFKY  333

Query  313  ISNLKGIDHFDDIGPCVVMASPGMMQSGLSRELFENWCTDPKNGVIIAGYCVEGTLAKTI  372
            I +L     F+D GPCVV+ASPGM+QSG+S ELFE WC D +NG+I+AGYCV+GT+AK I
Sbjct  334  IQSLLDTRSFEDTGPCVVLASPGMLQSGISLELFERWCGDKRNGIIVAGYCVDGTIAKDI  393

Query  373  LSEPEEITTLAGQKLPLNM-SVDYISFSAHTDYQQTSEFIRLL-KPQHVVLVHGEQNEMS  430
            LS+P EIT   G+ LPL M ++  +SFSAH+D +QT +FI+ L K +HV+LVHG    M 
Sbjct  394  LSKPREITKPDGKVLPLRMRTIQSVSFSAHSDGRQTRDFIQALPKTKHVILVHGNVGAMG  453

Query  431  RLKMALQREYEADTTTNIKFYNPRNTHSVELYFRGEKTAKVMGNLAATKPEVGNKLSGVL  490
            +LK  LQ+++ AD    ++ Y  +N  ++ + F  ++TAKV+G LA   P  G  +SGVL
Sbjct  454  QLKNKLQQDF-AD--RGVQVYATKNQEAIRIPFSVQRTAKVLGTLARNPPRDGEFISGVL  510

Query  491  V-KRDFKYHLLAASDLSKYTDMSMSVVTQRQSIP---WNSSLSTLKLL------------  534
            +      Y ++  +D+  +TD+ ++ + Q   +P   + S    L++L            
Sbjct  511  LMSGHHTYSVVHPTDIPHFTDLDVAQIQQAIVLPLPRYKSPHEVLEMLKRYFAQSQMFSD  570

Query  535  --------------XDRIGGAGTTEVLEEEKRIRAFKCIDLSVEGK-----IIIMEWQAT  575
                           + IGG    E      +I   K + + V+        + + W ++
Sbjct  571  VTPHEQQKQEGGDAANAIGGGQEQECAGNATQITVSKDVWVDVQQSTRSQTTVTVNWTSS  630

Query  576  PVNDMFADSVLACI  589
              ND+ AD  + CI
Sbjct  631  HHNDLLAD--VTCI  642


>INT11_DROME unnamed protein product
Length=597

 Score = 336 bits (861),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 203/572 (35%), Positives = 309/572 (54%), Gaps = 36/572 (6%)

Query  17   LQIKPLGAGQEVGRSCIMLDFKGKKIMLDCGIHPGLSGMDALPYVDLIEAD-----EVDL  71
            ++I PLGAGQ+VGRSC++L   GK IMLDCG+H G +     P    I  +      +D 
Sbjct  4    IKITPLGAGQDVGRSCLLLSMGGKNIMLDCGMHMGYNDERRFPDFSYIVPEGPITSHIDC  63

Query  72   LFISHFHLDHCGALPWFLMKTSFRGRCFMTHATKAIYRWMLSDYIKIS-NISTEQMLYTE  130
            + ISHFHLDHCGALP+      + G  +MTH TKAI   +L D  K++     E   +T 
Sbjct  64   VIISHFHLDHCGALPYMSEIVGYTGPIYMTHPTKAIAPILLEDMRKVAVERKGESNFFTT  123

Query  131  ADLEASMEKIETINFHEERDV-MGVRFCAYNAGHVLGAAMFLIEIAGVKILYTGDFSRQE  189
              ++  M+K+  +  H+   V   +   AY AGHVLGAAMF I++    ++YTGD++   
Sbjct  124  QMIKDCMKKVIPVTLHQSMMVDTDLEIKAYYAGHVLGAAMFWIKVGSQSVVYTGDYNMTP  183

Query  190  DRHLMAAEIPPVKPDVLITESTYGTHIHEKREDRENRFTSLVQKTVQQGGRCLIPVFALG  249
            DRHL AA I   +PD+LI+ESTY T I + +  RE  F   V + V +GG+ LIPVFALG
Sbjct  184  DRHLGAAWIDKCRPDLLISESTYATTIRDSKRCRERDFLKKVHECVAKGGKVLIPVFALG  243

Query  250  RAQELLLILDEYWSQNPELHEIPIYYASSLAKKCMAVYQTYINAMNDKIRRQIAVNNPFV  309
            RAQEL ++L+ YW +     + PIY+A  L +K    Y+ +I   N KIR+     N F 
Sbjct  244  RAQELCILLETYWERMN--LKYPIYFALGLTEKANTYYKMFITWTNQKIRKTFVHRNMFD  301

Query  310  FRHISNLKGIDHFDDIGPCVVMASPGMMQSGLSRELFENWCTDPKNGVIIAGYCVEGTLA  369
            F+HI       + D+ G  VV A+PGM+ +GLS ++F+ W  +  N VI+ GYCV+GT+ 
Sbjct  302  FKHIKPFDKA-YIDNPGAMVVFATPGMLHAGLSLQIFKKWAPNENNMVIMPGYCVQGTVG  360

Query  370  KTILSEPEEITTLAGQKLPLNMSVDYISFSAHTDYQQTSEFIRLLKPQHVVLVHGEQNEM  429
              IL   +++     Q + + M+V+Y+SFSAH D +   + I+  +P++V+LVHGE  +M
Sbjct  361  NKILGGAKKVEFENRQVVEVKMAVEYMSFSAHADAKGIMQLIQNCEPKNVMLVHGEAGKM  420

Query  430  SRLKMALQREYEADTTTNIKFYNPRNTHS----------VELYFRGEKTAKVMGNLAATK  479
              L+  ++ E+      N++ Y P N  +          V+      K      N     
Sbjct  421  KFLRSKIKDEF------NLETYMPANGETCVISTPVKIPVDASVSLLKAEARSYNAQPPD  474

Query  480  PEVGNKLSGVLVKRDFKYHLLAASDLSKYTDMSMSVVTQRQSIPWNSSLSTLK-------  532
            P+    + GVLV +D +  L   +D  K   ++  V+     +  + S   ++       
Sbjct  475  PKRRRLIHGVLVMKDNRIMLQNLTDALKEIGINRHVMRFTSKVKMDDSGPVIRTSERLKT  534

Query  533  LLXDRIGGAGTTEVLEEEKRIRAFKCIDLSVE  564
            LL +++  AG T  ++E   I A + +++ VE
Sbjct  535  LLEEKL--AGWTVTMQENGSI-AIESVEVKVE  563



Lambda      K        H
   0.316    0.131    0.383 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1022168484


Query= XP_011197349.1 protein rolling stone [Bactrocera dorsalis]

Length=331
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ROST_DROME  unnamed protein product                                   172     9e-52
Q8IQJ5_DROME  unnamed protein product                                 32.0    0.72 
Q9N2Q2_DROME  unnamed protein product                                 30.8    1.9  


>ROST_DROME unnamed protein product
Length=275

 Score = 172 bits (436),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 92/273 (34%), Positives = 146/273 (53%), Gaps = 17/273 (6%)

Query  12   KKELRRDKCGFDHTPADDFVKSQWQSRTKSVVYLIYRWLIALFFTAVVIDSMLEKEEGSS  71
             KEL+R   GF +     F +SQWQ    + +YL+YRW+ ALFF  V I  ++ +     
Sbjct  12   NKELQRANFGFAYNRVHLFYRSQWQKDEINTIYLLYRWIWALFFLGVYIMCVIVQFCDGK  71

Query  72   TNFWLYFIYLTNWGVMLCMLTNLLGAILVTTWHFHPEYADNLLN----MESLTSPFVIYW  127
                 +FIY+TNWG  LC +T L+ A+ VT WHF      +L+         +    IYW
Sbjct  72   -----FFIYMTNWGFGLCTITMLISAVQVTCWHFDVRSTRSLVQESGHKAETSRGLKIYW  126

Query  128  GMHIISLVLSIVITVIYWSVLYDAAESSLN--ATNVLTHACNSIFMFIDLLIVAHPLRLL  185
             ++ ++L L+++I+ +YW  L+      +   A +++TH  NS+ M ID L++A PLR+L
Sbjct  127  WLYNMTLSLALIISTVYWVFLHGKMNKPMRFPAISIITHGMNSVMMLIDFLVIAFPLRIL  186

Query  186  HMFLPALFGIIFAIFSVIYQTCGGKNRRGKPYIYHVIDWREPLNATLVVLGVLLLTCCIY  245
            HM       I F +F++IY  CGG +  G  Y+Y ++DW  P    +  +G+ LL  C +
Sbjct  187  HMVYGMSLAIFFFLFTLIYHLCGGTDEFGNHYVYPILDWNNPNRCMVTFVGIFLLIMCYW  246

Query  246  LILFTIYKLRTLLYRRINNASYYFPTTTPHTGG  278
            ++LF +YKL+ +  R  +         +PH  G
Sbjct  247  VLLFGLYKLKRMFNRAFS------VVWSPHAVG  273


>Q8IQJ5_DROME unnamed protein product
Length=648

 Score = 32.0 bits (71),  Expect = 0.72, Method: Compositional matrix adjust.
 Identities = 31/101 (31%), Positives = 44/101 (44%), Gaps = 12/101 (12%)

Query  111  DNLLNMESLTSPFVIYWGMHIISLVLSIVITVIYWSVLYD----AAESSLNATNVLTHAC  166
            D  L        F + W  H  SL LS +  ++  S L D    A    L A  V+  AC
Sbjct  18   DQQLQHNDSQQQFCLRWHNHQTSL-LSTLPILLDQSHLTDVTISAEGRQLRAHRVVLSAC  76

Query  167  NSIFM--FIDLLIVAHPLRLLHMFLP-ALFGIIFAIFSVIY  204
            +S FM  F  L    HP+    + +P A FG I ++ + +Y
Sbjct  77   SSFFMDIFRALEASNHPV----IIIPGASFGAIVSLLTFMY  113


>Q9N2Q2_DROME unnamed protein product
Length=698

 Score = 30.8 bits (68),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 19/33 (58%), Gaps = 2/33 (6%)

Query  270  PTTTPHTGGAEKSANGTLPKTVKG--TGIQHSP  300
            PT+ P +G  E SA  T P+ VK     +Q+SP
Sbjct  598  PTSRPPSGSQEGSATATAPRAVKDLRQALQNSP  630



Lambda      K        H
   0.316    0.131    0.383 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1022168484


Query= XP_011197350.1 cleavage stimulation factor subunit 2 [Bactrocera
dorsalis]

Length=414
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VE52_DROME  unnamed protein product                                 495     5e-175
O45577_CAEEL  unnamed protein product                                 209     2e-64 
O45713_CAEEL  unnamed protein product                                 75.1    8e-17 


>Q9VE52_DROME unnamed protein product
Length=419

 Score = 495 bits (1274),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 305/428 (71%), Positives = 331/428 (77%), Gaps = 23/428 (5%)

Query  1    MADKNSEQSIMDKSMRSVFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFG  60
            MADK  EQSIMDKSMRSVFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFG
Sbjct  1    MADKAQEQSIMDKSMRSVFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFG  60

Query  61   FCEYKDQETALSAMRNLNGYEIGGRTLRVDNACTEKSRMEMQQLLQGPQIENPYGEHCDP  120
            FCEYKDQETALSAMRNLNGYEIGGRTLRVDNACTEKSRMEMQQLLQGPQ+ENPYGE C+P
Sbjct  61   FCEYKDQETALSAMRNLNGYEIGGRTLRVDNACTEKSRMEMQQLLQGPQVENPYGEPCEP  120

Query  121  DQAPEIITKTVASLPPEQMYELMKHMKLCIQNNPSESRQMLMLNPQLAYALLQSMVVMRI  180
            + APE+ITKTVASLPPEQMYELMK MKLCI +NPSE+RQMLMLNPQLAYALLQ+MVVMRI
Sbjct  121  EDAPELITKTVASLPPEQMYELMKQMKLCIVSNPSEARQMLMLNPQLAYALLQAMVVMRI  180

Query  181  VDPQAALGMLFKANQMPPVLGGNPLS--GNVQSQSISTNIMQQSQPQPTQPPPIVGGPPM  238
            VDPQ ALGMLFKANQMPPVLGGNP    GN           QQ Q    Q        P+
Sbjct  181  VDPQQALGMLFKANQMPPVLGGNPHQGPGNHTMMGQQQVPQQQVQIPQQQQQAPQPPMPV  240

Query  239  PVPGPNFNVMQGGDIDLRAMGGPGLGGPSNMDPRQMDPRMARNIDQDMRA-MPNPVPPPH  297
            P PG   NV    DIDLR +     GGP  MDPR     M R +DQD+RA +PNPVPPP 
Sbjct  241  PGPGFPANV-HPNDIDLRMVP----GGPMPMDPRM----MGRGMDQDLRASLPNPVPPPL  291

Query  298  MDPRAQRQMPPQQVNPQPS-----FPTDPRQRQIDPRLR------GNAAGPPGIPGPTMS  346
            MDPRA+ QMPPQQ    P      +P+DPRQR +DPRLR        A        P  +
Sbjct  292  MDPRARAQMPPQQQQGVPQAPPAPYPSDPRQRPMDPRLRAGPGPQQQAPPQGIPQAPPPT  351

Query  347  QQQQTAQQQLQNRLASNCGIPNDATDQEKAALIMQVLQLSDEQISQLPPEQRASILVLKE  406
            QQQQ A QQLQ+RL ++  +P+DA+DQEKAALIMQVLQLSDEQI+QLP EQR SI++LKE
Sbjct  352  QQQQAAAQQLQSRLGAHGVLPSDASDQEKAALIMQVLQLSDEQIAQLPSEQRVSIVMLKE  411

Query  407  QIAKSTQR  414
            QIAKSTQR
Sbjct  412  QIAKSTQR  419


>O45577_CAEEL unnamed protein product
Length=336

 Score = 209 bits (533),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 137/186 (74%), Gaps = 8/186 (4%)

Query  12   DKSMRSVFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQETAL  71
            D+S RSVFVGNI Y+ +E+ ++ IFS+ G VLS+K+V DRE+GKPKG+GF E+ D +TA 
Sbjct  14   DRSQRSVFVGNISYDVSEDTIRSIFSKAGNVLSIKMVHDRETGKPKGYGFIEFPDIQTAE  73

Query  72   SAMRNLNGYEIGGRTLRVDNACTEKSRMEMQQLLQ-----GPQIENPYGEHCDPDQAPEI  126
             A+RNLNGYE+ GR LRVD+A      M M++         P  ENPYG  CD  +APE 
Sbjct  74   VAIRNLNGYELSGRILRVDSAA---GGMNMEEFGSSSNAPAPVEENPYGPECDAGKAPER  130

Query  127  ITKTVASLPPEQMYELMKHMKLCIQNNPSESRQMLMLNPQLAYALLQSMVVMRIVDPQAA  186
            I++TVASL PE+M+ELMK ++  ++NNPSE  + L+ +PQ+AYA+LQ+ VVMRIVDPQ A
Sbjct  131  ISQTVASLAPEKMFELMKQLQESLKNNPSELHKFLVEHPQIAYAVLQAAVVMRIVDPQTA  190

Query  187  LGMLFK  192
            LG+L +
Sbjct  191  LGLLHR  196


 Score = 32.3 bits (72),  Expect = 0.71, Method: Compositional matrix adjust.
 Identities = 14/38 (37%), Positives = 25/38 (66%), Gaps = 0/38 (0%)

Query  376  AALIMQVLQLSDEQISQLPPEQRASILVLKEQIAKSTQ  413
            A L+MQV+QLS+  +  LP   R  I+ L++Q+ ++ +
Sbjct  299  AELLMQVMQLSEHDLQMLPAGDREKIIELRQQLKRNVK  336


>O45713_CAEEL unnamed protein product
Length=85

 Score = 75.1 bits (183),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 33/76 (43%), Positives = 51/76 (67%), Gaps = 0/76 (0%)

Query  17  SVFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQETALSAMRN  76
           SV+VGN P++ TE+ L   FS+ G V ++++V DRE+G+P+GF F E+ ++  A  A+  
Sbjct  5   SVYVGNAPFQTTEDDLGNYFSQAGNVSNVRIVCDRETGRPRGFAFVEFTEEAAAQRAVDQ  64

Query  77  LNGYEIGGRTLRVDNA  92
            NG +  GR LRV+ A
Sbjct  65  FNGVDFNGRALRVNLA  80



Lambda      K        H
   0.316    0.131    0.383 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1022168484


Query= XP_011197352.1 uncharacterized protein LOC105221908 isoform X1
[Bactrocera dorsalis]

Length=1214
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

WDS_DROME  unnamed protein product                                    84.7    4e-17
POC1_TETTS  unnamed protein product                                   79.7    8e-15
D6QUQ2_9CNID  unnamed protein product                                 78.2    1e-14


>WDS_DROME unnamed protein product
Length=361

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 88/353 (25%), Positives = 149/353 (42%), Gaps = 78/353 (22%)

Query  809   HTGAVWCMKFSSCGRLLATAGQDKVLRIWVLKDAYPFFQDMRTKYNADQKSSPTPSQESL  868
             HT AV  +KFS  G  LA++  DK+++IW   D          K+               
Sbjct  71    HTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDG---------KF---------------  106

Query  869   VSQHSEEAIAMAAAAEKCTGPFMPKAFCTYIGHTSDLLDVSWSKN-YFILSSSMDKTVRL  927
                  E+ I+                     GH   + DV+WS +   ++S S DKT+++
Sbjct  107   -----EKTIS---------------------GHKLGISDVAWSSDSRLLVSGSDDKTLKV  140

Query  928   WHISRKECLCCFQ-HIDFVTAIAFHPRDDRYFLSGSLDGKLRLWNIPDKKVALWNEVDGQ  986
             W +S  + L   + H ++V    F+P+ +   +SGS D  +R+W++   K      +   
Sbjct  141   WELSTGKSLKTLKGHSNYVFCCNFNPQSN-LIVSGSFDESVRIWDVRTGKCL--KTLPAH  197

Query  987   TKLITAANFCQNGQFAVVGSYDGRCIFYNTDQLKYHTQIHVRSTRGKNRIGRKISGIEPM  1046
             +  ++A +F ++G   V  SYDG C  ++T   +    +        +     +S ++  
Sbjct  198   SDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTL-------IDDDNPPVSFVKFS  250

Query  1047  PGEDKILVTSNDSRVRLYDLRDLNLSCKYKGYLNVSSQIKASFS-HDGKYIIAGSENQCI  1105
             P    IL  + D+ ++L+D         Y G+ N    I A+FS   GK+I++GSE+  +
Sbjct  251   PNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMV  310

Query  1106  YIWKTNHDYSKLSSVRRDRSDFWEGIKAHNATVTCAIFAPHP-EAIIKSEPDE  1157
             YIW                 +  + ++ H  TV C   A HP E II S   E
Sbjct  311   YIW------------NLQSKEVVQKLQGHTDTVLCT--ACHPTENIIASAALE  349


 Score = 39.7 bits (91),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 33/168 (20%), Positives = 74/168 (44%), Gaps = 24/168 (14%)

Query  1038  RKISGIEPMPGEDKILVTSNDSRVRLYDLRDLNLSCKYKGY-LNVSSQIKASFSHDGKYI  1096
             + +S ++  P  + +  +S D  ++++   D        G+ L +S     ++S D + +
Sbjct  73    KAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISD---VAWSSDSRLL  129

Query  1097  IAGSENQCIYIWKTNHDYSKLSSVRRDRSDFWEGIKAHNATVTCAIFAPHPEAIIKSEPD  1156
             ++GS+++ + +W+       LS+ +  ++     +K H+  V C  F P    I+    D
Sbjct  130   VSGSDDKTLKVWE-------LSTGKSLKT-----LKGHSNYVFCCNFNPQSNLIVSGSFD  177

Query  1157  E--------IGHSEKMQNHQPDPLVEQHKKGCGYVMVSADFNGAIKVF  1196
             E         G   K      DP+   H    G ++VS+ ++G  +++
Sbjct  178   ESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIW  225


>POC1_TETTS unnamed protein product
Length=634

 Score = 79.7 bits (195),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 75/316 (24%), Positives = 134/316 (42%), Gaps = 68/316 (22%)

Query  809   HTGAVWCMKFSSCGRLLATAGQDKVLRIWVLKDAYPFFQDMRTKYNADQKSSPTPSQESL  868
             H GAV+C+K+S  G  +A+ GQD+ +R+W                      +   S+ S+
Sbjct  88    HKGAVYCVKYSPDGETIASCGQDRQIRLW---------------------QNTVQSKCSI  126

Query  869   VSQHSEEAIAMAAAAEKCTGPFMPKAFCTYIGHTSDLLDVSWSKNYFILSSSMDKTVRLW  928
             +  H     +M+ +A+                              ++LSSS DKT++LW
Sbjct  127   IKAHCGAIRSMSFSADGG----------------------------YLLSSSDDKTLKLW  158

Query  929   HISRKECLCCFQ-HIDFVTAIAFHPRDDRYFLSGSLDGKLRLWNIPDKK-VALWNEVDGQ  986
              +  K+ +C F  H ++V +    P D R   SGS D  + LW++  +K V+ ++ +D  
Sbjct  159   RLQDKKFMCSFAGHKNWVRSGVISP-DMRLVASGSDDKTVMLWDLNFQKIVSKYSTLDDN  217

Query  987   TKLITAANFCQNGQFA--VVGSYDGRCIFYNTDQLKYHTQIHVRSTRGKNRIGR------  1038
              K+    ++  +      V+   DG C+  ++    +  +I +   R    I        
Sbjct  218   VKISQINSYSDHMDTVSQVLFHPDGTCLISSS----FDHKIKITDIRSNKLIQHYNAHDA  273

Query  1039  KISGIEPMPGEDKILVTSNDSRVRLYDLRDLNLSCKYKGYLNVSSQIKASFSHDGKYI-I  1097
             +++ I   P    +    +DS+++++DLR       Y  Y N        F+  G Y   
Sbjct  274   QVNSISIHPTGYFLASAGSDSKIKIWDLRQGRQI--YTLYSNDKDITTVQFNQSGDYFAT  331

Query  1098  AGSENQCIYIWKTNHD  1113
              GS+N C+ +WKTN D
Sbjct  332   GGSQNLCM-VWKTNFD  346


 Score = 31.2 bits (69),  Expect = 6.6, Method: Compositional matrix adjust.
 Identities = 21/92 (23%), Positives = 41/92 (45%), Gaps = 2/92 (2%)

Query  749  TVDKAKSLASEVSHARHKEDVADITDVMNPEANIKIKASSTNKGPYEFTKLQHVQDLYGE  808
            T+D    ++   S++ H + V+ +  + +P+    I +S  +K      +   +   Y  
Sbjct  213  TLDDNVKISQINSYSDHMDTVSQV--LFHPDGTCLISSSFDHKIKITDIRSNKLIQHYNA  270

Query  809  HTGAVWCMKFSSCGRLLATAGQDKVLRIWVLK  840
            H   V  +     G  LA+AG D  ++IW L+
Sbjct  271  HDAQVNSISIHPTGYFLASAGSDSKIKIWDLR  302


>D6QUQ2_9CNID unnamed protein product
Length=463

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 76/330 (23%), Positives = 146/330 (44%), Gaps = 36/330 (11%)

Query  806   YGEHTGAVWCMKFSSCGRLLATAGQDKVLRIWVLKDAYPFFQDMRTKYNADQKSSPT--P  863
             +  H  AV C+ F+   + L +   D  L ++  K   P  +  R   + D  +S +  P
Sbjct  14    FKGHRDAVTCLDFNPNMKQLVSGSMDSSLMVFHFK---PHMRAYRFVGHKDAITSVSFSP  70

Query  864   SQESLVSQHSEEAIAMAAAAEKCTGPFMPKAFCTYIGHTSDLLDVSWSKN-YFILSSSMD  922
             S   + S   ++ + +         P +      +  H + +  V +S++   +L+SS D
Sbjct  71    SGHLIASGSRDKTVRLWV-------PSVKGESTVFKAHMATVRSVDFSRDGQSLLTSSDD  123

Query  923   KTVRLWHISRKEC-LCCFQHIDFVTAIAFHPRDDRYFLSGSLDGKLRLWNIPDKKVA-LW  980
             K+++LW + R++       H+++V    F P D R  +S S D  ++LW+   K+    +
Sbjct  124   KSLKLWAVHRQKFQFSLTGHMNWVRCARFSP-DGRLIVSASDDKSIKLWDRTSKECTHTF  182

Query  981   NEVDGQTKLITAANFCQNGQFAVVGSYDGRCIFYNT--DQLKYHTQIHVRSTRGKNRIGR  1038
              E  G    +    F  NG     G  D     ++   ++L  H Q+H          G 
Sbjct  183   YEYGG---FVNHVEFHPNGTCIAAGGSDNTVKVWDIRMNKLLQHYQVH----------GG  229

Query  1039  KISGIEPMPGEDKILVTSNDSRVRLYDLRDLNLSCKYKGYLNVSSQIKASFSHDGKYIIA  1098
              ++ +   P  + ++  S D+ +++ DL +  L     G+   ++ +K  FS +G+Y  +
Sbjct  230   AVNSLSFHPSGNYLVSASADNTLKILDLMEGRLFYTLHGHQGGANCVK--FSRNGEYFAS  287

Query  1099  GSENQCIYIWKTNH---DYSKLSSVRRDRS  1125
             GS ++ + +WKTN    DYS++    R RS
Sbjct  288   GSSDEQVMVWKTNFDTIDYSQVLHAHRKRS  317


 Score = 60.5 bits (145),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 55/233 (24%), Positives = 106/233 (45%), Gaps = 19/233 (8%)

Query  805   LYGEHTGAVWCMKFSSCGRLLATAGQDKVLRIW-VLKDAYPFFQDMRTKYNADQKSSPTP  863
             ++  H   V  + FS  G+ L T+  DK L++W V +  + F   +    N  + +  +P
Sbjct  97    VFKAHMATVRSVDFSRDGQSLLTSSDDKSLKLWAVHRQKFQF--SLTGHMNWVRCARFSP  154

Query  864   SQESLVSQHSEEAIAMA-AAAEKCTGPFMPKAFCTYIGHTSDLLDVSWSKN-YFILSSSM  921
                 +VS   +++I +    +++CT  F    +  ++ H      V +  N   I +   
Sbjct  155   DGRLIVSASDDKSIKLWDRTSKECTHTFY--EYGGFVNH------VEFHPNGTCIAAGGS  206

Query  922   DKTVRLWHISRKECLCCFQ-HIDFVTAIAFHPRDDRYFLSGSLDGKLRLWNIPDKKVALW  980
             D TV++W I   + L  +Q H   V +++FHP  + Y +S S D  L++ ++ + +  L+
Sbjct  207   DNTVKVWDIRMNKLLQHYQVHGGAVNSLSFHPSGN-YLVSASADNTLKILDLMEGR--LF  263

Query  981   NEVDGQTKLITAANFCQNGQFAVVGSYDGRCIFY--NTDQLKYHTQIHVRSTR  1031
               + G         F +NG++   GS D + + +  N D + Y   +H    R
Sbjct  264   YTLHGHQGGANCVKFSRNGEYFASGSSDEQVMVWKTNFDTIDYSQVLHAHRKR  316


 Score = 42.7 bits (99),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 41/182 (23%), Positives = 73/182 (40%), Gaps = 26/182 (14%)

Query  978   ALWNEVDGQTKLITAANFCQNGQFAVVGSYDGRCIFYNTDQLKYHTQIHVRSTRGKNRIG  1037
             +L     G    +T  +F  N +  V GS D       +  + +H + H+R+ R    +G
Sbjct  9     SLERHFKGHRDAVTCLDFNPNMKQLVSGSMD-------SSLMVFHFKPHMRAYR---FVG  58

