BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= NP_957742.1 NADH dehydrogenase subunit 2 (mitochondrion) [Bactrocera
oleae]

Length=340
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

NU2M_DROME  unnamed protein product                                   410     6e-144
LVSE_DICDI  unnamed protein product                                   30.4    2.7   
M9PI96_DROME  unnamed protein product                                 30.0    3.6   


>NU2M_DROME unnamed protein product
Length=341

 Score = 410 bits (1054),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 221/338 (65%), Positives = 278/338 (82%), Gaps = 1/338 (0%)

Query  1    MFNNSAKIMFFFILMTGTMITVSSNSWLGAWMGLEINLLSFIPLM-NNNNLMSTEASLKY  59
            MFNNS+KI+F  I++ GT+ITV+SNSWLGAWMGLEINLLSFIPL+ +NNNLMSTEASLKY
Sbjct  1    MFNNSSKILFITIMIIGTLITVTSNSWLGAWMGLEINLLSFIPLLSDNNNLMSTEASLKY  60

Query  60   FLTQAMASAVLLFAIMMSYLNNHPIMQDNTIYGDLMITSSLLLKSGAAPFHFWFPNVMEG  119
            FLTQ +AS VLLF+ ++  L N+   + N  +  ++I S+LLLKSGAAPFHFWFPN+MEG
Sbjct  61   FLTQVLASTVLLFSSILLMLKNNMNNEINESFTSMIIMSALLLKSGAAPFHFWFPNMMEG  120

Query  120  LSWMSALTLMTWQKIAPLMLISYTMQSNFIILVIITSTITGSLGGLNQTSLSKLMAFSSI  179
            L+WM+AL LMTWQKIAPLMLISY      +++ +I S I G++GGLNQTSL KLMAFSSI
Sbjct  121  LTWMNALMLMTWQKIAPLMLISYLNIKYLLLISVILSVIIGAIGGLNQTSLRKLMAFSSI  180

Query  180  NHLGWMLAAMQAIESLWIIYFSFYTFLSFSLIFMFNSFKMFHINQLFNSFFSSKILKFTL  239
            NHLGWML+++   ES+W+IYF FY+FLSF L FMFN FK+FH+NQLF+ F +SKILKFTL
Sbjct  181  NHLGWMLSSLMISESIWLIYFFFYSFLSFVLTFMFNIFKLFHLNQLFSWFVNSKILKFTL  240

Query  240  FLNLLSLGGLPPFIGFLPKWLVIQFLVLKNQYILMTIMTVMTLITLFFYLRLCFAAFMLN  299
            F+N LSLGGLPPF+GFLPKWLVIQ L L NQY ++T+M + TLITLFFYLR+C++AFM+N
Sbjct  241  FMNFLSLGGLPPFLGFLPKWLVIQQLTLCNQYFMLTLMMMSTLITLFFYLRICYSAFMMN  300

Query  300  YYENNWPTNMKINFISFKIMLTLSFISTFSLILVSMIY  337
            Y+ENNW   M +N I++ + + ++F S F L L+S+ Y
Sbjct  301  YFENNWIMKMNMNSINYNMYMIMTFFSIFGLFLISLFY  338


>LVSE_DICDI unnamed protein product
Length=2192

 Score = 30.4 bits (67),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 28/60 (47%), Gaps = 0/60 (0%)

Query  64   AMASAVLLFAIMMSYLNNHPIMQDNTIYGDLMITSSLLLKSGAAPFHFWFPNVMEGLSWM  123
                +  LF I++S L +HP  ++  I        S LLKS      +W P+ ++ LS +
Sbjct  600  GSGHSSCLFKILLSLLQHHPAFREQIIETHGFQVISFLLKSTPTSSPYWTPDDIDSLSRL  659


>M9PI96_DROME unnamed protein product
Length=649

 Score = 30.0 bits (66),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 26/51 (51%), Gaps = 1/51 (2%)

Query  158  ITGSLGGLNQTSLSKLMAFSSINHLGWMLA-AMQAIESLWIIYFSFYTFLS  207
            +TG +  L +  LS+ +A  S++ L W    A+Q+   L   YF +   LS
Sbjct  68   LTGDVKALGEWQLSRSVALESLDELNWQATVALQSCRQLEYRYFVYVEDLS  118



Lambda      K        H
   0.332    0.140    0.428 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3457179198


Query= NP_957743.1 cytochrome c oxidase subunit I, partial (mitochondrion)
[Bactrocera oleae]

Length=511
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

COX1_DROME  unnamed protein product                                   938     0.0  
COX1_DICDI  unnamed protein product                                   573     0.0  


>COX1_DROME unnamed protein product
Length=511

 Score = 938 bits (2425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/511 (95%), Positives = 502/511 (98%), Gaps = 0/511 (0%)

Query  1    SRQWLFSTNHKDIGTLYFIFGAWAGMVGTSLSILVRAELGHPGALIGDDQIYNVIVTAHA  60
            SRQWLFSTNHKDIGTLYFIFGAWAGMVGTSLSIL+RAELGHPGALIGDDQIYNVIVTAHA
Sbjct  1    SRQWLFSTNHKDIGTLYFIFGAWAGMVGTSLSILIRAELGHPGALIGDDQIYNVIVTAHA  60

Query  61   FVMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPSLTLLLVSSMVENGA  120
            F+MIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPP+L+LLLVSSMVENGA
Sbjct  61   FIMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPALSLLLVSSMVENGA  120

Query  121  GTGWTVYPPLSSIIAHGGASVDLAIFSLHLAGISSILGAVNFITTVINMRSTGITFDRMP  180
            GTGWTVYPPLS+ IAHGGASVDLAIFSLHLAGISSILGAVNFITTVINMRSTGI+ DRMP
Sbjct  121  GTGWTVYPPLSAGIAHGGASVDLAIFSLHLAGISSILGAVNFITTVINMRSTGISLDRMP  180

Query  181  LFVWAVVLTALLLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLFWFFGHPE  240
            LFVW+VV+TALLLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLFWFFGHPE
Sbjct  181  LFVWSVVITALLLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLFWFFGHPE  240

Query  241  VYILILPGFGMISHIISQESGKKETFGSLGMIYAMMAIGLLGFIVWAHHMFTVGMDVDTR  300
            VYILILPGFGMISHIISQESGKKETFGSLGMIYAM+AIGLLGFIVWAHHMFTVGMDVDTR
Sbjct  241  VYILILPGFGMISHIISQESGKKETFGSLGMIYAMLAIGLLGFIVWAHHMFTVGMDVDTR  300

Query  301  AYFTSATMIIAVPTGIKIFSWLATLHGTQLNYSPAMLWALGFVFLFTVGGLTGVVLAYSS  360
            AYFTSATMIIAVPTGIKIFSWLATLHGTQL+YSPA+LWALGFVFLFTVGGLTGVVLA SS
Sbjct  301  AYFTSATMIIAVPTGIKIFSWLATLHGTQLSYSPAILWALGFVFLFTVGGLTGVVLANSS  360

Query  361  VDIILHDTYYVVAHFHYVLSMGAVFAIMAGFVHWYPLFTGLNLNPNWLKSQFIIMFIGVN  420
            VDIILHDTYYVVAHFHYVLSMGAVFAIMAGF+HWYPLFTGL LN  WLKS FIIMFIGVN
Sbjct  361  VDIILHDTYYVVAHFHYVLSMGAVFAIMAGFIHWYPLFTGLTLNNKWLKSHFIIMFIGVN  420

Query  421  LTFFPQHFLGLAGMPRRYSDYPDAYTTWNVVSTIGSSISLLGILFFLFIIWESLVTQRQV  480
            LTFFPQHFLGLAGMPRRYSDYPDAYTTWN+VSTIGS+ISLLGILFF FIIWESLV+QRQV
Sbjct  421  LTFFPQHFLGLAGMPRRYSDYPDAYTTWNIVSTIGSTISLLGILFFFFIIWESLVSQRQV  480

Query  481  IYPMQLNSSIEWLQNTPPAEHSYSELPLLTN  511
            IYP+QLNSSIEW QNTPPAEHSYSELPLLTN
Sbjct  481  IYPIQLNSSIEWYQNTPPAEHSYSELPLLTN  511


>COX1_DICDI unnamed protein product
Length=764

 Score = 573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/501 (60%), Positives = 381/501 (76%), Gaps = 12/501 (2%)

Query  3    QWLFSTNHKDIGTLYFIFGAWAGMVGTSLSILVRAELGHPGALIGDDQIYNVIVTAHAFV  62
            +W+ S +HK+IGT+Y  F   AG+VGT LS+++R EL     L GD Q YNVIVTAH  +
Sbjct  24   KWIISVDHKNIGTMYTNFSILAGIVGTLLSLVIRMELSTGNMLDGDGQQYNVIVTAHGLI  83

Query  63   MIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPSLTLLLVSSMVENGAGT  122
            MIFF+VMP M+GGF NW +P+M+G+PD+AFPR+NN+S WL+  S  LLL SS V  G GT
Sbjct  84   MIFFVVMPAMLGGFANWFIPIMVGSPDVAFPRLNNISLWLIIVSFFLLLTSSCVGIGVGT  143

Query  123  GWTVYPPLSSIIAHGGASVDLAIFSLHLAGISSILGAVNFITTVINMRSTGITFDRMPLF  182
            GWTVYPPLS++  H G +VD+ I SLH+AG SS+LGA+NF+TTV NM+  G+++ ++ LF
Sbjct  144  GWTVYPPLSTMEYHPGHAVDVGILSLHIAGASSLLGAINFLTTVFNMKIAGLSWSKVSLF  203

Query  183  VWAVVLTALLLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLFWFFGHPEVY  242
            VW++++TA+LL+LSLPVLAG +TML+TDRN  T+FFDP GGGDPILYQHLFWFFGHPEVY
Sbjct  204  VWSILITAVLLVLSLPVLAGGLTMLITDRNFETTFFDPIGGGDPILYQHLFWFFGHPEVY  263

Query  243  ILILPGFGMISHIISQESGKKETFGSLGMIYAMMAIGLLGFIVWAHHMFTVGMDVDTRAY  302
            ILILPGFG++S I+S+ S  K  FG  GMI AM AIG LGF+VWAHHM+TVG+DVDTRAY
Sbjct  264  ILILPGFGLVSIILSKYS-NKGIFGVKGMISAMSAIGFLGFLVWAHHMYTVGLDVDTRAY  322

Query  303  FTSATMIIAVPTGIKIFSWLATLHGTQLNYSPAMLWALGFVFLFTVGGLTGVVLAYSSVD  362
            FT+ATMIIA+PTGIKIFSWLATL G  +  +  ML+ +GF+ LFT+GGLTGVVLA   +D
Sbjct  323  FTAATMIIAIPTGIKIFSWLATLWGGVIKITTPMLFVIGFLVLFTIGGLTGVVLANGGLD  382

Query  363  IILHDTYYVVAHFHYVLSMGAVFAIMAGFVHWYP------LFTGLNLNPNWLKSQFIIMF  416
            I LHDTYYVVAHFHYVLSMGA+FAI AG+ ++Y       LF  +  N    +  F  MF
Sbjct  383  ISLHDTYYVVAHFHYVLSMGAIFAIFAGYYYYYSIMNSTRLFGVVRYNEQLGRIHFWTMF  442

Query  417  IGVNLTFFPQHFLGLAGMPRRYSDYPDAYTTWNVVSTIGSSISLLGILFFLFIIW-----  471
            IGVN+TFFP HFLGLAGMPRR  DYPDAY  WN++++ GS I+  G+LFF+  I+     
Sbjct  443  IGVNVTFFPMHFLGLAGMPRRIGDYPDAYIGWNLIASYGSLITAFGLLFFVVNIFTPYIR  502

Query  472  ESLVTQRQVIYPMQLNSSIEW  492
             S+  +   I  M L+ + +W
Sbjct  503  RSVNIKNGAIILMGLDFARDW  523



Lambda      K        H
   0.332    0.140    0.428 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3457179198


Query= NP_957744.1 cytochrome c oxidase subunit II (mitochondrion)
[Bactrocera oleae]

Length=229
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

COX1_DICDI  unnamed protein product                                   224     1e-68
G5EF47_CAEEL  unnamed protein product                                 29.3    2.9  
Q58SL8_DROME  unnamed protein product                                 27.7    8.2  


>COX1_DICDI unnamed protein product
Length=764

 Score = 224 bits (570),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 97/233 (42%), Positives = 152/233 (65%), Gaps = 20/233 (9%)

Query  7    LGLQDSASPLMEQLTFFHDHALMILVMITTLVGYLMFMLF-----------------FNS  49
            +G QD A+P+ME +   H++    L+++   +G++M  +                  F +
Sbjct  525  IGFQDPATPIMEGIIDLHNYIFFYLIVVAVFIGWVMGRILWRFSYKWSYPTIGDIEIFKN  584

Query  50   YTNRN-LLHGQTIEMIWTILPAIVLLFIALPSLRLLYLLDEINEPSVTLKAIGHQWYWSY  108
            +T  N ++HG  IE++WT++P ++L  IA+PS  LLY +DEI  P+VT+K IGHQWYWSY
Sbjct  585  FTAYNQIIHGTVIEIVWTLIPTVILYLIAIPSFTLLYAMDEIINPTVTIKIIGHQWYWSY  644

Query  109  EYSDFLN--VEFDSYMIPTNELSADGFRLLDVDNRVILPMNSQIRILVTAADVIHSWTVP  166
            EY D  +  +EFDSYM+   +L+    RLL+VDN +++P+ + IR+++T+ DV+HSW +P
Sbjct  645  EYGDNASNLIEFDSYMVYERDLAEGQLRLLEVDNAMVVPVKTHIRLIITSGDVLHSWAIP  704

Query  167  ALGVKVDGTPGRLNQTNFLMNRPGLFYGQCSEICGANHSFMPIVIESLPVNHF  219
            + G+KVD  PGRLNQ    + R G FYGQCSE+CG +H FMPI ++++ +  +
Sbjct  705  SFGIKVDAVPGRLNQIGLYVKREGTFYGQCSELCGVDHGFMPIKVQAVKLGEY  757


>G5EF47_CAEEL unnamed protein product
Length=458

 Score = 29.3 bits (64),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 44/106 (42%), Gaps = 14/106 (13%)

Query  4    WAALGLQDSASPLMEQLTFFHDHALMILVMITTLVGYLMFMLFFNSYTNRNLLHGQTIEM  63
            W  LGL  S      +  +FH  AL   +   T  G L  +  F ++ NR++     I+ 
Sbjct  167  WNQLGLISSLGAKNLESVYFHTRALHATMEFPTASGGLTNI--FKNFANRDISRPMPIKD  224

Query  64   IWTILPAIVLLFIALPSLRLLYLLDEINEPSVTLKAIGHQWYWSYE  109
            ++            L  L  ++ L EI + SV L+ IG +   S E
Sbjct  225  LY------------LSCLGRIHFLLEIEDSSVHLQKIGEEAATSKE  258


>Q58SL8_DROME unnamed protein product
Length=319

 Score = 27.7 bits (60),  Expect = 8.2, Method: Compositional matrix adjust.
 Identities = 19/82 (23%), Positives = 36/82 (44%), Gaps = 5/82 (6%)

Query  86   LLDEINEPSVTL-----KAIGHQWYWSYEYSDFLNVEFDSYMIPTNELSADGFRLLDVDN  140
            +L E++EP  +L      +   QW   +  S  + +EFD+Y+    +  +D  + L V  
Sbjct  28   MLLEVSEPGASLYMSYYASTELQWLPRFNISSLVKIEFDAYIFWPEKFLSDLLKTLGVQT  87

Query  141  RVILPMNSQIRILVTAADVIHS  162
               +    +    V   DV++S
Sbjct  88   VKTIIFRDRTLETVVTRDVLNS  109



Lambda      K        H
   0.332    0.140    0.428 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3457179198


Query= NP_957745.1 ATP synthase F0 subunit 8 (mitochondrion) [Bactrocera
oleae]

Length=53
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q1T6W7_CAEEL  unnamed protein product                                 24.3    5.8  
Q9BL68_CAEEL  unnamed protein product                                 24.3    5.8  
TRPG_CAEEL  unnamed protein product                                   24.3    6.2  


>Q1T6W7_CAEEL unnamed protein product
Length=1027

 Score = 24.3 bits (51),  Expect = 5.8, Method: Composition-based stats.
 Identities = 11/34 (32%), Positives = 16/34 (47%), Gaps = 0/34 (0%)

Query  13   FIVFSITFILFSMMNYYSVIPQTPKSQISNKYST  46
             + FS  FI  + +N+    P T KSQ+     T
Sbjct  714  LVKFSAMFIYAAQVNFDKSTPSTSKSQLHTAVRT  747


>Q9BL68_CAEEL unnamed protein product
Length=1241

 Score = 24.3 bits (51),  Expect = 5.8, Method: Composition-based stats.
 Identities = 11/34 (32%), Positives = 16/34 (47%), Gaps = 0/34 (0%)

Query  13   FIVFSITFILFSMMNYYSVIPQTPKSQISNKYST  46
             + FS  FI  + +N+    P T KSQ+     T
Sbjct  871  LVKFSAMFIYAAQVNFDKSTPSTSKSQLHTAVRT  904


>TRPG_CAEEL unnamed protein product
Length=2032

 Score = 24.3 bits (51),  Expect = 6.2, Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 18/27 (67%), Gaps = 0/27 (0%)

Query  10    LSLFIVFSITFILFSMMNYYSVIPQTP  36
             +S F  ++I+FILF     Y+++ +TP
Sbjct  1307  ISTFWSWTISFILFITFFTYTLLVKTP  1333



Lambda      K        H
   0.332    0.140    0.428 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3457179198


Query= NP_957746.1 ATP synthase F0 subunit 6 (mitochondrion) [Bactrocera
oleae]

Length=225
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ATP6_DROME  unnamed protein product                                   393     6e-141
Q9VCB6_DROME  unnamed protein product                                 30.0    1.9   
Q7K112_DROME  unnamed protein product                                 29.6    2.1   


>ATP6_DROME unnamed protein product
Length=224

 Score = 393 bits (1009),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 202/225 (90%), Positives = 218/225 (97%), Gaps = 1/225 (0%)

Query  1    MMTNLFSVFDPSSSIFNLSMNWMSTFLGLTLIPSAYWLMPSRWHIFWNSILLTLHKEFKT  60
            MMTNLFSVFDPS+ IFN S+NW+STFLGL +IPS YWLMPSR++I WNSILLTLHKEFKT
Sbjct  1    MMTNLFSVFDPSA-IFNFSLNWLSTFLGLLMIPSIYWLMPSRYNIMWNSILLTLHKEFKT  59

Query  61   LLGPSGHSGSTFIFVSLFSLILFNNFMGLFPYIFTSTSHLTLTLTLALPLWLCFMLYGWI  120
            LLGPSGH+GSTFIF+SLFSLILFNNFMGLFPYIFTSTSHLTLTL+LALPLWLCFMLYGWI
Sbjct  60   LLGPSGHNGSTFIFISLFSLILFNNFMGLFPYIFTSTSHLTLTLSLALPLWLCFMLYGWI  119

Query  121  NHTQHMFAHLVPQGTPAVLMPFMVCIETISNIIRPGTLAVRLAANMIAGHLLLTLLGNTG  180
            NHTQHMFAHLVPQGTPA+LMPFMVCIETISNIIRPGTLAVRL ANMIAGHLLLTLLGNTG
Sbjct  120  NHTQHMFAHLVPQGTPAILMPFMVCIETISNIIRPGTLAVRLTANMIAGHLLLTLLGNTG  179

Query  181  PSLSYMIMSFLLMGQIALLVLESAVAIIQSYVFAVLSTLYSSEVN  225
            PS+SY++++FLLM QIALLVLESAVA+IQSYVFAVLSTLYSSEVN
Sbjct  180  PSMSYILVTFLLMAQIALLVLESAVAMIQSYVFAVLSTLYSSEVN  224


>Q9VCB6_DROME unnamed protein product
Length=545

 Score = 30.0 bits (66),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 1/58 (2%)

Query  75   VSLFSLILFNNFMGLFPYIFTSTSHLTLTLTLALPLWLCFM-LYGWINHTQHMFAHLV  131
            + L  L+L NNF+ + PY      HL +   +  PL   FM +Y   N TQ +  +++
Sbjct  98   IQLRELLLNNNFLRVLPYEIGKLFHLVILGLMGNPLQKEFMNIYNEPNGTQKLLTYML  155


>Q7K112_DROME unnamed protein product
Length=552

 Score = 29.6 bits (65),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 1/58 (2%)

Query  75   VSLFSLILFNNFMGLFPYIFTSTSHLTLTLTLALPLWLCFM-LYGWINHTQHMFAHLV  131
            + L  L+L NNF+ + PY      HL +   +  PL   FM +Y   N TQ +  +++
Sbjct  105  IQLRELLLNNNFLRVLPYEIGKLFHLVILGLMGNPLQKEFMNIYNEPNGTQKLLTYML  162



Lambda      K        H
   0.332    0.140    0.428 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3457179198


Query= NP_957747.1 cytochrome c oxidase subunit III (mitochondrion)
[Bactrocera oleae]

Length=262
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q20766_CAEEL  unnamed protein product                                 28.9    6.1  
CLOCK_DROME  unnamed protein product                                  28.1    9.7  


>Q20766_CAEEL unnamed protein product
Length=1406

 Score = 28.9 bits (63),  Expect = 6.1, Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 1/35 (3%)

Query  82    WGMILFILSEVLFFVSFF-WAFFHSSLSPAIELGA  115
             WG +L   S VLF++  F +   H  L P I++ A
Sbjct  995   WGRVLLSFSNVLFYMKIFEYLSVHPLLGPYIQMAA  1029


>CLOCK_DROME unnamed protein product
Length=1027

 Score = 28.1 bits (61),  Expect = 9.7, Method: Composition-based stats.
 Identities = 13/37 (35%), Positives = 20/37 (54%), Gaps = 0/37 (0%)

Query  105  SSLSPAIELGAMWPPAGIQPFNPFQIPLLNTAILLSS  141
            ++ SPA++   MW  + +QP    QI  L T+   SS
Sbjct  441  AATSPAVDSSPMWSASAVQPSGSCQINPLKTSRPASS  477



Lambda      K        H
   0.332    0.140    0.428 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3457179198


Query= NP_957748.1 NADH dehydrogenase subunit 3 (mitochondrion) [Bactrocera
oleae]

Length=117
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8WTK2_CAEEL  unnamed protein product                                 26.6    6.0  


>Q8WTK2_CAEEL unnamed protein product
Length=491

 Score = 26.6 bits (57),  Expect = 6.0, Method: Composition-based stats.
 Identities = 11/41 (27%), Positives = 20/41 (49%), Gaps = 0/41 (0%)

Query  11  LIIIASVVMMLASILSKKTLTDREKCSPFECGFDPKSSSRL  51
            + + SV  ML  +L+     DR   + +E G DP+ + + 
Sbjct  9   FLALLSVTFMLIFVLTTPYSNDRSSYAAYEGGIDPRKTRQF  49



Lambda      K        H
   0.332    0.140    0.428 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3457179198


Query= NP_957749.1 NADH dehydrogenase subunit 5 (mitochondrion) [Bactrocera
oleae]

Length=572
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

NU2M_DROME  unnamed protein product                                   37.7    0.019
EIF3M_CAEEL  unnamed protein product                                  33.5    0.50 
H2KZD5_CAEEL  unnamed protein product                                 32.7    0.99 


>NU2M_DROME unnamed protein product
Length=341

 Score = 37.7 bits (86),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 58/116 (50%), Gaps = 11/116 (9%)

Query  171  MKHSMEMEI----IGGLIMLAAMTKSAQIPFSSWLPAAMAAPTPVSALVHSSTLVTAGVY  226
            +K++M  EI       +IM A + KS   PF  W P  M   T ++AL+  +    A + 
Sbjct  80   LKNNMNNEINESFTSMIIMSALLLKSGAAPFHFWFPNMMEGLTWMNALMLMTWQKIAPLM  139

Query  227  LLIRFNVLLSGSWLGDLLLLLSGLTMFMAGLGANFEFDLKKIIALSTLSQLGLMMS  282
            L+   N+         LLL+   L++ +  +G   +  L+K++A S+++ LG M+S
Sbjct  140  LISYLNI-------KYLLLISVILSVIIGAIGGLNQTSLRKLMAFSSINHLGWMLS  188


>EIF3M_CAEEL unnamed protein product
Length=390

 Score = 33.5 bits (75),  Expect = 0.50, Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 30/68 (44%), Gaps = 11/68 (16%)

Query  275  SQLGLMMSILSMGFYKLAFFHLLTHALFKALLFMCAGAIIHNMNNSQDIRLMGGLSVYMP  334
            S  G+ + +LS  +   + FH +   +FKAL+ MCA A           RL+G L   + 
Sbjct  105  SHAGIAVRVLSNLYKGYSNFHTVQEKIFKALVDMCAEA-----------RLIGELECNLE  153

Query  335  LTSGCFNV  342
                 FN 
Sbjct  154  TLQDRFNT  161


>H2KZD5_CAEEL unnamed protein product
Length=1030

 Score = 32.7 bits (73),  Expect = 0.99, Method: Compositional matrix adjust.
 Identities = 19/66 (29%), Positives = 31/66 (47%), Gaps = 3/66 (5%)

Query  15   NFFLLSLFFLLNDYSVFLEWEVVSLNSVSIVMTFLFDWMSLLFMSFVLLIASLVIYYSKE  74
            NF   S+ FL  D  +  E +   L   S V T L +W    F +++ ++ S     S+ 
Sbjct  280  NFLKDSISFLSGDLEISCEPD---LEKPSFVQTELNEWSDPRFYAYLDIVTSQSAIRSER  336

Query  75   YMSEDK  80
            Y+S+ K
Sbjct  337  YLSQSK  342



Lambda      K        H
   0.332    0.140    0.428 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3457179198


Query= NP_957750.1 NADH dehydrogenase subunit 4 (mitochondrion) [Bactrocera
oleae]

Length=446
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8IK84_PLAF7  unnamed protein product                                 33.9    0.38 
NU2M_DROME  unnamed protein product                                   32.3    0.74 
Q20344_CAEEL  unnamed protein product                                 28.9    7.4  


>Q8IK84_PLAF7 unnamed protein product
Length=5906

 Score = 33.9 bits (76),  Expect = 0.38, Method: Composition-based stats.
 Identities = 33/155 (21%), Positives = 63/155 (41%), Gaps = 45/155 (29%)

Query  27    LLFIVTFIFIVLNYCTNYFVNISYFLGFDVISYGLILLSFWICTLM-----------LTA  75
             L+F++  I IVL  C N +  + Y     ++   LIL++F I  ++           L  
Sbjct  5105  LIFLLKHILIVLLICFNIYYGLYY-----IVFLTLILITFAILEILSNPYDKRSFNILNK  5159

Query  76    SESVYK--------------YGSYKNLFLFNILILLIFLVLTFSSMSLFMFYLFFESSLI  121
             S ++                Y +Y+N F+F I ++  +         ++MFY   +   +
Sbjct  5160  SLNIGNVLNIFFPLIIWGSFYWTYENFFIFPIFVIYAY--------HIYMFYHIVKEFTL  5211

Query  122   PTLFL-------ILGWGYQPERLQAGVYLLFYTLL  149
                F+       I   GY PE ++   Y ++Y ++
Sbjct  5212  SIHFIKTENIVNIQTIGYDPENIKNKNYKIYYKVM  5246


>NU2M_DROME unnamed protein product
Length=341

 Score = 32.3 bits (72),  Expect = 0.74, Method: Compositional matrix adjust.
 Identities = 17/40 (43%), Positives = 27/40 (68%), Gaps = 1/40 (3%)

Query  252  ISLVGGVLISLVC-LRQTDLKALIAYSSVAHMGIVLGGLM  290
            IS++  V+I  +  L QT L+ L+A+SS+ H+G +L  LM
Sbjct  152  ISVILSVIIGAIGGLNQTSLRKLMAFSSINHLGWMLSSLM  191


>Q20344_CAEEL unnamed protein product
Length=243

 Score = 28.9 bits (63),  Expect = 7.4, Method: Compositional matrix adjust.
 Identities = 14/49 (29%), Positives = 24/49 (49%), Gaps = 0/49 (0%)

Query  41   CTNYFVNISYFLGFDVISYGLILLSFWICTLMLTASESVYKYGSYKNLF  89
            C NYF  I  ++G+ ++ + L  L+F I T       ++  +  YK  F
Sbjct  180  CPNYFGEIMEWIGYAILGWNLPALAFAIFTFANIGPRAIAHHNWYKEKF  228



Lambda      K        H
   0.332    0.140    0.428 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3457179198


Query= NP_957751.1 NADH dehydrogenase subunit 4L (mitochondrion)
[Bactrocera oleae]

Length=98
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9PEK9_DROME  unnamed protein product                                 27.3    2.4  
Q59E18_DROME  unnamed protein product                                 27.3    2.4  
M9ND25_DROME  unnamed protein product                                 27.3    2.4  


>M9PEK9_DROME unnamed protein product
Length=926

 Score = 27.3 bits (59),  Expect = 2.4, Method: Composition-based stats.
 Identities = 19/62 (31%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query  26   KHLLSMLLSLEYIVLNLF-FLLFIYLNLMDYSSFFSMMFLTFSVCEG-ALGLSILVSMIR  83
            +  L   L+LE++V + F FL F+YL  M  S+    +F+   +    ALGL  +  +  
Sbjct  718  RQFLVTALTLEFLVSSSFYFLRFVYLPEMSPSAILLALFIRSQLTNSFALGLIFVPKLWY  777

Query  84   TH  85
             H
Sbjct  778  QH  779


>Q59E18_DROME unnamed protein product
Length=944

 Score = 27.3 bits (59),  Expect = 2.4, Method: Composition-based stats.
 Identities = 19/62 (31%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query  26   KHLLSMLLSLEYIVLNLF-FLLFIYLNLMDYSSFFSMMFLTFSVCEG-ALGLSILVSMIR  83
            +  L   L+LE++V + F FL F+YL  M  S+    +F+   +    ALGL  +  +  
Sbjct  718  RQFLVTALTLEFLVSSSFYFLRFVYLPEMSPSAILLALFIRSQLTNSFALGLIFVPKLWY  777

Query  84   TH  85
             H
Sbjct  778  QH  779


>M9ND25_DROME unnamed protein product
Length=951

 Score = 27.3 bits (59),  Expect = 2.4, Method: Composition-based stats.
 Identities = 19/62 (31%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query  26   KHLLSMLLSLEYIVLNLF-FLLFIYLNLMDYSSFFSMMFLTFSVCEG-ALGLSILVSMIR  83
            +  L   L+LE++V + F FL F+YL  M  S+    +F+   +    ALGL  +  +  
Sbjct  718  RQFLVTALTLEFLVSSSFYFLRFVYLPEMSPSAILLALFIRSQLTNSFALGLIFVPKLWY  777

Query  84   TH  85
             H
Sbjct  778  QH  779



Lambda      K        H
   0.332    0.140    0.428 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3457179198


Query= NP_957752.1 NADH dehydrogenase subunit 6 (mitochondrion) [Bactrocera
oleae]

Length=174
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q57W00_TRYB2  unnamed protein product                                 28.9    2.5  
ATG1_DICDI  unnamed protein product                                   27.3    9.0  
Q583T3_TRYB2  unnamed protein product                                 27.3    9.7  


>Q57W00_TRYB2 unnamed protein product
Length=1035

 Score = 28.9 bits (63),  Expect = 2.5, Method: Composition-based stats.
 Identities = 19/79 (24%), Positives = 39/79 (49%), Gaps = 6/79 (8%)

Query  28   LMLLIQTLQICLLTGLMAK-----SFWFSYILFLIFLGGMLVLFIYVTSLASNEMFSLSM  82
            L++L Q   + + + +M +     S W  +I  +I   GMLV+ +     +    F+LS+
Sbjct  551  LVVLAQKTAVVIFSAVMQEDDGLASPWTGFIASVILHLGMLVILVVCRPYSGPVEFALSL  610

Query  83   KLTTLCITIMTSLTFISLF  101
             L  L + ++ ++  +S F
Sbjct  611  AL-QLMLVVLAAMGLVSSF  628


>ATG1_DICDI unnamed protein product
Length=668

 Score = 27.3 bits (59),  Expect = 9.0, Method: Compositional matrix adjust.
 Identities = 18/53 (34%), Positives = 31/53 (58%), Gaps = 11/53 (21%)

Query  111  IQNLEMNTYFNPNLFTHENSLN------LHKLY-NFPTNLM----TILLMNYL  152
            ++N + ++ F+PN F +EN+L       + +LY N+PT+L       LL+ YL
Sbjct  568  VKNQDHHSSFSPNRFIYENALEFGKKGAVEELYNNYPTSLQFYTDGTLLLEYL  620


>Q583T3_TRYB2 unnamed protein product
Length=966

 Score = 27.3 bits (59),  Expect = 9.7, Method: Composition-based stats.
 Identities = 10/25 (40%), Positives = 16/25 (64%), Gaps = 0/25 (0%)

Query  123  NLFTHENSLNLHKLYNFPTNLMTIL  147
            N+ + EN+  LH  Y FP +L ++L
Sbjct  406  NVISGENAFILHDRYGFPVDLTSLL  430



Lambda      K        H
   0.332    0.140    0.428 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3457179198


Query= NP_957753.1 cytochrome b (mitochondrion) [Bactrocera oleae]

Length=378
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CYB_DROME  unnamed protein product                                    691     0.0  


>CYB_DROME unnamed protein product
Length=378

 Score = 691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/378 (89%), Positives = 364/378 (96%), Gaps = 0/378 (0%)

Query  1    MNKPLRTQHPLFQIANNALVDLPAPINISAWWNFGSLLGLCLTIQILTGLFLAMHYTADI  60
            MNKPLR  HPLF+IANNALVDLPAPINIS+WWNFGSLLGLCL IQILTGLFLAMHYTADI
Sbjct  1    MNKPLRNSHPLFKIANNALVDLPAPINISSWWNFGSLLGLCLIIQILTGLFLAMHYTADI  60

Query  61   NLAFNSVNHICRDVNYGWLLRTIHANGASFFFICIYLHVGRGIYYGSYLFTPTWLVGVLI  120
            NLAF SVNHICRDVNYGWLLRT+HANGASFFFICIYLHVGRGIYYGSY FTPTWL+GV+I
Sbjct  61   NLAFYSVNHICRDVNYGWLLRTLHANGASFFFICIYLHVGRGIYYGSYKFTPTWLIGVII  120

Query  121  LFLVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYLGIDLVQWVWGGFAVDNATLTRFF  180
            LFLVM TAFMGYVLPWGQMSFWGATVITNLLSAIPYLG+DLVQW+WGGFAVDNATLTRFF
Sbjct  121  LFLVMGTAFMGYVLPWGQMSFWGATVITNLLSAIPYLGMDLVQWLWGGFAVDNATLTRFF  180

Query  181  TFHFILPFIVLAMTLIHLLFLHQTGSNNPIGLNSNIDKIPFHPYFSYKDIVGFVIMVAAL  240
            TFHFILPFIVLAMT+IHLLFLHQTGSNNPIGLNSNIDKIPFHPYF++KDIVGF++M+  L
Sbjct  181  TFHFILPFIVLAMTMIHLLFLHQTGSNNPIGLNSNIDKIPFHPYFTFKDIVGFIVMIFIL  240

Query  241  LLLTLINPYLLGDPDNFIPANPLVTPVHIQPEWYFLFAYAILRSIPNKLGGVIALVLSIA  300
            + L LI+P LLGDPDNFIPANPLVTP HIQPEWYFLFAYAILRSIPNKLGGVIALVLSIA
Sbjct  241  ISLVLISPNLLGDPDNFIPANPLVTPAHIQPEWYFLFAYAILRSIPNKLGGVIALVLSIA  300

Query  301  ILAILPFYHMSKFRGIQFYPINKILFWNMVVTVILLTWIGARPVEEPYVLVGQILTIIYF  360
            IL ILPFY++SKFRGIQFYPIN+++FW+M+VTVILLTWIGARPVEEPYVL+GQILT++YF
Sbjct  301  ILMILPFYNLSKFRGIQFYPINQVMFWSMLVTVILLTWIGARPVEEPYVLIGQILTVVYF  360

Query  361  LYYIINPLINKWWDNLIN  378
            LYY++NPLI KWWDNL+N
Sbjct  361  LYYLVNPLITKWWDNLLN  378



Lambda      K        H
   0.332    0.140    0.428 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3457179198


Query= NP_957754.1 NADH dehydrogenase subunit 1 (mitochondrion) [Bactrocera
oleae]

Length=313
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CAC1D_DROME  unnamed protein product                                  31.2    1.3  
Q20046_CAEEL  unnamed protein product                                 28.9    6.6  


>CAC1D_DROME unnamed protein product
Length=2516

 Score = 31.2 bits (69),  Expect = 1.3, Method: Composition-based stats.
 Identities = 27/97 (28%), Positives = 41/97 (42%), Gaps = 12/97 (12%)

Query  78   SPIFSLFLSLVAWLCIPLFVKLFSFNLGLLFFLCCASLGVYTVMVAGWSSNSNYALLGGL  137
            +P+ +L + +V W       K F F + L  F  C +L VYT      S+ +N  L    
Sbjct  602  NPLRALCIRIVEW-------KPFEFLILLTIFANCIALAVYTPYPGSDSNVTNQTLEKVE  654

Query  138  RAVAQTISYEVSMALVLLSFVFLIGSY-----NILDF  169
                   + E  M ++   FV   G+Y     N+LDF
Sbjct  655  YVFLVIFTAECVMKILAYGFVLHNGAYLRNGWNLLDF  691


>Q20046_CAEEL unnamed protein product
Length=897

 Score = 28.9 bits (63),  Expect = 6.6, Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (51%), Gaps = 2/51 (4%)

Query  143  TISYEVSMALVLLSFVFLIGSYNILDFFYYQKFVWFLVILFPMSLVWFCIC  193
            TI Y+ S   +  + + +I  Y+     Y QK +  L I+ PMSL W  +C
Sbjct  391  TIEYDDSTDEIFENSLEII--YHKDSSGYDQKLIIALSIIIPMSLFWSALC  439



Lambda      K        H
   0.332    0.140    0.428 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3457179198


Query= XP_014085096.1 PREDICTED: protein lethal(2)k10201 [Bactrocera oleae]

Length=167
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

L2K1_DROME  unnamed protein product                                   80.9    3e-19
WEK_DROME  unnamed protein product                                    35.0    0.018
X2JCQ6_DROME  unnamed protein product                                 32.7    0.14 


>L2K1_DROME unnamed protein product
Length=221

 Score = 80.9 bits (198),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 73/150 (49%), Gaps = 27/150 (18%)

Query  1    MLSVAEIINLLNSIPVGYKSPEDNCFNAGNQTYIPEYKKLGVITVANELQEDLPETDKND  60
            +LS  +II +L+ +P G+  P D    +     +  +KKLGV+             D +D
Sbjct  10   LLSREQIIRILSEVPAGFIKPTDPPAPS-----LAPFKKLGVLV------------DIDD  52

Query  61   LFCDMPGCQVAFKNAASYQSHFYNEHRYICSVCRRCLPTAHLLDLHILECHDSYFIIRAK  120
            +  +          AA  + +   E  Y C  CR+ LPTAHLLDLHI E HD YF    +
Sbjct  53   ILGEQDAA------AARIRDNIDKEQSYSCVECRKMLPTAHLLDLHITEQHDCYFAASVE  106

Query  121  RGEA-MYSCFLGECLNNYAANRIKDIRKNH  149
            RG+  M+SCFL EC   +   R    RK+H
Sbjct  107  RGDKPMFSCFLEECTIKFHTAR---QRKDH  133


>WEK_DROME unnamed protein product
Length=470

 Score = 35.0 bits (79),  Expect = 0.018, Method: Compositional matrix adjust.
 Identities = 22/83 (27%), Positives = 41/83 (49%), Gaps = 4/83 (5%)

Query  26   FNAGNQTYIPEYKKLGVITVANELQEDLPETDKNDLFCDMPGCQVAFKNAASYQSH--FY  83
             + G + Y+ ++   G+ T  + ++  L  T++    C  P C   FKN A  + H   +
Sbjct  293  MHGGPKKYVCDHCGKGLKTFTSLVEHQLVHTEEKPCIC--PVCNAGFKNKARLRVHSQTH  350

Query  84   NEHRYICSVCRRCLPTAHLLDLH  106
             E ++ C+VC + L T  +L+ H
Sbjct  351  GEPKFECNVCGKKLQTRAILNKH  373


>X2JCQ6_DROME unnamed protein product
Length=822

 Score = 32.7 bits (73),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 37/90 (41%), Gaps = 13/90 (14%)

Query  63   CDMPGCQVAFKNAASYQSHF--YNEHRYICSVCRRCLPTAHLLDLHILECHDSYFIIRAK  120
            C++ GC  AF       +H   +N   + C +C++C  T   L  H          +R  
Sbjct  391  CEVSGCDKAFNTRYRLHAHLRLHNGETFNCELCQKCFTTLSDLKKH----------MRTH  440

Query  121  RGEAMYSCFLGECLNNY-AANRIKDIRKNH  149
              E  Y C   +C   + A++ +K  R+ H
Sbjct  441  TQERPYKCPEDDCGKAFTASHHLKTHRRTH  470



Lambda      K        H
   0.332    0.140    0.428 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3457179198


Query= XP_014085097.1 PREDICTED: trichohyalin isoform X1 [Bactrocera oleae]

Length=732
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9Y102_DROME  unnamed protein product                                 320     6e-98
M9PFV8_DROME  unnamed protein product                                 317     9e-97
RBP2A_PLAF7  unnamed protein product                                  86.3    5e-17


>Q9Y102_DROME unnamed protein product
Length=800

 Score = 320 bits (821),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 154/318 (48%), Positives = 202/318 (64%), Gaps = 27/318 (8%)

Query  5    IFILACLAPYINA-YHVSAATAGVSFMNENYLDHRVSQAFNTQNAGSKALSNRRMYGMCP  63
            +FILA  A  I   +H SAA A ++F          S A +   A   +   RR+Y +CP
Sbjct  12   VFILALFAHTIAVEFHGSAARAEINFEG-------PSPAHSQDTAAPTSRPKRRVYALCP  64

Query  64   PHFQRVGSECYSLLPQASSWLEAHFFCKDKNAKLAEPQYRADRKLRVFLKKYDAQRELTG  123
            P F RVG++CYSL+ Q SSWLEAHFFCKDKNA L EP   ADRKLR+FL+K DA      
Sbjct  65   PKFHRVGTDCYSLVDQRSSWLEAHFFCKDKNANLTEPGKHADRKLRLFLQKQDALSGEND  124

Query  124  PIWIGATYDWQSNVWQWSISGKNLTYDSFSRMEPEIRQNLENHCAVYDPNLDYRWSARPC  183
            PIW+GATYD  +N WQWS+SG+NL+ DSFSR +    Q L+N+CA+YDP+L YRWSARPC
Sbjct  125  PIWLGATYDHHNNRWQWSMSGRNLSTDSFSRTDSA--QPLDNNCAIYDPSLKYRWSARPC  182

Query  184  PERFRFICQHKMPKVSEKNRGKVYTRWNATYPNEYANEVILEVMDQPAKNGRRSNVIVKA  243
             ++ RFICQHKMPKVS  NR K+Y RWNATYPNE ANEV+LE+++ P +N RR +  VKA
Sbjct  183  SDKLRFICQHKMPKVSGPNRYKIYNRWNATYPNEQANEVVLEILE-PRENDRRYHRRVKA  241

Query  244  DGSDEQIVLPKSRGRAGHNRGRTGRRPNRPTTIHPNDIDAQ-----------ATSNSPTT  292
            + SDE++++P  R           R+  +    HPND++ Q            ++ +PTT
Sbjct  242  EDSDEEMIIPDRRRNNNRRNNHRNRQI-KNQNQHPNDVNYQPAQQRQRNRPRTSTVAPTT  300

Query  293  ---LVHYNEIPVPVTATP  307
               +   N++  P + TP
Sbjct  301  TQSVSQSNDVLAP-SPTP  317


 Score = 33.5 bits (75),  Expect = 0.74, Method: Compositional matrix adjust.
 Identities = 120/405 (30%), Positives = 192/405 (47%), Gaps = 119/405 (29%)

Query  363  QERERQRHLREQEQQDQQPKSYEQTEQPRRELDELRQREAIDLERQRQQQLAEAEEKRRE  422
            +E+++QR  +EQ+ +++Q +  ++ EQ R    EL++ +   L   + +Q  E +E+  +
Sbjct  428  EEQQKQRDEQEQKDREEQDRLKQEEEQARTHQKELKENQEQQLRELKAKQEREKQERDYQ  487

Query  423  YESRHQELEAMKKKLAEEKKER--DDEYTSAERIRQERIDRQREREEKERKEREEQMKKE  480
             + R  ELE +K++ AE  ++   D+E   AE++R ERI +QRE E ++R+EREEQ +K+
Sbjct  488  QQKREHELELLKQRQAEADRQHAADEE---AEKLRLERIQKQRELEAQQRREREEQRRKQ  544

Query  481  QEERAKEEAKREQERLEMEKRQLEEYEERLKQARDERERQLHEQQERKRQEDLANRRRLE  540
            +EE+ +++ +   +RL  EKR  + Y ER++ A  ERE+QL E  E KR E+L  + +L+
Sbjct  545  REEQEEQDRQNHAKRLAEEKRLHDLYAERIRLANTEREKQLAEAHEAKRLEELKLQEQLK  604

Query  541  E----------------------------------------EEKQRQEDIKRQLEEE---  557
            +                                        EE QR+E+ K Q E E   
Sbjct  605  KQEDERQEQIRREQEEEEKRLELERLEEARRFEEKELKRLHEENQRREEQKLQREREIAL  664

Query  558  -----------EKRLKLEQLEDARKLERQELE---RLAEENRRREEKLRQRQEEIARREE  603
                       E+ L+ E  E+ RK+ +Q LE   R AEE R+ +E   +  EE    E+
Sbjct  665  REAAEKKLAEEEEMLRKEVAEEERKV-KQRLEDEMRQAEEARKAKEAEERAAEEAKAAEQ  723

Query  604  EQRKIEEEEERIKKELEEAEERRKAEHEAQIKLEEEALKARAEAEQKAAEEEKRKRLERF  663
            ++R                                       EA +K A+EE + +LE  
Sbjct  724  KRR--------------------------------------VEAAKKKADEEVKAKLE--  743

Query  664  DALKKQDDERLRQEEKEKKRKYAERLSRLPPEDQRKFFEMRKRRK  708
                            EK+R+Y  R+S L PEDQ+KF EMRKRRK
Sbjct  744  ----------------EKRREYVTRISALSPEDQKKFIEMRKRRK  772


 Score = 33.1 bits (74),  Expect = 0.87, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 75/118 (64%), Gaps = 16/118 (14%)

Query  472  EREEQMKKEQEERAKEEAKR-----------EQERLEMEKRQLEEYEERLKQARDERERQ  520
            E E++++ EQE++ +EE ++           EQ+RL+ E+ Q   +++ LK+ ++++ R+
Sbjct  413  EHEQKLRNEQEKKLREEQQKQRDEQEQKDREEQDRLKQEEEQARTHQKELKENQEQQLRE  472

Query  521  LHEQQERKRQE-DLANRRRLEEEE--KQRQEDIKRQ--LEEEEKRLKLEQLEDARKLE  573
            L  +QER++QE D   ++R  E E  KQRQ +  RQ   +EE ++L+LE+++  R+LE
Sbjct  473  LKAKQEREKQERDYQQQKREHELELLKQRQAEADRQHAADEEAEKLRLERIQKQRELE  530


>M9PFV8_DROME unnamed protein product
Length=808

 Score = 317 bits (813),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 154/324 (48%), Positives = 201/324 (62%), Gaps = 31/324 (10%)

Query  5    IFILACLAPYINA-YHVSAATAGVSFMNENYLDHRVSQAFNTQNAGSKALSNRRMYGMCP  63
            +FILA  A  I   +H SAA A ++F          S A +   A   +   RR+Y +CP
Sbjct  12   VFILALFAHTIAVEFHGSAARAEINFEGP-------SPAHSQDTAAPTSRPKRRVYALCP  64

Query  64   PHFQRVGSECYSLLPQASSWLEAHFFCKDKNAKLAEPQYRADRKLRVFLKKYDAQRELTG  123
            P F RVG++CYSL+ Q SSWLEAHFFCKDKNA L EP   ADRKLR+FL+K DA      
Sbjct  65   PKFHRVGTDCYSLVDQRSSWLEAHFFCKDKNANLTEPGKHADRKLRLFLQKQDALSGEND  124

Query  124  PIWIGATYDWQSNVWQWSISGKNLTYDSFSRMEPEI------RQNLENHCAVYDPNLDYR  177
            PIW+GATYD  +N WQWS+SG+NL+ DSFSR +          Q L+N+CA+YDP+L YR
Sbjct  125  PIWLGATYDHHNNRWQWSMSGRNLSTDSFSRTDSAYVQLISNSQPLDNNCAIYDPSLKYR  184

Query  178  WSARPCPERFRFICQHKMPKVSEKNRGKVYTRWNATYPNEYANEVILEVMDQPAKNGRRS  237
            WSARPC ++ RFICQHKMPKVS  NR K+Y RWNATYPNE ANEV+LE+++ P +N RR 
Sbjct  185  WSARPCSDKLRFICQHKMPKVSGPNRYKIYNRWNATYPNEQANEVVLEILE-PRENDRRY  243

Query  238  NVIVKADGSDEQIVLPKSRGRAGHNRGRTGRRPNRPTTIHPNDIDAQ-----------AT  286
            +  VKA+ SDE++++P  R           R+       HPND++ Q            +
Sbjct  244  HRRVKAEDSDEEMIIPDRRRNNNRRNNHRNRQIKNQNQ-HPNDVNYQPAQQRQRNRPRTS  302

Query  287  SNSPTT---LVHYNEIPVPVTATP  307
            + +PTT   +   N++  P + TP
Sbjct  303  TVAPTTTQSVSQSNDVLAP-SPTP  325


 Score = 33.5 bits (75),  Expect = 0.80, Method: Compositional matrix adjust.
 Identities = 120/405 (30%), Positives = 192/405 (47%), Gaps = 119/405 (29%)

Query  363  QERERQRHLREQEQQDQQPKSYEQTEQPRRELDELRQREAIDLERQRQQQLAEAEEKRRE  422
            +E+++QR  +EQ+ +++Q +  ++ EQ R    EL++ +   L   + +Q  E +E+  +
Sbjct  436  EEQQKQRDEQEQKDREEQDRLKQEEEQARTHQKELKENQEQQLRELKAKQEREKQERDYQ  495

Query  423  YESRHQELEAMKKKLAEEKKER--DDEYTSAERIRQERIDRQREREEKERKEREEQMKKE  480
             + R  ELE +K++ AE  ++   D+E   AE++R ERI +QRE E ++R+EREEQ +K+
Sbjct  496  QQKREHELELLKQRQAEADRQHAADEE---AEKLRLERIQKQRELEAQQRREREEQRRKQ  552

Query  481  QEERAKEEAKREQERLEMEKRQLEEYEERLKQARDERERQLHEQQERKRQEDLANRRRLE  540
            +EE+ +++ +   +RL  EKR  + Y ER++ A  ERE+QL E  E KR E+L  + +L+
Sbjct  553  REEQEEQDRQNHAKRLAEEKRLHDLYAERIRLANTEREKQLAEAHEAKRLEELKLQEQLK  612

Query  541  E----------------------------------------EEKQRQEDIKRQLEEE---  557
            +                                        EE QR+E+ K Q E E   
Sbjct  613  KQEDERQEQIRREQEEEEKRLELERLEEARRFEEKELKRLHEENQRREEQKLQREREIAL  672

Query  558  -----------EKRLKLEQLEDARKLERQELE---RLAEENRRREEKLRQRQEEIARREE  603
                       E+ L+ E  E+ RK+ +Q LE   R AEE R+ +E   +  EE    E+
Sbjct  673  REAAEKKLAEEEEMLRKEVAEEERKV-KQRLEDEMRQAEEARKAKEAEERAAEEAKAAEQ  731

Query  604  EQRKIEEEEERIKKELEEAEERRKAEHEAQIKLEEEALKARAEAEQKAAEEEKRKRLERF  663
            ++R                                       EA +K A+EE + +LE  
Sbjct  732  KRR--------------------------------------VEAAKKKADEEVKAKLE--  751

Query  664  DALKKQDDERLRQEEKEKKRKYAERLSRLPPEDQRKFFEMRKRRK  708
                            EK+R+Y  R+S L PEDQ+KF EMRKRRK
Sbjct  752  ----------------EKRREYVTRISALSPEDQKKFIEMRKRRK  780


 Score = 33.1 bits (74),  Expect = 0.95, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 75/118 (64%), Gaps = 16/118 (14%)

Query  472  EREEQMKKEQEERAKEEAKR-----------EQERLEMEKRQLEEYEERLKQARDERERQ  520
            E E++++ EQE++ +EE ++           EQ+RL+ E+ Q   +++ LK+ ++++ R+
Sbjct  421  EHEQKLRNEQEKKLREEQQKQRDEQEQKDREEQDRLKQEEEQARTHQKELKENQEQQLRE  480

Query  521  LHEQQERKRQE-DLANRRRLEEEE--KQRQEDIKRQ--LEEEEKRLKLEQLEDARKLE  573
            L  +QER++QE D   ++R  E E  KQRQ +  RQ   +EE ++L+LE+++  R+LE
Sbjct  481  LKAKQEREKQERDYQQQKREHELELLKQRQAEADRQHAADEEAEKLRLERIQKQRELE  538


>RBP2A_PLAF7 unnamed protein product
Length=3130

 Score = 86.3 bits (212),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 82/246 (33%), Positives = 149/246 (61%), Gaps = 24/246 (10%)

Query  456   QERIDRQREREEKERKEREEQMKKEQEERAKEEA--KREQERLEME---KRQLEEYEERL  510
             +ER++R+++ + K+ +E  ++ ++ QE++ KEEA  ++EQERL+ E   KRQ +E  ER 
Sbjct  2705  KERLEREKQEQLKKEEELRKKEQERQEQQQKEEALKRQEQERLQKEEELKRQEQERLERE  2764

Query  511   KQARDERERQLHEQQERKRQEDLANRRRLEEEEKQRQEDIKRQLEEEEKRLKLEQLEDAR  570
             KQ + ++E +L  Q++ + Q++ A +R+ E+E  Q++E++KRQ +E  +R K EQL+   
Sbjct  2765  KQEQLQKEEELKRQEQERLQKEEALKRQ-EQERLQKEEELKRQEQERLEREKQEQLQKEE  2823

Query  571   KLERQELERLAEENRRREEKLRQRQEEIARREEEQRKIEEEEERIKKELEEAEERRKAEH  630
             +L+RQE ERL +E    E   RQ QE + + EE +R+ +E  ER K EL E E+  K++ 
Sbjct  2824  ELKRQEQERLQKE----EALKRQEQERLQKEEELKRQEQERLERKKIELAEREQHIKSKL  2879

Query  631   EAQI---------KLEEEALKARAEAEQKAAEEEKRKRLE-----RFDALKKQDDERLRQ  676
             E+ +         K ++E +K +    + + E++  K L+     + D+L  ++DE ++ 
Sbjct  2880  ESDMVKIIKDELTKEKDEIIKNKDIKLRHSLEQKWLKHLQNILSLKIDSLLNKNDEVIKD  2939

Query  677   EEKEKK  682
              E + K
Sbjct  2940  NETQLK  2945


 Score = 79.7 bits (195),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 92/320 (29%), Positives = 166/320 (52%), Gaps = 50/320 (16%)

Query  329   KEKRRMERKKQRAQQMQKEKEREWKEQRMRILANQERERQRHLREQEQQDQQPKSYEQTE  388
             +EK R+ER+KQ   + ++E  ++ +E++ +    +  +RQ   R Q+++           
Sbjct  2703  QEKERLEREKQEQLKKEEELRKKEQERQEQQQKEEALKRQEQERLQKEE-----------  2751

Query  389   QPRRELDELRQREAIDLERQRQQQLAEAEEKRREYESRHQELEAMKKKLAEEKKERDDEY  448
                    EL+++E   LER++Q+QL + EE +R+ + R Q+ EA+K+    +++ER  + 
Sbjct  2752  -------ELKRQEQERLEREKQEQLQKEEELKRQEQERLQKEEALKR----QEQERLQKE  2800

Query  449   TSAERIRQERIDRQREREEKERKEREEQMKKEQEER-AKEEA--KREQERLEME---KRQ  502
                +R  QER+    ERE++E+ ++EE++K++++ER  KEEA  ++EQERL+ E   KRQ
Sbjct  2801  EELKRQEQERL----EREKQEQLQKEEELKRQEQERLQKEEALKRQEQERLQKEEELKRQ  2856

Query  503   LEEYEERLKQARDERERQLHEQQERKRQEDLANRRRLEEEEKQRQEDIKRQLEEEEKRLK  562
              +E  ER K    ERE+ +  + E    + + +    E++E  + +DIK +   E+K LK
Sbjct  2857  EQERLERKKIELAEREQHIKSKLESDMVKIIKDELTKEKDEIIKNKDIKLRHSLEQKWLK  2916

Query  563   LEQLEDARKLERQELERLAEENRRREEKL-----------------RQRQEEIARREEEQ  605
               Q   + K++   L +  E  +  E +L                 R+  E I   EE Q
Sbjct  2917  HLQNILSLKIDSL-LNKNDEVIKDNETQLKTNILNSLKNQLYLNLKRELNEIIKEYEENQ  2975

Query  606   RKIEEEEERIKKELEEAEER  625
             +KI    + +   LE+   R
Sbjct  2976  KKILHSNQLVNDSLEQKTNR  2995


 Score = 55.1 bits (131),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 59/177 (33%), Positives = 107/177 (60%), Gaps = 26/177 (15%)

Query  540   EEEEKQRQEDIKRQLEEEEK--RLKLEQLEDARK-----------------LERQELERL  580
             +EEE++ +E I+++ +E+E+  R K EQL+   +                 L+RQE ERL
Sbjct  2688  QEEERKERERIEKEKQEKERLEREKQEQLKKEEELRKKEQERQEQQQKEEALKRQEQERL  2747

Query  581   A--EENRRREEKLRQRQEEIARREEEQRKIEEEEERIKKELEEAEERRKAEHEAQIKLEE  638
                EE +R+E++  +R+++   ++EE+ K +E+E   K+E  + +E+ + + E ++K +E
Sbjct  2748  QKEEELKRQEQERLEREKQEQLQKEEELKRQEQERLQKEEALKRQEQERLQKEEELKRQE  2807

Query  639   EALKARAEAEQKAAEEE----KRKRLERFDALKKQDDERLRQEEKEKKRKYAERLSR  691
             +    R + EQ   EEE    +++RL++ +ALK+Q+ ERL++EE E KR+  ERL R
Sbjct  2808  QERLEREKQEQLQKEEELKRQEQERLQKEEALKRQEQERLQKEE-ELKRQEQERLER  2863


 Score = 48.9 bits (115),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 69/278 (25%), Positives = 132/278 (47%), Gaps = 60/278 (22%)

Query  314   QKQMPHDRVVWRQRQKEKRRMERKKQRAQQMQKEKEREWKEQRMRILANQERERQRHLRE  373
             Q+Q   +R    Q QKE+   E K+Q  +++QKE+           L  QE+ER +   E
Sbjct  2756  QEQERLEREKQEQLQKEE---ELKRQEQERLQKEEA----------LKRQEQERLQKEEE  2802

Query  374   QEQQDQQPKSYEQTEQPRRELDELRQREAIDLERQRQQQLAEAEEKRREYESRHQELEAM  433
              ++Q+Q+                        LER++Q+QL + EE +R+ + R Q+ EA+
Sbjct  2803  LKRQEQE-----------------------RLEREKQEQLQKEEELKRQEQERLQKEEAL  2839

Query  434   KKKLAEEKKERDDEYTSAERIRQERIDRQRE--REEKERKEREEQMKKEQEERAKEEAKR  491
             K++                   QER+ ++ E  R+E+ER ER++    E+E+  K  +K 
Sbjct  2840  KRQ------------------EQERLQKEEELKRQEQERLERKKIELAEREQHIK--SKL  2879

Query  492   EQERLEMEKRQLEEYEERLKQARDERERQLHEQQERKRQEDLANRR--RLEEEEKQRQED  549
             E + +++ K +L + ++ + + +D + R   EQ+  K  +++ + +   L  +  +  +D
Sbjct  2880  ESDMVKIIKDELTKEKDEIIKNKDIKLRHSLEQKWLKHLQNILSLKIDSLLNKNDEVIKD  2939

Query  550   IKRQLEEEEKRLKLEQLEDARKLERQELERLAEENRRR  587
              + QL+         QL    K E  E+ +  EEN+++
Sbjct  2940  NETQLKTNILNSLKNQLYLNLKRELNEIIKEYEENQKK  2977


 Score = 47.4 bits (111),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 48/150 (32%), Positives = 94/150 (63%), Gaps = 13/150 (9%)

Query  573   ERQELERLAEENRRREEKLRQRQEEIARREEEQRKIE-EEEERIKKELE-EAEERRKAEH  630
             E++ LER  +E  ++EE+LR++++E   +++++  ++ +E+ER++KE E + +E+ + E 
Sbjct  2704  EKERLEREKQEQLKKEEELRKKEQERQEQQQKEEALKRQEQERLQKEEELKRQEQERLER  2763

Query  631   EAQIKLEEEALKARAEAEQKAAEEEKRKRLERFDALKKQDDERLRQEEKEKKRKYAERLS  690
             E Q +L++E    R E E          RL++ +ALK+Q+ ERL++EE E KR+  ERL 
Sbjct  2764  EKQEQLQKEEELKRQEQE----------RLQKEEALKRQEQERLQKEE-ELKRQEQERLE  2812

Query  691   RLPPEDQRKFFEMRKRRKAKKTQELLQQKQ  720
             R   E  +K  E++++ + +  +E   ++Q
Sbjct  2813  REKQEQLQKEEELKRQEQERLQKEEALKRQ  2842


 Score = 42.0 bits (97),  Expect = 0.002, Method: Composition-based stats.
 Identities = 37/137 (27%), Positives = 81/137 (59%), Gaps = 6/137 (4%)

Query  311   RTGQKQMPHDRVVWRQRQKEKRRMER-KKQRAQQMQKEKEREWKEQ-RMRILANQERERQ  368
             R  Q+Q+  +  + RQ Q+  ++ E  K+Q  +++QKE+E + +EQ R+     ++ +++
Sbjct  2763  REKQEQLQKEEELKRQEQERLQKEEALKRQEQERLQKEEELKRQEQERLEREKQEQLQKE  2822

Query  369   RHLREQEQQD-QQPKSYEQTEQPR-RELDELRQREAIDLERQRQQQLAEAEEKRREYESR  426
               L+ QEQ+  Q+ ++ ++ EQ R ++ +EL+++E   LER++ +     +  + + ES 
Sbjct  2823  EELKRQEQERLQKEEALKRQEQERLQKEEELKRQEQERLERKKIELAEREQHIKSKLES-  2881

Query  427   HQELEAMKKKLAEEKKE  443
                ++ +K +L +EK E
Sbjct  2882  -DMVKIIKDELTKEKDE  2897



Lambda      K        H
   0.332    0.140    0.428 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3457179198


Query= XP_014085098.1 PREDICTED: trichohyalin isoform X2 [Bactrocera oleae]

Length=730
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9Y102_DROME  unnamed protein product                                 325     8e-100
M9PFV8_DROME  unnamed protein product                                 317     8e-97 
RBP2A_PLAF7  unnamed protein product                                  86.3    5e-17 


>Q9Y102_DROME unnamed protein product
Length=800

 Score = 325 bits (833),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 154/316 (49%), Positives = 201/316 (64%), Gaps = 25/316 (8%)

Query  5    IFILACLAPYINA-YHVSAATAGVSFMNENYLDHRVSQAFNTQNAGSKALSNRRMYGMCP  63
            +FILA  A  I   +H SAA A ++F          S A +   A   +   RR+Y +CP
Sbjct  12   VFILALFAHTIAVEFHGSAARAEINFEGP-------SPAHSQDTAAPTSRPKRRVYALCP  64

Query  64   PHFQRVGSECYSLLPQASSWLEAHFFCKDKNAKLAEPQYRADRKLRVFLKKYDAQRELTG  123
            P F RVG++CYSL+ Q SSWLEAHFFCKDKNA L EP   ADRKLR+FL+K DA      
Sbjct  65   PKFHRVGTDCYSLVDQRSSWLEAHFFCKDKNANLTEPGKHADRKLRLFLQKQDALSGEND  124

Query  124  PIWIGATYDWQSNVWQWSISGKNLTYDSFSRMEPEQNLENHCAVYDPNLDYRWSARPCPE  183
            PIW+GATYD  +N WQWS+SG+NL+ DSFSR +  Q L+N+CA+YDP+L YRWSARPC +
Sbjct  125  PIWLGATYDHHNNRWQWSMSGRNLSTDSFSRTDSAQPLDNNCAIYDPSLKYRWSARPCSD  184

Query  184  RFRFICQHKMPKVSEKNRGKVYTRWNATYPNEYANEVILEVMDQPAKNGRRSNVIVKADG  243
            + RFICQHKMPKVS  NR K+Y RWNATYPNE ANEV+LE+++ P +N RR +  VKA+ 
Sbjct  185  KLRFICQHKMPKVSGPNRYKIYNRWNATYPNEQANEVVLEILE-PRENDRRYHRRVKAED  243

Query  244  SDEQIVLPKSRGRAGHNRGRTGRRPNRPTTIHPNDIDAQ-----------ATSNSPTT--  290
            SDE++++P  R           R+       HPND++ Q            ++ +PTT  
Sbjct  244  SDEEMIIPDRRRNNNRRNNHRNRQIKNQNQ-HPNDVNYQPAQQRQRNRPRTSTVAPTTTQ  302

Query  291  -LVHYNEIPVPVTATP  305
             +   N++  P + TP
Sbjct  303  SVSQSNDVLAP-SPTP  317


 Score = 33.5 bits (75),  Expect = 0.82, Method: Compositional matrix adjust.
 Identities = 120/405 (30%), Positives = 192/405 (47%), Gaps = 119/405 (29%)

Query  361  QERERQRHLREQEQQDQQPKSYEQTEQPRRELDELRQREAIDLERQRQQQLAEAEEKRRE  420
            +E+++QR  +EQ+ +++Q +  ++ EQ R    EL++ +   L   + +Q  E +E+  +
Sbjct  428  EEQQKQRDEQEQKDREEQDRLKQEEEQARTHQKELKENQEQQLRELKAKQEREKQERDYQ  487

Query  421  YESRHQELEAMKKKLAEEKKER--DDEYTSAERIRQERIDRQREREEKERKEREEQMKKE  478
             + R  ELE +K++ AE  ++   D+E   AE++R ERI +QRE E ++R+EREEQ +K+
Sbjct  488  QQKREHELELLKQRQAEADRQHAADEE---AEKLRLERIQKQRELEAQQRREREEQRRKQ  544

Query  479  QEERAKEEAKREQERLEMEKRQLEEYEERLKQARDERERQLHEQQERKRQEDLANRRRLE  538
            +EE+ +++ +   +RL  EKR  + Y ER++ A  ERE+QL E  E KR E+L  + +L+
Sbjct  545  REEQEEQDRQNHAKRLAEEKRLHDLYAERIRLANTEREKQLAEAHEAKRLEELKLQEQLK  604

Query  539  E----------------------------------------EEKQRQEDIKRQLEEE---  555
            +                                        EE QR+E+ K Q E E   
Sbjct  605  KQEDERQEQIRREQEEEEKRLELERLEEARRFEEKELKRLHEENQRREEQKLQREREIAL  664

Query  556  -----------EKRLKLEQLEDARKLERQELE---RLAEENRRREEKLRQRQEEIARREE  601
                       E+ L+ E  E+ RK+ +Q LE   R AEE R+ +E   +  EE    E+
Sbjct  665  REAAEKKLAEEEEMLRKEVAEEERKV-KQRLEDEMRQAEEARKAKEAEERAAEEAKAAEQ  723

Query  602  EQRKIEEEEERIKKELEEAEERRKAEHEAQIKLEEEALKARAEAEQKAAEEEKRKRLERF  661
            ++R                                       EA +K A+EE + +LE  
Sbjct  724  KRR--------------------------------------VEAAKKKADEEVKAKLE--  743

Query  662  DALKKQDDERLRQEEKEKKRKYAERLSRLPPEDQRKFFEMRKRRK  706
                            EK+R+Y  R+S L PEDQ+KF EMRKRRK
Sbjct  744  ----------------EKRREYVTRISALSPEDQKKFIEMRKRRK  772


 Score = 33.1 bits (74),  Expect = 0.97, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 75/118 (64%), Gaps = 16/118 (14%)

Query  470  EREEQMKKEQEERAKEEAKR-----------EQERLEMEKRQLEEYEERLKQARDERERQ  518
            E E++++ EQE++ +EE ++           EQ+RL+ E+ Q   +++ LK+ ++++ R+
Sbjct  413  EHEQKLRNEQEKKLREEQQKQRDEQEQKDREEQDRLKQEEEQARTHQKELKENQEQQLRE  472

Query  519  LHEQQERKRQE-DLANRRRLEEEE--KQRQEDIKRQ--LEEEEKRLKLEQLEDARKLE  571
            L  +QER++QE D   ++R  E E  KQRQ +  RQ   +EE ++L+LE+++  R+LE
Sbjct  473  LKAKQEREKQERDYQQQKREHELELLKQRQAEADRQHAADEEAEKLRLERIQKQRELE  530


>M9PFV8_DROME unnamed protein product
Length=808

 Score = 317 bits (813),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 154/324 (48%), Positives = 201/324 (62%), Gaps = 33/324 (10%)

Query  5    IFILACLAPYINA-YHVSAATAGVSFMNENYLDHRVSQAFNTQNAGSKALSNRRMYGMCP  63
            +FILA  A  I   +H SAA A ++F          S A +   A   +   RR+Y +CP
Sbjct  12   VFILALFAHTIAVEFHGSAARAEINFEGP-------SPAHSQDTAAPTSRPKRRVYALCP  64

Query  64   PHFQRVGSECYSLLPQASSWLEAHFFCKDKNAKLAEPQYRADRKLRVFLKKYDAQRELTG  123
            P F RVG++CYSL+ Q SSWLEAHFFCKDKNA L EP   ADRKLR+FL+K DA      
Sbjct  65   PKFHRVGTDCYSLVDQRSSWLEAHFFCKDKNANLTEPGKHADRKLRLFLQKQDALSGEND  124

Query  124  PIWIGATYDWQSNVWQWSISGKNLTYDSFSRMEP--------EQNLENHCAVYDPNLDYR  175
            PIW+GATYD  +N WQWS+SG+NL+ DSFSR +          Q L+N+CA+YDP+L YR
Sbjct  125  PIWLGATYDHHNNRWQWSMSGRNLSTDSFSRTDSAYVQLISNSQPLDNNCAIYDPSLKYR  184

Query  176  WSARPCPERFRFICQHKMPKVSEKNRGKVYTRWNATYPNEYANEVILEVMDQPAKNGRRS  235
            WSARPC ++ RFICQHKMPKVS  NR K+Y RWNATYPNE ANEV+LE+++ P +N RR 
Sbjct  185  WSARPCSDKLRFICQHKMPKVSGPNRYKIYNRWNATYPNEQANEVVLEILE-PRENDRRY  243

Query  236  NVIVKADGSDEQIVLPKSRGRAGHNRGRTGRRPNRPTTIHPNDIDAQ-----------AT  284
            +  VKA+ SDE++++P  R           R+       HPND++ Q            +
Sbjct  244  HRRVKAEDSDEEMIIPDRRRNNNRRNNHRNRQIKNQNQ-HPNDVNYQPAQQRQRNRPRTS  302

Query  285  SNSPTT---LVHYNEIPVPVTATP  305
            + +PTT   +   N++  P + TP
Sbjct  303  TVAPTTTQSVSQSNDVLAP-SPTP  325


 Score = 33.5 bits (75),  Expect = 0.70, Method: Compositional matrix adjust.
 Identities = 120/405 (30%), Positives = 192/405 (47%), Gaps = 119/405 (29%)

Query  361  QERERQRHLREQEQQDQQPKSYEQTEQPRRELDELRQREAIDLERQRQQQLAEAEEKRRE  420
            +E+++QR  +EQ+ +++Q +  ++ EQ R    EL++ +   L   + +Q  E +E+  +
Sbjct  436  EEQQKQRDEQEQKDREEQDRLKQEEEQARTHQKELKENQEQQLRELKAKQEREKQERDYQ  495

Query  421  YESRHQELEAMKKKLAEEKKER--DDEYTSAERIRQERIDRQREREEKERKEREEQMKKE  478
             + R  ELE +K++ AE  ++   D+E   AE++R ERI +QRE E ++R+EREEQ +K+
Sbjct  496  QQKREHELELLKQRQAEADRQHAADEE---AEKLRLERIQKQRELEAQQRREREEQRRKQ  552

Query  479  QEERAKEEAKREQERLEMEKRQLEEYEERLKQARDERERQLHEQQERKRQEDLANRRRLE  538
            +EE+ +++ +   +RL  EKR  + Y ER++ A  ERE+QL E  E KR E+L  + +L+
Sbjct  553  REEQEEQDRQNHAKRLAEEKRLHDLYAERIRLANTEREKQLAEAHEAKRLEELKLQEQLK  612

Query  539  E----------------------------------------EEKQRQEDIKRQLEEE---  555
            +                                        EE QR+E+ K Q E E   
Sbjct  613  KQEDERQEQIRREQEEEEKRLELERLEEARRFEEKELKRLHEENQRREEQKLQREREIAL  672

Query  556  -----------EKRLKLEQLEDARKLERQELE---RLAEENRRREEKLRQRQEEIARREE  601
                       E+ L+ E  E+ RK+ +Q LE   R AEE R+ +E   +  EE    E+
Sbjct  673  REAAEKKLAEEEEMLRKEVAEEERKV-KQRLEDEMRQAEEARKAKEAEERAAEEAKAAEQ  731

Query  602  EQRKIEEEEERIKKELEEAEERRKAEHEAQIKLEEEALKARAEAEQKAAEEEKRKRLERF  661
            ++R                                       EA +K A+EE + +LE  
Sbjct  732  KRR--------------------------------------VEAAKKKADEEVKAKLE--  751

Query  662  DALKKQDDERLRQEEKEKKRKYAERLSRLPPEDQRKFFEMRKRRK  706
                            EK+R+Y  R+S L PEDQ+KF EMRKRRK
Sbjct  752  ----------------EKRREYVTRISALSPEDQKKFIEMRKRRK  780


 Score = 33.1 bits (74),  Expect = 0.98, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 75/118 (64%), Gaps = 16/118 (14%)

Query  470  EREEQMKKEQEERAKEEAKR-----------EQERLEMEKRQLEEYEERLKQARDERERQ  518
            E E++++ EQE++ +EE ++           EQ+RL+ E+ Q   +++ LK+ ++++ R+
Sbjct  421  EHEQKLRNEQEKKLREEQQKQRDEQEQKDREEQDRLKQEEEQARTHQKELKENQEQQLRE  480

Query  519  LHEQQERKRQE-DLANRRRLEEEE--KQRQEDIKRQ--LEEEEKRLKLEQLEDARKLE  571
            L  +QER++QE D   ++R  E E  KQRQ +  RQ   +EE ++L+LE+++  R+LE
Sbjct  481  LKAKQEREKQERDYQQQKREHELELLKQRQAEADRQHAADEEAEKLRLERIQKQRELE  538


>RBP2A_PLAF7 unnamed protein product
Length=3130

 Score = 86.3 bits (212),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 82/246 (33%), Positives = 149/246 (61%), Gaps = 24/246 (10%)

Query  454   QERIDRQREREEKERKEREEQMKKEQEERAKEEA--KREQERLEME---KRQLEEYEERL  508
             +ER++R+++ + K+ +E  ++ ++ QE++ KEEA  ++EQERL+ E   KRQ +E  ER 
Sbjct  2705  KERLEREKQEQLKKEEELRKKEQERQEQQQKEEALKRQEQERLQKEEELKRQEQERLERE  2764

Query  509   KQARDERERQLHEQQERKRQEDLANRRRLEEEEKQRQEDIKRQLEEEEKRLKLEQLEDAR  568
             KQ + ++E +L  Q++ + Q++ A +R+ E+E  Q++E++KRQ +E  +R K EQL+   
Sbjct  2765  KQEQLQKEEELKRQEQERLQKEEALKRQ-EQERLQKEEELKRQEQERLEREKQEQLQKEE  2823

Query  569   KLERQELERLAEENRRREEKLRQRQEEIARREEEQRKIEEEEERIKKELEEAEERRKAEH  628
             +L+RQE ERL +E    E   RQ QE + + EE +R+ +E  ER K EL E E+  K++ 
Sbjct  2824  ELKRQEQERLQKE----EALKRQEQERLQKEEELKRQEQERLERKKIELAEREQHIKSKL  2879

Query  629   EAQI---------KLEEEALKARAEAEQKAAEEEKRKRLE-----RFDALKKQDDERLRQ  674
             E+ +         K ++E +K +    + + E++  K L+     + D+L  ++DE ++ 
Sbjct  2880  ESDMVKIIKDELTKEKDEIIKNKDIKLRHSLEQKWLKHLQNILSLKIDSLLNKNDEVIKD  2939

Query  675   EEKEKK  680
              E + K
Sbjct  2940  NETQLK  2945


 Score = 79.7 bits (195),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 92/320 (29%), Positives = 166/320 (52%), Gaps = 50/320 (16%)

Query  327   KEKRRMERKKQRAQQMQKEKEREWKEQRMRILANQERERQRHLREQEQQDQQPKSYEQTE  386
             +EK R+ER+KQ   + ++E  ++ +E++ +    +  +RQ   R Q+++           
Sbjct  2703  QEKERLEREKQEQLKKEEELRKKEQERQEQQQKEEALKRQEQERLQKEE-----------  2751

Query  387   QPRRELDELRQREAIDLERQRQQQLAEAEEKRREYESRHQELEAMKKKLAEEKKERDDEY  446
                    EL+++E   LER++Q+QL + EE +R+ + R Q+ EA+K+    +++ER  + 
Sbjct  2752  -------ELKRQEQERLEREKQEQLQKEEELKRQEQERLQKEEALKR----QEQERLQKE  2800

Query  447   TSAERIRQERIDRQREREEKERKEREEQMKKEQEER-AKEEA--KREQERLEME---KRQ  500
                +R  QER+    ERE++E+ ++EE++K++++ER  KEEA  ++EQERL+ E   KRQ
Sbjct  2801  EELKRQEQERL----EREKQEQLQKEEELKRQEQERLQKEEALKRQEQERLQKEEELKRQ  2856

Query  501   LEEYEERLKQARDERERQLHEQQERKRQEDLANRRRLEEEEKQRQEDIKRQLEEEEKRLK  560
              +E  ER K    ERE+ +  + E    + + +    E++E  + +DIK +   E+K LK
Sbjct  2857  EQERLERKKIELAEREQHIKSKLESDMVKIIKDELTKEKDEIIKNKDIKLRHSLEQKWLK  2916

Query  561   LEQLEDARKLERQELERLAEENRRREEKL-----------------RQRQEEIARREEEQ  603
               Q   + K++   L +  E  +  E +L                 R+  E I   EE Q
Sbjct  2917  HLQNILSLKIDSL-LNKNDEVIKDNETQLKTNILNSLKNQLYLNLKRELNEIIKEYEENQ  2975

Query  604   RKIEEEEERIKKELEEAEER  623
             +KI    + +   LE+   R
Sbjct  2976  KKILHSNQLVNDSLEQKTNR  2995


 Score = 55.1 bits (131),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 59/177 (33%), Positives = 107/177 (60%), Gaps = 26/177 (15%)

Query  538   EEEEKQRQEDIKRQLEEEEK--RLKLEQLEDARK-----------------LERQELERL  578
             +EEE++ +E I+++ +E+E+  R K EQL+   +                 L+RQE ERL
Sbjct  2688  QEEERKERERIEKEKQEKERLEREKQEQLKKEEELRKKEQERQEQQQKEEALKRQEQERL  2747

Query  579   A--EENRRREEKLRQRQEEIARREEEQRKIEEEEERIKKELEEAEERRKAEHEAQIKLEE  636
                EE +R+E++  +R+++   ++EE+ K +E+E   K+E  + +E+ + + E ++K +E
Sbjct  2748  QKEEELKRQEQERLEREKQEQLQKEEELKRQEQERLQKEEALKRQEQERLQKEEELKRQE  2807

Query  637   EALKARAEAEQKAAEEE----KRKRLERFDALKKQDDERLRQEEKEKKRKYAERLSR  689
             +    R + EQ   EEE    +++RL++ +ALK+Q+ ERL++EE E KR+  ERL R
Sbjct  2808  QERLEREKQEQLQKEEELKRQEQERLQKEEALKRQEQERLQKEE-ELKRQEQERLER  2863


 Score = 48.9 bits (115),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 69/278 (25%), Positives = 132/278 (47%), Gaps = 60/278 (22%)

Query  312   QKQMPHDRVVWRQRQKEKRRMERKKQRAQQMQKEKEREWKEQRMRILANQERERQRHLRE  371
             Q+Q   +R    Q QKE+   E K+Q  +++QKE+           L  QE+ER +   E
Sbjct  2756  QEQERLEREKQEQLQKEE---ELKRQEQERLQKEEA----------LKRQEQERLQKEEE  2802

Query  372   QEQQDQQPKSYEQTEQPRRELDELRQREAIDLERQRQQQLAEAEEKRREYESRHQELEAM  431
              ++Q+Q+                        LER++Q+QL + EE +R+ + R Q+ EA+
Sbjct  2803  LKRQEQE-----------------------RLEREKQEQLQKEEELKRQEQERLQKEEAL  2839

Query  432   KKKLAEEKKERDDEYTSAERIRQERIDRQRE--REEKERKEREEQMKKEQEERAKEEAKR  489
             K++                   QER+ ++ E  R+E+ER ER++    E+E+  K  +K 
Sbjct  2840  KRQ------------------EQERLQKEEELKRQEQERLERKKIELAEREQHIK--SKL  2879

Query  490   EQERLEMEKRQLEEYEERLKQARDERERQLHEQQERKRQEDLANRR--RLEEEEKQRQED  547
             E + +++ K +L + ++ + + +D + R   EQ+  K  +++ + +   L  +  +  +D
Sbjct  2880  ESDMVKIIKDELTKEKDEIIKNKDIKLRHSLEQKWLKHLQNILSLKIDSLLNKNDEVIKD  2939

Query  548   IKRQLEEEEKRLKLEQLEDARKLERQELERLAEENRRR  585
              + QL+         QL    K E  E+ +  EEN+++
Sbjct  2940  NETQLKTNILNSLKNQLYLNLKRELNEIIKEYEENQKK  2977


 Score = 47.4 bits (111),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 48/150 (32%), Positives = 94/150 (63%), Gaps = 13/150 (9%)

Query  571   ERQELERLAEENRRREEKLRQRQEEIARREEEQRKIE-EEEERIKKELE-EAEERRKAEH  628
             E++ LER  +E  ++EE+LR++++E   +++++  ++ +E+ER++KE E + +E+ + E 
Sbjct  2704  EKERLEREKQEQLKKEEELRKKEQERQEQQQKEEALKRQEQERLQKEEELKRQEQERLER  2763

Query  629   EAQIKLEEEALKARAEAEQKAAEEEKRKRLERFDALKKQDDERLRQEEKEKKRKYAERLS  688
             E Q +L++E    R E E          RL++ +ALK+Q+ ERL++EE E KR+  ERL 
Sbjct  2764  EKQEQLQKEEELKRQEQE----------RLQKEEALKRQEQERLQKEE-ELKRQEQERLE  2812

Query  689   RLPPEDQRKFFEMRKRRKAKKTQELLQQKQ  718
             R   E  +K  E++++ + +  +E   ++Q
Sbjct  2813  REKQEQLQKEEELKRQEQERLQKEEALKRQ  2842


 Score = 42.0 bits (97),  Expect = 0.002, Method: Composition-based stats.
 Identities = 37/137 (27%), Positives = 81/137 (59%), Gaps = 6/137 (4%)

Query  309   RTGQKQMPHDRVVWRQRQKEKRRMER-KKQRAQQMQKEKEREWKEQ-RMRILANQERERQ  366
             R  Q+Q+  +  + RQ Q+  ++ E  K+Q  +++QKE+E + +EQ R+     ++ +++
Sbjct  2763  REKQEQLQKEEELKRQEQERLQKEEALKRQEQERLQKEEELKRQEQERLEREKQEQLQKE  2822

Query  367   RHLREQEQQD-QQPKSYEQTEQPR-RELDELRQREAIDLERQRQQQLAEAEEKRREYESR  424
               L+ QEQ+  Q+ ++ ++ EQ R ++ +EL+++E   LER++ +     +  + + ES 
Sbjct  2823  EELKRQEQERLQKEEALKRQEQERLQKEEELKRQEQERLERKKIELAEREQHIKSKLES-  2881

Query  425   HQELEAMKKKLAEEKKE  441
                ++ +K +L +EK E
Sbjct  2882  -DMVKIIKDELTKEKDE  2897



Lambda      K        H
   0.332    0.140    0.428 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3457179198


Query= XP_014085099.1 PREDICTED: HIV Tat-specific factor 1 [Bactrocera
oleae]

Length=661
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7K204_DROME  unnamed protein product                                 647     0.0  
PUF68_DROME  unnamed protein product                                  52.8    6e-07
D5MCQ9_CAEEL  unnamed protein product                                 40.4    0.003


>Q7K204_DROME unnamed protein product
Length=556

 Score = 647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/484 (69%), Positives = 383/484 (79%), Gaps = 27/484 (6%)

Query  139  YAQHVTYEEDGSAIYTDPNTNYRYKWCTTENNWLPCDADKADSTATATENPYENEHYKWC  198
            Y +H+TY  DG AIYTDP+T  +YKWC T NNW P   D  +      E+PYENEHYKWC
Sbjct  72   YEEHMTYGADGGAIYTDPSTKQKYKWCATGNNWQPLGVD--EDVDGQAEDPYENEHYKWC  129

Query  199  SQTQKWIPKVQQQTTETDHYKWDAVKKEWIPKAAAAQTTDSKPNANNTDPANVTYDIDED  258
             ++Q+W+PK  +Q TET+HYKWD  +K+W+PK          PN        V    DE 
Sbjct  130  PKSQQWLPK--KQETETEHYKWDDEQKKWVPK---------HPNPGQEGVCGV----DEH  174

Query  259  GQRIYTDKDGTVFFWDESKNAWFPKIDDDFMAHYQMNYGFIDNTSASEEEARRKAEEEQK  318
            G+R YTDKDG  FFWD +K+AWFPKIDDDFMA YQMNYGFIDNTSA E+E   K   E K
Sbjct  175  GERTYTDKDGVEFFWDATKSAWFPKIDDDFMARYQMNYGFIDNTSAGEKEKAEKEAAEAK  234

Query  319  QKELELQRMTEEAKVAAA----AAAAANANGEGASAIKRKAQEPPKWFEVDPEQNTKVYV  374
            +KE EL+RMT EA+ A +    A++AA   G      KRKAQEPPKWFE+DP QNTKVYV
Sbjct  235  RKEEELKRMTAEAEAAMSRDNPASSAAVPTG------KRKAQEPPKWFEMDPLQNTKVYV  288

Query  375  SNLPLDITMDEFAELMGKCGMIMRDPQTQKYKLKLYAESDGQLKGDGLCDYMKVESVGLA  434
            SNLPLDITMDEFA+LMGKCGM+MRDPQTQK+KLKLYAE DGQ+KGDGLCDY+KVESV LA
Sbjct  289  SNLPLDITMDEFADLMGKCGMVMRDPQTQKFKLKLYAEKDGQIKGDGLCDYIKVESVNLA  348

Query  435  LNILDEYNLRGQKIRVQRAKFQMRGEYNPALKPKRKKKDKEKLQKMKEKLFDWRPEKMRG  494
            L ILDEYNLRG KIRVQRA+FQMRGEYNPALKPKRKKKDKEKLQKMKEKLFDWRP+K+RG
Sbjct  349  LKILDEYNLRGHKIRVQRAQFQMRGEYNPALKPKRKKKDKEKLQKMKEKLFDWRPDKLRG  408

Query  495  ERSKNEKVVIIKNLFDPIIFEKEVQLILDYQNELREECSKCGTVRKVVIYDRHPEGVAQV  554
            ERSKNEK VIIKNLF P +FEKEV+LIL+YQN LREECSKCG VRKVVIYDRHP+GVAQ+
Sbjct  409  ERSKNEKTVIIKNLFTPELFEKEVELILEYQNNLREECSKCGMVRKVVIYDRHPDGVAQI  468

Query  555  NMADPEEADVVIQMMHGRFFGQRKLSAEHWDGKTKYKIVETEAEVQKRLSHWDQYLTREE  614
            NMA PEEAD+VIQMM GR+FGQR+LSAE WDGKTKYKI E+  E  +RLS WD++L  EE
Sbjct  469  NMASPEEADLVIQMMQGRYFGQRQLSAEAWDGKTKYKIEESAVEAHERLSKWDEFLAEEE  528

Query  615  NEER  618
             +++
Sbjct  529  TDKK  532


>PUF68_DROME unnamed protein product
Length=637

 Score = 52.8 bits (125),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 58/109 (53%), Gaps = 27/109 (25%)

Query  493  RGERSKNEKVVIIKNLFDPIIFEKEVQLILDYQNELREECSKCGTVRKVVIYDRHPEGVA  552
            R  R  + +V+I++N+  P    ++V   L  Q E++EECSK GTV +V+I++       
Sbjct  529  RLMRPVDSRVIILRNMVGP----EDVDETL--QEEIQEECSKFGTVSRVIIFNEK-----  577

Query  553  QVNMADPEEADVVIQM----------------MHGRFFGQRKLSAEHWD  585
            Q    D +EA++++++                + GRFFG R++ AE +D
Sbjct  578  QTENEDDDEAEIIVKIFVEFSAGAEAMRGKEALDGRFFGGRRVVAELYD  626


>D5MCQ9_CAEEL unnamed protein product
Length=293

 Score = 40.4 bits (93),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 50/210 (24%), Positives = 77/210 (37%), Gaps = 37/210 (18%)

Query  279  AWFPKIDDDFMAHYQMNYGFIDNTSASEEEARRKAEEEQKQKELELQRMTEEAKVAAAAA  338
               P  +DD +      YG I +T A  ++A    +              +     AAAA
Sbjct  113  GLMPNTNDDLLREMCSKYGNIASTKAIMDKATNNCKGYG---------FVDFESPQAAAA  163

Query  339  AAANANGEGASAIKRKAQEPPKWFEVDPEQNTKVYVSNLPLDITMDEFAELMGKCGMIMR  398
            A    N EG  A   K Q+     E DP   T +Y++NLPLD T       + K GM++ 
Sbjct  164  AVDGLNTEGVQAQMAKLQQQ----EQDP---TNLYIANLPLDFTEQMLETELNKFGMVI-  215

Query  399  DPQTQKYKLKLYAESDGQLKGDGLCDYMKVESVGLALNILDEYNLRGQKIRVQRAKFQMR  458
                     ++    D Q +G G       E   + ++ L+              +F   
Sbjct  216  -------STRILRTPDNQSRGVGFARMDSKEKCEVIISALNG------------GRFDTM  256

Query  459  GEYNPALKPKRKKKD-KEKLQKMKEKLFDW  487
             +  PAL  K+     K KL    + +F+W
Sbjct  257  SKEGPALLIKQADTGRKSKLSGRTDGVFEW  286



Lambda      K        H
   0.332    0.140    0.428 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3457179198


Query= XP_014085100.1 PREDICTED: uncharacterized protein LOC106614094
[Bactrocera oleae]

Length=1081
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q57WT1_TRYB2  unnamed protein product                                 61.6    3e-09
Q54D12_DICDI  unnamed protein product                                 46.2    1e-04
E8NHA2_DROME  unnamed protein product                                 46.2    2e-04


>Q57WT1_TRYB2 unnamed protein product
Length=1152

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 53/210 (25%), Positives = 80/210 (38%), Gaps = 43/210 (20%)

Query  7    ITESGRLFVWGENHYGQLGIGSTSSQTSNSNHNNNNNKNHNSTSHGDIITKPTCVKSLKT  66
            I  SG L+ WG N +GQLG G                    + + G+ +  P  + +LK+
Sbjct  821  IGSSGALYSWGWNTHGQLGHGV-------------------AVNLGEAVFTPKEISALKS  861

Query  67   LGLKIADVAFGNDWSIILTHSNELFYTGRNIFPSDANVARNFSAATVADEQCQIIRKPFR  126
            L  ++  VA G  + I LT   E++  G  ++                 E+C  +  P R
Sbjct  862  LA-QVVQVACGGTFVIALTQCGEVYSWGETLYCGHGT----------GGERC--LTNPKR  908

Query  127  IEVLDDCLTKNEDAECYTHVLAGDEHFVLMTSFGRLIGWGSNQNYQLGMPAGHTAEKPYE  186
            I  L D             V AGD H   ++    +  WG       G P+      P  
Sbjct  909  IAALQD----------IAAVAAGDRHAAAVSYDHVIYAWGRGPVGDGGSPS-TVVPVPVA  957

Query  187  IDLGAPVQQFVCGPESTLVLTTTGKLYFTG  216
            +    PV+Q VC   +T ++T  G LY  G
Sbjct  958  VKFAHPVRQLVCCQVNTFIITDVGDLYVWG  987


 Score = 38.5 bits (88),  Expect = 0.040, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 44/95 (46%), Gaps = 15/95 (16%)

Query  148  AGDEHFVLMTSFGRLIGWGSNQNYQLGMPAGHTAEKPYEIDLGAPVQQFV----CGPEST  203
            AG  H + +TS G +  WG  +N +LG  +G   EK   ID  A   Q V    CG   T
Sbjct  559  AGPCHCLAITSSGAVYSWGVERNGRLGHGSGKNEEKMRLID--ALSNQVVTDASCGSFHT  616

Query  204  LVLTTTGKLYFTGHLNDFVFSQFTELQQNLGPTEQ  238
             VLT  G++        FVF + T  Q  L PT Q
Sbjct  617  AVLTKQGQI--------FVFGENTYGQLGL-PTRQ  642


 Score = 33.9 bits (76),  Expect = 0.96, Method: Compositional matrix adjust.
 Identities = 52/226 (23%), Positives = 92/226 (41%), Gaps = 29/226 (13%)

Query  7    ITESGRLFVWGENHYGQLGIGSTSSQ-------TSNSNHNNNNNKNHNST--SHGDIITK  57
            +T+ G++FV+GEN YGQLG+ +   +             + +  + H       GD++  
Sbjct  619  LTKQGQIFVFGENTYGQLGLPTRQPRLLPEILPLPKRAISVSCGREHTCILLEDGDVMA-  677

Query  58   PTCVKSLKTLGLKIADVAFGNDW-SIILTHSNELFYTGRNIFPSDANVARNFSAATVADE  116
                 SL+  G+    V FG+ + +      N L  T   +   D +V    +A  +   
Sbjct  678  ---CGSLRCSGV---GVGFGSRFVAPRRAVQNYLILT---LASGDLHV---LAAGLLRTM  725

Query  117  QCQIIRKPFRIEVLDDCLTKNEDAECY--THVLAGDEHFVLMTSFGRLIGWGSNQNYQLG  174
               +++ P    +LDD    NE A  +    V AG+   +++   G     G  +N QLG
Sbjct  726  ALTVVQTPPESPILDDLPKVNEVARRHGLRGVSAGNGFTIILAETGEAFSIGQGENGQLG  785

Query  175  MPAGHTAEKPYEIDLGAP----VQQFVCGPESTLVLTTTGKLYFTG  216
            M     ++K     +  P    +    CG    + + ++G LY  G
Sbjct  786  MGDTSLSQKTALRKVVVPDFEELCAVECGFNFAIAIGSSGALYSWG  831


 Score = 31.6 bits (70),  Expect = 4.7, Method: Compositional matrix adjust.
 Identities = 23/80 (29%), Positives = 32/80 (40%), Gaps = 6/80 (8%)

Query  139  DAECYTHVLAGDEHFVLMTSFGRLIGWGSNQNYQLGMPAGHTAEKPYEIDLGAPVQQFVC  198
            DA C      G  H  ++T  G++  +G N   QLG+P       P  + L        C
Sbjct  608  DASC------GSFHTAVLTKQGQIFVFGENTYGQLGLPTRQPRLLPEILPLPKRAISVSC  661

Query  199  GPESTLVLTTTGKLYFTGHL  218
            G E T +L   G +   G L
Sbjct  662  GREHTCILLEDGDVMACGSL  681


>Q54D12_DICDI unnamed protein product
Length=455

 Score = 46.2 bits (108),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 55/225 (24%), Positives = 93/225 (41%), Gaps = 40/225 (18%)

Query  7    ITESGRLFVWGENHYGQLGIGSTSSQTSNSNHNNNNNKNHNSTSHGDIITKPTCVKSLKT  66
            +T  G++  +GEN++GQLG+G T ++T+                       PT V++L  
Sbjct  156  LTRDGKVLGFGENNFGQLGLGDTRNRTA-----------------------PTPVETLNN  192

Query  67   LGLKIADVAFGNDWSIILTHSNELFYTGRN----IFPSDANVARNFSAATVADEQCQIIR  122
                I D+  G D SI +T +  +F  G N    I        R  S   V D + +   
Sbjct  193  --QHIIDIGVGLDHSIAVTKAGHVFGWGYNVEGQIGQKVVEYTRMNSTTEVMDGEEEGGA  250

Query  123  KPFRIEVLDDC------LTKNEDAECYTHVLAGDEHFVLMTSFGRLIGWGSNQNYQLGMP  176
               R +++ D       L    +    ++V  G +   L+++ G +  +GSN+   LG+ 
Sbjct  251  GSLREQMIPDVEYTLPTLVPGLEQIKISNVFCGYDSTFLLSARGNVYSFGSNEIGTLGLG  310

Query  177  AGHTAE--KPYEIDL---GAPVQQFVCGPESTLVLTTTGKLYFTG  216
            +       KP +I        ++Q   G   TL LT+ G +Y  G
Sbjct  311  SELKGRVTKPTKIKFTETNEKIKQLSSGASHTLFLTSGGNVYSCG  355


>E8NHA2_DROME unnamed protein product
Length=1062

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 77/169 (46%), Gaps = 46/169 (27%)

Query  7    ITESGRLFVWGENHYGQLGIGSTSSQTSNSNHNNNNNKNHNSTSHGDIITKPTCVKSLKT  66
            I++SG +F WG N+ GQLG+            N+  N+++           PT +K+L+T
Sbjct  218  ISKSGAVFGWGRNNCGQLGL------------NDETNRSY-----------PTQLKTLRT  254

Query  67   LGLKIADVAFGNDWSIILTHSNELFYTGRNIFPSDANVARNFSAATVADEQCQIIRKPFR  126
            LG++   VA G+++S+ LT+   +F  G   +     +   FS+  +             
Sbjct  255  LGVRF--VACGDEFSVFLTNEGGVFTCGAGAY---GQLGHGFSSNEMLPRMV--------  301

Query  127  IEVLDDCLTKNEDAECYTHVLAGDEH-FVLMTSFGRLIGWGSNQNYQLG  174
            +E++   +T+         V  G+ H   L+ S GR+  +G   + QLG
Sbjct  302  MELMGSTITQ---------VACGNRHTLALVPSRGRVYAFGLGSSGQLG  341


 Score = 45.8 bits (107),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 53/213 (25%), Positives = 85/213 (40%), Gaps = 45/213 (21%)

Query  7    ITESGRLFVWGENHYGQLGIGSTSSQTSNSNHNNNNNKNHNSTSHGDIITKPTCVKSLKT  66
            +T  G L+ WG N YGQLG+ S                  N  +H +   + T +     
Sbjct  163  LTSCGELYSWGSNIYGQLGVNSP-----------------NDLTHCNYPLRLTTL-----  200

Query  67   LGLKIADVAFGNDWSIILTHSNELFYTGRNIFPSDANVARNFSAATVADEQCQIIRKPFR  126
            LG+ +A +A G + S +++ S  +F  GRN          N     + DE  +    P +
Sbjct  201  LGIPLAAIACGGNHSFLISKSGAVFGWGRN----------NCGQLGLNDETNR--SYPTQ  248

Query  127  IEVLDDCLTKNEDAECYTHVLAGDEHFVLMTSFGRLIGWGSNQNYQLGMPAGHTAEKPYE  186
            ++ L     +         V  GDE  V +T+ G +   G+    QLG         P  
Sbjct  249  LKTLRTLGVR--------FVACGDEFSVFLTNEGGVFTCGAGAYGQLGHGFSSNEMLPRM  300

Query  187  ID--LGAPVQQFVCGPESTLVLTTT-GKLYFTG  216
            +   +G+ + Q  CG   TL L  + G++Y  G
Sbjct  301  VMELMGSTITQVACGNRHTLALVPSRGRVYAFG  333


 Score = 43.9 bits (102),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 55/221 (25%), Positives = 85/221 (38%), Gaps = 61/221 (28%)

Query  7    ITESGRLFVWGENHYGQLGIGSTSSQTSNSNHNNNNNKNHNSTSHGDIITKPTCVKSLKT  66
            +++ G++  WG+N  GQLG            H  +           +I+  P  V+ L T
Sbjct  110  LSDWGQVLSWGDNDCGQLG------------HATDK----------EIVQLPKVVRQLVT  147

Query  67   LGLKIADVAFGNDWSIILTHSNELFYTGRNIF-------PSDANVARNFSAATVADEQCQ  119
                +  +A GN+ S+ LT   EL+  G NI+       P+D                C 
Sbjct  148  K--TVVQIACGNNHSLALTSCGELYSWGSNIYGQLGVNSPNDLT-------------HC-  191

Query  120  IIRKPFRIEVLDDCLTKNEDAECYTHVLAGDEHFVLMTSFGRLIGWGSNQNYQLGMPAGH  179
                P R+  L   L     A     +  G  H  L++  G + GWG N   QLG+    
Sbjct  192  --NYPLRLTTL---LGIPLAA-----IACGGNHSFLISKSGAVFGWGRNNCGQLGLNDET  241

Query  180  TAEKPYEID----LGAPVQQFVCGPESTLVLTTTGKLYFTG  216
                P ++     LG  V+   CG E ++ LT  G ++  G
Sbjct  242  NRSYPTQLKTLRTLG--VRFVACGDEFSVFLTNEGGVFTCG  280


 Score = 38.1 bits (87),  Expect = 0.053, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 35/73 (48%), Gaps = 11/73 (15%)

Query  156  MTSFGRLIGWGSNQNYQLGMPAGHTAEK-------PYEIDLGAPVQQFVCGPESTLVLTT  208
            M S   L  WGS  + QLG+  G   E+       P+  D    VQQ  CG   TL LT 
Sbjct  1    MASGKELYCWGSTSHGQLGL-GGIEDEQILTPSQIPWTPD--TAVQQVACGHRHTLFLTA  57

Query  209  TGKLYFTGHLNDF  221
            TGK+Y  G  ND+
Sbjct  58   TGKVYACGS-NDY  69


 Score = 37.4 bits (85),  Expect = 0.072, Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 38/80 (48%), Gaps = 13/80 (16%)

Query  145  HVLAGDEHFVLMTSFGRLIGWGSNQNYQLGMPAGHTAEKPYEIDLGAPVQQFV-------  197
             +  G  H + ++ +G+++ WG N   QL    GH  +K   + L   V+Q V       
Sbjct  99   QICCGSRHSLALSDWGQVLSWGDNDCGQL----GHATDKEI-VQLPKVVRQLVTKTVVQI  153

Query  198  -CGPESTLVLTTTGKLYFTG  216
             CG   +L LT+ G+LY  G
Sbjct  154  ACGNNHSLALTSCGELYSWG  173



Lambda      K        H
   0.332    0.140    0.428 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3457179198


Query= XP_014085101.1 PREDICTED: pentatricopeptide repeat-containing
protein 1, mitochondrial [Bactrocera oleae]

Length=706
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q381Z3_TRYB2  unnamed protein product                                 54.3    3e-07
Q9VJ86_DROME  unnamed protein product                                 51.2    3e-06
Q95NR4_DROME  unnamed protein product                                 48.1    2e-05


>Q381Z3_TRYB2 unnamed protein product
Length=822

 Score = 54.3 bits (129),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 73/172 (42%), Gaps = 7/172 (4%)

Query  164  EVQMLKQDRAKPDAYIYNLLISGCAKAGYTRKAFNLFTKLRQRGLKVK-GGTYTSLFNAC  222
            E  M      +PD   Y LL   C +     +AF+L+ ++R+    V    TY +L   C
Sbjct  123  EDSMCVNSNVQPDLTTYQLLFRACERKSQYHRAFHLYMQMREMPHIVPDTTTYDTLLGFC  182

Query  223  ANAPSTVYGIEQANRLREIMLEKGYDPNVKNYNAMIKAFGRCGDVKTAYLLADELMEKQL  282
            A     V  + QA    E M +    P+V  YN ++ A       +    + + + E  +
Sbjct  183  A----AVKDVPQALFFMEEMKKNCVAPSVNTYNCLMGALREKAPYEETLRVYNGMTEWGV  238

Query  283  PLNVETFNFLLQACASDVDYGFRHCLLTWHKMMQHGLKPDYYTFNTVLRCVR  334
               V TFN +  A     DY     L  + +M + G+ P+  ++NT+L  VR
Sbjct  239  KPTVRTFNTVTGAALIHDDYEMAFQL--FEEMKKQGVLPNVVSYNTLLCLVR  288


 Score = 38.1 bits (87),  Expect = 0.028, Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 44/90 (49%), Gaps = 2/90 (2%)

Query  436  FLNLMKECKITPDIETFTTLLEVIPPTYAAEKQLLTY--VRKIGLKADIDFFNILIKKRS  493
            F+  MK+  + P + T+  L+  +      E+ L  Y  + + G+K  +  FN +     
Sbjct  194  FMEEMKKNCVAPSVNTYNCLMGALREKAPYEETLRVYNGMTEWGVKPTVRTFNTVTGAAL  253

Query  494  MRFDYEGAKEVLSMIRTAGLEPDIVTYGVL  523
            +  DYE A ++   ++  G+ P++V+Y  L
Sbjct  254  IHDDYEMAFQLFEEMKKQGVLPNVVSYNTL  283


 Score = 35.4 bits (80),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 19/55 (35%), Positives = 31/55 (56%), Gaps = 7/55 (13%)

Query  285  NVETFNFLLQACASDVDYGF-RHCLLTWHKMMQHGLKPDY---YTFNTVLRCVRD  335
            NV+T+  +++AC   + +GF +HC   ++ M+  GL PDY       TV   +RD
Sbjct  460  NVDTYRLIVRAC---LHFGFAKHCHYFYNAMLNEGLGPDYNFALLMETVCEEIRD  511


 Score = 34.3 bits (77),  Expect = 0.46, Method: Compositional matrix adjust.
 Identities = 96/435 (22%), Positives = 164/435 (38%), Gaps = 82/435 (19%)

Query  140  TIDYARLIKSHLAEKRLKDAIAVLEVQMLKQDRAKPDAYIYNLLISGCAKAGYTRKAFNL  199
            T  Y  L+    A K +  A+  +E   +K++   P    YN L+    +     +   +
Sbjct  172  TTTYDTLLGFCAAVKDVPQALFFME--EMKKNCVAPSVNTYNCLMGALREKAPYEETLRV  229

Query  200  FTKLRQRGLKVKGGTYTSLFNACANAPSTVYGIEQANRLREIMLEKGYDPNVKNYNAMIK  259
            +  + + G+K    T    FN    A       E A +L E M ++G  PNV +YN ++ 
Sbjct  230  YNGMTEWGVKPTVRT----FNTVTGAALIHDDYEMAFQLFEEMKKQGVLPNVVSYNTLLC  285

Query  260  AFGRCGDV---KTAYLLADELMEKQLPLNVETFNFLLQACASDVDYGFRHCLLTWHKMMQ  316
               +  D    + AY       E+Q               A  +          +H+M  
Sbjct  286  LVRQRLDYVMGRNAYASVKRTREQQ---------------AHGMKAISELTTTLFHEMGS  330

Query  317  HGLKPDYYTFNTVLRCVRDC---GFGDLNTM-----EKVLNQICAEREELLATATSIE--  366
              ++P+ +TFN V+  + +C   G  D+  M      K  N+     E++ AT  S+   
Sbjct  331  MVVEPNTFTFNLVMEILIECDDFGVFDIYRMMQEHYNKNNNKTSIIEEKIEATRMSVSIM  390

Query  367  -KETSL--------PKEISPS-----NTQDVEKQSQLIEFKNNAEQLEMPNL--------  404
              E SL        P+E +PS      + DV K +      N A    +P+L        
Sbjct  391  MAEASLSLDSNKIQPRERNPSIDSILCSIDVNKDT-----SNAANLAGLPSLDVIMGMDN  445

Query  405  --LAARPHLGSLVSLAEVSRPHERFILLGGLSG----FLNLMKECKITPDIETFTTLLE-  457
               +AR     +    +  R   R  L  G +     F N M    + PD   F  L+E 
Sbjct  446  RKRSARITANEMQPNVDTYRLIVRACLHFGFAKHCHYFYNAMLNEGLGPDY-NFALLMET  504

Query  458  VIPPTYAAEK--QLLTYVRKIGLKADIDFFNILIKKRSMRFDYEGAKEVLSMIRTAGL--  513
            V       EK   +L++ +  G+  D+  FN  ++  +      G  ++LS++    L  
Sbjct  505  VCEEIRDVEKAFAVLSHAKMAGVYIDVSLFNAYLRVLAAV----GDDKLLSILGEMELGI  560

Query  514  -----EPDIVTYGVL  523
                 +PD+ TY ++
Sbjct  561  NSFCSQPDVETYNIV  575


 Score = 30.8 bits (68),  Expect = 5.1, Method: Compositional matrix adjust.
 Identities = 25/93 (27%), Positives = 43/93 (46%), Gaps = 3/93 (3%)

Query  155  RLK--DAIAVLEVQMLKQDRAKPDAYIYNLLISGCAKAGYTRKAFNLFTKLRQRGLKVKG  212
            RLK  D +  L  ++L     + D   YN++   C   G   +A +LF +LR + +K   
Sbjct  693  RLKEWDKLDALFHKLLGYPDMEADVNCYNIMFDMCLLCGKYVEAKSLFNELRMKCVKPDL  752

Query  213  GTYTSLFNA-CANAPSTVYGIEQANRLREIMLE  244
              Y +L +   A A S +Y + +  R+  +  E
Sbjct  753  RMYNTLLHIFAAAADSAMYEVLETMRMNHVAPE  785


>Q9VJ86_DROME unnamed protein product
Length=1412

 Score = 51.2 bits (121),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 65/133 (49%), Gaps = 12/133 (9%)

Query  230  YGIEQANRLREIMLEKGYDPNVKNYNAMIKAFGRCGDVKTAYLLADELMEKQLPLNVETF  289
            +G    + L EI   KG +PN   Y  +I  + + GD++ A  + + +  K LP+N   F
Sbjct  155  HGFAPTDFLAEIE-AKGIEPNRVTYQRLIARYCQQGDIEGATRILEFMRAKSLPVNENVF  213

Query  290  NFLLQACASDVDYGFRHCLLTWHKMMQHGLKPDYYTFNTVLRCVRDCGF---GDLNTMEK  346
            N L+   +   D      +L    MMQ GL+P   T+ T+L     C F   GDL  +++
Sbjct  214  NSLILGHSQANDLESAKGILGV--MMQAGLEPSADTYTTLL-----CAFARHGDLAAVKE  266

Query  347  VLNQICAEREELL  359
             L + C ++E +L
Sbjct  267  TLAE-CEQKEIIL  278


 Score = 39.3 bits (90),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 43/94 (46%), Gaps = 4/94 (4%)

Query  174  KPDAYIYNLLISGCAKAGYTRKAFNLFTKLRQRGLKVKGGTYTSLFNACANAPSTVYGIE  233
            +P+   Y  LI+   + G    A  +   +R + L V      ++FN+     S    +E
Sbjct  172  EPNRVTYQRLIARYCQQGDIEGATRILEFMRAKSLPVN----ENVFNSLILGHSQANDLE  227

Query  234  QANRLREIMLEKGYDPNVKNYNAMIKAFGRCGDV  267
             A  +  +M++ G +P+   Y  ++ AF R GD+
Sbjct  228  SAKGILGVMMQAGLEPSADTYTTLLCAFARHGDL  261


 Score = 38.5 bits (88),  Expect = 0.021, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 30/56 (54%), Gaps = 0/56 (0%)

Query  468  QLLTYVRKIGLKADIDFFNILIKKRSMRFDYEGAKEVLSMIRTAGLEPDIVTYGVL  523
            ++L ++R   L  + + FN LI   S   D E AK +L ++  AGLEP   TY  L
Sbjct  196  RILEFMRAKSLPVNENVFNSLILGHSQANDLESAKGILGVMMQAGLEPSADTYTTL  251


>Q95NR4_DROME unnamed protein product
Length=1412

 Score = 48.1 bits (113),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 64/133 (48%), Gaps = 12/133 (9%)

Query  230  YGIEQANRLREIMLEKGYDPNVKNYNAMIKAFGRCGDVKTAYLLADELMEKQLPLNVETF  289
            +G    + L EI   KG +PN   Y  +I  + + GD++ A  + + +  K LP+N   F
Sbjct  155  HGFAPTDFLAEIE-AKGIEPNRVTYQRLIARYCQQGDIEGATRILEFMRAKSLPVNENVF  213

Query  290  NFLLQACASDVDYGFRHCLLTWHKMMQHGLKPDYYTFNTVLRCVRDCGF---GDLNTMEK  346
            N L+   +   D      +L    M Q GL+P   T+ T+L     C F   GDL  +++
Sbjct  214  NSLILGHSQANDLESAKGILGV--MKQAGLEPSADTYTTLL-----CAFARHGDLAAVKE  266

Query  347  VLNQICAEREELL  359
             L + C ++E +L
Sbjct  267  TLAE-CEQKEIIL  278


 Score = 40.0 bits (92),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 31/56 (55%), Gaps = 0/56 (0%)

Query  468  QLLTYVRKIGLKADIDFFNILIKKRSMRFDYEGAKEVLSMIRTAGLEPDIVTYGVL  523
            ++L ++R   L  + + FN LI   S   D E AK +L +++ AGLEP   TY  L
Sbjct  196  RILEFMRAKSLPVNENVFNSLILGHSQANDLESAKGILGVMKQAGLEPSADTYTTL  251


 Score = 37.0 bits (84),  Expect = 0.062, Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 42/94 (45%), Gaps = 4/94 (4%)

Query  174  KPDAYIYNLLISGCAKAGYTRKAFNLFTKLRQRGLKVKGGTYTSLFNACANAPSTVYGIE  233
            +P+   Y  LI+   + G    A  +   +R + L V      ++FN+     S    +E
Sbjct  172  EPNRVTYQRLIARYCQQGDIEGATRILEFMRAKSLPVN----ENVFNSLILGHSQANDLE  227

Query  234  QANRLREIMLEKGYDPNVKNYNAMIKAFGRCGDV  267
             A  +  +M + G +P+   Y  ++ AF R GD+
Sbjct  228  SAKGILGVMKQAGLEPSADTYTTLLCAFARHGDL  261



Lambda      K        H
   0.332    0.140    0.428 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3457179198


Query= XP_014085102.1 PREDICTED: dehydrogenase/reductase SDR family member
4 [Bactrocera oleae]

Length=297
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DHRS4_CAEEL  unnamed protein product                                  249     3e-82
Q8I2S7_PLAF7  unnamed protein product                                 124     3e-33
O61709_CAEEL  unnamed protein product                                 117     3e-31


>DHRS4_CAEEL unnamed protein product
Length=260

 Score = 249 bits (635),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 122/257 (47%), Positives = 177/257 (69%), Gaps = 4/257 (2%)

Query  45   NMKRLEGKVAIVTASTEGIGFAIAKRLAEDGAAVVISSRKERNVENAVERLRKLNL-KVT  103
            N +R EGKVAIVTA+T+GIG AIA+RL ++GA+VVI SR ++NV+ A+E L+   L KV 
Sbjct  4    NCRRFEGKVAIVTAATKGIGLAIAERLLDEGASVVIGSRNQKNVDEAIEYLKNKGLTKVA  63

Query  104  GLKCHVGEKQDRKRLFEETIRTFGKLNILVSNAATNPAVGGVFECEESVWDKIFDINVKS  163
            G+  H+    D+K+L + T++ FGK+NILV+N   NPA G + E  + VWDK+F++NVK+
Sbjct  64   GIAGHIASTDDQKKLVDFTLQKFGKINILVNNHGINPAFGHILEVSDQVWDKLFEVNVKA  123

Query  164  SYLLAKEALPYLRKEQGSNIVFVSSIAGYDAFNLLGAYSVSKTALIGLTKAASKELASEG  223
             + + K   P++ KE G  I+F +S + Y +   + AY V+KT L+GLT+A +  LA + 
Sbjct  124  GFQMTKLVHPHIAKEGGGAIIFNASYSAYKSPPGIAAYGVTKTTLVGLTRALAMGLAKDN  183

Query  224  IRVNCLAPGIIKTKFSSALYETESANE---ASISKVPMGRLGTPEEMGGVVSFLVSDDAS  280
            IRVN +APG+IKTK S  L++     E     I ++ +GRLG P++  G V++L SDD+S
Sbjct  184  IRVNGIAPGVIKTKMSQVLWDGGEDAEKELTDIQEIALGRLGVPDDCAGTVAYLASDDSS  243

Query  281  YITGETILAAGGMSARL  297
            YITGE I+ AGG+ ARL
Sbjct  244  YITGEMIIIAGGVQARL  260


>Q8I2S7_PLAF7 unnamed protein product
Length=301

 Score = 124 bits (310),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/292 (29%), Positives = 148/292 (51%), Gaps = 8/292 (3%)

Query  8    LITKAKSCYTVANI---SGVSLNICCKHLSSSGIHTATE-ENMKRL-EGKVAIVTASTEG  62
            L TK   CY ++ +   + ++ N   K+++S  + +  + EN     E KVA+VT +  G
Sbjct  12   LFTKFFHCYKISYVLKNAKLAPNHAIKNINSLNLLSENKKENYYYCGENKVALVTGAGRG  71

Query  63   IGFAIAKRLAEDGAAVVISSRKERNVENAVERLRKLNLKVTGLKCHVGEKQDRKRLFEET  122
            IG  IAK LA+  + V+  SR +++ ++ V+ ++    + +G    V +K++   +  + 
Sbjct  72   IGREIAKMLAKSVSHVICISRTQKSCDSVVDEIKSFGYESSGYAGDVSKKEEISEVINKI  131

Query  123  IRTFGKLNILVSNAATNPAVGGVFECEESVWDKIFDINVKSSYLLAKEALPYLRKEQGSN  182
            +     ++ILV+NA            +   W+ +   N+ S + + +     +   +   
Sbjct  132  LTEHKNVDILVNNAGITRD-NLFLRMKNDEWEDVLRTNLNSLFYITQPISKRMINNRYGR  190

Query  183  IVFVSSIAGYDAFNLLGAYSVSKTALIGLTKAASKELASEGIRVNCLAPGIIKTKFSSAL  242
            I+ +SSI G         YS SK  +IG TK+ +KELAS  I VN +APG I +  +  +
Sbjct  191  IINISSIVGLTGNVGQANYSSSKAGVIGFTKSLAKELASRNITVNAIAPGFISSDMTDKI  250

Query  243  YETESANEASISKVPMGRLGTPEEMGGVVSFLVSDDASYITGETILAAGGMS  294
              +E   +  IS +P GR+GTPEE+  +  FL SD + YI G   +  GG+S
Sbjct  251  --SEQIKKNIISNIPAGRMGTPEEVANLACFLSSDKSGYINGRVFVIDGGLS  300


>O61709_CAEEL unnamed protein product
Length=253

 Score = 117 bits (293),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 77/250 (31%), Positives = 130/250 (52%), Gaps = 6/250 (2%)

Query  54   AIVTASTEGIGFAIAKRLAEDGAAVVISSRKERNVENAVERLRKLNLKVTGLKCHVGEKQ  113
            A+V  +T  +G A+ +RLA  G  V  ++    +V    E   K+   VT     V   +
Sbjct  4    ALVIGATSTLGKAVVRRLAFTGYKVAAAADCPNSVGKVAEDNIKVGGDVTAFSLDVANAE  63

Query  114  DRKRLFEETIRTFGKLNILVSNAATNPAVGGVFECEESVWDKIFDINVKSSYLLAKEALP  173
             RK L  +     G L+ L+     N  +G + E     +DK+F  N+ + + L++ A+ 
Sbjct  64   HRKELITKVAEKLGGLDTLIIVPPQNEVLGEIIETSGEDFDKLFANNLTTPFRLSQAAMS  123

Query  174  YLRKEQGSNIVFVSSIAGYDAFNLLGAYSVSKTALIGLTKAASKELASEGIRVNCLAPGI  233
             L K Q  +I++++S  G+     +G YSV+ ++++ LTK+ ++  A +G+RVN +  G+
Sbjct  124  TLAKSQNGSIIYLTSCFGFTPSIDMGLYSVASSSVLSLTKSVAQSAAKQGVRVNSVVSGM  183

Query  234  IKTKFSSALYETESANEASI------SKVPMGRLGTPEEMGGVVSFLVSDDASYITGETI  287
            I+   + A+++  S  EA        S +P+GRLG P ++   V FL S  A YITGE  
Sbjct  184  IEGDGTGAVWDHASGEEARQIKQHLESMIPLGRLGRPSDVASYVEFLASTKARYITGENC  243

Query  288  LAAGGMSARL  297
            +  GG+S RL
Sbjct  244  IVGGGVSYRL  253



Lambda      K        H
   0.332    0.140    0.428 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3457179198


Query= XP_014085103.1 PREDICTED: uncharacterized protein LOC106614097
[Bactrocera oleae]

Length=274
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VTT2_DROME  unnamed protein product                                 67.8    9e-13
Q9VTT3_DROME  unnamed protein product                                 45.4    2e-05
Q5BHZ5_DROME  unnamed protein product                                 31.6    0.60 


>Q9VTT2_DROME unnamed protein product
Length=391

 Score = 67.8 bits (164),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 55/94 (59%), Gaps = 3/94 (3%)

Query  4    RVMWDEAAEADLIQLWQEKTPQLRSTRKNSHIYEEMSREMNTAGHNYTATEIKIKIHNFT  63
            R +W + AE  L+QLW +     R   KN  IY +M+REM+  G ++  TE+K K+ N +
Sbjct  151  RHVWKKDAEKMLLQLWAQHLKDFRGESKNVIIYRQMAREMSQFGPSH--TELKTKMDNLS  208

Query  64   NKYRQEKQKV-SGGSPSVWKHYAAVREAVGGYKS  96
             KYR E ++V   G PS W+H+  ++  + G KS
Sbjct  209  RKYRIEAERVRETGVPSKWEHFHKLQALLIGTKS  242


>Q9VTT3_DROME unnamed protein product
Length=368

 Score = 45.4 bits (106),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 44/83 (53%), Gaps = 3/83 (4%)

Query  7    WDEAAEADLIQLWQEKTPQLRSTRKNSHIYEEMSREMNTAGHNYTATEIKIKIHNFTNKY  66
            W   A   L++LW      LR +RK   +  +M+ EM + G  +T TEIK KI +   +Y
Sbjct  121  WSFHAVELLLELWARHCVDLRDSRKRVQVIWKMTGEMKSLG--FTFTEIKNKIDDMGQQY  178

Query  67   RQEKQ-KVSGGSPSVWKHYAAVR  88
            R+E   + + G  S W+++  ++
Sbjct  179  RRESHMEKTTGHKSQWEYFETMK  201


>Q5BHZ5_DROME unnamed protein product
Length=319

 Score = 31.6 bits (70),  Expect = 0.60, Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 36/79 (46%), Gaps = 14/79 (18%)

Query  18  LWQEKTPQLRSTRKNSHIYEEMSREMNTAGHNYTATEIKIKIHNFTNKYRQEKQKVSGGS  77
           LW   +P   S +K    Y+E+ + +     N +  ++K KI++    YR+E        
Sbjct  29  LWDSSSPDYLSKQKKEPGYQELLKILRRVNSNCSIQDVKRKINSLRCCYRRE--------  80

Query  78  PSVWKHYAAVREAVGGYKS  96
                 +  V+E+V GY++
Sbjct  81  ------FKKVQESVNGYQT  93



Lambda      K        H
   0.332    0.140    0.428 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3457179198


Query= XP_014085104.1 PREDICTED: TP53-regulating kinase [Bactrocera oleae]

Length=227
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VRJ6_DROME  unnamed protein product                                 335     3e-118
Q387G5_TRYB2  unnamed protein product                                 128     2e-36 
Q8IC06_PLAF7  unnamed protein product                                 118     1e-32 


>Q9VRJ6_DROME unnamed protein product
Length=224

 Score = 335 bits (860),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 159/227 (70%), Positives = 188/227 (83%), Gaps = 5/227 (2%)

Query  1    MKVLKQGAEGRLYLGEFKGEKCLVKERFIKHYRHPELDTQITRQRIKAETKAATRCQNAG  60
            +++LKQGAEGRLYLG+FKGE CL+KERF+K YRHPEL+TQITRQR+KAE KA+ RC  AG
Sbjct  3    LEILKQGAEGRLYLGDFKGEACLIKERFVKKYRHPELNTQITRQRMKAEAKASGRCLAAG  62

Query  61   ILAPRILHTDLNERKIYMEYFGDAITAKELIQRVVADHTVETAEVVLKNLCRQVGTIIGK  120
            ILAP+ILH+DLN  K+YMEYF  A TAK+ IQ  V+  T + A+  L   C ++G IIGK
Sbjct  63   ILAPKILHSDLNTHKLYMEYFDAAKTAKQFIQETVSTQTEDEAKKCLLEFCTRIGEIIGK  122

Query  121  LHANNIIHGDLTTSNILINPKSENKDFKDHDVIFIDFGLSHYNQAAEDKSVDLYVLERAL  180
            +H+N+IIHGDLTTSNILINPK       D+DVI IDFGLSHYNQA EDK VDLYVLERAL
Sbjct  123  MHSNHIIHGDLTTSNILINPKG-----GDYDVILIDFGLSHYNQATEDKGVDLYVLERAL  177

Query  181  LSTHSEQPYLFDYILEAYRKECGKDEGAIISKFEEVRARGRKRTMIG  227
            LSTHSEQPY+F+++L AYR  CGKDE A+++KFEEVRARGRKRTMIG
Sbjct  178  LSTHSEQPYIFEHVLAAYRTACGKDEQAVLTKFEEVRARGRKRTMIG  224


>Q387G5_TRYB2 unnamed protein product
Length=246

 Score = 128 bits (322),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 85/238 (36%), Positives = 123/238 (52%), Gaps = 15/238 (6%)

Query  2    KVLKQGAEGRLYLGEFKGEKCLVKERFIKHYRHPELDTQITRQRIKAETKAATRCQNAGI  61
             VL Q AE R+Y  +F     + K R  K YRHP LD ++  QR   E +A  RCQ  GI
Sbjct  12   SVLFQCAESRVYECDFYSHPAVCKYRLPKPYRHPTLDKRLREQRSVREARALVRCQKQGI  71

Query  62   LAPRILHTDLNERKIYMEYFGDAITAKELIQRVVADHTVETA-EVVLKNLCRQVGTIIGK  120
              P +   D     I ME     ++ ++++    A   +E A   V   L   +G ++G 
Sbjct  72   AVPAVYAIDRESCAIVMERI-IGMSVRDVLNE--AQRPLEGAVSPVAARLLEGMGEVVGL  128

Query  121  LHANNIIHGDLTTSNILINPKSENKDFKDHD---------VIFIDFGLSHYNQAAEDKSV  171
            LH  +IIHGDLTTSN +    +  +   D           ++ +DFGL     +AE+++V
Sbjct  129  LHNAHIIHGDLTTSNFMYRTATVAEGKADSAACGAAPRDRLVVLDFGLVMDKNSAEERAV  188

Query  172  DLYVLERALLSTH-SEQPYLFDYILEAYRKECGKDE-GAIISKFEEVRARGRKRTMIG  227
            DLYVLERA+ S+H S +     +IL  YR+     +  A I++   VRARGRKR+M+G
Sbjct  189  DLYVLERAIKSSHPSLEGVASAFILNGYRRTADPHQVEATITRLGAVRARGRKRSMVG  246


>Q8IC06_PLAF7 unnamed protein product
Length=229

 Score = 118 bits (296),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 80/250 (32%), Positives = 124/250 (50%), Gaps = 47/250 (19%)

Query  4    LKQGAEGRLYLGEFKGEKCLVKERFIKHYRHPELDTQITRQRIKAETKAATRCQNAGILA  63
            +  G++ R+Y   F  ++ + K  + K+YRH ++DT+I + R+  E K   +  +  I  
Sbjct  1    MSAGSDARIYRCTFIKKEAVKKVIYRKYYRHKKIDTKIRKLRVSNEIKFTKKLASLNIDV  60

Query  64   PRILHTDLNERKIYMEYFGDAITAKELIQRVVADHTVETAEVVLKNL---------CRQV  114
            P I   D  E+ +Y EY                     T   +LKNL         C  V
Sbjct  61   PYIYFVDAKEKSLYFEYVKGC-----------------TINFILKNLKEYEPKIPIC--V  101

Query  115  GTIIGKLHANNIIHGDLTTSNILI-----------------NPKSENKDFKDHDVIFIDF  157
            G ++ K+H  NIIHGD TTSN+++                 +P + + D ++  +  IDF
Sbjct  102  GMVLAKIHNGNIIHGDYTTSNLILRNSFIQQNNLLDLKNNNSPYNFS-DLENVKLCVIDF  160

Query  158  GLSHYNQAAEDKSVDLYVLERALLSTHSEQPYLFDYILEAYRKECGKDEGAIISKFEEVR  217
            GLS  + + EDK+VDL+VL + + S HSE P L + ILE Y+ +   +   I +K E V+
Sbjct  161  GLSFLSSSIEDKAVDLFVLLKTIKSFHSEFPSLEEDILEGYKMK-SDNVNDIFTKLEIVK  219

Query  218  ARGRKRTMIG  227
             RGRKR M+G
Sbjct  220  QRGRKRPMVG  229



Lambda      K        H
   0.332    0.140    0.428 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3457179198


Query= XP_014085105.1 PREDICTED: charged multivesicular body protein 2b-B
[Bactrocera oleae]

Length=211
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9U2F6_CAEEL  unnamed protein product                                 122     3e-34
Q9VBI3_DROME  unnamed protein product                                 113     2e-30
Q8SXB1_DROME  unnamed protein product                                 103     5e-27


>Q9U2F6_CAEEL unnamed protein product
Length=237

 Score = 122 bits (305),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/185 (35%), Positives = 111/185 (60%), Gaps = 0/185 (0%)

Query  5    LFGKKPTVKEQQRENDKNLRKANRDIDRERRKLEEEEHKLQQEIKKAAAQGNNDVCRILA  64
            LFG++ T  E  R+N + L KA R++DRER ++E +E K+  +IK  A +   D  +++A
Sbjct  4    LFGRRKTPAELLRQNQRALNKAIRELDRERARMEAQEKKVIADIKNMAKKNQMDSVKVMA  63

Query  65   KQLVEIRKQKSRTFAATSKITSIGYQNKNMGTNIVLADAMGTTAKTMGDMNKVMRPERIA  124
            K LV  R+   +     + I ++  + + + +   +A AM    K M  MN+ +   +I 
Sbjct  64   KDLVRTRRYIKKFIVMKANIQAVSLKVQTLKSQDAMASAMKGVTKAMQSMNRQLNLPQIQ  123

Query  125  ANLRDFQKANMHMEMTDEMINDTLDDMLNESGDEEESDTIVNKVLDEIGIEISGKMANIP  184
              + +F+K +  M+M +E++ D +DD L ++GDEEE+D IVN+VLDE+GI++  +MA +P
Sbjct  124  KIMMEFEKQSEIMDMKEEVMGDAIDDALGDAGDEEETDQIVNQVLDELGIQMGEEMAGLP  183

Query  185  STGSG  189
            S   G
Sbjct  184  SAAGG  188


>Q9VBI3_DROME unnamed protein product
Length=256

 Score = 113 bits (282),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 72/190 (38%), Positives = 119/190 (63%), Gaps = 1/190 (1%)

Query  2    FNNLFGKKPTVKEQQRENDKNLRKANRDIDRERRKLEEEEHKLQQEIKKAAAQGNNDVCR  61
             + LFGKK +  E  R+N + L KA RD+DRER K+E++E K+  +IKK A +G  D  +
Sbjct  1    MDWLFGKKISPDEMLRKNQRALNKAMRDLDRERMKMEQQEKKIIADIKKMAKEGQMDAVK  60

Query  62   ILAKQLVEIRKQKSRTFAATSKITSIGYQNKNMGTNIVLADAMGTTAKTMGDMNKVMRPE  121
            I+AK LV  R+   +     + I ++  + + + +   +A AM    K M +MN+ +   
Sbjct  61   IMAKDLVRTRRYAKKFMLMKANIQAVSLKIQTLKSQNTMAQAMKGVTKAMQNMNRQLNLP  120

Query  122  RIAANLRDFQKANMHMEMTDEMINDTLDDMLNESGDEEESDTIVNKVLDEIGIEISGKMA  181
            +I   L+DF+K +  M+M +EMIND +DD + + GDEEE+D +V++VLDE+G+++  ++ 
Sbjct  121  QIQKILQDFEKQSEMMDMKEEMINDAIDDAMEDEGDEEETDAVVSQVLDELGLQLGEQLG  180

Query  182  NIPSTGSGDL  191
            ++PS  SG L
Sbjct  181  DLPS-ASGSL  189


>Q8SXB1_DROME unnamed protein product
Length=243

 Score = 103 bits (257),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 66/175 (38%), Positives = 111/175 (63%), Gaps = 1/175 (1%)

Query  17   RENDKNLRKANRDIDRERRKLEEEEHKLQQEIKKAAAQGNNDVCRILAKQLVEIRKQKSR  76
            R+N + L KA RD+DRER K+E++E K+  +IKK A +G  D  +I+AK LV  R+   +
Sbjct  3    RKNQRALNKAMRDLDRERMKMEQQEKKIIADIKKMAKEGQMDAVKIMAKDLVRTRRYAKK  62

Query  77   TFAATSKITSIGYQNKNMGTNIVLADAMGTTAKTMGDMNKVMRPERIAANLRDFQKANMH  136
                 + I ++  + + + +   +A AM    K M +MN+ +   +I   L+DF+K +  
Sbjct  63   FMLMKANIQAVSLKIQTLKSQNTMAQAMKGVTKAMQNMNRQLNLPQIQKILQDFEKQSEM  122

Query  137  MEMTDEMINDTLDDMLNESGDEEESDTIVNKVLDEIGIEISGKMANIPSTGSGDL  191
            M+M +EMIND +DD + + GDEEE+D +V++VLDE+G+++  ++ ++PS  SG L
Sbjct  123  MDMKEEMINDAIDDAMEDEGDEEETDAVVSQVLDELGLQLGEQLGDLPS-ASGSL  176



Lambda      K        H
   0.332    0.140    0.428 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3457179198


Query= XP_014085106.1 PREDICTED: uncharacterized protein LOC106614101
[Bactrocera oleae]

Length=202
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q45EJ8_CAEEL  unnamed protein product                                 28.9    3.2  
H2L0I3_CAEEL  unnamed protein product                                 28.9    3.2  
H2L0I2_CAEEL  unnamed protein product                                 28.9    3.2  


>Q45EJ8_CAEEL unnamed protein product
Length=2117

 Score = 28.9 bits (63),  Expect = 3.2, Method: Composition-based stats.
 Identities = 33/146 (23%), Positives = 61/146 (42%), Gaps = 28/146 (19%)

Query  12   KIASQYGTSSTRSIWIKTRGQMFWEVDCQVNSDAFFKSNFRMNHQSFNKLCIMLKSLEK-  70
            ++ ++Y  S  R+I +++RG      D      A  ++  R N +  N+    LK L + 
Sbjct  516  ELMTKYEESIERNIELESRG------DDSQRKIAELEAELRRNREKLNEAQGALKKLHEM  569

Query  71   -----KNTNYRKSIQLEKRIAIALYALGSSAKYRAIGNMFGIGKSSVCNILIEFCHEVWR  125
                 KN +   SI+  + ++     L  S   RA+ N F    + +         ++ R
Sbjct  570  AQDSEKNVDGTVSIKRTRSLSPGKTPLPPSEALRAVRNTFRNKDNDI--------QQLER  621

Query  126  CLWPLYLNKFPMNEFQLREYLNGFES  151
                    K  + E Q++E+LN FE+
Sbjct  622  --------KLKIAESQVKEFLNKFEN  639


>H2L0I3_CAEEL unnamed protein product
Length=2350

 Score = 28.9 bits (63),  Expect = 3.2, Method: Composition-based stats.
 Identities = 33/146 (23%), Positives = 61/146 (42%), Gaps = 28/146 (19%)

Query  12   KIASQYGTSSTRSIWIKTRGQMFWEVDCQVNSDAFFKSNFRMNHQSFNKLCIMLKSLEK-  70
            ++ ++Y  S  R+I +++RG      D      A  ++  R N +  N+    LK L + 
Sbjct  443  ELMTKYEESIERNIELESRG------DDSQRKIAELEAELRRNREKLNEAQGALKKLHEM  496

Query  71   -----KNTNYRKSIQLEKRIAIALYALGSSAKYRAIGNMFGIGKSSVCNILIEFCHEVWR  125
                 KN +   SI+  + ++     L  S   RA+ N F    + +         ++ R
Sbjct  497  AQDSEKNVDGTVSIKRTRSLSPGKTPLPPSEALRAVRNTFRNKDNDI--------QQLER  548

Query  126  CLWPLYLNKFPMNEFQLREYLNGFES  151
                    K  + E Q++E+LN FE+
Sbjct  549  --------KLKIAESQVKEFLNKFEN  566


>H2L0I2_CAEEL unnamed protein product
Length=2396

 Score = 28.9 bits (63),  Expect = 3.2, Method: Composition-based stats.
 Identities = 33/146 (23%), Positives = 61/146 (42%), Gaps = 28/146 (19%)

Query  12   KIASQYGTSSTRSIWIKTRGQMFWEVDCQVNSDAFFKSNFRMNHQSFNKLCIMLKSLEK-  70
            ++ ++Y  S  R+I +++RG      D      A  ++  R N +  N+    LK L + 
Sbjct  516  ELMTKYEESIERNIELESRG------DDSQRKIAELEAELRRNREKLNEAQGALKKLHEM  569

Query  71   -----KNTNYRKSIQLEKRIAIALYALGSSAKYRAIGNMFGIGKSSVCNILIEFCHEVWR  125
                 KN +   SI+  + ++     L  S   RA+ N F    + +         ++ R
Sbjct  570  AQDSEKNVDGTVSIKRTRSLSPGKTPLPPSEALRAVRNTFRNKDNDI--------QQLER  621

Query  126  CLWPLYLNKFPMNEFQLREYLNGFES  151
                    K  + E Q++E+LN FE+
Sbjct  622  --------KLKIAESQVKEFLNKFEN  639



Lambda      K        H
   0.332    0.140    0.428 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3457179198


Query= XP_014085107.1 PREDICTED: dolichyl-diphosphooligosaccharide--protein
glycosyltransferase subunit 4 isoform X1 [Bactrocera oleae]

Length=40
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q3HKQ1_DROME  unnamed protein product                                 26.6    0.48 
O18033_CAEEL  unnamed protein product                                 24.6    2.6  
A5JYX8_CAEEL  unnamed protein product                                 24.6    2.6  


>Q3HKQ1_DROME unnamed protein product
Length=106

 Score = 26.6 bits (57),  Expect = 0.48, Method: Compositional matrix adjust.
 Identities = 10/23 (43%), Positives = 17/23 (74%), Gaps = 0/23 (0%)

Query  1   MISDVQLAIFSNVLGVFLFLLVV  23
           M S+VQL +F N++ +F F+ +V
Sbjct  76  MNSEVQLPLFQNIIKIFKFIWLV  98


>O18033_CAEEL unnamed protein product
Length=557

 Score = 24.6 bits (52),  Expect = 2.6, Method: Composition-based stats.
 Identities = 11/35 (31%), Positives = 21/35 (60%), Gaps = 0/35 (0%)

Query  5    VQLAIFSNVLGVFLFLLVVAYHYISANSNKSIAKT  39
            V+ A+F  V+   +F  + A++YI+ +S  +I  T
Sbjct  514  VKPAVFELVIAAGVFTYLSAFYYIATHSQNTIEGT  548


>A5JYX8_CAEEL unnamed protein product
Length=563

 Score = 24.6 bits (52),  Expect = 2.6, Method: Composition-based stats.
 Identities = 11/35 (31%), Positives = 21/35 (60%), Gaps = 0/35 (0%)

Query  5    VQLAIFSNVLGVFLFLLVVAYHYISANSNKSIAKT  39
            V+ A+F  V+   +F  + A++YI+ +S  +I  T
Sbjct  520  VKPAVFELVIAAGVFTYLSAFYYIATHSQNTIEGT  554



Lambda      K        H
   0.332    0.140    0.428 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3457179198


Query= XP_014085108.1 PREDICTED: adult enhancer factor 1 [Bactrocera oleae]

Length=322
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GLAS_DROME  unnamed protein product                                   142     4e-38
Q8IG96_DROME  unnamed protein product                                 133     1e-37
M9PGG2_DROME  unnamed protein product                                 139     1e-36


>GLAS_DROME unnamed protein product
Length=604

 Score = 142 bits (359),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 85/125 (68%), Gaps = 0/125 (0%)

Query  186  GSSGGGGGHEKPFLCSVCDRRFRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQSSTLTNHL  245
            G  G  GG  KP LC +C + + + STL  H++ H+GE+PY+C  C+K+F Q++ LT H+
Sbjct  425  GDEGSSGGEMKPNLCRLCGKTYARPSTLKTHLRTHSGERPYRCPDCNKSFSQAANLTAHV  484

Query  246  KIHTGEKPFNCTYCPKNFRQLSTLTNHVKIHTGEKPFECAVCKKQFRQSSTLNNHIKIHV  305
            + HTG+KPF C  C + F Q S++T H++ H+GE+P+ C+ CKK F  SSTL  H++IH 
Sbjct  485  RTHTGQKPFRCPICDRRFSQSSSVTTHMRTHSGERPYRCSSCKKSFSDSSTLTKHLRIHS  544

Query  306  MDKVY  310
             +K Y
Sbjct  545  GEKPY  549


 Score = 141 bits (355),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 82/110 (75%), Gaps = 0/110 (0%)

Query  195  EKPFLCSVCDRRFRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQSSTLTNHLKIHTGEKPF  254
            E+P+ C  C++ F Q + LT HV+ HTG+KP++C +CD+ F QSS++T H++ H+GE+P+
Sbjct  462  ERPYRCPDCNKSFSQAANLTAHVRTHTGQKPFRCPICDRRFSQSSSVTTHMRTHSGERPY  521

Query  255  NCTYCPKNFRQLSTLTNHVKIHTGEKPFECAVCKKQFRQSSTLNNHIKIH  304
             C+ C K+F   STLT H++IH+GEKP++C +C  +F QS  LN H+++H
Sbjct  522  RCSSCKKSFSDSSTLTKHLRIHSGEKPYQCKLCLLRFSQSGNLNRHMRVH  571


>Q8IG96_DROME unnamed protein product
Length=206

 Score = 133 bits (334),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 70/105 (67%), Gaps = 0/105 (0%)

Query  200  CSVCDRRFRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQSSTLTNHLKIHTGEKPFNCTYC  259
            C +CD+ F+Q +TL  H  IH   +PY C  C K FRQ S LT HL+IHT EKPF C YC
Sbjct  92   CPICDKEFKQKTTLLQHGCIHIESRPYPCPECGKRFRQQSHLTQHLRIHTNEKPFGCMYC  151

Query  260  PKNFRQLSTLTNHVKIHTGEKPFECAVCKKQFRQSSTLNNHIKIH  304
            P+ FRQ + L  H++IHTGEKP++C  C K FRQ + L+ H + H
Sbjct  152  PRFFRQRTILNQHLRIHTGEKPYKCGQCGKDFRQKAILDQHTRTH  196


 Score = 103 bits (256),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 84/180 (47%), Gaps = 19/180 (11%)

Query  140  AHLVATAAHSPALSEHHFA-AGREVVANGHSAGSSTNGGGGGGGNSSGSSGGGGGHEKPF  198
             HL+      P L        G +    G  AG+   GGG    +S G+  G GG   P 
Sbjct  5    PHLIFKNGPHPTLWPSDVPFPGEDNDTKGDIAGT---GGGYHDEDSQGTPDGSGGMHYP-  60

Query  199  LCSVCDRRFRQ------LSTLTNHVKIHTGEKPY--KCNVCDKTFRQSSTLTNHLKIHTG  250
                    F+       L  +  H+ +     P   +C +CDK F+Q +TL  H  IH  
Sbjct  61   ------SYFKDGKGQKILPEVLQHIGVRPANMPLYVRCPICDKEFKQKTTLLQHGCIHIE  114

Query  251  EKPFNCTYCPKNFRQLSTLTNHVKIHTGEKPFECAVCKKQFRQSSTLNNHIKIHVMDKVY  310
             +P+ C  C K FRQ S LT H++IHT EKPF C  C + FRQ + LN H++IH  +K Y
Sbjct  115  SRPYPCPECGKRFRQQSHLTQHLRIHTNEKPFGCMYCPRFFRQRTILNQHLRIHTGEKPY  174


 Score = 99.0 bits (245),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 54/81 (67%), Gaps = 0/81 (0%)

Query  196  KPFLCSVCDRRFRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQSSTLTNHLKIHTGEKPFN  255
            +P+ C  C +RFRQ S LT H++IHT EKP+ C  C + FRQ + L  HL+IHTGEKP+ 
Sbjct  116  RPYPCPECGKRFRQQSHLTQHLRIHTNEKPFGCMYCPRFFRQRTILNQHLRIHTGEKPYK  175

Query  256  CTYCPKNFRQLSTLTNHVKIH  276
            C  C K+FRQ + L  H + H
Sbjct  176  CGQCGKDFRQKAILDQHTRTH  196


 Score = 71.6 bits (174),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 35/54 (65%), Gaps = 0/54 (0%)

Query  195  EKPFLCSVCDRRFRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQSSTLTNHLKIH  248
            EKPF C  C R FRQ + L  H++IHTGEKPYKC  C K FRQ + L  H + H
Sbjct  143  EKPFGCMYCPRFFRQRTILNQHLRIHTGEKPYKCGQCGKDFRQKAILDQHTRTH  196


>M9PGG2_DROME unnamed protein product
Length=938

 Score = 139 bits (351),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 73/111 (66%), Gaps = 0/111 (0%)

Query  200  CSVCDRRFRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQSSTLTNHLKIHTGEKPFNCTYC  259
            C +CD+ F+Q +TL  H  IH   +PY C  C K FRQ S LT HL+IHT EKPF C YC
Sbjct  527  CPICDKEFKQKTTLLQHGCIHIESRPYPCPECGKRFRQQSHLTQHLRIHTNEKPFGCMYC  586

Query  260  PKNFRQLSTLTNHVKIHTGEKPFECAVCKKQFRQSSTLNNHIKIHVMDKVY  310
            P+ FRQ + L  H++IHTGEKP++C  C K FRQ + L+ H + H  D+ +
Sbjct  587  PRFFRQRTILNQHLRIHTGEKPYKCGQCGKDFRQKAILDQHTRTHQGDRPF  637


 Score = 139 bits (349),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 82/138 (59%), Gaps = 9/138 (7%)

Query  176  GGGGGGGNSSGSSGGGGGHE---KP------FLCSVCDRRFRQLSTLTNHVKIHTGEKPY  226
            G G  G  S G +G G G     KP      F C  C + F+Q STL  H +IHT  +P+
Sbjct  298  GVGSVGVTSGGRTGNGPGRPHKNKPHSDLRLFKCLTCGKDFKQKSTLLQHDRIHTDARPF  357

Query  227  KCNVCDKTFRQSSTLTNHLKIHTGEKPFNCTYCPKNFRQLSTLTNHVKIHTGEKPFECAV  286
             C+ C K FRQ S LT HL+IH  EKPF C YC ++FRQ + L  H++IH+GEKPF C  
Sbjct  358  PCSECGKRFRQQSHLTQHLRIHANEKPFTCPYCSRSFRQRAILNQHIRIHSGEKPFACPE  417

Query  287  CKKQFRQSSTLNNHIKIH  304
            C K FRQ + LN H++ H
Sbjct  418  CGKHFRQKAILNQHVRTH  435


 Score = 122 bits (306),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 72/112 (64%), Gaps = 2/112 (2%)

Query  196  KPFLCSVCDRRFRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQSSTLTNHLKIHTGEKPFN  255
            +P+ C  C +RFRQ S LT H++IHT EKP+ C  C + FRQ + L  HL+IHTGEKP+ 
Sbjct  551  RPYPCPECGKRFRQQSHLTQHLRIHTNEKPFGCMYCPRFFRQRTILNQHLRIHTGEKPYK  610

Query  256  CTYCPKNFRQLSTLTNHVKIHTGEKPFECAV--CKKQFRQSSTLNNHIKIHV  305
            C  C K+FRQ + L  H + H G++PF C +  C+++F   + +  HI  H+
Sbjct  611  CGQCGKDFRQKAILDQHTRTHQGDRPFCCPMPNCRRRFATENEVTKHIDNHM  662


 Score = 108 bits (269),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 62/175 (35%), Positives = 86/175 (49%), Gaps = 9/175 (5%)

Query  140  AHLVATAAHSPALSEHHFA-AGREVVANGHSAGSSTNGGGGGGGNSSGSSGGGGGHEKPF  198
             HL+      P L        G +    G  AG+   GGG    +S G+  G GG   P 
Sbjct  440  PHLIFKNGPHPTLWPSDVPFPGEDNDTKGDIAGT---GGGYHDEDSQGTPDGSGGMHYPS  496

Query  199  LCSVCDRRFRQ-LSTLTNHVKIHTGEKPY--KCNVCDKTFRQSSTLTNHLKIHTGEKPFN  255
                 D + ++ L  +  H+ +     P   +C +CDK F+Q +TL  H  IH   +P+ 
Sbjct  497  YFK--DGKGQKILPEVLQHIGVRPANMPLYVRCPICDKEFKQKTTLLQHGCIHIESRPYP  554

Query  256  CTYCPKNFRQLSTLTNHVKIHTGEKPFECAVCKKQFRQSSTLNNHIKIHVMDKVY  310
            C  C K FRQ S LT H++IHT EKPF C  C + FRQ + LN H++IH  +K Y
Sbjct  555  CPECGKRFRQQSHLTQHLRIHTNEKPFGCMYCPRFFRQRTILNQHLRIHTGEKPY  609


 Score = 104 bits (259),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 57/86 (66%), Gaps = 0/86 (0%)

Query  196  KPFLCSVCDRRFRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQSSTLTNHLKIHTGEKPFN  255
            +PF CS C +RFRQ S LT H++IH  EKP+ C  C ++FRQ + L  H++IH+GEKPF 
Sbjct  355  RPFPCSECGKRFRQQSHLTQHLRIHANEKPFTCPYCSRSFRQRAILNQHIRIHSGEKPFA  414

Query  256  CTYCPKNFRQLSTLTNHVKIHTGEKP  281
            C  C K+FRQ + L  HV+ H    P
Sbjct  415  CPECGKHFRQKAILNQHVRTHQDVSP  440


 Score = 89.7 bits (221),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 50/84 (60%), Gaps = 2/84 (2%)

Query  195  EKPFLCSVCDRRFRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQSSTLTNHLKIHTGEKPF  254
            EKPF C  C R FRQ + L  H++IHTGEKPYKC  C K FRQ + L  H + H G++PF
Sbjct  578  EKPFGCMYCPRFFRQRTILNQHLRIHTGEKPYKCGQCGKDFRQKAILDQHTRTHQGDRPF  637

Query  255  NCTY--CPKNFRQLSTLTNHVKIH  276
             C    C + F   + +T H+  H
Sbjct  638  CCPMPNCRRRFATENEVTKHIDNH  661


 Score = 71.2 bits (173),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 36/59 (61%), Gaps = 0/59 (0%)

Query  195  EKPFLCSVCDRRFRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQSSTLTNHLKIHTGEKP  253
            EKPF C  C R FRQ + L  H++IH+GEKP+ C  C K FRQ + L  H++ H    P
Sbjct  382  EKPFTCPYCSRSFRQRAILNQHIRIHSGEKPFACPECGKHFRQKAILNQHVRTHQDVSP  440


 Score = 68.6 bits (166),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 41/65 (63%), Gaps = 0/65 (0%)

Query  246  KIHTGEKPFNCTYCPKNFRQLSTLTNHVKIHTGEKPFECAVCKKQFRQSSTLNNHIKIHV  305
            K H+  + F C  C K+F+Q STL  H +IHT  +PF C+ C K+FRQ S L  H++IH 
Sbjct  321  KPHSDLRLFKCLTCGKDFKQKSTLLQHDRIHTDARPFPCSECGKRFRQQSHLTQHLRIHA  380

Query  306  MDKVY  310
             +K +
Sbjct  381  NEKPF  385


 Score = 44.7 bits (104),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 34/154 (22%), Positives = 52/154 (34%), Gaps = 48/154 (31%)

Query  195  EKPFLCSVCDRRFRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQSSTLTNHLKIHTGEKPF  254
            EKPF C  C + FRQ + L  HV+ H    P+        F+       H  +   + PF
Sbjct  410  EKPFACPECGKHFRQKAILNQHVRTHQDVSPH------LIFKNGP----HPTLWPSDVPF  459

Query  255  ------------------------------NCTYCPKNFRQ------LSTLTNHVKIHTG  278
                                             + P  F+       L  +  H+ +   
Sbjct  460  PGEDNDTKGDIAGTGGGYHDEDSQGTPDGSGGMHYPSYFKDGKGQKILPEVLQHIGVRPA  519

Query  279  EKPF--ECAVCKKQFRQSSTLNNHIKIHVMDKVY  310
              P    C +C K+F+Q +TL  H  IH+  + Y
Sbjct  520  NMPLYVRCPICDKEFKQKTTLLQHGCIHIESRPY  553



Lambda      K        H
   0.332    0.140    0.428 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3457179198


Query= XP_014085109.1 PREDICTED: adult enhancer factor 1 [Bactrocera oleae]

Length=322
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GLAS_DROME  unnamed protein product                                   142     4e-38
Q8IG96_DROME  unnamed protein product                                 133     1e-37
M9PGG2_DROME  unnamed protein product                                 139     1e-36


>GLAS_DROME unnamed protein product
Length=604

 Score = 142 bits (359),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 85/125 (68%), Gaps = 0/125 (0%)

Query  186  GSSGGGGGHEKPFLCSVCDRRFRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQSSTLTNHL  245
            G  G  GG  KP LC +C + + + STL  H++ H+GE+PY+C  C+K+F Q++ LT H+
Sbjct  425  GDEGSSGGEMKPNLCRLCGKTYARPSTLKTHLRTHSGERPYRCPDCNKSFSQAANLTAHV  484