Query  1038  RK--ISGIEPMPGEDKILVTSNDSRVRLYDLRDLNLSCKYKGYLNVSSQIKASFSHDGKY  1095
              K  I+ +   P    I   S D  VRL+       S  +K ++     +   FS DG+ 
Sbjct  59    HKDAITSVSFSPSGHLIASGSRDKTVRLWVPSVKGESTVFKAHMATVRSV--DFSRDGQS  116

Query  1096  IIAGSENQCIYIWKTNHDYSKLSSVRRDRSDFWEGIKAHNATVTCAIFAPHPEAIIKSEP  1155
             ++  S+++ + +W  +            R  F   +  H   V CA F+P    I+ +  
Sbjct  117   LLTSSDDKSLKLWAVH------------RQKFQFSLTGHMNWVRCARFSPDGRLIVSASD  164

Query  1156  DE  1157
             D+
Sbjct  165   DK  166



Lambda      K        H
   0.316    0.131    0.383 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1022168484


Query= XP_011197353.1 uncharacterized protein LOC105221908 isoform X2
[Bactrocera dorsalis]

Length=1206
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

WDS_DROME  unnamed protein product                                    84.7    4e-17
POC1_TETTS  unnamed protein product                                   79.7    8e-15
WDR51_CAEEL  unnamed protein product                                  77.4    1e-14


>WDS_DROME unnamed protein product
Length=361

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 90/353 (25%), Positives = 148/353 (42%), Gaps = 78/353 (22%)

Query  801   HTGAVWCMKFSSCGRLLATAGQDKVLRIWVLKDAYPFFQDMRTKYNADQKSSPTPSQESL  860
             HT AV  +KFS  G  LA++  DK+++IW    AY            D K   T S    
Sbjct  71    HTKAVSAVKFSPNGEWLASSSADKLIKIW---GAY------------DGKFEKTIS----  111

Query  861   VSQHSEEAIAMAAAAEKCTGPFMPKAFCTYIGHTSDLLDVSWSKN-YFILSSSMDKTVRL  919
                                            GH   + DV+WS +   ++S S DKT+++
Sbjct  112   -------------------------------GHKLGISDVAWSSDSRLLVSGSDDKTLKV  140

Query  920   WHISRKECLCCFQ-HIDFVTAIAFHPRDDRYFLSGSLDGKLRLWNIPDKKVALWNEVDGQ  978
             W +S  + L   + H ++V    F+P+ +   +SGS D  +R+W++   K      +   
Sbjct  141   WELSTGKSLKTLKGHSNYVFCCNFNPQSN-LIVSGSFDESVRIWDVRTGKCL--KTLPAH  197

Query  979   TKLITAANFCQNGQFAVVGSYDGRCIFYNTDQLKYHTQIHVRSTRGKNRIGRKISGIEPM  1038
             +  ++A +F ++G   V  SYDG C  ++T   +    +        +     +S ++  
Sbjct  198   SDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTL-------IDDDNPPVSFVKFS  250

Query  1039  PGEDKILVTSNDSRVRLYDLRDLNLSCKYKGYLNVSSQIKASFS-HDGKYIIAGSENQCI  1097
             P    IL  + D+ ++L+D         Y G+ N    I A+FS   GK+I++GSE+  +
Sbjct  251   PNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMV  310

Query  1098  YIWKTNHDYSKLSSVRRDRSDFWEGIKAHNATVTCAIFAPHP-EAIIKSEPDE  1149
             YIW                 +  + ++ H  TV C   A HP E II S   E
Sbjct  311   YIW------------NLQSKEVVQKLQGHTDTVLCT--ACHPTENIIASAALE  349


 Score = 39.7 bits (91),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 33/168 (20%), Positives = 74/168 (44%), Gaps = 24/168 (14%)

Query  1030  RKISGIEPMPGEDKILVTSNDSRVRLYDLRDLNLSCKYKGY-LNVSSQIKASFSHDGKYI  1088
             + +S ++  P  + +  +S D  ++++   D        G+ L +S     ++S D + +
Sbjct  73    KAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISD---VAWSSDSRLL  129

Query  1089  IAGSENQCIYIWKTNHDYSKLSSVRRDRSDFWEGIKAHNATVTCAIFAPHPEAIIKSEPD  1148
             ++GS+++ + +W+       LS+ +  ++     +K H+  V C  F P    I+    D
Sbjct  130   VSGSDDKTLKVWE-------LSTGKSLKT-----LKGHSNYVFCCNFNPQSNLIVSGSFD  177

Query  1149  E--------IGHSEKMQNHQPDPLVEQHKKGCGYVMVSADFNGAIKVF  1188
             E         G   K      DP+   H    G ++VS+ ++G  +++
Sbjct  178   ESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIW  225


>POC1_TETTS unnamed protein product
Length=634

 Score = 79.7 bits (195),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 75/316 (24%), Positives = 134/316 (42%), Gaps = 68/316 (22%)

Query  801   HTGAVWCMKFSSCGRLLATAGQDKVLRIWVLKDAYPFFQDMRTKYNADQKSSPTPSQESL  860
             H GAV+C+K+S  G  +A+ GQD+ +R+W                      +   S+ S+
Sbjct  88    HKGAVYCVKYSPDGETIASCGQDRQIRLW---------------------QNTVQSKCSI  126

Query  861   VSQHSEEAIAMAAAAEKCTGPFMPKAFCTYIGHTSDLLDVSWSKNYFILSSSMDKTVRLW  920
             +  H     +M+ +A+                              ++LSSS DKT++LW
Sbjct  127   IKAHCGAIRSMSFSADGG----------------------------YLLSSSDDKTLKLW  158

Query  921   HISRKECLCCFQ-HIDFVTAIAFHPRDDRYFLSGSLDGKLRLWNIPDKK-VALWNEVDGQ  978
              +  K+ +C F  H ++V +    P D R   SGS D  + LW++  +K V+ ++ +D  
Sbjct  159   RLQDKKFMCSFAGHKNWVRSGVISP-DMRLVASGSDDKTVMLWDLNFQKIVSKYSTLDDN  217

Query  979   TKLITAANFCQNGQFA--VVGSYDGRCIFYNTDQLKYHTQIHVRSTRGKNRIGR------  1030
              K+    ++  +      V+   DG C+  ++    +  +I +   R    I        
Sbjct  218   VKISQINSYSDHMDTVSQVLFHPDGTCLISSS----FDHKIKITDIRSNKLIQHYNAHDA  273

Query  1031  KISGIEPMPGEDKILVTSNDSRVRLYDLRDLNLSCKYKGYLNVSSQIKASFSHDGKYI-I  1089
             +++ I   P    +    +DS+++++DLR       Y  Y N        F+  G Y   
Sbjct  274   QVNSISIHPTGYFLASAGSDSKIKIWDLRQGRQI--YTLYSNDKDITTVQFNQSGDYFAT  331

Query  1090  AGSENQCIYIWKTNHD  1105
              GS+N C+ +WKTN D
Sbjct  332   GGSQNLCM-VWKTNFD  346


 Score = 31.2 bits (69),  Expect = 6.5, Method: Compositional matrix adjust.
 Identities = 21/92 (23%), Positives = 41/92 (45%), Gaps = 2/92 (2%)

Query  741  TVDKAKSLASEVSHARHKEDVADITDVMNPEANIKIKASSTNKGPYEFTKLQHVQDLYGE  800
            T+D    ++   S++ H + V+ +  + +P+    I +S  +K      +   +   Y  
Sbjct  213  TLDDNVKISQINSYSDHMDTVSQV--LFHPDGTCLISSSFDHKIKITDIRSNKLIQHYNA  270

Query  801  HTGAVWCMKFSSCGRLLATAGQDKVLRIWVLK  832
            H   V  +     G  LA+AG D  ++IW L+
Sbjct  271  HDAQVNSISIHPTGYFLASAGSDSKIKIWDLR  302


>WDR51_CAEEL unnamed protein product
Length=376

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 74/303 (24%), Positives = 130/303 (43%), Gaps = 63/303 (21%)

Query  801   HTGAVWCMKFSSCGRLLATAGQDKVLRIWVLKDAYPFFQDMRTKYNADQKSSPTPSQESL  860
             HT ++   KFS CG+ L T+  DK ++IW                N D           +
Sbjct  86    HTKSISSAKFSPCGKYLGTSSADKTVKIW----------------NMDH----------M  119

Query  861   VSQHSEEAIAMAAAAEKCTGPFMPKAFCTYIGHTSDLLDVSWSKN-YFILSSSMDKTVRL  919
             + +                         T  GH   + D++WS +   ++S+S DKT+++
Sbjct  120   ICER------------------------TLTGHKLGVNDIAWSSDSRCVVSASDDKTLKI  155

Query  920   WHISRKECLCCFQ-HIDFVTAIAFHPRDDRYFLSGSLDGKLRLWNIPDKKVALWNEVDGQ  978
             + I         + H ++V    F+P+     +SGS D  +R+W++  K       +   
Sbjct  156   FEIVTSRMTKTLKGHNNYVFCCNFNPQS-SLVVSGSFDESVRIWDV--KTGMCIKTLPAH  212

Query  979   TKLITAANFCQNGQFAVVGSYDGRCIFYNTDQLKYHTQIHVRSTRGKNRIGRKISGIEPM  1038
             +  ++A +F ++G     GSYDG    ++T     + Q        +N     ++ ++  
Sbjct  213   SDPVSAVSFNRDGSLIASGSYDGLVRIWDT----ANGQCIKTLVDDENP---PVAFVKFS  265

Query  1039  PGEDKILVTSNDSRVRLYDLRDLNLSCKYKGYLNVSSQIKASFS-HDGKYIIAGSENQCI  1097
             P    IL ++ DS ++L+D        +Y G+ N    I A+FS   GK+II+GSE+  I
Sbjct  266   PNGKYILASNLDSTLKLWDFSKGKTLKQYTGHENSKYCIFANFSVTGGKWIISGSEDCKI  325

Query  1098  YIW  1100
             YIW
Sbjct  326   YIW  328


 Score = 42.7 bits (99),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 46/213 (22%), Positives = 97/213 (46%), Gaps = 30/213 (14%)

Query  786  YEFTKLQHVQDLYGEHTGAVWCMKFSSCGRLLATAGQDKVLRIWVLKDAYPFFQDMRTKY  845
            +E    +  + L G H   V+C  F+    L+ +   D+ +RIW +K             
Sbjct  156  FEIVTSRMTKTLKG-HNNYVFCCNFNPQSSLVVSGSFDESVRIWDVKTGMCI---KTLPA  211

Query  846  NADQKSSPTPSQE-SLVSQHSEEAIA--MAAAAEKCTGPFM-----PKAFCTYIGHTSDL  897
            ++D  S+ + +++ SL++  S + +      A  +C    +     P AF          
Sbjct  212  HSDPVSAVSFNRDGSLIASGSYDGLVRIWDTANGQCIKTLVDDENPPVAF----------  261

Query  898  LDVSWSKN-YFILSSSMDKTVRLWHISRKECLCCF---QHIDFVTAIAFHPRDDRYFLSG  953
              V +S N  +IL+S++D T++LW  S+ + L  +   ++  +     F     ++ +SG
Sbjct  262  --VKFSPNGKYILASNLDSTLKLWDFSKGKTLKQYTGHENSKYCIFANFSVTGGKWIISG  319

Query  954  SLDGKLRLWNIPDKKVALWNEVDGQTKLITAAN  986
            S D K+ +WN+  +++     ++G T+ + A++
Sbjct  320  SEDCKIYIWNLQTREIV--QCLEGHTQPVLASD  350


 Score = 33.5 bits (75),  Expect = 1.00, Method: Compositional matrix adjust.
 Identities = 38/178 (21%), Positives = 71/178 (40%), Gaps = 18/178 (10%)

Query  928   LCCFQ-HIDFVTAIAFHPRDDRYFLSGSLDGKLRLWNIPDKKVALWNEVDGQTKLITAAN  986
             +C  + H   +++  F P   +Y  + S D  +++WN+ D  +          + +T   
Sbjct  80    MCTLEGHTKSISSAKFSPCG-KYLGTSSADKTVKIWNM-DHMIC--------ERTLTGHK  129

Query  987   FCQNGQFAVVGSYDGRCIFYNTDQ--LKYHTQIHVRSTRGKNRIGRKISGIEPMPGEDKI  1044
                 G   +  S D RC+   +D   LK    +  R T+        +      P    +
Sbjct  130   L---GVNDIAWSSDSRCVVSASDDKTLKIFEIVTSRMTKTLKGHNNYVFCCNFNPQSSLV  186

Query  1045  LVTSNDSRVRLYDLRDLNLSCKYKGYLNVSSQIKASFSHDGKYIIAGSENQCIYIWKT  1102
             +  S D  VR++D++          + +  S +  SF+ DG  I +GS +  + IW T
Sbjct  187   VSGSFDESVRIWDVKTGMCIKTLPAHSDPVSAV--SFNRDGSLIASGSYDGLVRIWDT  242



Lambda      K        H
   0.316    0.131    0.383 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1022168484


Query= XP_011197354.1 uncharacterized protein LOC105221908 isoform X3
[Bactrocera dorsalis]

Length=1195
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

WDS_DROME  unnamed protein product                                    85.1    4e-17
POC1_TETTS  unnamed protein product                                   79.3    9e-15
WDR51_CAEEL  unnamed protein product                                  77.4    1e-14


>WDS_DROME unnamed protein product
Length=361

 Score = 85.1 bits (209),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 90/353 (25%), Positives = 148/353 (42%), Gaps = 78/353 (22%)

Query  790   HTGAVWCMKFSSCGRLLATAGQDKVLRIWVLKDAYPFFQDMRTKYNADQKSSPTPSQESL  849
             HT AV  +KFS  G  LA++  DK+++IW    AY            D K   T S    
Sbjct  71    HTKAVSAVKFSPNGEWLASSSADKLIKIW---GAY------------DGKFEKTIS----  111

Query  850   VSQHSEEAIAMAAAAEKCTGPFMPKAFCTYIGHTSDLLDVSWSKN-YFILSSSMDKTVRL  908
                                            GH   + DV+WS +   ++S S DKT+++
Sbjct  112   -------------------------------GHKLGISDVAWSSDSRLLVSGSDDKTLKV  140

Query  909   WHISRKECLCCFQ-HIDFVTAIAFHPRDDRYFLSGSLDGKLRLWNIPDKKVALWNEVDGQ  967
             W +S  + L   + H ++V    F+P+ +   +SGS D  +R+W++   K      +   
Sbjct  141   WELSTGKSLKTLKGHSNYVFCCNFNPQSN-LIVSGSFDESVRIWDVRTGKCL--KTLPAH  197

Query  968   TKLITAANFCQNGQFAVVGSYDGRCIFYNTDQLKYHTQIHVRSTRGKNRIGRKISGIEPM  1027
             +  ++A +F ++G   V  SYDG C  ++T   +    +        +     +S ++  
Sbjct  198   SDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTL-------IDDDNPPVSFVKFS  250

Query  1028  PGEDKILVTSNDSRVRLYDLRDLNLSCKYKGYLNVSSQIKASFS-HDGKYIIAGSENQCI  1086
             P    IL  + D+ ++L+D         Y G+ N    I A+FS   GK+I++GSE+  +
Sbjct  251   PNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMV  310

Query  1087  YIWKTNHDYSKLSSVRRDRSDFWEGIKAHNATVTCAIFAPHP-EAIIKSEPDE  1138
             YIW                 +  + ++ H  TV C   A HP E II S   E
Sbjct  311   YIW------------NLQSKEVVQKLQGHTDTVLCT--ACHPTENIIASAALE  349


 Score = 39.7 bits (91),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 33/168 (20%), Positives = 74/168 (44%), Gaps = 24/168 (14%)

Query  1019  RKISGIEPMPGEDKILVTSNDSRVRLYDLRDLNLSCKYKGY-LNVSSQIKASFSHDGKYI  1077
             + +S ++  P  + +  +S D  ++++   D        G+ L +S     ++S D + +
Sbjct  73    KAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISD---VAWSSDSRLL  129

Query  1078  IAGSENQCIYIWKTNHDYSKLSSVRRDRSDFWEGIKAHNATVTCAIFAPHPEAIIKSEPD  1137
             ++GS+++ + +W+       LS+ +  ++     +K H+  V C  F P    I+    D
Sbjct  130   VSGSDDKTLKVWE-------LSTGKSLKT-----LKGHSNYVFCCNFNPQSNLIVSGSFD  177

Query  1138  E--------IGHSEKMQNHQPDPLVEQHKKGCGYVMVSADFNGAIKVF  1177
             E         G   K      DP+   H    G ++VS+ ++G  +++
Sbjct  178   ESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIW  225


>POC1_TETTS unnamed protein product
Length=634

 Score = 79.3 bits (194),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 75/316 (24%), Positives = 134/316 (42%), Gaps = 68/316 (22%)

Query  790   HTGAVWCMKFSSCGRLLATAGQDKVLRIWVLKDAYPFFQDMRTKYNADQKSSPTPSQESL  849
             H GAV+C+K+S  G  +A+ GQD+ +R+W                      +   S+ S+
Sbjct  88    HKGAVYCVKYSPDGETIASCGQDRQIRLW---------------------QNTVQSKCSI  126

Query  850   VSQHSEEAIAMAAAAEKCTGPFMPKAFCTYIGHTSDLLDVSWSKNYFILSSSMDKTVRLW  909
             +  H     +M+ +A+                              ++LSSS DKT++LW
Sbjct  127   IKAHCGAIRSMSFSADGG----------------------------YLLSSSDDKTLKLW  158

Query  910   HISRKECLCCFQ-HIDFVTAIAFHPRDDRYFLSGSLDGKLRLWNIPDKK-VALWNEVDGQ  967
              +  K+ +C F  H ++V +    P D R   SGS D  + LW++  +K V+ ++ +D  
Sbjct  159   RLQDKKFMCSFAGHKNWVRSGVISP-DMRLVASGSDDKTVMLWDLNFQKIVSKYSTLDDN  217

Query  968   TKLITAANFCQNGQFA--VVGSYDGRCIFYNTDQLKYHTQIHVRSTRGKNRIGR------  1019
              K+    ++  +      V+   DG C+  ++    +  +I +   R    I        
Sbjct  218   VKISQINSYSDHMDTVSQVLFHPDGTCLISSS----FDHKIKITDIRSNKLIQHYNAHDA  273

Query  1020  KISGIEPMPGEDKILVTSNDSRVRLYDLRDLNLSCKYKGYLNVSSQIKASFSHDGKYI-I  1078
             +++ I   P    +    +DS+++++DLR       Y  Y N        F+  G Y   
Sbjct  274   QVNSISIHPTGYFLASAGSDSKIKIWDLRQGRQI--YTLYSNDKDITTVQFNQSGDYFAT  331

Query  1079  AGSENQCIYIWKTNHD  1094
              GS+N C+ +WKTN D
Sbjct  332   GGSQNLCM-VWKTNFD  346


 Score = 31.2 bits (69),  Expect = 6.9, Method: Compositional matrix adjust.
 Identities = 21/92 (23%), Positives = 41/92 (45%), Gaps = 2/92 (2%)

Query  730  TVDKAKSLASEVSHARHKEDVADITDVMNPEANIKIKASSTNKGPYEFTKLQHVQDLYGE  789
            T+D    ++   S++ H + V+ +  + +P+    I +S  +K      +   +   Y  
Sbjct  213  TLDDNVKISQINSYSDHMDTVSQV--LFHPDGTCLISSSFDHKIKITDIRSNKLIQHYNA  270

Query  790  HTGAVWCMKFSSCGRLLATAGQDKVLRIWVLK  821
            H   V  +     G  LA+AG D  ++IW L+
Sbjct  271  HDAQVNSISIHPTGYFLASAGSDSKIKIWDLR  302


>WDR51_CAEEL unnamed protein product
Length=376

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 74/303 (24%), Positives = 130/303 (43%), Gaps = 63/303 (21%)

Query  790   HTGAVWCMKFSSCGRLLATAGQDKVLRIWVLKDAYPFFQDMRTKYNADQKSSPTPSQESL  849
             HT ++   KFS CG+ L T+  DK ++IW                N D           +
Sbjct  86    HTKSISSAKFSPCGKYLGTSSADKTVKIW----------------NMDH----------M  119

Query  850   VSQHSEEAIAMAAAAEKCTGPFMPKAFCTYIGHTSDLLDVSWSKN-YFILSSSMDKTVRL  908
             + +                         T  GH   + D++WS +   ++S+S DKT+++
Sbjct  120   ICER------------------------TLTGHKLGVNDIAWSSDSRCVVSASDDKTLKI  155

Query  909   WHISRKECLCCFQ-HIDFVTAIAFHPRDDRYFLSGSLDGKLRLWNIPDKKVALWNEVDGQ  967
             + I         + H ++V    F+P+     +SGS D  +R+W++  K       +   
Sbjct  156   FEIVTSRMTKTLKGHNNYVFCCNFNPQS-SLVVSGSFDESVRIWDV--KTGMCIKTLPAH  212

Query  968   TKLITAANFCQNGQFAVVGSYDGRCIFYNTDQLKYHTQIHVRSTRGKNRIGRKISGIEPM  1027
             +  ++A +F ++G     GSYDG    ++T     + Q        +N     ++ ++  
Sbjct  213   SDPVSAVSFNRDGSLIASGSYDGLVRIWDT----ANGQCIKTLVDDENP---PVAFVKFS  265

Query  1028  PGEDKILVTSNDSRVRLYDLRDLNLSCKYKGYLNVSSQIKASFS-HDGKYIIAGSENQCI  1086
             P    IL ++ DS ++L+D        +Y G+ N    I A+FS   GK+II+GSE+  I
Sbjct  266   PNGKYILASNLDSTLKLWDFSKGKTLKQYTGHENSKYCIFANFSVTGGKWIISGSEDCKI  325

Query  1087  YIW  1089
             YIW
Sbjct  326   YIW  328


 Score = 42.7 bits (99),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 46/213 (22%), Positives = 97/213 (46%), Gaps = 30/213 (14%)

Query  775  YEFTKLQHVQDLYGEHTGAVWCMKFSSCGRLLATAGQDKVLRIWVLKDAYPFFQDMRTKY  834
            +E    +  + L G H   V+C  F+    L+ +   D+ +RIW +K             
Sbjct  156  FEIVTSRMTKTLKG-HNNYVFCCNFNPQSSLVVSGSFDESVRIWDVKTGMCI---KTLPA  211

Query  835  NADQKSSPTPSQE-SLVSQHSEEAIA--MAAAAEKCTGPFM-----PKAFCTYIGHTSDL  886
            ++D  S+ + +++ SL++  S + +      A  +C    +     P AF          
Sbjct  212  HSDPVSAVSFNRDGSLIASGSYDGLVRIWDTANGQCIKTLVDDENPPVAF----------  261

Query  887  LDVSWSKN-YFILSSSMDKTVRLWHISRKECLCCF---QHIDFVTAIAFHPRDDRYFLSG  942
              V +S N  +IL+S++D T++LW  S+ + L  +   ++  +     F     ++ +SG
Sbjct  262  --VKFSPNGKYILASNLDSTLKLWDFSKGKTLKQYTGHENSKYCIFANFSVTGGKWIISG  319

Query  943  SLDGKLRLWNIPDKKVALWNEVDGQTKLITAAN  975
            S D K+ +WN+  +++     ++G T+ + A++
Sbjct  320  SEDCKIYIWNLQTREIV--QCLEGHTQPVLASD  350


 Score = 33.9 bits (76),  Expect = 0.90, Method: Compositional matrix adjust.
 Identities = 38/178 (21%), Positives = 71/178 (40%), Gaps = 18/178 (10%)

Query  917   LCCFQ-HIDFVTAIAFHPRDDRYFLSGSLDGKLRLWNIPDKKVALWNEVDGQTKLITAAN  975
             +C  + H   +++  F P   +Y  + S D  +++WN+ D  +          + +T   
Sbjct  80    MCTLEGHTKSISSAKFSPCG-KYLGTSSADKTVKIWNM-DHMIC--------ERTLTGHK  129

Query  976   FCQNGQFAVVGSYDGRCIFYNTDQ--LKYHTQIHVRSTRGKNRIGRKISGIEPMPGEDKI  1033
                 G   +  S D RC+   +D   LK    +  R T+        +      P    +
Sbjct  130   L---GVNDIAWSSDSRCVVSASDDKTLKIFEIVTSRMTKTLKGHNNYVFCCNFNPQSSLV  186

Query  1034  LVTSNDSRVRLYDLRDLNLSCKYKGYLNVSSQIKASFSHDGKYIIAGSENQCIYIWKT  1091
             +  S D  VR++D++          + +  S +  SF+ DG  I +GS +  + IW T
Sbjct  187   VSGSFDESVRIWDVKTGMCIKTLPAHSDPVSAV--SFNRDGSLIASGSYDGLVRIWDT  242



Lambda      K        H
   0.316    0.131    0.383 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1022168484


Query= XP_011197356.1 transcriptional adapter 2B isoform X1 [Bactrocera
dorsalis]

Length=558
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TAD2B_DROME  unnamed protein product                                  748     0.0  
Q8IJP9_PLAF7  unnamed protein product                                 114     4e-26
TAD2A_DROME  unnamed protein product                                  99.4    9e-22


>TAD2B_DROME unnamed protein product
Length=555

 Score = 748 bits (1932),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/559 (69%), Positives = 434/559 (78%), Gaps = 5/559 (1%)

Query  1    MTSIGDLFTKYNCTNCQDDISGIRVHCAECENFDLCLQCFASGAEIGTHQNNHAYQFMDT  60
            MT+I DLFTKYNCTNCQDDI GIRVHCAECENFDLCLQCFA+GAEIG HQNNH+YQFMDT
Sbjct  1    MTTIADLFTKYNCTNCQDDIQGIRVHCAECENFDLCLQCFAAGAEIGAHQNNHSYQFMDT  60

Query  61   GTAILSVFRGKGAWTAREEIRLLDAIEQYGFGNWEDISKHIETKSAEDAKEEYVKRFVNG  120
            GT+ILSVFRGKGAWTAREEIRLLDAIEQYGFGNWEDISKHIETKSAEDAKEEYV +FVNG
Sbjct  61   GTSILSVFRGKGAWTAREEIRLLDAIEQYGFGNWEDISKHIETKSAEDAKEEYVNKFVNG  120

Query  121  AIGLHTWTPAQSQRPLLVDHTSED-VGPLGATALQRLPPLDITNEEAAQLGYMPNRDGFE  179
             IG  TWTPAQSQRP L+DHT +D  GPLG  AL  LPPL+I ++EA QLGYMPNRD FE
Sbjct  121  TIGRATWTPAQSQRPRLIDHTGDDDAGPLGTNALSTLPPLEINSDEAMQLGYMPNRDSFE  180

Query  180  REYDPTAEQLISTMSLSTEDTEADYLLKLAHVDMYTRRLRERVRRKRLVRDYQLVANFFR  239
            REYDPTAEQLIS +SLS+EDTE D +LKLAHVD+YTRRLRER RRKR+VRDYQLV+NFFR
Sbjct  181  REYDPTAEQLISNISLSSEDTEVDVMLKLAHVDIYTRRLRERARRKRMVRDYQLVSNFFR  240

Query  240  NRNYAQHPGMTREQKEFRDRFRVFAQFYTSNEYERLLMSLEREKELRIRLAELCRYRYNG  299
            NRNYAQ  G+T+EQ+EFRDRFRV+AQFYT NEYERLL SLEREKELRIR +EL RYRYNG
Sbjct  241  NRNYAQQQGLTKEQREFRDRFRVYAQFYTCNEYERLLGSLEREKELRIRQSELYRYRYNG  300

Query  300  LTKIDECRHFEQHAAMSLNRSTGPYGHGKTDNTHLSIGSRRQLGSSLHSPQHSSRKPELS  359
            LTKI EC HFEQHAA + +RSTGPYGHGKTD+TH S GS R   SSLHSPQ + RK E+S
Sbjct  301  LTKIAECTHFEQHAATATHRSTGPYGHGKTDHTHTSNGSHRPPSSSLHSPQPNLRKVEMS  360

Query  360  NGGEAHLNSIASRNTLHTGDLTSSGALLHNRNYLDSCRESSVHTTISQAGMIVGAGTMST  419
            +GGEA  NSIA RNTLH  D T SGALL ++NYLDSCR SS  T +   GM++G    S 
Sbjct  361  SGGEASSNSIAPRNTLHIADPTCSGALLPSKNYLDSCRGSSAATMLQTTGMVMGVTVDSG  420

Query  420  TKLTNGNPQPLIPIQQYTTTMGVKNQQTPQLQINDVAVNEKQHLQQLLLQENNNLDIKTL  479
                  +    +      +  G +    P  Q   +  +  QH  Q       +  + + 
Sbjct  421  ATTGVTSTATTMANLPTNSAKGSQQHLQPLQQHPQLLQSGNQHKMQNEAAGGGSDQVPS-  479

Query  480  PMSSILRAQLDELKHLPQPLGTDLLSTNEQQVCKDFNLPPTTYLSLKTCLLSGAPVVNNL  539
             MS  LR QL+ELKHLPQP G++LLS NE  +CK  N+ PTTYLS+KT  LSGAP +   
Sbjct  480  -MSLKLRTQLEELKHLPQPPGSELLSHNELDLCKKHNITPTTYLSVKTVCLSGAPSLG--  536

Query  540  SPVENSLRKYFVKVGWLSH  558
            SP+E SLRK+F+K GWLSH
Sbjct  537  SPMETSLRKFFIKCGWLSH  555


>Q8IJP9_PLAF7 unnamed protein product
Length=2578

 Score = 114 bits (284),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 95/326 (29%), Positives = 154/326 (47%), Gaps = 37/326 (11%)

Query  6     DLF-TKYNCTNCQDDIS-GIRVHCAECENFDLCLQCFASGAEIGT----HQNNHAYQFMD  59
             D+F + Y+C  C  DI+  IR+ CAEC +FDLC+ CF++G E+ +    H N H Y  + 
Sbjct  1521  DIFDSNYHCDICNKDITHTIRIRCAECVDFDLCVNCFSTGKEMKSDKCEHYNYHNYIPIP  1580

Query  60    TGTAILSVFRGKGAWTAREEIRLLDAIEQYGFGNWEDISKHIE-----TKSAEDAKEEYV  114
                  L     K  W+A EE+ LLD I ++GFGNWE ++  +      TK+  + +  Y 
Sbjct  1581  KYDFPLY----KLNWSAEEELLLLDGISKFGFGNWEQVADLVNSVANITKTDRECESHYY  1636

Query  115   KRFVNGAIGLHTWTPAQSQRPLLV---------DHTSE-DVGPLGATALQRLPPLDITNE  164
               ++          P    + LL+         +H  E D+       L    P    N 
Sbjct  1637  NFYLKS-----NCAPLPDNKRLLIKPDGNPYEIEHVVEKDINDNDDYVL----PKSKKNN  1687

Query  165   EAAQLGYMPNRDGFEREYDPTAEQLISTMSLSTEDTEADYLLKLAHVDMYTRRLRERVRR  224
                 +GY P R  F+ EYD  AE L++ M     D      LKL  +++Y  +L ER+ R
Sbjct  1688  RTQIIGYWPLRGDFDIEYDNDAELLLADMEFKESDLPQQKELKLQVLEIYNSKLDERIYR  1747

Query  225   KRLVRDYQLVANFFRNRNYAQHPGMTREQKEFRDRFRVFAQFYTSNEYERLLMSLEREKE  284
             KR V +  L+ +        +    T+E+KE     +  ++F++   +E  +  L  E++
Sbjct  1748  KRTVIERGLLDS---KAQMQKEKKRTKEEKELYAALKPLSRFHSPQHHEYFIQLLLEEQK  1804

Query  285   LRIRLAELCRYRYNGLTKIDECRHFE  310
             LR RL +L  ++  GL  I++ + +E
Sbjct  1805  LRQRLTKLQEWKALGLQNIEQVQEYE  1830


>TAD2A_DROME unnamed protein product
Length=562

 Score = 99.4 bits (246),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 70/242 (29%), Positives = 114/242 (47%), Gaps = 33/242 (14%)

Query  13   CTNCQDDISGIRVHCAECENFDLCLQCFASGAEIGTHQNNHAYQFMDTGTAILSVFRGKG  72
            C  C+  ++   + C+EC +  LCLQCF+ G E  +H+NNHAY  +      + VF  + 
Sbjct  96   CATCRCSLTEPYIKCSECLDTLLCLQCFSRGKEAFSHRNNHAYIIVRDN---IQVFADEP  152

Query  73   AWTAREEIRLLDAIEQYGFGNWEDISKHIETK-SAEDAKEEYVKRFVNGAIGLHTWTPAQ  131
             WTAR+E  LL  +  +G+GNWE +S+ ++ +    + +  Y   +  G           
Sbjct  153  HWTARDERILLKTLRTHGYGNWEAVSQALDQRHEPAEVRRHYHDCYFGGIF---------  203

Query  132  SQRPLLVDHTSEDVGPLGATALQRLPPLDIT-NEEAAQL------GYMPNRDGFEREYDP  184
             +R L + H  +   P     + ++  LD   +++ A +      GY   R  F+  YD 
Sbjct  204  -ERLLNLKHARDSYVPERMPYVFKMRSLDPPRHDDIASMQFRLSAGYRCARGDFDTPYDT  262

Query  185  TAEQLISTM------------SLSTEDTEADYLLKLAHVDMYTRRLRERVRRKRLVRDYQ  232
            +AE L+S M            S S  + E    L+L  V  Y  RLRER RR +++R + 
Sbjct  263  SAESLLSIMVDHRGRDDDNEASESEFEREVTEELQLGLVRAYNNRLRERQRRYKIMRQHG  322

Query  233  LV  234
            L+
Sbjct  323  LI  324



Lambda      K        H
   0.316    0.131    0.383 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1022168484


Query= XP_011197357.1 facilitated trehalose transporter Tret1 [Bactrocera
dorsalis]

Length=468
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TRET1_BOMMO  unnamed protein product                                  179     2e-50
TRET1_APILI  unnamed protein product                                  176     2e-49
TRET1_POLVA  unnamed protein product                                  172     7e-48


>TRET1_BOMMO unnamed protein product
Length=505

 Score = 179 bits (454),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 122/452 (27%), Positives = 222/452 (49%), Gaps = 25/452 (6%)

Query  17   QILVTLAAHIMTLSHGIGLGWLSPTLLILQSPRSPLEFKVAVEDVSWIGSIFGLGSLSSN  76
            Q+L   A  + +++ G   G+ SP +L +      +   +  E+++W+G +  L +L   
Sbjct  51   QLLAAFAVSVGSMNVGFSSGYTSPAVLTMN-----ITLDITKEEITWVGGLMPLAALVGG  105

Query  77   IFFGLLADRIARKTNMYLLAIPHMLFWILNYFAQSVGYFYASRFFAGLTCGGLYVIGPVF  136
            I  G L + + RK  +   A+P  + W+L   A +V   +A R   G+  G + +  PV+
Sbjct  106  IVGGPLIEYLGRKKTIMGTAVPFTIGWMLIANAINVVMVFAGRVICGVCVGIVSLAFPVY  165

Query  137  ISEISAKEIRGALTSLAMMFYSCGILIGFILPSYLDYHLIPCIVIFLSIIYFAVLSLFPD  196
            I E    E+RGAL  L   F + GIL+ F++ SYLD+  +      + + +F ++ L P+
Sbjct  166  IGETIQPEVRGALGLLPTAFGNTGILLAFLVGSYLDWSNLAFFGAAIPVPFFLLMILTPE  225

Query  197  TPGSLLQQGQLEEAEKAFNFY--NNIDRKGAIRELCVNELQTSTAISDFEELKASKLKGG  254
            TP   + + +++EA K+  +    N++ +  +R+L +++ +             S   GG
Sbjct  226  TPRWYVSKARVQEARKSLRWLRGKNVNIEKEMRDLTISQTE-------------SDRTGG  272

Query  255  KATSITLQDFFNKSALKKFAIAFVLCLQNQFSSSFAFVNYMSHIFAESGSTLNPQDCTIF  314
             A     +  F+K  L    I+  L L  Q +   A + Y + IF  SGS+++    +I 
Sbjct  273  NA----FKQLFSKRYLPAVMISLGLMLFQQLTGINAVIFYAASIFQMSGSSVDENLASII  328

Query  315  VGVVQILCTLLASILVEKFGRKTLMLASTAGMALGMFGFGAFVQFTDGATK-AEYNWVPL  373
            +GVV  + T +A++L+++ GRK L+  S+  M   +   GA+            Y W+PL
Sbjct  329  IGVVNFISTFIATMLIDRLGRKVLLYISSVAMITTLLALGAYFYLKQNHIDVTAYGWLPL  388

Query  374  VAVAFVTATASFGVISLTFTIIVEILPAKIRAQAQSIAMMFCSIMVFITLKLYPYFLFNL  433
              +       S G   + + ++ EILP+KIR  A S+A  F     FI  K +   +  +
Sbjct  389  ACLVIYVLGFSIGFGPIPWLMLGEILPSKIRGTAASLATGFNWTCTFIVTKTFQNIIDAI  448

Query  434  GISITMYSCASSCVITGIYLLIFLPETKGKSM  465
             +  T++  A  C+   ++++ F+PETKGKS+
Sbjct  449  YMHGTLWLFAVICIGGLLFVIFFVPETKGKSL  480


>TRET1_APILI unnamed protein product
Length=502

 Score = 176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 124/456 (27%), Positives = 221/456 (48%), Gaps = 17/456 (4%)

Query  13   RYRMQILVTLAAHIMTLSHGIGLGWLSPTLLILQSPRSPLEFKVAVEDVSWIGSIFGLGS  72
            RY MQ+L  LA  + +L  G    + SP L+ ++   +   F+V ++   WIGSI  L +
Sbjct  38   RYTMQLLAALAVSMASLMIGYSSSYTSPALVSMRD-NTTATFEVTMDMAMWIGSIMPLSA  96

Query  73   LSSNIFFGLLADRIARKTNMYLLAIPHMLFWILNYFAQSVGYFYASRFFAGLTCGGLYVI  132
            L   I  G   + I R+  +   A+P +  W+    A +V      R   G   G   + 
Sbjct  97   LIGGIIGGPCIEYIGRRNTILSTALPFLAGWLFIALATNVAMILVGRSICGFCVGVASLS  156

Query  133  GPVFISEISAKEIRGALTSLAMMFYSCGILIGFILPSYLDYHLIPCIVIFLSIIYFAVLS  192
             PV++ E    E+RG+L  L  +F + GIL+ F    YL +  +  +   + II+  ++ 
Sbjct  157  LPVYLGESIQPEVRGSLGLLPTVFGNSGILMCFTAGMYLAWRNLALLGACIPIIFLILMF  216

Query  193  LFPDTPGSLLQQGQLEEAEKAFNFYNNIDRKGAIRELCVNELQTSTAISDFEELKASKLK  252
            L P+TP   + +G+++EA K+  +                  +T+    + + ++   ++
Sbjct  217  LIPETPRWYISKGKIKEARKSLQWLRG---------------KTADISEELDSIQKMHIE  261

Query  253  GGK-ATSITLQDFFNKSALKKFAIAFVLCLQNQFSSSFAFVNYMSHIFAESGSTLNPQDC  311
              + AT   L + F K+ +K   I+  L    QFS   A + Y   IF +SGST++    
Sbjct  262  SERIATEGALIELFRKNHIKPVFISLGLMFFQQFSGINAVIFYTVQIFKDSGSTVDENLS  321

Query  312  TIFVGVVQILCTLLASILVEKFGRKTLMLASTAGMALGMFGFGAFVQFTDGATKAEYNWV  371
            TI VG+V  + T +A++++++ GRK L+  S+  M + +F FG F    +      + W+
Sbjct  322  TIIVGLVNFISTFVAAMIIDRLGRKMLLYISSILMCITLFTFGTFFYVKELMDVTAFGWI  381

Query  372  PLVAVAFVTATASFGVISLTFTIIVEILPAKIRAQAQSIAMMFCSIMVFITLKLYPYFLF  431
            PL+++       SFG   + + ++ EILP KIR  A S+A  F     F+  K Y   + 
Sbjct  382  PLMSLIVYVIGFSFGFGPIPWLMMGEILPVKIRGTAASVATAFNWSCTFVVTKTYEDLVL  441

Query  432  NLGISITMYSCASSCVITGIYLLIFLPETKGKSMAN  467
            ++G   T +   +   +  I+++I +PET+G+S+  
Sbjct  442  HIGPYGTFWLFGTLVAVAFIFVIICVPETRGRSLEE  477


>TRET1_POLVA unnamed protein product
Length=504

 Score = 172 bits (436),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 130/456 (29%), Positives = 209/456 (46%), Gaps = 28/456 (6%)

Query  17   QILVTLAAHIMTLSHGIGLGWLSPTLLILQSPRSPLEFKVAVEDVSWIGSIFGLGSLSSN  76
            QIL  +A  + ++  G    + SP L+ +Q+  +   FKV  ++ SW+G I  L  L+  
Sbjct  43   QILAAIAVSMGSMVVGFASAYTSPALVSMQN-TTITSFKVTEQEASWVGGIMPLAGLAGG  101

Query  77   IFFGLLADRIARKTNMYLLAIPHMLFWILNYFAQSVGYFYASRFFAGLTCGGLYVIGPVF  136
            I  G   + + RK  +   A+P ++ W+L  FA S+    A R  +G   G   +  PV+
Sbjct  102  IAGGPFIEYLGRKNTILATAVPFIVAWLLIAFANSIWMVLAGRALSGFCVGIASLSLPVY  161

Query  137  ISEISAKEIRGALTSLAMMFYSCGILIGFILPSYLDYHLIPCIVIFLSIIYFAVLSLFPD  196
            + E    E+RG L  L   F + GILI F+   Y+++  +  I   L I +  +  L P+
Sbjct  162  LGETVQPEVRGTLGLLPTAFGNIGILICFVAGKYVNWSGLAFIGSILPIPFMVLTLLIPE  221

Query  197  TPGSLLQQGQLEEAEKAFNFYN------NIDRKGAIRELCVNELQTSTAISDFEELKASK  250
            TP   + +G+ E A KA  +          + KG ++  C  E                 
Sbjct  222  TPRWFVTRGREERARKALQWLRGKKADVEPELKGIVKSHCEAERH---------------  266

Query  251  LKGGKATSITLQDFFNKSALKKFAIAFVLCLQNQFSSSFAFVNYMSHIFAESGSTLNPQD  310
                 A+   + D   +S LK   IA  L    Q S   A + Y   IF ++GST++   
Sbjct  267  -----ASQNAIFDLMKRSNLKPLLIALGLMFFQQLSGINAVIFYTVSIFKDAGSTIDENL  321

Query  311  CTIFVGVVQILCTLLASILVEKFGRKTLMLASTAGMALGMFGFGAFVQFTD-GATKAEYN  369
            CTI VGVV    T  A++L+++ GRK L+  S   M + +   G F  + + G   +   
Sbjct  322  CTIIVGVVNFGATFFATVLIDRLGRKILLYISEVAMVITLLTLGTFFYYKNSGNDVSNIG  381

Query  370  WVPLVAVAFVTATASFGVISLTFTIIVEILPAKIRAQAQSIAMMFCSIMVFITLKLYPYF  429
            W+PL +        S GV  + + ++ EILP KIR  A S+A  F     FI  K +   
Sbjct  382  WLPLASFVIYVIGFSSGVGPIPWLMLGEILPGKIRGSAASVATGFNWTCTFIVTKTFADI  441

Query  430  LFNLGISITMYSCASSCVITGIYLLIFLPETKGKSM  465
            +  +G     +     C+I   +++ F+PET+GKS+
Sbjct  442  VAAIGNHGAFWFFGVICLIGLFFVIFFVPETQGKSL  477



Lambda      K        H
   0.316    0.131    0.383 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1022168484


Query= XP_011197358.1 protein claret segregational [Bactrocera dorsalis]

Length=717
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

NCD_DROME  unnamed protein product                                    815     0.0  
KIF2_DICDI  unnamed protein product                                   313     1e-95
KLP3_CAEEL  unnamed protein product                                   243     3e-71


>NCD_DROME unnamed protein product
Length=700

 Score = 815 bits (2104),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/729 (59%), Positives = 515/729 (71%), Gaps = 54/729 (7%)

Query  1    MESKLPKPSGIKRPTALTRNILPMDRIKTATLGLRSK------SANLSICALDNFQPLSR  54
            MES+LPKPSG+K+P    + +LP DRI+    G  +       +AN + C  +   PLSR
Sbjct  1    MESRLPKPSGLKKPQMPIKTVLPTDRIRAGLGGGAAGAGAFNVNANQTYCG-NLLPPLSR  59

Query  55   DLTNLPNSFQRR---ERAGSPDIGRPNDTNSNGVSRSKLRRSRSACDIRDMRPMKRPEL-  110
            DL NLP   +RR    RA SP+  +          R+KLRRSRSACDI ++R  KR    
Sbjct  60   DLNNLPQVLERRGGGARAASPEPMKLGH-------RAKLRRSRSACDINELRGNKRTAAA  112

Query  111  -TLAPIPAKTTRFASAGVTNNSAVSTQPFSSNCTVSKPQRIGHVAVSSTSTAKKVYPTKS  169
             +L  IP+K +R   A                 TVS  QR+   A  S+ TA  V     
Sbjct  113  PSLPSIPSKVSRLGGA----------------LTVSS-QRLVRPAAPSSITATAV-----  150

Query  170  QNTANVGNNGPGRVASTSTKTSTTVTKKGMGSGTTTSVSTTGAGKPINKRIPPYDFKARY  229
                        R   T                 T + +++GA     KRI PYDFKAR+
Sbjct  151  -----------KRPPVTRPAPRAAGGAAAKKPAGTGAAASSGAAAAAPKRIAPYDFKARF  199

Query  230  NDLLEKYKILKAKFEEKCEQMGAMEGVPEQLEESQDQLFKTKEELKNICTERDCLSQQIK  289
            +DLLEK+K+LK K+E++ E MG +E +P+QLEE+Q++L +T+  LKN  ++ +CL +Q+K
Sbjct  200  HDLLEKHKVLKTKYEKQTEDMGELESMPQQLEETQNKLIETESSLKNTQSDNECLQRQVK  259

Query  290  SLNLKIDSISALCVKTKDELDFITEEHKILKEAHGILTNEVLELRERSIRLTEENVLLQE  349
                KI++I++   +TK+EL  +   H+ +K  H  L+ EV+ LR+R+  L   N     
Sbjct  260  QHTAKIETITSTLGRTKEELSELQAIHEKVKTEHAALSTEVVHLRQRTEELLRCNEQQAA  319

Query  350  DLTACKEQLFRANLERKELHNTIMDLRGNIRVFCRVRPPLDFEQEKLLCGWNYVDESTVE  409
            +L  CKEQLF++N+ERKELHNT+MDLRGNIRVFCR+RPPL+ E+ ++ C W Y DESTVE
Sbjct  320  ELETCKEQLFQSNMERKELHNTVMDLRGNIRVFCRIRPPLESEENRMCCTWTYHDESTVE  379

Query  410  IQNF--ENKNKSGAHTFSFDHVFHPNSKQEDIFEMVSPLIQSALDGYNICIFAYGQTGSG  467
            +Q+   + K+K G   FSFD VFHP S Q DIFEMVSPLIQSALDGYNICIFAYGQTGSG
Sbjct  380  LQSIDAQAKSKMGQQIFSFDQVFHPLSSQSDIFEMVSPLIQSALDGYNICIFAYGQTGSG  439

Query  468  KTYTMDGIPTNVGVIPRTVDLLFDSIKNYKRLGWEYEIRVTFLEIYNEVLYDLLSNDQKD  527
            KTYTMDG+P +VGVIPRTVDLLFDSI+ Y+ LGWEYEI+ TFLEIYNEVLYDLLSN+QKD
Sbjct  440  KTYTMDGVPESVGVIPRTVDLLFDSIRGYRNLGWEYEIKATFLEIYNEVLYDLLSNEQKD  499

Query  528  MEIRMAKHNKNDIYVSNITQETVTSASRLRDLMHVAKMNRATASTAGNERSSRSHAVTKI  587
            MEIRMAK+NKNDIYVSNIT+ETV   + LR LMH AKMNRATASTAGNERSSRSHAVTK+
Sbjct  500  MEIRMAKNNKNDIYVSNITEETVLDPNHLRHLMHTAKMNRATASTAGNERSSRSHAVTKL  559

Query  588  ELIGYHAEKNETSVGTINLVDLAGSESPKTSTRMNETKNINRSLSELTNVILALLQKQDH  647
            ELIG HAEK E SVG+INLVDLAGSESPKTSTRM ETKNINRSLSELTNVILALLQKQDH
Sbjct  560  ELIGRHAEKQEISVGSINLVDLAGSESPKTSTRMTETKNINRSLSELTNVILALLQKQDH  619

Query  648  IPYRNSKLTHLLMPSLGGNSKTLMFINVAPFLDCFVESVKSLRFAASVNSCKMAKAKRNR  707
            IPYRNSKLTHLLMPSLGGNSKTLMFINV+PF DCF ESVKSLRFAASVNSCKM KAKRNR
Sbjct  620  IPYRNSKLTHLLMPSLGGNSKTLMFINVSPFQDCFQESVKSLRFAASVNSCKMTKAKRNR  679

Query  708  FLNTSSNNS  716
            +LN S  NS
Sbjct  680  YLNNSVANS  688


>KIF2_DICDI unnamed protein product
Length=792

 Score = 313 bits (803),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 196/501 (39%), Positives = 291/501 (58%), Gaps = 40/501 (8%)

Query  243  FEEKCEQMGA----MEGVPEQLEESQDQLFKTKEELKNICTERDCLSQQIKSLNLKIDSI  298
            FEEK +++      ++ V + L+E + +L +   ++  +   +D + + ++  N  I  +
Sbjct  298  FEEKNKEVEKIKLELKNVLQSLKEKEKELMEAHYKVSQVSVLKDNMERDLQQSNQMILDL  357

Query  299  SALCVKTKDELDFITEEHKILKEAHGILTNEVLEL----RERSIRLTEENVLLQEDLTAC  354
                  +  +   + E+   +K+    L +E+L L    RER    TE   L +E+    
Sbjct  358  QHEIRSSSLKAIQVDEKFNNMKDVTKDLDDEILRLNQLVRERD---TEIESLRKENRELL  414

Query  355  KEQLFRANLERKELHNTIMDLRGNIRVFCRVRPPLDFEQEKLLCGW---------NYVDE  405
            ++      + RK LHNTI +L+GNIRVFCR+RP  DF   +   G          N V+ 
Sbjct  415  EKSRSDEKVRRK-LHNTIQELKGNIRVFCRIRP--DFSSGQGANGSVFNIPAGTDNLVEV  471

Query  406  STVEIQNFENKNKSGAHTFSFDHVFHPNSKQEDIFEMVSPLIQSALDGYNICIFAYGQTG  465
             +  I +F  +      TF+FD VF P+S QE +FE +S L+QS+LDGYN CIF YGQTG
Sbjct  472  KSPTIDSFNGEASIKKSTFTFDRVFGPSSTQELVFEDISQLVQSSLDGYNTCIFTYGQTG  531

Query  466  SGKTYTMDG---IPTNVGVIPRTVDLLFDSIKNYKRLGWEYEIRVTFLEIYNEVLYDLLS  522
            SGKT+++ G   +P+  G+IPRTV+ +F SI++    GW Y+I   FLEIYNE + DLL+
Sbjct  532  SGKTHSILGDLKVPSQRGMIPRTVEKIFSSIQDLTEKGWTYQIECFFLEIYNETINDLLN  591

Query  523  -------NDQKDMEIRMA-KHNKNDIYVSNITQETVTSA--SRLRDLMHVAKMNRATAST  572
                    + K  EI+   KHN +    +      V     S++ +L+++A  NR+ A T
Sbjct  592  TTTTTTGGNSKSNEIKYEIKHNPDTNVTTVTNMTVVPVTHPSQVYELLNLANKNRSVAKT  651

Query  573  AGNERSSRSHAVTKIELIGYHAEKNETSVGTINLVDLAGSESPKTS----TRMNETKNIN  628
              NERSSRSH V +++LIGY+ + +E + G +NL+DLAGSE    S     ++ ET+ IN
Sbjct  652  LCNERSSRSHTVFQLKLIGYNQQSSERTQGLLNLIDLAGSERVSRSGVEGKQLKETQAIN  711

Query  629  RSLSELTNVILALLQKQDHIPYRNSKLTHLLMPSLGGNSKTLMFINVAPFLDCFVESVKS  688
            +SLS L +VI AL  K+ HIPYRNSKLT LL  S+GGNSKTLMF+N++P L    ES  S
Sbjct  712  KSLSSLGDVISALANKEQHIPYRNSKLTFLLQNSIGGNSKTLMFVNISPELKDLQESTSS  771

Query  689  LRFAASVNSCKMAKAKRNRFL  709
            LRFAA VNSC++  A++ + +
Sbjct  772  LRFAAKVNSCELGAARKQKII  792


>KLP3_CAEEL unnamed protein product
Length=598

 Score = 243 bits (621),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 139/345 (40%), Positives = 209/345 (61%), Gaps = 15/345 (4%)

Query  359  FRANLE-RKELHNTIMDLRGNIRVFCRVRPPL--DFEQEKLLCGWNYVDESTVEIQNFEN  415
            ++A +E RK+LHN +++L GNIRVF R+RP L  + + +K +   + +D   V + N   
Sbjct  225  YKAEMEKRKQLHNQLVELNGNIRVFYRIRPQLASETDNQKPVVVIDEMDNGVVHVSNTTG  284

Query  416  KNKSGAHTFSFDHVFHPNSKQEDIFEMVSPLIQSALDGYNICIFAYGQTGSGKTYTMDGI  475
              K+ A     D V   +  Q+ IF  VSP+I S +DGYN+CIFAYG TGSGKTYTMDG 
Sbjct  285  TRKTSAGA---DKVIPTDFSQDQIFNEVSPIITSCIDGYNVCIFAYGHTGSGKTYTMDGP  341

Query  476  PTNVGVIPRTVDLLFDSIKNYKRLG-WEYEIRVTFLEIYNEVLYDLLSNDQKDMEIRMAK  534
             T  G+  R +  LF++ K  +R G  +Y+I+V  +EIYNE + DLL+    ++ IR  +
Sbjct  342  VTMPGINQRAIMQLFETAK--ERTGDIKYDIKVAMMEIYNEKIRDLLNTSNTNLAIRQTE  399

Query  535  HNKNDIYVSNITQETVTSASRLRDLMHVAKMNRATASTAGNERSSRSHAVTKIELIGYHA  594
              ++ I    + + +V SA  + + +   + N+A A+T  N  SSRSH + ++ +   + 
Sbjct  400  EGRSSI--PGLEEVSVNSAEEVTETLARGRKNKAVAATEANIESSRSHVIVRVLVSATNL  457