Query  246  KIHTGEKPFNCTYCPKNFRQLSTLTNHVKIHTGEKPFECAVCKKQFRQSSTLNNHIKIHV  305
            + HTG+KPF C  C + F Q S++T H++ H+GE+P+ C+ CKK F  SSTL  H++IH 
Sbjct  485  RTHTGQKPFRCPICDRRFSQSSSVTTHMRTHSGERPYRCSSCKKSFSDSSTLTKHLRIHS  544

Query  306  MDKVY  310
             +K Y
Sbjct  545  GEKPY  549


 Score = 141 bits (355),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 82/110 (75%), Gaps = 0/110 (0%)

Query  195  EKPFLCSVCDRRFRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQSSTLTNHLKIHTGEKPF  254
            E+P+ C  C++ F Q + LT HV+ HTG+KP++C +CD+ F QSS++T H++ H+GE+P+
Sbjct  462  ERPYRCPDCNKSFSQAANLTAHVRTHTGQKPFRCPICDRRFSQSSSVTTHMRTHSGERPY  521

Query  255  NCTYCPKNFRQLSTLTNHVKIHTGEKPFECAVCKKQFRQSSTLNNHIKIH  304
             C+ C K+F   STLT H++IH+GEKP++C +C  +F QS  LN H+++H
Sbjct  522  RCSSCKKSFSDSSTLTKHLRIHSGEKPYQCKLCLLRFSQSGNLNRHMRVH  571


>Q8IG96_DROME unnamed protein product
Length=206

 Score = 133 bits (334),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 70/105 (67%), Gaps = 0/105 (0%)

Query  200  CSVCDRRFRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQSSTLTNHLKIHTGEKPFNCTYC  259
            C +CD+ F+Q +TL  H  IH   +PY C  C K FRQ S LT HL+IHT EKPF C YC
Sbjct  92   CPICDKEFKQKTTLLQHGCIHIESRPYPCPECGKRFRQQSHLTQHLRIHTNEKPFGCMYC  151

Query  260  PKNFRQLSTLTNHVKIHTGEKPFECAVCKKQFRQSSTLNNHIKIH  304
            P+ FRQ + L  H++IHTGEKP++C  C K FRQ + L+ H + H
Sbjct  152  PRFFRQRTILNQHLRIHTGEKPYKCGQCGKDFRQKAILDQHTRTH  196


 Score = 103 bits (256),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 84/180 (47%), Gaps = 19/180 (11%)

Query  140  AHLVATAAHSPALSEHHFA-AGREVVANGHSAGSSTNGGGGGGGNSSGSSGGGGGHEKPF  198
             HL+      P L        G +    G  AG+   GGG    +S G+  G GG   P 
Sbjct  5    PHLIFKNGPHPTLWPSDVPFPGEDNDTKGDIAGT---GGGYHDEDSQGTPDGSGGMHYP-  60

Query  199  LCSVCDRRFRQ------LSTLTNHVKIHTGEKPY--KCNVCDKTFRQSSTLTNHLKIHTG  250
                    F+       L  +  H+ +     P   +C +CDK F+Q +TL  H  IH  
Sbjct  61   ------SYFKDGKGQKILPEVLQHIGVRPANMPLYVRCPICDKEFKQKTTLLQHGCIHIE  114

Query  251  EKPFNCTYCPKNFRQLSTLTNHVKIHTGEKPFECAVCKKQFRQSSTLNNHIKIHVMDKVY  310
             +P+ C  C K FRQ S LT H++IHT EKPF C  C + FRQ + LN H++IH  +K Y
Sbjct  115  SRPYPCPECGKRFRQQSHLTQHLRIHTNEKPFGCMYCPRFFRQRTILNQHLRIHTGEKPY  174


 Score = 99.0 bits (245),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 54/81 (67%), Gaps = 0/81 (0%)

Query  196  KPFLCSVCDRRFRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQSSTLTNHLKIHTGEKPFN  255
            +P+ C  C +RFRQ S LT H++IHT EKP+ C  C + FRQ + L  HL+IHTGEKP+ 
Sbjct  116  RPYPCPECGKRFRQQSHLTQHLRIHTNEKPFGCMYCPRFFRQRTILNQHLRIHTGEKPYK  175

Query  256  CTYCPKNFRQLSTLTNHVKIH  276
            C  C K+FRQ + L  H + H
Sbjct  176  CGQCGKDFRQKAILDQHTRTH  196


 Score = 71.6 bits (174),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 35/54 (65%), Gaps = 0/54 (0%)

Query  195  EKPFLCSVCDRRFRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQSSTLTNHLKIH  248
            EKPF C  C R FRQ + L  H++IHTGEKPYKC  C K FRQ + L  H + H
Sbjct  143  EKPFGCMYCPRFFRQRTILNQHLRIHTGEKPYKCGQCGKDFRQKAILDQHTRTH  196


>M9PGG2_DROME unnamed protein product
Length=938

 Score = 139 bits (351),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 73/111 (66%), Gaps = 0/111 (0%)

Query  200  CSVCDRRFRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQSSTLTNHLKIHTGEKPFNCTYC  259
            C +CD+ F+Q +TL  H  IH   +PY C  C K FRQ S LT HL+IHT EKPF C YC
Sbjct  527  CPICDKEFKQKTTLLQHGCIHIESRPYPCPECGKRFRQQSHLTQHLRIHTNEKPFGCMYC  586

Query  260  PKNFRQLSTLTNHVKIHTGEKPFECAVCKKQFRQSSTLNNHIKIHVMDKVY  310
            P+ FRQ + L  H++IHTGEKP++C  C K FRQ + L+ H + H  D+ +
Sbjct  587  PRFFRQRTILNQHLRIHTGEKPYKCGQCGKDFRQKAILDQHTRTHQGDRPF  637


 Score = 139 bits (349),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 82/138 (59%), Gaps = 9/138 (7%)

Query  176  GGGGGGGNSSGSSGGGGGHE---KP------FLCSVCDRRFRQLSTLTNHVKIHTGEKPY  226
            G G  G  S G +G G G     KP      F C  C + F+Q STL  H +IHT  +P+
Sbjct  298  GVGSVGVTSGGRTGNGPGRPHKNKPHSDLRLFKCLTCGKDFKQKSTLLQHDRIHTDARPF  357

Query  227  KCNVCDKTFRQSSTLTNHLKIHTGEKPFNCTYCPKNFRQLSTLTNHVKIHTGEKPFECAV  286
             C+ C K FRQ S LT HL+IH  EKPF C YC ++FRQ + L  H++IH+GEKPF C  
Sbjct  358  PCSECGKRFRQQSHLTQHLRIHANEKPFTCPYCSRSFRQRAILNQHIRIHSGEKPFACPE  417

Query  287  CKKQFRQSSTLNNHIKIH  304
            C K FRQ + LN H++ H
Sbjct  418  CGKHFRQKAILNQHVRTH  435


 Score = 122 bits (306),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 72/112 (64%), Gaps = 2/112 (2%)

Query  196  KPFLCSVCDRRFRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQSSTLTNHLKIHTGEKPFN  255
            +P+ C  C +RFRQ S LT H++IHT EKP+ C  C + FRQ + L  HL+IHTGEKP+ 
Sbjct  551  RPYPCPECGKRFRQQSHLTQHLRIHTNEKPFGCMYCPRFFRQRTILNQHLRIHTGEKPYK  610

Query  256  CTYCPKNFRQLSTLTNHVKIHTGEKPFECAV--CKKQFRQSSTLNNHIKIHV  305
            C  C K+FRQ + L  H + H G++PF C +  C+++F   + +  HI  H+
Sbjct  611  CGQCGKDFRQKAILDQHTRTHQGDRPFCCPMPNCRRRFATENEVTKHIDNHM  662


 Score = 108 bits (269),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 62/175 (35%), Positives = 86/175 (49%), Gaps = 9/175 (5%)

Query  140  AHLVATAAHSPALSEHHFA-AGREVVANGHSAGSSTNGGGGGGGNSSGSSGGGGGHEKPF  198
             HL+      P L        G +    G  AG+   GGG    +S G+  G GG   P 
Sbjct  440  PHLIFKNGPHPTLWPSDVPFPGEDNDTKGDIAGT---GGGYHDEDSQGTPDGSGGMHYPS  496

Query  199  LCSVCDRRFRQ-LSTLTNHVKIHTGEKPY--KCNVCDKTFRQSSTLTNHLKIHTGEKPFN  255
                 D + ++ L  +  H+ +     P   +C +CDK F+Q +TL  H  IH   +P+ 
Sbjct  497  YFK--DGKGQKILPEVLQHIGVRPANMPLYVRCPICDKEFKQKTTLLQHGCIHIESRPYP  554

Query  256  CTYCPKNFRQLSTLTNHVKIHTGEKPFECAVCKKQFRQSSTLNNHIKIHVMDKVY  310
            C  C K FRQ S LT H++IHT EKPF C  C + FRQ + LN H++IH  +K Y
Sbjct  555  CPECGKRFRQQSHLTQHLRIHTNEKPFGCMYCPRFFRQRTILNQHLRIHTGEKPY  609


 Score = 104 bits (259),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 57/86 (66%), Gaps = 0/86 (0%)

Query  196  KPFLCSVCDRRFRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQSSTLTNHLKIHTGEKPFN  255
            +PF CS C +RFRQ S LT H++IH  EKP+ C  C ++FRQ + L  H++IH+GEKPF 
Sbjct  355  RPFPCSECGKRFRQQSHLTQHLRIHANEKPFTCPYCSRSFRQRAILNQHIRIHSGEKPFA  414

Query  256  CTYCPKNFRQLSTLTNHVKIHTGEKP  281
            C  C K+FRQ + L  HV+ H    P
Sbjct  415  CPECGKHFRQKAILNQHVRTHQDVSP  440


 Score = 89.7 bits (221),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 50/84 (60%), Gaps = 2/84 (2%)

Query  195  EKPFLCSVCDRRFRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQSSTLTNHLKIHTGEKPF  254
            EKPF C  C R FRQ + L  H++IHTGEKPYKC  C K FRQ + L  H + H G++PF
Sbjct  578  EKPFGCMYCPRFFRQRTILNQHLRIHTGEKPYKCGQCGKDFRQKAILDQHTRTHQGDRPF  637

Query  255  NCTY--CPKNFRQLSTLTNHVKIH  276
             C    C + F   + +T H+  H
Sbjct  638  CCPMPNCRRRFATENEVTKHIDNH  661


 Score = 71.2 bits (173),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 36/59 (61%), Gaps = 0/59 (0%)

Query  195  EKPFLCSVCDRRFRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQSSTLTNHLKIHTGEKP  253
            EKPF C  C R FRQ + L  H++IH+GEKP+ C  C K FRQ + L  H++ H    P
Sbjct  382  EKPFTCPYCSRSFRQRAILNQHIRIHSGEKPFACPECGKHFRQKAILNQHVRTHQDVSP  440


 Score = 68.6 bits (166),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 41/65 (63%), Gaps = 0/65 (0%)

Query  246  KIHTGEKPFNCTYCPKNFRQLSTLTNHVKIHTGEKPFECAVCKKQFRQSSTLNNHIKIHV  305
            K H+  + F C  C K+F+Q STL  H +IHT  +PF C+ C K+FRQ S L  H++IH 
Sbjct  321  KPHSDLRLFKCLTCGKDFKQKSTLLQHDRIHTDARPFPCSECGKRFRQQSHLTQHLRIHA  380

Query  306  MDKVY  310
             +K +
Sbjct  381  NEKPF  385


 Score = 44.7 bits (104),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 34/154 (22%), Positives = 52/154 (34%), Gaps = 48/154 (31%)

Query  195  EKPFLCSVCDRRFRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQSSTLTNHLKIHTGEKPF  254
            EKPF C  C + FRQ + L  HV+ H    P+        F+       H  +   + PF
Sbjct  410  EKPFACPECGKHFRQKAILNQHVRTHQDVSPH------LIFKNGP----HPTLWPSDVPF  459

Query  255  ------------------------------NCTYCPKNFRQ------LSTLTNHVKIHTG  278
                                             + P  F+       L  +  H+ +   
Sbjct  460  PGEDNDTKGDIAGTGGGYHDEDSQGTPDGSGGMHYPSYFKDGKGQKILPEVLQHIGVRPA  519

Query  279  EKPF--ECAVCKKQFRQSSTLNNHIKIHVMDKVY  310
              P    C +C K+F+Q +TL  H  IH+  + Y
Sbjct  520  NMPLYVRCPICDKEFKQKTTLLQHGCIHIESRPY  553



Lambda      K        H
   0.332    0.140    0.428 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3457179198


Query= XP_014085110.1 PREDICTED: adult enhancer factor 1 [Bactrocera oleae]

Length=322
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GLAS_DROME  unnamed protein product                                   142     4e-38
Q8IG96_DROME  unnamed protein product                                 133     1e-37
M9PGG2_DROME  unnamed protein product                                 139     1e-36


>GLAS_DROME unnamed protein product
Length=604

 Score = 142 bits (359),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 85/125 (68%), Gaps = 0/125 (0%)

Query  186  GSSGGGGGHEKPFLCSVCDRRFRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQSSTLTNHL  245
            G  G  GG  KP LC +C + + + STL  H++ H+GE+PY+C  C+K+F Q++ LT H+
Sbjct  425  GDEGSSGGEMKPNLCRLCGKTYARPSTLKTHLRTHSGERPYRCPDCNKSFSQAANLTAHV  484

Query  246  KIHTGEKPFNCTYCPKNFRQLSTLTNHVKIHTGEKPFECAVCKKQFRQSSTLNNHIKIHV  305
            + HTG+KPF C  C + F Q S++T H++ H+GE+P+ C+ CKK F  SSTL  H++IH 
Sbjct  485  RTHTGQKPFRCPICDRRFSQSSSVTTHMRTHSGERPYRCSSCKKSFSDSSTLTKHLRIHS  544

Query  306  MDKVY  310
             +K Y
Sbjct  545  GEKPY  549


 Score = 141 bits (355),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 82/110 (75%), Gaps = 0/110 (0%)

Query  195  EKPFLCSVCDRRFRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQSSTLTNHLKIHTGEKPF  254
            E+P+ C  C++ F Q + LT HV+ HTG+KP++C +CD+ F QSS++T H++ H+GE+P+
Sbjct  462  ERPYRCPDCNKSFSQAANLTAHVRTHTGQKPFRCPICDRRFSQSSSVTTHMRTHSGERPY  521

Query  255  NCTYCPKNFRQLSTLTNHVKIHTGEKPFECAVCKKQFRQSSTLNNHIKIH  304
             C+ C K+F   STLT H++IH+GEKP++C +C  +F QS  LN H+++H
Sbjct  522  RCSSCKKSFSDSSTLTKHLRIHSGEKPYQCKLCLLRFSQSGNLNRHMRVH  571


>Q8IG96_DROME unnamed protein product
Length=206

 Score = 133 bits (334),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 70/105 (67%), Gaps = 0/105 (0%)

Query  200  CSVCDRRFRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQSSTLTNHLKIHTGEKPFNCTYC  259
            C +CD+ F+Q +TL  H  IH   +PY C  C K FRQ S LT HL+IHT EKPF C YC
Sbjct  92   CPICDKEFKQKTTLLQHGCIHIESRPYPCPECGKRFRQQSHLTQHLRIHTNEKPFGCMYC  151

Query  260  PKNFRQLSTLTNHVKIHTGEKPFECAVCKKQFRQSSTLNNHIKIH  304
            P+ FRQ + L  H++IHTGEKP++C  C K FRQ + L+ H + H
Sbjct  152  PRFFRQRTILNQHLRIHTGEKPYKCGQCGKDFRQKAILDQHTRTH  196


 Score = 103 bits (256),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 84/180 (47%), Gaps = 19/180 (11%)

Query  140  AHLVATAAHSPALSEHHFA-AGREVVANGHSAGSSTNGGGGGGGNSSGSSGGGGGHEKPF  198
             HL+      P L        G +    G  AG+   GGG    +S G+  G GG   P 
Sbjct  5    PHLIFKNGPHPTLWPSDVPFPGEDNDTKGDIAGT---GGGYHDEDSQGTPDGSGGMHYP-  60

Query  199  LCSVCDRRFRQ------LSTLTNHVKIHTGEKPY--KCNVCDKTFRQSSTLTNHLKIHTG  250
                    F+       L  +  H+ +     P   +C +CDK F+Q +TL  H  IH  
Sbjct  61   ------SYFKDGKGQKILPEVLQHIGVRPANMPLYVRCPICDKEFKQKTTLLQHGCIHIE  114

Query  251  EKPFNCTYCPKNFRQLSTLTNHVKIHTGEKPFECAVCKKQFRQSSTLNNHIKIHVMDKVY  310
             +P+ C  C K FRQ S LT H++IHT EKPF C  C + FRQ + LN H++IH  +K Y
Sbjct  115  SRPYPCPECGKRFRQQSHLTQHLRIHTNEKPFGCMYCPRFFRQRTILNQHLRIHTGEKPY  174


 Score = 99.0 bits (245),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 54/81 (67%), Gaps = 0/81 (0%)

Query  196  KPFLCSVCDRRFRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQSSTLTNHLKIHTGEKPFN  255
            +P+ C  C +RFRQ S LT H++IHT EKP+ C  C + FRQ + L  HL+IHTGEKP+ 
Sbjct  116  RPYPCPECGKRFRQQSHLTQHLRIHTNEKPFGCMYCPRFFRQRTILNQHLRIHTGEKPYK  175

Query  256  CTYCPKNFRQLSTLTNHVKIH  276
            C  C K+FRQ + L  H + H
Sbjct  176  CGQCGKDFRQKAILDQHTRTH  196


 Score = 71.6 bits (174),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 35/54 (65%), Gaps = 0/54 (0%)

Query  195  EKPFLCSVCDRRFRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQSSTLTNHLKIH  248
            EKPF C  C R FRQ + L  H++IHTGEKPYKC  C K FRQ + L  H + H
Sbjct  143  EKPFGCMYCPRFFRQRTILNQHLRIHTGEKPYKCGQCGKDFRQKAILDQHTRTH  196


>M9PGG2_DROME unnamed protein product
Length=938

 Score = 139 bits (351),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 73/111 (66%), Gaps = 0/111 (0%)

Query  200  CSVCDRRFRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQSSTLTNHLKIHTGEKPFNCTYC  259
            C +CD+ F+Q +TL  H  IH   +PY C  C K FRQ S LT HL+IHT EKPF C YC
Sbjct  527  CPICDKEFKQKTTLLQHGCIHIESRPYPCPECGKRFRQQSHLTQHLRIHTNEKPFGCMYC  586

Query  260  PKNFRQLSTLTNHVKIHTGEKPFECAVCKKQFRQSSTLNNHIKIHVMDKVY  310
            P+ FRQ + L  H++IHTGEKP++C  C K FRQ + L+ H + H  D+ +
Sbjct  587  PRFFRQRTILNQHLRIHTGEKPYKCGQCGKDFRQKAILDQHTRTHQGDRPF  637


 Score = 139 bits (349),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 82/138 (59%), Gaps = 9/138 (7%)

Query  176  GGGGGGGNSSGSSGGGGGHE---KP------FLCSVCDRRFRQLSTLTNHVKIHTGEKPY  226
            G G  G  S G +G G G     KP      F C  C + F+Q STL  H +IHT  +P+
Sbjct  298  GVGSVGVTSGGRTGNGPGRPHKNKPHSDLRLFKCLTCGKDFKQKSTLLQHDRIHTDARPF  357

Query  227  KCNVCDKTFRQSSTLTNHLKIHTGEKPFNCTYCPKNFRQLSTLTNHVKIHTGEKPFECAV  286
             C+ C K FRQ S LT HL+IH  EKPF C YC ++FRQ + L  H++IH+GEKPF C  
Sbjct  358  PCSECGKRFRQQSHLTQHLRIHANEKPFTCPYCSRSFRQRAILNQHIRIHSGEKPFACPE  417

Query  287  CKKQFRQSSTLNNHIKIH  304
            C K FRQ + LN H++ H
Sbjct  418  CGKHFRQKAILNQHVRTH  435


 Score = 122 bits (306),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 72/112 (64%), Gaps = 2/112 (2%)

Query  196  KPFLCSVCDRRFRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQSSTLTNHLKIHTGEKPFN  255
            +P+ C  C +RFRQ S LT H++IHT EKP+ C  C + FRQ + L  HL+IHTGEKP+ 
Sbjct  551  RPYPCPECGKRFRQQSHLTQHLRIHTNEKPFGCMYCPRFFRQRTILNQHLRIHTGEKPYK  610

Query  256  CTYCPKNFRQLSTLTNHVKIHTGEKPFECAV--CKKQFRQSSTLNNHIKIHV  305
            C  C K+FRQ + L  H + H G++PF C +  C+++F   + +  HI  H+
Sbjct  611  CGQCGKDFRQKAILDQHTRTHQGDRPFCCPMPNCRRRFATENEVTKHIDNHM  662


 Score = 108 bits (269),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 62/175 (35%), Positives = 86/175 (49%), Gaps = 9/175 (5%)

Query  140  AHLVATAAHSPALSEHHFA-AGREVVANGHSAGSSTNGGGGGGGNSSGSSGGGGGHEKPF  198
             HL+      P L        G +    G  AG+   GGG    +S G+  G GG   P 
Sbjct  440  PHLIFKNGPHPTLWPSDVPFPGEDNDTKGDIAGT---GGGYHDEDSQGTPDGSGGMHYPS  496

Query  199  LCSVCDRRFRQ-LSTLTNHVKIHTGEKPY--KCNVCDKTFRQSSTLTNHLKIHTGEKPFN  255
                 D + ++ L  +  H+ +     P   +C +CDK F+Q +TL  H  IH   +P+ 
Sbjct  497  YFK--DGKGQKILPEVLQHIGVRPANMPLYVRCPICDKEFKQKTTLLQHGCIHIESRPYP  554

Query  256  CTYCPKNFRQLSTLTNHVKIHTGEKPFECAVCKKQFRQSSTLNNHIKIHVMDKVY  310
            C  C K FRQ S LT H++IHT EKPF C  C + FRQ + LN H++IH  +K Y
Sbjct  555  CPECGKRFRQQSHLTQHLRIHTNEKPFGCMYCPRFFRQRTILNQHLRIHTGEKPY  609


 Score = 104 bits (259),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 57/86 (66%), Gaps = 0/86 (0%)

Query  196  KPFLCSVCDRRFRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQSSTLTNHLKIHTGEKPFN  255
            +PF CS C +RFRQ S LT H++IH  EKP+ C  C ++FRQ + L  H++IH+GEKPF 
Sbjct  355  RPFPCSECGKRFRQQSHLTQHLRIHANEKPFTCPYCSRSFRQRAILNQHIRIHSGEKPFA  414

Query  256  CTYCPKNFRQLSTLTNHVKIHTGEKP  281
            C  C K+FRQ + L  HV+ H    P
Sbjct  415  CPECGKHFRQKAILNQHVRTHQDVSP  440


 Score = 89.7 bits (221),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 50/84 (60%), Gaps = 2/84 (2%)

Query  195  EKPFLCSVCDRRFRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQSSTLTNHLKIHTGEKPF  254
            EKPF C  C R FRQ + L  H++IHTGEKPYKC  C K FRQ + L  H + H G++PF
Sbjct  578  EKPFGCMYCPRFFRQRTILNQHLRIHTGEKPYKCGQCGKDFRQKAILDQHTRTHQGDRPF  637

Query  255  NCTY--CPKNFRQLSTLTNHVKIH  276
             C    C + F   + +T H+  H
Sbjct  638  CCPMPNCRRRFATENEVTKHIDNH  661


 Score = 71.2 bits (173),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 36/59 (61%), Gaps = 0/59 (0%)

Query  195  EKPFLCSVCDRRFRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQSSTLTNHLKIHTGEKP  253
            EKPF C  C R FRQ + L  H++IH+GEKP+ C  C K FRQ + L  H++ H    P
Sbjct  382  EKPFTCPYCSRSFRQRAILNQHIRIHSGEKPFACPECGKHFRQKAILNQHVRTHQDVSP  440


 Score = 68.6 bits (166),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 41/65 (63%), Gaps = 0/65 (0%)

Query  246  KIHTGEKPFNCTYCPKNFRQLSTLTNHVKIHTGEKPFECAVCKKQFRQSSTLNNHIKIHV  305
            K H+  + F C  C K+F+Q STL  H +IHT  +PF C+ C K+FRQ S L  H++IH 
Sbjct  321  KPHSDLRLFKCLTCGKDFKQKSTLLQHDRIHTDARPFPCSECGKRFRQQSHLTQHLRIHA  380

Query  306  MDKVY  310
             +K +
Sbjct  381  NEKPF  385


 Score = 44.7 bits (104),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 34/154 (22%), Positives = 52/154 (34%), Gaps = 48/154 (31%)

Query  195  EKPFLCSVCDRRFRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQSSTLTNHLKIHTGEKPF  254
            EKPF C  C + FRQ + L  HV+ H    P+        F+       H  +   + PF
Sbjct  410  EKPFACPECGKHFRQKAILNQHVRTHQDVSPH------LIFKNGP----HPTLWPSDVPF  459

Query  255  ------------------------------NCTYCPKNFRQ------LSTLTNHVKIHTG  278
                                             + P  F+       L  +  H+ +   
Sbjct  460  PGEDNDTKGDIAGTGGGYHDEDSQGTPDGSGGMHYPSYFKDGKGQKILPEVLQHIGVRPA  519

Query  279  EKPF--ECAVCKKQFRQSSTLNNHIKIHVMDKVY  310
              P    C +C K+F+Q +TL  H  IH+  + Y
Sbjct  520  NMPLYVRCPICDKEFKQKTTLLQHGCIHIESRPY  553



Lambda      K        H
   0.332    0.140    0.428 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3457179198


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jan 6, 2022  5:17 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_014085111.1 PREDICTED: adult enhancer factor 1 [Bactrocera oleae]

Length=322
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GLAS_DROME  unnamed protein product                                   142     4e-38
Q8IG96_DROME  unnamed protein product                                 133     1e-37
M9PGG2_DROME  unnamed protein product                                 139     1e-36


>GLAS_DROME unnamed protein product
Length=604

 Score = 142 bits (359),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 85/125 (68%), Gaps = 0/125 (0%)

Query  186  GSSGGGGGHEKPFLCSVCDRRFRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQSSTLTNHL  245
            G  G  GG  KP LC +C + + + STL  H++ H+GE+PY+C  C+K+F Q++ LT H+
Sbjct  425  GDEGSSGGEMKPNLCRLCGKTYARPSTLKTHLRTHSGERPYRCPDCNKSFSQAANLTAHV  484

Query  246  KIHTGEKPFNCTYCPKNFRQLSTLTNHVKIHTGEKPFECAVCKKQFRQSSTLNNHIKIHV  305
            + HTG+KPF C  C + F Q S++T H++ H+GE+P+ C+ CKK F  SSTL  H++IH 
Sbjct  485  RTHTGQKPFRCPICDRRFSQSSSVTTHMRTHSGERPYRCSSCKKSFSDSSTLTKHLRIHS  544

Query  306  MDKVY  310
             +K Y
Sbjct  545  GEKPY  549


 Score = 141 bits (355),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 82/110 (75%), Gaps = 0/110 (0%)

Query  195  EKPFLCSVCDRRFRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQSSTLTNHLKIHTGEKPF  254
            E+P+ C  C++ F Q + LT HV+ HTG+KP++C +CD+ F QSS++T H++ H+GE+P+
Sbjct  462  ERPYRCPDCNKSFSQAANLTAHVRTHTGQKPFRCPICDRRFSQSSSVTTHMRTHSGERPY  521

Query  255  NCTYCPKNFRQLSTLTNHVKIHTGEKPFECAVCKKQFRQSSTLNNHIKIH  304
             C+ C K+F   STLT H++IH+GEKP++C +C  +F QS  LN H+++H
Sbjct  522  RCSSCKKSFSDSSTLTKHLRIHSGEKPYQCKLCLLRFSQSGNLNRHMRVH  571


>Q8IG96_DROME unnamed protein product
Length=206

 Score = 133 bits (334),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 70/105 (67%), Gaps = 0/105 (0%)

Query  200  CSVCDRRFRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQSSTLTNHLKIHTGEKPFNCTYC  259
            C +CD+ F+Q +TL  H  IH   +PY C  C K FRQ S LT HL+IHT EKPF C YC
Sbjct  92   CPICDKEFKQKTTLLQHGCIHIESRPYPCPECGKRFRQQSHLTQHLRIHTNEKPFGCMYC  151

Query  260  PKNFRQLSTLTNHVKIHTGEKPFECAVCKKQFRQSSTLNNHIKIH  304
            P+ FRQ + L  H++IHTGEKP++C  C K FRQ + L+ H + H
Sbjct  152  PRFFRQRTILNQHLRIHTGEKPYKCGQCGKDFRQKAILDQHTRTH  196


 Score = 103 bits (256),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 84/180 (47%), Gaps = 19/180 (11%)

Query  140  AHLVATAAHSPALSEHHFA-AGREVVANGHSAGSSTNGGGGGGGNSSGSSGGGGGHEKPF  198
             HL+      P L        G +    G  AG+   GGG    +S G+  G GG   P 
Sbjct  5    PHLIFKNGPHPTLWPSDVPFPGEDNDTKGDIAGT---GGGYHDEDSQGTPDGSGGMHYP-  60

Query  199  LCSVCDRRFRQ------LSTLTNHVKIHTGEKPY--KCNVCDKTFRQSSTLTNHLKIHTG  250
                    F+       L  +  H+ +     P   +C +CDK F+Q +TL  H  IH  
Sbjct  61   ------SYFKDGKGQKILPEVLQHIGVRPANMPLYVRCPICDKEFKQKTTLLQHGCIHIE  114

Query  251  EKPFNCTYCPKNFRQLSTLTNHVKIHTGEKPFECAVCKKQFRQSSTLNNHIKIHVMDKVY  310
             +P+ C  C K FRQ S LT H++IHT EKPF C  C + FRQ + LN H++IH  +K Y
Sbjct  115  SRPYPCPECGKRFRQQSHLTQHLRIHTNEKPFGCMYCPRFFRQRTILNQHLRIHTGEKPY  174


 Score = 99.0 bits (245),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 54/81 (67%), Gaps = 0/81 (0%)

Query  196  KPFLCSVCDRRFRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQSSTLTNHLKIHTGEKPFN  255
            +P+ C  C +RFRQ S LT H++IHT EKP+ C  C + FRQ + L  HL+IHTGEKP+ 
Sbjct  116  RPYPCPECGKRFRQQSHLTQHLRIHTNEKPFGCMYCPRFFRQRTILNQHLRIHTGEKPYK  175

Query  256  CTYCPKNFRQLSTLTNHVKIH  276
            C  C K+FRQ + L  H + H
Sbjct  176  CGQCGKDFRQKAILDQHTRTH  196


 Score = 71.6 bits (174),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 35/54 (65%), Gaps = 0/54 (0%)

Query  195  EKPFLCSVCDRRFRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQSSTLTNHLKIH  248
            EKPF C  C R FRQ + L  H++IHTGEKPYKC  C K FRQ + L  H + H
Sbjct  143  EKPFGCMYCPRFFRQRTILNQHLRIHTGEKPYKCGQCGKDFRQKAILDQHTRTH  196


>M9PGG2_DROME unnamed protein product
Length=938

 Score = 139 bits (351),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 73/111 (66%), Gaps = 0/111 (0%)

Query  200  CSVCDRRFRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQSSTLTNHLKIHTGEKPFNCTYC  259
            C +CD+ F+Q +TL  H  IH   +PY C  C K FRQ S LT HL+IHT EKPF C YC
Sbjct  527  CPICDKEFKQKTTLLQHGCIHIESRPYPCPECGKRFRQQSHLTQHLRIHTNEKPFGCMYC  586

Query  260  PKNFRQLSTLTNHVKIHTGEKPFECAVCKKQFRQSSTLNNHIKIHVMDKVY  310
            P+ FRQ + L  H++IHTGEKP++C  C K FRQ + L+ H + H  D+ +
Sbjct  587  PRFFRQRTILNQHLRIHTGEKPYKCGQCGKDFRQKAILDQHTRTHQGDRPF  637


 Score = 139 bits (349),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 82/138 (59%), Gaps = 9/138 (7%)

Query  176  GGGGGGGNSSGSSGGGGGHE---KP------FLCSVCDRRFRQLSTLTNHVKIHTGEKPY  226
            G G  G  S G +G G G     KP      F C  C + F+Q STL  H +IHT  +P+
Sbjct  298  GVGSVGVTSGGRTGNGPGRPHKNKPHSDLRLFKCLTCGKDFKQKSTLLQHDRIHTDARPF  357

Query  227  KCNVCDKTFRQSSTLTNHLKIHTGEKPFNCTYCPKNFRQLSTLTNHVKIHTGEKPFECAV  286
             C+ C K FRQ S LT HL+IH  EKPF C YC ++FRQ + L  H++IH+GEKPF C  
Sbjct  358  PCSECGKRFRQQSHLTQHLRIHANEKPFTCPYCSRSFRQRAILNQHIRIHSGEKPFACPE  417

Query  287  CKKQFRQSSTLNNHIKIH  304
            C K FRQ + LN H++ H
Sbjct  418  CGKHFRQKAILNQHVRTH  435


 Score = 122 bits (306),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 72/112 (64%), Gaps = 2/112 (2%)

Query  196  KPFLCSVCDRRFRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQSSTLTNHLKIHTGEKPFN  255
            +P+ C  C +RFRQ S LT H++IHT EKP+ C  C + FRQ + L  HL+IHTGEKP+ 
Sbjct  551  RPYPCPECGKRFRQQSHLTQHLRIHTNEKPFGCMYCPRFFRQRTILNQHLRIHTGEKPYK  610

Query  256  CTYCPKNFRQLSTLTNHVKIHTGEKPFECAV--CKKQFRQSSTLNNHIKIHV  305
            C  C K+FRQ + L  H + H G++PF C +  C+++F   + +  HI  H+
Sbjct  611  CGQCGKDFRQKAILDQHTRTHQGDRPFCCPMPNCRRRFATENEVTKHIDNHM  662


 Score = 108 bits (269),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 62/175 (35%), Positives = 86/175 (49%), Gaps = 9/175 (5%)

Query  140  AHLVATAAHSPALSEHHFA-AGREVVANGHSAGSSTNGGGGGGGNSSGSSGGGGGHEKPF  198
             HL+      P L        G +    G  AG+   GGG    +S G+  G GG   P 
Sbjct  440  PHLIFKNGPHPTLWPSDVPFPGEDNDTKGDIAGT---GGGYHDEDSQGTPDGSGGMHYPS  496

Query  199  LCSVCDRRFRQ-LSTLTNHVKIHTGEKPY--KCNVCDKTFRQSSTLTNHLKIHTGEKPFN  255
                 D + ++ L  +  H+ +     P   +C +CDK F+Q +TL  H  IH   +P+ 
Sbjct  497  YFK--DGKGQKILPEVLQHIGVRPANMPLYVRCPICDKEFKQKTTLLQHGCIHIESRPYP  554

Query  256  CTYCPKNFRQLSTLTNHVKIHTGEKPFECAVCKKQFRQSSTLNNHIKIHVMDKVY  310
            C  C K FRQ S LT H++IHT EKPF C  C + FRQ + LN H++IH  +K Y
Sbjct  555  CPECGKRFRQQSHLTQHLRIHTNEKPFGCMYCPRFFRQRTILNQHLRIHTGEKPY  609


 Score = 104 bits (259),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 57/86 (66%), Gaps = 0/86 (0%)

Query  196  KPFLCSVCDRRFRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQSSTLTNHLKIHTGEKPFN  255
            +PF CS C +RFRQ S LT H++IH  EKP+ C  C ++FRQ + L  H++IH+GEKPF 
Sbjct  355  RPFPCSECGKRFRQQSHLTQHLRIHANEKPFTCPYCSRSFRQRAILNQHIRIHSGEKPFA  414

Query  256  CTYCPKNFRQLSTLTNHVKIHTGEKP  281
            C  C K+FRQ + L  HV+ H    P
Sbjct  415  CPECGKHFRQKAILNQHVRTHQDVSP  440


 Score = 89.7 bits (221),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 50/84 (60%), Gaps = 2/84 (2%)

Query  195  EKPFLCSVCDRRFRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQSSTLTNHLKIHTGEKPF  254
            EKPF C  C R FRQ + L  H++IHTGEKPYKC  C K FRQ + L  H + H G++PF
Sbjct  578  EKPFGCMYCPRFFRQRTILNQHLRIHTGEKPYKCGQCGKDFRQKAILDQHTRTHQGDRPF  637

Query  255  NCTY--CPKNFRQLSTLTNHVKIH  276
             C    C + F   + +T H+  H
Sbjct  638  CCPMPNCRRRFATENEVTKHIDNH  661


 Score = 71.2 bits (173),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 36/59 (61%), Gaps = 0/59 (0%)

Query  195  EKPFLCSVCDRRFRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQSSTLTNHLKIHTGEKP  253
            EKPF C  C R FRQ + L  H++IH+GEKP+ C  C K FRQ + L  H++ H    P
Sbjct  382  EKPFTCPYCSRSFRQRAILNQHIRIHSGEKPFACPECGKHFRQKAILNQHVRTHQDVSP  440


 Score = 68.6 bits (166),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 41/65 (63%), Gaps = 0/65 (0%)

Query  246  KIHTGEKPFNCTYCPKNFRQLSTLTNHVKIHTGEKPFECAVCKKQFRQSSTLNNHIKIHV  305
            K H+  + F C  C K+F+Q STL  H +IHT  +PF C+ C K+FRQ S L  H++IH 
Sbjct  321  KPHSDLRLFKCLTCGKDFKQKSTLLQHDRIHTDARPFPCSECGKRFRQQSHLTQHLRIHA  380

Query  306  MDKVY  310
             +K +
Sbjct  381  NEKPF  385


 Score = 44.7 bits (104),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 34/154 (22%), Positives = 52/154 (34%), Gaps = 48/154 (31%)

Query  195  EKPFLCSVCDRRFRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQSSTLTNHLKIHTGEKPF  254
            EKPF C  C + FRQ + L  HV+ H    P+        F+       H  +   + PF
Sbjct  410  EKPFACPECGKHFRQKAILNQHVRTHQDVSPH------LIFKNGP----HPTLWPSDVPF  459

Query  255  ------------------------------NCTYCPKNFRQ------LSTLTNHVKIHTG  278
                                             + P  F+       L  +  H+ +   
Sbjct  460  PGEDNDTKGDIAGTGGGYHDEDSQGTPDGSGGMHYPSYFKDGKGQKILPEVLQHIGVRPA  519

Query  279  EKPF--ECAVCKKQFRQSSTLNNHIKIHVMDKVY  310
              P    C +C K+F+Q +TL  H  IH+  + Y
Sbjct  520  NMPLYVRCPICDKEFKQKTTLLQHGCIHIESRPY  553



Lambda      K        H
   0.311    0.122    0.353 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3194608626


Query= XP_014085112.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase 64E
[Bactrocera oleae]

Length=1643
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

UBPE_DROME  unnamed protein product                                   1452    0.0   
Q22240_CAEEL  unnamed protein product                                 413     1e-120
UBP7_DROME  unnamed protein product                                   177     1e-44 


>UBPE_DROME unnamed protein product
Length=1556

 Score = 1452 bits (3759),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 769/1332 (58%), Positives = 937/1332 (70%), Gaps = 111/1332 (8%)

Query  327   LSDPELLSDDDLALGASASPTETEP---FG---GDGLLKLRNTSPRSPKYGPLTEGETYQ  380
             +SD E LSDDDLALGASASPT   P   +G   GD  ++           G  T+  TY 
Sbjct  288   ISDAEQLSDDDLALGASASPTMLGPGYDYGAPTGDSDVEGVTGVTDPSTIG--TDDGTYP  345

Query  381   QMTLERDFTRLGKKLQPISASAVINTTAATGGSTMSTMSSGSS------ANGYVGLVNQA  434
              ++   +F R       + A   +NTT A   S+ +T +   +        GYVGLVNQA
Sbjct  346   ALS---NFYRRKYGGDELRAWQRVNTTGADFVSSATTETEAEARQASLGPRGYVGLVNQA  402

Query  435   MTCYLNSLLQALFMTPEFRNALYRWEFDNDNEAKNIPYQLQKLFLNLQTSKKSAVETTDL  494
             MTCYLNSLLQALFMTPEFRNALYRWEFDNDNEAKNIPYQLQKLFLNLQTS K+AVETTDL
Sbjct  403   MTCYLNSLLQALFMTPEFRNALYRWEFDNDNEAKNIPYQLQKLFLNLQTSPKAAVETTDL  462

Query  495   TRSFGWDSTEAWQQHDIQELCRVMFDALEHKFKNTKQMNLIASLYEGKMLDYVKCLECNT  554
             TRSFGWDSTEAWQQHDIQELCRVMFDALEHKFKNTKQ NLI++LYEGKM DYVKCLECNT
Sbjct  463   TRSFGWDSTEAWQQHDIQELCRVMFDALEHKFKNTKQANLISNLYEGKMNDYVKCLECNT  522

Query  555   EKTRADTFLDIPLPVRPFGSTVAYGSIEEALRAFVQPETLDGNNQYFCEKCNKKCDAHKG  614
             EKTR DTFLDIPLPVRPFGS+ AYGSIEEALRAFVQPETLDGNNQY CEKC KKCDAHKG
Sbjct  523   EKTREDTFLDIPLPVRPFGSSSAYGSIEEALRAFVQPETLDGNNQYLCEKCKKKCDAHKG  582

Query  615   LKFKNFPYILTLHLKRFDFDYQTMHRIKLNDKVTFPEMLNLNSFISTADLESPVPSTSTS  674
             L FK+FPYILTLHLKRFDFDYQTMHRIKLND+VTFP+ LNLN+FI+              
Sbjct  583   LHFKSFPYILTLHLKRFDFDYQTMHRIKLNDRVTFPQTLNLNTFINR-------------  629

Query  675   AATANTIPGNIATNGFIPNVATSTNDDCSTTDSGSAMEEDLCCSGTATTASSSQHENDMN  734
               + N+   N   NG        T DDCST DSGSAME+D   SG  TTASSSQHEND+N
Sbjct  630   --SGNSGEQNSQLNG--------TVDDCSTADSGSAMEDDNLSSGVVTTASSSQHENDLN  679

Query  735   DDDEGIDMSTSTDHRINSSNASVEQRIKHDNGPYLYELFAIMIHSGSASGGHYYAYIKEF  794
             D+DEGIDMS+ST            +  K  +GPYLYELFAIMIHSGSASGGHYYAYIK+F
Sbjct  680   DEDEGIDMSSST-----------SKSAKQGSGPYLYELFAIMIHSGSASGGHYYAYIKDF  728

Query  795   DNNGWYCFNDQSVSPITEEDIEKSFGGGSSRAYYSSVYSSSTNAYMLMYRQIDAQRNERA  854
             DNN W+CFNDQ+V+ IT+EDI++SFGG +    YSS Y+SSTNAYMLMYRQ+DA+RNE  
Sbjct  729   DNNEWFCFNDQNVTSITQEDIQRSFGGPNGSY-YSSAYTSSTNAYMLMYRQVDAKRNELV  787

Query  855   TKSTDFPEHINQLLPKLHQEEETRVPRSTGRHGVVVSDLSVQELIKPRVSFYNPELKKIK  914
              K  DFPEHI  LLPKLH EEETRV R  GRH + V+DL++ +L KPRV FYNP LKK+K
Sbjct  788   AKVADFPEHIKTLLPKLHSEEETRVSR-LGRH-ITVTDLALPDLYKPRVYFYNPSLKKMK  845

Query  915   FTRAYVS-SFHIKSVLESAYQLLNVEKFAPLSRCRLVVYNDMGEQICQSLEHISDPTLSE  973
              TR YVS SF+I  VL SAY++LNVE+FAPLSRCRLV YN   + I QSLE  +DP L+E
Sbjct  846   ITRVYVSQSFNINLVLMSAYEMLNVEQFAPLSRCRLVAYNSSMDTIIQSLESCTDPALTE  905

Query  974   LRQQTDGPLEFLLETREEGQEFEVYKPGGVTWNVYIVNVAKMQLDGPHLVY--APSKEAN  1031
             LR   +  L+FLLE R E QEFEVY P G+TW V+ V+++ M +DGP LVY  A  +EA+
Sbjct  906   LRAAQNYSLDFLLEYRAEDQEFEVYPPNGITWYVFKVDLSTMAMDGPFLVYSAAREREAS  965

Query  1032  AALLHSIAVRLNLNENQLLLATVKT---DAFVALDTASSENDTAEGMQRQVITQEDLQEI  1088
               L  SIA+RL+++E Q LLATV+     AFV+ D     + T E +Q        LQ +
Sbjct  966   DVLRRSIALRLHISEQQFLLATVRATVPKAFVSYDP----HPTPEALQH-------LQNM  1014

Query  1089  AQEQFRGLTYIYLNVPNTDASTLEILDIPALETPTIEVSADVVDAVQMNANVLHTLSPSN  1148
             A  QF+ +TY YLNVPNTDA+TLE+L +P +E+       DVVDA  MN      +S SN
Sbjct  1015  ANTQFKSITYFYLNVPNTDAATLEMLGVPTVESVECASGGDVVDAAMMNGVAPGHMSSSN  1074

Query  1149  S--------DCTSNLSQKSCARESPLLPATAAAAGTTTLAGQESHSEDSSLSDGDRTLVE  1200
                      D    +SQ S +                   G ES+SEDSSLSDGDRTLVE
Sbjct  1075  DYDWRRYKRDLVEPMSQPSPSH------------------GHESNSEDSSLSDGDRTLVE  1116

Query  1201  S--LHNRYGGDSQISSTNHSPYLSSPEDDAYNKANSLKRIHDLFQMAPDHTMETAS---M  1255
             +  + +R GGDSQ+SST+HSP LSSPED+A +  +++ R+H        +         +
Sbjct  1117  TDNMAHRGGGDSQVSSTSHSPQLSSPEDEAASH-DAMMRVHAYCNGNGSYAAADVVDPLL  1175

Query  1256  SRSNTPQFFYAEKINAVDWMTISPRILSSSTNDPNEELG-RKPTHSYKIIVDPRMKMSTF  1314
               ++T  FFYA K+  VD +       SSS +  +EE   RKPT +YK++V   M+M  F
Sbjct  1176  LPTSTNHFFYATKVECVDVVGTG----SSSGHQSDEEAQLRKPTRAYKLLVGTHMRMGAF  1231

Query  1315  MRHVESLIGVPSNYFKLQHKYE---VIDLMSTVLFVCMGETLSVELGKVLQPDEDKAKIS  1371
              +H+E LI VP+ +FKLQ K++     +  ++++ +  GETL+VELGK L+PDE KAKI 
Sbjct  1232  KKHIEQLIQVPAAHFKLQRKHDNNLSNNQNNSLVHLIEGETLTVELGKTLEPDEFKAKIH  1291

Query  1372  FMRLSELDNDTGKLPCICEWVCKASMTVAEAKKELIAKLHRIDVKYKTLNPNNCRLWLKG  1431
             F+RL+++DN+T KLPC+CEWV  A+ T  +AKKEL+AKLHRID KY TL+  NCR+WLKG
Sbjct  1292  FLRLADIDNETSKLPCVCEWVYNANTTAEQAKKELVAKLHRIDAKYATLSVQNCRIWLKG  1351

Query  1432  GRNPIEIMGDDETLGTDLRSMTGAEFLVQECEAGVSPQVPADSLTIFVRRWHADKLQLDK  1491
             GR PI+I+ DDETL  D+RS   AEF+VQECE  V PQ   DSLT+FVRRW   KL+  K
Sbjct  1352  GRIPIKILSDDETLYCDMRSSIAAEFIVQECEEEVDPQPKDDSLTLFVRRWCPAKLEFGK  1411

Query  1492  FQEVTLEKESEIRSELAKITDIPQEHIAYSKINGSFPCTNISLLSINSTLSWFSIPATLN  1551
             FQE+TL+++SEIR  L++I+DIP + ++Y K+N +FPCT+IS LS+N + SW+S+P TL+
Sbjct  1412  FQEITLDQDSEIRLSLSQISDIPIDKLSYMKLNSNFPCTSISALSVNESSSWYSVPTTLD  1471

Query  1552  KYPLTSTVSGNVYFYKDVTKAPKEPTTEERRELGTREKLRLDRLGCMSTSLYSPRRERAL  1611
             KYPL ST +GN+Y YKD T   +E T EERR +  REK RLDR+GC+ST+ Y+ RRERAL
Sbjct  1472  KYPLNSTQTGNIYLYKDRTVPARELTLEERRLMNAREKARLDRVGCVSTTRYAQRRERAL  1531

Query  1612  KIYLDSPQSNNN  1623
             KIYLDSP+ ++N
Sbjct  1532  KIYLDSPEKSSN  1543


 Score = 117 bits (294),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 73/183 (40%), Positives = 105/183 (57%), Gaps = 8/183 (4%)

Query  7    EKSTQCVV--HDLTPGSEQKKINIVVRSQYTIEKVFRNISTQYPYEAYDLLLQPNGTESP  64
            ++S QC V   D TPGSEQKKIN+VVRS +T+++V   I TQ+ YE ++LLLQP+  +  
Sbjct  4    KESEQCTVSVFDQTPGSEQKKINVVVRSHFTVKRVIDLIGTQFSYEKFELLLQPHDNKD-  62

Query  65   LLHLNARKNELLFAAPGFSAQEKNVLVLLPPDVWDGDVQKRFDFTKTLSKKKCISKSNG-  123
            L++LNA +++L++   GF  Q KN L+LLP   WDGDV KRF+        K + KS+G 
Sbjct  63   LVNLNALESQLMYEVAGFEPQLKNHLILLPSGSWDGDVTKRFELPIKRVVVKKVMKSDGE  122

Query  124  ---STGTTSPKKSTIKTTKTVKATSADKAVNAVKASSTDK-ASNAIKDSSTVEASSAVKA  179
               S  T   KK  +      K  S   + +  K +S D  A  +I   S+ E +S +K 
Sbjct  123  KAKSPATGEKKKRVVGEKTKKKPASGSSSPSKAKTTSEDSLAKTSISSESSPEKTSKIKT  182

Query  180  SNA  182
            + A
Sbjct  183  TAA  185


>Q22240_CAEEL unnamed protein product
Length=1326

 Score = 413 bits (1061),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 228/464 (49%), Positives = 290/464 (63%), Gaps = 54/464 (12%)

Query  427  YVGLVNQAMTCYLNSLLQALFMTPEFRNALYRWEF---------DNDNEAKNIPYQLQKL  477
            YVGLVNQAMTCYLNSL+Q+L+MTPEFRNA+Y WE+               ++IP QLQKL
Sbjct  87   YVGLVNQAMTCYLNSLVQSLYMTPEFRNAMYDWEYVQQPAHIKEQRKKAEQSIPCQLQKL  146

Query  478  FLNLQTSKKSAVETTDLTRSFGWDSTEAWQQHDIQELCRVMFDALEHKFKNTKQMNLIAS  537
            FL LQTS+  ++ET DLT+SFGW S EA+ QHD+QELCR+MFDALEHK+K T+   LI  
Sbjct  147  FLLLQTSENDSLETKDLTQSFGWTSNEAYDQHDVQELCRLMFDALEHKWKGTEHEKLIQD  206

Query  538  LYEGKMLDYVKCLECNTEKTRADTFLDIPLPVRPFGSTVAYGSIEEALRAFVQPETLDGN  597
            LY G M D+V CL+C  E  + D FLD+PL V+PFG+  AY S+EEAL AFVQPE LDG+
Sbjct  207  LYRGTMEDFVACLKCGRESVKTDYFLDLPLAVKPFGAIHAYKSVEEALTAFVQPELLDGS  266

Query  598  NQYFCEKCNKKCDAHKGLKFKNFPYILTLHLKRFDFDYQTMHRIKLNDKVTFPEMLNLNS  657
            NQY CE C  K DAHKGL+   FPY+LT+ LKRFDFDY TMHRIKLNDK+TFP++L+LN 
Sbjct  267  NQYMCENCKSKQDAHKGLRITQFPYLLTIQLKRFDFDYNTMHRIKLNDKMTFPDVLDLND  326

Query  658  FISTADLESPVPSTSTSAATANTIPGNIATNGFIPNVATSTNDDCSTTDSGSAMEEDLCC  717
            +++           ST+++    I  N + N           DD    + GS      C 
Sbjct  327  YVNKE-------KRSTTSSAWQQIGKNKSEN---------EEDD---MELGSP-NPKRCT  366

Query  718  SGTATTASSSQHENDMNDDDEGIDMSTSTDHRINSSNASVEQRIKHDNGPYLYELFAIMI  777
             G  +       EN        + +    DH      A+V+  +K  +G  +YELF++M+
Sbjct  367  PGVQSPNRYQGSEN--------VCVGQPIDH------AAVDDIVK-TSGDNVYELFSVMV  411

Query  778  HSGSASGGHYYAYIKEFDNNGWYCFNDQSVSPITEEDIEKSFGGGSSRAYYSSVYSSSTN  837
            HSG+A+GGHY+AYIK  D + WY FND  V   T  +IEKSFGG     + S    S+TN
Sbjct  412  HSGNAAGGHYFAYIKNLDQDRWYVFNDTRVDFATPLEIEKSFGG-----HPSGWNQSNTN  466

Query  838  AYMLMYRQIDAQRNERATKSTDFPEHINQLLPKLHQEEETRVPR  881
            AYMLMYR+ID +RN R   S   P+HI     K  QE+  R+ R
Sbjct  467  AYMLMYRRIDPKRNARFILSNQLPQHI-----KDSQEKWKRLER  505


>UBP7_DROME unnamed protein product
Length=1129

 Score = 177 bits (450),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 96/238 (40%), Positives = 143/238 (60%), Gaps = 8/238 (3%)

Query  426  GYVGLVNQAMTCYLNSLLQALFMTPEFRNALYRWEFDNDNEAKNIPYQLQKLFLNLQTSK  485
            GYVGL NQ  TCY+NSLLQ L+ T   R ++YR   + D+ +K++   LQ++F  LQ   
Sbjct  239  GYVGLKNQGATCYMNSLLQTLYFTNSLRLSVYRIPTEADDSSKSVGLSLQRVFHELQFGD  298

Query  486  KSAVETTDLTRSFGWDSTEAWQQHDIQELCRVMFDALEHKFKNTKQMNLIASLYEGKMLD  545
            +  V T  LT+SFGW++ +++ QHD+QE  RV+ D LE K K T     I  L+EGKM  
Sbjct  299  R-PVGTKKLTKSFGWETLDSFMQHDVQEFLRVLLDKLESKMKGTILEGTIPGLFEGKMSS  357

Query  546  YVKCLECNTEKTRADTFLDIPLPVRPFGSTVAYGSIEEALRAFVQPETLDGNNQYFCEKC  605
            Y+KC   +   TR +TF DI L ++         +I E+ + +V PETL+G+N+Y     
Sbjct  358  YIKCKNVDYNSTRYETFYDIQLNIK------DKKNIYESFQDYVAPETLEGDNKYDA-GV  410

Query  606  NKKCDAHKGLKFKNFPYILTLHLKRFDFDYQTMHRIKLNDKVTFPEMLNLNSFISTAD  663
            +   +A KG+ F +FP +L LHL RF +D  T   IK ND+  F E +NL+ +++ ++
Sbjct  411  HGLQEASKGVIFTSFPPVLHLHLMRFQYDPVTDSSIKYNDRFEFYEHINLDRYLAESE  468


 Score = 57.8 bits (138),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 47/83 (57%), Gaps = 5/83 (6%)

Query  770  YELFAIMIHSGSASGGHYYAYIKEFDNNGWYCFNDQSVSPI-TEEDIEKSFGGGSSRAYY  828
            Y L A+++HSG   GGHY  +I    +  W+ F+D  VS    +E IE+++GG       
Sbjct  474  YVLHAVLVHSGDNHGGHYVVFINPKADGRWFKFDDDVVSSCRKQEAIEQNYGGMDDEI--  531

Query  829  SSVYSSSTNAYMLMY-RQIDAQR  850
             S ++  +NAYML+Y RQ +  R
Sbjct  532  -SFHAKCSNAYMLVYIRQSELDR  553



Lambda      K        H
   0.311    0.122    0.353 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3194608626


Query= XP_014085113.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase 64E
[Bactrocera oleae]

Length=1643
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

UBPE_DROME  unnamed protein product                                   1452    0.0   
Q22240_CAEEL  unnamed protein product                                 413     1e-120
UBP7_DROME  unnamed protein product                                   177     1e-44 


>UBPE_DROME unnamed protein product
Length=1556

 Score = 1452 bits (3759),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 769/1332 (58%), Positives = 937/1332 (70%), Gaps = 111/1332 (8%)

Query  327   LSDPELLSDDDLALGASASPTETEP---FG---GDGLLKLRNTSPRSPKYGPLTEGETYQ  380
             +SD E LSDDDLALGASASPT   P   +G   GD  ++           G  T+  TY 
Sbjct  288   ISDAEQLSDDDLALGASASPTMLGPGYDYGAPTGDSDVEGVTGVTDPSTIG--TDDGTYP  345

Query  381   QMTLERDFTRLGKKLQPISASAVINTTAATGGSTMSTMSSGSS------ANGYVGLVNQA  434
              ++   +F R       + A   +NTT A   S+ +T +   +        GYVGLVNQA
Sbjct  346   ALS---NFYRRKYGGDELRAWQRVNTTGADFVSSATTETEAEARQASLGPRGYVGLVNQA  402

Query  435   MTCYLNSLLQALFMTPEFRNALYRWEFDNDNEAKNIPYQLQKLFLNLQTSKKSAVETTDL  494
             MTCYLNSLLQALFMTPEFRNALYRWEFDNDNEAKNIPYQLQKLFLNLQTS K+AVETTDL
Sbjct  403   MTCYLNSLLQALFMTPEFRNALYRWEFDNDNEAKNIPYQLQKLFLNLQTSPKAAVETTDL  462

Query  495   TRSFGWDSTEAWQQHDIQELCRVMFDALEHKFKNTKQMNLIASLYEGKMLDYVKCLECNT  554
             TRSFGWDSTEAWQQHDIQELCRVMFDALEHKFKNTKQ NLI++LYEGKM DYVKCLECNT
Sbjct  463   TRSFGWDSTEAWQQHDIQELCRVMFDALEHKFKNTKQANLISNLYEGKMNDYVKCLECNT  522

Query  555   EKTRADTFLDIPLPVRPFGSTVAYGSIEEALRAFVQPETLDGNNQYFCEKCNKKCDAHKG  614
             EKTR DTFLDIPLPVRPFGS+ AYGSIEEALRAFVQPETLDGNNQY CEKC KKCDAHKG
Sbjct  523   EKTREDTFLDIPLPVRPFGSSSAYGSIEEALRAFVQPETLDGNNQYLCEKCKKKCDAHKG  582

Query  615   LKFKNFPYILTLHLKRFDFDYQTMHRIKLNDKVTFPEMLNLNSFISTADLESPVPSTSTS  674
             L FK+FPYILTLHLKRFDFDYQTMHRIKLND+VTFP+ LNLN+FI+              
Sbjct  583   LHFKSFPYILTLHLKRFDFDYQTMHRIKLNDRVTFPQTLNLNTFINR-------------  629

Query  675   AATANTIPGNIATNGFIPNVATSTNDDCSTTDSGSAMEEDLCCSGTATTASSSQHENDMN  734
               + N+   N   NG        T DDCST DSGSAME+D   SG  TTASSSQHEND+N
Sbjct  630   --SGNSGEQNSQLNG--------TVDDCSTADSGSAMEDDNLSSGVVTTASSSQHENDLN  679

Query  735   DDDEGIDMSTSTDHRINSSNASVEQRIKHDNGPYLYELFAIMIHSGSASGGHYYAYIKEF  794
             D+DEGIDMS+ST            +  K  +GPYLYELFAIMIHSGSASGGHYYAYIK+F
Sbjct  680   DEDEGIDMSSST-----------SKSAKQGSGPYLYELFAIMIHSGSASGGHYYAYIKDF  728

Query  795   DNNGWYCFNDQSVSPITEEDIEKSFGGGSSRAYYSSVYSSSTNAYMLMYRQIDAQRNERA  854
             DNN W+CFNDQ+V+ IT+EDI++SFGG +    YSS Y+SSTNAYMLMYRQ+DA+RNE  
Sbjct  729   DNNEWFCFNDQNVTSITQEDIQRSFGGPNGSY-YSSAYTSSTNAYMLMYRQVDAKRNELV  787

Query  855   TKSTDFPEHINQLLPKLHQEEETRVPRSTGRHGVVVSDLSVQELIKPRVSFYNPELKKIK  914
              K  DFPEHI  LLPKLH EEETRV R  GRH + V+DL++ +L KPRV FYNP LKK+K
Sbjct  788   AKVADFPEHIKTLLPKLHSEEETRVSR-LGRH-ITVTDLALPDLYKPRVYFYNPSLKKMK  845

Query  915   FTRAYVS-SFHIKSVLESAYQLLNVEKFAPLSRCRLVVYNDMGEQICQSLEHISDPTLSE  973
              TR YVS SF+I  VL SAY++LNVE+FAPLSRCRLV YN   + I QSLE  +DP L+E
Sbjct  846   ITRVYVSQSFNINLVLMSAYEMLNVEQFAPLSRCRLVAYNSSMDTIIQSLESCTDPALTE  905

Query  974   LRQQTDGPLEFLLETREEGQEFEVYKPGGVTWNVYIVNVAKMQLDGPHLVY--APSKEAN  1031
             LR   +  L+FLLE R E QEFEVY P G+TW V+ V+++ M +DGP LVY  A  +EA+
Sbjct  906   LRAAQNYSLDFLLEYRAEDQEFEVYPPNGITWYVFKVDLSTMAMDGPFLVYSAAREREAS  965

Query  1032  AALLHSIAVRLNLNENQLLLATVKT---DAFVALDTASSENDTAEGMQRQVITQEDLQEI  1088
               L  SIA+RL+++E Q LLATV+     AFV+ D     + T E +Q        LQ +
Sbjct  966   DVLRRSIALRLHISEQQFLLATVRATVPKAFVSYDP----HPTPEALQH-------LQNM  1014

Query  1089  AQEQFRGLTYIYLNVPNTDASTLEILDIPALETPTIEVSADVVDAVQMNANVLHTLSPSN  1148
             A  QF+ +TY YLNVPNTDA+TLE+L +P +E+       DVVDA  MN      +S SN
Sbjct  1015  ANTQFKSITYFYLNVPNTDAATLEMLGVPTVESVECASGGDVVDAAMMNGVAPGHMSSSN  1074

Query  1149  S--------DCTSNLSQKSCARESPLLPATAAAAGTTTLAGQESHSEDSSLSDGDRTLVE  1200
                      D    +SQ S +                   G ES+SEDSSLSDGDRTLVE
Sbjct  1075  DYDWRRYKRDLVEPMSQPSPSH------------------GHESNSEDSSLSDGDRTLVE  1116

Query  1201  S--LHNRYGGDSQISSTNHSPYLSSPEDDAYNKANSLKRIHDLFQMAPDHTMETAS---M  1255
             +  + +R GGDSQ+SST+HSP LSSPED+A +  +++ R+H        +         +
Sbjct  1117  TDNMAHRGGGDSQVSSTSHSPQLSSPEDEAASH-DAMMRVHAYCNGNGSYAAADVVDPLL  1175

Query  1256  SRSNTPQFFYAEKINAVDWMTISPRILSSSTNDPNEELG-RKPTHSYKIIVDPRMKMSTF  1314
               ++T  FFYA K+  VD +       SSS +  +EE   RKPT +YK++V   M+M  F
Sbjct  1176  LPTSTNHFFYATKVECVDVVGTG----SSSGHQSDEEAQLRKPTRAYKLLVGTHMRMGAF  1231

Query  1315  MRHVESLIGVPSNYFKLQHKYE---VIDLMSTVLFVCMGETLSVELGKVLQPDEDKAKIS  1371
              +H+E LI VP+ +FKLQ K++     +  ++++ +  GETL+VELGK L+PDE KAKI 
Sbjct  1232  KKHIEQLIQVPAAHFKLQRKHDNNLSNNQNNSLVHLIEGETLTVELGKTLEPDEFKAKIH  1291

Query  1372  FMRLSELDNDTGKLPCICEWVCKASMTVAEAKKELIAKLHRIDVKYKTLNPNNCRLWLKG  1431
             F+RL+++DN+T KLPC+CEWV  A+ T  +AKKEL+AKLHRID KY TL+  NCR+WLKG
Sbjct  1292  FLRLADIDNETSKLPCVCEWVYNANTTAEQAKKELVAKLHRIDAKYATLSVQNCRIWLKG  1351

Query  1432  GRNPIEIMGDDETLGTDLRSMTGAEFLVQECEAGVSPQVPADSLTIFVRRWHADKLQLDK  1491
             GR PI+I+ DDETL  D+RS   AEF+VQECE  V PQ   DSLT+FVRRW   KL+  K
Sbjct  1352  GRIPIKILSDDETLYCDMRSSIAAEFIVQECEEEVDPQPKDDSLTLFVRRWCPAKLEFGK  1411

Query  1492  FQEVTLEKESEIRSELAKITDIPQEHIAYSKINGSFPCTNISLLSINSTLSWFSIPATLN  1551
             FQE+TL+++SEIR  L++I+DIP + ++Y K+N +FPCT+IS LS+N + SW+S+P TL+
Sbjct  1412  FQEITLDQDSEIRLSLSQISDIPIDKLSYMKLNSNFPCTSISALSVNESSSWYSVPTTLD  1471

Query  1552  KYPLTSTVSGNVYFYKDVTKAPKEPTTEERRELGTREKLRLDRLGCMSTSLYSPRRERAL  1611
             KYPL ST +GN+Y YKD T   +E T EERR +  REK RLDR+GC+ST+ Y+ RRERAL
Sbjct  1472  KYPLNSTQTGNIYLYKDRTVPARELTLEERRLMNAREKARLDRVGCVSTTRYAQRRERAL  1531

Query  1612  KIYLDSPQSNNN  1623
             KIYLDSP+ ++N
Sbjct  1532  KIYLDSPEKSSN  1543


 Score = 117 bits (294),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 73/183 (40%), Positives = 105/183 (57%), Gaps = 8/183 (4%)

Query  7    EKSTQCVV--HDLTPGSEQKKINIVVRSQYTIEKVFRNISTQYPYEAYDLLLQPNGTESP  64
            ++S QC V   D TPGSEQKKIN+VVRS +T+++V   I TQ+ YE ++LLLQP+  +  
Sbjct  4    KESEQCTVSVFDQTPGSEQKKINVVVRSHFTVKRVIDLIGTQFSYEKFELLLQPHDNKD-  62

Query  65   LLHLNARKNELLFAAPGFSAQEKNVLVLLPPDVWDGDVQKRFDFTKTLSKKKCISKSNG-  123
            L++LNA +++L++   GF  Q KN L+LLP   WDGDV KRF+        K + KS+G 
Sbjct  63   LVNLNALESQLMYEVAGFEPQLKNHLILLPSGSWDGDVTKRFELPIKRVVVKKVMKSDGE  122

Query  124  ---STGTTSPKKSTIKTTKTVKATSADKAVNAVKASSTDK-ASNAIKDSSTVEASSAVKA  179
               S  T   KK  +      K  S   + +  K +S D  A  +I   S+ E +S +K 
Sbjct  123  KAKSPATGEKKKRVVGEKTKKKPASGSSSPSKAKTTSEDSLAKTSISSESSPEKTSKIKT  182

Query  180  SNA  182
            + A
Sbjct  183  TAA  185


>Q22240_CAEEL unnamed protein product
Length=1326

 Score = 413 bits (1061),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 228/464 (49%), Positives = 290/464 (63%), Gaps = 54/464 (12%)

Query  427  YVGLVNQAMTCYLNSLLQALFMTPEFRNALYRWEF---------DNDNEAKNIPYQLQKL  477
            YVGLVNQAMTCYLNSL+Q+L+MTPEFRNA+Y WE+               ++IP QLQKL
Sbjct  87   YVGLVNQAMTCYLNSLVQSLYMTPEFRNAMYDWEYVQQPAHIKEQRKKAEQSIPCQLQKL  146

Query  478  FLNLQTSKKSAVETTDLTRSFGWDSTEAWQQHDIQELCRVMFDALEHKFKNTKQMNLIAS  537
            FL LQTS+  ++ET DLT+SFGW S EA+ QHD+QELCR+MFDALEHK+K T+   LI  
Sbjct  147  FLLLQTSENDSLETKDLTQSFGWTSNEAYDQHDVQELCRLMFDALEHKWKGTEHEKLIQD  206

Query  538  LYEGKMLDYVKCLECNTEKTRADTFLDIPLPVRPFGSTVAYGSIEEALRAFVQPETLDGN  597
            LY G M D+V CL+C  E  + D FLD+PL V+PFG+  AY S+EEAL AFVQPE LDG+
Sbjct  207  LYRGTMEDFVACLKCGRESVKTDYFLDLPLAVKPFGAIHAYKSVEEALTAFVQPELLDGS  266

Query  598  NQYFCEKCNKKCDAHKGLKFKNFPYILTLHLKRFDFDYQTMHRIKLNDKVTFPEMLNLNS  657
            NQY CE C  K DAHKGL+   FPY+LT+ LKRFDFDY TMHRIKLNDK+TFP++L+LN 
Sbjct  267  NQYMCENCKSKQDAHKGLRITQFPYLLTIQLKRFDFDYNTMHRIKLNDKMTFPDVLDLND  326

Query  658  FISTADLESPVPSTSTSAATANTIPGNIATNGFIPNVATSTNDDCSTTDSGSAMEEDLCC  717
            +++           ST+++    I  N + N           DD    + GS      C 
Sbjct  327  YVNKE-------KRSTTSSAWQQIGKNKSEN---------EEDD---MELGSP-NPKRCT  366

Query  718  SGTATTASSSQHENDMNDDDEGIDMSTSTDHRINSSNASVEQRIKHDNGPYLYELFAIMI  777
             G  +       EN        + +    DH      A+V+  +K  +G  +YELF++M+
Sbjct  367  PGVQSPNRYQGSEN--------VCVGQPIDH------AAVDDIVK-TSGDNVYELFSVMV  411

Query  778  HSGSASGGHYYAYIKEFDNNGWYCFNDQSVSPITEEDIEKSFGGGSSRAYYSSVYSSSTN  837
            HSG+A+GGHY+AYIK  D + WY FND  V   T  +IEKSFGG     + S    S+TN
Sbjct  412  HSGNAAGGHYFAYIKNLDQDRWYVFNDTRVDFATPLEIEKSFGG-----HPSGWNQSNTN  466

Query  838  AYMLMYRQIDAQRNERATKSTDFPEHINQLLPKLHQEEETRVPR  881
            AYMLMYR+ID +RN R   S   P+HI     K  QE+  R+ R
Sbjct  467  AYMLMYRRIDPKRNARFILSNQLPQHI-----KDSQEKWKRLER  505


>UBP7_DROME unnamed protein product
Length=1129

 Score = 177 bits (450),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 96/238 (40%), Positives = 143/238 (60%), Gaps = 8/238 (3%)

Query  426  GYVGLVNQAMTCYLNSLLQALFMTPEFRNALYRWEFDNDNEAKNIPYQLQKLFLNLQTSK  485
            GYVGL NQ  TCY+NSLLQ L+ T   R ++YR   + D+ +K++   LQ++F  LQ   
Sbjct  239  GYVGLKNQGATCYMNSLLQTLYFTNSLRLSVYRIPTEADDSSKSVGLSLQRVFHELQFGD  298

Query  486  KSAVETTDLTRSFGWDSTEAWQQHDIQELCRVMFDALEHKFKNTKQMNLIASLYEGKMLD  545
            +  V T  LT+SFGW++ +++ QHD+QE  RV+ D LE K K T     I  L+EGKM  
Sbjct  299  R-PVGTKKLTKSFGWETLDSFMQHDVQEFLRVLLDKLESKMKGTILEGTIPGLFEGKMSS  357

Query  546  YVKCLECNTEKTRADTFLDIPLPVRPFGSTVAYGSIEEALRAFVQPETLDGNNQYFCEKC  605
            Y+KC   +   TR +TF DI L ++         +I E+ + +V PETL+G+N+Y     
Sbjct  358  YIKCKNVDYNSTRYETFYDIQLNIK------DKKNIYESFQDYVAPETLEGDNKYDA-GV  410

Query  606  NKKCDAHKGLKFKNFPYILTLHLKRFDFDYQTMHRIKLNDKVTFPEMLNLNSFISTAD  663
            +   +A KG+ F +FP +L LHL RF +D  T   IK ND+  F E +NL+ +++ ++
Sbjct  411  HGLQEASKGVIFTSFPPVLHLHLMRFQYDPVTDSSIKYNDRFEFYEHINLDRYLAESE  468


 Score = 57.8 bits (138),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 47/83 (57%), Gaps = 5/83 (6%)

Query  770  YELFAIMIHSGSASGGHYYAYIKEFDNNGWYCFNDQSVSPI-TEEDIEKSFGGGSSRAYY  828
            Y L A+++HSG   GGHY  +I    +  W+ F+D  VS    +E IE+++GG       
Sbjct  474  YVLHAVLVHSGDNHGGHYVVFINPKADGRWFKFDDDVVSSCRKQEAIEQNYGGMDDEI--  531

Query  829  SSVYSSSTNAYMLMY-RQIDAQR  850
             S ++  +NAYML+Y RQ +  R
Sbjct  532  -SFHAKCSNAYMLVYIRQSELDR  553



Lambda      K        H
   0.311    0.122    0.353 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3194608626


Query= XP_014085114.1 PREDICTED: ubiquitin carboxyl-terminal hydrolase 64E
[Bactrocera oleae]

Length=1643
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

UBPE_DROME  unnamed protein product                                   1452    0.0   
Q22240_CAEEL  unnamed protein product                                 413     1e-120
UBP7_DROME  unnamed protein product                                   177     1e-44 


>UBPE_DROME unnamed protein product
Length=1556

 Score = 1452 bits (3759),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 769/1332 (58%), Positives = 937/1332 (70%), Gaps = 111/1332 (8%)

Query  327   LSDPELLSDDDLALGASASPTETEP---FG---GDGLLKLRNTSPRSPKYGPLTEGETYQ  380
             +SD E LSDDDLALGASASPT   P   +G   GD  ++           G  T+  TY 
Sbjct  288   ISDAEQLSDDDLALGASASPTMLGPGYDYGAPTGDSDVEGVTGVTDPSTIG--TDDGTYP  345

Query  381   QMTLERDFTRLGKKLQPISASAVINTTAATGGSTMSTMSSGSS------ANGYVGLVNQA  434
              ++   +F R       + A   +NTT A   S+ +T +   +        GYVGLVNQA
Sbjct  346   ALS---NFYRRKYGGDELRAWQRVNTTGADFVSSATTETEAEARQASLGPRGYVGLVNQA  402

Query  435   MTCYLNSLLQALFMTPEFRNALYRWEFDNDNEAKNIPYQLQKLFLNLQTSKKSAVETTDL  494
             MTCYLNSLLQALFMTPEFRNALYRWEFDNDNEAKNIPYQLQKLFLNLQTS K+AVETTDL
Sbjct  403   MTCYLNSLLQALFMTPEFRNALYRWEFDNDNEAKNIPYQLQKLFLNLQTSPKAAVETTDL  462

Query  495   TRSFGWDSTEAWQQHDIQELCRVMFDALEHKFKNTKQMNLIASLYEGKMLDYVKCLECNT  554
             TRSFGWDSTEAWQQHDIQELCRVMFDALEHKFKNTKQ NLI++LYEGKM DYVKCLECNT
Sbjct  463   TRSFGWDSTEAWQQHDIQELCRVMFDALEHKFKNTKQANLISNLYEGKMNDYVKCLECNT  522

Query  555   EKTRADTFLDIPLPVRPFGSTVAYGSIEEALRAFVQPETLDGNNQYFCEKCNKKCDAHKG  614
             EKTR DTFLDIPLPVRPFGS+ AYGSIEEALRAFVQPETLDGNNQY CEKC KKCDAHKG
Sbjct  523   EKTREDTFLDIPLPVRPFGSSSAYGSIEEALRAFVQPETLDGNNQYLCEKCKKKCDAHKG  582

Query  615   LKFKNFPYILTLHLKRFDFDYQTMHRIKLNDKVTFPEMLNLNSFISTADLESPVPSTSTS  674
             L FK+FPYILTLHLKRFDFDYQTMHRIKLND+VTFP+ LNLN+FI+              
Sbjct  583   LHFKSFPYILTLHLKRFDFDYQTMHRIKLNDRVTFPQTLNLNTFINR-------------  629

Query  675   AATANTIPGNIATNGFIPNVATSTNDDCSTTDSGSAMEEDLCCSGTATTASSSQHENDMN  734
               + N+   N   NG        T DDCST DSGSAME+D   SG  TTASSSQHEND+N
Sbjct  630   --SGNSGEQNSQLNG--------TVDDCSTADSGSAMEDDNLSSGVVTTASSSQHENDLN  679

Query  735   DDDEGIDMSTSTDHRINSSNASVEQRIKHDNGPYLYELFAIMIHSGSASGGHYYAYIKEF  794
             D+DEGIDMS+ST            +  K  +GPYLYELFAIMIHSGSASGGHYYAYIK+F
Sbjct  680   DEDEGIDMSSST-----------SKSAKQGSGPYLYELFAIMIHSGSASGGHYYAYIKDF  728