Query  595  EKNETSVGTINLVDLAGSE----SPKTSTRMNETKNINRSLSELTNVILALLQKQDHIPY  650
                T+VG +NLVDLAGSE    +  T   + E + IN+SLSEL NV+LAL Q Q HIP+
Sbjct  458  ITKATTVGRLNLVDLAGSERVSQTNATGQLLKEAQAINKSLSELGNVVLALRQNQKHIPF  517

Query  651  RNSKLTHLLMPSLGGNSKTLMFINVAPFLDCFVESVKSLRFAASV  695
            RN +LT +L  SL G+SKTL+ ++++P      ES+ S+ FA  +
Sbjct  518  RNCQLTRILEDSLNGDSKTLVIVHLSPDAKSLNESISSVNFAEKI  562



Lambda      K        H
   0.316    0.131    0.383 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1022168484


Query= XP_011197359.1 3'(2'),5'-bisphosphate nucleotidase 1 [Bactrocera
dorsalis]

Length=305
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

IMPA3_DROME  unnamed protein product                                  117     2e-30
O76455_DROME  unnamed protein product                                 71.2    1e-13
Q9VFP6_DROME  unnamed protein product                                 70.9    1e-13


>IMPA3_DROME unnamed protein product
Length=355

 Score = 117 bits (294),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 87/288 (30%), Positives = 136/288 (47%), Gaps = 21/288 (7%)

Query  8    RIMALSINTAARAGSIIREVMQRGNLGIVEK----EGKDDLQTEADRSAQQCIIASLSRK  63
            +++  +I  A R G  + +V +   L    K    EG +D  T+AD  +   +   L R 
Sbjct  59   KMLIAAIQAAQRGGLEVLDVARSRQLKERSKGKTDEGVNDPFTDADGRSHCVMKQGLQRI  118

Query  64   FPNITIIGEEGDSNLNVKAEWLVSEENEEFLTHSCPEELLEIKEEEFVIWVDPLDGTSEY  123
            FP + I  EE D     +A     +      T   P+  + +  ++  +WVDPLD T E+
Sbjct  119  FPRVQIFSEE-DKEHCKQAHGYDLDPTVLHETAQIPD--VTVNAQDVTVWVDPLDATKEF  175

Query  124  TKGLLEHVTVLIGIAIKDRAVGGIIYQPYYKQSNGDIGRTVWGLKGLGTGGF----EPKS  179
            T+ L E+VT ++ +A+  R + G+I+ P+        G+T W   G     +     P+ 
Sbjct  176  TEELYEYVTTMVCVAVAGRPIIGVIHSPFN-------GQTAWAWVGNSMSEYLSNLHPQH  228

Query  180  PPKGQM-IITTTRSHLTPLVQQALDALSPT-KVIKVGGAGYKVLQLLEGKAHAYVFASPG  237
             P  Q  IIT +RSH       A         ++   GAGYKVLQ++   A AY+  S  
Sbjct  229  SPNNQAPIITVSRSHTAGAKDLARGIFGENVSLLTAAGAGYKVLQVVANNATAYLHTSK-  287

Query  238  CKRWDTCAPEAVLEAYGGTLTDLAGIHYSYAADVDYKNRMGVLATIPE  285
             K+WD CA +A+L A GGT+T L     +Y  +    N  G+LAT+ +
Sbjct  288  IKKWDICAGDAILHALGGTMTTLNDQLINYGPEESPVNTEGLLATLEQ  335


>O76455_DROME unnamed protein product
Length=375

 Score = 71.2 bits (173),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/206 (26%), Positives = 96/206 (47%), Gaps = 33/206 (16%)

Query  112  IWVDPLDGTSEYTKGL-------------LEHVTVLIGIAIKDRAV--GGIIYQPYYKQS  156
            IW+DP+D T+EY  G              L+ VTVLIG+  +D  V   G++ QP+ ++ 
Sbjct  159  IWIDPIDATAEYISGDTMFTDFPGITSTGLDCVTVLIGVYERDTGVPVMGVVAQPFGEKL  218

Query  157  NGDI--GRTVWG--LKGLGTGGFEPKSPPKGQMIITTTRSHLTPLVQQALDALSPTKVIK  212
              ++      WG  L  +     + ++  + + +   + S  + ++Q+ LD     +   
Sbjct  219  EENVYSSSMFWGVCLPTVRAHNCDFEARDENRRLGIFSSSEQSDILQRFLDL--GYEFAF  276

Query  213  VGGAGYKVLQLLEGKAHAYVFASPGCKRWDTCAPEAVLEAYGGTLTDLAG---------I  263
              GAG+K L+++  +   Y+ +     +WDTCAP+A+L A GG + D A          +
Sbjct  277  SAGAGHKALKVITHEVDVYLLSKGSTFKWDTCAPQAILRALGGDVLDYAASVADQKAVPL  336

Query  264  HY---SYAADVDYKNRMGVLATIPEI  286
             Y      AD D+K   G + ++  +
Sbjct  337  KYLIEDAEADADWKRNAGGIISVRNV  362


>Q9VFP6_DROME unnamed protein product
Length=375

 Score = 70.9 bits (172),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/206 (26%), Positives = 96/206 (47%), Gaps = 33/206 (16%)

Query  112  IWVDPLDGTSEYTKGL-------------LEHVTVLIGIAIKDRAV--GGIIYQPYYKQS  156
            IW+DP+D T+EY  G              L+ VTVLIG+  +D  V   G++ QP+ ++ 
Sbjct  159  IWIDPIDATAEYISGDTMFTDFPGITSTGLDCVTVLIGVYERDTGVPVMGVVAQPFGEKL  218

Query  157  NGDI--GRTVWG--LKGLGTGGFEPKSPPKGQMIITTTRSHLTPLVQQALDALSPTKVIK  212
              ++      WG  L  +     + ++  + + +   + S  + ++Q+ LD     +   
Sbjct  219  EENVYSSSMFWGVCLPTVRAHNCDFEARDENRRLGIFSSSEQSDILQRFLDL--GYEFAF  276

Query  213  VGGAGYKVLQLLEGKAHAYVFASPGCKRWDTCAPEAVLEAYGGTLTDLAG---------I  263
              GAG+K L+++  +   Y+ +     +WDTCAP+A+L A GG + D A          +
Sbjct  277  SAGAGHKALKVITHEVDVYLLSKGSTFKWDTCAPQAILRALGGDVLDYAASVAEQKAVPL  336

Query  264  HY---SYAADVDYKNRMGVLATIPEI  286
             Y      AD D+K   G + ++  +
Sbjct  337  KYLIEDAEADADWKRNAGGIISVRNV  362



Lambda      K        H
   0.316    0.131    0.383 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1022168484


Query= XP_011197360.1 probable small nuclear ribonucleoprotein Sm D2
[Bactrocera dorsalis]

Length=119
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SMD2_DROME  unnamed protein product                                   240     1e-83
SMD2_CAEEL  unnamed protein product                                   174     1e-57
Q586C5_TRYB2  unnamed protein product                                 64.7    2e-14


>SMD2_DROME unnamed protein product
Length=119

 Score = 240 bits (612),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 118/119 (99%), Positives = 119/119 (100%), Gaps = 0/119 (0%)

Query  1    MALVKPKSELTPEELARQEEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDR  60
            MALVKPKSELTPEELARQEEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDR
Sbjct  1    MALVKPKSELTPEELARQEEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDR  60

Query  61   HCNMVLESVKEMWTELPRTGKGKKKVKPVNKDRFISKMFLRGDSVILVLRNPLATAAGK  119
            HCNMVLE+VKEMWTELPRTGKGKKKVKPVNKDRFISKMFLRGDSVILVLRNPLATAAGK
Sbjct  61   HCNMVLENVKEMWTELPRTGKGKKKVKPVNKDRFISKMFLRGDSVILVLRNPLATAAGK  119


>SMD2_CAEEL unnamed protein product
Length=118

 Score = 174 bits (441),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/115 (82%), Positives = 104/115 (90%), Gaps = 0/115 (0%)

Query  2    ALVKPKSELTPEELARQEEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRH  61
            A  KP+SE+T EELA +E+EEFN GPLS+LT SVKNN QVLINCRNNKKLLGRVKAFDRH
Sbjct  3    AQAKPRSEMTAEELAAKEDEEFNVGPLSILTNSVKNNHQVLINCRNNKKLLGRVKAFDRH  62

Query  62   CNMVLESVKEMWTELPRTGKGKKKVKPVNKDRFISKMFLRGDSVILVLRNPLATA  116
            CNMVLE+VKEMWTE+P+TGKGKKK K V KDRFISKMFLRGDSVILV++NPLA A
Sbjct  63   CNMVLENVKEMWTEVPKTGKGKKKAKSVAKDRFISKMFLRGDSVILVVKNPLAQA  117


>Q586C5_TRYB2 unnamed protein product
Length=111

 Score = 64.7 bits (156),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 48/90 (53%), Gaps = 11/90 (12%)

Query  26   GPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLESVKEMWTELPRTGKGKKK  85
            GP  +L  +VKN T+V I  R NK L+  V AFD+H N+VL    E+             
Sbjct  32   GPFCLLDSAVKNGTRVFIQSRYNKSLVATVVAFDKHFNLVLRDAVELTM-----------  80

Query  86   VKPVNKDRFISKMFLRGDSVILVLRNPLAT  115
            V    K+R I  MFLRG SV+ ++R P +T
Sbjct  81   VNNEQKERSIRNMFLRGASVVFIVRLPQST  110



Lambda      K        H
   0.316    0.131    0.383 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1022168484


Query= XP_011197361.1 protein D2 [Bactrocera dorsalis]

Length=192
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VI09_DROME  unnamed protein product                                 247     3e-84
Q9VD01_DROME  unnamed protein product                                 178     3e-57
PEBPH_CAEEL  unnamed protein product                                  179     5e-57


>Q9VI09_DROME unnamed protein product
Length=202

 Score = 247 bits (631),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 147/187 (79%), Gaps = 1/187 (1%)

Query  4    ASTSDSTDDVFKQHKVVPDVIPVAPKQYLKVSYKN-VLAENGKELTPTQVAVQPSIEWNA  62
            A  + S ++VF+ H+VVPDVIP  P Q LKV+Y N ++A++G ELTPTQV  QP +EW+A
Sbjct  14   AVQAGSVEEVFRSHQVVPDVIPEPPNQLLKVTYSNNLVAKDGVELTPTQVKDQPVVEWDA  73

Query  63   ENDAFYTIIMTDPDAPSRSNPKFREFNHWLVTNIHGTDISSGDVLTAYVGSGPPQGTGLH  122
            +   FYT+IMTDPDAPSR+ PKFREF HW++ NI G D++SG+ +  Y+GSGPPQGTGLH
Sbjct  74   QPGEFYTLIMTDPDAPSRAEPKFREFKHWILANIAGNDLASGEPIAEYIGSGPPQGTGLH  133

Query  123  RYVFLVYKQPAEIRFQETRVPKNSSQNRPNFSATKFAKKYKLGDPIAGNFFQAQWDEYVP  182
            RYVFL+YKQ  ++ F E RV K S ++RP FSA KFA  ++LG+PIAG F+QAQ+D+YVP
Sbjct  134  RYVFLLYKQSGKLEFDEERVSKRSRKDRPKFSAAKFAINHELGNPIAGTFYQAQYDDYVP  193

Query  183  TVHRQLS  189
             +H+QLS
Sbjct  194  KLHKQLS  200


>Q9VD01_DROME unnamed protein product
Length=176

 Score = 178 bits (451),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 113/167 (68%), Gaps = 2/167 (1%)

Query  19   VVPDVIPVAPKQYLKVSY-KNVLAENGKELTPTQVAVQPSIEWNAENDAFYTIIMTDPDA  77
            ++PD+I V P     ++Y   V  E GKELTPTQV  QP++ ++AE ++ YTI++ DPDA
Sbjct  6    IIPDIIDVKPASKATITYPSGVQVELGKELTPTQVKDQPTVVFDAEPNSLYTILLVDPDA  65

Query  78   PSRSNPKFREFNHWLVTNIHGTDISSGDVLTAYVGSGPPQGTGLHRYVFLVYKQPAEIRF  137
            PSR +PKFRE  HWLV NI G  +S G  +  Y+G+GP +GTGLHRYVFLV+KQ  +I  
Sbjct  66   PSREDPKFRELLHWLVINIPGNKVSEGQTIAEYIGAGPREGTGLHRYVFLVFKQNDKIT-  124

Query  138  QETRVPKNSSQNRPNFSATKFAKKYKLGDPIAGNFFQAQWDEYVPTV  184
             E  V K S   R N  A  + +KY  G P+AGNFFQAQ+D+YV T+
Sbjct  125  TEKFVSKTSRTGRINVKARDYIQKYSFGGPVAGNFFQAQYDDYVKTL  171


>PEBPH_CAEEL unnamed protein product
Length=221

 Score = 179 bits (454),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 119/181 (66%), Gaps = 3/181 (2%)

Query  12   DVFKQHKVVPDVIPV-APKQYLKVSYKNVLAEN-GKELTPTQVAVQPSIEWNAENDAFYT  69
            + F +H+V+PDV+    P + + V + + +  N G  LTPTQV   P ++W+AE  A YT
Sbjct  40   EAFTKHEVIPDVLASNPPSKVVSVKFNSGVEANLGNVLTPTQVKDTPEVKWDAEPGALYT  99

Query  70   IIMTDPDAPSRSNPKFREFNHWLVTNIHGTDISSGDVLTAYVGSGPPQGTGLHRYVFLVY  129
            +I TDPDAPSR  P +RE++HWLV NI G DI+ GD L+ Y+G+GPP  TGLHRYV+L+Y
Sbjct  100  LIKTDPDAPSRKEPTYREWHHWLVVNIPGNDIAKGDTLSEYIGAGPPPKTGLHRYVYLIY  159

Query  130  KQPAEIRFQE-TRVPKNSSQNRPNFSATKFAKKYKLGDPIAGNFFQAQWDEYVPTVHRQL  188
            KQ   I   E  R+   S   R  + A  F  K+KLG P+ GN FQA++D+YVP +++QL
Sbjct  160  KQSGRIEDAEHGRLTNTSGDKRGGWKAADFVAKHKLGAPVFGNLFQAEYDDYVPILNKQL  219

Query  189  S  189
             
Sbjct  220  G  220



Lambda      K        H
   0.316    0.131    0.383 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1022168484


Query= XP_011197362.1 protein D3 [Bactrocera dorsalis]

Length=205
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VI09_DROME  unnamed protein product                                 218     1e-72
PEBPH_CAEEL  unnamed protein product                                  202     4e-66
Q9VD01_DROME  unnamed protein product                                 180     7e-58


>Q9VI09_DROME unnamed protein product
Length=202

 Score = 218 bits (556),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/200 (57%), Positives = 138/200 (69%), Gaps = 2/200 (1%)

Query  4    LKHLLFVSLFYMAHAADSDITKFMKHLEVIPDVIAEGPKDFLKVSYDSGVVADKGVELTP  63
            L+ LL +    +A  A S    F  H +V+PDVI E P   LKV+Y + +VA  GVELTP
Sbjct  2    LRVLLPLVGCLLAVQAGSVEEVFRSH-QVVPDVIPEPPNQLLKVTYSNNLVAKDGVELTP  60

Query  64   TQVKHQPKVEWNPESTNTFYTLIMTDPDAPSRAKPEMREWHHWLVVNIPGNSLDKGEVLS  123
            TQVK QP VEW+ +    FYTLIMTDPDAPSRA+P+ RE+ HW++ NI GN L  GE ++
Sbjct  61   TQVKDQPVVEWDAQP-GEFYTLIMTDPDAPSRAEPKFREFKHWILANIAGNDLASGEPIA  119

Query  124  AYIGSGAPKDTGLHRYVFLLYKQPKKLEFTETHLTNTSAKGRENFSTKNFAEKYGLGVPV  183
             YIGSG P+ TGLHRYVFLLYKQ  KLEF E  ++  S K R  FS   FA  + LG P+
Sbjct  120  EYIGSGPPQGTGLHRYVFLLYKQSGKLEFDEERVSKRSRKDRPKFSAAKFAINHELGNPI  179

Query  184  AGNFFQAQYDDYVPELYKQL  203
            AG F+QAQYDDYVP+L+KQL
Sbjct  180  AGTFYQAQYDDYVPKLHKQL  199


>PEBPH_CAEEL unnamed protein product
Length=221

 Score = 202 bits (515),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 105/181 (58%), Positives = 125/181 (69%), Gaps = 4/181 (2%)

Query  26   FMKHLEVIPDVIAEGP-KDFLKVSYDSGVVADKGVELTPTQVKHQPKVEWNPESTNTFYT  84
            F KH EVIPDV+A  P    + V ++SGV A+ G  LTPTQVK  P+V+W+ E     YT
Sbjct  42   FTKH-EVIPDVLASNPPSKVVSVKFNSGVEANLGNVLTPTQVKDTPEVKWDAEP-GALYT  99

Query  85   LIMTDPDAPSRAKPEMREWHHWLVVNIPGNSLDKGEVLSAYIGSGAPKDTGLHRYVFLLY  144
            LI TDPDAPSR +P  REWHHWLVVNIPGN + KG+ LS YIG+G P  TGLHRYV+L+Y
Sbjct  100  LIKTDPDAPSRKEPTYREWHHWLVVNIPGNDIAKGDTLSEYIGAGPPPKTGLHRYVYLIY  159

Query  145  KQPKKLEFTE-THLTNTSAKGRENFSTKNFAEKYGLGVPVAGNFFQAQYDDYVPELYKQL  203
            KQ  ++E  E   LTNTS   R  +   +F  K+ LG PV GN FQA+YDDYVP L KQL
Sbjct  160  KQSGRIEDAEHGRLTNTSGDKRGGWKAADFVAKHKLGAPVFGNLFQAEYDDYVPILNKQL  219

Query  204  G  204
            G
Sbjct  220  G  220


>Q9VD01_DROME unnamed protein product
Length=176

 Score = 180 bits (457),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 117/173 (68%), Gaps = 2/173 (1%)

Query  27   MKHLEVIPDVIAEGPKDFLKVSYDSGVVADKGVELTPTQVKHQPKVEWNPESTNTFYTLI  86
            M    +IPD+I   P     ++Y SGV  + G ELTPTQVK QP V ++ E  N+ YT++
Sbjct  1    MDTAGIIPDIIDVKPASKATITYPSGVQVELGKELTPTQVKDQPTVVFDAEP-NSLYTIL  59

Query  87   MTDPDAPSRAKPEMREWHHWLVVNIPGNSLDKGEVLSAYIGSGAPKDTGLHRYVFLLYKQ  146
            + DPDAPSR  P+ RE  HWLV+NIPGN + +G+ ++ YIG+G  + TGLHRYVFL++KQ
Sbjct  60   LVDPDAPSREDPKFRELLHWLVINIPGNKVSEGQTIAEYIGAGPREGTGLHRYVFLVFKQ  119

Query  147  PKKLEFTETHLTNTSAKGRENFSTKNFAEKYGLGVPVAGNFFQAQYDDYVPEL  199
              K+  TE  ++ TS  GR N   +++ +KY  G PVAGNFFQAQYDDYV  L
Sbjct  120  NDKIT-TEKFVSKTSRTGRINVKARDYIQKYSFGGPVAGNFFQAQYDDYVKTL  171



Lambda      K        H
   0.316    0.131    0.383 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1022168484


Query= XP_011197363.1 uncharacterized protein LOC105221918 [Bactrocera
dorsalis]

Length=274
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A0A0B4KGB8_DROME  unnamed protein product                             31.6    0.90 
Q9W244_DROME  unnamed protein product                                 31.2    1.0  


>A0A0B4KGB8_DROME unnamed protein product
Length=1916

 Score = 31.6 bits (70),  Expect = 0.90, Method: Composition-based stats.
 Identities = 21/68 (31%), Positives = 30/68 (44%), Gaps = 4/68 (6%)

Query  206  PAPM-PAAEYGPPSTTASSYDPSSWEPASGGP---YARWDSQSLAYSSYHPSSSSYNSGS  261
            P P  PA+  G P  T  SY P    P+ G      AR   +   +      +  Y+SG+
Sbjct  25   PNPTSPASAPGTPQATRHSYPPVELMPSPGAAAHRSARTPGEQYHFGYQAHPAQHYHSGA  84

Query  262  SSTGSSSS  269
             STG +S+
Sbjct  85   KSTGRASA  92


>Q9W244_DROME unnamed protein product
Length=1995

 Score = 31.2 bits (69),  Expect = 1.0, Method: Composition-based stats.
 Identities = 21/68 (31%), Positives = 30/68 (44%), Gaps = 4/68 (6%)

Query  206  PAPM-PAAEYGPPSTTASSYDPSSWEPASGGP---YARWDSQSLAYSSYHPSSSSYNSGS  261
            P P  PA+  G P  T  SY P    P+ G      AR   +   +      +  Y+SG+
Sbjct  25   PNPTSPASAPGTPQATRHSYPPVELMPSPGAAAHRSARTPGEQYHFGYQAHPAQHYHSGA  84

Query  262  SSTGSSSS  269
             STG +S+
Sbjct  85   KSTGRASA  92



Lambda      K        H
   0.316    0.131    0.383 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1022168484


Query= XP_011197364.1 uncharacterized protein LOC105221920 isoform X1
[Bactrocera dorsalis]

Length=267
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ALLC_DICDI  unnamed protein product                                   30.4    1.7  
Q38DC7_TRYB2  unnamed protein product                                 29.3    4.4  
Q383Z3_TRYB2  unnamed protein product                                 28.1    8.6  


>ALLC_DICDI unnamed protein product
Length=369

 Score = 30.4 bits (67),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 33/69 (48%), Gaps = 7/69 (10%)

Query  95   EERDLVDAVGDYLQGHDVTMDLP-----LGDAKVTVSSRNLANDELSLNVKLAGDGVVEG  149
            E   LV  V D+  G+   + +P     +GD   T   R   ND L+  VKLA +G+V+ 
Sbjct  196  ENGGLVTQVSDHFYGNKNNIIMPGRSVNMGDGWETKRRRGPGNDWLT--VKLAKEGIVKR  253

Query  150  KGKKGNFFK  158
                 N+FK
Sbjct  254  IEVDTNWFK  262


>Q38DC7_TRYB2 unnamed protein product
Length=687

 Score = 29.3 bits (64),  Expect = 4.4, Method: Compositional matrix adjust.
 Identities = 16/45 (36%), Positives = 25/45 (56%), Gaps = 1/45 (2%)

Query  202  GFFSFIVSVGLAIFQLCKKIAAEHHSAHITAHG-PWDGRAIGVSA  245
            G F+ I ++G    ++      +H S HIT+H  P D  ++GVSA
Sbjct  222  GRFTVIGTIGWIAPEVLDSGMMDHRSGHITSHSFPSDVWSLGVSA  266


>Q383Z3_TRYB2 unnamed protein product
Length=490

 Score = 28.1 bits (61),  Expect = 8.6, Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 40/87 (46%), Gaps = 21/87 (24%)

Query  161  KKHRLRKMIMPLMVLILLKAMTV---IPMAIGIL-----------KIKAFNALALGF---  203
            +KH L  MI+P+ + IL+  + V   +P  IG+L            +  ++A + G    
Sbjct  291  RKHILTFMILPIGMGILISGLMVSQSLPFYIGVLCCVWYLQGVVDNVNIYDAWSCGMGFR  350

Query  204  ----FSFIVSVGLAIFQLCKKIAAEHH  226
                F+ +V+  L +  +   +A+EH 
Sbjct  351  RNVRFAILVTFSLCLGNVLWALASEHQ  377



Lambda      K        H
   0.316    0.131    0.383 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1022168484


Query= XP_011197365.1 uncharacterized protein LOC105221920 isoform X2
[Bactrocera dorsalis]

Length=258
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q38DC7_TRYB2  unnamed protein product                                 29.3    4.2  
Q383Z3_TRYB2  unnamed protein product                                 28.9    4.7  
DDB1_DICDI  unnamed protein product                                   28.1    9.9  


>Q38DC7_TRYB2 unnamed protein product
Length=687

 Score = 29.3 bits (64),  Expect = 4.2, Method: Compositional matrix adjust.
 Identities = 16/45 (36%), Positives = 25/45 (56%), Gaps = 1/45 (2%)

Query  193  GFFSFIVSVGLAIFQLCKKIAAEHHSAHITAHG-PWDGRAIGVSA  236
            G F+ I ++G    ++      +H S HIT+H  P D  ++GVSA
Sbjct  222  GRFTVIGTIGWIAPEVLDSGMMDHRSGHITSHSFPSDVWSLGVSA  266


>Q383Z3_TRYB2 unnamed protein product
Length=490

 Score = 28.9 bits (63),  Expect = 4.7, Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 48/110 (44%), Gaps = 32/110 (29%)

Query  133  DELSLNVK----LAGDGVVEGKGKKHRLRKMIMPLMVLILLKAMTV---IPMAIGIL---  182
            D+L   VK    L GD       +KH L  MI+P+ + IL+  + V   +P  IG+L   
Sbjct  275  DDLKCGVKSSAILIGD-------RKHILTFMILPIGMGILISGLMVSQSLPFYIGVLCCV  327

Query  183  --------KIKAFNALALGF-------FSFIVSVGLAIFQLCKKIAAEHH  217
                     +  ++A + G        F+ +V+  L +  +   +A+EH 
Sbjct  328  WYLQGVVDNVNIYDAWSCGMGFRRNVRFAILVTFSLCLGNVLWALASEHQ  377


>DDB1_DICDI unnamed protein product
Length=1181

 Score = 28.1 bits (61),  Expect = 9.9, Method: Composition-based stats.
 Identities = 21/84 (25%), Positives = 41/84 (49%), Gaps = 9/84 (11%)

Query  29    NMQGMIDEENAKCESGADSMACIKVRAMRFLDTVINNDNYKFGDVEVHSNGYQPAAADAN  88
             +M  ++++ +   E  A +   I +R++  +     ND+Y  G     SN +       N
Sbjct  982   SMSLLVEQSDGSLEQIARNPQPIWIRSVAMI-----NDDYFIG--AEASNNF--IVVKKN  1032

Query  89    SARSNDEERDLVDAVGDYLQGHDV  112
             +  +N+ ER+L+D+VG Y  G  +
Sbjct  1033  NDSTNELERELLDSVGHYHIGESI  1056



Lambda      K        H
   0.316    0.131    0.383 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1022168484


Query= XP_011197366.1 uncharacterized protein LOC105221921 [Bactrocera
dorsalis]

Length=311


***** No hits found *****



Lambda      K        H
   0.316    0.131    0.383 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1022168484


Query= XP_011197367.2 facilitated trehalose transporter Tret1, partial
[Bactrocera dorsalis]

Length=232
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VU17_DROME  unnamed protein product                                 95.5    2e-22
TRET1_BOMMO  unnamed protein product                                  95.5    2e-22
Q8IQH6_DROME  unnamed protein product                                 95.1    2e-22


>Q9VU17_DROME unnamed protein product
Length=539

 Score = 95.5 bits (236),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/182 (32%), Positives = 89/182 (49%), Gaps = 0/182 (0%)

Query  9    LGWLSPTLLILQSPRSPLEFKVAVEDVSWIGSIFGLGSLSSNIFFGLLADRIARKTNMYL  68
            LGW SP    +       +F V  +  SW+GS   LG+    I  G L + I RK  M  
Sbjct  101  LGWTSPAETEIVDRGEGYDFPVDKDQFSWVGSAMTLGAACVCIPIGFLINMIGRKWTMLF  160

Query  69   LAIPHMLFWILNYFAQSVGYFYASRFFAGLTCGGLYVIGPVFISEISAKEIRGALTSLAM  128
            L +P +L W +  +A +V   YASRF  G+  G   V  P++  EI+ KEIRG L S   
Sbjct  161  LVLPFILGWTMLIWAVNVSMLYASRFILGIAGGAFCVTAPMYTGEIAQKEIRGTLGSFFQ  220

Query  129  MFYSCGILIGFILPSYLDYHLIPCIVIFLSIIYFAVLSLFPDTPGSLLQQGQLEEAEKSF  188
            +  + GIL  + + + +    +  I   L +I+ A+    P++P  L+ + + E A KS 
Sbjct  221  LMITIGILFVYAVGAGVKIFWLSIICGILPLIFGAIFFFMPESPTYLVSKDRSENAIKSI  280

Query  189  NF  190
             +
Sbjct  281  QW  282


>TRET1_BOMMO unnamed protein product
Length=505

 Score = 95.5 bits (236),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/226 (26%), Positives = 119/226 (53%), Gaps = 8/226 (4%)

Query  2    TLSHGIGLGWLSPTLLILQSPRSPLEFKVAVEDVSWIGSIFGLGSLSSNIFFGLLADRIA  61
            +++ G   G+ SP +L +      +   +  E+++W+G +  L +L   I  G L + + 
Sbjct  62   SMNVGFSSGYTSPAVLTMN-----ITLDITKEEITWVGGLMPLAALVGGIVGGPLIEYLG  116

Query  62   RKTNMYLLAIPHMLFWILNYFAQSVGYFYASRFFAGLTCGGLYVIGPVFISEISAKEIRG  121
            RK  +   A+P  + W+L   A +V   +A R   G+  G + +  PV+I E    E+RG
Sbjct  117  RKKTIMGTAVPFTIGWMLIANAINVVMVFAGRVICGVCVGIVSLAFPVYIGETIQPEVRG  176

Query  122  ALTSLAMMFYSCGILIGFILPSYLDYHLIPCIVIFLSIIYFAVLSLFPDTPGSLLQQGQL  181
            AL  L   F + GIL+ F++ SYLD+  +      + + +F ++ L P+TP   + + ++
Sbjct  177  ALGLLPTAFGNTGILLAFLVGSYLDWSNLAFFGAAIPVPFFLLMILTPETPRWYVSKARV  236

Query  182  EEAEKSFNFY--NNIDRKGAIRELCVNELQTS-TAISDFEELKASK  224
            +EA KS  +    N++ +  +R+L +++ ++  T  + F++L + +
Sbjct  237  QEARKSLRWLRGKNVNIEKEMRDLTISQTESDRTGGNAFKQLFSKR  282


 Score = 32.0 bits (71),  Expect = 0.47, Method: Compositional matrix adjust.
 Identities = 41/174 (24%), Positives = 74/174 (43%), Gaps = 27/174 (16%)

Query  41   IFGLGSLSSNIFFGLLADRIARKTNMYL--LAIPHMLFWILNYFAQSVGYFYASRF-FAG  97
            I G+ +  S     +L DR+ RK  +Y+  +A+   L  +  YF     +   + + +  
Sbjct  328  IIGVVNFISTFIATMLIDRLGRKVLLYISSVAMITTLLALGAYFYLKQNHIDVTAYGWLP  387

Query  98   LTCGGLYVI------GPV---FISEISAKEIRGALTSLAMMF-YSCGILIGFILPSYLD-  146
            L C  +YV+      GP+    + EI   +IRG   SLA  F ++C  ++     + +D 
Sbjct  388  LACLVIYVLGFSIGFGPIPWLMLGEILPSKIRGTAASLATGFNWTCTFIVTKTFQNIIDA  447

Query  147  --------YHLIPCIVIFLSIIYFAVLSLFPDTPGSLLQQGQLEEAEKSFNFYN  192
                       + CI   L +I+F      P+T G  L++ +++    S    N
Sbjct  448  IYMHGTLWLFAVICIGGLLFVIFFV-----PETKGKSLEEIEMKLTSGSRRVRN  496


>Q8IQH6_DROME unnamed protein product
Length=471

 Score = 95.1 bits (235),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/205 (30%), Positives = 97/205 (47%), Gaps = 2/205 (1%)

Query  9    LGWLSPTLLILQSPRSPLEFKVAVEDVSWIGSIFGLGSLSSNIFFGLLADRIARKTNMYL  68
            LGW SP    +       +F V  +  SW+GS   LG+    I  G L + I RK  M  
Sbjct  33   LGWTSPAETEIVDRGEGYDFPVDKDQFSWVGSAMTLGAACVCIPIGFLINMIGRKWTMLF  92

Query  69   LAIPHMLFWILNYFAQSVGYFYASRFFAGLTCGGLYVIGPVFISEISAKEIRGALTSLAM  128
            L +P +L W +  +A +V   YASRF  G+  G   V  P++  EI+ KEIRG L S   
Sbjct  93   LVLPFILGWTMLIWAVNVSMLYASRFILGIAGGAFCVTAPMYTGEIAQKEIRGTLGSFFQ  152

Query  129  MFYSCGILIGFILPSYLDYHLIPCIVIFLSIIYFAVLSLFPDTPGSLLQQGQLEEAEKSF  188
            +  + GIL  + + + +    +  I   L +I+ A+    P++P  L+ + + E A KS 
Sbjct  153  LMITIGILFVYAVGAGVKIFWLSIICGILPLIFGAIFFFMPESPTYLVSKDRSENAIKSI  212

Query  189  NFY--NNIDRKGAIRELCVNELQTS  211
             +      D +  + EL   + +T 
Sbjct  213  QWLRGKEYDYEPELAELRETDRETK  237



Lambda      K        H
   0.316    0.131    0.383 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1022168484


Query= XP_011197368.1 uncharacterized protein LOC105221922 [Bactrocera
dorsalis]

Length=910


***** No hits found *****



Lambda      K        H
   0.316    0.131    0.383 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1022168484


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jan 6, 2022  1:11 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_011197371.1 uncharacterized protein LOC105221923 [Bactrocera
dorsalis]

Length=217
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A0A0B4KI07_DROME  unnamed protein product                             29.6    2.7  
Q9VAP9_DROME  unnamed protein product                                 29.6    2.7  
A0A0B4KI51_DROME  unnamed protein product                             29.6    2.8  


>A0A0B4KI07_DROME unnamed protein product
Length=2684

 Score = 29.6 bits (65),  Expect = 2.7, Method: Composition-based stats.
 Identities = 13/26 (50%), Positives = 17/26 (65%), Gaps = 0/26 (0%)

Query  76    ERVERYLATHELNFGLPGDEDEEAEN  101
             +R+ RY   HE +  LP DEDEE E+
Sbjct  1902  KRLIRYHCMHENDVELPSDEDEEFES  1927


>Q9VAP9_DROME unnamed protein product
Length=2976

 Score = 29.6 bits (65),  Expect = 2.7, Method: Composition-based stats.
 Identities = 13/26 (50%), Positives = 17/26 (65%), Gaps = 0/26 (0%)

Query  76    ERVERYLATHELNFGLPGDEDEEAEN  101
             +R+ RY   HE +  LP DEDEE E+
Sbjct  2194  KRLIRYHCMHENDVELPSDEDEEFES  2219


>A0A0B4KI51_DROME unnamed protein product
Length=3003

 Score = 29.6 bits (65),  Expect = 2.8, Method: Composition-based stats.
 Identities = 13/26 (50%), Positives = 17/26 (65%), Gaps = 0/26 (0%)

Query  76    ERVERYLATHELNFGLPGDEDEEAEN  101
             +R+ RY   HE +  LP DEDEE E+
Sbjct  2194  KRLIRYHCMHENDVELPSDEDEEFES  2219



Lambda      K        H
   0.319    0.134    0.374 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1750876036


Query= XP_011197372.1 uncharacterized protein LOC105221924 [Bactrocera
dorsalis]

Length=276
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q57UP5_TRYB2  unnamed protein product                                 32.0    0.66 
EFGM_DROME  unnamed protein product                                   30.4    1.7  
Q7KN81_DROME  unnamed protein product                                 30.0    2.0  


>Q57UP5_TRYB2 unnamed protein product
Length=1166

 Score = 32.0 bits (71),  Expect = 0.66, Method: Composition-based stats.
 Identities = 49/142 (35%), Positives = 61/142 (43%), Gaps = 17/142 (12%)

Query  74   IELVNGISFKRDSASAVARSSKALSENEIYAQLPENAEERNG--RLVDIAMQ-NAADFLG  130
            +EL      K  SAS  AR  K L EN +Y Q      +  G   L D   Q NAA+  G
Sbjct  314  LELARLFDSKPSSASVSARVGKWLDENGLYPQRTSYRSKECGDENLNDDNQQPNAAEAAG  373

Query  131  SHSLEVKIPAEATQDMARALDEGRGKLKKMLGPIAIAVGAKLFAVIPIVLGALALLTTKA  190
            + S    IPA A +D A A     G L     P A A+   L +       A ALL   A
Sbjct  374  NAS----IPA-AEEDTAWAC----GSLTTTSSPFAGAMHHVLQSPC-----ANALLYMFA  419

Query  191  VIVAKIALLLALIVSGSRFFGG  212
             + +  AL LA + S S  +GG
Sbjct  420  EVFSIPALELADMASSSGMYGG  441


>EFGM_DROME unnamed protein product
Length=745

 Score = 30.4 bits (67),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 32/65 (49%), Gaps = 1/65 (2%)

Query  97   LSENEIYAQLPENAEERNGRLVDIAMQNAADFLGSHSLEVKIPAEATQDMARALDEGRGK  156
            ++ N  + QLP   E     +VD+  + A  F G H +++++  E  QDM     E R +
Sbjct  190  MNHNAAFIQLPIGVESNCKGIVDLVREKAIYFEGEHGMDIRL-DEIPQDMRVESLERRQE  248

Query  157  LKKML  161
            L + L
Sbjct  249  LIEHL  253


>Q7KN81_DROME unnamed protein product
Length=286

 Score = 30.0 bits (66),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 48/174 (28%), Positives = 77/174 (44%), Gaps = 33/174 (19%)

Query  44   LGSCFEAEDMTTCFAVKGITALNRAARS----NNIELVNGISFKRDSASAVARSSKALSE  99
               C E+ D  +C  +     L R A+S      IEL  G+S  +   S   R  K+L +
Sbjct  32   FAQCLES-DSISCLQL----TLFRKAKSVFDNPQIELFGGVSLVK---SNEGRQGKSL-D  82

Query  100  NEIYAQLPENAEERNGRLVDIAMQNAADFLGSHSLEVKIPAEATQDMARAL-DEGRGKLK  158
            N +  +     E R   + +  M NA  F    SL     A A + +ARA+ D+ +  L+
Sbjct  83   NSLAVEAAPTVEARTAEMGNYFMDNAKSFFAERSLNFNF-ANAARSVARAIPDDIKADLR  141

Query  159  KML--------------GPIAIAVGAKLFAVIPI--VLGALALLTTKAVIVAKI  196
            +++               PI + VGAK+ AV+ +  + G L  L  KA++V+ I
Sbjct  142  ELVVESRTRKKKLLKKFLPILLGVGAKI-AVLGVGSIFG-LLFLAKKALVVSVI  193



Lambda      K        H
   0.319    0.134    0.374 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1750876036


Query= XP_011197373.1 uncharacterized protein LOC105221925 [Bactrocera
dorsalis]

Length=510


***** No hits found *****



Lambda      K        H
   0.319    0.134    0.374 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1750876036


Query= XP_011197374.1 uncharacterized protein LOC105221926 [Bactrocera
dorsalis]

Length=364


***** No hits found *****



Lambda      K        H
   0.319    0.134    0.374 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1750876036


Query= XP_011197376.1 uncharacterized protein LOC105221927 [Bactrocera
dorsalis]

Length=314
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q38A03_TRYB2  unnamed protein product                                 28.5    8.6  
Q9VR69_DROME  unnamed protein product                                 28.5    9.3  


>Q38A03_TRYB2 unnamed protein product
Length=333

 Score = 28.5 bits (62),  Expect = 8.6, Method: Compositional matrix adjust.
 Identities = 16/46 (35%), Positives = 23/46 (50%), Gaps = 3/46 (7%)

Query  26  PAQ-NSNSNSSPHKAARSTLLDNGLTRTLKHIY--GICGDRDDLFW  68
           PA+ N+N  + PHK +    LD GL      ++  G+C  RD   W
Sbjct  4   PAEVNANIGTPPHKVSSIPGLDAGLAPLCATMWAGGLCPTRDVTLW  49


>Q9VR69_DROME unnamed protein product
Length=486

 Score = 28.5 bits (62),  Expect = 9.3, Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 21/42 (50%), Gaps = 4/42 (10%)

Query  267  QHSQTYSSSHAGEYEAGHESGSYHRSIDDEMMMQDKAYNAWV  308
            ++S      H G Y  GHE G+   SI  +  +QDK Y  WV
Sbjct  174  EYSNYQQIQHLGYY--GHEIGT--ESISQQQGLQDKGYEEWV  211



Lambda      K        H
   0.319    0.134    0.374 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1750876036


Query= XP_011197377.1 uncharacterized protein LOC105221928 [Bactrocera
dorsalis]

Length=234
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7KN81_DROME  unnamed protein product                                 38.5    0.003
Q9XZ15_DROME  unnamed protein product                                 38.5    0.003
CLAT_CAEEL  unnamed protein product                                   29.6    2.6  


>Q7KN81_DROME unnamed protein product
Length=286

 Score = 38.5 bits (88),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 46/162 (28%), Positives = 79/162 (49%), Gaps = 20/162 (12%)

Query  38   ECGDRSMVLCMK----ERALHYFDTENGDVKLTEGISLIKTDDIPVGRSLSEA-ALPEEP  92
            +C +   + C++     +A   FD  N  ++L  G+SL+K+++   G+SL  + A+   P
Sbjct  34   QCLESDSISCLQLTLFRKAKSVFD--NPQIELFGGVSLVKSNEGRQGKSLDNSLAVEAAP  91

Query  93   --EARENEVDALLVERVARFFGTHTLQFK-----------VPKDSIQDMQRALEESRGKK  139
              EAR  E+    ++    FF   +L F            +P D   D++  + ESR +K
Sbjct  92   TVEARTAEMGNYFMDNAKSFFAERSLNFNFANAARSVARAIPDDIKADLRELVVESRTRK  151

Query  140  KEKKKYLLPLLMLFKLKMAALLPLAIGFLALISFKALVIGKI  181
            K+  K  LP+L+    K+A L   +I  L  ++ KALV+  I
Sbjct  152  KKLLKKFLPILLGVGAKIAVLGVGSIFGLLFLAKKALVVSVI  193


>Q9XZ15_DROME unnamed protein product
Length=312

 Score = 38.5 bits (88),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 46/162 (28%), Positives = 79/162 (49%), Gaps = 20/162 (12%)

Query  38   ECGDRSMVLCMK----ERALHYFDTENGDVKLTEGISLIKTDDIPVGRSLSEA-ALPEEP  92
            +C +   + C++     +A   FD  N  ++L  G+SL+K+++   G+SL  + A+   P
Sbjct  60   QCLESDSISCLQLTLFRKAKSVFD--NPQIELFGGVSLVKSNEGRQGKSLDNSLAVEAAP  117

Query  93   --EARENEVDALLVERVARFFGTHTLQFK-----------VPKDSIQDMQRALEESRGKK  139
              EAR  E+    ++    FF   +L F            +P D   D++  + ESR +K
Sbjct  118  TVEARTAEMGNYFMDNAKSFFAERSLNFNFANAARSVARAIPDDIKADLRELVVESRTRK  177

Query  140  KEKKKYLLPLLMLFKLKMAALLPLAIGFLALISFKALVIGKI  181
            K+  K  LP+L+    K+A L   +I  L  ++ KALV+  I
Sbjct  178  KKLLKKFLPILLGVGAKIAVLGVGSIFGLLFLAKKALVVSVI  219


>CLAT_CAEEL unnamed protein product
Length=627

 Score = 29.6 bits (65),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 34/138 (25%), Positives = 60/138 (43%), Gaps = 12/138 (9%)

Query  73   KTDDIPVGRSLSEAALPEEP-EARENEVDALL-------VERVARFFGTHTLQFKVPKDS  124
            K D++P   +  E ALP+ P  + E  +D  L       V + A    TH    K  + +
Sbjct  5    KVDELPPNDNWYETALPKPPVPSLEATLDRYLEYAAVVAVGQKASLATTHDAAHKFVRQA  64

Query  125  IQDMQRALEESRGKKKEKKKYLLPLLMLFKLKMAALLPLAIGFL-ALISF--KALVIGKI  181
                ++ LE +        K+ LP  M  +++M   +    G++   + F  K   I   
Sbjct  65   TPLQEQLLEIAEKSPNWATKFWLP-EMYMRVRMPTPVNSNPGYIFPKVKFETKEDHIKYT  123

Query  182  ALLLSGIIGLKKLLESKK  199
            ALL  G++  K L+++K+
Sbjct  124  ALLTRGLLEYKNLIDTKQ  141



Lambda      K        H
   0.319    0.134    0.374 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1750876036


Query= XP_011197378.1 uncharacterized protein LOC105221929 [Bactrocera
dorsalis]

Length=287
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

I2HAA0_CAEEL  unnamed protein product                                 30.4    2.3  
STX7A_DICDI  unnamed protein product                                  28.5    6.9  
Q38AC2_TRYB2  unnamed protein product                                 28.9    7.2  


>I2HAA0_CAEEL unnamed protein product
Length=913

 Score = 30.4 bits (67),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 14/43 (33%), Positives = 25/43 (58%), Gaps = 2/43 (5%)

Query  8    LMTSLFILSC--TFRNVTARTATGSTAQQLAAGQTKGEDNTSP  48
            L+ +L +  C  T+R ++ R    +TA++L  G T+G  +T P
Sbjct  219  LVATLMMAPCMVTYRRMSNRIEQEATAEELVEGATRGSTSTVP  261


>STX7A_DICDI unnamed protein product
Length=356

 Score = 28.5 bits (62),  Expect = 6.9, Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 40/80 (50%), Gaps = 5/80 (6%)

Query  85   VKLLTGLQRVLRTAKVLKIIDGVQFVRSYDDGGANGNAVNSASFTNEKELEAVLPRGTAS  144
            V++LT L ++L T K    +D  + +R+  D   +  +  S    N   L ++  R   S
Sbjct  102  VQILTKLVQLLGTPK--DSMDTREKIRNCVDSTTHLISSESGKVKN---LTSLASRSRDS  156

Query  145  KEQALHNMISKEFSNMLQNF  164
            K + L+  + KEF+N LQ F
Sbjct  157  KNKLLYQKLVKEFNNCLQQF  176


>Q38AC2_TRYB2 unnamed protein product
Length=2432

 Score = 28.9 bits (63),  Expect = 7.2, Method: Compositional matrix adjust.
 Identities = 16/52 (31%), Positives = 27/52 (52%), Gaps = 4/52 (8%)

Query  66    QAYRIYKQCAQDNI----SVCLQVKLLTGLQRVLRTAKVLKIIDGVQFVRSY  113
             + YR+  +C +  +    S+C  +  LT +QRV      L+  +GV  VRS+
Sbjct  2127  EDYRVNPRCIRMELDLMRSMCDNLYYLTAIQRVEPFEFALERTEGVDLVRSF  2178



Lambda      K        H
   0.319    0.134    0.374 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1750876036


Query= XP_011197379.1 uncharacterized protein LOC105221930 [Bactrocera
dorsalis]

Length=287
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

G5EBN5_CAEEL  unnamed protein product                                 29.3    5.0  
H8ESG1_CAEEL  unnamed protein product                                 29.3    5.0  


>G5EBN5_CAEEL unnamed protein product
Length=1492

 Score = 29.3 bits (64),  Expect = 5.0, Method: Composition-based stats.
 Identities = 17/62 (27%), Positives = 27/62 (44%), Gaps = 2/62 (3%)

Query  228  YEVVAHPHHSASHSVSHDSYGSGYSADAGSSGSYGSS--GHGGWGRSLDAQDLAYAAQKP  285
            + +  +P  + S+ V     G+ Y A AGS   +G+     G  G    AQ + + AQ  
Sbjct  924  HAIRPYPGDTGSYQVPRIVPGAQYGAQAGSGAYFGAQFGAQGAQGAHFGAQGVQFGAQGA  983

Query  286  QA  287
            Q 
Sbjct  984  QG  985


>H8ESG1_CAEEL unnamed protein product
Length=1494

 Score = 29.3 bits (64),  Expect = 5.0, Method: Composition-based stats.
 Identities = 17/62 (27%), Positives = 27/62 (44%), Gaps = 2/62 (3%)

Query  228  YEVVAHPHHSASHSVSHDSYGSGYSADAGSSGSYGSS--GHGGWGRSLDAQDLAYAAQKP  285
            + +  +P  + S+ V     G+ Y A AGS   +G+     G  G    AQ + + AQ  
Sbjct  924  HAIRPYPGDTGSYQVPRIVPGAQYGAQAGSGAYFGAQFGAQGAQGAHFGAQGVQFGAQGA  983

Query  286  QA  287
            Q 
Sbjct  984  QG  985



Lambda      K        H
   0.319    0.134    0.374 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1750876036


Query= XP_011197380.1 uncharacterized protein LOC105221932 [Bactrocera
dorsalis]

Length=285
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7KN81_DROME  unnamed protein product                                 310     5e-106
Q9XZ15_DROME  unnamed protein product                                 310     1e-105


>Q7KN81_DROME unnamed protein product
Length=286

 Score = 310 bits (793),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 223/289 (77%), Positives = 247/289 (85%), Gaps = 7/289 (2%)

Query  1    MNLYLTATCILLLSAGAFADPIKDNNVVTPASGFNKCLEADSISCLQLTLFRKARSFFEN  60
            M  ++   CILLL+AG  ADP+K          F +CLE+DSISCLQLTLFRKA+S F+N
Sbjct  1    MKFFVATACILLLAAGISADPVKAAE--EQPGAFAQCLESDSISCLQLTLFRKAKSVFDN  58

Query  61   PQIEVFGGVSLIKSNEGRQGKSLDDNAVAVEAAPSVEARTSEMGTYFMNHAKNFFAERSL  120
            PQIE+FGGVSL+KSNEGRQGKSLD N++AVEAAP+VEART+EMG YFM++AK+FFAERSL
Sbjct  59   PQIELFGGVSLVKSNEGRQGKSLD-NSLAVEAAPTVEARTAEMGNYFMDNAKSFFAERSL  117

Query  121  NFNFANAARSVARAIPDDIKADLRELVVESRTKKKKLLKKFLPILLGVGAKVAVLGVGAI  180
            NFNFANAARSVARAIPDDIKADLRELVVESRT+KKKLLKKFLPILLGVGAK+AVLGVG+I
Sbjct  118  NFNFANAARSVARAIPDDIKADLRELVVESRTRKKKLLKKFLPILLGVGAKIAVLGVGSI  177

Query  181  FGLLFLAKKALVVSVIAFFLALAAGASS-GLSRLGGGGGGGLLGGLGGLFGGKNSGSSSG  239
            FGLLFLAKKALVVSVIAFFLALAAGASS      G GGGGGLLGGLGGLFGGKN+G SS 
Sbjct  178  FGLLFLAKKALVVSVIAFFLALAAGASSGLGRIGGSGGGGGLLGGLGGLFGGKNAGGSSA  237

Query  240  ---SSGGWSSGAASGGWSSGGNSGWDSHGAYSSPVAQTIAYSGYKQARR  285
                      GA+S GWSSGG+SGWD+HGAYSSPVAQTIAY GYKQARR
Sbjct  238  ASTGGWSSGGGASSAGWSSGGSSGWDTHGAYSSPVAQTIAYQGYKQARR  286


>Q9XZ15_DROME unnamed protein product
Length=312

 Score = 310 bits (793),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 223/289 (77%), Positives = 247/289 (85%), Gaps = 7/289 (2%)

Query  1    MNLYLTATCILLLSAGAFADPIKDNNVVTPASGFNKCLEADSISCLQLTLFRKARSFFEN  60
            M  ++   CILLL+AG  ADP+K          F +CLE+DSISCLQLTLFRKA+S F+N
Sbjct  27   MKFFVATACILLLAAGISADPVKAAE--EQPGAFAQCLESDSISCLQLTLFRKAKSVFDN  84

Query  61   PQIEVFGGVSLIKSNEGRQGKSLDDNAVAVEAAPSVEARTSEMGTYFMNHAKNFFAERSL  120
            PQIE+FGGVSL+KSNEGRQGKSLD N++AVEAAP+VEART+EMG YFM++AK+FFAERSL
Sbjct  85   PQIELFGGVSLVKSNEGRQGKSLD-NSLAVEAAPTVEARTAEMGNYFMDNAKSFFAERSL  143

Query  121  NFNFANAARSVARAIPDDIKADLRELVVESRTKKKKLLKKFLPILLGVGAKVAVLGVGAI  180
            NFNFANAARSVARAIPDDIKADLRELVVESRT+KKKLLKKFLPILLGVGAK+AVLGVG+I
Sbjct  144  NFNFANAARSVARAIPDDIKADLRELVVESRTRKKKLLKKFLPILLGVGAKIAVLGVGSI  203

Query  181  FGLLFLAKKALVVSVIAFFLALAAGASS-GLSRLGGGGGGGLLGGLGGLFGGKNSGSSSG  239
            FGLLFLAKKALVVSVIAFFLALAAGASS      G GGGGGLLGGLGGLFGGKN+G SS 
Sbjct  204  FGLLFLAKKALVVSVIAFFLALAAGASSGLGRIGGSGGGGGLLGGLGGLFGGKNAGGSSA  263

Query  240  ---SSGGWSSGAASGGWSSGGNSGWDSHGAYSSPVAQTIAYSGYKQARR  285
                      GA+S GWSSGG+SGWD+HGAYSSPVAQTIAY GYKQARR
Sbjct  264  ASTGGWSSGGGASSAGWSSGGSSGWDTHGAYSSPVAQTIAYQGYKQARR  312



Lambda      K        H
   0.319    0.134    0.374 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1750876036


Query= XP_011197381.1 uncharacterized protein LOC105221933 [Bactrocera
dorsalis]

Length=274
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7K7E6_DROME  unnamed protein product                                 31.6    0.82 
Q1W9P9_DROME  unnamed protein product                                 31.6    0.87 
O77283_DROME  unnamed protein product                                 31.6    0.88 


>Q7K7E6_DROME unnamed protein product
Length=1761

 Score = 31.6 bits (70),  Expect = 0.82, Method: Compositional matrix adjust.
 Identities = 18/52 (35%), Positives = 25/52 (48%), Gaps = 4/52 (8%)

Query  98   LVLMRGLEIVPIEPVSNGLPAEPALESDDTF-LGYISEYLRSHELNIKFADL  148
            +V  RG+  VP  P  +GLP +P     D+F L     Y   H LN + A +
Sbjct  625  MVAKRGVAAVPQSPTRHGLPYDPGY---DSFSLSSTDSYPPKHALNPQLAKI  673


>Q1W9P9_DROME unnamed protein product
Length=1765

 Score = 31.6 bits (70),  Expect = 0.87, Method: Compositional matrix adjust.
 Identities = 18/52 (35%), Positives = 25/52 (48%), Gaps = 4/52 (8%)