Query  795   DNNGWYCFNDQSVSPITEEDIEKSFGGGSSRAYYSSVYSSSTNAYMLMYRQIDAQRNERA  854
             DNN W+CFNDQ+V+ IT+EDI++SFGG +    YSS Y+SSTNAYMLMYRQ+DA+RNE  
Sbjct  729   DNNEWFCFNDQNVTSITQEDIQRSFGGPNGSY-YSSAYTSSTNAYMLMYRQVDAKRNELV  787

Query  855   TKSTDFPEHINQLLPKLHQEEETRVPRSTGRHGVVVSDLSVQELIKPRVSFYNPELKKIK  914
              K  DFPEHI  LLPKLH EEETRV R  GRH + V+DL++ +L KPRV FYNP LKK+K
Sbjct  788   AKVADFPEHIKTLLPKLHSEEETRVSR-LGRH-ITVTDLALPDLYKPRVYFYNPSLKKMK  845

Query  915   FTRAYVS-SFHIKSVLESAYQLLNVEKFAPLSRCRLVVYNDMGEQICQSLEHISDPTLSE  973
              TR YVS SF+I  VL SAY++LNVE+FAPLSRCRLV YN   + I QSLE  +DP L+E
Sbjct  846   ITRVYVSQSFNINLVLMSAYEMLNVEQFAPLSRCRLVAYNSSMDTIIQSLESCTDPALTE  905

Query  974   LRQQTDGPLEFLLETREEGQEFEVYKPGGVTWNVYIVNVAKMQLDGPHLVY--APSKEAN  1031
             LR   +  L+FLLE R E QEFEVY P G+TW V+ V+++ M +DGP LVY  A  +EA+
Sbjct  906   LRAAQNYSLDFLLEYRAEDQEFEVYPPNGITWYVFKVDLSTMAMDGPFLVYSAAREREAS  965

Query  1032  AALLHSIAVRLNLNENQLLLATVKT---DAFVALDTASSENDTAEGMQRQVITQEDLQEI  1088
               L  SIA+RL+++E Q LLATV+     AFV+ D     + T E +Q        LQ +
Sbjct  966   DVLRRSIALRLHISEQQFLLATVRATVPKAFVSYDP----HPTPEALQH-------LQNM  1014

Query  1089  AQEQFRGLTYIYLNVPNTDASTLEILDIPALETPTIEVSADVVDAVQMNANVLHTLSPSN  1148
             A  QF+ +TY YLNVPNTDA+TLE+L +P +E+       DVVDA  MN      +S SN
Sbjct  1015  ANTQFKSITYFYLNVPNTDAATLEMLGVPTVESVECASGGDVVDAAMMNGVAPGHMSSSN  1074

Query  1149  S--------DCTSNLSQKSCARESPLLPATAAAAGTTTLAGQESHSEDSSLSDGDRTLVE  1200
                      D    +SQ S +                   G ES+SEDSSLSDGDRTLVE
Sbjct  1075  DYDWRRYKRDLVEPMSQPSPSH------------------GHESNSEDSSLSDGDRTLVE  1116

Query  1201  S--LHNRYGGDSQISSTNHSPYLSSPEDDAYNKANSLKRIHDLFQMAPDHTMETAS---M  1255
             +  + +R GGDSQ+SST+HSP LSSPED+A +  +++ R+H        +         +
Sbjct  1117  TDNMAHRGGGDSQVSSTSHSPQLSSPEDEAASH-DAMMRVHAYCNGNGSYAAADVVDPLL  1175

Query  1256  SRSNTPQFFYAEKINAVDWMTISPRILSSSTNDPNEELG-RKPTHSYKIIVDPRMKMSTF  1314
               ++T  FFYA K+  VD +       SSS +  +EE   RKPT +YK++V   M+M  F
Sbjct  1176  LPTSTNHFFYATKVECVDVVGTG----SSSGHQSDEEAQLRKPTRAYKLLVGTHMRMGAF  1231

Query  1315  MRHVESLIGVPSNYFKLQHKYE---VIDLMSTVLFVCMGETLSVELGKVLQPDEDKAKIS  1371
              +H+E LI VP+ +FKLQ K++     +  ++++ +  GETL+VELGK L+PDE KAKI 
Sbjct  1232  KKHIEQLIQVPAAHFKLQRKHDNNLSNNQNNSLVHLIEGETLTVELGKTLEPDEFKAKIH  1291

Query  1372  FMRLSELDNDTGKLPCICEWVCKASMTVAEAKKELIAKLHRIDVKYKTLNPNNCRLWLKG  1431
             F+RL+++DN+T KLPC+CEWV  A+ T  +AKKEL+AKLHRID KY TL+  NCR+WLKG
Sbjct  1292  FLRLADIDNETSKLPCVCEWVYNANTTAEQAKKELVAKLHRIDAKYATLSVQNCRIWLKG  1351

Query  1432  GRNPIEIMGDDETLGTDLRSMTGAEFLVQECEAGVSPQVPADSLTIFVRRWHADKLQLDK  1491
             GR PI+I+ DDETL  D+RS   AEF+VQECE  V PQ   DSLT+FVRRW   KL+  K
Sbjct  1352  GRIPIKILSDDETLYCDMRSSIAAEFIVQECEEEVDPQPKDDSLTLFVRRWCPAKLEFGK  1411

Query  1492  FQEVTLEKESEIRSELAKITDIPQEHIAYSKINGSFPCTNISLLSINSTLSWFSIPATLN  1551
             FQE+TL+++SEIR  L++I+DIP + ++Y K+N +FPCT+IS LS+N + SW+S+P TL+
Sbjct  1412  FQEITLDQDSEIRLSLSQISDIPIDKLSYMKLNSNFPCTSISALSVNESSSWYSVPTTLD  1471

Query  1552  KYPLTSTVSGNVYFYKDVTKAPKEPTTEERRELGTREKLRLDRLGCMSTSLYSPRRERAL  1611
             KYPL ST +GN+Y YKD T   +E T EERR +  REK RLDR+GC+ST+ Y+ RRERAL
Sbjct  1472  KYPLNSTQTGNIYLYKDRTVPARELTLEERRLMNAREKARLDRVGCVSTTRYAQRRERAL  1531

Query  1612  KIYLDSPQSNNN  1623
             KIYLDSP+ ++N
Sbjct  1532  KIYLDSPEKSSN  1543


 Score = 117 bits (294),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 73/183 (40%), Positives = 105/183 (57%), Gaps = 8/183 (4%)

Query  7    EKSTQCVV--HDLTPGSEQKKINIVVRSQYTIEKVFRNISTQYPYEAYDLLLQPNGTESP  64
            ++S QC V   D TPGSEQKKIN+VVRS +T+++V   I TQ+ YE ++LLLQP+  +  
Sbjct  4    KESEQCTVSVFDQTPGSEQKKINVVVRSHFTVKRVIDLIGTQFSYEKFELLLQPHDNKD-  62

Query  65   LLHLNARKNELLFAAPGFSAQEKNVLVLLPPDVWDGDVQKRFDFTKTLSKKKCISKSNG-  123
            L++LNA +++L++   GF  Q KN L+LLP   WDGDV KRF+        K + KS+G 
Sbjct  63   LVNLNALESQLMYEVAGFEPQLKNHLILLPSGSWDGDVTKRFELPIKRVVVKKVMKSDGE  122

Query  124  ---STGTTSPKKSTIKTTKTVKATSADKAVNAVKASSTDK-ASNAIKDSSTVEASSAVKA  179
               S  T   KK  +      K  S   + +  K +S D  A  +I   S+ E +S +K 
Sbjct  123  KAKSPATGEKKKRVVGEKTKKKPASGSSSPSKAKTTSEDSLAKTSISSESSPEKTSKIKT  182

Query  180  SNA  182
            + A
Sbjct  183  TAA  185


>Q22240_CAEEL unnamed protein product
Length=1326

 Score = 413 bits (1061),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 228/464 (49%), Positives = 290/464 (63%), Gaps = 54/464 (12%)

Query  427  YVGLVNQAMTCYLNSLLQALFMTPEFRNALYRWEF---------DNDNEAKNIPYQLQKL  477
            YVGLVNQAMTCYLNSL+Q+L+MTPEFRNA+Y WE+               ++IP QLQKL
Sbjct  87   YVGLVNQAMTCYLNSLVQSLYMTPEFRNAMYDWEYVQQPAHIKEQRKKAEQSIPCQLQKL  146

Query  478  FLNLQTSKKSAVETTDLTRSFGWDSTEAWQQHDIQELCRVMFDALEHKFKNTKQMNLIAS  537
            FL LQTS+  ++ET DLT+SFGW S EA+ QHD+QELCR+MFDALEHK+K T+   LI  
Sbjct  147  FLLLQTSENDSLETKDLTQSFGWTSNEAYDQHDVQELCRLMFDALEHKWKGTEHEKLIQD  206

Query  538  LYEGKMLDYVKCLECNTEKTRADTFLDIPLPVRPFGSTVAYGSIEEALRAFVQPETLDGN  597
            LY G M D+V CL+C  E  + D FLD+PL V+PFG+  AY S+EEAL AFVQPE LDG+
Sbjct  207  LYRGTMEDFVACLKCGRESVKTDYFLDLPLAVKPFGAIHAYKSVEEALTAFVQPELLDGS  266

Query  598  NQYFCEKCNKKCDAHKGLKFKNFPYILTLHLKRFDFDYQTMHRIKLNDKVTFPEMLNLNS  657
            NQY CE C  K DAHKGL+   FPY+LT+ LKRFDFDY TMHRIKLNDK+TFP++L+LN 
Sbjct  267  NQYMCENCKSKQDAHKGLRITQFPYLLTIQLKRFDFDYNTMHRIKLNDKMTFPDVLDLND  326

Query  658  FISTADLESPVPSTSTSAATANTIPGNIATNGFIPNVATSTNDDCSTTDSGSAMEEDLCC  717
            +++           ST+++    I  N + N           DD    + GS      C 
Sbjct  327  YVNKE-------KRSTTSSAWQQIGKNKSEN---------EEDD---MELGSP-NPKRCT  366

Query  718  SGTATTASSSQHENDMNDDDEGIDMSTSTDHRINSSNASVEQRIKHDNGPYLYELFAIMI  777
             G  +       EN        + +    DH      A+V+  +K  +G  +YELF++M+
Sbjct  367  PGVQSPNRYQGSEN--------VCVGQPIDH------AAVDDIVK-TSGDNVYELFSVMV  411

Query  778  HSGSASGGHYYAYIKEFDNNGWYCFNDQSVSPITEEDIEKSFGGGSSRAYYSSVYSSSTN  837
            HSG+A+GGHY+AYIK  D + WY FND  V   T  +IEKSFGG     + S    S+TN
Sbjct  412  HSGNAAGGHYFAYIKNLDQDRWYVFNDTRVDFATPLEIEKSFGG-----HPSGWNQSNTN  466

Query  838  AYMLMYRQIDAQRNERATKSTDFPEHINQLLPKLHQEEETRVPR  881
            AYMLMYR+ID +RN R   S   P+HI     K  QE+  R+ R
Sbjct  467  AYMLMYRRIDPKRNARFILSNQLPQHI-----KDSQEKWKRLER  505


>UBP7_DROME unnamed protein product
Length=1129

 Score = 177 bits (450),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 96/238 (40%), Positives = 143/238 (60%), Gaps = 8/238 (3%)

Query  426  GYVGLVNQAMTCYLNSLLQALFMTPEFRNALYRWEFDNDNEAKNIPYQLQKLFLNLQTSK  485
            GYVGL NQ  TCY+NSLLQ L+ T   R ++YR   + D+ +K++   LQ++F  LQ   
Sbjct  239  GYVGLKNQGATCYMNSLLQTLYFTNSLRLSVYRIPTEADDSSKSVGLSLQRVFHELQFGD  298

Query  486  KSAVETTDLTRSFGWDSTEAWQQHDIQELCRVMFDALEHKFKNTKQMNLIASLYEGKMLD  545
            +  V T  LT+SFGW++ +++ QHD+QE  RV+ D LE K K T     I  L+EGKM  
Sbjct  299  R-PVGTKKLTKSFGWETLDSFMQHDVQEFLRVLLDKLESKMKGTILEGTIPGLFEGKMSS  357

Query  546  YVKCLECNTEKTRADTFLDIPLPVRPFGSTVAYGSIEEALRAFVQPETLDGNNQYFCEKC  605
            Y+KC   +   TR +TF DI L ++         +I E+ + +V PETL+G+N+Y     
Sbjct  358  YIKCKNVDYNSTRYETFYDIQLNIK------DKKNIYESFQDYVAPETLEGDNKYDA-GV  410

Query  606  NKKCDAHKGLKFKNFPYILTLHLKRFDFDYQTMHRIKLNDKVTFPEMLNLNSFISTAD  663
            +   +A KG+ F +FP +L LHL RF +D  T   IK ND+  F E +NL+ +++ ++
Sbjct  411  HGLQEASKGVIFTSFPPVLHLHLMRFQYDPVTDSSIKYNDRFEFYEHINLDRYLAESE  468


 Score = 57.8 bits (138),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 47/83 (57%), Gaps = 5/83 (6%)

Query  770  YELFAIMIHSGSASGGHYYAYIKEFDNNGWYCFNDQSVSPI-TEEDIEKSFGGGSSRAYY  828
            Y L A+++HSG   GGHY  +I    +  W+ F+D  VS    +E IE+++GG       
Sbjct  474  YVLHAVLVHSGDNHGGHYVVFINPKADGRWFKFDDDVVSSCRKQEAIEQNYGGMDDEI--  531

Query  829  SSVYSSSTNAYMLMY-RQIDAQR  850
             S ++  +NAYML+Y RQ +  R
Sbjct  532  -SFHAKCSNAYMLVYIRQSELDR  553



Lambda      K        H
   0.311    0.122    0.353 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3194608626


Query= XP_014085115.1 PREDICTED: epidermal growth factor receptor substrate
15 homolog [Bactrocera oleae]

Length=1109
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VP79_DROME  unnamed protein product                                 1499    0.0  
Q6AWN7_DROME  unnamed protein product                                 1498    0.0  
O18363_DROME  unnamed protein product                                 1333    0.0  


>Q9VP79_DROME unnamed protein product
Length=1049

 Score = 1499 bits (3880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 824/1152 (72%), Positives = 893/1152 (78%), Gaps = 146/1152 (13%)

Query  1     MGTKSPGAPQRCRLILQRCLAIQLSKPGHTPEDFWMYDSGYMIFQNFLAANAQCWWNAPL  60
             MGTKSPG PQRCRLILQRCLAIQL+KPGHTPEDFWMYDSGYMIFQNFLAANAQCWWN PL
Sbjct  1     MGTKSPGGPQRCRLILQRCLAIQLTKPGHTPEDFWMYDSGYMIFQNFLAANAQCWWNGPL  60

Query  61    TAATRALKYAGHVAPGMLLVTAEPCALEVLRGAYARSVLKPPATYVISSVGDIDDCIVTP  120
             TAATRALKYAGHVAPGMLLVTAEPCALEVLRGA+ARSVLKPPATYVISSVGDIDDCIVTP
Sbjct  61    TAATRALKYAGHVAPGMLLVTAEPCALEVLRGAFARSVLKPPATYVISSVGDIDDCIVTP  120

Query  121   TVQGQFTPLPEALCDVIMDLTAEGHSATIENVRIKLSIRFPHMTPPATEVIYDTLAQLMQ  180
             TVQGQFTPLPEALCDVIMDLTAEG SATIE+VR KL  RFPHMT PATEVIYD+LAQLMQ
Sbjct  121   TVQGQFTPLPEALCDVIMDLTAEGQSATIEHVRSKLGSRFPHMTTPATEVIYDSLAQLMQ  180

Query  181   EQKIYQTAKGYFIFTPERRRSRSRPR--------AMRNGYQDFEE----TDEIPQEARTM  228
             EQKIYQT+KGYFIFTPERRRSRSRPR        ++  G+   EE     D +PQEARTM
Sbjct  181   EQKIYQTSKGYFIFTPERRRSRSRPRSNHHQLNGSLAYGHLAEEEQQHGDDVVPQEARTM  240

Query  229   LMTNAEALHSLYGEISTERDGDLTHQCIQTNLADVICGGNPNDKILYPRAAKRRSASFPT  288
             LM+N+EALHSLYGEISTERDGDLTHQCIQTNLADVICGGNPNDKI+YPRAAKRRSASFPT
Sbjct  241   LMSNSEALHSLYGEISTERDGDLTHQCIQTNLADVICGGNPNDKIIYPRAAKRRSASFPT  300

Query  289   PRSLERRHSLRLFGSSKRLQRCASTRSLSKTYAQTL-ATDSSSSEYQSTDSSSPKKGSLL  347
             PRSLERRHSLRLFGSSKRLQRCASTRSLSKTYAQTL  TDSSSSEYQSTDSSSPKKGSLL
Sbjct  301   PRSLERRHSLRLFGSSKRLQRCASTRSLSKTYAQTLNTTDSSSSEYQSTDSSSPKKGSLL  360

Query  348   SRLFRRSGRAKQRQIETYSAQFPPAEWFNSRAVHLHSVGTQTADHDMPVAHTLSNSTFYD  407
             SRLFRRSGRAKQRQIETYSAQFPPAEWFN+RAVHLHSVGTQTA+HDMPVAHTLSNSTFYD
Sbjct  361   SRLFRRSGRAKQRQIETYSAQFPPAEWFNTRAVHLHSVGTQTAEHDMPVAHTLSNSTFYD  420

Query  408   GSELSQRSLTLPRRHRRHMSSDSTFLISSRDCSPIRRRSPVYCSSSLPRSTQSIPATASG  467
             GSELSQRS TLPRRHRRHMSS+STFLISSRDCSPIRRRSPVYCSSSLPRSTQSIPAT   
Sbjct  421   GSELSQRSSTLPRRHRRHMSSESTFLISSRDCSPIRRRSPVYCSSSLPRSTQSIPAT---  477

Query  468   TTNITNAPTSAAKTNHSTATLSRLSAPNHTTTASAVTAATVSANAQKSSSKSVIGKHIFE  527
                        AKTNHS    SRLS  +           +V+    K++ KSVIGKHIFE
Sbjct  478   ----------TAKTNHS----SRLSHGH---------GGSVTPTPPKTAQKSVIGKHIFE  514

Query  528   QSPSRTSGTLKAPATKRQSDNIIINGYASNLDSGKVSYRSVQ-SGPSSLESGKASSMLTS  586
              SPSR S TLKA A KR +D +IIN    N    K +YRS+Q SGPSSLES K +SML S
Sbjct  515   SSPSR-SATLKATAAKRHTDGLIINSCLDN----KATYRSLQSSGPSSLESCKTTSMLAS  569

Query  587   GPSSIDSGKVSFS-KTSGHSSLDSQCSTNTAVVQP------SPARSILVLNGSPRGTPRH  639
             GPSSIDSGKVSFS KTSGHSSLDSQCSTNTAV+ P        +RSIL+LNGSPRGTPRH
Sbjct  570   GPSSIDSGKVSFSQKTSGHSSLDSQCSTNTAVIAPPSNSNNGSSRSILLLNGSPRGTPRH  629

Query  640   QAMRARAAE-QTQRQRASTPSRILEEITNQQKPLPGRTTSNTGGQSYYNGIPNSNSNNSI  698
             QAMRAR AE Q QRQRASTPSRI+EEI       P       GG    NG+P SNSNNSI
Sbjct  630   QAMRARVAEAQAQRQRASTPSRIMEEI------YPA------GGS---NGVPTSNSNNSI  674

Query  699   TLQVTTSNGSQSSIPSTKIYVQNSPARSVITLENGKLMENSNVYIINNETTTNEKGEIIK  758
             TLQVTTSNG+Q SIPSTKI+VQNSP RSVITLENGK++ENSNV+IINNET TNEKGEIIK
Sbjct  675   TLQVTTSNGNQ-SIPSTKIFVQNSPVRSVITLENGKMLENSNVFIINNETMTNEKGEIIK  733

Query  759   KTLSKQETAPMRSQQQQKEQQKRNYAQAHAQTHSQTKSMQQQQLQQQQQQQQQSTNIQQI  818
             KTLSKQ +A                A A   T  + +++ +Q L                
Sbjct  734   KTLSKQTSA----------------APAATSTPVKPETVSEQPL----------------  761

Query  819   YKDNSISENEANSETCDSISFISETSPDNLDTLS-STEVIDNSKFTKNINNDATMNNSRK  877
                   SE EANSETCDSISFISE SP++   +   T V D  K+ KN NNDATMNNSRK
Sbjct  762   ------SETEANSETCDSISFISECSPESTCAVEPETPVYDGGKYAKNTNNDATMNNSRK  815

Query  878   LCLQLPQHGSSHIVYKNNVLKNESNPNSPSGEKTLAMAALAAKQDFEIAGSVGNLRFYEK  937
             LCLQL    ++ I YKNNVLKNES PNSPS +  L MAAL AKQDFEIAGSVGNL FYEK
Sbjct  816   LCLQL----ANGIAYKNNVLKNESQPNSPSADAPLKMAAL-AKQDFEIAGSVGNLNFYEK  870

Query  938   NTKDTTHAK----LMNSHCDLKNLNRYESSGNLQKTGNILQSNPAINSDD--LAHILQKN  991
             ++KD   ++    +MNS  DLKNL  YES   LQK         ++N D+  LAH+L K+
Sbjct  871   SSKDVGASQSNNMMMNSSTDLKNLC-YESVCQLQKC--------SMNGDELALAHLLHKS  921

Query  992   IIAVGSEPNLALKDNNCSNASDKSVEKEALDRRFSLSKD--PNGPVSANATGNEDLYNFP  1049
                +GSEPNLALKD     A+DKS++KEA+DRR SL+K+    G  S  A G E+LYNFP
Sbjct  922   SNPLGSEPNLALKD----LANDKSIDKEAIDRRLSLTKESLEQGMGSVLANGGEELYNFP  977

Query  1050  SLTDLSFNFTSLAAQKILQGVSLNSIDTLVELNM------AAAAAANKEKQQNNQP----  1099
             SLTDLSFNFTSLAA+KILQGVSLNSIDTLVELNM      AA A   +EKQQNNQP    
Sbjct  978   SLTDLSFNFTSLAARKILQGVSLNSIDTLVELNMAAAAAAAAVANNAQEKQQNNQPATAG  1037

Query  1100  --TPVCTDYGMV  1109
                 VCTD+GMV
Sbjct  1038  PTASVCTDFGMV  1049


>Q6AWN7_DROME unnamed protein product
Length=1049

 Score = 1498 bits (3877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 823/1152 (71%), Positives = 892/1152 (77%), Gaps = 146/1152 (13%)

Query  1     MGTKSPGAPQRCRLILQRCLAIQLSKPGHTPEDFWMYDSGYMIFQNFLAANAQCWWNAPL  60
             MGTKSPG PQRCRLILQRCLAIQL+KPGH PEDFWMYDSGYMIFQNFLAANAQCWWN PL
Sbjct  1     MGTKSPGGPQRCRLILQRCLAIQLTKPGHKPEDFWMYDSGYMIFQNFLAANAQCWWNGPL  60

Query  61    TAATRALKYAGHVAPGMLLVTAEPCALEVLRGAYARSVLKPPATYVISSVGDIDDCIVTP  120
             TAATRALKYAGHVAPGMLLVTAEPCALEVLRGA+ARSVLKPPATYVISSVGDIDDCIVTP
Sbjct  61    TAATRALKYAGHVAPGMLLVTAEPCALEVLRGAFARSVLKPPATYVISSVGDIDDCIVTP  120

Query  121   TVQGQFTPLPEALCDVIMDLTAEGHSATIENVRIKLSIRFPHMTPPATEVIYDTLAQLMQ  180
             TVQGQFTPLPEALCDVIMDLTAEG SATIE+VR KL  RFPHMT PATEVIYD+LAQLMQ
Sbjct  121   TVQGQFTPLPEALCDVIMDLTAEGQSATIEHVRSKLGSRFPHMTTPATEVIYDSLAQLMQ  180

Query  181   EQKIYQTAKGYFIFTPERRRSRSRPR--------AMRNGYQDFEE----TDEIPQEARTM  228
             EQKIYQT+KGYFIFTPERRRSRSRPR        ++  G+   EE     D +PQEARTM
Sbjct  181   EQKIYQTSKGYFIFTPERRRSRSRPRSNHHQLNGSLAYGHLAEEEQQHGDDVVPQEARTM  240

Query  229   LMTNAEALHSLYGEISTERDGDLTHQCIQTNLADVICGGNPNDKILYPRAAKRRSASFPT  288
             LM+N+EALHSLYGEISTERDGDLTHQCIQTNLADVICGGNPNDKI+YPRAAKRRSASFPT
Sbjct  241   LMSNSEALHSLYGEISTERDGDLTHQCIQTNLADVICGGNPNDKIIYPRAAKRRSASFPT  300

Query  289   PRSLERRHSLRLFGSSKRLQRCASTRSLSKTYAQTL-ATDSSSSEYQSTDSSSPKKGSLL  347
             PRSLERRHSLRLFGSSKRLQRCASTRSLSKTYAQTL  TDSSSSEYQSTDSSSPKKGSLL
Sbjct  301   PRSLERRHSLRLFGSSKRLQRCASTRSLSKTYAQTLNTTDSSSSEYQSTDSSSPKKGSLL  360

Query  348   SRLFRRSGRAKQRQIETYSAQFPPAEWFNSRAVHLHSVGTQTADHDMPVAHTLSNSTFYD  407
             SRLFRRSGRAKQRQIETYSAQFPPAEWFN+RAVHLHSVGTQTA+HDMPVAHTLSNSTFYD
Sbjct  361   SRLFRRSGRAKQRQIETYSAQFPPAEWFNTRAVHLHSVGTQTAEHDMPVAHTLSNSTFYD  420

Query  408   GSELSQRSLTLPRRHRRHMSSDSTFLISSRDCSPIRRRSPVYCSSSLPRSTQSIPATASG  467
             GSELSQRS TLPRRHRRHMSS+STFLISSRDCSPIRRRSPVYCSSSLPRSTQSIPAT   
Sbjct  421   GSELSQRSSTLPRRHRRHMSSESTFLISSRDCSPIRRRSPVYCSSSLPRSTQSIPAT---  477

Query  468   TTNITNAPTSAAKTNHSTATLSRLSAPNHTTTASAVTAATVSANAQKSSSKSVIGKHIFE  527
                        AKTNHS    SRLS  +           +V+    K++ KSVIGKHIFE
Sbjct  478   ----------TAKTNHS----SRLSHGH---------GGSVTPTPPKTAQKSVIGKHIFE  514

Query  528   QSPSRTSGTLKAPATKRQSDNIIINGYASNLDSGKVSYRSVQ-SGPSSLESGKASSMLTS  586
              SPSR S TLKA A KR +D +IIN    N    K +YRS+Q SGPSSLES K +SML S
Sbjct  515   SSPSR-SATLKATAAKRHTDGLIINSCLDN----KATYRSLQSSGPSSLESCKTTSMLAS  569

Query  587   GPSSIDSGKVSFS-KTSGHSSLDSQCSTNTAVVQP------SPARSILVLNGSPRGTPRH  639
             GPSSIDSGKVSFS KTSGHSSLDSQCSTNTAV+ P        +RSIL+LNGSPRGTPRH
Sbjct  570   GPSSIDSGKVSFSQKTSGHSSLDSQCSTNTAVIAPPSNSNNGSSRSILLLNGSPRGTPRH  629

Query  640   QAMRARAAE-QTQRQRASTPSRILEEITNQQKPLPGRTTSNTGGQSYYNGIPNSNSNNSI  698
             QAMRAR AE Q QRQRASTPSRI+EEI       P       GG    NG+P SNSNNSI
Sbjct  630   QAMRARVAEAQAQRQRASTPSRIMEEI------YPA------GGS---NGVPTSNSNNSI  674

Query  699   TLQVTTSNGSQSSIPSTKIYVQNSPARSVITLENGKLMENSNVYIINNETTTNEKGEIIK  758
             TLQVTTSNG+Q SIPSTKI+VQNSP RSVITLENGK++ENSNV+IINNET TNEKGEIIK
Sbjct  675   TLQVTTSNGNQ-SIPSTKIFVQNSPVRSVITLENGKMLENSNVFIINNETMTNEKGEIIK  733

Query  759   KTLSKQETAPMRSQQQQKEQQKRNYAQAHAQTHSQTKSMQQQQLQQQQQQQQQSTNIQQI  818
             KTLSKQ +A                A A   T  + +++ +Q L                
Sbjct  734   KTLSKQTSA----------------APAATSTPVKPETVSEQPL----------------  761

Query  819   YKDNSISENEANSETCDSISFISETSPDNLDTLS-STEVIDNSKFTKNINNDATMNNSRK  877
                   SE EANSETCDSISFISE SP++   +   T V D  K+ KN NNDATMNNSRK
Sbjct  762   ------SETEANSETCDSISFISECSPESTCAVEPETPVYDGGKYAKNTNNDATMNNSRK  815

Query  878   LCLQLPQHGSSHIVYKNNVLKNESNPNSPSGEKTLAMAALAAKQDFEIAGSVGNLRFYEK  937
             LCLQL    ++ I YKNNVLKNES PNSPS +  L MAAL AKQDFEIAGSVGNL FYEK
Sbjct  816   LCLQL----ANGIAYKNNVLKNESQPNSPSADAPLKMAAL-AKQDFEIAGSVGNLNFYEK  870

Query  938   NTKDTTHAK----LMNSHCDLKNLNRYESSGNLQKTGNILQSNPAINSDD--LAHILQKN  991
             ++KD   ++    +MNS  DLKNL  YES   LQK         ++N D+  LAH+L K+
Sbjct  871   SSKDVGASQSNNMMMNSSTDLKNLC-YESVCQLQKC--------SMNGDELALAHLLHKS  921

Query  992   IIAVGSEPNLALKDNNCSNASDKSVEKEALDRRFSLSKD--PNGPVSANATGNEDLYNFP  1049
                +GSEPNLALKD     A+DKS++KEA+DRR SL+K+    G  S  A G E+LYNFP
Sbjct  922   SSPLGSEPNLALKD----LANDKSIDKEAIDRRLSLTKESLEQGMGSVLANGGEELYNFP  977

Query  1050  SLTDLSFNFTSLAAQKILQGVSLNSIDTLVELNM------AAAAAANKEKQQNNQP----  1099
             SLTDLSFNFTSLAA+KILQGVSLNSIDTLVELNM      AA A   +EKQQNNQP    
Sbjct  978   SLTDLSFNFTSLAARKILQGVSLNSIDTLVELNMAAAAAAAAVANNAQEKQQNNQPATAG  1037

Query  1100  --TPVCTDYGMV  1109
                 VCTD+GMV
Sbjct  1038  PTASVCTDFGMV  1049


>O18363_DROME unnamed protein product
Length=882

 Score = 1333 bits (3449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 718/960 (75%), Positives = 767/960 (80%), Gaps = 113/960 (12%)

Query  1    MGTKSPGAPQRCRLILQRCLAIQLSKPGHTPEDFWMYDSGYMIFQNFLAANAQCWWNAPL  60
            MGTKSPG PQRCRLILQRCLAIQL KPGHTPEDFWMYDSGYMIFQNFLAANAQCWWN PL
Sbjct  1    MGTKSPGGPQRCRLILQRCLAIQLIKPGHTPEDFWMYDSGYMIFQNFLAANAQCWWNGPL  60

Query  61   TAATRALKYAGHVAPGMLLVTAEPCALEVLRGAYARSVLKPPATYVISSVGDIDDCIVTP  120
            TAATRALKYAGHVAPGMLLVTAEPCALEVLRGA+ARSVLKPPATYVISSVGDIDDCIVTP
Sbjct  61   TAATRALKYAGHVAPGMLLVTAEPCALEVLRGAFARSVLKPPATYVISSVGDIDDCIVTP  120

Query  121  TVQGQFTPLPEALCDVIMDLTAEGHSATIENVRIKLSIRFPHMTPPATEVIYDTLAQLMQ  180
            TVQGQFTPLPEALCDVIMDLTAEG SATIE+VR KL  RFPHMT PATEVIYD+LAQLMQ
Sbjct  121  TVQGQFTPLPEALCDVIMDLTAEGQSATIEHVRSKLGSRFPHMTTPATEVIYDSLAQLMQ  180

Query  181  EQKIYQTAKGYFIFTPERRRSRSRPR--------AMRNGYQDFEE----TDEIPQEARTM  228
            EQKIYQT+KGYFIFTPERRRSRSRPR        ++  G+   EE     D +PQEARTM
Sbjct  181  EQKIYQTSKGYFIFTPERRRSRSRPRSNHHQLNGSLAYGHLAEEEQQHGDDVVPQEARTM  240

Query  229  LMTNAEALHSLYGEISTERDGDLTHQCIQTNLADVICGGNPNDKILYPRAAKRRSASFPT  288
            LM+N+EALHSLYGEISTERDGDLTHQCIQTNLADVICGGNPNDKI+YPRAAKRRSASFPT
Sbjct  241  LMSNSEALHSLYGEISTERDGDLTHQCIQTNLADVICGGNPNDKIIYPRAAKRRSASFPT  300

Query  289  PRSLERRHSLRLFGSSKRLQRCASTRSLSKTYAQTL-ATDSSSSEYQSTDSSSPKKGSLL  347
            PRSLERRHSLRLFGSSKRLQRCASTRSLSKTYAQTL  TDSSSSEYQSTDSSSPKKGSLL
Sbjct  301  PRSLERRHSLRLFGSSKRLQRCASTRSLSKTYAQTLNTTDSSSSEYQSTDSSSPKKGSLL  360

Query  348  SRLFRRSGRAKQRQIETYSAQFPPAEWFNSRAVHLHSVGTQTADHDMPVAHTLSNSTFYD  407
            SRLFRRSGRAKQRQIETYSAQFPPAEWFN+RAVHLHSVGTQTA+HDMPVAHTLSNSTFYD
Sbjct  361  SRLFRRSGRAKQRQIETYSAQFPPAEWFNTRAVHLHSVGTQTAEHDMPVAHTLSNSTFYD  420

Query  408  GSELSQRSLTLPRRHRRHMSSDSTFLISSRDCSPIRRRSPVYCSSSLPRSTQSIPATASG  467
            GSELSQRS TLPRRHRRHMSS+STFLISSRDCSPIRRRSPVYCSSSLPRSTQSIPAT   
Sbjct  421  GSELSQRSSTLPRRHRRHMSSESTFLISSRDCSPIRRRSPVYCSSSLPRSTQSIPAT---  477

Query  468  TTNITNAPTSAAKTNHSTATLSRLSAPNHTTTASAVTAATVSANAQKSSSKSVIGKHIFE  527
                       AKTNHS    SRLS  +           +V+    K++ KSVIGKHIFE
Sbjct  478  ----------TAKTNHS----SRLSHGH---------GGSVTPTPPKTAQKSVIGKHIFE  514

Query  528  QSPSRTSGTLKAPATKRQSDNIIINGYASNLDSGKVSYRSVQ-SGPSSLESGKASSMLTS  586
             SPSR S TLKA A KR +D +IIN   S LD+ K +YRS+Q SGPSSLES K +SML S
Sbjct  515  SSPSR-SATLKATAAKRHTDGLIIN---SCLDN-KATYRSLQSSGPSSLESCKTTSMLAS  569

Query  587  GPSSIDSGKVSFS-KTSGHSSLDSQCSTNTAVVQP------SPARSILVLNGSPRGTPRH  639
            GPSSIDSGKVSFS KTSGHSSLDSQCSTNTAV+ P        +RSIL+LNGSPRGTPRH
Sbjct  570  GPSSIDSGKVSFSQKTSGHSSLDSQCSTNTAVIAPPSNSNNGSSRSILLLNGSPRGTPRH  629

Query  640  QAMRARAAE-QTQRQRASTPSRILEEITNQQKPLPGRTTSNTGGQSYYNGIPNSNSNNSI  698
            QAMRAR AE Q QRQRASTPSRI+EEI       P       GG    NG+P SNSNNSI
Sbjct  630  QAMRARVAEAQAQRQRASTPSRIMEEI------YPA------GGS---NGVPTSNSNNSI  674

Query  699  TLQVTTSNGSQSSIPSTKIYVQNSPARSVITLENGKLMENSNVYIINNETTTNEKGEIIK  758
            TLQVTTSNG+Q SIPSTKI+VQNSP RSVITLENGK++ENSNV+IINNET TNEKGEIIK
Sbjct  675  TLQVTTSNGNQ-SIPSTKIFVQNSPVRSVITLENGKMLENSNVFIINNETMTNEKGEIIK  733

Query  759  KTLSKQETAPMRSQQQQKEQQKRNYAQAHAQTHSQTKSMQQQQLQQQQQQQQQSTNIQQI  818
            KTLSKQ +A                A A   T  + +++ +Q L                
Sbjct  734  KTLSKQTSA----------------APAATSTPVKPETVSEQPL----------------  761

Query  819  YKDNSISENEANSETCDSISFISETSPDNLDTLS-STEVIDNSKFTKNINNDATMNNSRK  877
                  SE EANSETCDSISFISE SP++   +   T V D  K+ KN NNDATMNNSRK
Sbjct  762  ------SETEANSETCDSISFISECSPESTCAVEPETPVYDGGKYAKNTNNDATMNNSRK  815

Query  878  LCLQLPQHGSSHIVYKNNVLKNESNPNSPSGEKTLAMAALAAKQDFEIAGSVGNLRFYEK  937
            LCLQL    ++ I YKNNVLKNES PNSPS +  L MAAL AKQDFEIAGSVGNL FYE+
Sbjct  816  LCLQL----ANGIAYKNNVLKNESQPNSPSADAPLKMAAL-AKQDFEIAGSVGNLNFYER  870



Lambda      K        H
   0.311    0.122    0.353 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3194608626


Query= XP_014085116.1 PREDICTED: dolichyl-diphosphooligosaccharide--protein
glycosyltransferase subunit 4 isoform X1 [Bactrocera oleae]

Length=40
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q3HKQ1_DROME  unnamed protein product                                 26.6    0.48 
O18033_CAEEL  unnamed protein product                                 24.6    2.6  
A5JYX8_CAEEL  unnamed protein product                                 24.6    2.6  


>Q3HKQ1_DROME unnamed protein product
Length=106

 Score = 26.6 bits (57),  Expect = 0.48, Method: Compositional matrix adjust.
 Identities = 10/23 (43%), Positives = 17/23 (74%), Gaps = 0/23 (0%)

Query  1   MISDVQLAIFSNVLGVFLFLLVV  23
           M S+VQL +F N++ +F F+ +V
Sbjct  76  MNSEVQLPLFQNIIKIFKFIWLV  98


>O18033_CAEEL unnamed protein product
Length=557

 Score = 24.6 bits (52),  Expect = 2.6, Method: Composition-based stats.
 Identities = 11/35 (31%), Positives = 21/35 (60%), Gaps = 0/35 (0%)

Query  5    VQLAIFSNVLGVFLFLLVVAYHYISANSNKSIAKT  39
            V+ A+F  V+   +F  + A++YI+ +S  +I  T
Sbjct  514  VKPAVFELVIAAGVFTYLSAFYYIATHSQNTIEGT  548


>A5JYX8_CAEEL unnamed protein product
Length=563

 Score = 24.6 bits (52),  Expect = 2.6, Method: Composition-based stats.
 Identities = 11/35 (31%), Positives = 21/35 (60%), Gaps = 0/35 (0%)

Query  5    VQLAIFSNVLGVFLFLLVVAYHYISANSNKSIAKT  39
            V+ A+F  V+   +F  + A++YI+ +S  +I  T
Sbjct  520  VKPAVFELVIAAGVFTYLSAFYYIATHSQNTIEGT  554



Lambda      K        H
   0.311    0.122    0.353 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3194608626


Query= XP_014085117.1 PREDICTED: uncharacterized protein LOC106614105
[Bactrocera oleae]

Length=613
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9GRG8_9TRYP  unnamed protein product                                 33.1    0.28 
Q38AZ9_TRYB2  unnamed protein product                                 31.6    0.97 
Q57ZI4_TRYB2  unnamed protein product                                 30.4    5.4  


>Q9GRG8_9TRYP unnamed protein product
Length=140

 Score = 33.1 bits (74),  Expect = 0.28, Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 43/121 (36%), Gaps = 11/121 (9%)

Query  309  NVSRYAPNATYNVPRSAPNATYNIPSCPANTTYNVPRSAPNATYNIPSCPANTTYNVQRC  368
            ++SR  PNA          + YN          ++ R  PNA          + YN  R 
Sbjct  21   HMSRECPNARSGGNMGGGRSCYNC-----GQPDHISRDCPNARTGGNMGGGRSCYNCGR-  74

Query  369  APNATYNVSRPTPNATFNVPRCALNATYNVPQARTATRAACPNATFNVSRGGNRTFNTTM  428
                  ++SR  PNA          A Y+  Q     R  CPNA  + + GG   FN   
Sbjct  75   ----PGHISRDCPNARSGGNMGGGRACYHCQQEGHIARE-CPNAPLDAAAGGRACFNCGQ  129

Query  429  P  429
            P
Sbjct  130  P  130


>Q38AZ9_TRYB2 unnamed protein product
Length=140

 Score = 31.6 bits (70),  Expect = 0.97, Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 43/121 (36%), Gaps = 11/121 (9%)

Query  309  NVSRYAPNATYNVPRSAPNATYNIPSCPANTTYNVPRSAPNATYNIPSCPANTTYNVQRC  368
            ++SR  PNA          + YN          ++ R  PNA          + YN  R 
Sbjct  21   HMSRECPNARSGGNMGGGRSCYNC-----GQPDHISRDCPNARTGGNMGGGRSCYNCGR-  74

Query  369  APNATYNVSRPTPNATFNVPRCALNATYNVPQARTATRAACPNATFNVSRGGNRTFNTTM  428
                  ++SR  PNA          A Y+  Q     R  CPNA  + + GG   FN   
Sbjct  75   ----PGHISRDCPNARSGGNMGGGRACYHCQQEGHIARE-CPNAPADAAAGGRACFNCGQ  129

Query  429  P  429
            P
Sbjct  130  P  130


>Q57ZI4_TRYB2 unnamed protein product
Length=973

 Score = 30.4 bits (67),  Expect = 5.4, Method: Compositional matrix adjust.
 Identities = 23/93 (25%), Positives = 35/93 (38%), Gaps = 0/93 (0%)

Query  305  NATYNVSRYAPNATYNVPRSAPNATYNIPSCPANTTYNVPRSAPNATYNIPSCPANTTYN  364
            N  ++V + APN     P     A+ N    P N  ++V + APN     P     T  N
Sbjct  501  NYNWSVQQQAPNTVPTAPLVYQQASVNQTPAPVNHNWSVQQQAPNTVPTAPLVYQQTPVN  560

Query  365  VQRCAPNATYNVSRPTPNATFNVPRCALNATYN  397
              +   N  ++  +  PN     P     A+ N
Sbjct  561  QGQAPLNHNWSAQQQAPNVVPTAPLVYQQASVN  593



Lambda      K        H
   0.311    0.122    0.353 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3194608626


Query= XP_014085118.1 PREDICTED: F-box/LRR-repeat protein 2-like isoform X1
[Bactrocera oleae]

Length=464
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

YKK7_CAEEL  unnamed protein product                                   52.8    4e-07
Q38F63_TRYB2  unnamed protein product                                 49.7    4e-06
Q9VN08_DROME  unnamed protein product                                 46.6    3e-05


>YKK7_CAEEL unnamed protein product
Length=466

 Score = 52.8 bits (125),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 85/374 (23%), Positives = 145/374 (39%), Gaps = 70/374 (19%)

Query  22   ILNDDCLLEIFKQLKLVEQVRLATVCPRLRSVFQYYCQRHCKILRKYDL----SDMSTRE  77
            +L  + LL++F  L      R A VC R  S+            ++ DL     D+ T  
Sbjct  59   VLPKEVLLKVFSFLDTKALCRSAQVC-RSWSILALDGSN----WQRVDLFTFQRDVKTAV  113

Query  78   IRRFFEMAGNYLEELVNLPYNDQERNEYVTQVNKNCPNVRRIY-FGMTKIKSKCLRKLLM  136
            +       G +L+EL +L   +   +  +      CPN+  +  +   ++       L  
Sbjct  114  VENLARRCGGFLKEL-SLKGCENVHDSALRTFTSRCPNLEHLSLYRCKRVTDASCENLGR  172

Query  137  NMKHLNSLHLQKCS-LDDNAMKSVSE-LATLEILRLEGEEDITGR----YLSKLKCLKEL  190
                LN L+L+ CS + D AMK + +    L  L +   + I  R     LS  K L  L
Sbjct  173  YCHKLNYLNLENCSSITDRAMKYIGDGCPNLSYLNISWCDAIQDRGVQIILSNCKSLDTL  232

Query  191  TFVEC-GIQDDFFVEICTSLKELKKLTLQWCDALTDVAISALPVNCVNLEKLNIS-CNQS  248
                C G+ ++ F  +   +  +KKL L  C  LTD+ +  +      LE L +S CNQ 
Sbjct  233  ILRGCEGLTENVFGSVEAHMGAIKKLNLLQCFQLTDITVQNIANGATALEYLCMSNCNQI  292

Query  249  FEYYDIARLPRLVDLELSAEMFRTQSFNLLLNRLADQKGEQLECLRIFSPRLIVDDGMRP  308
             +         LV L                     Q    L+ L +    L+ D+G  P
Sbjct  293  SDR-------SLVSL--------------------GQHSHNLKVLELSGCTLLGDNGFIP  325

Query  309  LSQFKNLKVFGCDCSKYIDATCLRYICALQQLETVSLRYCRSVTNEAVLVLLDGCPKLKY  368
            L++       GC                 +QLE + +  C  +++  +  L + C  L+ 
Sbjct  326  LAR-------GC-----------------RQLERLDMEDCSLISDHTINSLANNCTALRE  361

Query  369  INVMHCDQLTEELV  382
            +++ HC+ +T+E +
Sbjct  362  LSLSHCELITDESI  375


>Q38F63_TRYB2 unnamed protein product
Length=490

 Score = 49.7 bits (117),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 87/308 (28%), Positives = 125/308 (41%), Gaps = 66/308 (21%)

Query  114  PNVRRIYFGMTKIKSKCLRKLLMNMKHLNSLHLQKCSLDDNAMKSVSELATLEILRLEGE  173
            P +R +Y   T ++   LR L      LN      C +    +  V  +A +++LR    
Sbjct  177  PALRELYLIGTSMRGNSLRGLGATTSLLN-----LCIVSCGCLTDVLHIADVQVLRQLTL  231

Query  174  EDITG-----RYLSKLKCLKELTFVECGIQDDFFVEICTSLKELKKLTLQWCDALTDVAI  228
            E  T        L  L  L EL      I D  F++  +S + L KL L WCD LTDV+ 
Sbjct  232  ESCTSLEEGVGKLGGLPALYELDLSYSSIVD-VFLQGLSSSRSLVKLNLSWCDQLTDVSP  290

Query  229  SALPVNCVNLEKLNI-SCNQSFEYY-DIARLPRLVDLELSA---------EMFRTQSFNL  277
             A       L+ LN+ SC        D+ +LP L +L+LS          ++  ++S   
Sbjct  291  LA---ELKTLKYLNLQSCEAVVAGIGDLGKLPGLYELDLSCTPITDCALRDLCSSRSLVR  347

Query  278  L----------LNRLADQK--GE-----------------QLECLRIFSPRL--IVDDGM  306
            L          L+ L   K  GE                 QL  LR        I DD +
Sbjct  348  LDISSCDNLTDLSALVSLKTLGELNLDACTEVKQGIGNISQLPELRRLDGTCLPITDDSL  407

Query  307  RPLSQFKNLKVFGCD-CSKYIDATCLRYICALQQLETVSLRYCRSVTN--EAVLVLLDGC  363
            R LS  ++L V   D C    D +CL    A++ LE +SL  C SV    EA+  L    
Sbjct  408  RDLSASRSLVVLCLDTCMDITDVSCLA---AVKTLEEISLNSCLSVEKGVEALTTL----  460

Query  364  PKLKYINV  371
            P+L+ +N+
Sbjct  461  PRLRSVNL  468


>Q9VN08_DROME unnamed protein product
Length=499

 Score = 46.6 bits (109),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 63/259 (24%), Positives = 104/259 (40%), Gaps = 53/259 (20%)

Query  23   LNDDCLLEIFKQLKLVEQVRLATVCPRLRSVFQYYCQRHCKILRKYDLSDMSTRE-----  77
            L+D+ LL+IFK L     +R+ATVC R        C R   +  + DL   + R      
Sbjct  182  LSDEILLDIFKWLPKKTLLRMATVCRRFN-----RCSRDETLWTRLDLGLRTIRPGALEQ  236

Query  78   -IRR---FFEMAGNYLEELVNLPYNDQERNEYVTQVNKNCPNVRRIYFGMTKIKSKCLRK  133
             +RR      +A   ++E    PY +  R             ++ +   M  I    L  
Sbjct  237  IVRRGVLVIRLAQTSIQEPAFAPYTEVFRTR-----------LQYLDLSMASITRSSLLT  285

Query  134  LLMNMKHLNSLHLQKCSLDDNAMKSVSELATLEILRLEGEEDITGRYLSKLKCLKELTFV  193
            LL + + L  + L+   LDD+    +++   LE + L                      +
Sbjct  286  LLSHCRQLKKISLENIELDDDICAEIAKNEALEAVNLT---------------------M  324

Query  194  ECGIQDDFFVEICTSLKELKKLTLQWCDALTDVAISALPVN-CVNLEKLNIS-CNQSFEY  251
              G+  +    +  SL  L  L + W D   D A++AL  +   NL +LNI+ C +    
Sbjct  325  ASGLTSNSVRLMMESLTSLSSLNISWTDLSAD-AVTALVTHISPNLIRLNIAGCRRVLFD  383

Query  252  YDIA----RLPRLVDLELS  266
              +A    R P+L++L+LS
Sbjct  384  SHVATLQKRCPQLLELDLS  402



Lambda      K        H
   0.311    0.122    0.353 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3194608626


Query= XP_014085119.1 PREDICTED: F-box/LRR-repeat protein 2-like isoform X2
[Bactrocera oleae]

Length=426
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

YKK7_CAEEL  unnamed protein product                                   52.4    4e-07
Q38F63_TRYB2  unnamed protein product                                 48.9    5e-06
Q9VN08_DROME  unnamed protein product                                 46.6    3e-05


>YKK7_CAEEL unnamed protein product
Length=466

 Score = 52.4 bits (124),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 83/370 (22%), Positives = 143/370 (39%), Gaps = 62/370 (17%)

Query  22   ILNDDCLLEIFKQLKLVEQVRLATVCPRLRSVFQYYCQRHCKILRKYDLSDMSTREIRRF  81
            +L  + LL++F  L      R A VC R  S+         ++       D+ T  +   
Sbjct  59   VLPKEVLLKVFSFLDTKALCRSAQVC-RSWSILALDGSNWQRVDLFTFQRDVKTAVVENL  117

Query  82   FEMAGNYLEELVNLPYNDQERNEYVTQVNKNCPNVRRI-YFGMTKIKSKCLRKLLMNMKH  140
                G +L+EL +L   +   +  +      CPN+  +  +   ++       L      
Sbjct  118  ARRCGGFLKEL-SLKGCENVHDSALRTFTSRCPNLEHLSLYRCKRVTDASCENLGRYCHK  176

Query  141  LNSLHLQKCS-LDDNAMKSVSE-LATLEILRLEGEEDITGR----YLSKLKCLKELTFVE  194
            LN L+L+ CS + D AMK + +    L  L +   + I  R     LS  K L  L    
Sbjct  177  LNYLNLENCSSITDRAMKYIGDGCPNLSYLNISWCDAIQDRGVQIILSNCKSLDTLILRG  236

Query  195  C-GIQDDFFVEICTSLKELKKLTLQWCDALTDVAISALPVNCVNLEKLNIS-CNQSFEYY  252
            C G+ ++ F  +   +  +KKL L  C  LTD+ +  +      LE L +S CNQ  +  
Sbjct  237  CEGLTENVFGSVEAHMGAIKKLNLLQCFQLTDITVQNIANGATALEYLCMSNCNQISDR-  295

Query  253  DIARLPRLVDLELSAEMFRTQSFNLLLNRLADQKGEQLECLRIFSPRLIVDDGMRPLSQF  312
                   LV L                     Q    L+ L +    L+ D+G  PL++ 
Sbjct  296  ------SLVSL--------------------GQHSHNLKVLELSGCTLLGDNGFIPLAR-  328

Query  313  KNLKVFGCDCSKYIDATCLRYICALQQLETVSLRYCRSVTNEAVLVLLDGCPKLKYINVM  372
                  GC                 +QLE + +  C  +++  +  L + C  L+ +++ 
Sbjct  329  ------GC-----------------RQLERLDMEDCSLISDHTINSLANNCTALRELSLS  365

Query  373  HCDQLTEELV  382
            HC+ +T+E +
Sbjct  366  HCELITDESI  375


>Q38F63_TRYB2 unnamed protein product
Length=490

 Score = 48.9 bits (115),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 84/311 (27%), Positives = 121/311 (39%), Gaps = 72/311 (23%)

Query  114  PNVRRIYFGMTKIKSKCLRKLLMNMKHLNSLHLQKCSLDDNAMKSVSELATLEILR---L  170
            P +R +Y   T ++   LR L      LN      C +    +  V  +A +++LR   L
Sbjct  177  PALRELYLIGTSMRGNSLRGLGATTSLLN-----LCIVSCGCLTDVLHIADVQVLRQLTL  231

Query  171  EG----EEDITGRYLSKLKCLKELTFVECGIQDDFFVEICTSLKELKKLTLQWCDALTDV  226
            E     EE +    L  L  L EL      I D  F++  +S + L KL L WCD LTDV
Sbjct  232  ESCTSLEEGVG--KLGGLPALYELDLSYSSIVD-VFLQGLSSSRSLVKLNLSWCDQLTDV  288

Query  227  A-------------------------ISALPVNCVNLEKLNISC-------------NQS  248
            +                         +  LP     L +L++SC             ++S
Sbjct  289  SPLAELKTLKYLNLQSCEAVVAGIGDLGKLP----GLYELDLSCTPITDCALRDLCSSRS  344

Query  249  FEYYDIARLPRLVDLELSAEMFRTQSFNL-LLNRLADQKG--EQLECLRIFSPRL--IVD  303
                DI+    L DL     +      NL     +    G   QL  LR        I D
Sbjct  345  LVRLDISSCDNLTDLSALVSLKTLGELNLDACTEVKQGIGNISQLPELRRLDGTCLPITD  404

Query  304  DGMRPLSQFKNLKVFGCD-CSKYIDATCLRYICALQQLETVSLRYCRSVTN--EAVLVLL  360
            D +R LS  ++L V   D C    D +CL    A++ LE +SL  C SV    EA+  L 
Sbjct  405  DSLRDLSASRSLVVLCLDTCMDITDVSCLA---AVKTLEEISLNSCLSVEKGVEALTTL-  460

Query  361  DGCPKLKYINV  371
               P+L+ +N+
Sbjct  461  ---PRLRSVNL  468


>Q9VN08_DROME unnamed protein product
Length=499

 Score = 46.6 bits (109),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 63/259 (24%), Positives = 104/259 (40%), Gaps = 53/259 (20%)

Query  23   LNDDCLLEIFKQLKLVEQVRLATVCPRLRSVFQYYCQRHCKILRKYDLSDMSTRE-----  77
            L+D+ LL+IFK L     +R+ATVC R        C R   +  + DL   + R      
Sbjct  182  LSDEILLDIFKWLPKKTLLRMATVCRRFN-----RCSRDETLWTRLDLGLRTIRPGALEQ  236

Query  78   -IRR---FFEMAGNYLEELVNLPYNDQERNEYVTQVNKNCPNVRRIYFGMTKIKSKCLRK  133
             +RR      +A   ++E    PY +  R             ++ +   M  I    L  
Sbjct  237  IVRRGVLVIRLAQTSIQEPAFAPYTEVFRTR-----------LQYLDLSMASITRSSLLT  285

Query  134  LLMNMKHLNSLHLQKCSLDDNAMKSVSELATLEILRLEGEEDITGRYLSKLKCLKELTFV  193
            LL + + L  + L+   LDD+    +++   LE + L                      +
Sbjct  286  LLSHCRQLKKISLENIELDDDICAEIAKNEALEAVNLT---------------------M  324

Query  194  ECGIQDDFFVEICTSLKELKKLTLQWCDALTDVAISALPVN-CVNLEKLNIS-CNQSFEY  251
              G+  +    +  SL  L  L + W D   D A++AL  +   NL +LNI+ C +    
Sbjct  325  ASGLTSNSVRLMMESLTSLSSLNISWTDLSAD-AVTALVTHISPNLIRLNIAGCRRVLFD  383

Query  252  YDIARL----PRLVDLELS  266
              +A L    P+L++L+LS
Sbjct  384  SHVATLQKRCPQLLELDLS  402



Lambda      K        H
   0.311    0.122    0.353 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3194608626


Query= XP_014085120.1 PREDICTED: uncharacterized protein LOC106614107
[Bactrocera oleae]

Length=1376
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VRN4_DROME  unnamed protein product                                 1153    0.0  
M9PBR0_DROME  unnamed protein product                                 1143    0.0  
BLMP1_CAEEL  unnamed protein product                                  270     7e-76


>Q9VRN4_DROME unnamed protein product
Length=1203

 Score = 1153 bits (2982),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 691/1125 (61%), Positives = 774/1125 (69%), Gaps = 180/1125 (16%)

Query  100   PSPDGTQDYDVTRMREDDFERLAVYIVPDVQCERGIANRADRTLPRSLTLKPSMVFSTPN  159
             P+PDG QDYDVTRMRE+DFERLAVY+VPDVQ ERG+ NRAD+TLPRSLTLK SMV+STPN
Sbjct  79    PTPDGNQDYDVTRMREEDFERLAVYLVPDVQAERGLPNRADKTLPRSLTLKSSMVYSTPN  138

Query  160   VKTEGVWSTGVIPRGTRFGPFEGVPTPNYPNDTNKARYFWRIFKDDYFYYLDGSDRAQAN  219
             VKTEGVWS+GVIPRGTRFGPFEG+PT NYPND NKARYFWRIFKDD +YYLDGSDR+Q+N
Sbjct  139   VKTEGVWSSGVIPRGTRFGPFEGIPTSNYPNDKNKARYFWRIFKDDDYYYLDGSDRSQSN  198

Query  220   WMRYVASAYSLSVMNLVACQHQENIYFYTTRDIMPNEELMVWYCKDFARRLGYDVDPERT  279
             WMRYVASAYSLSVMNLVACQHQENIYFYTTRDI+PNEELMVWYCKDFA RLGYDVDPE T
Sbjct  199   WMRYVASAYSLSVMNLVACQHQENIYFYTTRDILPNEELMVWYCKDFASRLGYDVDPETT  258

Query  280   IFGACKQAVDDDEDAEADGEDEDVPSNATASSTLLLSHKAKLRSNSPYCMPAPEIPPEVA  339
             IFGACKQAV+ +               A            K R    Y MPAPEIPP+VA
Sbjct  259   IFGACKQAVEAE-------------EEADEEEEEAEGEDGKPR----YSMPAPEIPPDVA  301

Query  340   YNHITYVMGLPIPPLPAVVAGNA--------TVSRRSITPSPSPPSCRDANASHVPQHLV  391
              +HITYVMGL +P    V AGN         +VS  +  P  + P CR ++         
Sbjct  302   VSHITYVMGLHLP----VGAGNGPANGSVAGSVSGATPPPPTATPCCRRSS---------  348

Query  392   GLPHIQHAQSTQRPSAHQLSTQQLPTTHLQHHQQHIQQHQTVLHLKQEPGASVIV-RERS  450
                          P AH  +T    T+    H  HIQ  +          ASVI+ ++RS
Sbjct  349   -------------PPAHVSTT----TSTCNAHHPHIQHGRH---------ASVIIGQDRS  382

Query  451   PAASECGAKDAKEVAGSPLPHKDTHYEHQLTPNDGSVRSVRSDEGYHSNEYHEDGLTPPE  510
             P AS       K+ AGSPL   D    HQ+TP DGSVRSVRSDEGYHSNE HEDGLTPPE
Sbjct  383   PMAS-----SDKDTAGSPLSGLD----HQMTPQDGSVRSVRSDEGYHSNECHEDGLTPPE  433

Query  511   DSSDSESEHNYVLDCSKKAIAPKETVITHPQKAAVAAAVAAAAAAANSSSNNNAAVNNCG  570
             DSSDSESEHNYVLDCSKKAIAPKETVI   QK + +     A   AN+++N+        
Sbjct  434   DSSDSESEHNYVLDCSKKAIAPKETVIAQAQKPSSSPP---AVVMANTTTNS--------  482

Query  571   PATSVTPAVVSSAAAAIDCGGGDKNEYRKFKVKMPLKYEFKNSKCAIKTEAMCHINNINN  630
                     +  S+  A      DKNEYRKFKVKMPLKYEFKN  C  +  ++  +     
Sbjct  483   -------MISHSSPTATPICETDKNEYRKFKVKMPLKYEFKNKTCVKQEPSLKEV-----  530

Query  631   SKQNTSDELPTVGATSSEDDLLAANEATPACTSSTQLDDEAMDV----------DHMPGS  680
                   D+  ++     ED ++     +   +++T L DE M +                
Sbjct  531   ------DQEMSLPQEEEEDQVMHPEPDSICPSTTTHLGDEHMLMMERERERERERIQERE  584

Query  681   TTQQQHASSTVIMVDRSLNNTNGHATRTIVPLNKAYYEAETTTPPPPPTAAQTSSAAGVA  740
              + QQ ASSTVI+++   +N+ G A RTIVPL+K YYE      P PP         G  
Sbjct  585   PSNQQPASSTVIVLE---HNSGGQA-RTIVPLSKPYYE------PDPP---------GER  625

Query  741   YMRFTPPSSSILETILTGQHRLEAAAAAAAACRQANAATPPPSSPTEMAYSYKKSHRYGN  800
             YMRF  PSSSILETILT QHRLEAAAAAA ACRQANAATPPP+SPTEMAYSYKKS RYGN
Sbjct  626   YMRFGQPSSSILETILTSQHRLEAAAAAANACRQANAATPPPTSPTEMAYSYKKSQRYGN  685

Query  801   AVSPDSSSNLAQAPDM---HAAALHDTEMLIASSRGSLKDDCSPPPASGH--DLKFSPAH  855
             AVSPDSSSNL Q P+     A  + + EM  A+    +K +CSPPP S H  ++ FSP+ 
Sbjct  686   AVSPDSSSNLGQNPEQLSSSAVVVGEQEMTRATM---IKGECSPPPPSHHHHNVIFSPSR  742

Query  856   VAHSAFVSDGHQTPPYSAYSPYSSGSVNGGAPGGGHP----LSHMPTSTFHSPPHSSHSP  911
               H+A++                +G   G +P  G+P         TSTFHSPPHSSHSP
Sbjct  743   --HAAYLG---------------AGEAGGHSPSPGYPGYPHYGAAATSTFHSPPHSSHSP  785

Query  912   FDRQWDASSG--STPNLHLLQSSSQML-------------MKPLRISPPSSLSPDGNSCP  956
             FDRQ +ASSG  S  NLHLLQ+S+QML             + PLRISPPSSLSPDGNSCP
Sbjct  786   FDRQSNASSGAGSATNLHLLQTSTQMLNHPLMQPLTPLQRLSPLRISPPSSLSPDGNSCP  845

Query  957   RSGSPLSPNSLAARGYRSLPYPLKKKDGKMHYECNVCCKTFGQLSNLKVHLRTHSGERPF  1016
             RSGSPLSPNSLA+RGYRSLPYPLKKKDGKMHYECNVCCKTFGQLSNLKVHLRTHSGERPF
Sbjct  846   RSGSPLSPNSLASRGYRSLPYPLKKKDGKMHYECNVCCKTFGQLSNLKVHLRTHSGERPF  905

Query  1017  KCNVCTKSFTQLAHLQKHHLVHTGEKPHQCDICKKRFSSTSNLKTHLRLHSGQKPYACDL  1076
             KCNVCTKSFTQLAHLQKHHLVHTGEKPHQCDICKKRFSSTSNLKTHLRLHSGQKPYACDL
Sbjct  906   KCNVCTKSFTQLAHLQKHHLVHTGEKPHQCDICKKRFSSTSNLKTHLRLHSGQKPYACDL  965

Query  1077  CPQKFTQFVHLKLHKRLHTNDRPYVCQGCDKKYISASGLRTHWKTTSCKPNDLEEELAMA  1136
             CPQKFTQFVHLKLHKRLHTNDRPYVCQGCDKKYISASGLRTHWKTTSCKPN+LEEELAMA
Sbjct  966   CPQKFTQFVHLKLHKRLHTNDRPYVCQGCDKKYISASGLRTHWKTTSCKPNNLEEELAMA  1025

Query  1137  AAATSECLDKYVPEPDSREAFEHMQQQM----HPHLRHLPPGSGS  1177
             AAATSECLDK  PEPDSREA+E + Q M    HP LRHL  G  S
Sbjct  1026  AAATSECLDKDHPEPDSREAYEQLTQHMHPAVHPGLRHLSSGGQS  1070


 Score = 43.5 bits (101),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/25 (88%), Positives = 22/25 (88%), Gaps = 1/25 (4%)

Query  1353  QHAQNQESRPSVIESS-QPMIIECT  1376
             QH Q QESRPSVIESS QPMIIECT
Sbjct  1179  QHVQAQESRPSVIESSNQPMIIECT  1203


>M9PBR0_DROME unnamed protein product
Length=1216

 Score = 1143 bits (2956),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 691/1138 (61%), Positives = 774/1138 (68%), Gaps = 193/1138 (17%)

Query  100   PSPDGTQDYDVTRMREDDFERLAVYIVPDVQCERGIANRADRTLPRSLTLKPSMVFSTPN  159
             P+PDG QDYDVTRMRE+DFERLAVY+VPDVQ ERG+ NRAD+TLPRSLTLK SMV+STPN
Sbjct  79    PTPDGNQDYDVTRMREEDFERLAVYLVPDVQAERGLPNRADKTLPRSLTLKSSMVYSTPN  138

Query  160   VKTEGVWSTGVIPRGTRFGPFEGVPTPNYPNDTNKARYFWR-------------IFKDDY  206
             VKTEGVWS+GVIPRGTRFGPFEG+PT NYPND NKARYFWR             IFKDD 
Sbjct  139   VKTEGVWSSGVIPRGTRFGPFEGIPTSNYPNDKNKARYFWRVQGTRHITYGNIKIFKDDD  198

Query  207   FYYLDGSDRAQANWMRYVASAYSLSVMNLVACQHQENIYFYTTRDIMPNEELMVWYCKDF  266
             +YYLDGSDR+Q+NWMRYVASAYSLSVMNLVACQHQENIYFYTTRDI+PNEELMVWYCKDF
Sbjct  199   YYYLDGSDRSQSNWMRYVASAYSLSVMNLVACQHQENIYFYTTRDILPNEELMVWYCKDF  258

Query  267   ARRLGYDVDPERTIFGACKQAVDDDEDAEADGEDEDVPSNATASSTLLLSHKAKLRSNSP  326
             A RLGYDVDPE TIFGACKQAV+ +               A            K R    
Sbjct  259   ASRLGYDVDPETTIFGACKQAVEAE-------------EEADEEEEEAEGEDGKPR----  301

Query  327   YCMPAPEIPPEVAYNHITYVMGLPIPPLPAVVAGNA--------TVSRRSITPSPSPPSC  378
             Y MPAPEIPP+VA +HITYVMGL +P    V AGN         +VS  +  P  + P C
Sbjct  302   YSMPAPEIPPDVAVSHITYVMGLHLP----VGAGNGPANGSVAGSVSGATPPPPTATPCC  357

Query  379   RDANASHVPQHLVGLPHIQHAQSTQRPSAHQLSTQQLPTTHLQHHQQHIQQHQTVLHLKQ  438
             R ++                      P AH  +T    T+    H  HIQ  +       
Sbjct  358   RRSS----------------------PPAHVSTT----TSTCNAHHPHIQHGRH------  385

Query  439   EPGASVIV-RERSPAASECGAKDAKEVAGSPLPHKDTHYEHQLTPNDGSVRSVRSDEGYH  497
                ASVI+ ++RSP AS       K+ AGSPL   D    HQ+TP DGSVRSVRSDEGYH
Sbjct  386   ---ASVIIGQDRSPMAS-----SDKDTAGSPLSGLD----HQMTPQDGSVRSVRSDEGYH  433

Query  498   SNEYHEDGLTPPEDSSDSESEHNYVLDCSKKAIAPKETVITHPQKAAVAAAVAAAAAAAN  557
             SNE HEDGLTPPEDSSDSESEHNYVLDCSKKAIAPKETVI   QK + +     A   AN
Sbjct  434   SNECHEDGLTPPEDSSDSESEHNYVLDCSKKAIAPKETVIAQAQKPSSSPP---AVVMAN  490

Query  558   SSSNNNAAVNNCGPATSVTPAVVSSAAAAIDCGGGDKNEYRKFKVKMPLKYEFKNSKCAI  617
             +++N+                +  S+  A      DKNEYRKFKVKMPLKYEFKN  C  
Sbjct  491   TTTNS---------------MISHSSPTATPICETDKNEYRKFKVKMPLKYEFKNKTCVK  535

Query  618   KTEAMCHINNINNSKQNTSDELPTVGATSSEDDLLAANEATPACTSSTQLDDEAMDV---  674
             +  ++  +           D+  ++     ED ++     +   +++T L DE M +   
Sbjct  536   QEPSLKEV-----------DQEMSLPQEEEEDQVMHPEPDSICPSTTTHLGDEHMLMMER  584

Query  675   -------DHMPGSTTQQQHASSTVIMVDRSLNNTNGHATRTIVPLNKAYYEAETTTPPPP  727
                           + QQ ASSTVI+++   +N+ G A RTIVPL+K YYE      P P
Sbjct  585   ERERERERIQEREPSNQQPASSTVIVLE---HNSGGQA-RTIVPLSKPYYE------PDP  634

Query  728   PTAAQTSSAAGVAYMRFTPPSSSILETILTGQHRLEAAAAAAAACRQANAATPPPSSPTE  787
             P         G  YMRF  PSSSILETILT QHRLEAAAAAA ACRQANAATPPP+SPTE
Sbjct  635   P---------GERYMRFGQPSSSILETILTSQHRLEAAAAAANACRQANAATPPPTSPTE  685

Query  788   MAYSYKKSHRYGNAVSPDSSSNLAQAPDM---HAAALHDTEMLIASSRGSLKDDCSPPPA  844
             MAYSYKKS RYGNAVSPDSSSNL Q P+     A  + + EM  A+    +K +CSPPP 
Sbjct  686   MAYSYKKSQRYGNAVSPDSSSNLGQNPEQLSSSAVVVGEQEMTRATM---IKGECSPPPP  742

Query  845   SGH--DLKFSPAHVAHSAFVSDGHQTPPYSAYSPYSSGSVNGGAPGGGHP----LSHMPT  898
             S H  ++ FSP+   H+A++                +G   G +P  G+P         T
Sbjct  743   SHHHHNVIFSPSR--HAAYLG---------------AGEAGGHSPSPGYPGYPHYGAAAT  785

Query  899   STFHSPPHSSHSPFDRQWDASSG--STPNLHLLQSSSQML-------------MKPLRIS  943
             STFHSPPHSSHSPFDRQ +ASSG  S  NLHLLQ+S+QML             + PLRIS
Sbjct  786   STFHSPPHSSHSPFDRQSNASSGAGSATNLHLLQTSTQMLNHPLMQPLTPLQRLSPLRIS  845

Query  944   PPSSLSPDGNSCPRSGSPLSPNSLAARGYRSLPYPLKKKDGKMHYECNVCCKTFGQLSNL  1003
             PPSSLSPDGNSCPRSGSPLSPNSLA+RGYRSLPYPLKKKDGKMHYECNVCCKTFGQLSNL
Sbjct  846   PPSSLSPDGNSCPRSGSPLSPNSLASRGYRSLPYPLKKKDGKMHYECNVCCKTFGQLSNL  905

Query  1004  KVHLRTHSGERPFKCNVCTKSFTQLAHLQKHHLVHTGEKPHQCDICKKRFSSTSNLKTHL  1063
             KVHLRTHSGERPFKCNVCTKSFTQLAHLQKHHLVHTGEKPHQCDICKKRFSSTSNLKTHL
Sbjct  906   KVHLRTHSGERPFKCNVCTKSFTQLAHLQKHHLVHTGEKPHQCDICKKRFSSTSNLKTHL  965

Query  1064  RLHSGQKPYACDLCPQKFTQFVHLKLHKRLHTNDRPYVCQGCDKKYISASGLRTHWKTTS  1123
             RLHSGQKPYACDLCPQKFTQFVHLKLHKRLHTNDRPYVCQGCDKKYISASGLRTHWKTTS
Sbjct  966   RLHSGQKPYACDLCPQKFTQFVHLKLHKRLHTNDRPYVCQGCDKKYISASGLRTHWKTTS  1025

Query  1124  CKPNDLEEELAMAAAATSECLDKYVPEPDSREAFEHMQQQM----HPHLRHLPPGSGS  1177
             CKPN+LEEELAMAAAATSECLDK  PEPDSREA+E + Q M    HP LRHL  G  S
Sbjct  1026  CKPNNLEEELAMAAAATSECLDKDHPEPDSREAYEQLTQHMHPAVHPGLRHLSSGGQS  1083


 Score = 43.5 bits (101),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/25 (88%), Positives = 22/25 (88%), Gaps = 1/25 (4%)

Query  1353  QHAQNQESRPSVIESS-QPMIIECT  1376
             QH Q QESRPSVIESS QPMIIECT
Sbjct  1192  QHVQAQESRPSVIESSNQPMIIECT  1216


>BLMP1_CAEEL unnamed protein product
Length=817

 Score = 270 bits (690),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 134/157 (85%), Gaps = 0/157 (0%)

Query  977   YPLKKKDGKMHYECNVCCKTFGQLSNLKVHLRTHSGERPFKCNVCTKSFTQLAHLQKHHL  1036
             Y  ++++GK  Y C  C KTFGQLSNLKVH+RTH+GERPFKC +CTK FTQLAHLQKHHL
Sbjct  497   YVQQQENGKTRYACKDCNKTFGQLSNLKVHVRTHTGERPFKCEICTKEFTQLAHLQKHHL  556

Query  1037  VHTGEKPHQCDICKKRFSSTSNLKTHLRLHSGQKPYACDLCPQKFTQFVHLKLHKRLHTN  1096
             VHTGE+PH+CDIC KRFSSTSNLKTHLRLH+GQKPY CD+C  KFTQ+VHL+LHKRLH N
Sbjct  557   VHTGERPHRCDICDKRFSSTSNLKTHLRLHNGQKPYTCDVCDAKFTQYVHLRLHKRLHAN  616

Query  1097  DRPYVCQGCDKKYISASGLRTHWKTTSCKPNDLEEEL  1133
             +RPY C  C KKYIS SGLRTHWKTT+CK  D+++ +
Sbjct  617   ERPYSCGTCGKKYISPSGLRTHWKTTTCKEEDMKDSM  653


 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 62/199 (31%), Positives = 86/199 (43%), Gaps = 42/199 (21%)

Query  109  DVTRMREDDFERLAVYIVPDVQCERGIANRADRTLPRSLTLKPSMVFSTPNVKTEGVWST  168
            D  +  +++   L ++ VPD         RA+ TLP +L LK S      N K   +WS+
Sbjct  67   DWKQSGDENLAELCIFHVPDKSVSLPNPKRAECTLPMNLILKSSSK----NRKKSSIWSS  122

Query  169  GVIPRGTRFGPFEG----------------------------VPTPNYPNDTNKARYFWR  200
              IPRG RFGP  G                            VP    P +       W+
Sbjct  123  DHIPRGVRFGPLVGEIRLVDVDTALVCPAEASMAGGGPAQEDVPFDEAPEE-------WK  175

Query  201  IFK---DDYFYYLDGSDRAQANWMRYVASAYSLSVMNLVACQHQENIYFYTTRDIMPNEE  257
            I+          +   D A++NWM+YVA+A      NLVA Q   +IYFYT + I  N E
Sbjct  176  IYSPSGGRLNKTICVKDDARSNWMKYVAAAEEEDFQNLVAAQIGNDIYFYTVKKIEANTE  235

Query  258  LMVWYCKDFARRLGYDVDP  276
            L  W+ +D+AR+L Y   P
Sbjct  236  LSFWFSRDYARKLNYSTRP  254



Lambda      K        H
   0.311    0.122    0.353 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3194608626


Query= XP_014085121.1 PREDICTED: uncharacterized protein LOC106614107
[Bactrocera oleae]

Length=1376
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VRN4_DROME  unnamed protein product                                 1153    0.0  
M9PBR0_DROME  unnamed protein product                                 1143    0.0  
BLMP1_CAEEL  unnamed protein product                                  270     7e-76


>Q9VRN4_DROME unnamed protein product
Length=1203

 Score = 1153 bits (2982),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 691/1125 (61%), Positives = 774/1125 (69%), Gaps = 180/1125 (16%)

Query  100   PSPDGTQDYDVTRMREDDFERLAVYIVPDVQCERGIANRADRTLPRSLTLKPSMVFSTPN  159
             P+PDG QDYDVTRMRE+DFERLAVY+VPDVQ ERG+ NRAD+TLPRSLTLK SMV+STPN
Sbjct  79    PTPDGNQDYDVTRMREEDFERLAVYLVPDVQAERGLPNRADKTLPRSLTLKSSMVYSTPN  138

Query  160   VKTEGVWSTGVIPRGTRFGPFEGVPTPNYPNDTNKARYFWRIFKDDYFYYLDGSDRAQAN  219
             VKTEGVWS+GVIPRGTRFGPFEG+PT NYPND NKARYFWRIFKDD +YYLDGSDR+Q+N
Sbjct  139   VKTEGVWSSGVIPRGTRFGPFEGIPTSNYPNDKNKARYFWRIFKDDDYYYLDGSDRSQSN  198

Query  220   WMRYVASAYSLSVMNLVACQHQENIYFYTTRDIMPNEELMVWYCKDFARRLGYDVDPERT  279
             WMRYVASAYSLSVMNLVACQHQENIYFYTTRDI+PNEELMVWYCKDFA RLGYDVDPE T
Sbjct  199   WMRYVASAYSLSVMNLVACQHQENIYFYTTRDILPNEELMVWYCKDFASRLGYDVDPETT  258

Query  280   IFGACKQAVDDDEDAEADGEDEDVPSNATASSTLLLSHKAKLRSNSPYCMPAPEIPPEVA  339
             IFGACKQAV+ +               A            K R    Y MPAPEIPP+VA
Sbjct  259   IFGACKQAVEAE-------------EEADEEEEEAEGEDGKPR----YSMPAPEIPPDVA  301

Query  340   YNHITYVMGLPIPPLPAVVAGNA--------TVSRRSITPSPSPPSCRDANASHVPQHLV  391
              +HITYVMGL +P    V AGN         +VS  +  P  + P CR ++         
Sbjct  302   VSHITYVMGLHLP----VGAGNGPANGSVAGSVSGATPPPPTATPCCRRSS---------  348

Query  392   GLPHIQHAQSTQRPSAHQLSTQQLPTTHLQHHQQHIQQHQTVLHLKQEPGASVIV-RERS  450
                          P AH  +T    T+    H  HIQ  +          ASVI+ ++RS
Sbjct  349   -------------PPAHVSTT----TSTCNAHHPHIQHGRH---------ASVIIGQDRS  382

Query  451   PAASECGAKDAKEVAGSPLPHKDTHYEHQLTPNDGSVRSVRSDEGYHSNEYHEDGLTPPE  510
             P AS       K+ AGSPL   D    HQ+TP DGSVRSVRSDEGYHSNE HEDGLTPPE
Sbjct  383   PMAS-----SDKDTAGSPLSGLD----HQMTPQDGSVRSVRSDEGYHSNECHEDGLTPPE  433

Query  511   DSSDSESEHNYVLDCSKKAIAPKETVITHPQKAAVAAAVAAAAAAANSSSNNNAAVNNCG  570
             DSSDSESEHNYVLDCSKKAIAPKETVI   QK + +     A   AN+++N+        
Sbjct  434   DSSDSESEHNYVLDCSKKAIAPKETVIAQAQKPSSSPP---AVVMANTTTNS--------  482

Query  571   PATSVTPAVVSSAAAAIDCGGGDKNEYRKFKVKMPLKYEFKNSKCAIKTEAMCHINNINN  630
                     +  S+  A      DKNEYRKFKVKMPLKYEFKN  C  +  ++  +     
Sbjct  483   -------MISHSSPTATPICETDKNEYRKFKVKMPLKYEFKNKTCVKQEPSLKEV-----  530

Query  631   SKQNTSDELPTVGATSSEDDLLAANEATPACTSSTQLDDEAMDV----------DHMPGS  680
                   D+  ++     ED ++     +   +++T L DE M +                
Sbjct  531   ------DQEMSLPQEEEEDQVMHPEPDSICPSTTTHLGDEHMLMMERERERERERIQERE  584

Query  681   TTQQQHASSTVIMVDRSLNNTNGHATRTIVPLNKAYYEAETTTPPPPPTAAQTSSAAGVA  740
              + QQ ASSTVI+++   +N+ G A RTIVPL+K YYE      P PP         G  
Sbjct  585   PSNQQPASSTVIVLE---HNSGGQA-RTIVPLSKPYYE------PDPP---------GER  625

Query  741   YMRFTPPSSSILETILTGQHRLEAAAAAAAACRQANAATPPPSSPTEMAYSYKKSHRYGN  800
             YMRF  PSSSILETILT QHRLEAAAAAA ACRQANAATPPP+SPTEMAYSYKKS RYGN
Sbjct  626   YMRFGQPSSSILETILTSQHRLEAAAAAANACRQANAATPPPTSPTEMAYSYKKSQRYGN  685

Query  801   AVSPDSSSNLAQAPDM---HAAALHDTEMLIASSRGSLKDDCSPPPASGH--DLKFSPAH  855
             AVSPDSSSNL Q P+     A  + + EM  A+    +K +CSPPP S H  ++ FSP+ 
Sbjct  686   AVSPDSSSNLGQNPEQLSSSAVVVGEQEMTRATM---IKGECSPPPPSHHHHNVIFSPSR  742

Query  856   VAHSAFVSDGHQTPPYSAYSPYSSGSVNGGAPGGGHP----LSHMPTSTFHSPPHSSHSP  911
               H+A++                +G   G +P  G+P         TSTFHSPPHSSHSP
Sbjct  743   --HAAYLG---------------AGEAGGHSPSPGYPGYPHYGAAATSTFHSPPHSSHSP  785

Query  912   FDRQWDASSG--STPNLHLLQSSSQML-------------MKPLRISPPSSLSPDGNSCP  956
             FDRQ +ASSG  S  NLHLLQ+S+QML             + PLRISPPSSLSPDGNSCP
Sbjct  786   FDRQSNASSGAGSATNLHLLQTSTQMLNHPLMQPLTPLQRLSPLRISPPSSLSPDGNSCP  845

Query  957   RSGSPLSPNSLAARGYRSLPYPLKKKDGKMHYECNVCCKTFGQLSNLKVHLRTHSGERPF  1016
             RSGSPLSPNSLA+RGYRSLPYPLKKKDGKMHYECNVCCKTFGQLSNLKVHLRTHSGERPF
Sbjct  846   RSGSPLSPNSLASRGYRSLPYPLKKKDGKMHYECNVCCKTFGQLSNLKVHLRTHSGERPF  905

Query  1017  KCNVCTKSFTQLAHLQKHHLVHTGEKPHQCDICKKRFSSTSNLKTHLRLHSGQKPYACDL  1076
             KCNVCTKSFTQLAHLQKHHLVHTGEKPHQCDICKKRFSSTSNLKTHLRLHSGQKPYACDL
Sbjct  906   KCNVCTKSFTQLAHLQKHHLVHTGEKPHQCDICKKRFSSTSNLKTHLRLHSGQKPYACDL  965

Query  1077  CPQKFTQFVHLKLHKRLHTNDRPYVCQGCDKKYISASGLRTHWKTTSCKPNDLEEELAMA  1136
             CPQKFTQFVHLKLHKRLHTNDRPYVCQGCDKKYISASGLRTHWKTTSCKPN+LEEELAMA
Sbjct  966   CPQKFTQFVHLKLHKRLHTNDRPYVCQGCDKKYISASGLRTHWKTTSCKPNNLEEELAMA  1025

Query  1137  AAATSECLDKYVPEPDSREAFEHMQQQM----HPHLRHLPPGSGS  1177
             AAATSECLDK  PEPDSREA+E + Q M    HP LRHL  G  S
Sbjct  1026  AAATSECLDKDHPEPDSREAYEQLTQHMHPAVHPGLRHLSSGGQS  1070


 Score = 43.5 bits (101),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/25 (88%), Positives = 22/25 (88%), Gaps = 1/25 (4%)

Query  1353  QHAQNQESRPSVIESS-QPMIIECT  1376
             QH Q QESRPSVIESS QPMIIECT
Sbjct  1179  QHVQAQESRPSVIESSNQPMIIECT  1203


>M9PBR0_DROME unnamed protein product
Length=1216

 Score = 1143 bits (2956),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 691/1138 (61%), Positives = 774/1138 (68%), Gaps = 193/1138 (17%)

Query  100   PSPDGTQDYDVTRMREDDFERLAVYIVPDVQCERGIANRADRTLPRSLTLKPSMVFSTPN  159
             P+PDG QDYDVTRMRE+DFERLAVY+VPDVQ ERG+ NRAD+TLPRSLTLK SMV+STPN
Sbjct  79    PTPDGNQDYDVTRMREEDFERLAVYLVPDVQAERGLPNRADKTLPRSLTLKSSMVYSTPN  138

Query  160   VKTEGVWSTGVIPRGTRFGPFEGVPTPNYPNDTNKARYFWR-------------IFKDDY  206
             VKTEGVWS+GVIPRGTRFGPFEG+PT NYPND NKARYFWR             IFKDD 
Sbjct  139   VKTEGVWSSGVIPRGTRFGPFEGIPTSNYPNDKNKARYFWRVQGTRHITYGNIKIFKDDD  198

Query  207   FYYLDGSDRAQANWMRYVASAYSLSVMNLVACQHQENIYFYTTRDIMPNEELMVWYCKDF  266
             +YYLDGSDR+Q+NWMRYVASAYSLSVMNLVACQHQENIYFYTTRDI+PNEELMVWYCKDF
Sbjct  199   YYYLDGSDRSQSNWMRYVASAYSLSVMNLVACQHQENIYFYTTRDILPNEELMVWYCKDF  258

Query  267   ARRLGYDVDPERTIFGACKQAVDDDEDAEADGEDEDVPSNATASSTLLLSHKAKLRSNSP  326
             A RLGYDVDPE TIFGACKQAV+ +               A            K R    
Sbjct  259   ASRLGYDVDPETTIFGACKQAVEAE-------------EEADEEEEEAEGEDGKPR----  301

Query  327   YCMPAPEIPPEVAYNHITYVMGLPIPPLPAVVAGNA--------TVSRRSITPSPSPPSC  378
             Y MPAPEIPP+VA +HITYVMGL +P    V AGN         +VS  +  P  + P C
Sbjct  302   YSMPAPEIPPDVAVSHITYVMGLHLP----VGAGNGPANGSVAGSVSGATPPPPTATPCC  357

Query  379   RDANASHVPQHLVGLPHIQHAQSTQRPSAHQLSTQQLPTTHLQHHQQHIQQHQTVLHLKQ  438
             R ++                      P AH  +T    T+    H  HIQ  +       
Sbjct  358   RRSS----------------------PPAHVSTT----TSTCNAHHPHIQHGRH------  385

Query  439   EPGASVIV-RERSPAASECGAKDAKEVAGSPLPHKDTHYEHQLTPNDGSVRSVRSDEGYH  497
                ASVI+ ++RSP AS       K+ AGSPL   D    HQ+TP DGSVRSVRSDEGYH
Sbjct  386   ---ASVIIGQDRSPMAS-----SDKDTAGSPLSGLD----HQMTPQDGSVRSVRSDEGYH  433

Query  498   SNEYHEDGLTPPEDSSDSESEHNYVLDCSKKAIAPKETVITHPQKAAVAAAVAAAAAAAN  557
             SNE HEDGLTPPEDSSDSESEHNYVLDCSKKAIAPKETVI   QK + +     A   AN
Sbjct  434   SNECHEDGLTPPEDSSDSESEHNYVLDCSKKAIAPKETVIAQAQKPSSSPP---AVVMAN  490

Query  558   SSSNNNAAVNNCGPATSVTPAVVSSAAAAIDCGGGDKNEYRKFKVKMPLKYEFKNSKCAI  617
             +++N+                +  S+  A      DKNEYRKFKVKMPLKYEFKN  C  
Sbjct  491   TTTNS---------------MISHSSPTATPICETDKNEYRKFKVKMPLKYEFKNKTCVK  535

Query  618   KTEAMCHINNINNSKQNTSDELPTVGATSSEDDLLAANEATPACTSSTQLDDEAMDV---  674
             +  ++  +           D+  ++     ED ++     +   +++T L DE M +   
Sbjct  536   QEPSLKEV-----------DQEMSLPQEEEEDQVMHPEPDSICPSTTTHLGDEHMLMMER  584

Query  675   -------DHMPGSTTQQQHASSTVIMVDRSLNNTNGHATRTIVPLNKAYYEAETTTPPPP  727
                           + QQ ASSTVI+++   +N+ G A RTIVPL+K YYE      P P
Sbjct  585   ERERERERIQEREPSNQQPASSTVIVLE---HNSGGQA-RTIVPLSKPYYE------PDP  634

Query  728   PTAAQTSSAAGVAYMRFTPPSSSILETILTGQHRLEAAAAAAAACRQANAATPPPSSPTE  787
             P         G  YMRF  PSSSILETILT QHRLEAAAAAA ACRQANAATPPP+SPTE
Sbjct  635   P---------GERYMRFGQPSSSILETILTSQHRLEAAAAAANACRQANAATPPPTSPTE  685

Query  788   MAYSYKKSHRYGNAVSPDSSSNLAQAPDM---HAAALHDTEMLIASSRGSLKDDCSPPPA  844
             MAYSYKKS RYGNAVSPDSSSNL Q P+     A  + + EM  A+    +K +CSPPP 
Sbjct  686   MAYSYKKSQRYGNAVSPDSSSNLGQNPEQLSSSAVVVGEQEMTRATM---IKGECSPPPP  742

Query  845   SGH--DLKFSPAHVAHSAFVSDGHQTPPYSAYSPYSSGSVNGGAPGGGHP----LSHMPT  898
             S H  ++ FSP+   H+A++                +G   G +P  G+P         T
Sbjct  743   SHHHHNVIFSPSR--HAAYLG---------------AGEAGGHSPSPGYPGYPHYGAAAT  785

Query  899   STFHSPPHSSHSPFDRQWDASSG--STPNLHLLQSSSQML-------------MKPLRIS  943
             STFHSPPHSSHSPFDRQ +ASSG  S  NLHLLQ+S+QML             + PLRIS
Sbjct  786   STFHSPPHSSHSPFDRQSNASSGAGSATNLHLLQTSTQMLNHPLMQPLTPLQRLSPLRIS  845

Query  944   PPSSLSPDGNSCPRSGSPLSPNSLAARGYRSLPYPLKKKDGKMHYECNVCCKTFGQLSNL  1003
             PPSSLSPDGNSCPRSGSPLSPNSLA+RGYRSLPYPLKKKDGKMHYECNVCCKTFGQLSNL
Sbjct  846   PPSSLSPDGNSCPRSGSPLSPNSLASRGYRSLPYPLKKKDGKMHYECNVCCKTFGQLSNL  905

Query  1004  KVHLRTHSGERPFKCNVCTKSFTQLAHLQKHHLVHTGEKPHQCDICKKRFSSTSNLKTHL  1063
             KVHLRTHSGERPFKCNVCTKSFTQLAHLQKHHLVHTGEKPHQCDICKKRFSSTSNLKTHL
Sbjct  906   KVHLRTHSGERPFKCNVCTKSFTQLAHLQKHHLVHTGEKPHQCDICKKRFSSTSNLKTHL  965

Query  1064  RLHSGQKPYACDLCPQKFTQFVHLKLHKRLHTNDRPYVCQGCDKKYISASGLRTHWKTTS  1123
             RLHSGQKPYACDLCPQKFTQFVHLKLHKRLHTNDRPYVCQGCDKKYISASGLRTHWKTTS
Sbjct  966   RLHSGQKPYACDLCPQKFTQFVHLKLHKRLHTNDRPYVCQGCDKKYISASGLRTHWKTTS  1025

Query  1124  CKPNDLEEELAMAAAATSECLDKYVPEPDSREAFEHMQQQM----HPHLRHLPPGSGS  1177
             CKPN+LEEELAMAAAATSECLDK  PEPDSREA+E + Q M    HP LRHL  G  S
Sbjct  1026  CKPNNLEEELAMAAAATSECLDKDHPEPDSREAYEQLTQHMHPAVHPGLRHLSSGGQS  1083


 Score = 43.5 bits (101),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/25 (88%), Positives = 22/25 (88%), Gaps = 1/25 (4%)

Query  1353  QHAQNQESRPSVIESS-QPMIIECT  1376
             QH Q QESRPSVIESS QPMIIECT
Sbjct  1192  QHVQAQESRPSVIESSNQPMIIECT  1216


>BLMP1_CAEEL unnamed protein product
Length=817

 Score = 270 bits (690),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 134/157 (85%), Gaps = 0/157 (0%)

Query  977   YPLKKKDGKMHYECNVCCKTFGQLSNLKVHLRTHSGERPFKCNVCTKSFTQLAHLQKHHL  1036
             Y  ++++GK  Y C  C KTFGQLSNLKVH+RTH+GERPFKC +CTK FTQLAHLQKHHL
Sbjct  497   YVQQQENGKTRYACKDCNKTFGQLSNLKVHVRTHTGERPFKCEICTKEFTQLAHLQKHHL  556

Query  1037  VHTGEKPHQCDICKKRFSSTSNLKTHLRLHSGQKPYACDLCPQKFTQFVHLKLHKRLHTN  1096
             VHTGE+PH+CDIC KRFSSTSNLKTHLRLH+GQKPY CD+C  KFTQ+VHL+LHKRLH N
Sbjct  557   VHTGERPHRCDICDKRFSSTSNLKTHLRLHNGQKPYTCDVCDAKFTQYVHLRLHKRLHAN  616

Query  1097  DRPYVCQGCDKKYISASGLRTHWKTTSCKPNDLEEEL  1133
             +RPY C  C KKYIS SGLRTHWKTT+CK  D+++ +
Sbjct  617   ERPYSCGTCGKKYISPSGLRTHWKTTTCKEEDMKDSM  653


 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 62/199 (31%), Positives = 86/199 (43%), Gaps = 42/199 (21%)

Query  109  DVTRMREDDFERLAVYIVPDVQCERGIANRADRTLPRSLTLKPSMVFSTPNVKTEGVWST  168
            D  +  +++   L ++ VPD         RA+ TLP +L LK S      N K   +WS+
Sbjct  67   DWKQSGDENLAELCIFHVPDKSVSLPNPKRAECTLPMNLILKSSSK----NRKKSSIWSS  122

Query  169  GVIPRGTRFGPFEG----------------------------VPTPNYPNDTNKARYFWR  200
              IPRG RFGP  G                            VP    P +       W+
Sbjct  123  DHIPRGVRFGPLVGEIRLVDVDTALVCPAEASMAGGGPAQEDVPFDEAPEE-------WK  175

Query  201  IFK---DDYFYYLDGSDRAQANWMRYVASAYSLSVMNLVACQHQENIYFYTTRDIMPNEE  257
            I+          +   D A++NWM+YVA+A      NLVA Q   +IYFYT + I  N E
Sbjct  176  IYSPSGGRLNKTICVKDDARSNWMKYVAAAEEEDFQNLVAAQIGNDIYFYTVKKIEANTE  235

Query  258  LMVWYCKDFARRLGYDVDP  276
            L  W+ +D+AR+L Y   P
Sbjct  236  LSFWFSRDYARKLNYSTRP  254



Lambda      K        H
   0.311    0.122    0.353 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3194608626


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jan 6, 2022  5:17 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_014085122.1 PREDICTED: uncharacterized protein LOC106614107
[Bactrocera oleae]

Length=1376
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VRN4_DROME  unnamed protein product                                 1153    0.0  
M9PBR0_DROME  unnamed protein product                                 1143    0.0  
BLMP1_CAEEL  unnamed protein product                                  270     7e-76


>Q9VRN4_DROME unnamed protein product
Length=1203

 Score = 1153 bits (2982),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 691/1125 (61%), Positives = 774/1125 (69%), Gaps = 180/1125 (16%)

Query  100   PSPDGTQDYDVTRMREDDFERLAVYIVPDVQCERGIANRADRTLPRSLTLKPSMVFSTPN  159
             P+PDG QDYDVTRMRE+DFERLAVY+VPDVQ ERG+ NRAD+TLPRSLTLK SMV+STPN
Sbjct  79    PTPDGNQDYDVTRMREEDFERLAVYLVPDVQAERGLPNRADKTLPRSLTLKSSMVYSTPN  138

Query  160   VKTEGVWSTGVIPRGTRFGPFEGVPTPNYPNDTNKARYFWRIFKDDYFYYLDGSDRAQAN  219
             VKTEGVWS+GVIPRGTRFGPFEG+PT NYPND NKARYFWRIFKDD +YYLDGSDR+Q+N
Sbjct  139   VKTEGVWSSGVIPRGTRFGPFEGIPTSNYPNDKNKARYFWRIFKDDDYYYLDGSDRSQSN  198

Query  220   WMRYVASAYSLSVMNLVACQHQENIYFYTTRDIMPNEELMVWYCKDFARRLGYDVDPERT  279
             WMRYVASAYSLSVMNLVACQHQENIYFYTTRDI+PNEELMVWYCKDFA RLGYDVDPE T
Sbjct  199   WMRYVASAYSLSVMNLVACQHQENIYFYTTRDILPNEELMVWYCKDFASRLGYDVDPETT  258

Query  280   IFGACKQAVDDDEDAEADGEDEDVPSNATASSTLLLSHKAKLRSNSPYCMPAPEIPPEVA  339
             IFGACKQAV+ +               A            K R    Y MPAPEIPP+VA
Sbjct  259   IFGACKQAVEAE-------------EEADEEEEEAEGEDGKPR----YSMPAPEIPPDVA  301

Query  340   YNHITYVMGLPIPPLPAVVAGNA--------TVSRRSITPSPSPPSCRDANASHVPQHLV  391
              +HITYVMGL +P    V AGN         +VS  +  P  + P CR ++         
Sbjct  302   VSHITYVMGLHLP----VGAGNGPANGSVAGSVSGATPPPPTATPCCRRSS---------  348

Query  392   GLPHIQHAQSTQRPSAHQLSTQQLPTTHLQHHQQHIQQHQTVLHLKQEPGASVIV-RERS  450
                          P AH  +T    T+    H  HIQ  +          ASVI+ ++RS
Sbjct  349   -------------PPAHVSTT----TSTCNAHHPHIQHGRH---------ASVIIGQDRS  382

Query  451   PAASECGAKDAKEVAGSPLPHKDTHYEHQLTPNDGSVRSVRSDEGYHSNEYHEDGLTPPE  510
             P AS       K+ AGSPL   D    HQ+TP DGSVRSVRSDEGYHSNE HEDGLTPPE
Sbjct  383   PMAS-----SDKDTAGSPLSGLD----HQMTPQDGSVRSVRSDEGYHSNECHEDGLTPPE  433

Query  511   DSSDSESEHNYVLDCSKKAIAPKETVITHPQKAAVAAAVAAAAAAANSSSNNNAAVNNCG  570
             DSSDSESEHNYVLDCSKKAIAPKETVI   QK + +     A   AN+++N+        
Sbjct  434   DSSDSESEHNYVLDCSKKAIAPKETVIAQAQKPSSSPP---AVVMANTTTNS--------  482

Query  571   PATSVTPAVVSSAAAAIDCGGGDKNEYRKFKVKMPLKYEFKNSKCAIKTEAMCHINNINN  630
                     +  S+  A      DKNEYRKFKVKMPLKYEFKN  C  +  ++  +     
Sbjct  483   -------MISHSSPTATPICETDKNEYRKFKVKMPLKYEFKNKTCVKQEPSLKEV-----  530

Query  631   SKQNTSDELPTVGATSSEDDLLAANEATPACTSSTQLDDEAMDV----------DHMPGS  680
                   D+  ++     ED ++     +   +++T L DE M +                
Sbjct  531   ------DQEMSLPQEEEEDQVMHPEPDSICPSTTTHLGDEHMLMMERERERERERIQERE  584

Query  681   TTQQQHASSTVIMVDRSLNNTNGHATRTIVPLNKAYYEAETTTPPPPPTAAQTSSAAGVA  740
              + QQ ASSTVI+++   +N+ G A RTIVPL+K YYE      P PP         G  
Sbjct  585   PSNQQPASSTVIVLE---HNSGGQA-RTIVPLSKPYYE------PDPP---------GER  625

Query  741   YMRFTPPSSSILETILTGQHRLEAAAAAAAACRQANAATPPPSSPTEMAYSYKKSHRYGN  800
             YMRF  PSSSILETILT QHRLEAAAAAA ACRQANAATPPP+SPTEMAYSYKKS RYGN
Sbjct  626   YMRFGQPSSSILETILTSQHRLEAAAAAANACRQANAATPPPTSPTEMAYSYKKSQRYGN  685

Query  801   AVSPDSSSNLAQAPDM---HAAALHDTEMLIASSRGSLKDDCSPPPASGH--DLKFSPAH  855
             AVSPDSSSNL Q P+     A  + + EM  A+    +K +CSPPP S H  ++ FSP+ 
Sbjct  686   AVSPDSSSNLGQNPEQLSSSAVVVGEQEMTRATM---IKGECSPPPPSHHHHNVIFSPSR  742

Query  856   VAHSAFVSDGHQTPPYSAYSPYSSGSVNGGAPGGGHP----LSHMPTSTFHSPPHSSHSP  911
               H+A++                +G   G +P  G+P         TSTFHSPPHSSHSP
Sbjct  743   --HAAYLG---------------AGEAGGHSPSPGYPGYPHYGAAATSTFHSPPHSSHSP  785

Query  912   FDRQWDASSG--STPNLHLLQSSSQML-------------MKPLRISPPSSLSPDGNSCP  956
             FDRQ +ASSG  S  NLHLLQ+S+QML             + PLRISPPSSLSPDGNSCP
Sbjct  786   FDRQSNASSGAGSATNLHLLQTSTQMLNHPLMQPLTPLQRLSPLRISPPSSLSPDGNSCP  845

Query  957   RSGSPLSPNSLAARGYRSLPYPLKKKDGKMHYECNVCCKTFGQLSNLKVHLRTHSGERPF  1016
             RSGSPLSPNSLA+RGYRSLPYPLKKKDGKMHYECNVCCKTFGQLSNLKVHLRTHSGERPF
Sbjct  846   RSGSPLSPNSLASRGYRSLPYPLKKKDGKMHYECNVCCKTFGQLSNLKVHLRTHSGERPF  905

Query  1017  KCNVCTKSFTQLAHLQKHHLVHTGEKPHQCDICKKRFSSTSNLKTHLRLHSGQKPYACDL  1076
             KCNVCTKSFTQLAHLQKHHLVHTGEKPHQCDICKKRFSSTSNLKTHLRLHSGQKPYACDL
Sbjct  906   KCNVCTKSFTQLAHLQKHHLVHTGEKPHQCDICKKRFSSTSNLKTHLRLHSGQKPYACDL  965

Query  1077  CPQKFTQFVHLKLHKRLHTNDRPYVCQGCDKKYISASGLRTHWKTTSCKPNDLEEELAMA  1136
             CPQKFTQFVHLKLHKRLHTNDRPYVCQGCDKKYISASGLRTHWKTTSCKPN+LEEELAMA
Sbjct  966   CPQKFTQFVHLKLHKRLHTNDRPYVCQGCDKKYISASGLRTHWKTTSCKPNNLEEELAMA  1025

Query  1137  AAATSECLDKYVPEPDSREAFEHMQQQM----HPHLRHLPPGSGS  1177
             AAATSECLDK  PEPDSREA+E + Q M    HP LRHL  G  S
Sbjct  1026  AAATSECLDKDHPEPDSREAYEQLTQHMHPAVHPGLRHLSSGGQS  1070


 Score = 43.5 bits (101),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/25 (88%), Positives = 22/25 (88%), Gaps = 1/25 (4%)

Query  1353  QHAQNQESRPSVIESS-QPMIIECT  1376
             QH Q QESRPSVIESS QPMIIECT
Sbjct  1179  QHVQAQESRPSVIESSNQPMIIECT  1203


>M9PBR0_DROME unnamed protein product
Length=1216

 Score = 1143 bits (2956),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 691/1138 (61%), Positives = 774/1138 (68%), Gaps = 193/1138 (17%)

Query  100   PSPDGTQDYDVTRMREDDFERLAVYIVPDVQCERGIANRADRTLPRSLTLKPSMVFSTPN  159
             P+PDG QDYDVTRMRE+DFERLAVY+VPDVQ ERG+ NRAD+TLPRSLTLK SMV+STPN
Sbjct  79    PTPDGNQDYDVTRMREEDFERLAVYLVPDVQAERGLPNRADKTLPRSLTLKSSMVYSTPN  138

Query  160   VKTEGVWSTGVIPRGTRFGPFEGVPTPNYPNDTNKARYFWR-------------IFKDDY  206
             VKTEGVWS+GVIPRGTRFGPFEG+PT NYPND NKARYFWR             IFKDD 
Sbjct  139   VKTEGVWSSGVIPRGTRFGPFEGIPTSNYPNDKNKARYFWRVQGTRHITYGNIKIFKDDD  198

Query  207   FYYLDGSDRAQANWMRYVASAYSLSVMNLVACQHQENIYFYTTRDIMPNEELMVWYCKDF  266
             +YYLDGSDR+Q+NWMRYVASAYSLSVMNLVACQHQENIYFYTTRDI+PNEELMVWYCKDF
Sbjct  199   YYYLDGSDRSQSNWMRYVASAYSLSVMNLVACQHQENIYFYTTRDILPNEELMVWYCKDF  258

Query  267   ARRLGYDVDPERTIFGACKQAVDDDEDAEADGEDEDVPSNATASSTLLLSHKAKLRSNSP  326
             A RLGYDVDPE TIFGACKQAV+ +               A            K R    
Sbjct  259   ASRLGYDVDPETTIFGACKQAVEAE-------------EEADEEEEEAEGEDGKPR----  301

Query  327   YCMPAPEIPPEVAYNHITYVMGLPIPPLPAVVAGNA--------TVSRRSITPSPSPPSC  378
             Y MPAPEIPP+VA +HITYVMGL +P    V AGN         +VS  +  P  + P C
Sbjct  302   YSMPAPEIPPDVAVSHITYVMGLHLP----VGAGNGPANGSVAGSVSGATPPPPTATPCC  357

Query  379   RDANASHVPQHLVGLPHIQHAQSTQRPSAHQLSTQQLPTTHLQHHQQHIQQHQTVLHLKQ  438
             R ++                      P AH  +T    T+    H  HIQ  +       
Sbjct  358   RRSS----------------------PPAHVSTT----TSTCNAHHPHIQHGRH------  385

Query  439   EPGASVIV-RERSPAASECGAKDAKEVAGSPLPHKDTHYEHQLTPNDGSVRSVRSDEGYH  497
                ASVI+ ++RSP AS       K+ AGSPL   D    HQ+TP DGSVRSVRSDEGYH
Sbjct  386   ---ASVIIGQDRSPMAS-----SDKDTAGSPLSGLD----HQMTPQDGSVRSVRSDEGYH  433

Query  498   SNEYHEDGLTPPEDSSDSESEHNYVLDCSKKAIAPKETVITHPQKAAVAAAVAAAAAAAN  557
             SNE HEDGLTPPEDSSDSESEHNYVLDCSKKAIAPKETVI   QK + +     A   AN
Sbjct  434   SNECHEDGLTPPEDSSDSESEHNYVLDCSKKAIAPKETVIAQAQKPSSSPP---AVVMAN  490

Query  558   SSSNNNAAVNNCGPATSVTPAVVSSAAAAIDCGGGDKNEYRKFKVKMPLKYEFKNSKCAI  617
             +++N+                +  S+  A      DKNEYRKFKVKMPLKYEFKN  C  
Sbjct  491   TTTNS---------------MISHSSPTATPICETDKNEYRKFKVKMPLKYEFKNKTCVK  535

Query  618   KTEAMCHINNINNSKQNTSDELPTVGATSSEDDLLAANEATPACTSSTQLDDEAMDV---  674
             +  ++  +           D+  ++     ED ++     +   +++T L DE M +   
Sbjct  536   QEPSLKEV-----------DQEMSLPQEEEEDQVMHPEPDSICPSTTTHLGDEHMLMMER  584

Query  675   -------DHMPGSTTQQQHASSTVIMVDRSLNNTNGHATRTIVPLNKAYYEAETTTPPPP  727
                           + QQ ASSTVI+++   +N+ G A RTIVPL+K YYE      P P
Sbjct  585   ERERERERIQEREPSNQQPASSTVIVLE---HNSGGQA-RTIVPLSKPYYE------PDP  634

Query  728   PTAAQTSSAAGVAYMRFTPPSSSILETILTGQHRLEAAAAAAAACRQANAATPPPSSPTE  787
             P         G  YMRF  PSSSILETILT QHRLEAAAAAA ACRQANAATPPP+SPTE
Sbjct  635   P---------GERYMRFGQPSSSILETILTSQHRLEAAAAAANACRQANAATPPPTSPTE  685

Query  788   MAYSYKKSHRYGNAVSPDSSSNLAQAPDM---HAAALHDTEMLIASSRGSLKDDCSPPPA  844
             MAYSYKKS RYGNAVSPDSSSNL Q P+     A  + + EM  A+    +K +CSPPP 
Sbjct  686   MAYSYKKSQRYGNAVSPDSSSNLGQNPEQLSSSAVVVGEQEMTRATM---IKGECSPPPP  742

Query  845   SGH--DLKFSPAHVAHSAFVSDGHQTPPYSAYSPYSSGSVNGGAPGGGHP----LSHMPT  898
             S H  ++ FSP+   H+A++                +G   G +P  G+P         T
Sbjct  743   SHHHHNVIFSPSR--HAAYLG---------------AGEAGGHSPSPGYPGYPHYGAAAT  785

Query  899   STFHSPPHSSHSPFDRQWDASSG--STPNLHLLQSSSQML-------------MKPLRIS  943
             STFHSPPHSSHSPFDRQ +ASSG  S  NLHLLQ+S+QML             + PLRIS
Sbjct  786   STFHSPPHSSHSPFDRQSNASSGAGSATNLHLLQTSTQMLNHPLMQPLTPLQRLSPLRIS  845

Query  944   PPSSLSPDGNSCPRSGSPLSPNSLAARGYRSLPYPLKKKDGKMHYECNVCCKTFGQLSNL  1003
             PPSSLSPDGNSCPRSGSPLSPNSLA+RGYRSLPYPLKKKDGKMHYECNVCCKTFGQLSNL
Sbjct  846   PPSSLSPDGNSCPRSGSPLSPNSLASRGYRSLPYPLKKKDGKMHYECNVCCKTFGQLSNL  905

Query  1004  KVHLRTHSGERPFKCNVCTKSFTQLAHLQKHHLVHTGEKPHQCDICKKRFSSTSNLKTHL  1063
             KVHLRTHSGERPFKCNVCTKSFTQLAHLQKHHLVHTGEKPHQCDICKKRFSSTSNLKTHL
Sbjct  906   KVHLRTHSGERPFKCNVCTKSFTQLAHLQKHHLVHTGEKPHQCDICKKRFSSTSNLKTHL  965

Query  1064  RLHSGQKPYACDLCPQKFTQFVHLKLHKRLHTNDRPYVCQGCDKKYISASGLRTHWKTTS  1123
             RLHSGQKPYACDLCPQKFTQFVHLKLHKRLHTNDRPYVCQGCDKKYISASGLRTHWKTTS
Sbjct  966   RLHSGQKPYACDLCPQKFTQFVHLKLHKRLHTNDRPYVCQGCDKKYISASGLRTHWKTTS  1025

Query  1124  CKPNDLEEELAMAAAATSECLDKYVPEPDSREAFEHMQQQM----HPHLRHLPPGSGS  1177
             CKPN+LEEELAMAAAATSECLDK  PEPDSREA+E + Q M    HP LRHL  G  S
Sbjct  1026  CKPNNLEEELAMAAAATSECLDKDHPEPDSREAYEQLTQHMHPAVHPGLRHLSSGGQS  1083


 Score = 43.5 bits (101),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/25 (88%), Positives = 22/25 (88%), Gaps = 1/25 (4%)

Query  1353  QHAQNQESRPSVIESS-QPMIIECT  1376
             QH Q QESRPSVIESS QPMIIECT
Sbjct  1192  QHVQAQESRPSVIESSNQPMIIECT  1216


>BLMP1_CAEEL unnamed protein product
Length=817

 Score = 270 bits (690),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 134/157 (85%), Gaps = 0/157 (0%)

Query  977   YPLKKKDGKMHYECNVCCKTFGQLSNLKVHLRTHSGERPFKCNVCTKSFTQLAHLQKHHL  1036
             Y  ++++GK  Y C  C KTFGQLSNLKVH+RTH+GERPFKC +CTK FTQLAHLQKHHL
Sbjct  497   YVQQQENGKTRYACKDCNKTFGQLSNLKVHVRTHTGERPFKCEICTKEFTQLAHLQKHHL  556

Query  1037  VHTGEKPHQCDICKKRFSSTSNLKTHLRLHSGQKPYACDLCPQKFTQFVHLKLHKRLHTN  1096
             VHTGE+PH+CDIC KRFSSTSNLKTHLRLH+GQKPY CD+C  KFTQ+VHL+LHKRLH N
Sbjct  557   VHTGERPHRCDICDKRFSSTSNLKTHLRLHNGQKPYTCDVCDAKFTQYVHLRLHKRLHAN  616

Query  1097  DRPYVCQGCDKKYISASGLRTHWKTTSCKPNDLEEEL  1133
             +RPY C  C KKYIS SGLRTHWKTT+CK  D+++ +
Sbjct  617   ERPYSCGTCGKKYISPSGLRTHWKTTTCKEEDMKDSM  653


 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 62/199 (31%), Positives = 86/199 (43%), Gaps = 42/199 (21%)

Query  109  DVTRMREDDFERLAVYIVPDVQCERGIANRADRTLPRSLTLKPSMVFSTPNVKTEGVWST  168
            D  +  +++   L ++ VPD         RA+ TLP +L LK S      N K   +WS+
Sbjct  67   DWKQSGDENLAELCIFHVPDKSVSLPNPKRAECTLPMNLILKSSSK----NRKKSSIWSS  122

Query  169  GVIPRGTRFGPFEG----------------------------VPTPNYPNDTNKARYFWR  200
              IPRG RFGP  G                            VP    P +       W+
Sbjct  123  DHIPRGVRFGPLVGEIRLVDVDTALVCPAEASMAGGGPAQEDVPFDEAPEE-------WK  175

Query  201  IFK---DDYFYYLDGSDRAQANWMRYVASAYSLSVMNLVACQHQENIYFYTTRDIMPNEE  257
            I+          +   D A++NWM+YVA+A      NLVA Q   +IYFYT + I  N E
Sbjct  176  IYSPSGGRLNKTICVKDDARSNWMKYVAAAEEEDFQNLVAAQIGNDIYFYTVKKIEANTE  235

Query  258  LMVWYCKDFARRLGYDVDP  276
            L  W+ +D+AR+L Y   P
Sbjct  236  LSFWFSRDYARKLNYSTRP  254



Lambda      K        H
   0.312    0.124    0.369 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 18013231158


Query= XP_014085123.1 PREDICTED: pre-mRNA-splicing factor CWC21 [Bactrocera
oleae]

Length=422
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TRSF_MUSDO  unnamed protein product                                   64.3    4e-11


>TRSF_MUSDO unnamed protein product
Length=367

 Score = 64.3 bits (155),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 60/180 (33%), Positives = 85/180 (47%), Gaps = 38/180 (21%)

Query  15   IQIKQHVPNGSIRKGPHAIERS--LVPDEVVIKRRFGEGSKPLFQRDDIVVNPESVTNTA  72
            I++ Q   + + +KGP  I RS  L+ +E+ IKRRFGEG+KPLF+RDD+ VN        
Sbjct  30   IKVHQQPTSATEKKGPSMIARSNDLI-EEIQIKRRFGEGTKPLFERDDVKVN--------  80

Query  73   DAQNDKQIQAETRNNTEDISNRRRKERHISTDSSSPERYRKYHT---SQKNESEIGSSNN  129
                       T  + E IS+++ K    S+ S       K ++   +QK   + GSS N
Sbjct  81   -----------TVADGESISSKKIKSHKASSPSKGVNGLVKQNSPDVTQKFTKKYGSSEN  129

Query  130  TTRR-----TKTAKPTSDGKYAVRRDVSPPPNRHRRIPEKIPYFVDEVREQDRIRRKYGS  184
               R      K     S+ K  V  +      R        PYF D +RE+DR+RR YGS
Sbjct  130  PDFRRHSSYEKDNYHKSNSKSGVHLEGHEGNYR--------PYFSDPIRERDRLRRLYGS  181



Lambda      K        H
   0.312    0.124    0.369 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 18013231158


Query= XP_014085124.1 PREDICTED: pre-mRNA-splicing factor CWC21 [Bactrocera
oleae]

Length=422
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TRSF_MUSDO  unnamed protein product                                   64.3    4e-11


>TRSF_MUSDO unnamed protein product
Length=367

 Score = 64.3 bits (155),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 60/180 (33%), Positives = 85/180 (47%), Gaps = 38/180 (21%)

Query  15   IQIKQHVPNGSIRKGPHAIERS--LVPDEVVIKRRFGEGSKPLFQRDDIVVNPESVTNTA  72
            I++ Q   + + +KGP  I RS  L+ +E+ IKRRFGEG+KPLF+RDD+ VN        
Sbjct  30   IKVHQQPTSATEKKGPSMIARSNDLI-EEIQIKRRFGEGTKPLFERDDVKVN--------  80

Query  73   DAQNDKQIQAETRNNTEDISNRRRKERHISTDSSSPERYRKYHT---SQKNESEIGSSNN  129
                       T  + E IS+++ K    S+ S       K ++   +QK   + GSS N
Sbjct  81   -----------TVADGESISSKKIKSHKASSPSKGVNGLVKQNSPDVTQKFTKKYGSSEN  129

Query  130  TTRR-----TKTAKPTSDGKYAVRRDVSPPPNRHRRIPEKIPYFVDEVREQDRIRRKYGS  184
               R      K     S+ K  V  +      R        PYF D +RE+DR+RR YGS
Sbjct  130  PDFRRHSSYEKDNYHKSNSKSGVHLEGHEGNYR--------PYFSDPIRERDRLRRLYGS  181



Lambda      K        H
   0.312    0.124    0.369 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 18013231158


Query= XP_014085125.1 PREDICTED: pre-mRNA-splicing factor CWC21 [Bactrocera
oleae]

Length=422
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TRSF_MUSDO  unnamed protein product                                   64.3    4e-11


>TRSF_MUSDO unnamed protein product
Length=367

 Score = 64.3 bits (155),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 60/180 (33%), Positives = 85/180 (47%), Gaps = 38/180 (21%)

Query  15   IQIKQHVPNGSIRKGPHAIERS--LVPDEVVIKRRFGEGSKPLFQRDDIVVNPESVTNTA  72
            I++ Q   + + +KGP  I RS  L+ +E+ IKRRFGEG+KPLF+RDD+ VN        
Sbjct  30   IKVHQQPTSATEKKGPSMIARSNDLI-EEIQIKRRFGEGTKPLFERDDVKVN--------  80

Query  73   DAQNDKQIQAETRNNTEDISNRRRKERHISTDSSSPERYRKYHT---SQKNESEIGSSNN  129
                       T  + E IS+++ K    S+ S       K ++   +QK   + GSS N
Sbjct  81   -----------TVADGESISSKKIKSHKASSPSKGVNGLVKQNSPDVTQKFTKKYGSSEN  129

Query  130  TTRR-----TKTAKPTSDGKYAVRRDVSPPPNRHRRIPEKIPYFVDEVREQDRIRRKYGS  184
               R      K     S+ K  V  +      R        PYF D +RE+DR+RR YGS
Sbjct  130  PDFRRHSSYEKDNYHKSNSKSGVHLEGHEGNYR--------PYFSDPIRERDRLRRLYGS  181



Lambda      K        H
   0.312    0.124    0.369 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 18013231158


Query= XP_014085126.1 PREDICTED: dolichyl-diphosphooligosaccharide--protein
glycosyltransferase subunit 4 isoform X2 [Bactrocera oleae]

Length=39
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q3HKQ1_DROME  unnamed protein product                                 26.2    0.48 
O18033_CAEEL  unnamed protein product                                 23.9    3.8  
A5JYX8_CAEEL  unnamed protein product                                 23.9    3.8  


>Q3HKQ1_DROME unnamed protein product
Length=106

 Score = 26.2 bits (56),  Expect = 0.48, Method: Compositional matrix adjust.
 Identities = 10/23 (43%), Positives = 17/23 (74%), Gaps = 0/23 (0%)

Query  1   MISDVQLAIFSNVLGVFLFLLVV  23
           M S+VQL +F N++ +F F+ +V
Sbjct  76  MNSEVQLPLFQNIIKIFKFIWLV  98


>O18033_CAEEL unnamed protein product
Length=557

 Score = 23.9 bits (50),  Expect = 3.8, Method: Composition-based stats.
 Identities = 10/30 (33%), Positives = 19/30 (63%), Gaps = 0/30 (0%)

Query  5    VQLAIFSNVLGVFLFLLVVAYHYISANSNN  34
            V+ A+F  V+   +F  + A++YI+ +S N
Sbjct  514  VKPAVFELVIAAGVFTYLSAFYYIATHSQN  543


>A5JYX8_CAEEL unnamed protein product
Length=563

 Score = 23.9 bits (50),  Expect = 3.8, Method: Composition-based stats.
 Identities = 10/30 (33%), Positives = 19/30 (63%), Gaps = 0/30 (0%)

Query  5    VQLAIFSNVLGVFLFLLVVAYHYISANSNN  34
            V+ A+F  V+   +F  + A++YI+ +S N
Sbjct  520  VKPAVFELVIAAGVFTYLSAFYYIATHSQN  549



Lambda      K        H
   0.312    0.124    0.369 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 18013231158


Query= XP_014085127.1 PREDICTED: pre-mRNA-splicing factor CWC21 [Bactrocera
oleae]

Length=422
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TRSF_MUSDO  unnamed protein product                                   64.3    4e-11


>TRSF_MUSDO unnamed protein product
Length=367

 Score = 64.3 bits (155),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 60/180 (33%), Positives = 85/180 (47%), Gaps = 38/180 (21%)

Query  15   IQIKQHVPNGSIRKGPHAIERS--LVPDEVVIKRRFGEGSKPLFQRDDIVVNPESVTNTA  72
            I++ Q   + + +KGP  I RS  L+ +E+ IKRRFGEG+KPLF+RDD+ VN        
Sbjct  30   IKVHQQPTSATEKKGPSMIARSNDLI-EEIQIKRRFGEGTKPLFERDDVKVN--------  80

Query  73   DAQNDKQIQAETRNNTEDISNRRRKERHISTDSSSPERYRKYHT---SQKNESEIGSSNN  129
                       T  + E IS+++ K    S+ S       K ++   +QK   + GSS N
Sbjct  81   -----------TVADGESISSKKIKSHKASSPSKGVNGLVKQNSPDVTQKFTKKYGSSEN  129

Query  130  TTRR-----TKTAKPTSDGKYAVRRDVSPPPNRHRRIPEKIPYFVDEVREQDRIRRKYGS  184
               R      K     S+ K  V  +      R        PYF D +RE+DR+RR YGS
Sbjct  130  PDFRRHSSYEKDNYHKSNSKSGVHLEGHEGNYR--------PYFSDPIRERDRLRRLYGS  181



Lambda      K        H
   0.312    0.124    0.369 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 18013231158


Query= XP_014085128.1 PREDICTED: pre-mRNA-splicing factor CWC21 [Bactrocera
oleae]

Length=422
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TRSF_MUSDO  unnamed protein product                                   64.3    4e-11


>TRSF_MUSDO unnamed protein product
Length=367

 Score = 64.3 bits (155),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 60/180 (33%), Positives = 85/180 (47%), Gaps = 38/180 (21%)

Query  15   IQIKQHVPNGSIRKGPHAIERS--LVPDEVVIKRRFGEGSKPLFQRDDIVVNPESVTNTA  72
            I++ Q   + + +KGP  I RS  L+ +E+ IKRRFGEG+KPLF+RDD+ VN        
Sbjct  30   IKVHQQPTSATEKKGPSMIARSNDLI-EEIQIKRRFGEGTKPLFERDDVKVN--------  80

Query  73   DAQNDKQIQAETRNNTEDISNRRRKERHISTDSSSPERYRKYHT---SQKNESEIGSSNN  129
                       T  + E IS+++ K    S+ S       K ++   +QK   + GSS N
Sbjct  81   -----------TVADGESISSKKIKSHKASSPSKGVNGLVKQNSPDVTQKFTKKYGSSEN  129

Query  130  TTRR-----TKTAKPTSDGKYAVRRDVSPPPNRHRRIPEKIPYFVDEVREQDRIRRKYGS  184
               R      K     S+ K  V  +      R        PYF D +RE+DR+RR YGS
Sbjct  130  PDFRRHSSYEKDNYHKSNSKSGVHLEGHEGNYR--------PYFSDPIRERDRLRRLYGS  181



Lambda      K        H
   0.312    0.124    0.369 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 18013231158


Query= XP_014085129.1 PREDICTED: polycomb group RING finger protein 3
[Bactrocera oleae]

Length=222
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PSC_DROME  unnamed protein product                                    142     6e-39
Q19336_CAEEL  unnamed protein product                                 138     6e-38
SUZ2_DROME  unnamed protein product                                   80.5    2e-17


>PSC_DROME unnamed protein product
Length=1601

 Score = 142 bits (359),  Expect = 6e-39, Method: Composition-based stats.
 Identities = 83/221 (38%), Positives = 116/221 (52%), Gaps = 12/221 (5%)

Query  3    RRVKLKTINPHITCKICGGYFIDATTVTECLHTFCKSCLVKHLEEKKTCPTCDMVIHQSH  62
            R V L  +NPHI C +C GY I+ATT+ ECLH+FC SCL+ HL +++ CP C+MVI+ + 
Sbjct  250  RPVLLTAVNPHIICHLCQGYLINATTIVECLHSFCHSCLINHLRKERFCPRCEMVINNAK  309

Query  63   PLQYISFDRTMQDIVYKLVPNLQEDEMRRERDFYKSRNIPCPKDMPQNHDDDEKMLEAHA  122
            P   I  D T+Q IVYKLVP L E E+ R+R FYK R        P+   DD + L    
Sbjct  310  P--NIKSDTTLQAIVYKLVPGLYERELMRKRAFYKDRPEEAALATPEQRGDDTEHLIFSP  367

Query  123  ESDFH---RLDEQVNVSLECMSNNFKNLQRRFIRCSSQATITHLKKLVAKKILNGIDKYR  179
              D        E   +  +        L+ R+++C +   ++HLKK V  K    ID  R
Sbjct  368  SDDMSLSLEYAELGELKTDSEPELVDTLRPRYLQCPAMCRVSHLKKFVYDKF--EIDAQR  425

Query  180  -EIDILCNEE---LLGKDHTLKFVYVTRWRFRDPPLRLQFR  216
              IDI+   +   LL     +   Y+  W+ RD P+R  +R
Sbjct  426  FSIDIMYKVKTIVLLDYYTLMDIAYIYTWK-RDAPMRFYYR  465


>Q19336_CAEEL unnamed protein product
Length=549

 Score = 138 bits (347),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 71/216 (33%), Positives = 122/216 (56%), Gaps = 14/216 (6%)

Query  4    RVKLKTINPHITCKICGGYFIDATTVTECLHTFCKSCLVKHLE-EKKTCPTCDMVIHQSH  62
            +  ++ +NP ITC IC GY +DATT+ +C+HTFCKSCL+ + E +  TCPTC   IH SH
Sbjct  317  KYNMEVLNPFITCGICDGYIVDATTIIDCMHTFCKSCLLTYFESDNNTCPTCGTFIHGSH  376

Query  63   PLQYISFDRTMQDIVYKLVPNLQEDEMRRERDFYKSRNIPCPKDMPQNHDDDEKMLEAHA  122
            P  Y+++DR + ++V + VP ++ +E+   + F +        D      + ++ LE   
Sbjct  377  PTHYVTYDRAVNELVNQFVPKMENNELDVRKTFLRDCREALGIDTAAEDRERKERLERER  436

Query  123  ES-------------DFHRLDEQVNVSLECMSNNFKNLQRRFIRCSSQATITHLKKLVAK  169
             +               HR D QV V+L   + N   + R ++RCS   T+  LKK ++ 
Sbjct  437  ITGTNRCYPLERPRFSHHRDDCQVTVNLLPGTANLPLITRPYVRCSEMTTMNTLKKFLSL  496

Query  170  KILNGIDKYREIDILCNEELLGKDHTLKFVYVTRWR  205
            +I +   +Y ++D+ C+ +L+GKD +++FV++ + R
Sbjct  497  QIWDDQSRYSDLDMFCDGQLMGKDFSVRFVWMMKRR  532


>SUZ2_DROME unnamed protein product
Length=1368

 Score = 80.5 bits (197),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 57/211 (27%), Positives = 99/211 (47%), Gaps = 23/211 (11%)

Query  14   ITCKICGGYFIDATTVTECLHTFCKSCLVKHLEEKKTCPTCDMVIHQSHPLQYISFDRTM  73
            ITC++C GY ID TTV  C HT+C+SC++KHL     CP C     +      +  D T+
Sbjct  33   ITCRLCRGYMIDPTTVDYCYHTYCRSCILKHLLRAVYCPECKASGGKEINELNLKSDDTL  92

Query  74   QDIVYKLVPNLQEDEMRRERDFYKSRNIPCPKDMPQNHDDDEKMLEAHAESDFHRLDEQV  133
            + ++YKLVP L + E +   DF +  ++            DE+  +   E +F    E +
Sbjct  93   RSLIYKLVPGLYQRECKELADFKEQHDLV-----------DEQTTD---EPEFFTTTELI  138

Query  134  NVSLECMSNNFKNL------QRRFIRCSSQATITHLKKLVAKKI-LNGIDKYREIDILCN  186
            ++SLE                  +++C++   +  LK+ +  K  +   +   E+++   
Sbjct  139  SLSLEYHPAMLHQCGPGEVPPTIYLQCAAGLPVELLKRFLCSKYNIETDNGLVEVEVTYK  198

Query  187  EELLGKDHTLKFV-YVTRWRFRDPPLRLQFR  216
            +E+L  + TL  V Y   W  R+ P+   +R
Sbjct  199  DEVLPTNFTLMDVAYCYNWS-RESPMAFCYR  228



Lambda      K        H
   0.312    0.124    0.369 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 18013231158


Query= XP_014085130.1 PREDICTED: transportin-1-like [Bactrocera oleae]

Length=886
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VRV8_DROME  unnamed protein product                                 1668    0.0  
Q86PD5_DROME  unnamed protein product                                 1665    0.0  
O76331_DROME  unnamed protein product                                 1657    0.0  


>Q9VRV8_DROME unnamed protein product
Length=893

 Score = 1668 bits (4319),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 805/893 (90%), Positives = 852/893 (95%), Gaps = 7/893 (1%)

Query  1    MTWEPQAEGLQQIITILKQSQSPDTATQMAVQLKLEELNQYPDFNNYLIYVLTKLKTEEE  60
            MTWEPQ EGLQQII ILK+SQSPDTATQMAVQ+KLEE N+YPDFNNYLIYVLTKLKTE+E
Sbjct  1    MTWEPQGEGLQQIIAILKESQSPDTATQMAVQMKLEEFNRYPDFNNYLIYVLTKLKTEDE  60

Query  61   PTRSLSGLILKNNIRMHGNNLQPEIVEYIKHECLQAIGDPSPLIRATVGILITTIASNGG  120
            PTRSLSGLILKNNIRMHG  LQPEIVEYIKHECLQA+GD SPLIRATVGILITTIASNGG
Sbjct  61   PTRSLSGLILKNNIRMHGTTLQPEIVEYIKHECLQAVGDASPLIRATVGILITTIASNGG  120

Query  121  LQNWPQLLPSLCDMLDSQDYNVCEGAFSALQKICEDSAEILDSAALNRPLNVMIPKFLQY  180
            L NWPQLLPSLC+MLD+QDYNVCEGAFSALQKICEDSAEILDSAALNRPLN+MIPKFL+Y
Sbjct  121  LHNWPQLLPSLCEMLDNQDYNVCEGAFSALQKICEDSAEILDSAALNRPLNIMIPKFLEY  180

Query  181  FSHNSPKIRSHAIACINQFIVNRSQALMLHIDTFIESLFNLSSDEDHEVRKNVCHGLVML  240
            F H+SPKIRSHAIACINQFI+NRSQALML+ID+FIE+LF+LSSDEDHEVRKNVCHGLVML
Sbjct  181  FKHSSPKIRSHAIACINQFIINRSQALMLNIDSFIENLFHLSSDEDHEVRKNVCHGLVML  240

Query  241  LEVRMDRLLPHMPQIIEYMLIRTQDPDEGVALEASEFWLSLAEQNICKEVLAPYLGQLAP  300
            LEVRMDRL+PHM QIIEYML+RTQD DEGVALEASEFWLSLAEQ+ICK+VLAPYL QLAP
Sbjct  241  LEVRMDRLMPHMSQIIEYMLLRTQDTDEGVALEASEFWLSLAEQSICKDVLAPYLAQLAP  300

Query  301  VLVRGMRYSEIDIILLKGNVEEDDMVPDREEDIRPRFHKSRTHTIKSGE-------TGVD  353
            VLVRGMRYSE+DIILLKGNVEEDDMVPDREEDIRPRFHKSR HTI+S +          D
Sbjct  301  VLVRGMRYSEVDIILLKGNVEEDDMVPDREEDIRPRFHKSRAHTIRSTQEGGAGATGDDD  360

Query  354  DDDEDDVLDDDSSLSEWNLRKCSAAALDVLANVFREECLPIVLPILKDTLFHQEWVIKES  413
            DD+ +D +DDDSSLSEWNLRKCSAAALDVLANVFRE+CLP+VLPILK+TLFHQEWVIKES
Sbjct  361  DDEFEDGMDDDSSLSEWNLRKCSAAALDVLANVFREDCLPVVLPILKETLFHQEWVIKES  420

Query  414  GVLALGAIAEGCMQGMIPHLPELIPYLISCLSDKKALVRSITCWTLSRYANWVVNQPHDQ  473
            GVLALGAIAEGCMQGMI HLPELIPYLISCLSDKKALVRSITCWTLSRYANWVVNQPHDQ
Sbjct  421  GVLALGAIAEGCMQGMIQHLPELIPYLISCLSDKKALVRSITCWTLSRYANWVVNQPHDQ  480

Query  474  YLKPLMEELLKRILDSNKRVQEAACSAFATLEEEACTELVPYLEYILKTLVFAFSKYQHK  533
            YLKPLMEELLKRILDSNKRVQEAACSAFATLEEEACTELVPYLEYILKTLVFAFSKYQHK
Sbjct  481  YLKPLMEELLKRILDSNKRVQEAACSAFATLEEEACTELVPYLEYILKTLVFAFSKYQHK  540

Query  534  NLLILYDAVGTLADSVGHHLNKPQYIDILMPPLIEKWNLLKDDDKDLFPLLECLSSIATA  593
            NLLILYDAVGTLADSVGHHLNKPQYIDILMPPLI+KWNLLKDDDKDLFPLLECLSSIATA
Sbjct  541  NLLILYDAVGTLADSVGHHLNKPQYIDILMPPLIDKWNLLKDDDKDLFPLLECLSSIATA  600

Query  594  LQSGFLPYCEPVYQRCISLIEQTLNQDMACKTNPGFEHPDKERMIVALDLLSGLAEGLDG  653
            LQSGFLPYC+PVY+RCISLIEQT+NQ+M CK N  ++HPDKERMIVALDLLSGLAEGLD 
Sbjct  601  LQSGFLPYCDPVYRRCISLIEQTINQEMLCKQNQTYDHPDKERMIVALDLLSGLAEGLDR  660

Query  654  HIESLVVKSNIMQLLYQCMQDVLPEVRQSSFALLGDLTKACFQHVHPFMSEFFPILGQNL  713
            HIE+LV  SNIM LLYQCMQDVLPEVRQSSFALLGDLTKACF HVHPFM++FFPILGQNL
Sbjct  661  HIETLVANSNIMHLLYQCMQDVLPEVRQSSFALLGDLTKACFPHVHPFMADFFPILGQNL  720

Query  714  NPDYISVCNNATWAIGEICMKLGEETRQYIHLVLNELFVIINRPNTPKTLLENTAITIGR  773
            NPD+ISVCNNATWAIGEICMKLGEET+QYI LVL++LF+IINRPNTPKTLLENTAITIGR
Sbjct  721  NPDFISVCNNATWAIGEICMKLGEETKQYIRLVLSDLFIIINRPNTPKTLLENTAITIGR  780

Query  774  LGYVCPVEVAPYLPEFVRQWCTSLRHIRDNDEKDSAFRGMCHMITVNPGGVVPDFIFFCD  833
            LGYVCPVEVAPYLPEFVRQWCTSLRHIRDNDEKDSAFRGMCHMITVNP GVV DFIFFCD
Sbjct  781  LGYVCPVEVAPYLPEFVRQWCTSLRHIRDNDEKDSAFRGMCHMITVNPAGVVADFIFFCD  840

Query  834  AVASWVNPPQDLHQMIQKILHGFKTQVGEENWRRFVDQFPPNLSERLGAMYNI  886
            A+ASWVNPP+DLHQMIQKILHGFKTQVGEENWRRFV+QFPP L+ERL  MYNI
Sbjct  841  AIASWVNPPEDLHQMIQKILHGFKTQVGEENWRRFVEQFPPTLAERLTTMYNI  893


>Q86PD5_DROME unnamed protein product
Length=893

 Score = 1665 bits (4311),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 803/893 (90%), Positives = 851/893 (95%), Gaps = 7/893 (1%)

Query  1    MTWEPQAEGLQQIITILKQSQSPDTATQMAVQLKLEELNQYPDFNNYLIYVLTKLKTEEE  60
            MTWEPQ EGLQQII ILK+SQSPDTAT+MAVQ+KLEE N+YPDFNNYLIYVLTKLKTE+E
Sbjct  1    MTWEPQGEGLQQIIAILKESQSPDTATKMAVQMKLEEFNRYPDFNNYLIYVLTKLKTEDE  60

Query  61   PTRSLSGLILKNNIRMHGNNLQPEIVEYIKHECLQAIGDPSPLIRATVGILITTIASNGG  120
            PTRSLSGLILKNNIRMHG  LQPEIVEYIKHECLQA+GD SPLIRATVGILITTIASNGG
Sbjct  61   PTRSLSGLILKNNIRMHGTTLQPEIVEYIKHECLQAVGDASPLIRATVGILITTIASNGG  120

Query  121  LQNWPQLLPSLCDMLDSQDYNVCEGAFSALQKICEDSAEILDSAALNRPLNVMIPKFLQY  180
            L NWPQLLPSLC+MLD+QDYNVCEGAFSALQKICEDSAEILDSAALNRPLN+MIPKFL+Y
Sbjct  121  LHNWPQLLPSLCEMLDNQDYNVCEGAFSALQKICEDSAEILDSAALNRPLNIMIPKFLEY  180

Query  181  FSHNSPKIRSHAIACINQFIVNRSQALMLHIDTFIESLFNLSSDEDHEVRKNVCHGLVML  240
            F H+SPKIRSHAIACINQFI+NRSQALML+ID+FIE+LF+LSSDEDHEVRKNVCHGLVML
Sbjct  181  FKHSSPKIRSHAIACINQFIINRSQALMLNIDSFIENLFHLSSDEDHEVRKNVCHGLVML  240

Query  241  LEVRMDRLLPHMPQIIEYMLIRTQDPDEGVALEASEFWLSLAEQNICKEVLAPYLGQLAP  300
            LEVRMDRL+PHM QIIEYML+RTQD DEGVALEASEFWLSLAEQ+ICK+VLAPYL QLAP
Sbjct  241  LEVRMDRLMPHMSQIIEYMLLRTQDTDEGVALEASEFWLSLAEQSICKDVLAPYLAQLAP  300

Query  301  VLVRGMRYSEIDIILLKGNVEEDDMVPDREEDIRPRFHKSRTHTIKSGE-------TGVD  353
            VLVRGMRYSE+DIILLKGNVEEDDMVPDREEDIRP FHKSR HTI+S +          D
Sbjct  301  VLVRGMRYSEVDIILLKGNVEEDDMVPDREEDIRPHFHKSRAHTIRSTQEGGAGATGDDD  360

Query  354  DDDEDDVLDDDSSLSEWNLRKCSAAALDVLANVFREECLPIVLPILKDTLFHQEWVIKES  413
            DD+ +D +DDDSSLSEWNLRKCSAAALDVLANVFRE+CLP+VLPILK+TLFHQEWVIKES
Sbjct  361  DDEFEDGMDDDSSLSEWNLRKCSAAALDVLANVFREDCLPVVLPILKETLFHQEWVIKES  420

Query  414  GVLALGAIAEGCMQGMIPHLPELIPYLISCLSDKKALVRSITCWTLSRYANWVVNQPHDQ  473
            GVLALGAIAEGCMQGMI HLPELIPYLISCLSDKKALVRSITCWTLSRYANWVVNQPHDQ
Sbjct  421  GVLALGAIAEGCMQGMIQHLPELIPYLISCLSDKKALVRSITCWTLSRYANWVVNQPHDQ  480

Query  474  YLKPLMEELLKRILDSNKRVQEAACSAFATLEEEACTELVPYLEYILKTLVFAFSKYQHK  533
            YLKPLMEELLKRILDSNKRVQEAACSAFATLEEEACTELVPYLEYILKTLVFAFSKYQHK
Sbjct  481  YLKPLMEELLKRILDSNKRVQEAACSAFATLEEEACTELVPYLEYILKTLVFAFSKYQHK  540

Query  534  NLLILYDAVGTLADSVGHHLNKPQYIDILMPPLIEKWNLLKDDDKDLFPLLECLSSIATA  593
            NLLILYDAVGTLADSVGHHLNKPQYIDILMPPLI+KWNLLKDDDKDLFPLLECLSSIATA
Sbjct  541  NLLILYDAVGTLADSVGHHLNKPQYIDILMPPLIDKWNLLKDDDKDLFPLLECLSSIATA  600

Query  594  LQSGFLPYCEPVYQRCISLIEQTLNQDMACKTNPGFEHPDKERMIVALDLLSGLAEGLDG  653
            LQSGFLPYC+PVY+RCISLIEQT+NQ+M CK N  ++HPDKERMIVALDLLSGLAEGLD 
Sbjct  601  LQSGFLPYCDPVYRRCISLIEQTINQEMLCKQNQTYDHPDKERMIVALDLLSGLAEGLDR  660

Query  654  HIESLVVKSNIMQLLYQCMQDVLPEVRQSSFALLGDLTKACFQHVHPFMSEFFPILGQNL  713
            HIE+LV  SNIM LLYQCMQDVLPEVRQSSFALLGDLTKACF HVHPFM++FFPILGQNL
Sbjct  661  HIETLVANSNIMHLLYQCMQDVLPEVRQSSFALLGDLTKACFPHVHPFMADFFPILGQNL  720

Query  714  NPDYISVCNNATWAIGEICMKLGEETRQYIHLVLNELFVIINRPNTPKTLLENTAITIGR  773
            NPD+ISVCNNATWAIGEICMKLGEET+QYI LVL++LF+IINRPNTPKTLLENTAITIGR
Sbjct  721  NPDFISVCNNATWAIGEICMKLGEETKQYIRLVLSDLFIIINRPNTPKTLLENTAITIGR  780

Query  774  LGYVCPVEVAPYLPEFVRQWCTSLRHIRDNDEKDSAFRGMCHMITVNPGGVVPDFIFFCD  833
            LGYVCPVEVAPYLPEFVRQWCTSLRHIRDNDEKDSAFRGMCHMITVNP GVV DFIFFCD
Sbjct  781  LGYVCPVEVAPYLPEFVRQWCTSLRHIRDNDEKDSAFRGMCHMITVNPAGVVADFIFFCD  840

Query  834  AVASWVNPPQDLHQMIQKILHGFKTQVGEENWRRFVDQFPPNLSERLGAMYNI  886
            A+ASWVNPP+DLHQMIQKILHGFKTQVGEENWRRFV+QFPP L+ERL  MYNI
Sbjct  841  AIASWVNPPEDLHQMIQKILHGFKTQVGEENWRRFVEQFPPTLAERLTTMYNI  893


>O76331_DROME unnamed protein product
Length=893

 Score = 1657 bits (4292),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 801/893 (90%), Positives = 850/893 (95%), Gaps = 7/893 (1%)

Query  1    MTWEPQAEGLQQIITILKQSQSPDTATQMAVQLKLEELNQYPDFNNYLIYVLTKLKTEEE  60
            MTWEPQ EGLQQII ILK+SQSPDTATQMAVQ+KLEE N+YPDFNNYLIYVLTKLKTE+E
Sbjct  1    MTWEPQGEGLQQIIAILKESQSPDTATQMAVQMKLEEFNRYPDFNNYLIYVLTKLKTEDE  60

Query  61   PTRSLSGLILKNNIRMHGNNLQPEIVEYIKHECLQAIGDPSPLIRATVGILITTIASNGG  120
            PTRSLSGLILKNNIRMHG  LQPEIVEYIKHECLQA+GD SPLIRATVGILITTIASNGG
Sbjct  61   PTRSLSGLILKNNIRMHGTTLQPEIVEYIKHECLQAVGDSSPLIRATVGILITTIASNGG  120

Query  121  LQNWPQLLPSLCDMLDSQDYNVCEGAFSALQKICEDSAEILDSAALNRPLNVMIPKFLQY  180
            L NWPQLLPSLC+MLD+QDYNVCEGAFSALQKICEDSAEILDSAALNRPLN+MIPKFL+Y
Sbjct  121  LHNWPQLLPSLCEMLDNQDYNVCEGAFSALQKICEDSAEILDSAALNRPLNIMIPKFLEY  180

Query  181  FSHNSPKIRSHAIACINQFIVNRSQALMLHIDTFIESLFNLSSDEDHEVRKNVCHGLVML  240
            F H+SPKIRSHAIACINQFI+NRSQALML+ID+FIE+LF+LSSDEDHEVRKNVCHGLVML
Sbjct  181  FKHSSPKIRSHAIACINQFIINRSQALMLNIDSFIENLFHLSSDEDHEVRKNVCHGLVML  240

Query  241  LEVRMDRLLPHMPQIIEYMLIRTQDPDEGVALEASEFWLSLAEQNICKEVLAPYLGQLAP  300
            L+VRMDRL+PHM QIIEYML+RTQD DEGVALEASEFWLSLAEQ+ICK+VLAPYL QLAP
Sbjct  241  LKVRMDRLMPHMSQIIEYMLLRTQDTDEGVALEASEFWLSLAEQSICKDVLAPYLAQLAP  300

Query  301  VLVRGMRYSEIDIILLKGNVEEDDMVPDREEDIRPRFHKSRTHTIKSGE-------TGVD  353
            VLVRGMRYSE+DIILLKGNVEEDDMVPDREEDIRPRFHKSR HTI+S +          D
Sbjct  301  VLVRGMRYSEVDIILLKGNVEEDDMVPDREEDIRPRFHKSRAHTIRSTQEGGAGATGDDD  360

Query  354  DDDEDDVLDDDSSLSEWNLRKCSAAALDVLANVFREECLPIVLPILKDTLFHQEWVIKES  413
            DD+ +D +DDDSSLSEWNLRKCSAAALDVLANVFRE+CLPIVLPILK+TLFHQEWVIKES
Sbjct  361  DDEFEDGMDDDSSLSEWNLRKCSAAALDVLANVFREDCLPIVLPILKETLFHQEWVIKES  420

Query  414  GVLALGAIAEGCMQGMIPHLPELIPYLISCLSDKKALVRSITCWTLSRYANWVVNQPHDQ  473
            GVLALGAIAEGCMQGMI HLPELIPYLISCLSDKKALVRSITCWTLSRYANWVVNQPHDQ
Sbjct  421  GVLALGAIAEGCMQGMIQHLPELIPYLISCLSDKKALVRSITCWTLSRYANWVVNQPHDQ  480

Query  474  YLKPLMEELLKRILDSNKRVQEAACSAFATLEEEACTELVPYLEYILKTLVFAFSKYQHK  533
            YLKPLMEELLKRILDSNKRVQEAACSAFATLEEEACTELVPYLEYILKTLVFAFSKYQHK
Sbjct  481  YLKPLMEELLKRILDSNKRVQEAACSAFATLEEEACTELVPYLEYILKTLVFAFSKYQHK  540

Query  534  NLLILYDAVGTLADSVGHHLNKPQYIDILMPPLIEKWNLLKDDDKDLFPLLECLSSIATA  593
            NLLILYDAVG+LADSVGHHLNKPQYIDILM P+I+KWNLLKDDDKDLFPLLECLSSIATA
Sbjct  541  NLLILYDAVGSLADSVGHHLNKPQYIDILMLPIIDKWNLLKDDDKDLFPLLECLSSIATA  600

Query  594  LQSGFLPYCEPVYQRCISLIEQTLNQDMACKTNPGFEHPDKERMIVALDLLSGLAEGLDG  653
            LQSGFLPYC+PVY+RCISLIEQT+NQ+M CK N  ++HPDKERMIVALDLLSGLAEGLD 
Sbjct  601  LQSGFLPYCDPVYRRCISLIEQTINQEMLCKQNQTYDHPDKERMIVALDLLSGLAEGLDR  660

Query  654  HIESLVVKSNIMQLLYQCMQDVLPEVRQSSFALLGDLTKACFQHVHPFMSEFFPILGQNL  713
            HIE+LV  SNIM LLYQCMQDVLPEVRQSSFALLGDLTKACF HVHPFM++FFPILGQNL
Sbjct  661  HIETLVANSNIMHLLYQCMQDVLPEVRQSSFALLGDLTKACFPHVHPFMADFFPILGQNL  720

Query  714  NPDYISVCNNATWAIGEICMKLGEETRQYIHLVLNELFVIINRPNTPKTLLENTAITIGR  773
            NPD+ISVCNNATWAIGEICMKLGEET+QYI LVL++LF+IINRPNTPKTLLENTAITIGR
Sbjct  721  NPDFISVCNNATWAIGEICMKLGEETKQYIRLVLSDLFIIINRPNTPKTLLENTAITIGR  780

Query  774  LGYVCPVEVAPYLPEFVRQWCTSLRHIRDNDEKDSAFRGMCHMITVNPGGVVPDFIFFCD  833
            LGYVCPVEVAPYLPEFVRQWCTSLRHIRDNDEKDSAFRGMCHMITVNP GVV DFIFFCD
Sbjct  781  LGYVCPVEVAPYLPEFVRQWCTSLRHIRDNDEKDSAFRGMCHMITVNPAGVVADFIFFCD  840

Query  834  AVASWVNPPQDLHQMIQKILHGFKTQVGEENWRRFVDQFPPNLSERLGAMYNI  886
            A+ASWVNPP+DLHQMIQKILHGFKTQVGEENW RFV+QFPP L+ERL  MYNI
Sbjct  841  AIASWVNPPEDLHQMIQKILHGFKTQVGEENWCRFVEQFPPTLAERLTTMYNI  893



Lambda      K        H
   0.312    0.124    0.369 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 18013231158


Query= XP_014085131.1 PREDICTED: uncharacterized protein LOC106614111
[Bactrocera oleae]

Length=682
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q400N4_CAEEL  unnamed protein product                                 57.0    4e-08
Q57V79_TRYB2  unnamed protein product                                 52.4    1e-06
Q381G2_TRYB2  unnamed protein product                                 47.8    3e-05


>Q400N4_CAEEL unnamed protein product
Length=1025

 Score = 57.0 bits (136),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 29/48 (60%), Gaps = 3/48 (6%)

Query  46  ICRICHCESDPQNPLLTPCYCAGSLKYVHQACLQQWLTASETNACELC  93
           +CR+C      +  L  PC C GS+KYVHQ CL +WL  S+   CELC
Sbjct  52  MCRVCRGN---EGSLYYPCLCTGSIKYVHQECLVEWLKYSKKEVCELC  96


>Q57V79_TRYB2 unnamed protein product
Length=873

 Score = 52.4 bits (124),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/58 (38%), Positives = 33/58 (57%), Gaps = 7/58 (12%)

Query  46   ICRICHCESDPQNPLLTPCYCAGSLKYVHQACLQQWLTAS------ETNACELCKFPF  97
            ICRIC  + +    L++ C C GS++++H +CL +W   S        N CE+CK PF
Sbjct  611  ICRICR-DDETDEKLISACECIGSVRWIHVSCLDRWRIESTKRNLHNVNCCEICKKPF  667


>Q381G2_TRYB2 unnamed protein product
Length=1111

 Score = 47.8 bits (112),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 3/50 (6%)

Query  47  CRICHCESDPQNPLLTPCYCAGSLKYVHQACLQQWLTASETNACELCKFP  96
           CR+CH  +      ++PC C GS+KYVH  CL +W+   ++  CE+C  P
Sbjct  9   CRMCHSSA---GKCVSPCCCDGSIKYVHSKCLARWVRHRKSLICEVCGTP  55



Lambda      K        H
   0.312    0.124    0.369 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 18013231158


Query= XP_014085132.1 PREDICTED: uncharacterized protein LOC106614111
[Bactrocera oleae]

Length=682
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q400N4_CAEEL  unnamed protein product                                 57.0    4e-08
Q57V79_TRYB2  unnamed protein product                                 52.4    1e-06
Q381G2_TRYB2  unnamed protein product                                 47.8    3e-05


>Q400N4_CAEEL unnamed protein product
Length=1025

 Score = 57.0 bits (136),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 29/48 (60%), Gaps = 3/48 (6%)

Query  46  ICRICHCESDPQNPLLTPCYCAGSLKYVHQACLQQWLTASETNACELC  93
           +CR+C      +  L  PC C GS+KYVHQ CL +WL  S+   CELC
Sbjct  52  MCRVCRGN---EGSLYYPCLCTGSIKYVHQECLVEWLKYSKKEVCELC  96


>Q57V79_TRYB2 unnamed protein product
Length=873

 Score = 52.4 bits (124),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/58 (38%), Positives = 33/58 (57%), Gaps = 7/58 (12%)

Query  46   ICRICHCESDPQNPLLTPCYCAGSLKYVHQACLQQWLTAS------ETNACELCKFPF  97
            ICRIC  + +    L++ C C GS++++H +CL +W   S        N CE+CK PF
Sbjct  611  ICRICR-DDETDEKLISACECIGSVRWIHVSCLDRWRIESTKRNLHNVNCCEICKKPF  667