Query  98   LVLMRGLEIVPIEPVSNGLPAEPALESDDTF-LGYISEYLRSHELNIKFADL  148
            +V  RG+  VP  P  +GLP +P     D+F L     Y   H LN + A +
Sbjct  629  MVAKRGVAAVPQSPTRHGLPYDPGY---DSFSLSSTDSYPPKHALNPQLAKI  677


>O77283_DROME unnamed protein product
Length=1712

 Score = 31.6 bits (70),  Expect = 0.88, Method: Compositional matrix adjust.
 Identities = 18/52 (35%), Positives = 25/52 (48%), Gaps = 4/52 (8%)

Query  98   LVLMRGLEIVPIEPVSNGLPAEPALESDDTF-LGYISEYLRSHELNIKFADL  148
            +V  RG+  VP  P  +GLP +P     D+F L     Y   H LN + A +
Sbjct  576  MVAKRGVAAVPQSPTRHGLPYDPGY---DSFSLSSTDSYPPKHALNPQLAKI  624



Lambda      K        H
   0.319    0.134    0.374 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1750876036


Query= XP_011197384.1 uncharacterized protein LOC105221935 [Bactrocera
dorsalis]

Length=297
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7KN81_DROME  unnamed protein product                                 32.0    0.55 
Q9XZ15_DROME  unnamed protein product                                 32.0    0.59 
DYHC_DROME  unnamed protein product                                   32.0    0.75 


>Q7KN81_DROME unnamed protein product
Length=286

 Score = 32.0 bits (71),  Expect = 0.55, Method: Compositional matrix adjust.
 Identities = 22/95 (23%), Positives = 43/95 (45%), Gaps = 3/95 (3%)

Query  71   AFEECKTQLSWMCLKIEFVKIMERLMERDELKLVPGVSVVRNANATEVKS--NDLMAEVA  128
            AF +C    S  CL++   +  + + +  +++L  GVS+V++    + KS  N L  E A
Sbjct  31   AFAQCLESDSISCLQLTLFRKAKSVFDNPQIELFGGVSLVKSNEGRQGKSLDNSLAVEAA  90

Query  129  RSYPNDPNSRLNGYIVNKLSSFLQTHFLRFKLIDS  163
             +      + +  Y ++   SF     L F   ++
Sbjct  91   PTV-EARTAEMGNYFMDNAKSFFAERSLNFNFANA  124


>Q9XZ15_DROME unnamed protein product
Length=312

 Score = 32.0 bits (71),  Expect = 0.59, Method: Compositional matrix adjust.
 Identities = 22/95 (23%), Positives = 43/95 (45%), Gaps = 3/95 (3%)

Query  71   AFEECKTQLSWMCLKIEFVKIMERLMERDELKLVPGVSVVRNANATEVKS--NDLMAEVA  128
            AF +C    S  CL++   +  + + +  +++L  GVS+V++    + KS  N L  E A
Sbjct  57   AFAQCLESDSISCLQLTLFRKAKSVFDNPQIELFGGVSLVKSNEGRQGKSLDNSLAVEAA  116

Query  129  RSYPNDPNSRLNGYIVNKLSSFLQTHFLRFKLIDS  163
             +      + +  Y ++   SF     L F   ++
Sbjct  117  PTV-EARTAEMGNYFMDNAKSFFAERSLNFNFANA  150


>DYHC_DROME unnamed protein product
Length=4639

 Score = 32.0 bits (71),  Expect = 0.75, Method: Composition-based stats.
 Identities = 21/73 (29%), Positives = 39/73 (53%), Gaps = 3/73 (4%)

Query  59    SNSNSKRDVMKRAFEECKTQLSWMCLKIEFVKIMERLME-RDELKLVPGVSVVRNANATE  117
             SN +   + + RA   C   + W   +IE+  +++R+   R+EL+ +   + V  A+A E
Sbjct  3359  SNPDYNFEKVNRASMACGPMVKWAIAQIEYADMLKRVEPLREELRSLEEQADVNLASAKE  3418

Query  118   VKSNDLMAEVARS  130
              K  DL+ ++ RS
Sbjct  3419  TK--DLVEQLERS  3429



Lambda      K        H
   0.319    0.134    0.374 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1750876036


Query= XP_011197385.1 uncharacterized protein LOC105221936 [Bactrocera
dorsalis]

Length=273
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9XXU0_CAEEL  unnamed protein product                                 30.0    2.1  
G5EEV8_CAEEL  unnamed protein product                                 30.0    2.3  
G5EDR4_CAEEL  unnamed protein product                                 29.6    2.6  


>Q9XXU0_CAEEL unnamed protein product
Length=343

 Score = 30.0 bits (66),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 22/36 (61%), Gaps = 0/36 (0%)

Query  7    FVYGLSCGYGLLRPTASATAKSPVTQLSGSAADAFV  42
            F+Y L C +G     A+ T+K P ++ +G+ AD ++
Sbjct  172  FIYFLFCLFGTCLCCATMTSKKPSSRTTGTFADMWL  207


>G5EEV8_CAEEL unnamed protein product
Length=384

 Score = 30.0 bits (66),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 22/36 (61%), Gaps = 0/36 (0%)

Query  7    FVYGLSCGYGLLRPTASATAKSPVTQLSGSAADAFV  42
            F+Y L C +G     A+ T+K P ++ +G+ AD ++
Sbjct  213  FIYFLFCLFGTCLCCATMTSKKPSSRTTGTFADMWL  248


>G5EDR4_CAEEL unnamed protein product
Length=410

 Score = 29.6 bits (65),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 22/36 (61%), Gaps = 0/36 (0%)

Query  7    FVYGLSCGYGLLRPTASATAKSPVTQLSGSAADAFV  42
            F+Y L C +G     A+ T+K P ++ +G+ AD ++
Sbjct  239  FIYFLFCLFGTCLCCATMTSKKPSSRTTGTFADMWL  274



Lambda      K        H
   0.319    0.134    0.374 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1750876036


Query= XP_011197386.1 kelch-like protein 1 isoform X3 [Bactrocera dorsalis]

Length=547
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VEN5_DROME  unnamed protein product                                 196     2e-54
Q7KSF5_DROME  unnamed protein product                                 196     3e-54
Q9VGE5_DROME  unnamed protein product                                 192     3e-54


>Q9VEN5_DROME unnamed protein product
Length=744

 Score = 196 bits (497),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 147/536 (27%), Positives = 244/536 (46%), Gaps = 35/536 (7%)

Query  17   LMDVAFNVLNSTCLIPAHRLILSAASPFFKNLFNA--DQCISSTVEINDIDGDILERLIN  74
            L DV   V     L PAH+++LSAASP+FK +F     +   S V++  +    + R++ 
Sbjct  57   LTDVVLEVKKE--LFPAHKVVLSAASPYFKAMFTGGLKESEMSRVQLQGVCPTAMSRILY  114

Query  75   FCYTGQLMITVSNGGAMLKAAIVLQLDDAISTCVDYIVTHINDYTFQCAYTLERETECEL  134
            F YTGQ+ +T      +L AA + Q+ + I  C  ++   ++            +  C  
Sbjct  115  FMYTGQIRVTEVTVCQLLPAATMFQVPNVIDACCAFLERQLDPTNAIGIAHFAEQHGCVE  174

Query  135  LKQKIIEYEIQNFMKVSQSDEFTNFDVEKLQGILESDNLNITREEDAYDAIKLWINHDVR  194
            L++K   +  +NF +V Q +EF      +L  ++  D LN+  E + Y+A+  W+ +D  
Sbjct  175  LQKKANVFIERNFTQVCQEEEFLQLSAYQLIALIRRDELNVQEEREVYNAVLKWVKYDED  234

Query  195  ARQEQLPLLIASLRLTQLPTDFLLTH------ILPLPGC-ELLA--MKAVLWISEP--KA  243
             R  ++  ++ ++R   L  +FL         +  +P C E LA   K +     P  K 
Sbjct  235  NRHCKMEHILGAVRCQFLTPNFLKEQMKNCDVLRKVPACREYLAKIFKDLTLHKCPGVKE  294

Query  244  RSKINIRFTEPRVFSAGNCSEPTLLAVCSKMNSSHLLQYNKAEDKWQDYASIKFDYRFFS  303
            R+    R     +F AG     +L           L  YN  +  W   A+++       
Sbjct  295  RTPNTTRM----IFVAGGFFRHSL---------DILEAYNVDDMTWTTLANLRIPRSGLG  341

Query  304  TILKDDNILFIGGWNKDTTFNNVLCWNIR----NKTCRNLEAMNQARYWHCVVELDEKIY  359
                      +GG N +   +    W  R     +T R    M+  R+   V  +DE +Y
Sbjct  342  AAFLKGKFYAVGGRNNNIGSSYDSDWVDRYSAVTETWRPCAPMSVPRHRVGVAVMDELMY  401

Query  360  AIGGRVGNESLSSVERYTKS-DGWEFVDSLIVGREGAGAVSLNGKIYIVGGHCGKSSLKS  418
            A+GG  G E  ++VE Y    D W  V  +   R G G V +N  +Y +GG  G   L S
Sbjct  402  AVGGSAGMEYHNTVEYYDPDLDRWTLVQPMHAKRLGVGVVVVNRLLYAIGGFDGNERLAS  461

Query  419  VECYNPDSNTWTLCADMKSCHYLPGVAAHNGHIYVLGSW-WRKSSRTVERYDPQRNKWSQ  477
            VECY+P++N W+    +++     GVAA N +IYV+G +   +   TVERYD + + W  
Sbjct  462  VECYHPENNEWSFLPPLQTGRSGAGVAAINQYIYVVGGFDGTRQLATVERYDTENDTWDM  521

Query  478  IYCLEGVYGNIAGVSLDYKLWALGGTSNSDDKTSVLIYDEKTYCWEQKCSLLRRGR  533
            +  ++     ++   LD KL+A+GG   ++  + V +YD +T  W    + L+ GR
Sbjct  522  VAPIQIARSALSLTPLDEKLYAIGGFDGNNFLSIVEVYDPRTNTWTTG-TPLKSGR  576


>Q7KSF5_DROME unnamed protein product
Length=776

 Score = 196 bits (498),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 147/536 (27%), Positives = 244/536 (46%), Gaps = 35/536 (7%)

Query  17   LMDVAFNVLNSTCLIPAHRLILSAASPFFKNLFNA--DQCISSTVEINDIDGDILERLIN  74
            L DV   V     L PAH+++LSAASP+FK +F     +   S V++  +    + R++ 
Sbjct  89   LTDVVLEVKKE--LFPAHKVVLSAASPYFKAMFTGGLKESEMSRVQLQGVCPTAMSRILY  146

Query  75   FCYTGQLMITVSNGGAMLKAAIVLQLDDAISTCVDYIVTHINDYTFQCAYTLERETECEL  134
            F YTGQ+ +T      +L AA + Q+ + I  C  ++   ++            +  C  
Sbjct  147  FMYTGQIRVTEVTVCQLLPAATMFQVPNVIDACCAFLERQLDPTNAIGIAHFAEQHGCVE  206

Query  135  LKQKIIEYEIQNFMKVSQSDEFTNFDVEKLQGILESDNLNITREEDAYDAIKLWINHDVR  194
            L++K   +  +NF +V Q +EF      +L  ++  D LN+  E + Y+A+  W+ +D  
Sbjct  207  LQKKANVFIERNFTQVCQEEEFLQLSAYQLIALIRRDELNVQEEREVYNAVLKWVKYDED  266

Query  195  ARQEQLPLLIASLRLTQLPTDFLLTH------ILPLPGC-ELLA--MKAVLWISEP--KA  243
             R  ++  ++ ++R   L  +FL         +  +P C E LA   K +     P  K 
Sbjct  267  NRHCKMEHILGAVRCQFLTPNFLKEQMKNCDVLRKVPACREYLAKIFKDLTLHKCPGVKE  326

Query  244  RSKINIRFTEPRVFSAGNCSEPTLLAVCSKMNSSHLLQYNKAEDKWQDYASIKFDYRFFS  303
            R+    R     +F AG     +L           L  YN  +  W   A+++       
Sbjct  327  RTPNTTRM----IFVAGGFFRHSL---------DILEAYNVDDMTWTTLANLRIPRSGLG  373

Query  304  TILKDDNILFIGGWNKDTTFNNVLCWNIR----NKTCRNLEAMNQARYWHCVVELDEKIY  359
                      +GG N +   +    W  R     +T R    M+  R+   V  +DE +Y
Sbjct  374  AAFLKGKFYAVGGRNNNIGSSYDSDWVDRYSAVTETWRPCAPMSVPRHRVGVAVMDELMY  433

Query  360  AIGGRVGNESLSSVERYTKS-DGWEFVDSLIVGREGAGAVSLNGKIYIVGGHCGKSSLKS  418
            A+GG  G E  ++VE Y    D W  V  +   R G G V +N  +Y +GG  G   L S
Sbjct  434  AVGGSAGMEYHNTVEYYDPDLDRWTLVQPMHAKRLGVGVVVVNRLLYAIGGFDGNERLAS  493

Query  419  VECYNPDSNTWTLCADMKSCHYLPGVAAHNGHIYVLGSW-WRKSSRTVERYDPQRNKWSQ  477
            VECY+P++N W+    +++     GVAA N +IYV+G +   +   TVERYD + + W  
Sbjct  494  VECYHPENNEWSFLPPLQTGRSGAGVAAINQYIYVVGGFDGTRQLATVERYDTENDTWDM  553

Query  478  IYCLEGVYGNIAGVSLDYKLWALGGTSNSDDKTSVLIYDEKTYCWEQKCSLLRRGR  533
            +  ++     ++   LD KL+A+GG   ++  + V +YD +T  W    + L+ GR
Sbjct  554  VAPIQIARSALSLTPLDEKLYAIGGFDGNNFLSIVEVYDPRTNTWTTG-TPLKSGR  608


>Q9VGE5_DROME unnamed protein product
Length=575

 Score = 192 bits (489),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 153/520 (29%), Positives = 231/520 (44%), Gaps = 17/520 (3%)

Query  17   LMDVAFNVLNSTCLIPAHRLILSAASPFFKNLFNADQCISSTVEI----NDIDGDILERL  72
            L DV   V + T    AHR++L+A  P+F  +F  +   S   EI    + I+   LE L
Sbjct  38   LCDVTLKVEDQT--FSAHRVVLAATIPYFYAMFTNNMAESRIKEITMKESAIEPSALESL  95

Query  73   INFCYTGQLMITVSNGGAMLKAAIVLQLDDAISTCVDYIVTHINDYTFQCAYTLERETEC  132
            IN+ Y+GQ+ I   N   ++  A  LQL +    C  ++++  + +      T      C
Sbjct  96   INYVYSGQVRIDNQNVQNLMVGASFLQLSNVRDACASFLISRFHPHNVLGIRTFADSMIC  155

Query  133  ELLKQKIIEYEIQNFMKVSQSDEFTNFDVEKLQGILESDNLNITREEDAYDAIKLWINHD  192
              L     +Y  QNF KVSQS+EF   D E+L  ++  D LN+  EE  ++A   W+ + 
Sbjct  156  RQLIDAADKYIDQNFAKVSQSEEFLALDCEQLLELMRRDELNVRTEEVIFEACMKWVKYA  215

Query  193  VRARQEQLPLLIASLRLTQLPTDFLLTH------ILPLPGCELLAMKAVLWISEPKARSK  246
               R E  P ++A++RL  L   FL         I     C  L  +A  +   P+ R  
Sbjct  216  EDKRSELFPQVLAAVRLPLLSPQFLADRVAREELIRSSHQCRDLLDEAKDFHLMPERRGL  275

Query  247  INIRFTEPRV--FSAGNCSEPTLLAVCSKMNSSHLLQYNKAEDKWQDYASIKFDYRFFST  304
            +    T  R   F  G       LA   +  S+  + Y+    KW+    +         
Sbjct  276  LQSFRTRQRSGEFFTGQIYAVGGLASTGESVSTVEI-YDPLTKKWKMGEQMSMMRSRVGV  334

Query  305  ILKDDNILFIGGWNKDTTFNNVLCWNIRNKTCRNLEAMNQARYWHCVVELDEKIYAIGGR  364
             + +  +   GG+N     + V  ++ R        AM   R    V  LD+ IY  GG 
Sbjct  335  AVLNGKLYAFGGFNGTERLSTVEVYDPRKNKWSQGCAMLCKRSAVGVAALDDCIYVCGGY  394

Query  365  VGNESLSSVE-RYTKSDGWEFVDSLIVGREGAGAVSLNGKIYIVGGHCGKSSLKSVECYN  423
             G  SL++VE  Y KS+ W+ V  ++  R   G   LNG +Y +GGH G S   SVE Y+
Sbjct  395  DGVTSLNTVEVYYPKSNTWKTVAQMMKYRSAGGVTQLNGYVYALGGHDGLSIFDSVERYD  454

Query  424  PDSNTWTLCADMKSCHYLPGVAAHNGHIYVLGSWWRKSS-RTVERYDPQRNKWSQIYCLE  482
               + W   + M +     GVA  NG IYV G +   S  R+VE YDPQ + W  +  + 
Sbjct  455  QAEDVWVKMSPMLNRRCRLGVATLNGKIYVCGGYCGNSFLRSVECYDPQTDTWKLVTPMN  514

Query  483  GVYGNIAGVSLDYKLWALGGTSNSDDKTSVLIYDEKTYCW  522
                 +A  +   KLWA+GG     + ++V +YD +T  W
Sbjct  515  CKRSRVALAANMGKLWAIGGYDGESNLSTVEVYDPETDKW  554


 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/179 (34%), Positives = 88/179 (49%), Gaps = 5/179 (3%)

Query  357  KIYAIGGRVG-NESLSSVERYTK-SDGWEFVDSLIVGREGAGAVSLNGKIYIVGGHCGKS  414
            +IYA+GG     ES+S+VE Y   +  W+  + + + R   G   LNGK+Y  GG  G  
Sbjct  292  QIYAVGGLASTGESVSTVEIYDPLTKKWKMGEQMSMMRSRVGVAVLNGKLYAFGGFNGTE  351

Query  415  SLKSVECYNPDSNTWTLCADMKSCHYLPGVAAHNGHIYVLGSWWRKSS-RTVERYDPQRN  473
             L +VE Y+P  N W+    M       GVAA +  IYV G +   +S  TVE Y P+ N
Sbjct  352  RLSTVEVYDPRKNKWSQGCAMLCKRSAVGVAALDDCIYVCGGYDGVTSLNTVEVYYPKSN  411

Query  474  KWSQIYCLEGVYGNIAGVS-LDYKLWALGGTSNSDDKTSVLIYDEKTYCWEQKCSLLRR  531
             W  +  +   Y +  GV+ L+  ++ALGG        SV  YD+    W +   +L R
Sbjct  412  TWKTVAQMMK-YRSAGGVTQLNGYVYALGGHDGLSIFDSVERYDQAEDVWVKMSPMLNR  469



Lambda      K        H
   0.319    0.134    0.374 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1750876036


Query= XP_011197388.1 uncharacterized protein LOC105221939 [Bactrocera
dorsalis]

Length=198
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q38CB0_TRYB2  unnamed protein product                                 29.3    2.3  
G5ECK4_CAEEL  unnamed protein product                                 28.9    3.1  


>Q38CB0_TRYB2 unnamed protein product
Length=422

 Score = 29.3 bits (64),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 15/20 (75%), Gaps = 0/20 (0%)

Query  130  VGEKDKEKLGGAATGRGISS  149
            + ++D EKLGG A  RG+SS
Sbjct  174  IAQRDCEKLGGVAAARGVSS  193


>G5ECK4_CAEEL unnamed protein product
Length=1523

 Score = 28.9 bits (63),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 17/46 (37%), Positives = 26/46 (57%), Gaps = 3/46 (7%)

Query  152   DFIS--GNAIRIPVGPMVFSVQRAEDDGNYIEIALLKKASGSQGSV  195
             DF+    N + +  G ++  +QR +DDGN  E  L+K+ SG  G V
Sbjct  1471  DFLPQGSNQVEVKEGEVIGVLQRTDDDGN-PEWLLIKRDSGKVGYV  1515



Lambda      K        H
   0.319    0.134    0.374 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1750876036


Query= XP_011197390.2 integrin alpha-PS3 [Bactrocera dorsalis]

Length=866
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ITA3_DROME  unnamed protein product                                   347     7e-104
ITA4_DROME  unnamed protein product                                   345     2e-103
ITA5_DROME  unnamed protein product                                   334     6e-100


>ITA3_DROME unnamed protein product
Length=1115

 Score = 347 bits (889),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 232/698 (33%), Positives = 344/698 (49%), Gaps = 69/698 (10%)

Query  1    MHGLCYWINNTMGDDSQDRVWKILSPFSAKSKQDEQDVKDKNRKPLYGNVRFGEFGFSVQ  60
            +HG+CYW+NNT+    Q  V +I SP   KS+Q +++  D   K  +  +  GE G S  
Sbjct  158  LHGVCYWVNNTVASTPQ-HVTRI-SPLRLKSEQVKEE--DNGNKASFFYI-MGELGLSAH  212

Query  61   LTSENDEVIFGSPGVLNWAGNVIHYNM------------NTQK-----------------  91
            +  +N + + G+PG+  W G+VI Y              +T K                 
Sbjct  213  VADDNTKFLIGAPGINTWRGSVILYRQVDPVDNPTASRRDTSKALRRTYRDVDSNDYTPE  272

Query  92   ------PRATIQGPKMASYKGYAVGCGHFNVSDKKQLSYVVTMPNANSETKLGALQIYTA  145
                  P   + G +  SY GYAV  G F+ S+  +L YV T P AN ++  G   I+  
Sbjct  273  HYAPEIPTPGLWGQEEDSYFGYAVSSGFFDSSNPTKLLYVATAPQANKQS--GEAYIFDV  330

Query  146  P-PSWNKQFPFQLGLTGAQYGEYFGYSLLVEDLNGDGLDDMLIGAPHHTVNSVFEAGAVY  204
               S +K   F+    G Q+GEYFGYS+L EDLNGDG  D+++ AP H +    + GA+Y
Sbjct  331  RGKSIHKYHVFR----GEQFGEYFGYSVLAEDLNGDGKTDVIVSAPQHALEDSHDNGAIY  386

Query  205  MFINLGRGKQLSFKQTLLESPFSRSGHFGTSLGKLGDVNGDDYKDIAIGAPFAGNNGNGA  264
            +FIN G     +F++ +L SP      FGT+L +LGD+N D Y D+A+GAPFA   GNG 
Sbjct  387  VFINKGF---FNFERQILRSPVETMARFGTALSRLGDINHDGYNDVAVGAPFA---GNGT  440

Query  265  VAIYFGGPNGLDVQPRQILNVSEQLVESGG--MFGHGLSRGGDNNTNDYN-LAVGAPNAD  321
            V IY G  NGL  QP Q L+   Q     G  MFGHGLSRG D + N +N  A+GAPNA+
Sbjct  441  VFIYLGSENGLRDQPSQRLDAPSQQPSKYGSHMFGHGLSRGSDIDGNGFNDFAIGAPNAE  500

Query  322  MVFVYRAYPVVKINATILPKNLIIPTNTTSLKFDICINIQSNSMK--IRTQELLLDLSVA  379
             V++YRAYPVVK++AT+  ++  I      +K   C  + + S    ++ QEL + +++ 
Sbjct  501  AVYLYRAYPVVKVHATVKSESREIKPEQEKVKITACYRLSTTSTDKLVQEQELAIRIAMD  560

Query  380  TEEKRINVRHCIGKD---PFIAGLTPQCLSCNATLIFDDRYIFIPIIMELTYRLKNDGKT  436
             + KR+        +      A    QC      + + ++ IF PI +E+ Y L    K 
Sbjct  561  KQLKRVKFTQTQTNEISFKVNANFGEQCRDFETQVRYSEKDIFTPIDLEMHYELTK--KV  618

Query  437  QENSEFCSNCAVVDPAWPSMVKAQIQYLHNCKGLVCFVDLRFEGVEIPKNVILGRGSVLP  496
             ++ EFC  CA+VDP  P +    I +   C   VC  DL+    ++    ILG    L 
Sbjct  619  PDSEEFCETCAIVDPTEPKVSTQNIIFSTGCATDVCTADLQLRSKDVSPTYILGSADTLR  678

Query  497  LKYIITNNGEEAYNTQLIIKSSLNVPITKMPAECVGEFEFGWRVECSIAKGRAF-KG-TA  554
            L Y ITN GE AY  Q  + S+  +   ++P  C         + C + +GR   KG T 
Sbjct  679  LNYEITNIGETAYLPQFNVTSTSRLAFAQVPGNCK---VVDAVMVCDLNRGRPLAKGDTD  735

Query  555  KQELSLDLSNVVGATEVEINATVHSTGKVVTPNVNKSSDKVKLTTTAEIWIAETSTKKIF  614
               +S D+S + G + + I+A V STG    P  N+ ++ + L    EI  +   T    
Sbjct  736  SVTISFDVSQLSGQSLI-IHAEVFSTGYEQNPTDNRQTNVIGLKEFTEIDASGGQTNSQI  794

Query  615  AGTDGEENIAVSTAFEIQNNGPSPLSFFHLIVDFPIGF  652
                   +  +   +EI++NGPS +    +    PI +
Sbjct  795  DLEHYSNSAEIVNNYEIKSNGPSVIEQLTVSFYIPIAY  832


 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 67/142 (47%), Gaps = 8/142 (6%)

Query  698   QIPENHTTFVTCQSTENSETKMSCALSNFHPANALFSGENITLLLNYEMNWKKAEKLLPS  757
             ++P N T    C+  E +    +    +F P       ++I L + Y ++  +   +L  
Sbjct  960   KLPVNRTIVFNCRDPEMTICVRAEMRVHFRPE------KSINLNMRYSVDLNEVNAILVD  1013

Query  758   NSQYLAHVAMVNL-KTDIPINGNLSIKQHFKGAIFKKDAKRNL-FWIYLGAIIGGILLLI  815
               +Y   +  + L K   P + + SI +  +  I  K  +  L  WI + ++IGG+LLL 
Sbjct  1014  PWEYFVILTDLKLQKKGDPTSTSFSINRRIEPNIISKHQETGLPIWIIIVSVIGGLLLLS  1073

Query  816   GMILLLRKLGFFKRLTKEEMEK  837
              +  LL K GFF R  K+E+++
Sbjct  1074  AISYLLYKFGFFNRTKKDELDR  1095


>ITA4_DROME unnamed protein product
Length=1069

 Score = 345 bits (884),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 272/934 (29%), Positives = 440/934 (47%), Gaps = 124/934 (13%)

Query  2     HGLCYWINNTMGD-DSQDRVWKILSPFSAKSKQDEQDVKDKNRKPLYGNVRFGEFGFSVQ  60
             +G+CYW+++T  + DS + + K   P   + KQ  + + D N  P Y     GE G S  
Sbjct  150   NGMCYWLSDTPKNIDSTEVMEKW--PLRIEKKQVLK-LADTNLIPYYS---MGELGLSAH  203

Query  61    LTSENDEVIFGSPGVLNWAGNV---------------IHYNMNTQK------PRATIQGP  99
             ++ +N +++ G+PG+  W G+V                   MNT +      P     G 
Sbjct  204   VSDDNSKLLMGAPGIDQWKGSVHLKQEVPSIKTSSGRQRRGMNTNRKCNECNPEPKNFGQ  263

Query  100   KMASYKGYAVGCGHFNVSDKKQLSYVVTMPNANSETKLGALQIYTA-PPSWNKQFPFQLG  158
             +  SY GYAV  G+F+ S+   + YV T P  N++   G   I+     S  K   F+  
Sbjct  264   EEFSYFGYAVSSGYFDSSNLSTVLYVATAPRGNNQ--FGEAYIFDIYEDSIYKYHEFR--  319