>Q381G2_TRYB2 unnamed protein product
Length=1111

 Score = 47.8 bits (112),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 3/50 (6%)

Query  47  CRICHCESDPQNPLLTPCYCAGSLKYVHQACLQQWLTASETNACELCKFP  96
           CR+CH  +      ++PC C GS+KYVH  CL +W+   ++  CE+C  P
Sbjct  9   CRMCHSSA---GKCVSPCCCDGSIKYVHSKCLARWVRHRKSLICEVCGTP  55



Lambda      K        H
   0.312    0.124    0.369 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 18013231158


Query= XP_014085133.1 PREDICTED: uncharacterized protein LOC106614111
[Bactrocera oleae]

Length=682
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q400N4_CAEEL  unnamed protein product                                 57.0    4e-08
Q57V79_TRYB2  unnamed protein product                                 52.4    1e-06
Q381G2_TRYB2  unnamed protein product                                 47.8    3e-05


>Q400N4_CAEEL unnamed protein product
Length=1025

 Score = 57.0 bits (136),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 29/48 (60%), Gaps = 3/48 (6%)

Query  46  ICRICHCESDPQNPLLTPCYCAGSLKYVHQACLQQWLTASETNACELC  93
           +CR+C      +  L  PC C GS+KYVHQ CL +WL  S+   CELC
Sbjct  52  MCRVCRGN---EGSLYYPCLCTGSIKYVHQECLVEWLKYSKKEVCELC  96


>Q57V79_TRYB2 unnamed protein product
Length=873

 Score = 52.4 bits (124),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/58 (38%), Positives = 33/58 (57%), Gaps = 7/58 (12%)

Query  46   ICRICHCESDPQNPLLTPCYCAGSLKYVHQACLQQWLTAS------ETNACELCKFPF  97
            ICRIC  + +    L++ C C GS++++H +CL +W   S        N CE+CK PF
Sbjct  611  ICRICR-DDETDEKLISACECIGSVRWIHVSCLDRWRIESTKRNLHNVNCCEICKKPF  667


>Q381G2_TRYB2 unnamed protein product
Length=1111

 Score = 47.8 bits (112),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 3/50 (6%)

Query  47  CRICHCESDPQNPLLTPCYCAGSLKYVHQACLQQWLTASETNACELCKFP  96
           CR+CH  +      ++PC C GS+KYVH  CL +W+   ++  CE+C  P
Sbjct  9   CRMCHSSA---GKCVSPCCCDGSIKYVHSKCLARWVRHRKSLICEVCGTP  55



Lambda      K        H
   0.312    0.124    0.369 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 18013231158


Query= XP_014085134.1 PREDICTED: uncharacterized protein LOC106614111
[Bactrocera oleae]

Length=682
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q400N4_CAEEL  unnamed protein product                                 57.0    4e-08
Q57V79_TRYB2  unnamed protein product                                 52.4    1e-06
Q381G2_TRYB2  unnamed protein product                                 47.8    3e-05


>Q400N4_CAEEL unnamed protein product
Length=1025

 Score = 57.0 bits (136),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 29/48 (60%), Gaps = 3/48 (6%)

Query  46  ICRICHCESDPQNPLLTPCYCAGSLKYVHQACLQQWLTASETNACELC  93
           +CR+C      +  L  PC C GS+KYVHQ CL +WL  S+   CELC
Sbjct  52  MCRVCRGN---EGSLYYPCLCTGSIKYVHQECLVEWLKYSKKEVCELC  96


>Q57V79_TRYB2 unnamed protein product
Length=873

 Score = 52.4 bits (124),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/58 (38%), Positives = 33/58 (57%), Gaps = 7/58 (12%)

Query  46   ICRICHCESDPQNPLLTPCYCAGSLKYVHQACLQQWLTAS------ETNACELCKFPF  97
            ICRIC  + +    L++ C C GS++++H +CL +W   S        N CE+CK PF
Sbjct  611  ICRICR-DDETDEKLISACECIGSVRWIHVSCLDRWRIESTKRNLHNVNCCEICKKPF  667


>Q381G2_TRYB2 unnamed protein product
Length=1111

 Score = 47.8 bits (112),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 3/50 (6%)

Query  47  CRICHCESDPQNPLLTPCYCAGSLKYVHQACLQQWLTASETNACELCKFP  96
           CR+CH  +      ++PC C GS+KYVH  CL +W+   ++  CE+C  P
Sbjct  9   CRMCHSSA---GKCVSPCCCDGSIKYVHSKCLARWVRHRKSLICEVCGTP  55



Lambda      K        H
   0.312    0.124    0.369 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 18013231158


Query= XP_014085135.1 PREDICTED: uncharacterized protein LOC106614111
[Bactrocera oleae]

Length=682
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q400N4_CAEEL  unnamed protein product                                 57.0    4e-08
Q57V79_TRYB2  unnamed protein product                                 52.4    1e-06
Q381G2_TRYB2  unnamed protein product                                 47.8    3e-05


>Q400N4_CAEEL unnamed protein product
Length=1025

 Score = 57.0 bits (136),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 29/48 (60%), Gaps = 3/48 (6%)

Query  46  ICRICHCESDPQNPLLTPCYCAGSLKYVHQACLQQWLTASETNACELC  93
           +CR+C      +  L  PC C GS+KYVHQ CL +WL  S+   CELC
Sbjct  52  MCRVCRGN---EGSLYYPCLCTGSIKYVHQECLVEWLKYSKKEVCELC  96


>Q57V79_TRYB2 unnamed protein product
Length=873

 Score = 52.4 bits (124),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/58 (38%), Positives = 33/58 (57%), Gaps = 7/58 (12%)

Query  46   ICRICHCESDPQNPLLTPCYCAGSLKYVHQACLQQWLTAS------ETNACELCKFPF  97
            ICRIC  + +    L++ C C GS++++H +CL +W   S        N CE+CK PF
Sbjct  611  ICRICR-DDETDEKLISACECIGSVRWIHVSCLDRWRIESTKRNLHNVNCCEICKKPF  667


>Q381G2_TRYB2 unnamed protein product
Length=1111

 Score = 47.8 bits (112),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 3/50 (6%)

Query  47  CRICHCESDPQNPLLTPCYCAGSLKYVHQACLQQWLTASETNACELCKFP  96
           CR+CH  +      ++PC C GS+KYVH  CL +W+   ++  CE+C  P
Sbjct  9   CRMCHSSA---GKCVSPCCCDGSIKYVHSKCLARWVRHRKSLICEVCGTP  55



Lambda      K        H
   0.312    0.124    0.369 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 18013231158


Query= XP_014085136.1 PREDICTED: zinc finger protein 14-like [Bactrocera
oleae]

Length=821
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9PD94_DROME  unnamed protein product                                 130     7e-31
O61360_DROME  unnamed protein product                                 129     3e-30
M9PCY3_DROME  unnamed protein product                                 128     3e-30


>M9PD94_DROME unnamed protein product
Length=907

 Score = 130 bits (327),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 126/473 (27%), Positives = 193/473 (41%), Gaps = 34/473 (7%)

Query  256  EGEDSSANTIECHICQKRFRKPERYEEHMRHHNDKLPHQCTVESCSKGFTTANGLRLHME  315
            +G   +  T  C IC K F+   +   H R+H+++ P  C V  C +GFTT+  L  H +
Sbjct  212  DGTPIATGTHVCDICGKMFQFRYQLIVHRRYHSERKPFMCQV--CGQGFTTSQDLTRHGK  269

Query  316  HCHAETCESFPCPEEGCGRTFPRTRLLNWHLRKVHKIAKELREAKCYTCNQCDKIFRCPM  375
              H      F C    C   F     L  H+++ H   K       + C  C K F    
Sbjct  270  -IHIGG-PMFTCIV--CFNVFANNTSLERHMKR-HSTDKP------FACTICQKTFARKE  318

Query  376  ALKKHMYKHDGKELPFPCNICGKRFVINSALKDHLMRHAGIKNYVCPYCGVGKTTRQEWN  435
             L  H   H G E PF C  C K F     + +H+ +H G   + C  CG   T ++   
Sbjct  319  HLDNHFRSHTG-ETPFRCQYCAKTFTRKEHMVNHVRKHTGQTPHQCDVCGKKYTRKEHLA  377

Query  436  THINTHTQEKKFNCPQCAYASHNKQNLRMHVKIVHEKIKDYACQYCGKTFGKSNACKMHE  495
             H+ +HT E  F C  C  +   K++   H+         + C +C KTF +      H 
Sbjct  378  NHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTAGETPHRCDFCSKTFTRKEHLLNHV  437

Query  496  MTHTGEKRCECKVCGKRFLYAKALTKHLKTHE----KRVLRAIEVYRKRQIENGFMPADT  551
              HTGE    C  C K F   + L  H++ H      +     + + +++     +   T
Sbjct  438  RQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGESPHKCTYCTKTFTRKEHLTNHVRQHT  497

Query  552  PDIPLPELLSTESHTQESHQKVAEEILKVCAEST---ATIPKNPRRVERVDISELAGTAV  608
             D P       ++ T++ H  +   +     +S        K   R E ++      ++ 
Sbjct  498  GDSPHRCSYCKKTFTRKEH--LTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSD  555

Query  609  NP----IPSVAVPSWSPQINFMMK----EGPYICPDCGQGFNGQGNLKRHHRIVHEGV--  658
            NP    + +         IN M +    + P+ C  CG+ F  +GNL  H R   +G   
Sbjct  556  NPHCCNVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQEM  615

Query  659  -KDFACRFCHKRFAKAQTLKHHEMTHTGEKPHECSNCGKRFIQYVALKRHMKI  710
             + FAC  C K F     L  H  +H+GEKPH C+ C K F++   LKRHMK+
Sbjct  616  ERPFACEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSKAFVERGNLKRHMKM  668


 Score = 104 bits (260),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 92/365 (25%), Positives = 143/365 (39%), Gaps = 38/365 (10%)

Query  362  YTCNQCDKIFRCPMALKKHMYKHDGKELPFPCNICGKRFVINSALKDHLMRHAGIKNYVC  421
            + C+ C K+F+    L  H   H  ++ PF C +CG+ F  +  L  H   H G   + C
Sbjct  221  HVCDICGKMFQFRYQLIVHRRYHSERK-PFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTC  279

Query  422  PYCGVGKTTRQEWNTHINTHTQEKKFNCPQCAYASHNKQNLRMHVKIVHEKIKDYACQYC  481
              C            H+  H+ +K F C  C      K++L  H +  H     + CQYC
Sbjct  280  IVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFR-SHTGETPFRCQYC  338

Query  482  GKTFGKSNACKMHEMTHTGEKRCECKVCGKRFLYAKALTKHLKTHEKRVLRAIEV-----  536
             KTF +      H   HTG+   +C VCGK++   + L  H+++H        E+     
Sbjct  339  AKTFTRKEHMVNHVRKHTGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSF  398

Query  537  YRKRQIENGFMPADTPDIPLPELLSTESHTQESH-----QKVAEEILKVCAESTATIPKN  591
             RK    N  +     + P      +++ T++ H     ++   E    C+    T  + 
Sbjct  399  SRKEHFTNHILWHTAGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRK  458

Query  592  PRRVERVDISELAGTAVNPIPSVAVPSWSPQINFMMKEGPYICPDCGQGFNGQGNLKRHH  651
               V    I +  G                       E P+ C  C + F  + +L  H 
Sbjct  459  EHLVNH--IRQHTG-----------------------ESPHKCTYCTKTFTRKEHLTNHV  493

Query  652  RIVHEGVKDFACRFCHKRFAKAQTLKHHEMTHTGEKPHECSNCGKRFIQYVALKRHMKIH  711
            R  H G     C +C K F + + L +H   HTG+ PH+C  C K F +   L  HM+ H
Sbjct  494  R-QHTGDSPHRCSYCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHMRQH  552

Query  712  MSKPP  716
             S  P
Sbjct  553  SSDNP  557


 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 109/409 (27%), Positives = 151/409 (37%), Gaps = 51/409 (12%)

Query  260  SSANTIECHICQKRFRKPERYEEHMRHHNDKLPHQCTVESCSKGFTTANGLRLHMEHCHA  319
            S+     C ICQK F + E  + H R H  + P +C  + C+K FT    +  H+     
Sbjct  300  STDKPFACTICQKTFARKEHLDNHFRSHTGETPFRC--QYCAKTFTRKEHMVNHVRKHTG  357

Query  320  ETCESFPCPEEGCGRTFPRTRLLNWHLRKVHKIAKELREAKCYTCNQCDKIFRCPMALKK  379
            +T    P   + CG+ + R   L  H+R  H      R      C  C K F        
Sbjct  358  QT----PHQCDVCGKKYTRKEHLANHMRS-HTNETPFR------CEICGKSFSRKEHFTN  406

Query  380  HMYKHDGKELPFPCNICGKRFVINSALKDHLMRHAGIKNYVCPYCGVGKTTRQEWNTHIN  439
            H+  H   E P  C+ C K F     L +H+ +H G   + C YC    T ++    HI 
Sbjct  407  HILWHTAGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIR  466

Query  440  THTQEKKFNCPQCAYASHNKQNLRMHVKIVHEKIKDYACQYCGKTFGKSNACKMHEMTHT  499
             HT E    C  C      K++L  HV+  H     + C YC KTF +      H   HT
Sbjct  467  QHTGESPHKCTYCTKTFTRKEHLTNHVR-QHTGDSPHRCSYCKKTFTRKEHLTNHVRLHT  525

Query  500  GEKRCECKVCGKRFLYAKALTKHLKTHEKRVLRAIEV-----YRKRQIENGFMPADTPDI  554
            G+   +C+ C K F   + L  H++ H         V      RK  + N      T D 
Sbjct  526  GDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGDR  585

Query  555  PLP--------ELLSTESHTQESHQKVAEEILKVCAESTATIPKNPRRVERVDISELAGT  606
            P           L       Q SH K  E       E     PKN             G 
Sbjct  586  PFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEK---CPKN---------FICKGH  633

Query  607  AVNPIPSVAVPSWSPQINFMMKEGPYICPDCGQGFNGQGNLKRHHRIVH  655
             V+ + S +             E P+ C  C + F  +GNLKRH ++ H
Sbjct  634  LVSHMRSHS------------GEKPHACTLCSKAFVERGNLKRHMKMNH  670


 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 83/298 (28%), Positives = 125/298 (42%), Gaps = 23/298 (8%)

Query  265  IECHICQKRFRKPERYEEHMRHHN-DKLPHQCTVESCSKGFTTANGLRLHMEHCHAETCE  323
              C IC K F + E +  H+  H   + PH+C  + CSK FT    L   + H    T E
Sbjct  389  FRCEICGKSFSRKEHFTNHILWHTAGETPHRC--DFCSKTFTRKEHL---LNHVRQHTGE  443

Query  324  SFPCPEEGCGRTFPRTRLLNWHLRKVHKIAKELREAKCYTCNQCDKIFRCPMALKKHMYK  383
            S P     C +TF R   L  H+R+         E+  + C  C K F     L  H+ +
Sbjct  444  S-PHRCSYCMKTFTRKEHLVNHIRQ------HTGESP-HKCTYCTKTFTRKEHLTNHVRQ  495

Query  384  HDGKELPFPCNICGKRFVINSALKDHLMRHAGIKNYVCPYCGVGKTTRQEWNTHINTHTQ  443
            H G + P  C+ C K F     L +H+  H G   + C YC    T ++  N H+  H+ 
Sbjct  496  HTG-DSPHRCSYCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHMRQHSS  554

Query  444  EKKFNCPQCAYASHNKQNLRMHVKIVHEKIKDYACQYCGKTFGKSNACKMHEMTHTGEKR  503
            +    C  C      K++L  H+   H   + + C+ CGK+F        H+ +HT  + 
Sbjct  555  DNPHCCNVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQE  614

Query  504  CE----CKVCGKRFLYAKALTKHLKTHEKRVLRAIEVYRKRQIENG----FMPADTPD  553
             E    C+ C K F+    L  H+++H      A  +  K  +E G     M  + PD
Sbjct  615  MERPFACEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSKAFVERGNLKRHMKMNHPD  672


 Score = 45.8 bits (107),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 40/90 (44%), Gaps = 1/90 (1%)

Query  627  MKEGPYICPDCGQGFNGQGNLKRHHRIVHEGVKDFACRFCHKRFAKAQTLKHHEMTHTGE  686
            +  G ++C  CG+ F  +  L  H R  H   K F C+ C + F  +Q L  H   H G 
Sbjct  216  IATGTHVCDICGKMFQFRYQLIVHRR-YHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGG  274

Query  687  KPHECSNCGKRFIQYVALKRHMKIHMSKPP  716
                C  C   F    +L+RHMK H +  P
Sbjct  275  PMFTCIVCFNVFANNTSLERHMKRHSTDKP  304


 Score = 42.7 bits (99),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 40/89 (45%), Gaps = 1/89 (1%)

Query  629  EGPYICPDCGQGFNGQGNLKRHHRIVHEGVKDFACRFCHKRFAKAQTLKHHEMTHTGEKP  688
            E P+ C  C + F  + ++  H R  H G     C  C K++ + + L +H  +HT E P
Sbjct  330  ETPFRCQYCAKTFTRKEHMVNHVR-KHTGQTPHQCDVCGKKYTRKEHLANHMRSHTNETP  388

Query  689  HECSNCGKRFIQYVALKRHMKIHMSKPPP  717
              C  CGK F +      H+  H +   P
Sbjct  389  FRCEICGKSFSRKEHFTNHILWHTAGETP  417


>O61360_DROME unnamed protein product
Length=962

 Score = 129 bits (323),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 124/466 (27%), Positives = 182/466 (39%), Gaps = 57/466 (12%)

Query  260  SSANTIECHICQKRFRKPERYEEHMRHHNDKLPHQCTVESCSKGFTTANGLRLHMEHCHA  319
            S+     C ICQK F + E  + H R H  + P +C  + C+K FT    +  H+     
Sbjct  300  STDKPFACTICQKTFARKEHLDNHFRSHTGETPFRC--QYCAKTFTRKEHMVNHVRKHTG  357

Query  320  ETCESFPCPEEGCGRTFPR----TRLLNWHLRKVHKIAKELREAKCYTCNQCDKIFRCPM  375
            ET    P   + C ++F R         WH  +             + C+ C K +    
Sbjct  358  ET----PHRCDICKKSFTRKEHYVNHYMWHTGQT-----------PHQCDVCGKKYTRKE  402

Query  376  ALKKHMYKHDGKELPFPCNICGKRFVINSALKDHLMRHAGIKNYVCPYCGVGKTTRQEWN  435
             L  HM  H   E PF C ICGK F       +H++ H G   + C +C    T ++   
Sbjct  403  HLANHMRSHT-NETPFRCEICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTFTRKEHLL  461

Query  436  THINTHTQEKKFNCPQCAYASHNKQNLRMHVKIVHEKIKDYACQYCGKTFGKSNACKMHE  495
             H+  HT E    C  C      K++L  H++  H     + C YC K F + +    H 
Sbjct  462  NHVRQHTGESPHRCSYCMKTFTRKEHLVNHIR-QHTGETPFKCTYCTKAFTRKDHMVNHV  520

Query  496  MTHTGEKRCECKVCGKRFLYAKALTKHLKTHE----KRVLRAIEVYRKRQIENGFMPADT  551
              HTGE   +C  C K F   + LT H++ H      R     + + +++     +   T
Sbjct  521  RQHTGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRLHT  580

Query  552  PDIPLPELLSTESHTQESHQKVAEEILKVCAESTATIPKNPRRVERVDISELAGTAVNPI  611
             D P       ++ T++ H                    N  R    D          P 
Sbjct  581  GDSPHKCEYCQKTFTRKEHLN------------------NHMRQHSSDNPHCCNVCNKPF  622

Query  612  PSVAVPSWSPQINFMMK----EGPYICPDCGQGFNGQGNLKRHHRIVHEGV---KDFACR  664
                       IN M +    + P+ C  CG+ F  +GNL  H R   +G    + FAC 
Sbjct  623  TR-----KEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACE  677

Query  665  FCHKRFAKAQTLKHHEMTHTGEKPHECSNCGKRFIQYVALKRHMKI  710
             C K F     L  H  +H+GEKPH C+ C K F++   LKRHMK+
Sbjct  678  KCPKNFICKGHLVSHMRSHSGEKPHACTLCSKAFVERGNLKRHMKM  723


 Score = 111 bits (277),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 117/469 (25%), Positives = 183/469 (39%), Gaps = 56/469 (12%)

Query  256  EGEDSSANTIECHICQKRFRKPERYEEHMRHHNDKLPHQCTVESCSKGFTTANGLRLHME  315
            +G   +  T  C IC K F+   +   H R+H+++ P  C V  C +GFTT+  L  H +
Sbjct  212  DGTPIATGTHVCDICGKMFQFRYQLIVHRRYHSERKPFMCQV--CGQGFTTSQDLTRHGK  269

Query  316  HCHAETCESFPCPEEGCGRTFPRTRLLNWHLRKVHKIAKELREAKCYTCNQCDKIFRCPM  375
              H      F C    C   F     L  H+++ H   K       + C  C K F    
Sbjct  270  -IHIGG-PMFTCIV--CFNVFANNTSLERHMKR-HSTDKP------FACTICQKTFARKE  318

Query  376  ALKKHMYKHDGKELPFPCNICGKRFVINSALKDHLMRHAGIKNYVCPYCGVGKTTRQEWN  435
             L  H   H G E PF C  C K F     + +H+ +H G   + C  C    T ++ + 
Sbjct  319  HLDNHFRSHTG-ETPFRCQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYV  377

Query  436  THINTHTQEKKFNCPQCAYASHNKQNLRMHVKIVHEKIKDYACQYCGKTFGKSNACKMHE  495
             H   HT +    C  C      K++L  H++  H     + C+ CGK+F +      H 
Sbjct  378  NHYMWHTGQTPHQCDVCGKKYTRKEHLANHMR-SHTNETPFRCEICGKSFSRKEHFTNHI  436

Query  496  MTHTGEKRCECKVCGKRFLYAKALTKHLKTHE----KRVLRAIEVYRKRQIENGFMPADT  551
            + HTGE    C  C K F   + L  H++ H      R    ++ + +++     +   T
Sbjct  437  LWHTGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQHT  496

Query  552  PDIPLPELLSTESHTQESH------QKVAEEILKVCAESTATIPKNPRRVERVDISELAG  605
             + P      T++ T++ H      Q   E   K C   T T  +       V   +  G
Sbjct  497  GETPFKCTYCTKAFTRKDHMVNHVRQHTGESPHK-CTYCTKTFTRKEHLTNHV--RQHTG  553

Query  606  TAVNPIPSVAVPSWSPQINFMMKEGPYICPDCGQGFNGQGNLKRHHRIVHEGVKDFACRF  665
                                   + P+ C  C + F  + +L  H R+ H G     C +
Sbjct  554  -----------------------DSPHRCSYCKKTFTRKEHLTNHVRL-HTGDSPHKCEY  589

Query  666  CHKRFAKAQTLKHHEMTHTGEKPHECSNCGKRFIQYVALKRHMKIHMSK  714
            C K F + + L +H   H+ + PH C+ C K F +    K H+  HMS+
Sbjct  590  CQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTR----KEHLINHMSR  634


 Score = 111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 103/402 (26%), Positives = 163/402 (41%), Gaps = 32/402 (8%)

Query  332  CGRTFPRTRLLNWHLRKVHKIAKELREAKCYTCNQCDKIFRCPMALKKHMYKHDGKELPF  391
            CG+ F     L  H R+ H       E K + C  C + F     L +H   H G  + F
Sbjct  226  CGKMFQFRYQLIVH-RRYHS------ERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPM-F  277

Query  392  PCNICGKRFVINSALKDHLMRHAGIKNYVCPYCGVGKTTRQEWNTHINTHTQEKKFNCPQ  451
             C +C   F  N++L+ H+ RH+  K + C  C      ++  + H  +HT E  F C  
Sbjct  278  TCIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQY  337

Query  452  CAYASHNKQNLRMHVKIVHEKIKDYACQYCGKTFGKSNACKMHEMTHTGEKRCECKVCGK  511
            CA     K+++  HV+  H     + C  C K+F +      H M HTG+   +C VCGK
Sbjct  338  CAKTFTRKEHMVNHVR-KHTGETPHRCDICKKSFTRKEHYVNHYMWHTGQTPHQCDVCGK  396

Query  512  RFLYAKALTKHLKTHEKRVLRAIEV-----YRKRQIENGFMPADTPDIPLPELLSTESHT  566
            ++   + L  H+++H        E+      RK    N  +   T + P      +++ T
Sbjct  397  KYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHIL-WHTGETPHRCDFCSKTFT  455

Query  567  QESH-----QKVAEEILKVCAESTATIPKNPRRVERVDISELAGTAVNPIPSVAVPSWSP  621
            ++ H     ++   E    C+    T  +    V  +       T   P           
Sbjct  456  RKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIR----QHTGETPFKCTYCTKAFT  511

Query  622  QINFMMK-------EGPYICPDCGQGFNGQGNLKRHHRIVHEGVKDFACRFCHKRFAKAQ  674
            + + M+        E P+ C  C + F  + +L  H R  H G     C +C K F + +
Sbjct  512  RKDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHVR-QHTGDSPHRCSYCKKTFTRKE  570

Query  675  TLKHHEMTHTGEKPHECSNCGKRFIQYVALKRHMKIHMSKPP  716
             L +H   HTG+ PH+C  C K F +   L  HM+ H S  P
Sbjct  571  HLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNP  612


 Score = 103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 114/406 (28%), Positives = 153/406 (38%), Gaps = 60/406 (15%)

Query  267  CHICQKRFRKPERYEEHMRHHNDKLPHQCTVESCSKGFTTANGLRLHMEHCHAETCESFP  326
            C IC+K F + E Y  H   H  + PHQC V  C K +T    L  HM     ET   F 
Sbjct  363  CDICKKSFTRKEHYVNHYMWHTGQTPHQCDV--CGKKYTRKEHLANHMRSHTNET--PFR  418

Query  327  CPEEGCGRTFPR----TRLLNWHLRKVHKIAKELREAKCYTCNQCDKIFRCPMALKKHMY  382
            C  E CG++F R    T  + WH  +             + C+ C K F     L  H+ 
Sbjct  419  C--EICGKSFSRKEHFTNHILWHTGET-----------PHRCDFCSKTFTRKEHLLNHVR  465

Query  383  KHDGKELPFPCNICGKRFVINSALKDHLMRHAGIKNYVCPYCGVGKTTRQEWNTHINTHT  442
            +H G E P  C+ C K F     L +H+ +H G   + C YC    T +     H+  HT
Sbjct  466  QHTG-ESPHRCSYCMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTRKDHMVNHVRQHT  524

Query  443  QEKKFNCPQCAYASHNKQNLRMHVKIVHEKIKDYACQYCGKTFGKSNACKMHEMTHTGEK  502
             E    C  C      K++L  HV+  H     + C YC KTF +      H   HTG+ 
Sbjct  525  GESPHKCTYCTKTFTRKEHLTNHVR-QHTGDSPHRCSYCKKTFTRKEHLTNHVRLHTGDS  583

Query  503  RCECKVCGKRFLYAKALTKHLKTHEKRVLRAIEV-----YRKRQIENGFMPADTPDIPLP  557
              +C+ C K F   + L  H++ H         V      RK  + N      T D P  
Sbjct  584  PHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGDRPFT  643

Query  558  --------ELLSTESHTQESHQKVAEEILKVCAESTATIPKNPRRVERVDISELAGTAVN  609
                     L       Q SH K  E       E     PKN             G  V+
Sbjct  644  CETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEK---CPKN---------FICKGHLVS  691

Query  610  PIPSVAVPSWSPQINFMMKEGPYICPDCGQGFNGQGNLKRHHRIVH  655
             + S +             E P+ C  C + F  +GNLKRH ++ H
Sbjct  692  HMRSHS------------GEKPHACTLCSKAFVERGNLKRHMKMNH  725


 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 84/319 (26%), Positives = 129/319 (40%), Gaps = 38/319 (12%)

Query  265  IECHICQKRFRKPERYEEHMRHHNDKLPHQCTVESCSKGFTTANGLRLHMEHCHAETCES  324
              C IC K F + E +  H+  H  + PH+C  + CSK FT    L   + H    T ES
Sbjct  417  FRCEICGKSFSRKEHFTNHILWHTGETPHRC--DFCSKTFTRKEHL---LNHVRQHTGES  471

Query  325  FPCPEEGCGRTFPRTRLLNWHLRK----------------------VHKIAKELREAKCY  362
             P     C +TF R   L  H+R+                      V+ + +   E+  +
Sbjct  472  -PHRCSYCMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTRKDHMVNHVRQHTGESP-H  529

Query  363  TCNQCDKIFRCPMALKKHMYKHDGKELPFPCNICGKRFVINSALKDHLMRHAGIKNYVCP  422
             C  C K F     L  H+ +H G + P  C+ C K F     L +H+  H G   + C 
Sbjct  530  KCTYCTKTFTRKEHLTNHVRQHTG-DSPHRCSYCKKTFTRKEHLTNHVRLHTGDSPHKCE  588

Query  423  YCGVGKTTRQEWNTHINTHTQEKKFNCPQCAYASHNKQNLRMHVKIVHEKIKDYACQYCG  482
            YC    T ++  N H+  H+ +    C  C      K++L  H+   H   + + C+ CG
Sbjct  589  YCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGDRPFTCETCG  648

Query  483  KTFGKSNACKMHEMTHTGEKRCE----CKVCGKRFLYAKALTKHLKTHEKRVLRAIEVYR  538
            K+F        H+ +HT  +  E    C+ C K F+    L  H+++H      A  +  
Sbjct  649  KSFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSGEKPHACTLCS  708

Query  539  KRQIENG----FMPADTPD  553
            K  +E G     M  + PD
Sbjct  709  KAFVERGNLKRHMKMNHPD  727


 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 71/303 (23%), Positives = 116/303 (38%), Gaps = 26/303 (9%)

Query  418  NYVCPYCGVGKTTRQEWNTHINTHTQEKKFNCPQCAYASHNKQNLRMHVKIVHEKIKDYA  477
             +VC  CG     R +   H   H++ K F C  C       Q+L  H KI H     + 
Sbjct  220  THVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKI-HIGGPMFT  278

Query  478  CQYCGKTFGKSNACKMHEMTHTGEKRCECKVCGKRFLYAKALTKHLKTHEK----RVLRA  533
            C  C   F  + + + H   H+ +K   C +C K F   + L  H ++H      R    
Sbjct  279  CIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYC  338

Query  534  IEVYRKRQIENGFMPADTPDIPLPELLSTESHTQESHQKVAEEILKVCAESTATIPKNPR  593
             + + +++     +   T + P    +  +S T++ H       +      T   P    
Sbjct  339  AKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEH------YVNHYMWHTGQTP----  388

Query  594  RVERVDISELAGTAVNPIPSVAVPSWSPQINFMMKEGPYICPDCGQGFNGQGNLKRHHRI  653
               + D+     T    + +         +     E P+ C  CG+ F+ + +   H  +
Sbjct  389  --HQCDVCGKKYTRKEHLAN--------HMRSHTNETPFRCEICGKSFSRKEHFTNH-IL  437

Query  654  VHEGVKDFACRFCHKRFAKAQTLKHHEMTHTGEKPHECSNCGKRFIQYVALKRHMKIHMS  713
             H G     C FC K F + + L +H   HTGE PH CS C K F +   L  H++ H  
Sbjct  438  WHTGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTG  497

Query  714  KPP  716
            + P
Sbjct  498  ETP  500


 Score = 45.4 bits (106),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 40/90 (44%), Gaps = 1/90 (1%)

Query  627  MKEGPYICPDCGQGFNGQGNLKRHHRIVHEGVKDFACRFCHKRFAKAQTLKHHEMTHTGE  686
            +  G ++C  CG+ F  +  L  H R  H   K F C+ C + F  +Q L  H   H G 
Sbjct  216  IATGTHVCDICGKMFQFRYQLIVHRR-YHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGG  274

Query  687  KPHECSNCGKRFIQYVALKRHMKIHMSKPP  716
                C  C   F    +L+RHMK H +  P
Sbjct  275  PMFTCIVCFNVFANNTSLERHMKRHSTDKP  304


>M9PCY3_DROME unnamed protein product
Length=878

 Score = 128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 126/466 (27%), Positives = 184/466 (39%), Gaps = 49/466 (11%)

Query  256  EGEDSSANTIECHICQKRFRKPERYEEHMRHHNDKLPHQCTVESCSKGFTTANGLRLHME  315
            +G   +  T  C IC K F+   +   H R+H+++ P  C V  C +GFTT+  L  H +
Sbjct  212  DGTPIATGTHVCDICGKMFQFRYQLIVHRRYHSERKPFMCQV--CGQGFTTSQDLTRHGK  269

Query  316  HCHAETCESFPCPEEGCGRTFPRTRLLNWHLRKVHKIAKELREAKCYTCNQCDKIFRCPM  375
              H      F C    C   F     L  H+++ H   K       + C  C K F    
Sbjct  270  -IHIGG-PMFTCIV--CFNVFANNTSLERHMKR-HSTDKP------FACTICQKTFARKE  318

Query  376  ALKKHMYKHDGKELPFPCNICGKRFVINSALKDHLMRHAGIKNYVCPYCGVGKTTRQEWN  435
             L  H   H G E PF C  C K F     + +H+ +H G   + C +C    T ++   
Sbjct  319  HLDNHFRSHTG-ETPFRCQYCAKTFTRKEHMVNHVRKHTGETPHRCDFCSKTFTRKEHLL  377

Query  436  THINTHTQEKKFNCPQCAYASHNKQNLRMHVKIVHEKIKDYACQYCGKTFGKSNACKMHE  495
             H+  HT E    C  C      K++L  H++  H     + C YC K F + +    H 
Sbjct  378  NHVRQHTGESPHRCSYCMKTFTRKEHLVNHIR-QHTGETPFKCTYCTKAFTRKDHMVNHV  436

Query  496  MTHTGEKRCECKVCGKRFLYAKALTKHLKTHE----KRVLRAIEVYRKRQIENGFMPADT  551
              HTGE   +C  C K F   + LT H++ H      R     + + +++     +   T
Sbjct  437  RQHTGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRLHT  496

Query  552  PDIPLPELLSTESHTQESHQKVAEEILKVCAESTATIPKNPRRVERVDISELAGTAVNPI  611
             D P       ++ T++ H                    N  R    D          P 
Sbjct  497  GDSPHKCEYCQKTFTRKEHLN------------------NHMRQHSSDNPHCCNVCNKPF  538

Query  612  PSVAVPSWSPQINFMMK----EGPYICPDCGQGFNGQGNLKRHHRIVHEGV---KDFACR  664
                       IN M +    + P+ C  CG+ F  +GNL  H R   +G    + FAC 
Sbjct  539  TR-----KEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACE  593

Query  665  FCHKRFAKAQTLKHHEMTHTGEKPHECSNCGKRFIQYVALKRHMKI  710
             C K F     L  H  +H+GEKPH C+ C K F++   LKRHMK+
Sbjct  594  KCPKNFICKGHLVSHMRSHSGEKPHACTLCSKAFVERGNLKRHMKM  639


 Score = 99.0 bits (245),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 88/331 (27%), Positives = 124/331 (37%), Gaps = 32/331 (10%)

Query  393  CNICGKRFVINSALKDHLMRHAGIKNYVCPYCGVGKTTRQEWNTHINTHTQEKKFNCPQC  452
            C+ICGK F     L  H   H+  K ++C  CG G TT Q+   H   H     F C  C
Sbjct  223  CDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTCIVC  282

Query  453  AYASHNKQNLRMHVKIVHEKIKDYACQYCGKTFGKSNACKMHEMTHTGEKRCECKVCGKR  512
                 N  +L  H+K  H   K +AC  C KTF +      H  +HTGE    C+ C K 
Sbjct  283  FNVFANNTSLERHMK-RHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYCAKT  341

Query  513  FLYAKALTKHLKTHEKRVLRAIEVYRKRQIENGFMPADTPDIPLPELLSTESHTQESHQK  572
            F   + +  H++ H        +   K       +           L     HT ES  +
Sbjct  342  FTRKEHMVNHVRKHTGETPHRCDFCSKTFTRKEHL-----------LNHVRQHTGESPHR  390

Query  573  VAEEILKVCAESTATIPKNPRRVERVDISELAGTAVNPIPSVAVPSWSPQINFMMK----  628
                    C+    T  +    V  +       T   P           + + M+     
Sbjct  391  --------CSYCMKTFTRKEHLVNHIR----QHTGETPFKCTYCTKAFTRKDHMVNHVRQ  438

Query  629  ---EGPYICPDCGQGFNGQGNLKRHHRIVHEGVKDFACRFCHKRFAKAQTLKHHEMTHTG  685
               E P+ C  C + F  + +L  H R  H G     C +C K F + + L +H   HTG
Sbjct  439  HTGESPHKCTYCTKTFTRKEHLTNHVR-QHTGDSPHRCSYCKKTFTRKEHLTNHVRLHTG  497

Query  686  EKPHECSNCGKRFIQYVALKRHMKIHMSKPP  716
            + PH+C  C K F +   L  HM+ H S  P
Sbjct  498  DSPHKCEYCQKTFTRKEHLNNHMRQHSSDNP  528


 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 92/383 (24%), Positives = 147/383 (38%), Gaps = 58/383 (15%)

Query  332  CGRTFPRTRLLNWHLRKVHKIAKELREAKCYTCNQCDKIFRCPMALKKHMYKHDGKELPF  391
            CG+ F     L  H R+ H       E K + C  C + F     L +H   H G  + F
Sbjct  226  CGKMFQFRYQLIVH-RRYHS------ERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPM-F  277

Query  392  PCNICGKRFVINSALKDHLMRHAGIKNYVCPYCGVGKTTRQEWNTHINTHTQEKKFNCPQ  451
             C +C   F  N++L+ H+ RH+  K + C  C      ++  + H  +HT E  F C  
Sbjct  278  TCIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQY  337

Query  452  CAYASHNKQNLRMHVKIVHEKIKDYACQYCGKTFGKSNACKMHEMTHTGEKRCECKVCGK  511
            CA     K+++  HV+  H     + C +C KTF +      H   HTGE    C  C K
Sbjct  338  CAKTFTRKEHMVNHVR-KHTGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMK  396

Query  512  RFLYAKALTKHLKTHEKRVLRAIEVYRKRQIENGFMPADTPDIPLPELLSTESHTQESHQ  571
             F   + L  H++ H                        T + P      T++ T++ H 
Sbjct  397  TFTRKEHLVNHIRQH------------------------TGETPFKCTYCTKAFTRKDH-  431

Query  572  KVAEEILKVCAESTATIPKNPRRVERVDISELAGTAVNPIPSVAVPSWSPQINFMMKEGP  631
             +   + +   ES        +   R +                    +  +     + P
Sbjct  432  -MVNHVRQHTGESPHKCTYCTKTFTRKE------------------HLTNHVRQHTGDSP  472

Query  632  YICPDCGQGFNGQGNLKRHHRIVHEGVKDFACRFCHKRFAKAQTLKHHEMTHTGEKPHEC  691
            + C  C + F  + +L  H R+ H G     C +C K F + + L +H   H+ + PH C
Sbjct  473  HRCSYCKKTFTRKEHLTNHVRL-HTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCC  531

Query  692  SNCGKRFIQYVALKRHMKIHMSK  714
            + C K F +    K H+  HMS+
Sbjct  532  NVCNKPFTR----KEHLINHMSR  550


 Score = 92.4 bits (228),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 110/404 (27%), Positives = 148/404 (37%), Gaps = 52/404 (13%)

Query  265  IECHICQKRFRKPERYEEHMRHHNDKLPHQCTVESCSKGFTTANGLRLHMEHCHAETCES  324
              C +C   F      E HM+ H+   P  CT+  C K F     L  H      ET   
Sbjct  277  FTCIVCFNVFANNTSLERHMKRHSTDKPFACTI--CQKTFARKEHLDNHFRSHTGET--P  332

Query  325  FPCPEEGCGRTFPRTRLLNWHLRKVHKIAKELREAKCYTCNQCDKIFRCPMALKKHMYKH  384
            F C  + C +TF R   +  H+RK H      R      C+ C K F     L  H+ +H
Sbjct  333  FRC--QYCAKTFTRKEHMVNHVRK-HTGETPHR------CDFCSKTFTRKEHLLNHVRQH  383

Query  385  DGKELPFPCNICGKRFVINSALKDHLMRHAGIKNYVCPYCGVGKTTRQEWNTHINTHTQE  444
             G E P  C+ C K F     L +H+ +H G   + C YC    T +     H+  HT E
Sbjct  384  TG-ESPHRCSYCMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTRKDHMVNHVRQHTGE  442

Query  445  KKFNCPQCAYASHNKQNLRMHVKIVHEKIKDYACQYCGKTFGKSNACKMHEMTHTGEKRC  504
                C  C      K++L  HV+  H     + C YC KTF +      H   HTG+   
Sbjct  443  SPHKCTYCTKTFTRKEHLTNHVR-QHTGDSPHRCSYCKKTFTRKEHLTNHVRLHTGDSPH  501

Query  505  ECKVCGKRFLYAKALTKHLKTHEKRVLRAIEV-----YRKRQIENGFMPADTPDIPLP--  557
            +C+ C K F   + L  H++ H         V      RK  + N      T D P    
Sbjct  502  KCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGDRPFTCE  561

Query  558  ------ELLSTESHTQESHQKVAEEILKVCAESTATIPKNPRRVERVDISELAGTAVNPI  611
                   L       Q SH K  E       E     PKN             G  V+ +
Sbjct  562  TCGKSFPLKGNLLFHQRSHTKGQEMERPFACEK---CPKN---------FICKGHLVSHM  609

Query  612  PSVAVPSWSPQINFMMKEGPYICPDCGQGFNGQGNLKRHHRIVH  655
             S +             E P+ C  C + F  +GNLKRH ++ H
Sbjct  610  RSHS------------GEKPHACTLCSKAFVERGNLKRHMKMNH  641


 Score = 45.8 bits (107),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 40/90 (44%), Gaps = 1/90 (1%)

Query  627  MKEGPYICPDCGQGFNGQGNLKRHHRIVHEGVKDFACRFCHKRFAKAQTLKHHEMTHTGE  686
            +  G ++C  CG+ F  +  L  H R  H   K F C+ C + F  +Q L  H   H G 
Sbjct  216  IATGTHVCDICGKMFQFRYQLIVHRRY-HSERKPFMCQVCGQGFTTSQDLTRHGKIHIGG  274

Query  687  KPHECSNCGKRFIQYVALKRHMKIHMSKPP  716
                C  C   F    +L+RHMK H +  P
Sbjct  275  PMFTCIVCFNVFANNTSLERHMKRHSTDKP  304



Lambda      K        H
   0.312    0.124    0.369 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 18013231158


Query= XP_014085137.1 PREDICTED: splicing factor 3B subunit 6-like protein
[Bactrocera oleae]

Length=121
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SF3B6_DROME  unnamed protein product                                  244     2e-85
RSP6_CAEEL  unnamed protein product                                   54.7    5e-10
Q38AL7_TRYB2  unnamed protein product                                 50.8    4e-09


>SF3B6_DROME unnamed protein product
Length=121

 Score = 244 bits (624),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 117/121 (97%), Positives = 121/121 (100%), Gaps = 0/121 (0%)

Query  1    MNKRNNIRLPPEVNRLLYVRNLPYKITSDEMYDIFGKFGAIRQIRVGNTPETRGTAFVVY  60
            MNKRN+IRLPPEVNRLLYVRNLPYKITSDEMYDIFGKFGAIRQIRVGNTPETRGTAFVVY
Sbjct  1    MNKRNHIRLPPEVNRLLYVRNLPYKITSDEMYDIFGKFGAIRQIRVGNTPETRGTAFVVY  60

Query  61   EDIFDAKNACDHLSGFNVCNRYLVVLYYQSNKAFKRLDVDKKQEELNNIKSKYNLKTPEA  120
            EDIFDAKNACDHLSGFNVCNRYLVVLYYQSNKAFKR+D+DKKQEELNNIK+KYNLKTPEA
Sbjct  61   EDIFDAKNACDHLSGFNVCNRYLVVLYYQSNKAFKRVDMDKKQEELNNIKAKYNLKTPEA  120

Query  121  P  121
            P
Sbjct  121  P  121


>RSP6_CAEEL unnamed protein product
Length=179

 Score = 54.7 bits (130),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 38/64 (59%), Gaps = 2/64 (3%)

Query  17  LYVRNLPYKITSDEMYDIFGKFGAIRQIRVGNTPETRGTAFVVYEDIFDAKNACDHLSGF  76
           +YV  LP   TS E+ +IF +FG IR++ V   P   G AFV Y+D+ DA++A   L G 
Sbjct  5   VYVGGLPSDATSQELEEIFDRFGRIRKVWVARRPP--GFAFVEYDDVRDAEDAVRALDGS  62

Query  77  NVCN  80
            +C 
Sbjct  63  RICG  66


>Q38AL7_TRYB2 unnamed protein product
Length=117

 Score = 50.8 bits (120),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 33/49 (67%), Gaps = 1/49 (2%)

Query  14  NRLLYVRNLPYKIT-SDEMYDIFGKFGAIRQIRVGNTPETRGTAFVVYE  61
            R+L V  +P K+   +E+Y +FG +G I+Q+R+G+   T+G A VVYE
Sbjct  4   ERILLVTGIPTKLCRGEELYKVFGNYGTIQQLRIGSDASTKGCAIVVYE  52



Lambda      K        H
   0.312    0.124    0.369 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 18013231158


Query= XP_014085138.1 PREDICTED: protein still life, isoforms C/SIF type 2
[Bactrocera oleae]

Length=1226
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SIF2_DROME  unnamed protein product                                   2233    0.0  
SIF1_DROME  unnamed protein product                                   2208    0.0  
O01847_CAEEL  unnamed protein product                                 100     4e-21


>SIF2_DROME unnamed protein product
Length=2061

 Score = 2233 bits (5786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1132/1280 (88%), Positives = 1161/1280 (91%), Gaps = 63/1280 (5%)

Query  1     MSLTTAVSDEDDGESVMASPYKAKATGTAASSFNCTGAVRKAGFLSVKKWLLRKKHQIEL  60
             MSLTTAVSDEDDGESVMASPYKAKATGTAASSFNCTGAVRKAGFLSVKKWLLRKKHQIEL
Sbjct  785   MSLTTAVSDEDDGESVMASPYKAKATGTAASSFNCTGAVRKAGFLSVKKWLLRKKHQIEL  844

Query  61    ARKRGWKGYWVCLKGTTLLFYPCDSREGRSVEAAPKHLIIVDGAIMQPIPEHPKRDYIFC  120
             ARKRGWKGYWVCLKGTTLLFYPCDSREGRSVEAAPKHLIIVDGAIMQPIPEHPKRDYIFC
Sbjct  845   ARKRGWKGYWVCLKGTTLLFYPCDSREGRSVEAAPKHLIIVDGAIMQPIPEHPKRDYIFC  904

Query  121   LSTAFGDAYLFQAPCQVELENWVNSIHSACAAAFARHRGKTGTLHLLQEEIFRLEKAIES  180
             LSTAFGDAYLFQAPCQVELENWVNSIHSACAAAFARHRGKTGTLHLLQEEIFRLEKAIES
Sbjct  905   LSTAFGDAYLFQAPCQVELENWVNSIHSACAAAFARHRGKTGTLHLLQEEIFRLEKAIES  964

Query  181   DHKLKHMAELQQSVVTDQDTRHQIQTQILQWEENLERLHCEQFRLRCYMASLQSGELPNP  240
             DHKLKHMAELQQSVVTDQ+TRHQIQTQILQWEENLERLHCEQFRLRCYMASLQSGELPNP
Sbjct  965   DHKLKHMAELQQSVVTDQETRHQIQTQILQWEENLERLHCEQFRLRCYMASLQSGELPNP  1024

Query  241   KSLLTHVSRPTKNTLNKLGVFTVSSFHAFICARSPSLLNNLLAGRGATKRRPPMLSRSNS  300
             KSLLTHVSRPTKNTLNKLGVFTVSSFHAFICARSPSLLNNLLAGRGATKRRPPMLSRSNS
Sbjct  1025  KSLLTHVSRPTKNTLNKLGVFTVSSFHAFICARSPSLLNNLLAGRGATKRRPPMLSRSNS  1084

Query  301   GSSRRSMQMNSRDEPEKTFKVAMPDNAYATVYLRDAMSVEEFLASACARRNLNPMEHFVR  360
             GSSRRSMQMNSRDEPEKTFKVAMPDNAY+TVYLRDAMSVEEFLASACARRNLNPMEHFVR
Sbjct  1085  GSSRRSMQMNSRDEPEKTFKVAMPDNAYSTVYLRDAMSVEEFLASACARRNLNPMEHFVR  1144

Query  361   VKKRRDMEDHNYFVPHRNDLIENYLHNHEFVEVCMKILYQVELHRTTLEQMWGFSVEAEL  420
             VKKRRDMEDHNYFVPHRNDLIENYLHNHEFVEVCMKILYQVEL RTTLEQMWGFSVEAEL
Sbjct  1145  VKKRRDMEDHNYFVPHRNDLIENYLHNHEFVEVCMKILYQVELQRTTLEQMWGFSVEAEL  1204

Query  421   IENAERQDELCCYVSRVEDKSVAMQNGIIKGDEIMVINAAIVSDLDMMYLESVLQEEQSL  480
             IENAERQDELCCYVSRVEDKSVAM NGIIKGDEIMVIN AIVSDLDMMYLESVLQEEQSL
Sbjct  1205  IENAERQDELCCYVSRVEDKSVAMHNGIIKGDEIMVINGAIVSDLDMMYLESVLQEEQSL  1264

Query  481   CMMMRSSRTEPPDLVGIMRVTDDMIDSLVCPPPPSDPPVMSEEMISGLIVPAPGWNGTGK  540
              MMMRSSRTEPPDLVGIMRVTDDMIDSLVCPPPP+DPPVMSEEMI+GLIVPAPGWNGT K
Sbjct  1265  SMMMRSSRTEPPDLVGIMRVTDDMIDSLVCPPPPTDPPVMSEEMITGLIVPAPGWNGTSK  1324

Query  541   DLYSPEAESSPAPSSVEPT--PAQMV-----------AVATKPTSRTSSFEIENLLKTAE  587
             DLYSPEAESSPA S V+P    AQ+                KPTSRTSSFEIENLLKTAE
Sbjct  1325  DLYSPEAESSPATSFVDPAAMAAQLAVGGVGGVVVGGLGVAKPTSRTSSFEIENLLKTAE  1384

Query  588   QVTGFCRSPQETRKSSPTGSVTSSVSNAALTPSRQLTDAEKLRKVILELVDTERTYVKHL  647
             QVTGFCRSPQETRKSSPTGSVTSSVS  ALTPSRQLTDAEKLRKV++ELVDTERTYVKHL
Sbjct  1385  QVTGFCRSPQETRKSSPTGSVTSSVSTTALTPSRQLTDAEKLRKVVMELVDTERTYVKHL  1444

Query  648   NNLLEHYLEPMKRETFLSNAEINALFGNIHEIVTFQRQFLQNLEEALELEPDFHKFEHSS  707
             NNLLEHYLEPMKRETFLSNAEINALFGNIHEIVTFQRQFLQNLEE+L+LEPDF+KFEH  
Sbjct  1445  NNLLEHYLEPMKRETFLSNAEINALFGNIHEIVTFQRQFLQNLEESLDLEPDFNKFEHCG  1504

Query  708   QFRNVLFAIGSAFLYYVNHFKLYSSFCASHSKAQKVLHPNEGNHALQEFLAARNPKQQHS  767
             QFRNVLFAIGSAFLYYVNHFKLYSSFCASHSKAQKVLHPNEGNHALQEFLAARNPKQQHS
Sbjct  1505  QFRNVLFAIGSAFLYYVNHFKLYSSFCASHSKAQKVLHPNEGNHALQEFLAARNPKQQHS  1564

Query  768   STLESYLIKPIQRILKYPLLLQQLRNLTDSRADEHLHLCEALKGMEKVAEHINEMQRIHE  827
             STLESYLIKPIQRILKYPLLLQQ+RNLTD+RADEH+HLCEALKGMEKVAEHINEMQRIHE
Sbjct  1565  STLESYLIKPIQRILKYPLLLQQMRNLTDTRADEHVHLCEALKGMEKVAEHINEMQRIHE  1624

Query  828   EYGAIFDHLFRQHQKSCKQPIDLSPGDLLYYGGVEWLNISDFLGKIKKGLELHAMCFVFK  887
             EYGAIFDHLFRQHQKSCKQPIDLSPGDLLYYGGVEWLNISDFLGKIKKGLELHAMCFVFK
Sbjct  1625  EYGAIFDHLFRQHQKSCKQPIDLSPGDLLYYGGVEWLNISDFLGKIKKGLELHAMCFVFK  1684

Query  888   SAVVFLCKERLRQKKKLMGVSSKNTPNEVEIIRYQVLIPVTEVQVRASSAKDMDSHFLWE  947
             SAVVFLCKERLRQKKKLMGVSSKN  NEVEIIRYQVLIPVTEVQVRASSAKDMDSHFLWE
Sbjct  1685  SAVVFLCKERLRQKKKLMGVSSKNATNEVEIIRYQVLIPVTEVQVRASSAKDMDSHFLWE  1744

Query  948   LIHLRSQLQRRSEKVYVLSNSTADFRNAFLKTIRQIIRESVRNMSIPMKGFGSSGSVSGI  1007
             LIHLRSQLQRRSEKVYVLSNSTADFRNAFLKTIRQIIRESVRNMSIPMK FG S      
Sbjct  1745  LIHLRSQLQRRSEKVYVLSNSTADFRNAFLKTIRQIIRESVRNMSIPMKNFGGSSGSVSG  1804

Query  1008  SSQG-----GGSGSSQTLERPKQQITIIQGSQTLGKPKKKSGSQRHSAGNIDYDNLSGSQ  1062
              S       G  G+SQTLERPKQQITI+ GS TLGKPKKKSGSQRHSAGNIDYDNLSGSQ
Sbjct  1805  HSSQGMGSMGYPGNSQTLERPKQQITIVHGSHTLGKPKKKSGSQRHSAGNIDYDNLSGSQ  1864

Query  1063  EADDVP----MLH----HQHQQQQLQPSGFRGRSKTVGDTTDPQQQQQQQH---------  1105
             EADD+P    ++H    H H  QQ+QP+GFRGRSKTVGD T+      + H         
Sbjct  1865  EADDLPPSVGVVHYASGHTH-GQQMQPAGFRGRSKTVGDVTEITCSSPEPHQQQQQQQQQ  1923

Query  1106  ---------------------QKHMQHHQQQQMHHHHQQMHQSDIERMDPGTKSEGEEDS  1144
                                  +      +Q  +HH     H SDIER+DPGTKSEGEEDS
Sbjct  1924  QQQLMQQGHAHAHPHPHPHPREPPPPPIRQPHLHH-----HSSDIERIDPGTKSEGEEDS  1978

Query  1145  QQGTIKAKATLGRTPNHLTLSTTSTLSVGSTGSQARLIQSSHPPSSYQPVLMKDLGSPVW  1204
             QQGTI+ KATLGRTPNHLTLSTTSTLSVGSTGSQARLIQSSHPP+SYQPVLMKDLGSPVW
Sbjct  1979  QQGTIRPKATLGRTPNHLTLSTTSTLSVGSTGSQARLIQSSHPPASYQPVLMKDLGSPVW  2038

Query  1205  KPRDMINLG-DAQSTTRKDD  1223
             KPRDMINLG D QSTTRKDD
Sbjct  2039  KPRDMINLGTDPQSTTRKDD  2058


>SIF1_DROME unnamed protein product
Length=2072

 Score = 2208 bits (5721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1123/1280 (88%), Positives = 1152/1280 (90%), Gaps = 72/1280 (6%)

Query  1     MSLTTAVSDEDDGESVMASPYKAKATGTAASSFNCTGAVRKAGFLSVKKWLLRKKHQIEL  60
             MSLTTAVSDEDDGESVMASPYKAKATGTAASSFNCTGAVRKAGFLSVKKWLLRKKHQIEL
Sbjct  805   MSLTTAVSDEDDGESVMASPYKAKATGTAASSFNCTGAVRKAGFLSVKKWLLRKKHQIEL  864

Query  61    ARKRGWKGYWVCLKGTTLLFYPCDSREGRSVEAAPKHLIIVDGAIMQPIPEHPKRDYIFC  120
             ARKRGWKGYWVCLKGTTLLFYPCDSREGRSVEAAPKHLIIVDGAIMQPIPEHPKRDYIFC
Sbjct  865   ARKRGWKGYWVCLKGTTLLFYPCDSREGRSVEAAPKHLIIVDGAIMQPIPEHPKRDYIFC  924

Query  121   LSTAFGDAYLFQAPCQVELENWVNSIHSACAAAFARHRGKTGTLHLLQEEIFRLEKAIES  180
             LSTAFGDAYLFQAPCQVELENWVNSIHSACAAAFARHRGKTGTLHLLQEEIFRLEKAIES
Sbjct  925   LSTAFGDAYLFQAPCQVELENWVNSIHSACAAAFARHRGKTGTLHLLQEEIFRLEKAIES  984

Query  181   DHKLKHMAELQQSVVTDQDTRHQIQTQILQWEENLERLHCEQFRLRCYMASLQSGELPNP  240
             DHKLKHMAELQQSVVTDQ+TRHQIQTQILQWEENLERLHCEQFRLRCYMASLQSGELPNP
Sbjct  985   DHKLKHMAELQQSVVTDQETRHQIQTQILQWEENLERLHCEQFRLRCYMASLQSGELPNP  1044

Query  241   KSLLTHVSRPTKNTLNKLGVFTVSSFHAFICARSPSLLNNLLAGRGATKRRPPMLSRSNS  300
             KSLLTHVSRPTKNTLNKLGVFTVSSFHAFICARSPSLLNNLLAGRGATKRRPPMLSRSNS
Sbjct  1045  KSLLTHVSRPTKNTLNKLGVFTVSSFHAFICARSPSLLNNLLAGRGATKRRPPMLSRSNS  1104

Query  301   GSSRRSMQMNSRDEPEKTFKVAMPDNAYATVYLRDAMSVEEFLASACARRNLNPMEHFVR  360
             GSSRRSMQMNSRDEPEKTFKVAMPDNAY+TVYLRDAMSVEEFLASACARRNLNPMEHFVR
Sbjct  1105  GSSRRSMQMNSRDEPEKTFKVAMPDNAYSTVYLRDAMSVEEFLASACARRNLNPMEHFVR  1164

Query  361   VKKRRDMEDHNYFVPHRNDLIENYLHNHEFVEVCMKILYQVELHRTTLEQMWGFSVEAEL  420
             VKKRRDMEDHNYFVPHRNDLIENYLHNHEFVEVCMKILYQVEL RTTLEQMWGFSVEAEL
Sbjct  1165  VKKRRDMEDHNYFVPHRNDLIENYLHNHEFVEVCMKILYQVELQRTTLEQMWGFSVEAEL  1224

Query  421   IENAERQDELCCYVSRVEDKSVAMQNGIIKGDEIMVINAAIVSDLDMMYLESVLQEEQSL  480
             IENAERQDELCCYVSRVEDKSVAM NGIIKGDEIMVIN AIVSDLDMMYLESVLQEEQSL
Sbjct  1225  IENAERQDELCCYVSRVEDKSVAMHNGIIKGDEIMVINGAIVSDLDMMYLESVLQEEQSL  1284

Query  481   CMMMRSSRTEPPDLVGIMRVTDDMIDSLVCPPPPSDPPVMSEEMISGLIVPAPGWNGTGK  540
              MMMRSSRTEPPDLVGIMRVTDDMIDSLVCPPPP+DPPVMSEEMI+GLIVPAPGWNGT K
Sbjct  1285  SMMMRSSRTEPPDLVGIMRVTDDMIDSLVCPPPPTDPPVMSEEMITGLIVPAPGWNGTSK  1344

Query  541   DLYSPEAESSPAPSSVEPT--PAQMV-----------AVATKPTSRTSSFEIENLLKTAE  587
             DLYSPEAESSPA S V+P    AQ+                KPTSRTSSFEIENLLKTAE
Sbjct  1345  DLYSPEAESSPATSFVDPAAMAAQLAVGGVGGVVVGGLGVAKPTSRTSSFEIENLLKTAE  1404

Query  588   QVTGFCRSPQETRKSSPTGSVTSSVSNAALTPSRQLTDAEKLRKVILELVDTERTYVKHL  647
                      QETRKSSPTGSVTSSVS  ALTPSRQLTDAEKLRKV++ELVDTERTYVKHL
Sbjct  1405  ---------QETRKSSPTGSVTSSVSTTALTPSRQLTDAEKLRKVVMELVDTERTYVKHL  1455

Query  648   NNLLEHYLEPMKRETFLSNAEINALFGNIHEIVTFQRQFLQNLEEALELEPDFHKFEHSS  707
             NNLLEHYLEPMKRETFLSNAEINALFGNIHEIVTFQRQFLQNLEE+L+LEPDF+KFEH  
Sbjct  1456  NNLLEHYLEPMKRETFLSNAEINALFGNIHEIVTFQRQFLQNLEESLDLEPDFNKFEHCG  1515

Query  708   QFRNVLFAIGSAFLYYVNHFKLYSSFCASHSKAQKVLHPNEGNHALQEFLAARNPKQQHS  767
             QFRNVLFAIGSAFLYYVNHFKLYSSFCASHSKAQKVLHPNEGNHALQEFLAARNPKQQHS
Sbjct  1516  QFRNVLFAIGSAFLYYVNHFKLYSSFCASHSKAQKVLHPNEGNHALQEFLAARNPKQQHS  1575

Query  768   STLESYLIKPIQRILKYPLLLQQLRNLTDSRADEHLHLCEALKGMEKVAEHINEMQRIHE  827
             STLESYLIKPIQRILKYPLLLQQ+RNLTD+RADEH+HLCEALKGMEKVAEHINEMQRIHE
Sbjct  1576  STLESYLIKPIQRILKYPLLLQQMRNLTDTRADEHVHLCEALKGMEKVAEHINEMQRIHE  1635

Query  828   EYGAIFDHLFRQHQKSCKQPIDLSPGDLLYYGGVEWLNISDFLGKIKKGLELHAMCFVFK  887
             EYGAIFDHLFRQHQKSCKQPIDLSPGDLLYYGGVEWLNISDFLGKIKKGLELHAMCFVFK
Sbjct  1636  EYGAIFDHLFRQHQKSCKQPIDLSPGDLLYYGGVEWLNISDFLGKIKKGLELHAMCFVFK  1695

Query  888   SAVVFLCKERLRQKKKLMGVSSKNTPNEVEIIRYQVLIPVTEVQVRASSAKDMDSHFLWE  947
             SAVVFLCKERLRQKKKLMGVSSKN  NEVEIIRYQVLIPVTEVQVRASSAKDMDSHFLWE
Sbjct  1696  SAVVFLCKERLRQKKKLMGVSSKNATNEVEIIRYQVLIPVTEVQVRASSAKDMDSHFLWE  1755

Query  948   LIHLRSQLQRRSEKVYVLSNSTADFRNAFLKTIRQIIRESVRNMSIPMKGFGSSGSVSGI  1007
             LIHLRSQLQRRSEKVYVLSNSTADFRNAFLKTIRQIIRESVRNMSIPMK FG S      
Sbjct  1756  LIHLRSQLQRRSEKVYVLSNSTADFRNAFLKTIRQIIRESVRNMSIPMKNFGGSSGSVSG  1815

Query  1008  SSQG-----GGSGSSQTLERPKQQITIIQGSQTLGKPKKKSGSQRHSAGNIDYDNLSGSQ  1062
              S       G  G+SQTLERPKQQITI+ GS TLGKPKKKSGSQRHSAGNIDYDNLSGSQ
Sbjct  1816  HSSQGMGSMGYPGNSQTLERPKQQITIVHGSHTLGKPKKKSGSQRHSAGNIDYDNLSGSQ  1875

Query  1063  EADDVP----MLH----HQHQQQQLQPSGFRGRSKTVGDTTDPQQQQQQQH---------  1105
             EADD+P    ++H    H H  QQ+QP+GFRGRSKTVGD T+      + H         
Sbjct  1876  EADDLPPSVGVVHYASGHTH-GQQMQPAGFRGRSKTVGDVTEITCSSPEPHQQQQQQQQQ  1934

Query  1106  ---------------------QKHMQHHQQQQMHHHHQQMHQSDIERMDPGTKSEGEEDS  1144
                                  +      +Q  +HH     H SDIER+DPGTKSEGEEDS
Sbjct  1935  QQQLMQQGHAHAHPHPHPHPREPPPPPIRQPHLHH-----HSSDIERIDPGTKSEGEEDS  1989

Query  1145  QQGTIKAKATLGRTPNHLTLSTTSTLSVGSTGSQARLIQSSHPPSSYQPVLMKDLGSPVW  1204
             QQGTI+ KATLGRTPNHLTLSTTSTLSVGSTGSQARLIQSSHPP+SYQPVLMKDLGSPVW
Sbjct  1990  QQGTIRPKATLGRTPNHLTLSTTSTLSVGSTGSQARLIQSSHPPASYQPVLMKDLGSPVW  2049

Query  1205  KPRDMINLG-DAQSTTRKDD  1223
             KPRDMINLG D QSTTRKDD
Sbjct  2050  KPRDMINLGTDPQSTTRKDD  2069


>O01847_CAEEL unnamed protein product
Length=889

 Score = 100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 71/272 (26%), Positives = 131/272 (48%), Gaps = 27/272 (10%)

Query  624  TDAEKLRKVILELVDTERTYVKHLNNLLEHYLEPMKRETFLSNAEINALFGNIHEIVTFQ  683
            T   KL   + EL+ TE+ YV  L  +          E FL   ++  +      +   Q
Sbjct  533  TGCAKLAMALQELLVTEKKYVSDLREM---------NEVFLCMRQVRDIMNAAIRLYKMQ  583

Query  684  RQFLQNLEEALELEPDFHKFEHS-SQFRNVLFAIGSAFLYYVNHFKLYSSFCASHSKAQK  742
              F+ ++EEA+    D  + + S +Q R+ +  + + F+   + FK+Y+ + A +   Q 
Sbjct  584  TSFVDSIEEAI---GDMSRQDISVAQIRDSVMRVCAVFINKCSDFKIYAEYAAGYHLLQ-  639

Query  743  VLHPNEGNHALQEFLAARNPKQQHSSTLESYLIKPIQRILKYPLLLQQLRNLTDSRADEH  802
              H  +    L   L A N  ++   + ES +IKP+QRI++YPLLL+ + +     A E 
Sbjct  640  --HEIKNKKELLSKLEAVNSTREQHCSWESRMIKPVQRIVQYPLLLKNIADALPKDARER  697

Query  803  LHLCEALKGMEKVAEHINEMQRIHEEYGAIFDHLFRQHQKS-CKQPIDLSPGDLLYYGGV  861
            + +  AL+ M+  AE++NEMQR+HE+Y    + + + ++    ++ + L   +LL +  +
Sbjct  698  VQVEAALQKMQTSAEYVNEMQRLHEDYAQYMETVRKANEPMLAEKSLRLDTRELLVFAHI  757

Query  862  EWLNISDFLGKIKKGLELHAMCFVFKSAVVFL  893
            +W          +     H + FVF S ++ L
Sbjct  758  KW----------RDAPAEHYVVFVFHSLILLL  779



Lambda      K        H
   0.312    0.124    0.369 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 18013231158


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jan 6, 2022  5:17 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_014085139.1 PREDICTED: uncharacterized protein LOC106614091
[Bactrocera oleae]

Length=5292


***** No hits found *****



Lambda      K        H
   0.305    0.122    0.330 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 72507983966


Query= XP_014085140.1 PREDICTED: 26S protease regulatory subunit 7
[Bactrocera oleae]

Length=433
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7KMQ0_DROME  unnamed protein product                                 870     0.0  
PRS7_CAEEL  unnamed protein product                                   780     0.0  
PRS7_DICDI  unnamed protein product                                   708     0.0  


>Q7KMQ0_DROME unnamed protein product
Length=433

 Score = 870 bits (2249),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/433 (97%), Positives = 429/433 (99%), Gaps = 0/433 (0%)

Query  1    MPDYLGDDQRKVKSEELEEKEIKSLDEGDIELLKTYGQSQYHRAIKSIEEDIQKAVKQVN  60
            MPDYLGDDQRKVK +E E+KEIKSLDEGDIELLKTYGQSQYH++IKSIEEDIQKAVKQVN
Sbjct  1    MPDYLGDDQRKVKHDEKEDKEIKSLDEGDIELLKTYGQSQYHKSIKSIEEDIQKAVKQVN  60

Query  61   ELTGIKESDTGLAPPALWDLAADKQILQNEQPLQVARCTKIINADSDDPKYIINVKQFAK  120
            ELTGIKESDTGLAPPALWDLAADKQILQNEQPLQVARCTKIINADSDDPKYIINVKQFAK
Sbjct  61   ELTGIKESDTGLAPPALWDLAADKQILQNEQPLQVARCTKIINADSDDPKYIINVKQFAK  120

Query  121  FVVDLADSVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEDKPDVTYSDVGGC  180
            FVVDLADSVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEDKPDVTYSDVGGC
Sbjct  121  FVVDLADSVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEDKPDVTYSDVGGC  180

Query  181  KEQIEKLREVVETPLLHPEKFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRV  240
            KEQIEKLREVVETPLLHPEKFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRV
Sbjct  181  KEQIEKLREVVETPLLHPEKFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRV  240

Query  241  IGSELVQKYVGEGARMVRELFEMARSKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTML  300
            IGSELVQKYVGEGARMVRELFEMARSKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTML
Sbjct  241  IGSELVQKYVGEGARMVRELFEMARSKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTML  300

Query  301  ELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKVEFGLPDLEGRTHIFKIHAR  360
            ELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKVEFGLPD +GR+HIFKIHAR
Sbjct  301  ELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKVEFGLPDQDGRSHIFKIHAR  360

Query  361  SMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKVATEKDFLEAVNKVIKSY  420
            SMSVERDIRF+LLARLCPNSTGAEIRSVCTEAGMFAIRARRKVATEKDFLEAV KVIKSY
Sbjct  361  SMSVERDIRFDLLARLCPNSTGAEIRSVCTEAGMFAIRARRKVATEKDFLEAVKKVIKSY  420

Query  421  AKFSATPRYMTYN  433
            AKFSATPRYMTYN
Sbjct  421  AKFSATPRYMTYN  433


>PRS7_CAEEL unnamed protein product
Length=435

 Score = 780 bits (2015),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/435 (85%), Positives = 404/435 (93%), Gaps = 2/435 (0%)

Query  1    MPDYLGDDQRKVKSEEL--EEKEIKSLDEGDIELLKTYGQSQYHRAIKSIEEDIQKAVKQ  58
            MPD+LGDD RK K ++   EEK  ++LDEGDI +LK YGQ  Y   +K+++ DI+  +K+
Sbjct  1    MPDHLGDDMRKTKKDDTKEEEKNFQALDEGDIAVLKRYGQGPYAEQLKTLDADIENCLKK  60

Query  59   VNELTGIKESDTGLAPPALWDLAADKQILQNEQPLQVARCTKIINADSDDPKYIINVKQF  118
            VNEL+G+KESDTGLAPPALWD+AADKQ +Q EQPLQVARCTKII +D  DP+Y+INVKQF
Sbjct  61   VNELSGVKESDTGLAPPALWDIAADKQAMQQEQPLQVARCTKIITSDKHDPRYLINVKQF  120

Query  119  AKFVVDLADSVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEDKPDVTYSDVG  178
            AKFVVDLADSVAPTDIEEGMRVGVDRNKYQIH+PLP KIDPTVTMMQVE+KPDVTYSDVG
Sbjct  121  AKFVVDLADSVAPTDIEEGMRVGVDRNKYQIHLPLPAKIDPTVTMMQVEEKPDVTYSDVG  180

Query  179  GCKEQIEKLREVVETPLLHPEKFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFI  238
            GCK+QIEKLREVVETPLLHPE++VNLGIEPPKGVLL+GPPGTGKTLCARAVANRTDACFI
Sbjct  181  GCKDQIEKLREVVETPLLHPERYVNLGIEPPKGVLLYGPPGTGKTLCARAVANRTDACFI  240

Query  239  RVIGSELVQKYVGEGARMVRELFEMARSKKACLIFFDEIDAIGGARFDDGAGGDNEVQRT  298
            RVIGSELVQKYVGEGARMVRELFEMAR+KKACLIFFDEIDA+GGARFDDG GGDNEVQRT
Sbjct  241  RVIGSELVQKYVGEGARMVRELFEMARTKKACLIFFDEIDAVGGARFDDGQGGDNEVQRT  300

Query  299  MLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKVEFGLPDLEGRTHIFKIH  358
            MLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKVEF LPDL GR HI KIH
Sbjct  301  MLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKVEFALPDLAGRAHILKIH  360

Query  359  ARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKVATEKDFLEAVNKVIK  418
            A+ MSVERDIR++LLARLCPNSTGAEIRSVCTEAGMFAIRARRKVATEKDFLEA+NKV+K
Sbjct  361  AKQMSVERDIRYDLLARLCPNSTGAEIRSVCTEAGMFAIRARRKVATEKDFLEAINKVVK  420

Query  419  SYAKFSATPRYMTYN  433
             YAKFSATPRY+T+N
Sbjct  421  GYAKFSATPRYLTHN  435


>PRS7_DICDI unnamed protein product
Length=428

 Score = 708 bits (1828),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/426 (79%), Positives = 375/426 (88%), Gaps = 0/426 (0%)

Query  8    DQRKVKSEELEEKEIKSLDEGDIELLKTYGQSQYHRAIKSIEEDIQKAVKQVNELTGIKE  67
            ++  V+ E L E    +LDEGDI LLK+YG   Y ++I+ +EEDI+K   +VNEL GIKE
Sbjct  3    NKEDVEDELLNETAPVALDEGDIALLKSYGVGPYSKSIRILEEDIKKMTSKVNELCGIKE  62

Query  68   SDTGLAPPALWDLAADKQILQNEQPLQVARCTKIINADSDDPKYIINVKQFAKFVVDLAD  127
            SDTG+ PP+ WDL  DK     E PLQVARCTKII+    + KYII VKQ AKFVV L D
Sbjct  63   SDTGIGPPSQWDLVVDKTSAHEEPPLQVARCTKIIDVGKPNAKYIITVKQIAKFVVALGD  122

Query  128  SVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEDKPDVTYSDVGGCKEQIEKL  187
             ++PTD+EEG+RVGVDRNKYQI IPLPPKID +VTMMQVE+KPD+TY DVGGCKEQIEKL
Sbjct  123  KLSPTDVEEGIRVGVDRNKYQIQIPLPPKIDASVTMMQVEEKPDITYKDVGGCKEQIEKL  182

Query  188  REVVETPLLHPEKFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRVIGSELVQ  247
            REVVE PLLHPEKFVNLGI+PPKGVL++GPPGTGKTLCARAVANRTDA F+RVIGSELVQ
Sbjct  183  REVVEMPLLHPEKFVNLGIDPPKGVLMYGPPGTGKTLCARAVANRTDAAFVRVIGSELVQ  242

Query  248  KYVGEGARMVRELFEMARSKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLD  307
            KYVGEGARMVR+LF+MARSKKAC+IFFDE+DAIGGARFDDGAGGDNEVQRTMLELINQLD
Sbjct  243  KYVGEGARMVRDLFQMARSKKACIIFFDEVDAIGGARFDDGAGGDNEVQRTMLELINQLD  302

Query  308  GFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKVEFGLPDLEGRTHIFKIHARSMSVERD  367
            GFDPRGNIKVLMATNRPDTLDPAL+RPGRLDRKVEFGLPDLEGR HIF IHA++MS  RD
Sbjct  303  GFDPRGNIKVLMATNRPDTLDPALLRPGRLDRKVEFGLPDLEGRAHIFTIHAKTMSCARD  362

Query  368  IRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKVATEKDFLEAVNKVIKSYAKFSATP  427
            IRFELLARLCPNSTGA+IRSVCTEAGMFAIRARRKV +EKDFLEA++KVIKSYAKFSAT 
Sbjct  363  IRFELLARLCPNSTGADIRSVCTEAGMFAIRARRKVVSEKDFLEAIDKVIKSYAKFSATS  422

Query  428  RYMTYN  433
            RYM YN
Sbjct  423  RYMHYN  428



Lambda      K        H
   0.305    0.122    0.330 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 72507983966


Query= XP_014085141.1 PREDICTED: solute carrier organic anion transporter
family member 3A1 [Bactrocera oleae]

Length=928
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VVH9_DROME  unnamed protein product                                 1135    0.0  
Q9VK84_DROME  unnamed protein product                                 320     1e-96
Q9W270_DROME  unnamed protein product                                 318     2e-96


>Q9VVH9_DROME unnamed protein product
Length=819

 Score = 1135 bits (2935),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 591/900 (66%), Positives = 674/900 (75%), Gaps = 102/900 (11%)

Query  47   SNGDA-------SLNGTPLHNGHGNANGTNGYQNGTRRDSTQAWTPLLSNGNGNSAALSN  99
            SNGD        SL G P  NGHG  NG   +QNG RRDS+QA+TPLLS  N        
Sbjct  4    SNGDVEAAAQVQSLGGKP-SNGHGQLNGNGYHQNGGRRDSSQAFTPLLSQHN--------  54

Query  100  GNGNAGLTDNSLVGTASINGAEDGSLAGQETNGTLGDPTTVLYTTSTSNNNEWKDAEQIN  159
                              NG  +G +       T   P+TVLY ++ SNNNEWK  E + 
Sbjct  55   ------------------NGTTNGEV-------TTPPPSTVLYESTPSNNNEWKAPEDLG  89