Query  159   LTGAQYGEYFGYSLLVEDLNGDGLDDMLIGAPHHTVNSVFEAGAVYMFINLGRGKQLSFK  218
               G  +GEYFGYS+L EDLNGDG  D++I AP + + + ++ GA+Y+FIN G     +F+
Sbjct  320   --GNHFGEYFGYSVLAEDLNGDGKTDVIISAPLYALRNSYDDGAIYVFINKG---SFTFE  374

Query  219   QTLLESPFSRSGHFGTSLGKLGDVNGDDYKDIAIGAPFAGNNGNGAVAIYFGGPNGLDVQ  278
             + ++ SP    G FGT+L ++GD+N D Y D+A+GAPFAGN   G+V IY G  NGL   
Sbjct  375   ERIIRSPAGSGGRFGTTLSRIGDINKDGYNDVAVGAPFAGN---GSVFIYLGSENGLRDP  431

Query  279   PRQILNVSEQLVESGG--MFGHGLSRGGDNNTNDYN-LAVGAPNADMVFVYRAYPVVKIN  335
             P Q L+   Q     G  MFGHGLSRG D + N +N  A+GAPNA+ V++YRAYPVVKI+
Sbjct  432   PSQCLDAPSQQPSKYGSYMFGHGLSRGSDIDGNGFNDFAIGAPNAEAVYLYRAYPVVKIH  491

Query  336   ATILPKNLIIPTNTTSLKFDICINIQSNS----MKIRTQELLLDLSVATEEK----RINV  387
             A I PK   +      +   +C  + S S      +  QEL++ + + T+ K      + 
Sbjct  492   AIIKPKLQNVNPEEERVNITVCYRLSSKSDSKAKALMEQELVIRIDIDTKSKIKLAVFDE  551

Query  388   RHCIGKDPFIAGLTPQCLSCNATLIFDDRYIFIPIIMELTYRLKNDGKTQENSEFCSNCA  447
              H   +  F A    + +     +  D R  F PI +E+ Y L    K   + +FC +CA
Sbjct  552   EHG-SQMSFKAKAFHEEICSEFQIEMDKRAKFTPIALEMQYELSK--KIPNSGDFCEDCA  608

Query  448   VVDPAWPSMVKAQIQYLHNCKGLVCFVDLRFEGVEIPKNVILGRGSVLPLKYIITNNGEE  507
             VVDPA P  V   I +   C   VC  DL+   +     ++LG  +VL L Y ITNNGE 
Sbjct  609   VVDPAEPKFVTEYITFNTGCATDVCVADLKISCINASSTLVLGTTAVLRLTYNITNNGEF  668

Query  508   AYNTQLIIKSSLNVPITKMPAEC-------VGEFEFGWRVECSIAKGRAFKGTAKQELSL  560
             AY+ +  + +S  + + ++P  C       V +   G R    +AKG     T    +S 
Sbjct  669   AYHPKFSVTNSAGLSLAQVPGNCKVNEAVMVCDLNHGQR----MAKG----DTDSLTISF  720

Query  561   DLSNVVGATEVEINATVHSTGKVVTPNVNKSSDKVKLTTTAEIWIAETSTKKIFAGTDGE  620
             D+  + G + +EI A V S      P  NK ++ + L   A+I+++   T       +  
Sbjct  721   DVRQLRGRS-LEIQAEVLSARDESNPENNKLTNVLSLREKADIYVSGVQTNDHVVLKESP  779

Query  621   ENIAVSTAFEIQNNGPSPLSFFHLIVDFPIGF-------------SGGQYISNYS-----  662
                 V   +EI+++GPS L    + +  P+ +             S  +  S Y+     
Sbjct  780   YTAEVVNYYEIKSHGPSTLENLTVSLYIPVAYKTPDSTNVKHIVTSSPKIQSKYAHKIMP  839

Query  663   ----------AQAYFKDLEYSSLDFNKSAPASPPTLNTTEILYVN--------QIPENHT  704
                       A  +  D + S+L F+ + P      N + I+  N         +P N+T
Sbjct  840   INFIDQNNALANNFAIDHDQSTLLFS-ATPQHENVGNLSGIVEQNPSISLLNEDLPVNNT  898

Query  705   TFVTCQSTENS-----ETKMSCALSNFHPANALFSGENITLLLNYEMNWKKAEKLLPSNS  759
               + CQ T  +     E ++   L        L   E + + +++ +N K A+ +     
Sbjct  899   LVLNCQDTNVTLCVPVEIRLENGLQ-------LKPEELMNMTVSFTVNLKDADDIW---E  948

Query  760   QYLAHVAMVNLKTDIPINGNLSIKQHFKGAIFKKDAKRNLFWIYLGAIIGGILLLIGMIL  819
              ++    +   K   P   + +I++  +  +  K A+  + W  + ++I GIL+      
Sbjct  949   YFVIQTDLKVHKIGDPTLSSFTIEKKIESNVICKHAEIAI-WKIIVSVIVGILVFSAATY  1007

Query  820   LLRKLGFFKRLTKEEMEKNLIEKREKARMKEDLD  853
              L K GFFKR  K+++++ + +  E   ++ +++
Sbjct  1008  ALYKRGFFKRAIKDDLKQLIRDSFEDGIIRTEME  1041


>ITA5_DROME unnamed protein product
Length=1000

 Score = 334 bits (856),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 263/907 (29%), Positives = 421/907 (46%), Gaps = 110/907 (12%)

Query  1    MHGLCYWINNTMGDDSQDRVWKILSPFSAKSKQDEQDVKDKNRKPLYGNVRFG-EFGFSV  59
            M G+CYW+ +T+ D           P S        DV+  +  P      F  E G S 
Sbjct  121  MRGICYWVRDTVADTP---------PLS--------DVRTISLIPSQAEEHFMLELGLSA  163

Query  60   QLTSENDEVIFGSPGVLNWAGNVIHYNMNTQKPRATIQGPKMAS---------YKGYAVG  110
             +T +N   + G+PGV +W G+V+ +       + +     + S         Y GYA+ 
Sbjct  164  HVTDDNSGFLIGAPGVRSWKGSVLVHRGEDLAAQGSYAVKMLDSWDWVKNHFTYVGYALS  223

Query  111  CGHFNVSDKKQLSYVVTMPNANSETKLGALQIYTAPPSWNKQFPFQLGLTGAQYGEYFGY  170
             G+F+ +++  L YV T P++   T  G   I+       ++        G Q GEYFGY
Sbjct  224  SGYFSSNNRTSLLYVTTAPSSVLNT--GKAYIFDVVGEIVRKLHV---FHGEQLGEYFGY  278

Query  171  SLLVEDLNGDGLDDMLIGAPHHTVNSVFEAGAVYMFINLGRGKQLSFKQTLLESPFSRSG  230
            S++ EDLNGDGL D+++ AP + +   ++ GA+Y+FIN G  K   F++ ++  P S   
Sbjct  279  SVVAEDLNGDGLTDVVVSAPLNALGDSYDVGAIYVFINKGLFK---FEKKIIRLPLSSGA  335

Query  231  HFGTSLGKLGDVNGDDYKDIAIGAPFAGNNGNGAVAIYFGGPNGLDVQPRQILNVSEQLV  290
             FG+SL K+GD+N D Y D+A+GAPFAGN   GAV I+ G  +GL  +P Q L+   +  
Sbjct  336  RFGSSLSKVGDINHDGYNDLAVGAPFAGN---GAVFIFLGSEHGLRDEPSQRLDAPSREP  392

Query  291  ESGG--MFGHGLSRGGDNNTNDYN-LAVGAPNADMVFVYRAYPVVKINATILPKNLIIPT  347
               G  MFG GLSRG D + N +N LA+GAP A+ V++YRAYPVVKI+AT+  ++  I  
Sbjct  393  GPYGAHMFGQGLSRGSDIDGNGFNDLAIGAPGAEAVYLYRAYPVVKIHATVRSESRAIRP  452

Query  348  NTTSLKFDICINIQSNS--MKIRTQELLLDLSVATEEKRINVRHCIGKDPFI---AGLTP  402
               ++    C  +++ S   +++ QEL   +++    +R++       +      AGL+ 
Sbjct  453  EQETITVTACYRLETTSKARQMQQQELTFRMTIDELLQRVSFAPMRTNEVSFQAQAGLSG  512

Query  403  QCLSCNATLIFDDRYIFIPIIMELTYRLKNDGKTQENSEFCSNCAVVDPAWPSMVKAQIQ  462
             C + +  + +    IF PI +EL Y L        +  FC +CAVVDP  P      + 
Sbjct  513  SCRNFSVGVHYTGG-IFTPIDLELHYELAKK-IPHSHEAFCESCAVVDPLEPKYATGTLS  570

Query  463  YLHNCKGLVCFVDLRFEGVEIPKNVILGRGSVLPLKYIITNNGEEAYNTQLIIKSSLNVP  522
            ++  C   VC  DL+    ++  + I G   VL   Y ITN+GE AY  Q  + SS  +P
Sbjct  571  FMTGCAAHVCVSDLQLSSKDVNSSFIFGSLEVLSFSYEITNSGEPAYVAQFNVTSSARLP  630

Query  523  ITKMPAECVGEFEFGWRVECSIAKGRAFKGTAKQELSL--DLSNVVGATEVEINATVHST  580
              K+P  C    E    + C +  GRA      + L++  D++ + G + + I A V S 
Sbjct  631  FAKVPGNCRVRHEV---MLCDLNGGRALARGDSESLTIIFDVTQLSGQS-LTIEAAVSSA  686

Query  581  GKVVTPNVNKSSDKVKLTTTAEIWIAETSTKKIFAGTDGEENIAVSTAFEIQNNGPSPLS  640
            G    P  N  S  + L   AEI  +        A  +   +  V+ ++E +++GPS + 
Sbjct  687  GMDQNPKDNTMSTTISLREYAEIDASGGPIDGHIALKEYPYSAEVNNSYEFKSHGPSIID  746

Query  641  FFHLIVDFPIGFS----------------------GGQYI-------SNYSAQAYFKDLE  671
               + VD PI ++                      G + +       +N  A+ Y   LE
Sbjct  747  ELTVYVDVPIAYTVTGSAGIKSIFNISSLQMQATHGSELVPIKLYDQTNTLAKEY--PLE  804

Query  672  YSSLDFNKSAP-------ASPPTLNTTEILYVNQIPENHTTFVTCQS---TENSETKMSC  721
             SS   N+          A  P +N ++IL    +P N T  + C     T    ++M  
Sbjct  805  DSSRRANRKRRELQQDQYAIMPDVNISDILTKENLPANRTLVLDCLRGNWTICVRSQMRV  864

Query  722  ALSNFHPANALFSGENITLLLNYEMNWKKAEKLLPSNSQYLAHVAMVNLKTDIPINGNLS  781
             L    P         I L ++++++         +   YL     V +  +   + +++
Sbjct  865  QLKPEQP---------IDLRISFKVDLND----FVNTFDYLVIFTNVEMFKEGD-STSIA  910

Query  782  IKQHFK-GAIFKKDAKRNLFWIYLGAIIGGILLLIGMILLLRKLGFFKRLTKEEMEKNLI  840
            +K++ K   IF         W  + ++I G LLL  M  +L KL FFKR  KEE+++ L 
Sbjct  911  LKRNLKPNVIFNYSETPLPIWYIILSLIAGHLLLGAMTYILYKLRFFKRGKKEELKRLLE  970

Query  841  EKREKAR  847
            E R + +
Sbjct  971  EHRSETK  977



Lambda      K        H
   0.319    0.134    0.374 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1750876036


Query= XP_011197391.1 integrin alpha-PS3 isoform X1 [Bactrocera dorsalis]

Length=1145
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ITA3_DROME  unnamed protein product                                   1244    0.0  
ITA5_DROME  unnamed protein product                                   882     0.0  
ITA4_DROME  unnamed protein product                                   845     0.0  


>ITA3_DROME unnamed protein product
Length=1115

 Score = 1244 bits (3219),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 633/1137 (56%), Positives = 825/1137 (73%), Gaps = 52/1137 (5%)

Query  30    PFTYIALLCSIFALIWPADGFNFAKQPNIAVPAPQHLKFFQPQTRSSYFGYTLVMRPTSI  89
             P  ++ALL    ALI   + FNF  +P+  + +P+HLKF   QTRSSYFGYTLV+R TSI
Sbjct  9     PHIFLALL----ALISHIEAFNFMPRPSRVINSPKHLKFHINQTRSSYFGYTLVIRQTSI  64

Query  90    IVGAPRAQSTLPAQRNVNETGAIYRCSLSPTSTCNPYVIDDKGNRTLERSDSYTYDNEAR  149
             IVGAPRAQSTL +QR +NETGAIYRCSL+    C+PYV+D +GN     S+ YT+D+E +
Sbjct  65    IVGAPRAQSTLESQRTINETGAIYRCSLT-NGVCSPYVLDSRGNVDAPYSE-YTFDSERK  122

Query  150   NNQWLGGAMDGGTKDTDKLLICAPRFLSPTISDYIMNGVCYWVADTLDDNPKNVQRISPL  209
             + QWLGG+MDGGTKDTDKLL+CAPRF +P+  D  ++GVCYWV +T+   P++V RISPL
Sbjct  123   DFQWLGGSMDGGTKDTDKLLVCAPRFYAPSSRDNHLHGVCYWVNNTVASTPQHVTRISPL  182

Query  210   RLKSDQMKQI-NGHRI-FYYMLAEEGLSAHVTDNNEEFVIGAPGINTWRGSTIHCRKRFE  267
             RLKS+Q+K+  NG++  F+Y++ E GLSAHV D+N +F+IGAPGINTWRGS I  R+   
Sbjct  183   RLKSEQVKEEDNGNKASFFYIMGELGLSAHVADDNTKFLIGAPGINTWRGSVILYRQVDP  242

Query  268   ED-PTLSRRDTSSLSRKRVIRDLEFSGQYT-------LDTGEL---QNDSYFGYAVGSGY  316
              D PT SRRDTS   R R  RD++ S  YT       + T  L   + DSYFGYAV SG+
Sbjct  243   VDNPTASRRDTSKALR-RTYRDVD-SNDYTPEHYAPEIPTPGLWGQEEDSYFGYAVSSGF  300

Query  317   FDSNDKTELLYVASAPQANLQSGEAYLYKYSEDSLLKLKRIYVFRGEKFGEYFGYSLITE  376
             FDS++ T+LLYVA+APQAN QSGEAY++     S+ K    +VFRGE+FGEYFGYS++ E
Sbjct  301   FDSSNPTKLLYVATAPQANKQSGEAYIFDVRGKSIHKY---HVFRGEQFGEYFGYSVLAE  357

Query  377   DLNGDGLTDVVISAPQYSSTNYFDNGAIYVFLNKGNFNFERKLIISPVQGKARFGTTLSR  436
             DLNGDG TDV++SAPQ++  +  DNGAIYVF+NKG FNFER+++ SPV+  ARFGT LSR
Sbjct  358   DLNGDGKTDVIVSAPQHALEDSHDNGAIYVFINKGFFNFERQILRSPVETMARFGTALSR  417

Query  437   LGDINHDGFNDIAVGAPFAGNGAVFVYLGSSNGLREEHSQRLDAPESVSSKYGEHMFGHG  496
             LGDINHDG+ND+AVGAPFAGNG VF+YLGS NGLR++ SQRLDAP    SKYG HMFGHG
Sbjct  418   LGDINHDGYNDVAVGAPFAGNGTVFIYLGSENGLRDQPSQRLDAPSQQPSKYGSHMFGHG  477

Query  497   LSKGVDIDRNGFNDFAIGAPNAEAVFVYRAYPVVKIHATVKSATREIKTDQNSFKITACY  556
             LS+G DID NGFNDFAIGAPNAEAV++YRAYPVVK+HATVKS +REIK +Q   KITACY
Sbjct  478   LSRGSDIDGNGFNDFAIGAPNAEAVYLYRAYPVVKVHATVKSESREIKPEQEKVKITACY  537

Query  557   KISTTSTQ--LTGQDLAIRIVVDSQVKRAKFIQTRTNEISFNVSAGLQEQCRTFDCEVYT  614
             ++STTST   +  Q+LAIRI +D Q+KR KF QT+TNEISF V+A   EQCR F+ +V  
Sbjct  538   RLSTTSTDKLVQEQELAIRIAMDKQLKRVKFTQTQTNEISFKVNANFGEQCRDFETQVRY  597

Query  615   NVADIFKPIELDMHYELINGVPKTEAFCDKCAAVDPAEPSIYREKIIFSTGCSSDICVAD  674
             +  DIF PI+L+MHYEL   VP +E FC+ CA VDP EP +  + IIFSTGC++D+C AD
Sbjct  598   SEKDIFTPIDLEMHYELTKKVPDSEEFCETCAIVDPTEPKVSTQNIIFSTGCATDVCTAD  657

Query  675   LEVKSRDLNHTYILGSSRTLSVTYDITNHGETAYLPQISFTSSNHMPFAKIPGTCRPKEN  734
             L+++S+D++ TYILGS+ TL + Y+ITN GETAYLPQ + TS++ + FA++PG C+  + 
Sbjct  658   LQLRSKDVSPTYILGSADTLRLNYEITNIGETAYLPQFNVTSTSRLAFAQVPGNCKVVDA  717

Query  735   DYLECDLKSNDVSMAKGATTSFTVTFDVSSISGKAMVLTARVFSTGKEANEANNVATDVI  794
               + CDL      +AKG T S T++FDVS +SG+++++ A VFSTG E N  +N  T+VI
Sbjct  718   -VMVCDLNRGR-PLAKGDTDSVTISFDVSQLSGQSLIIHAEVFSTGYEQNPTDNRQTNVI  775

Query  795   TLGEFTEIDVVGIPKTKHINLEEVSNTSQIINNYEIKSMGPSTVGTIDVVFYIPVAYKVP  854
              L EFTEID  G      I+LE  SN+++I+NNYEIKS GPS +  + V FYIP+AYKV 
Sbjct  776   GLKEFTEIDASGGQTNSQIDLEHYSNSAEIVNNYEIKSNGPSVIEQLTVSFYIPIAYKVA  835

Query  855   GTTNTIQIVEKDRINMQAVSDAQTVAID-YFENNTQLVMNAIEITSSTHSTAS---INSN  910
             G+T  I I+    + MQA  D+Q ++ID Y +NNT LV++ +E+T++         I  N
Sbjct  836   GSTAIIPIINVTSLKMQASYDSQLLSIDLYDQNNTMLVVDPVEVTTTLSGGLERTVITQN  895

Query  911   IQIYKEKQISTTYDSMGLYDLPVESDNYYIDDSSKFSQMSIRRKREAAANTATKAQYERI  970
              Q Y        + +M + D  + +           + MS R++R+  A TA + QY RI
Sbjct  896   RQSYDIHTSGHVHQTMEVLDTSMVAT----------ASMS-RKRRDLKALTANREQYARI  944

Query  971   --VKSHELLSEDLKGKLPVNRTIVFNCHDPEMTVCVRAVIRLHTFKPEKPLTVSMKYQVD  1028
               VK+H+LLS+D KGKLPVNRTIVFNC DPEMT+CVRA +R+H F+PEK + ++M+Y VD
Sbjct  945   SNVKAHDLLSDDFKGKLPVNRTIVFNCRDPEMTICVRAEMRVH-FRPEKSINLNMRYSVD  1003

Query  1029  LREINQILIEPWEYFVILIDVDVKKLGDLHQNTLAIRKNIDYNIVSKHQLYGTPIWVYIL  1088
             L E+N IL++PWEYFVIL D+ ++K GD    + +I + I+ NI+SKHQ  G PIW+ I+
Sbjct  1004  LNEVNAILVDPWEYFVILTDLKLQKKGDPTSTSFSINRRIEPNIISKHQETGLPIWIIIV  1063

Query  1089  AVLGGLLLLAAITYAMYKLGFFKRAKKEQMDALVHQGSTQPAQDVEPEAENLNTERN  1145
             +V+GGLLLL+AI+Y +YK GFF R KK+++D LV Q        VEPEAENLN+  N
Sbjct  1064  SVIGGLLLLSAISYLLYKFGFFNRTKKDELDRLVQQNP------VEPEAENLNSGGN  1114


>ITA5_DROME unnamed protein product
Length=1000

 Score = 882 bits (2280),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 474/1110 (43%), Positives = 676/1110 (61%), Gaps = 133/1110 (12%)

Query  50    FNFAKQPNIAVPAPQHLKFFQPQTRSSYFGYTLVMRPTSIIVGAPRAQSTLPAQRNVNET  109
              NF+  PN  + AP+HLK    Q RSSYFGY+LV+RPTSI VGAPRAQSTL +Q ++NET
Sbjct  1     MNFSPLPNRVIDAPKHLKTRMIQVRSSYFGYSLVIRPTSIFVGAPRAQSTLESQGSINET  60

Query  110   GAIYRCSLSPTSTCNPYVIDDKGNRTLERSDSYTYDNEARNNQWLGGAMDGGTKDTDKLL  169
             GA+YRC L+ + +C+ YV++DK N+                 QWLGG+MDGGTKDTDKLL
Sbjct  61    GAVYRCPLA-SGSCSHYVLNDKLNKQF---------------QWLGGSMDGGTKDTDKLL  104

Query  170   ICAPRFLSPTISDY-IMNGVCYWVADTLDDNP--KNVQRISPLRLKSDQMKQINGHRIFY  226
             +CAPRF  P   +Y  M G+CYWV DT+ D P   +V+ IS +  ++++          +
Sbjct  105   VCAPRFFVPKNKNYGQMRGICYWVRDTVADTPPLSDVRTISLIPSQAEE----------H  154

Query  227   YMLAEEGLSAHVTDNNEEFVIGAPGINTWRGSTIHCRKRFEEDPTLSRRDTSSLSRKRVI  286
             +ML E GLSAHVTD+N  F+IGAPG+ +W+GS +  R                       
Sbjct  155   FML-ELGLSAHVTDDNSGFLIGAPGVRSWKGSVLVHRGE---------------------  192

Query  287   RDLEFSGQYT---LDTGELQND--SYFGYAVGSGYFDSNDKTELLYVASAPQANLQSGEA  341
              DL   G Y    LD+ +   +  +Y GYA+ SGYF SN++T LLYV +AP + L +G+A
Sbjct  193   -DLAAQGSYAVKMLDSWDWVKNHFTYVGYALSSGYFSSNNRTSLLYVTTAPSSVLNTGKA  251

Query  342   YLYKYSEDSLLKLKRIYVFRGEKFGEYFGYSLITEDLNGDGLTDVVISAPQYSSTNYFDN  401
             Y++    + + KL   +VF GE+ GEYFGYS++ EDLNGDGLTDVV+SAP  +  + +D 
Sbjct  252   YIFDVVGEIVRKL---HVFHGEQLGEYFGYSVVAEDLNGDGLTDVVVSAPLNALGDSYDV  308

Query  402   GAIYVFLNKGNFNFERKLIISPVQGKARFGTTLSRLGDINHDGFNDIAVGAPFAGNGAVF  461
             GAIYVF+NKG F FE+K+I  P+   ARFG++LS++GDINHDG+ND+AVGAPFAGNGAVF
Sbjct  309   GAIYVFINKGLFKFEKKIIRLPLSSGARFGSSLSKVGDINHDGYNDLAVGAPFAGNGAVF  368

Query  462   VYLGSSNGLREEHSQRLDAPESVSSKYGEHMFGHGLSKGVDIDRNGFNDFAIGAPNAEAV  521
             ++LGS +GLR+E SQRLDAP      YG HMFG GLS+G DID NGFND AIGAP AEAV
Sbjct  369   IFLGSEHGLRDEPSQRLDAPSREPGPYGAHMFGQGLSRGSDIDGNGFNDLAIGAPGAEAV  428

Query  522   FVYRAYPVVKIHATVKSATREIKTDQNSFKITACYKISTTST--QLTGQDLAIRIVVDSQ  579
             ++YRAYPVVKIHATV+S +R I+ +Q +  +TACY++ TTS   Q+  Q+L  R+ +D  
Sbjct  429   YLYRAYPVVKIHATVRSESRAIRPEQETITVTACYRLETTSKARQMQQQELTFRMTIDEL  488

Query  580   VKRAKFIQTRTNEISFNVSAGLQEQCRTFDCEVYTNVADIFKPIELDMHYELINGVPKT-  638
             ++R  F   RTNE+SF   AGL   CR F   V+     IF PI+L++HYEL   +P + 
Sbjct  489   LQRVSFAPMRTNEVSFQAQAGLSGSCRNFSVGVHY-TGGIFTPIDLELHYELAKKIPHSH  547

Query  639   EAFCDKCAAVDPAEPSIYREKIIFSTGCSSDICVADLEVKSRDLNHTYILGSSRTLSVTY  698
             EAFC+ CA VDP EP      + F TGC++ +CV+DL++ S+D+N ++I GS   LS +Y
Sbjct  548   EAFCESCAVVDPLEPKYATGTLSFMTGCAAHVCVSDLQLSSKDVNSSFIFGSLEVLSFSY  607

Query  699   DITNHGETAYLPQISFTSSNHMPFAKIPGTCRPKENDYLECDLKSNDVSMAKGATTSFTV  758
             +ITN GE AY+ Q + TSS  +PFAK+PG CR + ++ + CDL     ++A+G + S T+
Sbjct  608   EITNSGEPAYVAQFNVTSSARLPFAKVPGNCRVR-HEVMLCDLNGGR-ALARGDSESLTI  665

Query  759   TFDVSSISGKAMVLTARVFSTGKEANEANNVATDVITLGEFTEIDVVGIPKTKHINLEEV  818
              FDV+ +SG+++ + A V S G + N  +N  +  I+L E+ EID  G P   HI L+E 
Sbjct  666   IFDVTQLSGQSLTIEAAVSSAGMDQNPKDNTMSTTISLREYAEIDASGGPIDGHIALKEY  725

Query  819   SNTSQIINNYEIKSMGPSTVGTIDVVFYIPVAYKVPGTTNTIQIVEKDRINMQAVSDAQT  878
               ++++ N+YE KS GPS +  + V   +P+AY V G+     I     + MQA   ++ 
Sbjct  726   PYSAEVNNSYEFKSHGPSIIDELTVYVDVPIAYTVTGSAGIKSIFNISSLQMQATHGSEL  785

Query  879   VAIDYFENNTQLVMNAIEITSSTHSTASINSNIQIYKEKQISTTYDSMGLYDLPVESDNY  938
             V I  ++    L                                            +  Y
Sbjct  786   VPIKLYDQTNTL--------------------------------------------AKEY  801

Query  939   YIDDSSKFSQMSIRRKREAAANTATKAQYERI--VKSHELLSEDLKGKLPVNRTIVFNCH  996
              ++DSS+ +    R++RE   +     QY  +  V   ++L+   K  LP NRT+V +C 
Sbjct  802   PLEDSSRRAN---RKRRELQQD-----QYAIMPDVNISDILT---KENLPANRTLVLDCL  850

Query  997   DPEMTVCVRAVIRLHTFKPEKPLTVSMKYQVDLREINQILIEPWEYFVILIDVDVKKLGD  1056
                 T+CVR+ +R+   KPE+P+ + + ++VDL +     +  ++Y VI  +V++ K GD
Sbjct  851   RGNWTICVRSQMRVQ-LKPEQPIDLRISFKVDLND----FVNTFDYLVIFTNVEMFKEGD  905