Query  160  NLKNGLLHYPVNHQGNNNGSLMNGKNGIGLGVPEKY-DEQDPLTGLYTQKNTRTREPDES  218
            +LKNGL +       NNNG+      G G  + EKY  EQ PLTG Y +   R+ E +ES
Sbjct  90   HLKNGLGNI---LSSNNNGT------GNGHSLSEKYAHEQAPLTGGY-KLPPRSSESEES  139

Query  219  DTDSELSNGDRSAPG--CGLFGCRPKWARNFASTNVFMVVFLLAYILQGMYMTYFVSVIT  276
            D DS+L+ G  +     CGLFGCRP+WAR FAST+VFMVVFLLAYILQGMYMTYFVSVIT
Sbjct  140  DFDSDLNGGSSAESSSSCGLFGCRPRWARRFASTHVFMVVFLLAYILQGMYMTYFVSVIT  199

Query  277  TIEKLFQIKSKTTGFLLSASEMGQISTAMLLTYFAGRGHRPRWIACGMVLFSIAAFACSL  336
            TIEKLFQIKSKTTG LLSASEMGQI TAMLLTYFAGRGHRPRWIACGMVLFSIAAF+C+L
Sbjct  200  TIEKLFQIKSKTTGILLSASEMGQICTAMLLTYFAGRGHRPRWIACGMVLFSIAAFSCAL  259

Query  337  PHFIFGKQLMQSLDTLSNGGNGGNAAMRALHGQMLHASYGLHGMNDTINATSANALEGGL  396
            PHFIFG+QLM S           +  ++       + S+  H +N +    + N      
Sbjct  260  PHFIFGEQLMHS-----------SVILQQTQVSPPNNSFSSHWLNASSEQVNPN------  302

Query  397  SALLANVPGSHEMNLCIPGQNSTNSNSECDEDQKLEQASHSKITVIVLCIFFASLLSSGI  456
                          LCI G N T+S SEC+E+++LEQASHSKITVIVLCIFF SLLSSGI
Sbjct  303  --------------LCILGGNQTHSGSECNEERQLEQASHSKITVIVLCIFFGSLLSSGI  348

Query  457  GQTAVATLGIPYIDDNVASKQSPMYMAITIGVRILGPASGFIVGSFCTRWYVNFSNPGFD  516
            GQTAVATLGIPYIDDNV SKQSPMYMA+TIG+RILGPASGFI GSFCTRWYVNFSNPGFD
Sbjct  349  GQTAVATLGIPYIDDNVGSKQSPMYMAVTIGMRILGPASGFIFGSFCTRWYVNFSNPGFD  408

Query  517  ASDPRWIGAWWLGPVGIGTLMLLSSFAMFSFPKQLRGKRNPNVGEAKTDGGDDAAAAVEV  576
            A+DPRWIGAWWLGPV IG+LMLL+S AMFSFPKQLRGK+ P  G+  T      AA VE 
Sbjct  409  ATDPRWIGAWWLGPVAIGSLMLLASIAMFSFPKQLRGKQKPP-GQTAT-----PAAPVEP  462

Query  577  DEKPKLRDFPKTVRRQLKNDILMFRTASCVFHLLPIAGLYTFLPKYLETQFRLTTYDASM  636
            +EKPKL+DFPKTVRRQL NDILMFRTASCVFHLLPIAGLYTFLPKYLETQFRL TYDA+M
Sbjct  463  EEKPKLKDFPKTVRRQLSNDILMFRTASCVFHLLPIAGLYTFLPKYLETQFRLATYDANM  522

Query  637  IAAFCGILVMGVGIVISGLVILKLKPSARSVAAWIAFTALFYSAGMVVLMFVGCSMKDFA  696
            IAAFCGILVMG+GIVISGL ILK KP+AR VAAWIAFTAL YSAGM++LMF+GCSM DFA
Sbjct  523  IAAFCGILVMGIGIVISGLFILKRKPTARGVAAWIAFTALVYSAGMIILMFIGCSMNDFA  582

Query  697  GYKSATSDSPAMIERACD--LNCSCDTGNYAPICGMDGRIYISTCHAGCTASAL--TDNG  752
            GYK +  +SPA+IE  C   LNC+CD  N+APIC  DG++YIS CHAGC++S+L  +DN 
Sbjct  583  GYKPSDGNSPALIEPTCSAALNCTCDKENFAPICA-DGKMYISACHAGCSSSSLRPSDNR  641

Query  753  TVFSNCTCIPDSFKNQAIGGYCANNCKNFIFFIIIFAVCVFMHSTSEVGSMLLVMRCTHP  812
            T++S+C CIPD+   +A+ GYC NNCKNFI+FI+IFA+CVFMHSTSEVGSMLLVMRCTHP
Sbjct  642  TLYSDCACIPDA--PEAVNGYCDNNCKNFIYFILIFAICVFMHSTSEVGSMLLVMRCTHP  699

Query  813  NDKAMAMGIIQSAIGLFGNVPCPIIYGAVVDSACLLWKTVCGKHGACSLYDSDTFRHYFL  872
             DKAMAMG+IQSAIGLFGNVPCPIIYGAVVDSACL+WK+VCGKHGACSLYD+DTFR YFL
Sbjct  700  KDKAMAMGVIQSAIGLFGNVPCPIIYGAVVDSACLIWKSVCGKHGACSLYDADTFRQYFL  759

Query  873  GITAGIMFLAFIMDLVVWSKAHRIDITPED---GSEPHGKQTVAETECKKSMV-APDTSV  928
            GITAGIMFLAF+MDLVVW KAHRIDI PED   G      +T+  +E K+ +  APDT+V
Sbjct  760  GITAGIMFLAFLMDLVVWRKAHRIDIAPEDPQEGGPASNGRTLEVSESKQPITPAPDTTV  819


 Score = 30.8 bits (68),  Expect = 6.9, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 44/110 (40%), Gaps = 14/110 (13%)

Query  9    DVEAAANQQMLNFQSPQRQIKTGTASTSPAGTPYKQNGSNGDASLNGTPLHNGHGNANGT  68
            DVEAAA  Q L         K         G  Y QNG   D+S   TPL + H   NGT
Sbjct  7    DVEAAAQVQSLGG-------KPSNGHGQLNGNGYHQNGGRRDSSQAFTPLLSQHN--NGT  57

Query  69   NGYQNGTRRDSTQAWTPLLSNGNGNSAA-----LSNGNGNAGLTDNSLVG  113
               +  T   ST  +    SN N   A      L NG GN   ++N+  G
Sbjct  58   TNGEVTTPPPSTVLYESTPSNNNEWKAPEDLGHLKNGLGNILSSNNNGTG  107


>Q9VK84_DROME unnamed protein product
Length=745

 Score = 320 bits (821),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 229/803 (29%), Positives = 354/803 (44%), Gaps = 166/803 (21%)

Query  222  SELSNGDRSAPG----CGLFGCRPKWARNFASTNVFMVVFLLAYILQGMYMTYFVSVITT  277
            +E+   D + P     CG+    P W + +A+T +FM V+ L   +Q M   YF+  +TT
Sbjct  2    AEVKRRDPNRPPGHYLCGMANWHPPWLQKYATTKMFMGVYGLLGTIQAMSYMYFIVTLTT  61

Query  278  IEKLFQIKSKTTGFLLSASEMGQISTAMLLTYFAGRGHRPRWIACGMVLFSIAAFACSLP  337
            +EK F+I S+TTG +LS +E+ QI  +++L+Y  G+ +RPRWIA G+V   ++ +   LP
Sbjct  62   LEKRFKIPSQTTGIILSGNEISQIMLSLILSYIGGQRNRPRWIAWGIVFCGLSCYILVLP  121

Query  338  HFIFG--KQLMQ----SLDTLSNGGNGGNAAMRALHGQMLHASYGLHGMNDTINATSANA  391
            HFI+G   +++Q      D+L NG  G + + +                           
Sbjct  122  HFIYGAGHEVLQFTKEYQDSLLNGTTGSDHSFQ---------------------------  154

Query  392  LEGGLSALLANVPGSHEMNLCIPGQNSTNSNSECDEDQKLEQASHSKITVIVLCIFFASL  451
                      N+       LC  G + T    +CD+            + + L + F S 
Sbjct  155  ----------NISSVKTERLC--GVDKTED--DCDD----------LFSYVPLVLIFLSQ  190

Query  452  LSSGIGQTAVATLGIPYIDDNVASKQSPMYMAITIGVRILGPASGFIVGSFCTRWYVNFS  511
               G+G T   +LG  Y+DDN     +P+ +A+ + +R++GP  GF  G      +++ +
Sbjct  191  FVLGVGNTLYYSLGQTYLDDNTKKTNTPLMLAVAMALRMIGPVVGFFFGFISLNTFIDPT  250

Query  512  N-PGFDASDPRWIGAWWLGPVGIGTLMLLSSFAMFSFPKQL-------------------  551
              P  D+ DPRW+GAWWLG V +GTLM L S  +  FPKQL                   
Sbjct  251  KTPLIDSKDPRWLGAWWLGWVILGTLMCLFSGLIGLFPKQLPKVNASRTNSHLPLALRQT  310

Query  552  --RGKRNPNVGEAKTDGGDDA-----AAAVEVDEKPKLRDFPKTVRRQLKNDILMFRTAS  604
                KR  N+  +     + A     AAA    + PKL+DFP+ + R L+N +L+F   S
Sbjct  311  KEELKREENLSLSSRFSSNAALDTIGAAAGANADLPKLKDFPRALMRLLRNKLLIFNILS  370

Query  605  CVFHLLPIAGLYTFLPKYLETQFRLTTYDASMIAAFCGILVMGVGIVISGLVILKLKPSA  664
             VF++L  +G  TFL KY+E QF      A++I     I+ M VG++ SG+V+ K KPS 
Sbjct  371  AVFYILGASGFMTFLTKYMEVQFHKDAQSATIIVGPISIMGMVVGLIGSGMVLSKKKPSV  430

Query  665  RSVAAWIAFTALFYSAGMVVLMFVGC----SMKDFAGYKSATSDSPAMIERACDLNCSCD  720
              V  W          G +   F+ C    SM   AG  + TS+        C++NCSC+
Sbjct  431  SKVLMWNVIVGGISILGQISYAFLYCPNTFSMTQ-AGQLNLTSN--------CNMNCSCE  481

Query  721  TGNYAPICGM-DGRIYISTCHAGCTASALTDNGTVFSNCTCI-----PDS----------  764
              +Y P+C       + S CHAGC     T    ++ +C+C+     P S          
Sbjct  482  GISYTPVCHEPTDTTFFSACHAGCRGYNATSK--LYEDCSCVVNDPAPKSAAQRLLNLLQ  539

Query  765  ----------------------------FKNQAIG-------------GYCANNCK-NFI  782
                                        F +Q +              G C  NC  +F 
Sbjct  540  PTPEPELDTTTYFDEYLSGVPLLDDNGDFDDQLLSRTRRSTSDSVIRPGICTKNCNWSFW  599

Query  783  FFIIIFAVCVFMHSTSEVGSMLLVMRCTHPNDKAMAMGIIQSAIGLFGNVPCPIIYGAVV  842
             F I   +  +  S+  VG++L+  R     DK+ A G+    I L   +P PII+G ++
Sbjct  600  AFSITSMIVSWFGSSGRVGNVLVNYRAVAHEDKSFAQGLALMMISLLALIPGPIIFGRLI  659

Query  843  DSACLLWKTVCGKHGACSLYDSDTFRHYFLGITAGIMFLAFIMDLVVWSKAHRIDI----  898
            DS CL+W   C  +G C LYD   FR+    ++  + F+  + D +VW     +DI    
Sbjct  660  DSTCLVWTKTCNGNGNCQLYDQTRFRYSLNFLSCLLTFMGLLFDYLVWYYGRNLDIYGDK  719

Query  899  -TPEDGSEPHGKQTVAETECKKS  920
               E+       Q +     KKS
Sbjct  720  EAKEEERANRKDQPITPLLAKKS  742


>Q9W270_DROME unnamed protein product
Length=680

 Score = 318 bits (815),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 207/712 (29%), Positives = 339/712 (48%), Gaps = 88/712 (12%)

Query  218  SDTDSELSNGDRSAPGCGLFGCRPKWARNFASTNVFMVVFLLAYILQGMYMTYFVSVITT  277
            +D +  L++ D +   CG    R    + FA+ ++F++V+ +A     M  TYF   ITT
Sbjct  22   ADDEKRLNSSDTT---CGFSIFRGPALQRFATAHMFVIVYGIASCFLAMAFTYFTGTITT  78

Query  278  IEKLFQIKSKTTGFLLSASEMGQISTAMLLTYFAGRGHRPRWIACGMVLFSIAAFACSLP  337
            +EK F I +K +G +   +++  + ++  L+Y+A RGHRPRW+A G+++ +I       P
Sbjct  79   MEKRFNIPTKISGLITVGNDISTVFSSAFLSYYASRGHRPRWVALGLIIIAIFCLLMLTP  138

Query  338  HFIFGKQLMQSLDTLSNGGNGGNAAMRALHGQMLHASYGLHGMNDTINATSANALEGGLS  397
            H  +G                G  A+R      +  S+G      ++N T  N       
Sbjct  139  HIFYGP---------------GEEALRLTEEYGMSESFG-----ASLNITEKND------  172

Query  398  ALLANVPGSHEMNLCIPGQNSTNSNSECDEDQKLEQASHSKITVIVLCIFFASLLSSGIG  457
                        +LC         NS C     LE+A     T IVL  FF +    GIG
Sbjct  173  ------------SLC------HEKNSNC-----LERAGD--YTPIVL--FFIAQFIGGIG  205

Query  458  QTAVATLGIPYIDDNVASKQSPMYMAITIGVRILGPASGFIVGSFCTRWYVN-FSNPGFD  516
             +     G+ Y+DDN AS ++P  ++ +  +R+LGPA GF + S C R Y++ F  P   
Sbjct  206  CSLFYAPGLSYMDDNSASSKTPAMLSWSSFLRMLGPAMGFSMVSLCLRLYIDPFKKPLIT  265

Query  517  ASDPRWIGAWWLGPVGIGTLMLLSSFAMFSFPKQL-RGKRNPNVGEAKTDGGDDAAAAVE  575
             +DPRW+GAWW+G + +  ++ +S+  +  FPK++ R K        K DG +D   A  
Sbjct  266  TNDPRWMGAWWIGWILLTFILTISAVFVGMFPKEMPRAKAR----RLKADGEEDIPLAGR  321

Query  576  VDEKPKLRDFPKTVRRQLKNDILMFRTASCVFHLLPIAGLYTFLPKYLETQFRLTTYDAS  635
                   +D   +++R   N + ++   + + +L      + F PKY+E Q+R +   ++
Sbjct  322  -----SFQDMLDSLKRLASNKVYVYNMLASILYLFGYMPYWIFTPKYIEIQYRQSASTST  376

Query  636  MIAAFCGILVMGVGIVISGLVILKLKPSARSVAAWIAFTALFYSAGMVVLMFVGCSMKDF  695
            M      +     GI+ISG VI K KPSAR++AAW         AGM+  + VGC   D 
Sbjct  377  MATGTWALGFSAAGILISGYVISKYKPSARAMAAWNFVVDYLTVAGMLCYVLVGCDESD-  435

Query  696  AGYKSATSDSPAMIERACDLNCSCDTGNYAPICGMDGRIYISTCHAGCTASALTDNG-TV  754
                 A S S      +C  +C C+   YAP+C  +   +IS CHAGCT  A+ + G T+
Sbjct  436  ----RANSLSIVPTGDSCSASCVCEYVYYAPVCSPENITFISACHAGCTDKAINELGKTI  491

Query  755  FSNCTCIPD-----------SFKNQ---AIGGYCANNC-KNFIFFIIIFAVCVFMHSTSE  799
            ++ C C+ +           S  +Q   A+ G C  +C K F+ F+ +     F+ +T  
Sbjct  492  YTGCRCMGNVSSIISLSNVTSLASQSQIAMDGACPVDCNKQFLIFLAVMCFLKFVGATGR  551

Query  800  VGSMLLVMRCTHPNDKAMAMGIIQSAIGLFGNVPCPIIYGAVVDSACLLWKTVCGKHGAC  859
              ++LL +RC    DK  ++G       +   +P PI++G ++DS CL+W   C   G C
Sbjct  552  SSNLLLALRCVPSKDKTFSLGFGSMVYSVLAFIPSPIVFGWMLDSYCLVWGKTCSSKGNC  611

Query  860  SLYDSDTFRHYFLGITAGIMFLAFIMDLVVWSKAHRIDITPEDGSEPHGKQT  911
             +YD+ + R+    + A ++FL    ++ VW  A  + +  ED      KQ+
Sbjct  612  WIYDTKSLRYTMNLVCASLIFLGSFWNIGVWYHAKDMKVFDEDEKTVQAKQS  663



Lambda      K        H
   0.305    0.122    0.330 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 72507983966


Query= XP_014085142.1 PREDICTED: solute carrier organic anion transporter
family member 3A1 [Bactrocera oleae]

Length=928
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VVH9_DROME  unnamed protein product                                 1135    0.0  
Q9VK84_DROME  unnamed protein product                                 320     1e-96
Q9W270_DROME  unnamed protein product                                 318     2e-96


>Q9VVH9_DROME unnamed protein product
Length=819

 Score = 1135 bits (2935),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 591/900 (66%), Positives = 674/900 (75%), Gaps = 102/900 (11%)

Query  47   SNGDA-------SLNGTPLHNGHGNANGTNGYQNGTRRDSTQAWTPLLSNGNGNSAALSN  99
            SNGD        SL G P  NGHG  NG   +QNG RRDS+QA+TPLLS  N        
Sbjct  4    SNGDVEAAAQVQSLGGKP-SNGHGQLNGNGYHQNGGRRDSSQAFTPLLSQHN--------  54

Query  100  GNGNAGLTDNSLVGTASINGAEDGSLAGQETNGTLGDPTTVLYTTSTSNNNEWKDAEQIN  159
                              NG  +G +       T   P+TVLY ++ SNNNEWK  E + 
Sbjct  55   ------------------NGTTNGEV-------TTPPPSTVLYESTPSNNNEWKAPEDLG  89

Query  160  NLKNGLLHYPVNHQGNNNGSLMNGKNGIGLGVPEKY-DEQDPLTGLYTQKNTRTREPDES  218
            +LKNGL +       NNNG+      G G  + EKY  EQ PLTG Y +   R+ E +ES
Sbjct  90   HLKNGLGNI---LSSNNNGT------GNGHSLSEKYAHEQAPLTGGY-KLPPRSSESEES  139

Query  219  DTDSELSNGDRSAPG--CGLFGCRPKWARNFASTNVFMVVFLLAYILQGMYMTYFVSVIT  276
            D DS+L+ G  +     CGLFGCRP+WAR FAST+VFMVVFLLAYILQGMYMTYFVSVIT
Sbjct  140  DFDSDLNGGSSAESSSSCGLFGCRPRWARRFASTHVFMVVFLLAYILQGMYMTYFVSVIT  199

Query  277  TIEKLFQIKSKTTGFLLSASEMGQISTAMLLTYFAGRGHRPRWIACGMVLFSIAAFACSL  336
            TIEKLFQIKSKTTG LLSASEMGQI TAMLLTYFAGRGHRPRWIACGMVLFSIAAF+C+L
Sbjct  200  TIEKLFQIKSKTTGILLSASEMGQICTAMLLTYFAGRGHRPRWIACGMVLFSIAAFSCAL  259

Query  337  PHFIFGKQLMQSLDTLSNGGNGGNAAMRALHGQMLHASYGLHGMNDTINATSANALEGGL  396
            PHFIFG+QLM S           +  ++       + S+  H +N +    + N      
Sbjct  260  PHFIFGEQLMHS-----------SVILQQTQVSPPNNSFSSHWLNASSEQVNPN------  302

Query  397  SALLANVPGSHEMNLCIPGQNSTNSNSECDEDQKLEQASHSKITVIVLCIFFASLLSSGI  456
                          LCI G N T+S SEC+E+++LEQASHSKITVIVLCIFF SLLSSGI
Sbjct  303  --------------LCILGGNQTHSGSECNEERQLEQASHSKITVIVLCIFFGSLLSSGI  348

Query  457  GQTAVATLGIPYIDDNVASKQSPMYMAITIGVRILGPASGFIVGSFCTRWYVNFSNPGFD  516
            GQTAVATLGIPYIDDNV SKQSPMYMA+TIG+RILGPASGFI GSFCTRWYVNFSNPGFD
Sbjct  349  GQTAVATLGIPYIDDNVGSKQSPMYMAVTIGMRILGPASGFIFGSFCTRWYVNFSNPGFD  408

Query  517  ASDPRWIGAWWLGPVGIGTLMLLSSFAMFSFPKQLRGKRNPNVGEAKTDGGDDAAAAVEV  576
            A+DPRWIGAWWLGPV IG+LMLL+S AMFSFPKQLRGK+ P  G+  T      AA VE 
Sbjct  409  ATDPRWIGAWWLGPVAIGSLMLLASIAMFSFPKQLRGKQKPP-GQTAT-----PAAPVEP  462

Query  577  DEKPKLRDFPKTVRRQLKNDILMFRTASCVFHLLPIAGLYTFLPKYLETQFRLTTYDASM  636
            +EKPKL+DFPKTVRRQL NDILMFRTASCVFHLLPIAGLYTFLPKYLETQFRL TYDA+M
Sbjct  463  EEKPKLKDFPKTVRRQLSNDILMFRTASCVFHLLPIAGLYTFLPKYLETQFRLATYDANM  522

Query  637  IAAFCGILVMGVGIVISGLVILKLKPSARSVAAWIAFTALFYSAGMVVLMFVGCSMKDFA  696
            IAAFCGILVMG+GIVISGL ILK KP+AR VAAWIAFTAL YSAGM++LMF+GCSM DFA
Sbjct  523  IAAFCGILVMGIGIVISGLFILKRKPTARGVAAWIAFTALVYSAGMIILMFIGCSMNDFA  582

Query  697  GYKSATSDSPAMIERACD--LNCSCDTGNYAPICGMDGRIYISTCHAGCTASAL--TDNG  752
            GYK +  +SPA+IE  C   LNC+CD  N+APIC  DG++YIS CHAGC++S+L  +DN 
Sbjct  583  GYKPSDGNSPALIEPTCSAALNCTCDKENFAPICA-DGKMYISACHAGCSSSSLRPSDNR  641

Query  753  TVFSNCTCIPDSFKNQAIGGYCANNCKNFIFFIIIFAVCVFMHSTSEVGSMLLVMRCTHP  812
            T++S+C CIPD+   +A+ GYC NNCKNFI+FI+IFA+CVFMHSTSEVGSMLLVMRCTHP
Sbjct  642  TLYSDCACIPDA--PEAVNGYCDNNCKNFIYFILIFAICVFMHSTSEVGSMLLVMRCTHP  699

Query  813  NDKAMAMGIIQSAIGLFGNVPCPIIYGAVVDSACLLWKTVCGKHGACSLYDSDTFRHYFL  872
             DKAMAMG+IQSAIGLFGNVPCPIIYGAVVDSACL+WK+VCGKHGACSLYD+DTFR YFL
Sbjct  700  KDKAMAMGVIQSAIGLFGNVPCPIIYGAVVDSACLIWKSVCGKHGACSLYDADTFRQYFL  759

Query  873  GITAGIMFLAFIMDLVVWSKAHRIDITPED---GSEPHGKQTVAETECKKSMV-APDTSV  928
            GITAGIMFLAF+MDLVVW KAHRIDI PED   G      +T+  +E K+ +  APDT+V
Sbjct  760  GITAGIMFLAFLMDLVVWRKAHRIDIAPEDPQEGGPASNGRTLEVSESKQPITPAPDTTV  819


 Score = 30.8 bits (68),  Expect = 6.9, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 44/110 (40%), Gaps = 14/110 (13%)

Query  9    DVEAAANQQMLNFQSPQRQIKTGTASTSPAGTPYKQNGSNGDASLNGTPLHNGHGNANGT  68
            DVEAAA  Q L         K         G  Y QNG   D+S   TPL + H   NGT
Sbjct  7    DVEAAAQVQSLGG-------KPSNGHGQLNGNGYHQNGGRRDSSQAFTPLLSQHN--NGT  57

Query  69   NGYQNGTRRDSTQAWTPLLSNGNGNSAA-----LSNGNGNAGLTDNSLVG  113
               +  T   ST  +    SN N   A      L NG GN   ++N+  G
Sbjct  58   TNGEVTTPPPSTVLYESTPSNNNEWKAPEDLGHLKNGLGNILSSNNNGTG  107


>Q9VK84_DROME unnamed protein product
Length=745

 Score = 320 bits (821),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 229/803 (29%), Positives = 354/803 (44%), Gaps = 166/803 (21%)

Query  222  SELSNGDRSAPG----CGLFGCRPKWARNFASTNVFMVVFLLAYILQGMYMTYFVSVITT  277
            +E+   D + P     CG+    P W + +A+T +FM V+ L   +Q M   YF+  +TT
Sbjct  2    AEVKRRDPNRPPGHYLCGMANWHPPWLQKYATTKMFMGVYGLLGTIQAMSYMYFIVTLTT  61

Query  278  IEKLFQIKSKTTGFLLSASEMGQISTAMLLTYFAGRGHRPRWIACGMVLFSIAAFACSLP  337
            +EK F+I S+TTG +LS +E+ QI  +++L+Y  G+ +RPRWIA G+V   ++ +   LP
Sbjct  62   LEKRFKIPSQTTGIILSGNEISQIMLSLILSYIGGQRNRPRWIAWGIVFCGLSCYILVLP  121

Query  338  HFIFG--KQLMQ----SLDTLSNGGNGGNAAMRALHGQMLHASYGLHGMNDTINATSANA  391
            HFI+G   +++Q      D+L NG  G + + +                           
Sbjct  122  HFIYGAGHEVLQFTKEYQDSLLNGTTGSDHSFQ---------------------------  154

Query  392  LEGGLSALLANVPGSHEMNLCIPGQNSTNSNSECDEDQKLEQASHSKITVIVLCIFFASL  451
                      N+       LC  G + T    +CD+            + + L + F S 
Sbjct  155  ----------NISSVKTERLC--GVDKTED--DCDD----------LFSYVPLVLIFLSQ  190

Query  452  LSSGIGQTAVATLGIPYIDDNVASKQSPMYMAITIGVRILGPASGFIVGSFCTRWYVNFS  511
               G+G T   +LG  Y+DDN     +P+ +A+ + +R++GP  GF  G      +++ +
Sbjct  191  FVLGVGNTLYYSLGQTYLDDNTKKTNTPLMLAVAMALRMIGPVVGFFFGFISLNTFIDPT  250

Query  512  N-PGFDASDPRWIGAWWLGPVGIGTLMLLSSFAMFSFPKQL-------------------  551
              P  D+ DPRW+GAWWLG V +GTLM L S  +  FPKQL                   
Sbjct  251  KTPLIDSKDPRWLGAWWLGWVILGTLMCLFSGLIGLFPKQLPKVNASRTNSHLPLALRQT  310

Query  552  --RGKRNPNVGEAKTDGGDDA-----AAAVEVDEKPKLRDFPKTVRRQLKNDILMFRTAS  604
                KR  N+  +     + A     AAA    + PKL+DFP+ + R L+N +L+F   S
Sbjct  311  KEELKREENLSLSSRFSSNAALDTIGAAAGANADLPKLKDFPRALMRLLRNKLLIFNILS  370

Query  605  CVFHLLPIAGLYTFLPKYLETQFRLTTYDASMIAAFCGILVMGVGIVISGLVILKLKPSA  664
             VF++L  +G  TFL KY+E QF      A++I     I+ M VG++ SG+V+ K KPS 
Sbjct  371  AVFYILGASGFMTFLTKYMEVQFHKDAQSATIIVGPISIMGMVVGLIGSGMVLSKKKPSV  430

Query  665  RSVAAWIAFTALFYSAGMVVLMFVGC----SMKDFAGYKSATSDSPAMIERACDLNCSCD  720
              V  W          G +   F+ C    SM   AG  + TS+        C++NCSC+
Sbjct  431  SKVLMWNVIVGGISILGQISYAFLYCPNTFSMTQ-AGQLNLTSN--------CNMNCSCE  481

Query  721  TGNYAPICGM-DGRIYISTCHAGCTASALTDNGTVFSNCTCI-----PDS----------  764
              +Y P+C       + S CHAGC     T    ++ +C+C+     P S          
Sbjct  482  GISYTPVCHEPTDTTFFSACHAGCRGYNATSK--LYEDCSCVVNDPAPKSAAQRLLNLLQ  539

Query  765  ----------------------------FKNQAIG-------------GYCANNCK-NFI  782
                                        F +Q +              G C  NC  +F 
Sbjct  540  PTPEPELDTTTYFDEYLSGVPLLDDNGDFDDQLLSRTRRSTSDSVIRPGICTKNCNWSFW  599

Query  783  FFIIIFAVCVFMHSTSEVGSMLLVMRCTHPNDKAMAMGIIQSAIGLFGNVPCPIIYGAVV  842
             F I   +  +  S+  VG++L+  R     DK+ A G+    I L   +P PII+G ++
Sbjct  600  AFSITSMIVSWFGSSGRVGNVLVNYRAVAHEDKSFAQGLALMMISLLALIPGPIIFGRLI  659

Query  843  DSACLLWKTVCGKHGACSLYDSDTFRHYFLGITAGIMFLAFIMDLVVWSKAHRIDI----  898
            DS CL+W   C  +G C LYD   FR+    ++  + F+  + D +VW     +DI    
Sbjct  660  DSTCLVWTKTCNGNGNCQLYDQTRFRYSLNFLSCLLTFMGLLFDYLVWYYGRNLDIYGDK  719

Query  899  -TPEDGSEPHGKQTVAETECKKS  920
               E+       Q +     KKS
Sbjct  720  EAKEEERANRKDQPITPLLAKKS  742


>Q9W270_DROME unnamed protein product
Length=680

 Score = 318 bits (815),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 207/712 (29%), Positives = 339/712 (48%), Gaps = 88/712 (12%)

Query  218  SDTDSELSNGDRSAPGCGLFGCRPKWARNFASTNVFMVVFLLAYILQGMYMTYFVSVITT  277
            +D +  L++ D +   CG    R    + FA+ ++F++V+ +A     M  TYF   ITT
Sbjct  22   ADDEKRLNSSDTT---CGFSIFRGPALQRFATAHMFVIVYGIASCFLAMAFTYFTGTITT  78

Query  278  IEKLFQIKSKTTGFLLSASEMGQISTAMLLTYFAGRGHRPRWIACGMVLFSIAAFACSLP  337
            +EK F I +K +G +   +++  + ++  L+Y+A RGHRPRW+A G+++ +I       P
Sbjct  79   MEKRFNIPTKISGLITVGNDISTVFSSAFLSYYASRGHRPRWVALGLIIIAIFCLLMLTP  138

Query  338  HFIFGKQLMQSLDTLSNGGNGGNAAMRALHGQMLHASYGLHGMNDTINATSANALEGGLS  397
            H  +G                G  A+R      +  S+G      ++N T  N       
Sbjct  139  HIFYGP---------------GEEALRLTEEYGMSESFG-----ASLNITEKND------  172

Query  398  ALLANVPGSHEMNLCIPGQNSTNSNSECDEDQKLEQASHSKITVIVLCIFFASLLSSGIG  457
                        +LC         NS C     LE+A     T IVL  FF +    GIG
Sbjct  173  ------------SLC------HEKNSNC-----LERAGD--YTPIVL--FFIAQFIGGIG  205

Query  458  QTAVATLGIPYIDDNVASKQSPMYMAITIGVRILGPASGFIVGSFCTRWYVN-FSNPGFD  516
             +     G+ Y+DDN AS ++P  ++ +  +R+LGPA GF + S C R Y++ F  P   
Sbjct  206  CSLFYAPGLSYMDDNSASSKTPAMLSWSSFLRMLGPAMGFSMVSLCLRLYIDPFKKPLIT  265

Query  517  ASDPRWIGAWWLGPVGIGTLMLLSSFAMFSFPKQL-RGKRNPNVGEAKTDGGDDAAAAVE  575
             +DPRW+GAWW+G + +  ++ +S+  +  FPK++ R K        K DG +D   A  
Sbjct  266  TNDPRWMGAWWIGWILLTFILTISAVFVGMFPKEMPRAKAR----RLKADGEEDIPLAGR  321

Query  576  VDEKPKLRDFPKTVRRQLKNDILMFRTASCVFHLLPIAGLYTFLPKYLETQFRLTTYDAS  635
                   +D   +++R   N + ++   + + +L      + F PKY+E Q+R +   ++
Sbjct  322  -----SFQDMLDSLKRLASNKVYVYNMLASILYLFGYMPYWIFTPKYIEIQYRQSASTST  376

Query  636  MIAAFCGILVMGVGIVISGLVILKLKPSARSVAAWIAFTALFYSAGMVVLMFVGCSMKDF  695
            M      +     GI+ISG VI K KPSAR++AAW         AGM+  + VGC   D 
Sbjct  377  MATGTWALGFSAAGILISGYVISKYKPSARAMAAWNFVVDYLTVAGMLCYVLVGCDESD-  435

Query  696  AGYKSATSDSPAMIERACDLNCSCDTGNYAPICGMDGRIYISTCHAGCTASALTDNG-TV  754
                 A S S      +C  +C C+   YAP+C  +   +IS CHAGCT  A+ + G T+
Sbjct  436  ----RANSLSIVPTGDSCSASCVCEYVYYAPVCSPENITFISACHAGCTDKAINELGKTI  491

Query  755  FSNCTCIPD-----------SFKNQ---AIGGYCANNC-KNFIFFIIIFAVCVFMHSTSE  799
            ++ C C+ +           S  +Q   A+ G C  +C K F+ F+ +     F+ +T  
Sbjct  492  YTGCRCMGNVSSIISLSNVTSLASQSQIAMDGACPVDCNKQFLIFLAVMCFLKFVGATGR  551

Query  800  VGSMLLVMRCTHPNDKAMAMGIIQSAIGLFGNVPCPIIYGAVVDSACLLWKTVCGKHGAC  859
              ++LL +RC    DK  ++G       +   +P PI++G ++DS CL+W   C   G C
Sbjct  552  SSNLLLALRCVPSKDKTFSLGFGSMVYSVLAFIPSPIVFGWMLDSYCLVWGKTCSSKGNC  611

Query  860  SLYDSDTFRHYFLGITAGIMFLAFIMDLVVWSKAHRIDITPEDGSEPHGKQT  911
             +YD+ + R+    + A ++FL    ++ VW  A  + +  ED      KQ+
Sbjct  612  WIYDTKSLRYTMNLVCASLIFLGSFWNIGVWYHAKDMKVFDEDEKTVQAKQS  663



Lambda      K        H
   0.305    0.122    0.330 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 72507983966


Query= XP_014085143.1 PREDICTED: uncharacterized protein LOC106614117
[Bactrocera oleae]

Length=104
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8IQR7_DROME  unnamed protein product                                 71.6    2e-17
Q9VBC7_DROME  unnamed protein product                                 27.7    2.1  
Q9UAE7_DROME  unnamed protein product                                 27.7    2.1  


>Q8IQR7_DROME unnamed protein product
Length=115

 Score = 71.6 bits (174),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 67/114 (59%), Gaps = 10/114 (9%)

Query  1    MANRC-LLVFVCLCSIALIAAL--PLQDDSQL-PQQG-HPPVLVRQVRTPDGGSVGVDVN  55
             +N+C +L+ V  C + ++A+   P  ++ Q  P+Q      LVR+ R+P+GGSV V  +
Sbjct  2    FSNKCGILILVSCCLVTIVASYRQPYPEEFQTSPEQLLQVAPLVRRARSPEGGSVVVTAS  61

Query  56   QD-----SASAHYNQNIYSSDDGNLKVDAAAQATHDFHNNDNSYSGSISGSYSW  104
            +D      AS  YN N+YSS DG   +DA AQA+ +F  N N+Y G I G++ +
Sbjct  62   KDNQVGREASVQYNHNLYSSGDGRGSIDAYAQASRNFDYNRNNYEGGIRGTWHF  115


>Q9VBC7_DROME unnamed protein product
Length=654

 Score = 27.7 bits (60),  Expect = 2.1, Method: Composition-based stats.
 Identities = 19/56 (34%), Positives = 33/56 (59%), Gaps = 10/56 (18%)

Query  46   DGGSVGVDVNQDSASAH--YNQNIYSS--DDG------NLKVDAAAQATHDFHNND  91
            +GG V +D+N  +A A     +N+ ++  DDG      +LK +  A+A++DF +ND
Sbjct  167  NGGKVRLDLNVQAAWAQGITGKNVTTAIMDDGVDYMHPDLKFNYNAEASYDFSSND  222


>Q9UAE7_DROME unnamed protein product
Length=654

 Score = 27.7 bits (60),  Expect = 2.1, Method: Composition-based stats.
 Identities = 19/56 (34%), Positives = 33/56 (59%), Gaps = 10/56 (18%)

Query  46   DGGSVGVDVNQDSASAH--YNQNIYSS--DDG------NLKVDAAAQATHDFHNND  91
            +GG V +D+N  +A A     +N+ ++  DDG      +LK +  A+A++DF +ND
Sbjct  167  NGGKVRLDLNVQAAWAQGITGKNVTTAIMDDGVDYMHPDLKFNYNAEASYDFSSND  222



Lambda      K        H
   0.305    0.122    0.330 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 72507983966


Query= XP_014085144.1 PREDICTED: uncharacterized protein LOC106614118
[Bactrocera oleae]

Length=1831
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RENT1_DROME  unnamed protein product                                  182     4e-46
RENT1_CAEEL  unnamed protein product                                  180     2e-45
Q582F1_TRYB2  unnamed protein product                                 143     2e-34


>RENT1_DROME unnamed protein product
Length=1180

 Score = 182 bits (463),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 173/553 (31%), Positives = 259/553 (47%), Gaps = 120/553 (22%)

Query  1307  ITLIQGPPGTGKSCVIANLVHQLLYGNEVRILDQKVLVCAQSNAAVDVIAEKLFDMSQTK  1366
             ++LIQGPPGTGK+   A +V+QL     V++    VLVCA SN AVD + EK        
Sbjct  468   LSLIQGPPGTGKTVTSATIVYQL-----VKLHGGTVLVCAPSNTAVDQLTEK--------  514

Query  1367  SPDKMFRLIRFGLLERISTKVRHATLPKIIERNQIRKLKAICKNLQ-IDHKVDMKEYLRN  1425
                                          I R  ++ ++   K+ + ID  V     L N
Sbjct  515   -----------------------------IHRTNLKVVRVCAKSREAIDSPVSFLA-LHN  544

Query  1426  EILKIEADIEHMKLSNVKNTVQEEVLLEKQRQIQLMRNIVNGVLRPEDENSLYNWHLKHA  1485
             +I  +E + E  KL  +K+   E    +++R     RN     L+   EN L    L+ A
Sbjct  545   QIRNMETNSELKKLQQLKDETGELSSADEKR----YRN-----LKRAAENQL----LEAA  591

Query  1486  NVVCTTLSSCV-----KLSKYVNYFDVCIIDEATQCTEPWTLMPLKFGINTLVLVGDTQQ  1540
             +V+C T   CV     +LS+    F   +IDE+ Q TEP  ++P+  G   L+LVGD  Q
Sbjct  592   DVICCT---CVGAGDGRLSRV--KFTSILIDESMQSTEPECMVPVVLGAKQLILVGDHCQ  646

Query  1541  LPATVLSKKASDFGLGTSLFTRIQRCIESVTLKTVVKADKASNVSSLECTDIIFSLQTQY  1600
             L   V+ KKA+  GL  SLF R+           VV   +             F L+ QY
Sbjct  647   LGPVVMCKKAARAGLSQSLFERL-----------VVLGIRP------------FRLEVQY  683

Query  1601  RMHPEICKWPNSYFYKNELIDD--AKTHQFK------TPLKPFSVLNLTYTQNDNCHRG-  1651
             RMHPE+ ++P+++FY+  L +   A+  + K       P +P   L +T  Q +    G 
Sbjct  684   RMHPELSQFPSNFFYEGSLQNGVCAEDRRLKLDFPWPQPERPMFFL-VTQGQEEIAGSGT  742

Query  1652  QIANELEAQFVARLV-KTLDGYIPMKYNTYGVITPYAQQRVALEKALRMAG------YSN  1704
                N  EA  V ++  + L   I  K    G+ITPY  QR  L + ++  G      Y  
Sbjct  743   SFLNRTEAANVEKITTRFLKAGI--KPEQIGIITPYEGQRAYLVQYMQYQGSLHSRLYQE  800

Query  1705  VMVNTIDSYQGMERDVIIISNARTT---GIGFLANYQRLNVALTRPKKCLILCGNFKNLE  1761
             + + ++D++QG E+D+II+S  R+    GIGFL + +RLNVALTR K  +I+ GN K L 
Sbjct  801   IEIASVDAFQGREKDIIIMSCVRSNERQGIGFLNDPRRLNVALTRAKFGIIIVGNPKVLA  860

Query  1762  TVPAWRSLLTSARERKLYHELSANCMDDMHRTVI----PKIKISKVN-NAITEATATAIT  1816
                 W  LL   ++RK+  E S N   ++  ++I    PK  ++ +N  A   +T  A  
Sbjct  861   KQQLWNHLLNFYKDRKVLVEGSLN---NLKESLIHFQKPKKLVNSMNIGAHFMSTIIADA  917

Query  1817  KEVTTVATITKQS  1829
             KEV    +I  +S
Sbjct  918   KEVMVPGSIYDRS  930


>RENT1_CAEEL unnamed protein product
Length=1069

 Score = 180 bits (456),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 166/563 (29%), Positives = 250/563 (44%), Gaps = 113/563 (20%)

Query  1277  IQYSGCDELNNRQKDVLLRTYRHATEPIPNITLIQGPPGTGKSCVIANLVHQLLYGNEVR  1336
             +  +G  ELN+ Q   + +     T P+   +LIQGPPGTGK+ V A +V+ L+   E  
Sbjct  438   LSVAGLPELNSSQMQAVKQVL---TRPL---SLIQGPPGTGKTVVSATIVYHLVQKTE--  489

Query  1337  ILDQKVLVCAQSNAAVDVIAEKLFDMSQTKSPDKMFRLIRFGLLERISTKVRHATLPKII  1396
                  VLVC+ SN AVD +AEK+             +++R     R  ++    T+P + 
Sbjct  490   ---GNVLVCSPSNIAVDHLAEKIHKTG--------LKVVRLCARSREHSET---TVPYLT  535

Query  1397  ERNQIRKLKAICKNLQIDHKVDMKEYLRNEILKIEADIEHMKLSNVKNTVQEEVLLEKQR  1456
              ++Q                           LK+    E  KL  +K+   E    +  R
Sbjct  536   LQHQ---------------------------LKVMGGAELQKLIQLKDEAGELEFKDDLR  568

Query  1457  QIQLMRNIVNGVLRPEDENSLYNWHLKHANVVCTTLSSCV--KLSKYVNYFDVCIIDEAT  1514
              +QL R           E+ L    L  A+V+C T SS    +LSK        +IDE+T
Sbjct  569   YMQLKR---------VKEHEL----LAAADVICCTCSSAADARLSKIRT--RTVLIDEST  613

Query  1515  QCTEPWTLMPLKFGINTLVLVGDTQQLPATVLSKKASDFGLGTSLFTRIQRCIESVTLKT  1574
             Q TEP  L+ +  G+  LVLVGD  QL   V+ KKA+  GL  SLF R+           
Sbjct  614   QATEPEILVSIMRGVRQLVLVGDHCQLGPVVICKKAAIAGLSQSLFERL-----------  662

Query  1575  VVKADKASNVSSLECTDIIFSLQTQYRMHPEICKWPNSYFYKNEL---IDDAKTH-----  1626
             V+   +             F LQ QYRMHP + ++P++ FY   L   + +   H     
Sbjct  663   VLLGIRP------------FRLQVQYRMHPVLSEFPSNVFYDGSLQNGVTENDRHMTGVD  710

Query  1627  -QFKTPLKPFSVLNLTYTQNDNCHRGQIANELEAQFVARLVKTL--DGYIPMKYNTYGVI  1683
               +  P KP    + + ++  +       N  EA  V +LV  L   G  P   +  GVI
Sbjct  711   WHWPKPNKPAFFWHCSGSEELSASGTSFLNRTEAANVEKLVSKLIKAGVQP---HQIGVI  767

Query  1684  TPYAQQRVALEKALRMAG------YSNVMVNTIDSYQGMERDVIIISNARTT---GIGFL  1734
             T Y  QR  +   +   G      Y NV + ++D++QG E+D II++  R+    GIGFL
Sbjct  768   TSYEGQRSFIVNYMHTQGTLNSKLYENVEIASVDAFQGREKDYIIVTCVRSNDILGIGFL  827

Query  1735  ANYQRLNVALTRPKKCLILCGNFKNLETVPAWRSLLTSARERKLYHELSANCMDDMHRTV  1794
             ++ +RLNVA+TR K  L+L GN K L     W  L+   + +++ +E   N +  ++   
Sbjct  828   SDPRRLNVAITRAKYGLVLVGNAKVLARHDLWHELINHYKSKEMLYEGPINALKPLN-LA  886

Query  1795  IPKIKISKVNNAITEATATAITK  1817
             +PK  I   NN    A    I +
Sbjct  887   LPKATIRTKNNIAGNANRFGIKR  909


>Q582F1_TRYB2 unnamed protein product
Length=842

 Score = 143 bits (361),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 144/520 (28%), Positives = 215/520 (41%), Gaps = 124/520 (24%)

Query  1281  GCDELNNRQKDVLLRTYRHATEPIPNITLIQGPPGTGKSCVIANLVHQLLYGNEVRILDQ  1340
             G   LN  Q+  L    R+       +TLIQGPPGTGK+     ++ +L    + RI   
Sbjct  368   GHHNLNYSQEQALRVALRNP------LTLIQGPPGTGKTSTSVAIIRELHSHVKSRI---  418

Query  1341  KVLVCAQSNAAVDVIAEKLFDMSQTKSPDKMFRLIRFGLLER--ISTKVRHATLPK----  1394
               LVCA SN AVD +A+++             +++R     R  I   V    L +    
Sbjct  419   --LVCAPSNVAVDHLAQRVSGTG--------LKVVRLQAKYRNDIPCSVESIGLERQVGD  468

Query  1395  -IIERNQIRKLKAICKNLQIDHKVDMKEY--LRNEILKIEADIEHMKLSNVKNTVQEEVL  1451
              I   + + +LK +  ++Q    ++ K+Y   ++ + KIE  I                 
Sbjct  469   YINASSGLERLKELLDSMQTGKSLNDKDYGTYKDGVEKIERLI-----------------  511

Query  1452  LEKQRQIQLMRNIVNGVLRPEDENSLYNWHLKHANVVCTTLSSCVKLSKY---VNYFDVC  1508
                      +RN                     A+VVC T   C+    Y      F   
Sbjct  512   ---------LRN---------------------ADVVCCT---CIGAGDYRLKTMKFKHV  538

Query  1509  IIDEATQCTEPWTLMPLKFGINTLVLVGDTQQLPATVLSKKASDFGLGTSLFTRIQRCIE  1568
             +IDEATQ TEP  L+PL  G   ++LVGD  QL   V S  A   G   SLF R+     
Sbjct  539   LIDEATQGTEPEVLIPLVRGAKQVILVGDHCQLRPLVFSTAAEKAGYQRSLFERL-----  593

Query  1569  SVTLKTVVKADKASNVSSLECTDIIFSLQTQYRMHPEICKWPNSYFYKNELIDDAKTHQ-  1627
                   V+   +               L  QYRM+P +  +P+ ++Y+  L +     Q 
Sbjct  594   ------VLMGHRP------------VRLDVQYRMNPSLSFFPSHHYYEGTLQNGVTAEQR  635

Query  1628  -----FKTP--LKPFSVLNLTYTQNDNCHRGQIANELEAQFVARLV-KTLDGYIPMKYNT  1679
                  F  P   KP    N T  +    +     N  EA    ++V K + G +  +   
Sbjct  636   DASEVFPWPDVTKPIFFYNATGNEELGSNGRSYLNRAEAALTEQIVTKLIQGGV--EPGD  693

Query  1680  YGVITPYAQQRVALEKALRMAG------YSNVMVNTIDSYQGMERDVIIISNARTT---G  1730
              GVITPY  Q   L   L  +G      Y  V ++++D++QG E++ II+S  R+    G
Sbjct  694   IGVITPYRSQCRYLRSYLSRSGRLPMEVYDRVEISSVDAFQGREKEFIILSCVRSNHRQG  753

Query  1731  IGFLANYQRLNVALTRPKKCLILCGNFKNLETVPAWRSLL  1770
              GF+ + +RLNV+LTR K+ LI+ GN +     P W  LL
Sbjct  754   AGFVTDGRRLNVSLTRAKRGLIIMGNVQLFSRYPGWHELL  793



Lambda      K        H
   0.305    0.122    0.330 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 72507983966


Query= XP_014085145.1 PREDICTED: SUMO-activating enzyme subunit 2
[Bactrocera oleae]

Length=698
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7KJV6_DROME  unnamed protein product                                 936     0.0  
Q7KUA4_DROME  unnamed protein product                                 933     0.0  
Q9VSD9_DROME  unnamed protein product                                 922     0.0  


>Q7KJV6_DROME unnamed protein product
Length=700

 Score = 936 bits (2418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 478/717 (67%), Positives = 563/717 (79%), Gaps = 36/717 (5%)

Query  1    MAAALNGVFPSTLQENVQKSKILVVGAGGIGCEILKNLVLSGFPDIEIIDLDTIDLSNLN  60
            MAAA+NGVFP TLQE V+KSK+LVVGAGGIGCE+LKNLVLSGF DIEIIDLDTIDLSNLN
Sbjct  1    MAAAINGVFPPTLQELVKKSKVLVVGAGGIGCEVLKNLVLSGFTDIEIIDLDTIDLSNLN  60

Query  61   RQFLFHREHVGKSKAQVARESALQFNPDVNIKAYHDSIMSTDYGVSFFKKFDIVLNALDN  120
            RQFLFHREHVGKSKA+VARESAL FNPD  I AYHDS+ STDYGV+FFKKFD+VL+ALDN
Sbjct  61   RQFLFHREHVGKSKARVARESALSFNPDAKITAYHDSVTSTDYGVNFFKKFDLVLSALDN  120

Query  121  RAARNHVNRMCLHAEVPLIESGTAGYNGQVELIKKGLTQCYECTPKAKQKTFPGCTIRNT  180
            RAARNHVNRMCL+A+VPLIESGTAGYNGQVELIK+GLTQCYECTPK KQ++FPGCTIRNT
Sbjct  121  RAARNHVNRMCLNADVPLIESGTAGYNGQVELIKRGLTQCYECTPKDKQRSFPGCTIRNT  180

Query  181  PSEPIHCIVWAKHLFNQLFGESVEDEDISPDMADPEANAVD-----SEEKSEN-----ED  230
            PSEPIHCIVWAKHLFNQLFGES+EDEDISPD ADP+A   D      E K +      E 
Sbjct  181  PSEPIHCIVWAKHLFNQLFGESLEDEDISPDAADPDAKEKDGGDGNGEPKGDGKEKGEES  240

Query  231  KEVAKTIPETETGNVARVNTRQWAKDSSYDAATLFNKFFFDDINYLLSMSNLWKERKAPT  290
            KE  +   +T  GN+ R+NTRQWAKDS+YDA  LFNKFF +DI YLL MSNLWK RKAP 
Sbjct  241  KEEKEAKEDTANGNIMRINTRQWAKDSNYDAGKLFNKFFNEDITYLLRMSNLWKTRKAPV  300

Query  291  PLKWDNVLIKQDNGVGVTAEALKDTTKHYHKVWSLAECATVFGDCLKKLSTSFLNLDDGE  350
            P++WD +L +  +G        KD  K +HKVWS+ ECA VF + LK+LS +FL L+  +
Sbjct  301  PVQWDTLLPEGSSG------DQKDVAKQHHKVWSIEECAQVFANSLKELSANFLKLEGDD  354

Query  351  SLVWDKDDQPAMDFVAACANIRAYIFEIGRKSRFEVKSMAGNIIPAIATTNAITAGVVVL  410
            +L WDKDDQPAMDFVAACAN+R++IF+I RKSRFE+KSMAGNIIPAIATTNAITAG+ V+
Sbjct  355  TLAWDKDDQPAMDFVAACANVRSHIFDIERKSRFEIKSMAGNIIPAIATTNAITAGISVM  414

Query  411  QTFKVLQGQLDKCKSVYMRLRQNPRQQLLVPEKFLTAPNPNCIVCSSEPAVHIRIDTKRM  470
            + FKVL+ + ++CK+VY RLR N R   LVP+  L  PNPNC VC+S+PA+ ++IDTKRM
Sbjct  415  RAFKVLEAKWEQCKAVYARLRPNARNHFLVPDASLPGPNPNCHVCASDPAITLKIDTKRM  474

Query  471  RIKDFRDDVLIKTLNMVNPDVVEPNKGIVVISSEEGETECNEEKLMSEMGIVDGVVLKCD  530
            RIK+ RD+VL+KTLNM+NPDV   + G ++ISSEEGETECN+ KL+SE+ IVDGV+LKCD
Sbjct  475  RIKELRDEVLVKTLNMLNPDVTVQSNGSILISSEEGETECNDGKLLSELNIVDGVILKCD  534

Query  531  DFFQNYELEVIVIHFDSERDESLFEVASDSSQIKQKD---SEPVV-KESNGKQAAKQT--  584
            DFFQNYEL +I+ HFD+ERDE+LFEV +D+SQ+K KD    E V  KE   K A K++  
Sbjct  535  DFFQNYELSIIISHFDAERDENLFEVVADASQLKPKDEDQKEAVKDKEDEPKSAKKRSTN  594

Query  585  -EEDDSADGPSTSKKSRVAEVVDDDDDLCL-IEDDEDGNVEENVVAATDKLSVTSPVRES  642
             E D   DGPSTSK+SR  EVV++DDD CL IE+DED    + VV ATDKLSV SP +  
Sbjct  595  GEGDSKDDGPSTSKRSRPNEVVEEDDDDCLVIEEDEDQ--ADVVVVATDKLSVQSPPKSG  652

Query  643  PPPLQRSIKRKPSETIV-EDITEIKDSDDEEDDGPTQIKRMRPDTSNVFLNEVINID  698
                    KRKP E I  EDITEI +S D+E  GPT+ KR R D SN     VI+ID
Sbjct  653  S-------KRKPCEVIEDEDITEILESSDDEPAGPTKCKRSRLDDSNPVA--VISID  700


>Q7KUA4_DROME unnamed protein product
Length=700

 Score = 933 bits (2411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 477/717 (67%), Positives = 562/717 (78%), Gaps = 36/717 (5%)

Query  1    MAAALNGVFPSTLQENVQKSKILVVGAGGIGCEILKNLVLSGFPDIEIIDLDTIDLSNLN  60
            MAAA+NGVFP TLQE V+KSK+LVVGAGGIGCE+LKNLVLSGF DIEIIDLDTIDLSNLN
Sbjct  1    MAAAINGVFPPTLQELVKKSKVLVVGAGGIGCEVLKNLVLSGFTDIEIIDLDTIDLSNLN  60

Query  61   RQFLFHREHVGKSKAQVARESALQFNPDVNIKAYHDSIMSTDYGVSFFKKFDIVLNALDN  120
            RQFLFHREHVGKSKA+VARESAL FNPD  I AYHDS+ STDYGV+FFKKFD+VL+ALDN
Sbjct  61   RQFLFHREHVGKSKARVARESALSFNPDAKITAYHDSVTSTDYGVNFFKKFDLVLSALDN  120

Query  121  RAARNHVNRMCLHAEVPLIESGTAGYNGQVELIKKGLTQCYECTPKAKQKTFPGCTIRNT  180
            RAARNHVNRMCL+A+VPLIESGTAGYNGQVELIK+GLTQCYECTPK KQ++FPGCTIRNT
Sbjct  121  RAARNHVNRMCLNADVPLIESGTAGYNGQVELIKRGLTQCYECTPKDKQRSFPGCTIRNT  180

Query  181  PSEPIHCIVWAKHLFNQLFGESVEDEDISPDMADPEANAVD-----SEEKSEN-----ED  230
            PSEPIHCIVWAKHLFNQLFGES+EDEDISPD ADP+A   D      E K +      E 
Sbjct  181  PSEPIHCIVWAKHLFNQLFGESLEDEDISPDAADPDAKEKDGGDGNGEPKGDGKEKGEES  240

Query  231  KEVAKTIPETETGNVARVNTRQWAKDSSYDAATLFNKFFFDDINYLLSMSNLWKERKAPT  290
            KE  +   +T  GN+ R+NTRQWAKD +YDA  LFNKFF +DI YLL MSNLWK RKAP 
Sbjct  241  KEEKEAKEDTANGNIMRINTRQWAKDCNYDAGKLFNKFFNEDITYLLRMSNLWKTRKAPV  300

Query  291  PLKWDNVLIKQDNGVGVTAEALKDTTKHYHKVWSLAECATVFGDCLKKLSTSFLNLDDGE  350
            P++WD +L +  +G        KD  K +HKVWS+ ECA VF + LK+LS +FL L+  +
Sbjct  301  PVQWDTLLPEGSSG------DQKDVAKQHHKVWSIEECAQVFANSLKELSANFLKLEGDD  354

Query  351  SLVWDKDDQPAMDFVAACANIRAYIFEIGRKSRFEVKSMAGNIIPAIATTNAITAGVVVL  410
            +L WDKDDQPAMDFVAACAN+R++IF+I RKSRFE+KSMAGNIIPAIATTNAITAG+ V+
Sbjct  355  TLAWDKDDQPAMDFVAACANVRSHIFDIERKSRFEIKSMAGNIIPAIATTNAITAGISVM  414

Query  411  QTFKVLQGQLDKCKSVYMRLRQNPRQQLLVPEKFLTAPNPNCIVCSSEPAVHIRIDTKRM  470
            + FKVL+ + ++CK+VY RLR N R   LVP+  L  PNPNC VC+S+PA+ ++IDTKRM
Sbjct  415  RAFKVLEAKWEQCKAVYARLRPNARNHFLVPDASLPGPNPNCHVCASDPAITLKIDTKRM  474

Query  471  RIKDFRDDVLIKTLNMVNPDVVEPNKGIVVISSEEGETECNEEKLMSEMGIVDGVVLKCD  530
            RIK+ RD+VL+KTLNM+NPDV   + G ++ISSEEGETECN+ KL+SE+ IVDGV+LKCD
Sbjct  475  RIKELRDEVLVKTLNMLNPDVTVQSNGSILISSEEGETECNDGKLLSELNIVDGVILKCD  534

Query  531  DFFQNYELEVIVIHFDSERDESLFEVASDSSQIKQKD---SEPVV-KESNGKQAAKQT--  584
            DFFQNYEL +I+ HFD+ERDE+LFEV +D+SQ+K KD    E V  KE   K A K++  
Sbjct  535  DFFQNYELSIIISHFDAERDENLFEVVADASQLKPKDEDQKEAVKDKEDEPKSAKKRSTN  594

Query  585  -EEDDSADGPSTSKKSRVAEVVDDDDDLCL-IEDDEDGNVEENVVAATDKLSVTSPVRES  642
             E D   DGPSTSK+SR  EVV++DDD CL IE+DED    + VV ATDKLSV SP +  
Sbjct  595  GEGDSKDDGPSTSKRSRPNEVVEEDDDDCLVIEEDEDQ--ADVVVVATDKLSVQSPPKSG  652

Query  643  PPPLQRSIKRKPSETIV-EDITEIKDSDDEEDDGPTQIKRMRPDTSNVFLNEVINID  698
                    KRKP E I  EDITEI +S D+E  GPT+ KR R D SN     VI+ID
Sbjct  653  S-------KRKPCEVIEDEDITEILESSDDEPAGPTKCKRSRLDDSNPVA--VISID  700


>Q9VSD9_DROME unnamed protein product
Length=700

 Score = 922 bits (2384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 474/717 (66%), Positives = 557/717 (78%), Gaps = 36/717 (5%)

Query  1    MAAALNGVFPSTLQENVQKSKILVVGAGGIGCEILKNLVLSGFPDIEIIDLDTIDLSNLN  60
            MAAA+NGVFP TL E V+KSK+LVVGAGGIGCE+LKNLVLSGF DIEIIDLDTIDLSNLN
Sbjct  1    MAAAINGVFPPTLHELVKKSKVLVVGAGGIGCEVLKNLVLSGFTDIEIIDLDTIDLSNLN  60

Query  61   RQFLFHREHVGKSKAQVARESALQFNPDVNIKAYHDSIMSTDYGVSFFKKFDIVLNALDN  120
            RQFLFHREHVGKSKA+VARESAL FNPD  I AYHDS+ STDYGV+FFKKFD+VLNALDN
Sbjct  61   RQFLFHREHVGKSKARVARESALSFNPDAKITAYHDSVTSTDYGVNFFKKFDLVLNALDN  120

Query  121  RAARNHVNRMCLHAEVPLIESGTAGYNGQVELIKKGLTQCYECTPKAKQKTFPGCTIRNT  180
            RA RNHVNRMCL+A+VPLIESGTAGYNGQVELIK+GLTQCYECTPK KQ++FPGCTIRNT
Sbjct  121  RADRNHVNRMCLNADVPLIESGTAGYNGQVELIKRGLTQCYECTPKDKQRSFPGCTIRNT  180

Query  181  PSEPIHCIVWAKHLFNQLFGESVEDEDISPDMADPEANAVD-----SEEKSEN-----ED  230
            PSEPIHCIVWAKHLFNQLFGES+EDEDISPD ADP+A   D      E K +      E 
Sbjct  181  PSEPIHCIVWAKHLFNQLFGESLEDEDISPDAADPDAKEKDGGDGNGEPKGDGKEKGEES  240

Query  231  KEVAKTIPETETGNVARVNTRQWAKDSSYDAATLFNKFFFDDINYLLSMSNLWKERKAPT  290
            KE  +   +T  GN+ R+NTRQWAKD +YDA  LFNKFF +DI YLL MSNLWK RKAP 
Sbjct  241  KEEKEAKEDTANGNIMRINTRQWAKDCNYDAGKLFNKFFNEDITYLLRMSNLWKTRKAPV  300

Query  291  PLKWDNVLIKQDNGVGVTAEALKDTTKHYHKVWSLAECATVFGDCLKKLSTSFLNLDDGE  350
            P++WD +L +  +G        KD  K +HKVWS+ ECA VF + LK+LS +FL L+  +
Sbjct  301  PVQWDTLLPEGSSG------DQKDVAKQHHKVWSIEECAQVFANSLKELSANFLKLEGDD  354

Query  351  SLVWDKDDQPAMDFVAACANIRAYIFEIGRKSRFEVKSMAGNIIPAIATTNAITAGVVVL  410
            +L WDKDDQPAMDFVAACAN+R++IF I  KSRFE KSMAGNIIPAIATTNAITAG+ V+
Sbjct  355  TLAWDKDDQPAMDFVAACANVRSHIFYIEPKSRFENKSMAGNIIPAIATTNAITAGISVM  414

Query  411  QTFKVLQGQLDKCKSVYMRLRQNPRQQLLVPEKFLTAPNPNCIVCSSEPAVHIRIDTKRM  470
            + FKVL+ + ++C++VY RLR N R   LVP+  L  PNPNC VC+S+PA+ ++IDTKRM
Sbjct  415  RAFKVLEAKWEQCQAVYARLRPNARNHFLVPDASLPGPNPNCHVCASDPAITLKIDTKRM  474

Query  471  RIKDFRDDVLIKTLNMVNPDVVEPNKGIVVISSEEGETECNEEKLMSEMGIVDGVVLKCD  530
            RIK+ RD+VL+KTLNM+NPDV   + G ++ISSEEGETECN+ KL+SE+ IVDGV+LKCD
Sbjct  475  RIKELRDEVLVKTLNMLNPDVTVQSNGSILISSEEGETECNDGKLLSELNIVDGVILKCD  534

Query  531  DFFQNYELEVIVIHFDSERDESLFEVASDSSQIKQKD---SEPVV-KESNGKQAAKQT--  584
            DFFQNYEL +I+ HFD+ERDE+LFEV +D+SQ+K KD    E V  KE   K A K++  
Sbjct  535  DFFQNYELSIIISHFDAERDENLFEVVADASQLKPKDEDQKEAVKDKEDEPKSAKKRSTN  594

Query  585  -EEDDSADGPSTSKKSRVAEVVDDDDDLCL-IEDDEDGNVEENVVAATDKLSVTSPVRES  642
             E D   DGPSTSK+SR  EVV++DDD CL IE+DED    + VV ATDKLSV SP +  
Sbjct  595  GEGDSKDDGPSTSKRSRPNEVVEEDDDDCLVIEEDEDQ--ADVVVVATDKLSVQSPPKSG  652

Query  643  PPPLQRSIKRKPSETIV-EDITEIKDSDDEEDDGPTQIKRMRPDTSNVFLNEVINID  698
                    KRKP E I  EDITEI +S D+E  GPT+ KR R D SN     VI+ID
Sbjct  653  S-------KRKPCEVIEDEDITEILESSDDEPAGPTKCKRSRLDDSNPVA--VISID  700



Lambda      K        H
   0.305    0.122    0.330 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 72507983966


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jan 6, 2022  5:17 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_014085146.1 PREDICTED: 2-aminoethanethiol dioxygenase [Bactrocera
oleae]

Length=249
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VY78_DROME  unnamed protein product                                 32.3    0.31 
Q381V0_TRYB2  unnamed protein product                                 28.5    7.2  
VATA_CAEEL  unnamed protein product                                   28.1    9.0  


>Q9VY78_DROME unnamed protein product
Length=260

 Score = 32.3 bits (72),  Expect = 0.31, Method: Compositional matrix adjust.
 Identities = 31/121 (26%), Positives = 55/121 (45%), Gaps = 4/121 (3%)

Query  28   FAMLKQLTELLTYLDIQFEPQEFETLFK--KPGRAPCTYVHILENDVVSMSVFV-MREGY  84
             A LK ++  +T +D+Q  P +F T F+   P       + ILEN+ +   +   +  GY
Sbjct  53   LAELKTISLKVTTVDMQKPPPDFRTNFEATHPPILIDNGLAILENEKIERHIMKNIPGGY  112

Query  85   TMPLHDHPCMHGLLRGIYGKLKVQSYTKQPLKPNEPLYDPKALEVCVKANEPKFVSSSTE  144
             + + D   +  L+  +Y KLK+    K   K N  L   + +   + A   +F++  T 
Sbjct  113  NLFVQDKE-VATLIENLYVKLKLMLVKKDEAKNNALLSHLRKINDHLSARNTRFLTGDTM  171

Query  145  C  145
            C
Sbjct  172  C  172


>Q381V0_TRYB2 unnamed protein product
Length=732

 Score = 28.5 bits (62),  Expect = 7.2, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 43/90 (48%), Gaps = 5/90 (6%)

Query  10   RQAFKTFD-QSNKLSFNTNFAMLKQLTELLTYLDIQFEPQEFETLFKKPGRAPCTYVHIL  68
            RQ   TF  Q   +  +T+ A +++L + LT + I      F+  F +P  +P T  ++ 
Sbjct  317  RQQLDTFGFQQQSVRKHTHQAYVEEL-DCLTSVPISQSVNCFQ--FLRPHLSPSTVSYLT  373

Query  69   ENDVVSMSVFVMREGYTMPLHDHPCMHGLL  98
             ND V     V REG +M  H  P M  ++
Sbjct  374  SNDRVIKLFRVQREGLSM-FHAFPEMESIV  402


>VATA_CAEEL unnamed protein product
Length=606

 Score = 28.1 bits (61),  Expect = 9.0, Method: Compositional matrix adjust.
 Identities = 15/43 (35%), Positives = 23/43 (53%), Gaps = 0/43 (0%)

Query  125  KALEVCVKANEPKFVSSSTECATLTPTERNYHEITAVGGMAAF  167
            +ALE   + N P+FVS  T+C  +   E +  EI  + G A+ 
Sbjct  448  RALEEFYEKNYPEFVSLRTKCKEILQEEEDLSEIVQLVGKASL  490



Lambda      K        H
   0.320    0.136    0.408 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2184764352


Query= XP_014085147.1 PREDICTED: dnaJ protein homolog 1 [Bactrocera oleae]

Length=345
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DNAJ1_DROME  unnamed protein product                                  462     1e-164
Q8I489_PLAF7  unnamed protein product                                 210     8e-65 
Q38AB7_TRYB2  unnamed protein product                                 207     3e-64 


>DNAJ1_DROME unnamed protein product
Length=334

 Score = 462 bits (1190),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 240/346 (69%), Positives = 274/346 (79%), Gaps = 13/346 (4%)

Query  1    MGKDFYKILGINKSANDDEIKKAYRKLALKYHPDKNKTPQAEERFKEIAEAYEVLSDKKK  60
            MGKDFYKILG+ + A+DDEIKKAYRKLALKYHPDKNK+PQAEERFKEIAEAYEVLSDKKK
Sbjct  1    MGKDFYKILGLERKASDDEIKKAYRKLALKYHPDKNKSPQAEERFKEIAEAYEVLSDKKK  60

Query  61   RDIYDQYGEEGLKGGVPGGPNEQGGGNYSYQFHGDPRATFAQFFGSSDPFGIFFSSSDPS  120
            RDI+D YGE+GLKGG PG       G Y+YQFHGDPRATFAQFFGSSDPFG FF+  D  
Sbjct  61   RDIFDNYGEDGLKGGQPGPDGGGQPGAYTYQFHGDPRATFAQFFGSSDPFGAFFTGGD--  118

Query  121  RMFGDSQNIFMSGGNEDDIYAQMGGGGGAFRSQSFNAQ-PNRKRQIQDPPIEHDLYVSLE  179
             MF   Q     GGN ++I+  +GG        +FNAQ P+RKRQ QDPPIEHDL+VSLE
Sbjct  119  NMFSGGQ-----GGNTNEIFWNIGGDDMF----AFNAQAPSRKRQ-QDPPIEHDLFVSLE  168

Query  180  EVDKGCVKKMKISRMSMATGQPRKEEKVLNITVKPGWKAGTKITFQKEGDQTAGKVPADI  239
            EVDKGC+KKMKISRM+  +  P KEEKVL ITVKPGWKAGTKITF +EGD    K PADI
Sbjct  169  EVDKGCIKKMKISRMATGSNGPYKEEKVLRITVKPGWKAGTKITFPQEGDSAPNKTPADI  228

Query  240  IFIIRDKPHQLFKREGSDIKYNAHISLKEALCGTVVKVPTLQGDRITLNSVGEVIKPNTV  299
            +FIIRDKPH LFKREG D+KY A ISLK+ALCG +V VPTLQG RI +N   E+IKP T 
Sbjct  229  VFIIRDKPHSLFKREGIDLKYTAQISLKQALCGALVSVPTLQGSRIQVNPNHEIIKPTTT  288

Query  300  KRIPGKGLPFPKEPTRRGDLLVAFDIKFPDSLPPATRELLGDVLPN  345
            +RI G GLP PKEP+RRGDL+V+FDIKFPD+L P+ +  L ++LPN
Sbjct  289  RRINGLGLPVPKEPSRRGDLIVSFDIKFPDTLAPSLQNQLSELLPN  334


>Q8I489_PLAF7 unnamed protein product
Length=402

 Score = 210 bits (535),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 127/349 (36%), Positives = 186/349 (53%), Gaps = 35/349 (10%)

Query  4    DFYKILGINKSANDDEIKKAYRKLALKYHPDKNKTPQ----AEERFKEIAEAYEVLSDKK  59
            D+Y +LG+ K    D+IKKAYRKLA+K+HPDK+   +    AE +FK I EAYEVLSD++
Sbjct  80   DYYAVLGLTKDCTQDDIKKAYRKLAMKWHPDKHLNDEDKVEAERKFKLIGEAYEVLSDEE  139

Query  60   KRDIYDQYGEEGLKGGVPGGPNEQGGGNYSYQFHGDPRATFAQFFGSSDPFGIFFSSSD-  118
            KR  YD +G+ GL     GG        Y+Y  + DP   F++FF S D    F    D 
Sbjct  140  KRKNYDLFGQSGL-----GGTTTNDEAYYTYS-NIDPNELFSRFF-SHDASSFFSQGFDD  192

Query  119  -PSRMFGDSQNIFMSGGNEDDIYAQMGGGGGAFRSQSFNAQPNRKRQIQDPPIEHDLYVS  177
             PS     S N      +  +I+++  G   +F                    E  L V+
Sbjct  193  FPSFQGFASMNSRRPRSSRSNIFSRSFGRAASF--------------------EVPLQVT  232

Query  178  LEEVDKGCVKKMKISRMSMATGQPRKEEKVLNITVKPGWKAGTKITFQKEGDQTA-GKVP  236
            LEE+  GC KK+K++R         ++   + + VKPGW  GTKI F  EG+Q++  + P
Sbjct  233  LEELYTGCRKKLKVTRKRFVGLNSYEDNTFITVDVKPGWSEGTKINFHGEGEQSSPNEQP  292

Query  237  ADIIFIIRDKPHQLFKREGSDIKYNAHISLKEALCGTVVKVPTLQGDRITLNSVGEVIKP  296
             D++FII+ KPH  F REG+++ Y  ++ L +AL G    + +L    I +  V ++I P
Sbjct  293  GDLVFIIKTKPHDRFIREGNNLIYKCYLPLDKALTGFQFSIKSLDNRDINVR-VDDIINP  351

Query  297  NTVKRIPGKGLPFPKEPTRRGDLLVAFDIKFPDSLPPATRELLGDVLPN  345
            N+ K I  +G+P+ K P+ +GDL + FDI FP  L P  +  L + L N
Sbjct  352  NSKKIITNEGMPYSKSPSVKGDLFIEFDIVFPKKLSPEQKRTLKETLEN  400


>Q38AB7_TRYB2 unnamed protein product
Length=336

 Score = 207 bits (526),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 137/354 (39%), Positives = 189/354 (53%), Gaps = 38/354 (11%)

Query  1    MGKDFYKILGINKSANDDEIKKAYRKLALKYHPDK--NKTPQAEERFKEIAEAYEVLSDK  58
            MG D+YK+LG+++ A+  +IKKAY +LALKYHPDK      +AE  FKE+AEAY+VLSD+
Sbjct  1    MGIDYYKVLGVSRDASPSDIKKAYHQLALKYHPDKASGNREEAERLFKEVAEAYDVLSDE  60

Query  59   KKRDIYDQYGEEGLKGGVP---------GGPNEQGGGNYSYQFHG-DPRATFAQFFGSSD  108
            KK+ IYD YGEEGLKGGVP          G +    G  +Y F   D    F  FFGS+D
Sbjct  61   KKKKIYDSYGEEGLKGGVPDGSSGGPGGAGFHGFSSGGGTYNFSNRDAFKVFESFFGSND  120

Query  109  PFGIFFSSSDPSRMFGDSQNIFMSGGNEDDIYAQMGGGGGAFRSQSFNAQPNRKRQIQDP  168
            PF           +      +F              G GG     S    P      + P
Sbjct  121  PFAGGDMFGGGPGL----HRVFR-------------GFGGPHGFMSGFGSPEMSPAHEVP  163

Query  169  PIEHDLYVSLEEVDKGCVKKMKISRMSMATGQPRKEEKVLNITVKPGWKAGTKITFQKEG  228
            P+E+    +LEE+  GC KK  + R  + TG+   E+K+  + V PG+K GTK+ F  EG
Sbjct  164  PLEYTFSCTLEEIYSGCTKKFNVLR-PLPTGE---EKKLFEVAVLPGYKKGTKVRFVGEG  219

Query  229  DQTAGKVP---ADIIFIIRDKPHQLFKREGSDIKYNAHISLKEALCGTVVKVPTLQGDRI  285
                G  P   AD++F++ +KPH  FKR+G+D+     I+LK+AL GT + V  L G   
Sbjct  220  GIVQGYPPNVMADLVFVLDEKPHPRFKRDGADVLTTVQINLKQALLGTTISVLCLDGTTQ  279

Query  286  TLNSVGEVIKPNTVKRIPGKGLPFPKEPTRRGDLLVAFDIKFPDSLPPATRELL  339
            +L   G V K     R+ GKGLP  ++  + GD+ V  ++  P SL  AT+ L+
Sbjct  280  SLPLTG-VSKNGRKLRVSGKGLP-NRKTKQNGDMYVTIEVVMPTSLNEATKRLV  331



Lambda      K        H
   0.320    0.136    0.408 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2184764352


Query= XP_014085148.1 PREDICTED: heat shock protein 27-like [Bactrocera
oleae]

Length=212
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

HSP27_DROME  unnamed protein product                                  238     4e-80
HSP23_DROME  unnamed protein product                                  159     2e-49
HSP26_DROME  unnamed protein product                                  158     1e-48


>HSP27_DROME unnamed protein product
Length=213

 Score = 238 bits (607),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 131/216 (61%), Positives = 161/216 (75%), Gaps = 15/216 (7%)

Query  1    MAIVPLLANLAREFDTEYR-DLEHYWDDDFGFGIHPLEIFRPMRHGHSLMLQP------R  53
            M+I+PLL +LARE D +YR D  H  +DDFGFG+H  ++F P R     +L P      R
Sbjct  1    MSIIPLL-HLARELDHDYRTDWGHLLEDDFGFGVHAHDLFHPRR-----LLLPNTLGLGR  54