Query  1057  LHQNTLAIRKNIDYNIVSKHQLYGTPIWVYILAVLGGLLLLAAITYAMYKLGFFKRAKKE  1116
                 ++A+++N+  N++  +     PIW  IL+++ G LLL A+TY +YKL FFKR KKE
Sbjct  906   --STSIALKRNLKPNVIFNYSETPLPIWYIILSLIAGHLLLGAMTYILYKLRFFKRGKKE  963

Query  1117  QMDALV--HQGST-QPAQDVEPEAENLNTE  1143
             ++  L+  H+  T +PA D E   E +N E
Sbjct  964   ELKRLLEEHRSETKEPATDCEGNQEEINVE  993


>ITA4_DROME unnamed protein product
Length=1069

 Score = 845 bits (2184),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 467/1106 (42%), Positives = 660/1106 (60%), Gaps = 96/1106 (9%)

Query  33    YIALLCSIFALIWPADGFNFAKQPNIAVPAPQHLKFFQPQTRSSYFGYTLVMRPTSIIVG  92
             +  L+  + AL    + +N +  PN  +  P+     +   RSSYFG++LV+R  SI+V 
Sbjct  2     FCLLVIVLLALQSEINAYNISPYPNSVLNFPE----LEGNRRSSYFGFSLVIREKSIMVA  57

Query  93    APRAQSTLPAQRNVNETGAIYRCSLSPTSTCNPYVIDDKGN-RTLERSDSYTYDNEARNN  151
             APRA S+L AQRN++E G I+RC     + C+PY ID KGN + +      T  N  ++ 
Sbjct  58    APRANSSLEAQRNISEPGVIFRCYFESGNNCSPYNIDTKGNYKGMPNDGLLTAKN--KDF  115

Query  152   QWLGGAMDGGTKDTDKLLICAPRFLSPTISDYIMNGVCYWVADTLDDNPKNVQRIS----  207
             +WLGGAMDGGT+D+DK L+CAPRF S    +   NG+CYW++DT    PKN+        
Sbjct  116   RWLGGAMDGGTRDSDKFLVCAPRFYSINNENDYNNGMCYWLSDT----PKNIDSTEVMEK  171

Query  208   -PLRLKSDQ-MKQINGHRIFYYMLAEEGLSAHVTDNNEEFVIGAPGINTWRGSTIHCRKR  265
              PLR++  Q +K  + + I YY + E GLSAHV+D+N + ++GAPGI+ W+GS +H ++ 
Sbjct  172   WPLRIEKKQVLKLADTNLIPYYSMGELGLSAHVSDDNSKLLMGAPGIDQWKGS-VHLKQE  230

Query  266   FEEDPTLSRRDTSSLSRKRVIRDLEFSGQYTLDTGELQNDSYFGYAVGSGYFDSNDKTEL  325
                  T S R    ++  R   +     +   + G+ +  SYFGYAV SGYFDS++ + +
Sbjct  231   VPSIKTSSGRQRRGMNTNRKCNECNPEPK---NFGQ-EEFSYFGYAVSSGYFDSSNLSTV  286

Query  326   LYVASAPQANLQSGEAYLYKYSEDSLLKLKRIYVFRGEKFGEYFGYSLITEDLNGDGLTD  385
             LYVA+AP+ N Q GEAY++   EDS+ K      FRG  FGEYFGYS++ EDLNGDG TD
Sbjct  287   LYVATAPRGNNQFGEAYIFDIYEDSIYKYHE---FRGNHFGEYFGYSVLAEDLNGDGKTD  343

Query  386   VVISAPQYSSTNYFDNGAIYVFLNKGNFNFERKLIISPVQGKARFGTTLSRLGDINHDGF  445
             V+ISAP Y+  N +D+GAIYVF+NKG+F FE ++I SP     RFGTTLSR+GDIN DG+
Sbjct  344   VIISAPLYALRNSYDDGAIYVFINKGSFTFEERIIRSPAGSGGRFGTTLSRIGDINKDGY  403

Query  446   NDIAVGAPFAGNGAVFVYLGSSNGLREEHSQRLDAPESVSSKYGEHMFGHGLSKGVDIDR  505
             ND+AVGAPFAGNG+VF+YLGS NGLR+  SQ LDAP    SKYG +MFGHGLS+G DID 
Sbjct  404   NDVAVGAPFAGNGSVFIYLGSENGLRDPPSQCLDAPSQQPSKYGSYMFGHGLSRGSDIDG  463

Query  506   NGFNDFAIGAPNAEAVFVYRAYPVVKIHATVKSATREIKTDQNSFKITACYKISTTSTQ-  564
             NGFNDFAIGAPNAEAV++YRAYPVVKIHA +K   + +  ++    IT CY++S+ S   
Sbjct  464   NGFNDFAIGAPNAEAVYLYRAYPVVKIHAIIKPKLQNVNPEEERVNITVCYRLSSKSDSK  523

Query  565   ---LTGQDLAIRIVVD--SQVKRAKFIQTRTNEISFNVSAGLQEQCRTFDCEVYTNVADI  619
                L  Q+L IRI +D  S++K A F +   +++SF   A  +E C  F  E+       
Sbjct  524   AKALMEQELVIRIDIDTKSKIKLAVFDEEHGSQMSFKAKAFHEEICSEFQIEMDKRAK--  581

Query  620   FKPIELDMHYELINGVPKTEAFCDKCAAVDPAEPSIYREKIIFSTGCSSDICVADLEVKS  679
             F PI L+M YEL   +P +  FC+ CA VDPAEP    E I F+TGC++D+CVADL++  
Sbjct  582   FTPIALEMQYELSKKIPNSGDFCEDCAVVDPAEPKFVTEYITFNTGCATDVCVADLKISC  641

Query  680   RDLNHTYILGSSRTLSVTYDITNHGETAYLPQISFTSSNHMPFAKIPGTCRPKENDYLEC  739
              + + T +LG++  L +TY+ITN+GE AY P+ S T+S  +  A++PG C+  E   + C
Sbjct  642   INASSTLVLGTTAVLRLTYNITNNGEFAYHPKFSVTNSAGLSLAQVPGNCKVNE-AVMVC  700

Query  740   DLKSNDVSMAKGATTSFTVTFDVSSISGKAMVLTARVFSTGKEANEANNVATDVITLGEF  799
             DL      MAKG T S T++FDV  + G+++ + A V S   E+N  NN  T+V++L E 
Sbjct  701   DLNHGQ-RMAKGDTDSLTISFDVRQLRGRSLEIQAEVLSARDESNPENNKLTNVLSLREK  759

Query  800   TEIDVVGIPKTKHINLEEVSNTSQIINNYEIKSMGPSTVGTIDVVFYIPVAYKVPGTTNT  859
              +I V G+    H+ L+E   T++++N YEIKS GPST+  + V  YIPVAYK P +TN 
Sbjct  760   ADIYVSGVQTNDHVVLKESPYTAEVVNYYEIKSHGPSTLENLTVSLYIPVAYKTPDSTNV  819

Query  860   IQIVEKDRINMQAVSDAQTVAIDYFENNTQLVMNAIEITSSTHSTASINSNIQIYKEKQI  919
               IV      +Q+    + + I++ + N  L                             
Sbjct  820   KHIVTSSP-KIQSKYAHKIMPINFIDQNNAL-----------------------------  849

Query  920   STTYDSMGLYDLPVESDNYYIDDSSKFSQMSIRRKREAAANTATKAQYERIVKSHELLSE  979
                            ++N+ ID        S   + E   N +   +      S  LL+E
Sbjct  850   ---------------ANNFAIDHDQSTLLFSATPQHENVGNLSGIVEQN---PSISLLNE  891

Query  980   DLKGKLPVNRTIVFNCHDPEMTVCVRAVIRLHT---FKPEKPLTVSMKYQVDLREINQIL  1036
             D    LPVN T+V NC D  +T+CV   IRL      KPE+ + +++ + V+L++ + I 
Sbjct  892   D----LPVNNTLVLNCQDTNVTLCVPVEIRLENGLQLKPEELMNMTVSFTVNLKDADDI-  946

Query  1037  IEPWEYFVILIDVDVKKLGDLHQNTLAIRKNIDYNIVSKHQLYGTPIWVYILAVLGGLLL  1096
                WEYFVI  D+ V K+GD   ++  I K I+ N++ KH      IW  I++V+ G+L+
Sbjct  947   ---WEYFVIQTDLKVHKIGDPTLSSFTIEKKIESNVICKHA--EIAIWKIIVSVIVGILV  1001

Query  1097  LAAITYAMYKLGFFKRAKKEQMDALV  1122
              +A TYA+YK GFFKRA K+ +  L+
Sbjct  1002  FSAATYALYKRGFFKRAIKDDLKQLI  1027



Lambda      K        H
   0.319    0.134    0.374 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1750876036


Query= XP_011197392.1 integrin alpha-PS3 isoform X2 [Bactrocera dorsalis]

Length=1120
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ITA3_DROME  unnamed protein product                                   1218    0.0  
ITA5_DROME  unnamed protein product                                   864     0.0  
ITA4_DROME  unnamed protein product                                   850     0.0  


>ITA3_DROME unnamed protein product
Length=1115

 Score = 1218 bits (3152),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 617/1129 (55%), Positives = 812/1129 (72%), Gaps = 49/1129 (4%)

Query  14    LVFLTLFHRLAAYNLSPKPNIIVKDPQ-FATGLPKVESSYFGFTINLRPLGIIVGAPRAQ  72
             L  L L   + A+N  P+P+ ++  P+     + +  SSYFG+T+ +R   IIVGAPRAQ
Sbjct  13    LALLALISHIEAFNFMPRPSRVINSPKHLKFHINQTRSSYFGYTLVIRQTSIIVGAPRAQ  72

Query  73    STLPAQRNVNETGAIYRCSLSPTSTCNPYVIDDKGNRTLERSDSYTYDNEARNNQWLGGA  132
             STL +QR +NETGAIYRCSL+    C+PYV+D +GN     S+ YT+D+E ++ QWLGG+
Sbjct  73    STLESQRTINETGAIYRCSLT-NGVCSPYVLDSRGNVDAPYSE-YTFDSERKDFQWLGGS  130

Query  133   MDGGTKDTDKLLICAPRFLSPTISDYIMNGVCYWVADTLDDNPKNVQRISPLRLKSDQMK  192
             MDGGTKDTDKLL+CAPRF +P+  D  ++GVCYWV +T+   P++V RISPLRLKS+Q+K
Sbjct  131   MDGGTKDTDKLLVCAPRFYAPSSRDNHLHGVCYWVNNTVASTPQHVTRISPLRLKSEQVK  190

Query  193   QI-NGHRI-FYYMLAEEGLSAHVTDNNEEFVIGAPGINTWRGSTIHCRKRFEED-PTLSR  249
             +  NG++  F+Y++ E GLSAHV D+N +F+IGAPGINTWRGS I  R+    D PT SR
Sbjct  191   EEDNGNKASFFYIMGELGLSAHVADDNTKFLIGAPGINTWRGSVILYRQVDPVDNPTASR  250

Query  250   RDTSSLSRKRVIRDLEFSGQYT-------LDTGEL---QNDSYFGYAVGSGYFDSNDKTE  299
             RDTS   R R  RD++ S  YT       + T  L   + DSYFGYAV SG+FDS++ T+
Sbjct  251   RDTSKALR-RTYRDVD-SNDYTPEHYAPEIPTPGLWGQEEDSYFGYAVSSGFFDSSNPTK  308

Query  300   LLYVASAPQANLQSGEAYLYKYSEDSLLKLKRIYVFRGEKFGEYFGYSLITEDLNGDGLT  359
             LLYVA+APQAN QSGEAY++     S+ K    +VFRGE+FGEYFGYS++ EDLNGDG T
Sbjct  309   LLYVATAPQANKQSGEAYIFDVRGKSIHKY---HVFRGEQFGEYFGYSVLAEDLNGDGKT  365

Query  360   DVVISAPQYSSTNYFDNGAIYVFLNKGNFNFERKLIISPVQGKARFGTTLSRLGDINHDG  419
             DV++SAPQ++  +  DNGAIYVF+NKG FNFER+++ SPV+  ARFGT LSRLGDINHDG
Sbjct  366   DVIVSAPQHALEDSHDNGAIYVFINKGFFNFERQILRSPVETMARFGTALSRLGDINHDG  425

Query  420   FNDIAVGAPFAGNGAVFVYLGSSNGLREEHSQRLDAPESVSSKYGEHMFGHGLSKGVDID  479
             +ND+AVGAPFAGNG VF+YLGS NGLR++ SQRLDAP    SKYG HMFGHGLS+G DID
Sbjct  426   YNDVAVGAPFAGNGTVFIYLGSENGLRDQPSQRLDAPSQQPSKYGSHMFGHGLSRGSDID  485

Query  480   RNGFNDFAIGAPNAEAVFVYRAYPVVKIHATVKSATREIKTDQNSFKITACYKISTTSTQ  539
              NGFNDFAIGAPNAEAV++YRAYPVVK+HATVKS +REIK +Q   KITACY++STTST 
Sbjct  486   GNGFNDFAIGAPNAEAVYLYRAYPVVKVHATVKSESREIKPEQEKVKITACYRLSTTSTD  545

Query  540   --LTGQDLAIRIVVDSQVKRAKFIQTRTNEISFNVSAGLQEQCRTFDCEVYTNVADIFKP  597
               +  Q+LAIRI +D Q+KR KF QT+TNEISF V+A   EQCR F+ +V  +  DIF P
Sbjct  546   KLVQEQELAIRIAMDKQLKRVKFTQTQTNEISFKVNANFGEQCRDFETQVRYSEKDIFTP  605

Query  598   IELDMHYELINGVPKTEAFCDKCAAVDPAEPSIYREKIIFSTGCSSDICVADLEVKSRDL  657
             I+L+MHYEL   VP +E FC+ CA VDP EP +  + IIFSTGC++D+C ADL+++S+D+
Sbjct  606   IDLEMHYELTKKVPDSEEFCETCAIVDPTEPKVSTQNIIFSTGCATDVCTADLQLRSKDV  665

Query  658   NHTYILGSSRTLSVTYDITNHGETAYLPQISFTSSNHMPFAKIPGTCRPKENDYLECDLK  717
             + TYILGS+ TL + Y+ITN GETAYLPQ + TS++ + FA++PG C+  +   + CDL 
Sbjct  666   SPTYILGSADTLRLNYEITNIGETAYLPQFNVTSTSRLAFAQVPGNCKVVDA-VMVCDLN  724

Query  718   SNDVSMAKGATTSFTVTFDVSSISGKAMVLTARVFSTGKEANEANNVATDVITLGEFTEI  777
                  +AKG T S T++FDVS +SG+++++ A VFSTG E N  +N  T+VI L EFTEI
Sbjct  725   RGR-PLAKGDTDSVTISFDVSQLSGQSLIIHAEVFSTGYEQNPTDNRQTNVIGLKEFTEI  783

Query  778   DVVGIPKTKHINLEEVSNTSQIINNYEIKSMGPSTVGTIDVVFYIPVAYKVPGTTNTIQI  837
             D  G      I+LE  SN+++I+NNYEIKS GPS +  + V FYIP+AYKV G+T  I I
Sbjct  784   DASGGQTNSQIDLEHYSNSAEIVNNYEIKSNGPSVIEQLTVSFYIPIAYKVAGSTAIIPI  843

Query  838   VEKDRINMQAVSDAQTVAID-YFENNTQLVMNAIEITSSTHSTAS---INSNIQIYKEKQ  893
             +    + MQA  D+Q ++ID Y +NNT LV++ +E+T++         I  N Q Y    
Sbjct  844   INVTSLKMQASYDSQLLSIDLYDQNNTMLVVDPVEVTTTLSGGLERTVITQNRQSYDIHT  903

Query  894   ISTTYDSMGLYDLPVESDNYYIDDSSKFSQMSIRRKREAAANTATKAQYERI--VKSHEL  951
                 + +M + D  + +           + MS R++R+  A TA + QY RI  VK+H+L
Sbjct  904   SGHVHQTMEVLDTSMVAT----------ASMS-RKRRDLKALTANREQYARISNVKAHDL  952

Query  952   LSEDLKGKLPVNRTIVFNCHDPEMTVCVRAVIRLHTFKPEKPLTVSMKYQVDLREINQIL  1011
             LS+D KGKLPVNRTIVFNC DPEMT+CVRA +R+H F+PEK + ++M+Y VDL E+N IL
Sbjct  953   LSDDFKGKLPVNRTIVFNCRDPEMTICVRAEMRVH-FRPEKSINLNMRYSVDLNEVNAIL  1011

Query  1012  IEPWEYFVILIDVDVKKLGDLHQNTLAIRKNIDYNIVSKHQLYGTPIWVYILAVLGGLLL  1071
             ++PWEYFVIL D+ ++K GD    + +I + I+ NI+SKHQ  G PIW+ I++V+GGLLL
Sbjct  1012  VDPWEYFVILTDLKLQKKGDPTSTSFSINRRIEPNIISKHQETGLPIWIIIVSVIGGLLL  1071

Query  1072  LAAITYAMYKLGFFKRAKKEQMDALVHQGSTQPAQDVEPEAENLNTERN  1120
             L+AI+Y +YK GFF R KK+++D LV Q        VEPEAENLN+  N
Sbjct  1072  LSAISYLLYKFGFFNRTKKDELDRLVQQNP------VEPEAENLNSGGN  1114


>ITA5_DROME unnamed protein product
Length=1000

 Score = 864 bits (2232),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 466/1109 (42%), Positives = 672/1109 (61%), Gaps = 134/1109 (12%)

Query  27    NLSPKPNIIVKDPQ-FATGLPKVESSYFGFTINLRPLGIIVGAPRAQSTLPAQRNVNETG  85
             N SP PN ++  P+   T + +V SSYFG+++ +RP  I VGAPRAQSTL +Q ++NETG
Sbjct  2     NFSPLPNRVIDAPKHLKTRMIQVRSSYFGYSLVIRPTSIFVGAPRAQSTLESQGSINETG  61

Query  86    AIYRCSLSPTSTCNPYVIDDKGNRTLERSDSYTYDNEARNNQWLGGAMDGGTKDTDKLLI  145
             A+YRC L+ + +C+ YV++DK N+                 QWLGG+MDGGTKDTDKLL+
Sbjct  62    AVYRCPLA-SGSCSHYVLNDKLNKQF---------------QWLGGSMDGGTKDTDKLLV  105

Query  146   CAPRFLSPTISDY-IMNGVCYWVADTLDDNP--KNVQRISPLRLKSDQMKQINGHRIFYY  202
             CAPRF  P   +Y  M G+CYWV DT+ D P   +V+ IS +  ++++          ++
Sbjct  106   CAPRFFVPKNKNYGQMRGICYWVRDTVADTPPLSDVRTISLIPSQAEE----------HF  155

Query  203   MLAEEGLSAHVTDNNEEFVIGAPGINTWRGSTIHCRKRFEEDPTLSRRDTSSLSRKRVIR  262
             ML E GLSAHVTD+N  F+IGAPG+ +W+GS +  R                        
Sbjct  156   ML-ELGLSAHVTDDNSGFLIGAPGVRSWKGSVLVHRGE----------------------  192

Query  263   DLEFSGQYT---LDTGELQND--SYFGYAVGSGYFDSNDKTELLYVASAPQANLQSGEAY  317
             DL   G Y    LD+ +   +  +Y GYA+ SGYF SN++T LLYV +AP + L +G+AY
Sbjct  193   DLAAQGSYAVKMLDSWDWVKNHFTYVGYALSSGYFSSNNRTSLLYVTTAPSSVLNTGKAY  252

Query  318   LYKYSEDSLLKLKRIYVFRGEKFGEYFGYSLITEDLNGDGLTDVVISAPQYSSTNYFDNG  377
             ++    + + KL   +VF GE+ GEYFGYS++ EDLNGDGLTDVV+SAP  +  + +D G
Sbjct  253   IFDVVGEIVRKL---HVFHGEQLGEYFGYSVVAEDLNGDGLTDVVVSAPLNALGDSYDVG  309

Query  378   AIYVFLNKGNFNFERKLIISPVQGKARFGTTLSRLGDINHDGFNDIAVGAPFAGNGAVFV  437
             AIYVF+NKG F FE+K+I  P+   ARFG++LS++GDINHDG+ND+AVGAPFAGNGAVF+
Sbjct  310   AIYVFINKGLFKFEKKIIRLPLSSGARFGSSLSKVGDINHDGYNDLAVGAPFAGNGAVFI  369

Query  438   YLGSSNGLREEHSQRLDAPESVSSKYGEHMFGHGLSKGVDIDRNGFNDFAIGAPNAEAVF  497
             +LGS +GLR+E SQRLDAP      YG HMFG GLS+G DID NGFND AIGAP AEAV+
Sbjct  370   FLGSEHGLRDEPSQRLDAPSREPGPYGAHMFGQGLSRGSDIDGNGFNDLAIGAPGAEAVY  429

Query  498   VYRAYPVVKIHATVKSATREIKTDQNSFKITACYKISTTST--QLTGQDLAIRIVVDSQV  555
             +YRAYPVVKIHATV+S +R I+ +Q +  +TACY++ TTS   Q+  Q+L  R+ +D  +
Sbjct  430   LYRAYPVVKIHATVRSESRAIRPEQETITVTACYRLETTSKARQMQQQELTFRMTIDELL  489

Query  556   KRAKFIQTRTNEISFNVSAGLQEQCRTFDCEVYTNVADIFKPIELDMHYELINGVPKT-E  614
             +R  F   RTNE+SF   AGL   CR F   V+     IF PI+L++HYEL   +P + E
Sbjct  490   QRVSFAPMRTNEVSFQAQAGLSGSCRNFSVGVHY-TGGIFTPIDLELHYELAKKIPHSHE  548

Query  615   AFCDKCAAVDPAEPSIYREKIIFSTGCSSDICVADLEVKSRDLNHTYILGSSRTLSVTYD  674
             AFC+ CA VDP EP      + F TGC++ +CV+DL++ S+D+N ++I GS   LS +Y+
Sbjct  549   AFCESCAVVDPLEPKYATGTLSFMTGCAAHVCVSDLQLSSKDVNSSFIFGSLEVLSFSYE  608

Query  675   ITNHGETAYLPQISFTSSNHMPFAKIPGTCRPKENDYLECDLKSNDVSMAKGATTSFTVT  734
             ITN GE AY+ Q + TSS  +PFAK+PG CR + ++ + CDL     ++A+G + S T+ 
Sbjct  609   ITNSGEPAYVAQFNVTSSARLPFAKVPGNCRVR-HEVMLCDLNGGR-ALARGDSESLTII  666

Query  735   FDVSSISGKAMVLTARVFSTGKEANEANNVATDVITLGEFTEIDVVGIPKTKHINLEEVS  794
             FDV+ +SG+++ + A V S G + N  +N  +  I+L E+ EID  G P   HI L+E  
Sbjct  667   FDVTQLSGQSLTIEAAVSSAGMDQNPKDNTMSTTISLREYAEIDASGGPIDGHIALKEYP  726

Query  795   NTSQIINNYEIKSMGPSTVGTIDVVFYIPVAYKVPGTTNTIQIVEKDRINMQAVSDAQTV  854
              ++++ N+YE KS GPS +  + V   +P+AY V G+     I     + MQA   ++ V
Sbjct  727   YSAEVNNSYEFKSHGPSIIDELTVYVDVPIAYTVTGSAGIKSIFNISSLQMQATHGSELV  786

Query  855   AIDYFENNTQLVMNAIEITSSTHSTASINSNIQIYKEKQISTTYDSMGLYDLPVESDNYY  914
              I  ++    L                                            +  Y 
Sbjct  787   PIKLYDQTNTL--------------------------------------------AKEYP  802

Query  915   IDDSSKFSQMSIRRKREAAANTATKAQYERI--VKSHELLSEDLKGKLPVNRTIVFNCHD  972
             ++DSS+ +    R++RE   +     QY  +  V   ++L+   K  LP NRT+V +C  
Sbjct  803   LEDSSRRAN---RKRRELQQD-----QYAIMPDVNISDILT---KENLPANRTLVLDCLR  851

Query  973   PEMTVCVRAVIRLHTFKPEKPLTVSMKYQVDLREINQILIEPWEYFVILIDVDVKKLGDL  1032
                T+CVR+ +R+   KPE+P+ + + ++VDL +     +  ++Y VI  +V++ K GD 
Sbjct  852   GNWTICVRSQMRVQ-LKPEQPIDLRISFKVDLND----FVNTFDYLVIFTNVEMFKEGD-  905

Query  1033  HQNTLAIRKNIDYNIVSKHQLYGTPIWVYILAVLGGLLLLAAITYAMYKLGFFKRAKKEQ  1092
                ++A+++N+  N++  +     PIW  IL+++ G LLL A+TY +YKL FFKR KKE+
Sbjct  906   -STSIALKRNLKPNVIFNYSETPLPIWYIILSLIAGHLLLGAMTYILYKLRFFKRGKKEE  964

Query  1093  MDALV--HQGST-QPAQDVEPEAENLNTE  1118
             +  L+  H+  T +PA D E   E +N E
Sbjct  965   LKRLLEEHRSETKEPATDCEGNQEEINVE  993


>ITA4_DROME unnamed protein product
Length=1069

 Score = 850 bits (2196),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 469/1103 (43%), Positives = 660/1103 (60%), Gaps = 95/1103 (9%)

Query  11    VLSLVFLTLFHRLAAYNLSPKPNIIVKDPQFATGLPKVESSYFGFTINLRPLGIIVGAPR  70
             +L +V L L   + AYN+SP PN ++  P+         SSYFGF++ +R   I+V APR
Sbjct  4     LLVIVLLALQSEINAYNISPYPNSVLNFPELEGNR---RSSYFGFSLVIREKSIMVAAPR  60

Query  71    AQSTLPAQRNVNETGAIYRCSLSPTSTCNPYVIDDKGN-RTLERSDSYTYDNEARNNQWL  129
             A S+L AQRN++E G I+RC     + C+PY ID KGN + +      T  N  ++ +WL
Sbjct  61    ANSSLEAQRNISEPGVIFRCYFESGNNCSPYNIDTKGNYKGMPNDGLLTAKN--KDFRWL  118

Query  130   GGAMDGGTKDTDKLLICAPRFLSPTISDYIMNGVCYWVADTLDDNPKNVQRIS-----PL  184
             GGAMDGGT+D+DK L+CAPRF S    +   NG+CYW++DT    PKN+         PL
Sbjct  119   GGAMDGGTRDSDKFLVCAPRFYSINNENDYNNGMCYWLSDT----PKNIDSTEVMEKWPL  174

Query  185   RLKSDQ-MKQINGHRIFYYMLAEEGLSAHVTDNNEEFVIGAPGINTWRGSTIHCRKRFEE  243
             R++  Q +K  + + I YY + E GLSAHV+D+N + ++GAPGI+ W+GS +H ++    
Sbjct  175   RIEKKQVLKLADTNLIPYYSMGELGLSAHVSDDNSKLLMGAPGIDQWKGS-VHLKQEVPS  233

Query  244   DPTLSRRDTSSLSRKRVIRDLEFSGQYTLDTGELQNDSYFGYAVGSGYFDSNDKTELLYV  303
               T S R    ++  R   +     +   + G+ +  SYFGYAV SGYFDS++ + +LYV
Sbjct  234   IKTSSGRQRRGMNTNRKCNECNPEPK---NFGQ-EEFSYFGYAVSSGYFDSSNLSTVLYV  289

Query  304   ASAPQANLQSGEAYLYKYSEDSLLKLKRIYVFRGEKFGEYFGYSLITEDLNGDGLTDVVI  363
             A+AP+ N Q GEA