Query  54   RRHYPYDRAQVLARRSARLGKDTAECSSLIPTVGKDGFQVCMDVSQFKPNELTVKTVDKT  113
            RR+ PY+R+     + +R  + +   ++L+P VGKDGFQVCMDVSQFKPNELTVK VD T
Sbjct  55   RRYSPYERSHGHHNQMSR--RASGGPNALLPAVGKDGFQVCMDVSQFKPNELTVKVVDNT  112

Query  114  VIVEGKHEEREDDHGMIQRHFIRKYTLPKDYDPKDVVSTISSDGVLTVKAPPPPSKAIKA  173
            V+VEGKHEERED HGMIQRHF+RKYTLPK +DP +VVST+SSDGVLT+KAPPPPSK    
Sbjct  113  VVVEGKHEEREDGHGMIQRHFVRKYTLPKGFDPNEVVSTVSSDGVLTLKAPPPPSKEQAK  172

Query  174  NERVVQIQQTGPAHLSVKAPEETNSEGKAKENSDKK  209
            +ER+VQIQQTGPAHLSVKAP     +GKA+  S +K
Sbjct  173  SERIVQIQQTGPAHLSVKAPAPEAGDGKAENGSGEK  208


>HSP23_DROME unnamed protein product
Length=186

 Score = 159 bits (402),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 91/124 (73%), Gaps = 3/124 (2%)

Query  86   VGKDGFQVCMDVSQFKPNELTVKTVDKTVIVEGKHEEREDDHGMIQRHFIRKYTLPKDYD  145
            +GKDGFQVCMDVS FKP+EL VK  D +V+VEG HEEREDDHG I RHF+R+Y LP  Y+
Sbjct  66   IGKDGFQVCMDVSHFKPSELVVKVQDNSVLVEGNHEEREDDHGFITRHFVRRYALPPGYE  125

Query  146  PKDVVSTISSDGVLTVKAPPPPSKAIKANERVVQIQQTGPAHLSVKAPEETNSEGKAKEN  205
               V ST+SSDGVLT+K P PP+   K NER+VQIQQ GPAHL+VK   E   E   ++N
Sbjct  126  ADKVASTLSSDGVLTIKVPKPPAIEDKGNERIVQIQQVGPAHLNVK---ENPKEAVEQDN  182

Query  206  SDKK  209
             + K
Sbjct  183  GNDK  186


>HSP26_DROME unnamed protein product
Length=208

 Score = 158 bits (399),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 93/121 (77%), Gaps = 3/121 (2%)

Query  86   VGKDGFQVCMDVSQFKPNELTVKTVDKTVIVEGKHEEREDDHGMIQRHFIRKYTLPKDYD  145
            VGKDGFQVCMDV+QFKP+EL VK VD +++VEGKHEER+DDHG I RHF+R+Y +P  Y 
Sbjct  84   VGKDGFQVCMDVAQFKPSELNVKVVDDSILVEGKHEERQDDHGHIMRHFVRRYKVPDGYK  143

Query  146  PKDVVSTISSDGVLTVKAPPPPSKAIKANERVVQIQQTGPAHLSVKAPEETNSEGKAKEN  205
             + VVS +SSDGVLTV  P P +   K+ ER++QIQQ GPAHL+VKA E   SE K KEN
Sbjct  144  AEQVVSQLSSDGVLTVSIPKPQAVEDKSKERIIQIQQVGPAHLNVKANE---SEVKGKEN  200

Query  206  S  206
             
Sbjct  201  G  201



Lambda      K        H
   0.320    0.136    0.408 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2184764352


Query= XP_014085149.1 PREDICTED: dihydropteridine reductase isoform X1
[Bactrocera oleae]

Length=265
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DHPR_DICDI  unnamed protein product                                   182     3e-57
DHS3_CAEEL  unnamed protein product                                   29.6    2.8  
DHRS4_CAEEL  unnamed protein product                                  28.9    3.6  


>DHPR_DICDI unnamed protein product
Length=231

 Score = 182 bits (463),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 103/230 (45%), Positives = 135/230 (59%), Gaps = 6/230 (3%)

Query  30   MVGRVLVYGGKGALGSACVSHFKSNNYWVGSIDLSVNEEADASIVLPRELSWEQQEAEVL  89
            M   +LV GG GALG+  V  FKS ++   SID   N  AD S  +    S E++   V+
Sbjct  1    MSKNILVLGGSGALGAEVVKFFKSKSWNTISIDFRENPNADHSFTIKD--SGEEEIKSVI  58

Query  90   TKVGDALSGEKLDAVICVAGGWAGGNASKD-LAKNTDLMWRQSVWTSTNSAAVASKYLKD  148
             K+       K+D  +C AGGW+GGNAS D   K+   M   +++++  SA + +K L  
Sbjct  59   EKINS--KSIKVDTFVCAAGGWSGGNASSDEFLKSVKGMIDMNLYSAFASAHIGAKLLNQ  116

Query  149  GGLLTLTGAQPALQGTSGMIGYGMAKAAVHQLTRSLAGKNSGLPTDAIAVAILPVTLDTP  208
            GGL  LTGA  AL  TSGMI YG  KAA H + + LA +N GLP  + ++ ILPVTLDTP
Sbjct  117  GGLFVLTGASAALNRTSGMIAYGATKAATHHIIKDLASENGGLPAGSTSLGILPVTLDTP  176

Query  209  MNRKWMPKADFGTWTPLSEVAGLFHKW-TQGKERPNSGALVQLITKDGVT  257
             NRK+M  A+F  WTPLSEVA    +W T    RP +G+LV+  TK  VT
Sbjct  177  TNRKYMSDANFDDWTPLSEVAEKLFEWSTNSDSRPTNGSLVKFETKSKVT  226


>DHS3_CAEEL unnamed protein product
Length=309

 Score = 29.6 bits (65),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 32/151 (21%), Positives = 62/151 (41%), Gaps = 12/151 (8%)

Query  67   EEADASIVLPRELSWEQQEAEVLTKVGDALSGE--KLDAVICVAGGWAGGNASKDLAKNT  124
            +E +A  V  +  + +  E + + +  D +  E  K+D ++  AG   G    K L +  
Sbjct  83   KELEAMGVEAKAYTVDLSEYKEINRTADLVKSEVGKVDILVNNAGIVTG----KKLLQCP  138

Query  125  DLMWRQSVWTSTNSAAVASKYLKDG------GLLTLTGAQPALQGTSGMIGYGMAKAAVH  178
            D +  ++V  +TN+    +K    G      G +    +     G +G++ Y  +K    
Sbjct  139  DELMVKTVSVNTNALFFTTKNFLPGMLESNKGHIVTIASMAGKCGVAGLVDYCASKHGAV  198

Query  179  QLTRSLAGKNSGLPTDAIAVAILPVTLDTPM  209
                SLA +   L  D     + P+ ++T M
Sbjct  199  GFNDSLASELYALKKDVKTTVVCPIYINTGM  229


>DHRS4_CAEEL unnamed protein product
Length=260

 Score = 28.9 bits (63),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 21/64 (33%), Positives = 31/64 (48%), Gaps = 4/64 (6%)

Query  149  GGLLTLTGAQPALQGTSGMIGYGMAKAAVHQLTRSLAGKNSGLPTDAIAV-AILPVTLDT  207
            GG +    +  A +   G+  YG+ K  +  LTR+LA    GL  D I V  I P  + T
Sbjct  140  GGAIIFNASYSAYKSPPGIAAYGVTKTTLVGLTRALA---MGLAKDNIRVNGIAPGVIKT  196

Query  208  PMNR  211
             M++
Sbjct  197  KMSQ  200



Lambda      K        H
   0.320    0.136    0.408 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2184764352


Query= XP_014085150.1 PREDICTED: dihydropteridine reductase isoform X2
[Bactrocera oleae]

Length=246
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DHPR_DICDI  unnamed protein product                                   183     1e-57
D6XG53_TRYB2  unnamed protein product                                 29.6    3.1  
Q56TY6_9TRYP  unnamed protein product                                 29.6    3.1  


>DHPR_DICDI unnamed protein product
Length=231

 Score = 183 bits (464),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 103/230 (45%), Positives = 135/230 (59%), Gaps = 6/230 (3%)

Query  11   MVGRVLVYGGKGALGSACVSHFKSNNYWVGSIDLSVNEEADASIVLPRELSWEQQEAEVL  70
            M   +LV GG GALG+  V  FKS ++   SID   N  AD S  +    S E++   V+
Sbjct  1    MSKNILVLGGSGALGAEVVKFFKSKSWNTISIDFRENPNADHSFTIKD--SGEEEIKSVI  58

Query  71   TKVGDALSGEKLDAVICVAGGWAGGNASKD-LAKNTDLMWRQSVWTSTNSAAVASKYLKD  129
             K+       K+D  +C AGGW+GGNAS D   K+   M   +++++  SA + +K L  
Sbjct  59   EKINS--KSIKVDTFVCAAGGWSGGNASSDEFLKSVKGMIDMNLYSAFASAHIGAKLLNQ  116

Query  130  GGLLTLTGAQPALQGTSGMIGYGMAKAAVHQLTRSLAGKNSGLPTDAIAVAILPVTLDTP  189
            GGL  LTGA  AL  TSGMI YG  KAA H + + LA +N GLP  + ++ ILPVTLDTP
Sbjct  117  GGLFVLTGASAALNRTSGMIAYGATKAATHHIIKDLASENGGLPAGSTSLGILPVTLDTP  176

Query  190  MNRKWMPKADFGTWTPLSEVAGLFHKW-TQGKERPNSGALVQLITKDGVT  238
             NRK+M  A+F  WTPLSEVA    +W T    RP +G+LV+  TK  VT
Sbjct  177  TNRKYMSDANFDDWTPLSEVAEKLFEWSTNSDSRPTNGSLVKFETKSKVT  226


>D6XG53_TRYB2 unnamed protein product
Length=735

 Score = 29.6 bits (65),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 52/127 (41%), Gaps = 11/127 (9%)

Query  93   AGGNASKDLAKNTDLMWRQSV-----WTSTNSAAVASKYLKDGGLLTLTGAQPALQGTSG  147
            A  + S+ +A+  D+   + V     +  T+S     KYL DG LL      P LQ  S 
Sbjct  96   AAISVSERVAEELDVTLGEEVGYCIRFDDTSSDRTRLKYLTDGMLLREAMGDPMLQRYSV  155

Query  148  MIGYGMAKAAVHQLTRSLAGKNSGLPTDAIAVAILPVTLDTPMNRKWMPKADFGTWTPLS  207
            +I     +  VH      A K+       + V ++  TL+    + + P+A      PL 
Sbjct  156  IILDEAHERTVHTDILIGAVKDLLHRRPDLRVVVMSATLEERRFQSYFPEA------PLV  209

Query  208  EVAGLFH  214
             V+G  +
Sbjct  210  HVSGRMY  216


>Q56TY6_9TRYP unnamed protein product
Length=735

 Score = 29.6 bits (65),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 52/127 (41%), Gaps = 11/127 (9%)

Query  93   AGGNASKDLAKNTDLMWRQSV-----WTSTNSAAVASKYLKDGGLLTLTGAQPALQGTSG  147
            A  + S+ +A+  D+   + V     +  T+S     KYL DG LL      P LQ  S 
Sbjct  96   AAISVSERVAEELDVTLGEEVGYCIRFDDTSSDRTRLKYLTDGMLLREAMGDPMLQRYSV  155

Query  148  MIGYGMAKAAVHQLTRSLAGKNSGLPTDAIAVAILPVTLDTPMNRKWMPKADFGTWTPLS  207
            +I     +  VH      A K+       + V ++  TL+    + + P+A      PL 
Sbjct  156  IILDEAHERTVHTDILIGAVKDLLHRRPDLRVVVMSATLEERRFQSYFPEA------PLV  209

Query  208  EVAGLFH  214
             V+G  +
Sbjct  210  HVSGRMY  216



Lambda      K        H
   0.320    0.136    0.408 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2184764352


Query= XP_014085151.1 PREDICTED: dihydropteridine reductase isoform X2
[Bactrocera oleae]

Length=246
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DHPR_DICDI  unnamed protein product                                   183     1e-57
D6XG53_TRYB2  unnamed protein product                                 29.6    3.1  
Q56TY6_9TRYP  unnamed protein product                                 29.6    3.1  


>DHPR_DICDI unnamed protein product
Length=231

 Score = 183 bits (464),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 103/230 (45%), Positives = 135/230 (59%), Gaps = 6/230 (3%)

Query  11   MVGRVLVYGGKGALGSACVSHFKSNNYWVGSIDLSVNEEADASIVLPRELSWEQQEAEVL  70
            M   +LV GG GALG+  V  FKS ++   SID   N  AD S  +    S E++   V+
Sbjct  1    MSKNILVLGGSGALGAEVVKFFKSKSWNTISIDFRENPNADHSFTIKD--SGEEEIKSVI  58

Query  71   TKVGDALSGEKLDAVICVAGGWAGGNASKD-LAKNTDLMWRQSVWTSTNSAAVASKYLKD  129
             K+       K+D  +C AGGW+GGNAS D   K+   M   +++++  SA + +K L  
Sbjct  59   EKINS--KSIKVDTFVCAAGGWSGGNASSDEFLKSVKGMIDMNLYSAFASAHIGAKLLNQ  116

Query  130  GGLLTLTGAQPALQGTSGMIGYGMAKAAVHQLTRSLAGKNSGLPTDAIAVAILPVTLDTP  189
            GGL  LTGA  AL  TSGMI YG  KAA H + + LA +N GLP  + ++ ILPVTLDTP
Sbjct  117  GGLFVLTGASAALNRTSGMIAYGATKAATHHIIKDLASENGGLPAGSTSLGILPVTLDTP  176

Query  190  MNRKWMPKADFGTWTPLSEVAGLFHKW-TQGKERPNSGALVQLITKDGVT  238
             NRK+M  A+F  WTPLSEVA    +W T    RP +G+LV+  TK  VT
Sbjct  177  TNRKYMSDANFDDWTPLSEVAEKLFEWSTNSDSRPTNGSLVKFETKSKVT  226


>D6XG53_TRYB2 unnamed protein product
Length=735

 Score = 29.6 bits (65),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 52/127 (41%), Gaps = 11/127 (9%)

Query  93   AGGNASKDLAKNTDLMWRQSV-----WTSTNSAAVASKYLKDGGLLTLTGAQPALQGTSG  147
            A  + S+ +A+  D+   + V     +  T+S     KYL DG LL      P LQ  S 
Sbjct  96   AAISVSERVAEELDVTLGEEVGYCIRFDDTSSDRTRLKYLTDGMLLREAMGDPMLQRYSV  155

Query  148  MIGYGMAKAAVHQLTRSLAGKNSGLPTDAIAVAILPVTLDTPMNRKWMPKADFGTWTPLS  207
            +I     +  VH      A K+       + V ++  TL+    + + P+A      PL 
Sbjct  156  IILDEAHERTVHTDILIGAVKDLLHRRPDLRVVVMSATLEERRFQSYFPEA------PLV  209

Query  208  EVAGLFH  214
             V+G  +
Sbjct  210  HVSGRMY  216


>Q56TY6_9TRYP unnamed protein product
Length=735

 Score = 29.6 bits (65),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 52/127 (41%), Gaps = 11/127 (9%)

Query  93   AGGNASKDLAKNTDLMWRQSV-----WTSTNSAAVASKYLKDGGLLTLTGAQPALQGTSG  147
            A  + S+ +A+  D+   + V     +  T+S     KYL DG LL      P LQ  S 
Sbjct  96   AAISVSERVAEELDVTLGEEVGYCIRFDDTSSDRTRLKYLTDGMLLREAMGDPMLQRYSV  155

Query  148  MIGYGMAKAAVHQLTRSLAGKNSGLPTDAIAVAILPVTLDTPMNRKWMPKADFGTWTPLS  207
            +I     +  VH      A K+       + V ++  TL+    + + P+A      PL 
Sbjct  156  IILDEAHERTVHTDILIGAVKDLLHRRPDLRVVVMSATLEERRFQSYFPEA------PLV  209

Query  208  EVAGLFH  214
             V+G  +
Sbjct  210  HVSGRMY  216



Lambda      K        H
   0.320    0.136    0.408 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2184764352


Query= XP_014085152.1 PREDICTED: uncharacterized protein LOC106614122
[Bactrocera oleae]

Length=278
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q584G0_TRYB2  unnamed protein product                                 29.6    2.4  


>Q584G0_TRYB2 unnamed protein product
Length=312

 Score = 29.6 bits (65),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 4/50 (8%)

Query  131  QSEHESFETNIMRNPLKDANLMLGEKL--MIASV--NAAGNINIETIDSN  176
            + E  +F  N++  P  D  L  GE+L  +I S   N AGN+  + ID++
Sbjct  55   EDEEANFTPNVLGGPTNDTPLFYGEELDSLIQSQERNVAGNVTTQNIDAS  104



Lambda      K        H
   0.320    0.136    0.408 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2184764352


Query= XP_014085153.1 PREDICTED: dihydropteridine reductase isoform X3
[Bactrocera oleae]

Length=246
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DHPR_DICDI  unnamed protein product                                   183     1e-57
D6XG53_TRYB2  unnamed protein product                                 29.6    3.1  
Q56TY6_9TRYP  unnamed protein product                                 29.6    3.1  


>DHPR_DICDI unnamed protein product
Length=231

 Score = 183 bits (464),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 103/230 (45%), Positives = 135/230 (59%), Gaps = 6/230 (3%)

Query  11   MVGRVLVYGGKGALGSACVSHFKSNNYWVGSIDLSVNEEADASIVLPRELSWEQQEAEVL  70
            M   +LV GG GALG+  V  FKS ++   SID   N  AD S  +    S E++   V+
Sbjct  1    MSKNILVLGGSGALGAEVVKFFKSKSWNTISIDFRENPNADHSFTIKD--SGEEEIKSVI  58

Query  71   TKVGDALSGEKLDAVICVAGGWAGGNASKD-LAKNTDLMWRQSVWTSTNSAAVASKYLKD  129
             K+       K+D  +C AGGW+GGNAS D   K+   M   +++++  SA + +K L  
Sbjct  59   EKINS--KSIKVDTFVCAAGGWSGGNASSDEFLKSVKGMIDMNLYSAFASAHIGAKLLNQ  116

Query  130  GGLLTLTGAQPALQGTSGMIGYGMAKAAVHQLTRSLAGKNSGLPTDAIAVAILPVTLDTP  189
            GGL  LTGA  AL  TSGMI YG  KAA H + + LA +N GLP  + ++ ILPVTLDTP
Sbjct  117  GGLFVLTGASAALNRTSGMIAYGATKAATHHIIKDLASENGGLPAGSTSLGILPVTLDTP  176

Query  190  MNRKWMPKADFGTWTPLSEVAGLFHKW-TQGKERPNSGALVQLITKDGVT  238
             NRK+M  A+F  WTPLSEVA    +W T    RP +G+LV+  TK  VT
Sbjct  177  TNRKYMSDANFDDWTPLSEVAEKLFEWSTNSDSRPTNGSLVKFETKSKVT  226


>D6XG53_TRYB2 unnamed protein product
Length=735

 Score = 29.6 bits (65),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 52/127 (41%), Gaps = 11/127 (9%)

Query  93   AGGNASKDLAKNTDLMWRQSV-----WTSTNSAAVASKYLKDGGLLTLTGAQPALQGTSG  147
            A  + S+ +A+  D+   + V     +  T+S     KYL DG LL      P LQ  S 
Sbjct  96   AAISVSERVAEELDVTLGEEVGYCIRFDDTSSDRTRLKYLTDGMLLREAMGDPMLQRYSV  155

Query  148  MIGYGMAKAAVHQLTRSLAGKNSGLPTDAIAVAILPVTLDTPMNRKWMPKADFGTWTPLS  207
            +I     +  VH      A K+       + V ++  TL+    + + P+A      PL 
Sbjct  156  IILDEAHERTVHTDILIGAVKDLLHRRPDLRVVVMSATLEERRFQSYFPEA------PLV  209

Query  208  EVAGLFH  214
             V+G  +
Sbjct  210  HVSGRMY  216


>Q56TY6_9TRYP unnamed protein product
Length=735

 Score = 29.6 bits (65),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 52/127 (41%), Gaps = 11/127 (9%)

Query  93   AGGNASKDLAKNTDLMWRQSV-----WTSTNSAAVASKYLKDGGLLTLTGAQPALQGTSG  147
            A  + S+ +A+  D+   + V     +  T+S     KYL DG LL      P LQ  S 
Sbjct  96   AAISVSERVAEELDVTLGEEVGYCIRFDDTSSDRTRLKYLTDGMLLREAMGDPMLQRYSV  155

Query  148  MIGYGMAKAAVHQLTRSLAGKNSGLPTDAIAVAILPVTLDTPMNRKWMPKADFGTWTPLS  207
            +I     +  VH      A K+       + V ++  TL+    + + P+A      PL 
Sbjct  156  IILDEAHERTVHTDILIGAVKDLLHRRPDLRVVVMSATLEERRFQSYFPEA------PLV  209

Query  208  EVAGLFH  214
             V+G  +
Sbjct  210  HVSGRMY  216



Lambda      K        H
   0.320    0.136    0.408 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2184764352


Query= XP_014085154.1 PREDICTED: dihydropteridine reductase isoform X2
[Bactrocera oleae]

Length=246
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DHPR_DICDI  unnamed protein product                                   183     1e-57
D6XG53_TRYB2  unnamed protein product                                 29.6    3.1  
Q56TY6_9TRYP  unnamed protein product                                 29.6    3.1  


>DHPR_DICDI unnamed protein product
Length=231

 Score = 183 bits (464),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 103/230 (45%), Positives = 135/230 (59%), Gaps = 6/230 (3%)

Query  11   MVGRVLVYGGKGALGSACVSHFKSNNYWVGSIDLSVNEEADASIVLPRELSWEQQEAEVL  70
            M   +LV GG GALG+  V  FKS ++   SID   N  AD S  +    S E++   V+
Sbjct  1    MSKNILVLGGSGALGAEVVKFFKSKSWNTISIDFRENPNADHSFTIKD--SGEEEIKSVI  58

Query  71   TKVGDALSGEKLDAVICVAGGWAGGNASKD-LAKNTDLMWRQSVWTSTNSAAVASKYLKD  129
             K+       K+D  +C AGGW+GGNAS D   K+   M   +++++  SA + +K L  
Sbjct  59   EKINS--KSIKVDTFVCAAGGWSGGNASSDEFLKSVKGMIDMNLYSAFASAHIGAKLLNQ  116

Query  130  GGLLTLTGAQPALQGTSGMIGYGMAKAAVHQLTRSLAGKNSGLPTDAIAVAILPVTLDTP  189
            GGL  LTGA  AL  TSGMI YG  KAA H + + LA +N GLP  + ++ ILPVTLDTP
Sbjct  117  GGLFVLTGASAALNRTSGMIAYGATKAATHHIIKDLASENGGLPAGSTSLGILPVTLDTP  176

Query  190  MNRKWMPKADFGTWTPLSEVAGLFHKW-TQGKERPNSGALVQLITKDGVT  238
             NRK+M  A+F  WTPLSEVA    +W T    RP +G+LV+  TK  VT
Sbjct  177  TNRKYMSDANFDDWTPLSEVAEKLFEWSTNSDSRPTNGSLVKFETKSKVT  226


>D6XG53_TRYB2 unnamed protein product
Length=735

 Score = 29.6 bits (65),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 52/127 (41%), Gaps = 11/127 (9%)

Query  93   AGGNASKDLAKNTDLMWRQSV-----WTSTNSAAVASKYLKDGGLLTLTGAQPALQGTSG  147
            A  + S+ +A+  D+   + V     +  T+S     KYL DG LL      P LQ  S 
Sbjct  96   AAISVSERVAEELDVTLGEEVGYCIRFDDTSSDRTRLKYLTDGMLLREAMGDPMLQRYSV  155

Query  148  MIGYGMAKAAVHQLTRSLAGKNSGLPTDAIAVAILPVTLDTPMNRKWMPKADFGTWTPLS  207
            +I     +  VH      A K+       + V ++  TL+    + + P+A      PL 
Sbjct  156  IILDEAHERTVHTDILIGAVKDLLHRRPDLRVVVMSATLEERRFQSYFPEA------PLV  209

Query  208  EVAGLFH  214
             V+G  +
Sbjct  210  HVSGRMY  216


>Q56TY6_9TRYP unnamed protein product
Length=735

 Score = 29.6 bits (65),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 52/127 (41%), Gaps = 11/127 (9%)

Query  93   AGGNASKDLAKNTDLMWRQSV-----WTSTNSAAVASKYLKDGGLLTLTGAQPALQGTSG  147
            A  + S+ +A+  D+   + V     +  T+S     KYL DG LL      P LQ  S 
Sbjct  96   AAISVSERVAEELDVTLGEEVGYCIRFDDTSSDRTRLKYLTDGMLLREAMGDPMLQRYSV  155

Query  148  MIGYGMAKAAVHQLTRSLAGKNSGLPTDAIAVAILPVTLDTPMNRKWMPKADFGTWTPLS  207
            +I     +  VH      A K+       + V ++  TL+    + + P+A      PL 
Sbjct  156  IILDEAHERTVHTDILIGAVKDLLHRRPDLRVVVMSATLEERRFQSYFPEA------PLV  209

Query  208  EVAGLFH  214
             V+G  +
Sbjct  210  HVSGRMY  216



Lambda      K        H
   0.320    0.136    0.408 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2184764352


Query= XP_014085155.1 PREDICTED: dihydropteridine reductase isoform X4
[Bactrocera oleae]

Length=236
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DHPR_DICDI  unnamed protein product                                   183     1e-57
DHS3_CAEEL  unnamed protein product                                   29.6    1.9  
DHRS4_CAEEL  unnamed protein product                                  28.9    3.2  


>DHPR_DICDI unnamed protein product
Length=231

 Score = 183 bits (464),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 103/230 (45%), Positives = 135/230 (59%), Gaps = 6/230 (3%)

Query  1    MVGRVLVYGGKGALGSACVSHFKSNNYWVGSIDLSVNEEADASIVLPRELSWEQQEAEVL  60
            M   +LV GG GALG+  V  FKS ++   SID   N  AD S  +    S E++   V+
Sbjct  1    MSKNILVLGGSGALGAEVVKFFKSKSWNTISIDFRENPNADHSFTIKD--SGEEEIKSVI  58

Query  61   TKVGDALSGEKLDAVICVAGGWAGGNASKD-LAKNTDLMWRQSVWTSTNSAAVASKYLKD  119
             K+       K+D  +C AGGW+GGNAS D   K+   M   +++++  SA + +K L  
Sbjct  59   EKINS--KSIKVDTFVCAAGGWSGGNASSDEFLKSVKGMIDMNLYSAFASAHIGAKLLNQ  116

Query  120  GGLLTLTGAQPALQGTSGMIGYGMAKAAVHQLTRSLAGKNSGLPTDAIAVAILPVTLDTP  179
            GGL  LTGA  AL  TSGMI YG  KAA H + + LA +N GLP  + ++ ILPVTLDTP
Sbjct  117  GGLFVLTGASAALNRTSGMIAYGATKAATHHIIKDLASENGGLPAGSTSLGILPVTLDTP  176

Query  180  MNRKWMPKADFGTWTPLSEVAGLFHKW-TQGKERPNSGALVQLITKDGVT  228
             NRK+M  A+F  WTPLSEVA    +W T    RP +G+LV+  TK  VT
Sbjct  177  TNRKYMSDANFDDWTPLSEVAEKLFEWSTNSDSRPTNGSLVKFETKSKVT  226


>DHS3_CAEEL unnamed protein product
Length=309

 Score = 29.6 bits (65),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 32/151 (21%), Positives = 62/151 (41%), Gaps = 12/151 (8%)

Query  38   EEADASIVLPRELSWEQQEAEVLTKVGDALSGE--KLDAVICVAGGWAGGNASKDLAKNT  95
            +E +A  V  +  + +  E + + +  D +  E  K+D ++  AG   G    K L +  
Sbjct  83   KELEAMGVEAKAYTVDLSEYKEINRTADLVKSEVGKVDILVNNAGIVTG----KKLLQCP  138

Query  96   DLMWRQSVWTSTNSAAVASKYLKDG------GLLTLTGAQPALQGTSGMIGYGMAKAAVH  149
            D +  ++V  +TN+    +K    G      G +    +     G +G++ Y  +K    
Sbjct  139  DELMVKTVSVNTNALFFTTKNFLPGMLESNKGHIVTIASMAGKCGVAGLVDYCASKHGAV  198

Query  150  QLTRSLAGKNSGLPTDAIAVAILPVTLDTPM  180
                SLA +   L  D     + P+ ++T M
Sbjct  199  GFNDSLASELYALKKDVKTTVVCPIYINTGM  229


>DHRS4_CAEEL unnamed protein product
Length=260

 Score = 28.9 bits (63),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 21/64 (33%), Positives = 31/64 (48%), Gaps = 4/64 (6%)

Query  120  GGLLTLTGAQPALQGTSGMIGYGMAKAAVHQLTRSLAGKNSGLPTDAIAV-AILPVTLDT  178
            GG +    +  A +   G+  YG+ K  +  LTR+LA    GL  D I V  I P  + T
Sbjct  140  GGAIIFNASYSAYKSPPGIAAYGVTKTTLVGLTRALA---MGLAKDNIRVNGIAPGVIKT  196

Query  179  PMNR  182
             M++
Sbjct  197  KMSQ  200



Lambda      K        H
   0.320    0.136    0.408 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2184764352


Query= XP_014085156.1 PREDICTED: dihydropteridine reductase isoform X4
[Bactrocera oleae]

Length=236
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DHPR_DICDI  unnamed protein product                                   183     1e-57
DHS3_CAEEL  unnamed protein product                                   29.6    1.9  
DHRS4_CAEEL  unnamed protein product                                  28.9    3.2  


>DHPR_DICDI unnamed protein product
Length=231

 Score = 183 bits (464),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 103/230 (45%), Positives = 135/230 (59%), Gaps = 6/230 (3%)

Query  1    MVGRVLVYGGKGALGSACVSHFKSNNYWVGSIDLSVNEEADASIVLPRELSWEQQEAEVL  60
            M   +LV GG GALG+  V  FKS ++   SID   N  AD S  +    S E++   V+
Sbjct  1    MSKNILVLGGSGALGAEVVKFFKSKSWNTISIDFRENPNADHSFTIKD--SGEEEIKSVI  58

Query  61   TKVGDALSGEKLDAVICVAGGWAGGNASKD-LAKNTDLMWRQSVWTSTNSAAVASKYLKD  119
             K+       K+D  +C AGGW+GGNAS D   K+   M   +++++  SA + +K L  
Sbjct  59   EKINS--KSIKVDTFVCAAGGWSGGNASSDEFLKSVKGMIDMNLYSAFASAHIGAKLLNQ  116

Query  120  GGLLTLTGAQPALQGTSGMIGYGMAKAAVHQLTRSLAGKNSGLPTDAIAVAILPVTLDTP  179
            GGL  LTGA  AL  TSGMI YG  KAA H + + LA +N GLP  + ++ ILPVTLDTP
Sbjct  117  GGLFVLTGASAALNRTSGMIAYGATKAATHHIIKDLASENGGLPAGSTSLGILPVTLDTP  176

Query  180  MNRKWMPKADFGTWTPLSEVAGLFHKW-TQGKERPNSGALVQLITKDGVT  228
             NRK+M  A+F  WTPLSEVA    +W T    RP +G+LV+  TK  VT
Sbjct  177  TNRKYMSDANFDDWTPLSEVAEKLFEWSTNSDSRPTNGSLVKFETKSKVT  226


>DHS3_CAEEL unnamed protein product
Length=309

 Score = 29.6 bits (65),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 32/151 (21%), Positives = 62/151 (41%), Gaps = 12/151 (8%)

Query  38   EEADASIVLPRELSWEQQEAEVLTKVGDALSGE--KLDAVICVAGGWAGGNASKDLAKNT  95
            +E +A  V  +  + +  E + + +  D +  E  K+D ++  AG   G    K L +  
Sbjct  83   KELEAMGVEAKAYTVDLSEYKEINRTADLVKSEVGKVDILVNNAGIVTG----KKLLQCP  138

Query  96   DLMWRQSVWTSTNSAAVASKYLKDG------GLLTLTGAQPALQGTSGMIGYGMAKAAVH  149
            D +  ++V  +TN+    +K    G      G +    +     G +G++ Y  +K    
Sbjct  139  DELMVKTVSVNTNALFFTTKNFLPGMLESNKGHIVTIASMAGKCGVAGLVDYCASKHGAV  198

Query  150  QLTRSLAGKNSGLPTDAIAVAILPVTLDTPM  180
                SLA +   L  D     + P+ ++T M
Sbjct  199  GFNDSLASELYALKKDVKTTVVCPIYINTGM  229


>DHRS4_CAEEL unnamed protein product
Length=260

 Score = 28.9 bits (63),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 21/64 (33%), Positives = 31/64 (48%), Gaps = 4/64 (6%)

Query  120  GGLLTLTGAQPALQGTSGMIGYGMAKAAVHQLTRSLAGKNSGLPTDAIAV-AILPVTLDT  178
            GG +    +  A +   G+  YG+ K  +  LTR+LA    GL  D I V  I P  + T
Sbjct  140  GGAIIFNASYSAYKSPPGIAAYGVTKTTLVGLTRALA---MGLAKDNIRVNGIAPGVIKT  196

Query  179  PMNR  182
             M++
Sbjct  197  KMSQ  200



Lambda      K        H
   0.320    0.136    0.408 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2184764352


Query= XP_014085157.1 PREDICTED: dihydropteridine reductase isoform X4
[Bactrocera oleae]

Length=236
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DHPR_DICDI  unnamed protein product                                   183     1e-57
DHS3_CAEEL  unnamed protein product                                   29.6    1.9  
DHRS4_CAEEL  unnamed protein product                                  28.9    3.2  


>DHPR_DICDI unnamed protein product
Length=231

 Score = 183 bits (464),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 103/230 (45%), Positives = 135/230 (59%), Gaps = 6/230 (3%)

Query  1    MVGRVLVYGGKGALGSACVSHFKSNNYWVGSIDLSVNEEADASIVLPRELSWEQQEAEVL  60
            M   +LV GG GALG+  V  FKS ++   SID   N  AD S  +    S E++   V+
Sbjct  1    MSKNILVLGGSGALGAEVVKFFKSKSWNTISIDFRENPNADHSFTIKD--SGEEEIKSVI  58

Query  61   TKVGDALSGEKLDAVICVAGGWAGGNASKD-LAKNTDLMWRQSVWTSTNSAAVASKYLKD  119
             K+       K+D  +C AGGW+GGNAS D   K+   M   +++++  SA + +K L  
Sbjct  59   EKINS--KSIKVDTFVCAAGGWSGGNASSDEFLKSVKGMIDMNLYSAFASAHIGAKLLNQ  116

Query  120  GGLLTLTGAQPALQGTSGMIGYGMAKAAVHQLTRSLAGKNSGLPTDAIAVAILPVTLDTP  179
            GGL  LTGA  AL  TSGMI YG  KAA H + + LA +N GLP  + ++ ILPVTLDTP
Sbjct  117  GGLFVLTGASAALNRTSGMIAYGATKAATHHIIKDLASENGGLPAGSTSLGILPVTLDTP  176

Query  180  MNRKWMPKADFGTWTPLSEVAGLFHKW-TQGKERPNSGALVQLITKDGVT  228
             NRK+M  A+F  WTPLSEVA    +W T    RP +G+LV+  TK  VT
Sbjct  177  TNRKYMSDANFDDWTPLSEVAEKLFEWSTNSDSRPTNGSLVKFETKSKVT  226


>DHS3_CAEEL unnamed protein product
Length=309

 Score = 29.6 bits (65),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 32/151 (21%), Positives = 62/151 (41%), Gaps = 12/151 (8%)

Query  38   EEADASIVLPRELSWEQQEAEVLTKVGDALSGE--KLDAVICVAGGWAGGNASKDLAKNT  95
            +E +A  V  +  + +  E + + +  D +  E  K+D ++  AG   G    K L +  
Sbjct  83   KELEAMGVEAKAYTVDLSEYKEINRTADLVKSEVGKVDILVNNAGIVTG----KKLLQCP  138

Query  96   DLMWRQSVWTSTNSAAVASKYLKDG------GLLTLTGAQPALQGTSGMIGYGMAKAAVH  149
            D +  ++V  +TN+    +K    G      G +    +     G +G++ Y  +K    
Sbjct  139  DELMVKTVSVNTNALFFTTKNFLPGMLESNKGHIVTIASMAGKCGVAGLVDYCASKHGAV  198

Query  150  QLTRSLAGKNSGLPTDAIAVAILPVTLDTPM  180
                SLA +   L  D     + P+ ++T M
Sbjct  199  GFNDSLASELYALKKDVKTTVVCPIYINTGM  229


>DHRS4_CAEEL unnamed protein product
Length=260

 Score = 28.9 bits (63),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 21/64 (33%), Positives = 31/64 (48%), Gaps = 4/64 (6%)

Query  120  GGLLTLTGAQPALQGTSGMIGYGMAKAAVHQLTRSLAGKNSGLPTDAIAV-AILPVTLDT  178
            GG +    +  A +   G+  YG+ K  +  LTR+LA    GL  D I V  I P  + T
Sbjct  140  GGAIIFNASYSAYKSPPGIAAYGVTKTTLVGLTRALA---MGLAKDNIRVNGIAPGVIKT  196

Query  179  PMNR  182
             M++
Sbjct  197  KMSQ  200



Lambda      K        H
   0.320    0.136    0.408 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2184764352


Query= XP_014085158.1 PREDICTED: dihydropteridine reductase isoform X4
[Bactrocera oleae]

Length=236
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DHPR_DICDI  unnamed protein product                                   183     1e-57
DHS3_CAEEL  unnamed protein product                                   29.6    1.9  
DHRS4_CAEEL  unnamed protein product                                  28.9    3.2  


>DHPR_DICDI unnamed protein product
Length=231

 Score = 183 bits (464),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 103/230 (45%), Positives = 135/230 (59%), Gaps = 6/230 (3%)

Query  1    MVGRVLVYGGKGALGSACVSHFKSNNYWVGSIDLSVNEEADASIVLPRELSWEQQEAEVL  60
            M   +LV GG GALG+  V  FKS ++   SID   N  AD S  +    S E++   V+
Sbjct  1    MSKNILVLGGSGALGAEVVKFFKSKSWNTISIDFRENPNADHSFTIKD--SGEEEIKSVI  58

Query  61   TKVGDALSGEKLDAVICVAGGWAGGNASKD-LAKNTDLMWRQSVWTSTNSAAVASKYLKD  119
             K+       K+D  +C AGGW+GGNAS D   K+   M   +++++  SA + +K L  
Sbjct  59   EKINS--KSIKVDTFVCAAGGWSGGNASSDEFLKSVKGMIDMNLYSAFASAHIGAKLLNQ  116

Query  120  GGLLTLTGAQPALQGTSGMIGYGMAKAAVHQLTRSLAGKNSGLPTDAIAVAILPVTLDTP  179
            GGL  LTGA  AL  TSGMI YG  KAA H + + LA +N GLP  + ++ ILPVTLDTP
Sbjct  117  GGLFVLTGASAALNRTSGMIAYGATKAATHHIIKDLASENGGLPAGSTSLGILPVTLDTP  176

Query  180  MNRKWMPKADFGTWTPLSEVAGLFHKW-TQGKERPNSGALVQLITKDGVT  228
             NRK+M  A+F  WTPLSEVA    +W T    RP +G+LV+  TK  VT
Sbjct  177  TNRKYMSDANFDDWTPLSEVAEKLFEWSTNSDSRPTNGSLVKFETKSKVT  226


>DHS3_CAEEL unnamed protein product
Length=309

 Score = 29.6 bits (65),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 32/151 (21%), Positives = 62/151 (41%), Gaps = 12/151 (8%)

Query  38   EEADASIVLPRELSWEQQEAEVLTKVGDALSGE--KLDAVICVAGGWAGGNASKDLAKNT  95
            +E +A  V  +  + +  E + + +  D +  E  K+D ++  AG   G    K L +  
Sbjct  83   KELEAMGVEAKAYTVDLSEYKEINRTADLVKSEVGKVDILVNNAGIVTG----KKLLQCP  138

Query  96   DLMWRQSVWTSTNSAAVASKYLKDG------GLLTLTGAQPALQGTSGMIGYGMAKAAVH  149
            D +  ++V  +TN+    +K    G      G +    +     G +G++ Y  +K    
Sbjct  139  DELMVKTVSVNTNALFFTTKNFLPGMLESNKGHIVTIASMAGKCGVAGLVDYCASKHGAV  198

Query  150  QLTRSLAGKNSGLPTDAIAVAILPVTLDTPM  180
                SLA +   L  D     + P+ ++T M
Sbjct  199  GFNDSLASELYALKKDVKTTVVCPIYINTGM  229


>DHRS4_CAEEL unnamed protein product
Length=260

 Score = 28.9 bits (63),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 21/64 (33%), Positives = 31/64 (48%), Gaps = 4/64 (6%)

Query  120  GGLLTLTGAQPALQGTSGMIGYGMAKAAVHQLTRSLAGKNSGLPTDAIAV-AILPVTLDT  178
            GG +    +  A +   G+  YG+ K  +  LTR+LA    GL  D I V  I P  + T
Sbjct  140  GGAIIFNASYSAYKSPPGIAAYGVTKTTLVGLTRALA---MGLAKDNIRVNGIAPGVIKT  196

Query  179  PMNR  182
             M++
Sbjct  197  KMSQ  200



Lambda      K        H
   0.320    0.136    0.408 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2184764352


Query= XP_014085159.1 PREDICTED: dihydropteridine reductase isoform X4
[Bactrocera oleae]

Length=236
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DHPR_DICDI  unnamed protein product                                   183     1e-57
DHS3_CAEEL  unnamed protein product                                   29.6    1.9  
DHRS4_CAEEL  unnamed protein product                                  28.9    3.2  


>DHPR_DICDI unnamed protein product
Length=231

 Score = 183 bits (464),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 103/230 (45%), Positives = 135/230 (59%), Gaps = 6/230 (3%)

Query  1    MVGRVLVYGGKGALGSACVSHFKSNNYWVGSIDLSVNEEADASIVLPRELSWEQQEAEVL  60
            M   +LV GG GALG+  V  FKS ++   SID   N  AD S  +    S E++   V+
Sbjct  1    MSKNILVLGGSGALGAEVVKFFKSKSWNTISIDFRENPNADHSFTIKD--SGEEEIKSVI  58

Query  61   TKVGDALSGEKLDAVICVAGGWAGGNASKD-LAKNTDLMWRQSVWTSTNSAAVASKYLKD  119
             K+       K+D  +C AGGW+GGNAS D   K+   M   +++++  SA + +K L  
Sbjct  59   EKINS--KSIKVDTFVCAAGGWSGGNASSDEFLKSVKGMIDMNLYSAFASAHIGAKLLNQ  116

Query  120  GGLLTLTGAQPALQGTSGMIGYGMAKAAVHQLTRSLAGKNSGLPTDAIAVAILPVTLDTP  179
            GGL  LTGA  AL  TSGMI YG  KAA H + + LA +N GLP  + ++ ILPVTLDTP
Sbjct  117  GGLFVLTGASAALNRTSGMIAYGATKAATHHIIKDLASENGGLPAGSTSLGILPVTLDTP  176

Query  180  MNRKWMPKADFGTWTPLSEVAGLFHKW-TQGKERPNSGALVQLITKDGVT  228
             NRK+M  A+F  WTPLSEVA    +W T    RP +G+LV+  TK  VT
Sbjct  177  TNRKYMSDANFDDWTPLSEVAEKLFEWSTNSDSRPTNGSLVKFETKSKVT  226


>DHS3_CAEEL unnamed protein product
Length=309

 Score = 29.6 bits (65),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 32/151 (21%), Positives = 62/151 (41%), Gaps = 12/151 (8%)

Query  38   EEADASIVLPRELSWEQQEAEVLTKVGDALSGE--KLDAVICVAGGWAGGNASKDLAKNT  95
            +E +A  V  +  + +  E + + +  D +  E  K+D ++  AG   G    K L +  
Sbjct  83   KELEAMGVEAKAYTVDLSEYKEINRTADLVKSEVGKVDILVNNAGIVTG----KKLLQCP  138

Query  96   DLMWRQSVWTSTNSAAVASKYLKDG------GLLTLTGAQPALQGTSGMIGYGMAKAAVH  149
            D +  ++V  +TN+    +K    G      G +    +     G +G++ Y  +K    
Sbjct  139  DELMVKTVSVNTNALFFTTKNFLPGMLESNKGHIVTIASMAGKCGVAGLVDYCASKHGAV  198

Query  150  QLTRSLAGKNSGLPTDAIAVAILPVTLDTPM  180
                SLA +   L  D     + P+ ++T M
Sbjct  199  GFNDSLASELYALKKDVKTTVVCPIYINTGM  229


>DHRS4_CAEEL unnamed protein product
Length=260

 Score = 28.9 bits (63),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 21/64 (33%), Positives = 31/64 (48%), Gaps = 4/64 (6%)

Query  120  GGLLTLTGAQPALQGTSGMIGYGMAKAAVHQLTRSLAGKNSGLPTDAIAV-AILPVTLDT  178
            GG +    +  A +   G+  YG+ K  +  LTR+LA    GL  D I V  I P  + T
Sbjct  140  GGAIIFNASYSAYKSPPGIAAYGVTKTTLVGLTRALA---MGLAKDNIRVNGIAPGVIKT  196

Query  179  PMNR  182
             M++
Sbjct  197  KMSQ  200



Lambda      K        H
   0.320    0.136    0.408 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2184764352


Query= XP_014085160.1 PREDICTED: probable cytochrome P450 6g2 [Bactrocera
oleae]

Length=457
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CP6G2_DROME  unnamed protein product                                  369     1e-123
CP6G1_DROME  unnamed protein product                                  326     1e-106
CP6W1_DROME  unnamed protein product                                  281     3e-89 


>CP6G2_DROME unnamed protein product
Length=519

 Score = 369 bits (948),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 180/343 (52%), Positives = 235/343 (69%), Gaps = 4/343 (1%)

Query  115  LEVKEPNALYTTDVIAITAYGIQANSLNDPNGIFRKSGKKIFNFTWLRSMEFKAFFFIPI  174
            LE KE  ALYTTDVIA  AYG+ ANS  DP   FR+ G+ +F F  LR+ EF   FF+P 
Sbjct  178  LEAKELCALYTTDVIATVAYGVSANSFTDPKCEFRRHGRSVFEFNLLRAAEFTLVFFLPH  237

Query  175  MVKIFRFKVFSKEASSFLRETIKHVMEERIKRGNVRNDLIDILIKFKQEAEEELREG-KK  233
            +V   RFKV   EA+ FLR+TI +VM ER K G  RNDLIDILI+F++  +     G K 
Sbjct  238  LVPFVRFKVVPAEATRFLRKTINYVMSEREKSGQKRNDLIDILIEFRRSTQLAKASGIKD  297

Query  234  PFILEKDALAAQAAIFFSAGFETSSATMSFAMFEMAHNPDVQRRLREELCEAYKNNDGKI  293
             F+ E D L AQA +FF+AGFE+SS+TM+FAM+E+A + DVQ+RLREE+ +A   + G++
Sbjct  298  QFVFEGDILVAQAVLFFTAGFESSSSTMAFAMYELAKDTDVQQRLREEIKDALVESGGQV  357

Query  294  TYELIMGLKYMDNVVKEVLRRYPPLPFLDRACTPSANEEGYSLKNFGIDFTIPHNMPVYI  353
            T ++I  L++M  ++ EVLR YPPLPFLDR CT   +   YSL  F   F +P  MPVYI
Sbjct  358  TLKMIESLEFMQMILLEVLRMYPPLPFLDRECTSGRD---YSLAPFHKKFVVPKGMPVYI  414

Query  354  PSQAIHMDPKNFKDPETFNPDRFLPENKNENNMNAYMPFGIGPHNCIGERFAMIQTKLGL  413
            P  A+HMDP+ F  P  F P+RF PEN+  +    YMPFG+GPH CIGERF  +Q K+GL
Sbjct  415  PCYALHMDPQYFPQPRKFLPERFSPENRKLHTPYTYMPFGLGPHGCIGERFGYLQAKVGL  474

Query  414  LYFYRNHYVTTCEKTPLKIHLNPRAIIIQSLGGIELKVVRDPL  456
            +   RNH +TT E+TP ++ L+P+AII Q+ GGI L++VRD L
Sbjct  475  VNLLRNHMITTSERTPHRMQLDPKAIITQAKGGIHLRLVRDAL  517


 Score = 61.2 bits (147),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 41/73 (56%), Gaps = 3/73 (4%)

Query  21  ILATLAFICFALYIWLQYQYSYWRRHRMPYIEPTMIFGNLKGIINSEADPCAWFQHLYNH  80
           ++A+L  I F   + LQ  YSYWRR  +  I P  I GNL G++N    P  +   LYNH
Sbjct  8   LVASLIGIAF---LALQQHYSYWRRMGVREIRPKWIVGNLMGLLNMRMSPAEFISQLYNH  64

Query  81  EKAKNHAAVGIYV  93
             A+N   VGI+V
Sbjct  65  PDAENEPFVGIHV  77


>CP6G1_DROME unnamed protein product
Length=524

 Score = 326 bits (836),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 162/351 (46%), Positives = 229/351 (65%), Gaps = 3/351 (1%)

Query  107  DAKTNSTILEVKEPNALYTTDVIAITAYGIQANSLNDPNGIFRKSGKKIFNFTWLRSMEF  166
            +  + S I E+KE  A ++TD IA  A+GI+ANSL +PN  FR  G+K+F FT  R+ +F
Sbjct  169  EKNSGSFITEIKEICAQFSTDSIATIAFGIRANSLENPNAEFRNYGRKMFTFTVARAKDF  228

Query  167  KAFFFIPIMVKIFRFKVFSKEASSFLRETIKHVMEERIKRGNVRNDLIDILIKFKQEAEE  226
               FF+P +V + R + F+ + S F+R TI HVMEER + G +RNDLID+L+  ++EA  
Sbjct  229  FVAFFLPKLVSLMRIQFFTADFSHFMRSTIGHVMEERERSGLLRNDLIDVLVSLRKEAAA  288

Query  227  ELREGKKPFILEKDALAAQAAIFFSAGFETSSATMSFAMFEMAHNPDVQRRLREELCEAY  286
            E    K  +   +D L AQA +FF+AGFETSS+TMSFA++EMA +P++Q+RLR+E+ EA 
Sbjct  289  E--PSKPHYAKNQDFLVAQAGVFFTAGFETSSSTMSFALYEMAKHPEMQKRLRDEINEAL  346

Query  287  KNNDGKITYELIMGLKYMDNVVKEVLRRYPPLPFLDRACTPSANEEGYSLKNFGIDFTIP  346
                G ++YE I  L+Y+  VV EVLR YP LPFLDR       +   SLK F  D+T+ 
Sbjct  347  VEGGGSLSYEKIQSLEYLAMVVDEVLRMYPVLPFLDREYESVEGQPDLSLKPF-YDYTLE  405

Query  347  HNMPVYIPSQAIHMDPKNFKDPETFNPDRFLPENKNENNMNAYMPFGIGPHNCIGERFAM  406
            +  PV+IP  A+H DPK + +P  F+P+RF P N+      AY PFG GPHNCIG R  +
Sbjct  406  NGTPVFIPIYALHHDPKYWTNPSQFDPERFSPANRKNIVAMAYQPFGSGPHNCIGSRIGL  465

Query  407  IQTKLGLLYFYRNHYVTTCEKTPLKIHLNPRAIIIQSLGGIELKVVRDPLF  457
            +Q+KLGL+   +NH V  CE T   +  +P+  ++Q+ GGI L++V D L+
Sbjct  466  LQSKLGLVSLLKNHSVRNCEATMKDMKFDPKGFVLQADGGIHLEIVNDRLY  516


 Score = 40.4 bits (93),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 40/75 (53%), Gaps = 0/75 (0%)

Query  18  LTEILATLAFICFALYIWLQYQYSYWRRHRMPYIEPTMIFGNLKGIINSEADPCAWFQHL  77
           LTE+L  +     ALY W Q  +SYW+R  +PYI PT I GN K +   E         +
Sbjct  3   LTEVLFVVVAALVALYTWFQRNHSYWQRKGIPYIPPTPIIGNTKVVFKMENSFGMHLSEI  62

Query  78  YNHEKAKNHAAVGIY  92
           YN  + K+ A VGIY
Sbjct  63  YNDPRLKDEAVVGIY  77


>CP6W1_DROME unnamed protein product
Length=514

 Score = 281 bits (718),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 138/341 (40%), Positives = 220/341 (65%), Gaps = 4/341 (1%)

Query  111  NSTILEVKEPNALYTTDVIAITAYGIQANSLNDPNGIFRKSGKKIFNFTWLRSMEFKAFF  170
            + T ++VK+  + +TTD+IA  A+G++AN+L D    F    + IF+ T  R ++F   F
Sbjct  166  SGTEVQVKDLCSRFTTDLIATIAFGVEANALQDAKSEFFYHNRAIFSLTLSRGIDFAIIF  225

Query  171  FIPIMVKIFRFKVFSKEASSFLRETIKHVMEERIKRGNVRNDLIDILIKFKQEAEEELRE  230
             IP +  + R K+FS+E + F+R ++ +V++ER + G  RNDLIDIL+  K+EA      
Sbjct  226  MIPALASLARVKLFSRETTKFIRSSVNYVLKERERTGEKRNDLIDILLALKREAAAN--P  283

Query  231  GKKPFILEKDALAAQAAIFFSAGFETSSATMSFAMFEMAHNPDVQRRLREELCEAYKNND  290
            GK    ++ D L AQAA+F +AGFETS++TM+  ++E+A N  +Q RLR+E+ + + + D
Sbjct  284  GKMSKEVDLDYLVAQAAVFQTAGFETSASTMTMTLYELAKNEALQDRLRQEIVDFFGDED  343

Query  291  GKITYELIMGLKYMDNVVKEVLRRYPPLPFLDRACTPSANEEGYSLKNFGIDFTIPHNMP  350
              I+YE I  + Y+  VV E LR+YP + +++R C+  A  E ++L+ F  +  +PH M 
Sbjct  344  -HISYERIQEMPYLSQVVNETLRKYPIVGYIERECSQPAEGERFTLEPFH-NMELPHGMS  401

Query  351  VYIPSQAIHMDPKNFKDPETFNPDRFLPENKNENNMNAYMPFGIGPHNCIGERFAMIQTK  410
            +Y+ + A+H DP+ + DPE ++P+RF   N++  NM+AYMPFG+GP NCIG R  ++Q+K
Sbjct  402  IYMSTVAVHRDPQYWPDPEKYDPERFNSSNRDNLNMDAYMPFGVGPRNCIGMRLGLLQSK  461

Query  411  LGLLYFYRNHYVTTCEKTPLKIHLNPRAIIIQSLGGIELKV  451
            LGL++  RNH   TC+KT  KI   P + ++ S   I L+V
Sbjct  462  LGLVHILRNHRFHTCDKTIKKIEWAPTSPVMASKRDIILRV  502


 Score = 36.6 bits (83),  Expect = 0.047, Method: Compositional matrix adjust.
 Identities = 16/67 (24%), Positives = 29/67 (43%), Gaps = 0/67 (0%)

Query  28  ICFALYIWLQYQYSYWRRHRMPYIEPTMIFGNLKGIINSEADPCAWFQHLYNHEKAKNHA  87
           +    YIW +   S+W RH + YI P  + G  +  + ++       Q  +     +N  
Sbjct  10  LTIVFYIWQRRTLSFWERHGVKYIRPFPVVGCTREFLTAKVPFFEQIQKFHEAPGFENEP  69

Query  88  AVGIYVA  94
            VG+Y+ 
Sbjct  70  FVGVYMT  76



Lambda      K        H
   0.320    0.136    0.408 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2184764352


Query= XP_014085161.1 PREDICTED: uncharacterized protein LOC106614126
[Bactrocera oleae]

Length=1600
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7KN04_DROME  unnamed protein product                                 335     1e-98
Q19305_CAEEL  unnamed protein product                                 269     2e-75
Q95S22_DROME  unnamed protein product                                 158     6e-41


>Q7KN04_DROME unnamed protein product
Length=763

 Score = 335 bits (860),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 196/569 (34%), Positives = 285/569 (50%), Gaps = 63/569 (11%)

Query  5    LHLLFVFLFIRDSWEICDRRPQGATD-ERSAVDENFQVLIEGNPKTYIPGQSYNISL-SV  62
            + L+ V          C R P       R+  D  +++++   P  Y+PG++YN+ L   
Sbjct  9    IRLIVVIWLTISMVTACPRAPTHLNHGRRTRGDNGYKLIVADGPNGYVPGKTYNLLLLGS  68

Query  63   DVALK---FLSFTLVVESEDDNIRP---TPDTVGYFELIDKAETRFSTQCENMIESTNAN  116
               LK   F  FT+  E+     RP   +P  VG F+L   + T+F+ +C N +   +  
Sbjct  69   RTHLKVQHFTHFTITAEAHTGARRPQAASPRRVGRFQLFSDSLTQFNDRCVNTVSEADDL  128

Query  117  TKVRVSVGWVAP--NGGCVLIKAAVLQHRSVWYIDDGFLTKRICAEEIDEVNSQTPALDV  174
             K  V V WVAP    GCV + A V +    W+ DDG L+  IC  + D   +Q      
Sbjct  129  PKTEVQVMWVAPESGSGCVSLSAMVYEGPRAWFADDGNLSTVICERKPDAAAAQ----KE  184

Query  175  CCACDEAKYELIVERKWGRNTHPHDFPAESWRTRFSELIGASHTQDYRFWQYGELASRGL  234
            CCACDEAKY  + E  W   THP D+P   W T FS++IGASH  ++ FW    +A+ G 
Sbjct  185  CCACDEAKYSFVFEGIWSNETHPKDYPFAIWLTHFSDVIGASHESNFSFWGENHIATAGF  244

Query  235  QEMAEHGATRLLEMEIKSGN--VRTIIKAPGIIYRQNTASTTLANVRVDRENHVISLVSK  292
            + +AE G+   LE E+++    +RT+IKA G+ Y  N    T +  RVDR++  +SLVS 
Sbjct  245  RSLAEWGSPAALETELRANGPKLRTLIKAAGLWY-PNVNQNTSSKFRVDRKHPKVSLVSM  303

Query  293  IEPSPDWILGVAGLELCLENCTWVNEKVLNLYPWDIGTDAGPSYMSPDQPQKPPDVVRRI  352
              PSPDW++G++GL+LC E+C+W      +L+PWD GTD+G SYMSP+   +PP+ + RI
Sbjct  304  FGPSPDWVVGISGLDLCTEDCSWKESMDFDLFPWDAGTDSGISYMSPNSETQPPERMYRI  363

Query  353  TSTSPNDQRSPFYEETGKPMKALATLYVRRKKLYERECDSGEVMPL--------------  398
            T+  P D R+PFY    + M  LA LY+RR+K+  R CD   +  L              
Sbjct  364  TTMYPEDPRAPFYNPKSREMTPLAKLYLRREKIVSRNCDDEFLQALQLEVSDDAEEQDTR  423

Query  399  -ECATHPWSTWSECTTRCGPGTQYRTRAYKDPDLAASFSCQVVLRQAQKCIGEQCRIP--  455
             EC    +S WS C+  CG G + R+R Y  P  A    C   L   + C+     IP  
Sbjct  424  AECRVGDYSAWSPCSVSCGKGIRMRSRQYLYPAAADQNKCARQLVAKEMCVAA---IPEC  480

Query  456  --------DVEPDETE---------------AAGCELTPWSTWSVCSRRCGRGHMTRSRE  492
                    D + DE E               A  C+ +PWS WS CS  CG G   R+R 
Sbjct  481  ADGPAQSKDRDDDEGENLANSQSLVGSNGEGAGLCKTSPWSVWSECSASCGIGITMRTRT  540

Query  493  YLNPYEREQCLNDNPVELEQRRDCDARDC  521
            ++N   R++C +   + + ++  C   DC
Sbjct  541  FVNHLGRKRCPH---ITIVEKNKCMRPDC  566


 Score = 300 bits (769),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 153/409 (37%), Positives = 222/409 (54%), Gaps = 24/409 (6%)

Query  851   RFISFKLALESKDG----NPSLTQDLGHFELIDPVETRYSPNCVNMVESTNTNPKTRIDV  906
              F  F +  E+  G      +  + +G F+L     T+++  CVN V   +  PKT + V
Sbjct  76    HFTHFTITAEAHTGARRPQAASPRRVGRFQLFSDSLTQFNDRCVNTVSEADDLPKTEVQV  135

Query  907   MWVAPDKPGSGCILIRTTLLQHRDVWYMDDGGLTRSICEESTDEVESAPLSENQNKCCAC  966
             MWVAP+  GSGC+ +   + +    W+ DDG L+  ICE   D   +      Q +CCAC
Sbjct  136   MWVAPES-GSGCVSLSAMVYEGPRAWFADDGNLSTVICERKPDAAAA------QKECCAC  188

Query  967   DEARYELTFKSTWSRNHHPKDFPTKGWITRFSDIIGASHTEDYRFWEYAQLASQGMKEFA  1026
             DEA+Y   F+  WS   HPKD+P   W+T FSD+IGASH  ++ FW    +A+ G +  A
Sbjct  189   DEAKYSFVFEGIWSNETHPKDYPFAIWLTHFSDVIGASHESNFSFWGENHIATAGFRSLA  248

Query  1027  EHGAAQTLEREFSYNFKKGKIRTIIKARGPAFPNLNGQSVASIRADPQHHLLSLASKIDP  1086
             E G+   LE E   N    K+RT+IKA G  +PN+N  + +  R D +H  +SL S   P
Sbjct  249   EWGSPAALETELRAN--GPKLRTLIKAAGLWYPNVNQNTSSKFRVDRKHPKVSLVSMFGP  306

Query  1087  SPDWIVGVSGLELCMSNCTWLERKTVTLYPWDVGTDAGPSYTSPDQPQIPAAVIQRMRSD  1146
             SPDW+VG+SGL+LC  +C+W E     L+PWD GTD+G SY SP+    P   + R+ + 
Sbjct  307   SPDWVVGISGLDLCTEDCSWKESMDFDLFPWDAGTDSGISYMSPNSETQPPERMYRITTM  366

Query  1147  MPNDPRSPFFDDKGGKMKPLAILDIKRQRLYERLCEDEESNNL-----------DVPREC  1195
              P DPR+PF++ K  +M PLA L ++R+++  R C+DE    L           D   EC
Sbjct  367   YPEDPRAPFYNPKSREMTPLAKLYLRREKIVSRNCDDEFLQALQLEVSDDAEEQDTRAEC  426

Query  1196  FTHPWTAWTECTSKCGEGRQFRTRVYKQPDLADIFKCEVETRQDRTCMG  1244
                 ++AW+ C+  CG+G + R+R Y  P  AD  KC  +      C+ 
Sbjct  427   RVGDYSAWSPCSVSCGKGIRMRSRQYLYPAAADQNKCARQLVAKEMCVA  475


 Score = 70.9 bits (172),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 59/119 (50%), Gaps = 8/119 (7%)

Query  400  CATHPWSTWSECTTRCGPGTQYRTRAYKDPDLAASFSCQVVLRQAQKCIGEQCRIPDVEP  459
            C T PWS WSEC+  CG G   RTR + +  L       + + +  KC+   C    VE 
Sbjct  515  CKTSPWSVWSECSASCGIGITMRTRTFVN-HLGRKRCPHITIVEKNKCMRPDCTYEQVEL  573

Query  460  DETEAAGCELTPWSTWSVCSRRCGRGHMTRSREYL--NPYEREQCLNDNPVELEQRRDC  516
             + +   C  + WS WS CS  CGRG   R+R  L  N  ++E C     +EL Q+++C
Sbjct  574  PDPQ---CPTSQWSDWSPCSSTCGRGVTIRTRLLLLENGPDKESCTQR--MELHQQKEC  627


 Score = 38.5 bits (88),  Expect = 0.046, Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 18/27 (67%), Gaps = 0/27 (0%)

Query  1195  CFTHPWTAWTECTSKCGEGRQFRTRVY  1221
             C T PW+ W+EC++ CG G   RTR +
Sbjct  515   CKTSPWSVWSECSASCGIGITMRTRTF  541


 Score = 34.3 bits (77),  Expect = 0.91, Method: Compositional matrix adjust.
 Identities = 17/52 (33%), Positives = 26/52 (50%), Gaps = 2/52 (4%)

Query  1194  ECFTHPWTAWTECTSKCGEGRQFRTRVYKQPDLADIFKC--EVETRQDRTCM  1243
             +C T  W+ W+ C+S CG G   RTR+    +  D   C   +E  Q + C+
Sbjct  577   QCPTSQWSDWSPCSSTCGRGVTIRTRLLLLENGPDKESCTQRMELHQQKECV  628


 Score = 33.5 bits (75),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 16/26 (62%), Gaps = 0/26 (0%)

Query  399  ECATHPWSTWSECTTRCGPGTQYRTR  424
            +C T  WS WS C++ CG G   RTR
Sbjct  577  QCPTSQWSDWSPCSSTCGRGVTIRTR  602


 Score = 32.7 bits (73),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 18/63 (29%), Positives = 27/63 (43%), Gaps = 2/63 (3%)

Query  1186  SNNLDVPRECFTHPWTAWTECTSKCGEG-RQFRTRVYKQPDLADIFKCEVETRQDRTCMG  1244
             S+ +D PR C    W+ W+ C+  CG G  + R  V  +P       C     + R+C  
Sbjct  702   SSRVDQPRACVLSDWSVWSPCSVSCGVGVSESRRYVVTEPQNGGQ-PCSKRLVKSRSCAM  760

Query  1245  EEC  1247
               C
Sbjct  761   PAC  763


 Score = 31.6 bits (70),  Expect = 6.5, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 18/29 (62%), Gaps = 1/29 (3%)

Query  466  GCELTPWSTWSVCSRRCGRGHMTRSREYL  494
             C L+ WS WS CS  CG G ++ SR Y+
Sbjct  710  ACVLSDWSVWSPCSVSCGVG-VSESRRYV  737


>Q19305_CAEEL unnamed protein product
Length=819

 Score = 269 bits (688),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 157/534 (29%), Positives = 271/534 (51%), Gaps = 55/534 (10%)

Query  21   CDRRPQGATDERSAVDENFQVLIEGN-------PKTYIPGQSYNISL----SVDVALKFL  69
            C  +P  A  ++S     + + I G         K ++PG+ Y +S+    +      F 
Sbjct  27   CTIKPYEAKGDKSPGSNGYVIEINGTTTKSMDISKGFVPGEIYKVSIRGWRTQYTVKTFR  86

Query  70   SFTLVVESEDDNIRPTPDTVGYFELID-KAETRFSTQC-ENMIESTNANTKVRVSVGWVA  127
             F +    ED+       + G ++++    + R S  C ++ +   N  +K  V + W A
Sbjct  87   GFVVSSLFEDNT------SAGSWQVVKGHGDARISPGCRQSGVSHANLKSKTSVHMMWKA  140

Query  128  P--NGGCVLIKAAVLQHRSVWYIDDGFLTKRICAEEIDEVNSQTPALD---VCCACDEAK  182
            P  + GCV+ +A+V++ + +W+ +   LT ++C ++  ++    P  D    CCACD A+
Sbjct  141  PEVSSGCVVFRASVIETKYIWFTEAEGLTVKLCIQKGTQI--LKPVDDPSATCCACDIAQ  198

Query  183  YELIVERKWGRNTHPHDFPAESWRTRFSELIGASHTQDYRFWQYGELASRGLQEMAEHGA  242
            Y+L     W +NTHP D+P     T F++++G+SH+ +Y  W  G +++ G++E+AE G 
Sbjct  199  YDLEFTGIWSKNTHPKDYPTLEHLTHFTDMLGSSHSSNYSLWTIGGISTDGMKEIAEWGN  258

Query  243  T--RLLEMEIKSGNVRTIIKAPGIIYRQNTASTTLANVRVDRENHVISLVSKIEPSPDWI  300
            T     E + K+  VR+++K  G+ +  +   TT +   V++ +H +SL +   PSPDW 
Sbjct  259  TYKAEAEAKAKASEVRSLMKVKGLWF-PDVQGTTKSQFVVNKYHHFVSLATMFGPSPDWC  317

Query  301  LGVAGLELCLENCTWVNEKVLNLYPWDIGTDAGPSYMSPDQPQKPPDVVRRITSTSPNDQ  360
            +G++ + LCL +CTW  E+   L P+D GTD+GP+YMSP++P +P + +  IT+    + 
Sbjct  318  VGLSSVNLCLPDCTWAEERTFELQPFDAGTDSGPTYMSPNEPTEPREPIHWITTKL--NP  375

Query  361  RSPFYEETGKPMKALATLYVRRKKLYERECDSGEVMPL------------------ECAT  402
             SPFY      +  LA + +RRK +   EC S +++                    EC  
Sbjct  376  LSPFYNSKSDTIPTLAKVILRRKNVTSSECKSDDILKAEAHNITNTSEDEEYKDRRECMM  435

Query  403  HPWSTWSECTTRCGPGTQYRTRAYKDPDLAASFSCQVVLRQAQKCIGEQCRIPDVEPDET  462
              W  WS C+  CG G + R+R Y  P  A  F C     + Q C     +I + E  E 
Sbjct  436  TQWEPWSLCSATCGKGIRIRSRVYVFPIKAQVFHCHRQTTEKQFC---NAKINECENSEA  492

Query  463  EAAGCELTPWSTWSVCSRRCGRGHMTRSREYLNPYEREQCLNDNPVELEQRRDC  516
             ++ C+++ W +W  CS +CG G  +R+R +LNP  +     D  V+LE++  C
Sbjct  493  FSSKCQVSSWGSWGECSVQCGHGMRSRNRTFLNPATKS---GDCSVDLERKDIC  543


 Score = 258 bits (660),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 128/376 (34%), Positives = 214/376 (57%), Gaps = 21/376 (6%)

Query  882   ETRYSPNC-VNMVESTNTNPKTRIDVMWVAPDKPGSGCILIRTTLLQHRDVWYMDDGGLT  940
             + R SP C  + V   N   KT + +MW AP+   SGC++ R ++++ + +W+ +  GLT
Sbjct  111   DARISPGCRQSGVSHANLKSKTSVHMMWKAPEV-SSGCVVFRASVIETKYIWFTEAEGLT  169

Query  941   RSICEESTDEVESAPLSENQNKCCACDEARYELTFKSTWSRNHHPKDFPTKGWITRFSDI  1000
               +C +   ++   P+ +    CCACD A+Y+L F   WS+N HPKD+PT   +T F+D+
Sbjct  170   VKLCIQKGTQILK-PVDDPSATCCACDIAQYDLEFTGIWSKNTHPKDYPTLEHLTHFTDM  228

Query  1001  IGASHTEDYRFWEYAQLASQGMKEFAEHGAAQTLEREFSYNFKKGKIRTIIKARGPAFPN  1060
             +G+SH+ +Y  W    +++ GMKE AE G   T + E     K  ++R+++K +G  FP+
Sbjct  229   LGSSHSSNYSLWTIGGISTDGMKEIAEWG--NTYKAEAEAKAKASEVRSLMKVKGLWFPD  286

Query  1061  LNGQSVASIRADPQHHLLSLASKIDPSPDWIVGVSGLELCMSNCTWLERKTVTLYPWDVG  1120
             + G + +    +  HH +SLA+   PSPDW VG+S + LC+ +CTW E +T  L P+D G
Sbjct  287   VQGTTKSQFVVNKYHHFVSLATMFGPSPDWCVGLSSVNLCLPDCTWAEERTFELQPFDAG  346

Query  1121  TDAGPSYTSPDQPQIPAAVIQRMRSDMPNDPRSPFFDDKGGKMKPLAILDIKRQRLYERL  1180
             TD+GP+Y SP++P  P   I  + + +  +P SPF++ K   +  LA + ++R+ +    
Sbjct  347   TDSGPTYMSPNEPTEPREPIHWITTKL--NPLSPFYNSKSDTIPTLAKVILRRKNVTSSE  404

Query  1181  CEDE-----ESNNLDVP---------RECFTHPWTAWTECTSKCGEGRQFRTRVYKQPDL  1226
             C+ +     E++N+            REC    W  W+ C++ CG+G + R+RVY  P  
Sbjct  405   CKSDDILKAEAHNITNTSEDEEYKDRRECMMTQWEPWSLCSATCGKGIRIRSRVYVFPIK  464

Query  1227  ADIFKCEVETRQDRTC  1242
             A +F C  +T + + C
Sbjct  465   AQVFHCHRQTTEKQFC  480


 Score = 74.3 bits (181),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 72/150 (48%), Gaps = 10/150 (7%)

Query  389  ECDSGEVMPLECATHPWSTWSECTTRCGPGTQYRTRAYKDPDLAASFSCQVVLRQAQKCI  448
            EC++ E    +C    W +W EC+ +CG G + R R + +P    S  C V L +   C+
Sbjct  486  ECENSEAFSSKCQVSSWGSWGECSVQCGHGMRSRNRTFLNP-ATKSGDCSVDLERKDICV  544

Query  449  GEQCRIPDVEPDETEAAGCELTPWSTWSVCSRRCGRGHMTRSREYLNPYEREQCLNDNPV  508
            GE     +V PD      C+ T WS WS CS  C  G   R+R +      ++C++   V
Sbjct  545  GENGDDCNVTPDPL----CKTTAWSDWSPCSASCDEGVRVRTRLFFYSEHEKRCMH---V  597

Query  509  ELEQRRDCDARDCGARRTQQDRDEDVDEND  538
             L+++  C  + C  RR  +   E++ + D
Sbjct  598  NLQEKDTCVMQSC--RRFIEINSEEICQED  625


 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/91 (29%), Positives = 36/91 (40%), Gaps = 9/91 (10%)

Query  398  LECATHPWSTWSECTTRCGPGTQYRTRAYKDPDLAASFSCQVVLRQAQKCIGEQCRIPDV  457
            ++C    W+ W  C+  CG G + R+R            C   L Q  +C    C +   
Sbjct  704  VDCEVSKWTAWGSCSVSCGRGKKSRSRHVVKLARNGGHQCSEHLMQELQCRLRPCPV---  760

Query  458  EPDETEAAGCELTPWSTWSVCSRRCGRGHMT  488
                     C++ PWS WS CS  CG G  T
Sbjct  761  ------KLTCQVGPWSRWSPCSVSCGEGSQT  785


 Score = 38.9 bits (89),  Expect = 0.037, Method: Compositional matrix adjust.
 Identities = 24/71 (34%), Positives = 30/71 (42%), Gaps = 6/71 (8%)

Query  460  DETEAAGCELTPWSTWSVCSRRCGRGHMTRSREYLNPYER--EQCLNDNPVELEQRRDCD  517
            D  E   CE++ W+ W  CS  CGRG  +RSR  +        QC       L Q   C 
Sbjct  699  DGGERVDCEVSKWTAWGSCSVSCGRGKKSRSRHVVKLARNGGHQCSE----HLMQELQCR  754

Query  518  ARDCGARRTQQ  528
             R C  + T Q
Sbjct  755  LRPCPVKLTCQ  765


 Score = 37.0 bits (84),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 21/81 (26%), Positives = 35/81 (43%), Gaps = 4/81 (5%)

Query  1168  ILDIKRQRLYERLCE---DEESNNLDVPRECFTHPWTAWTECTSKCGEGRQFRTRVYKQP  1224
             +    RQ   ++ C    +E  N+     +C    W +W EC+ +CG G + R R +  P
Sbjct  467   VFHCHRQTTEKQFCNAKINECENSEAFSSKCQVSSWGSWGECSVQCGHGMRSRNRTFLNP  526

Query  1225  DLADIFKCEVETRQDRTCMGE  1245
                    C V+  +   C+GE
Sbjct  527   ATKS-GDCSVDLERKDICVGE  546


 Score = 37.0 bits (84),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 54/131 (41%), Gaps = 28/131 (21%)

Query  730  FRNYWFYDADERQCQIFTTNNCDENKNKFRTLSACEGTC---------LLPHSLYLSQPG  780
            F  YW Y+ ++ QC+ F    C  N+N+F T   C+  C         L+P++  L   G
Sbjct  635  FPRYW-YNHEKTQCERFIFTGCKGNRNQFETEEECKQICLPGYEKSKSLIPNNQLLEDFG  693

Query  781  QDEDND---------NRWSRQFGESASLVKKRKKKSGRKNRKRKQKDYVGNIRNYSHKFR  831
              E +D         ++W+     S S  +      G+K+R R     V   RN  H+  
Sbjct  694  NTEVDDGGERVDCEVSKWTAWGSCSVSCGR------GKKSRSRH---VVKLARNGGHQCS  744

Query  832  SEFVREYLCEI  842
               ++E  C +
Sbjct  745  EHLMQELQCRL  755


 Score = 32.7 bits (73),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 38/73 (52%), Gaps = 5/73 (7%)

Query  1180  LCEDEESNNLDVPRE--CFTHPWTAWTECTSKCGEGRQFRTRVYKQPDLADIFKC-EVET  1236
             +C  E  ++ +V  +  C T  W+ W+ C++ C EG + RTR++   +     +C  V  
Sbjct  542   ICVGENGDDCNVTPDPLCKTTAWSDWSPCSASCDEGVRVRTRLFFYSEHEK--RCMHVNL  599

Query  1237  RQDRTCMGEECGR  1249
             ++  TC+ + C R
Sbjct  600   QEKDTCVMQSCRR  612


>Q95S22_DROME unnamed protein product
Length=461

 Score = 158 bits (400),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 92/267 (34%), Positives = 132/267 (49%), Gaps = 46/267 (17%)

Query  295  PSPDWILGVAGLELCLENCTWVNEKVLNLYPWDIGTDAGPSYMSPDQPQKPPDVVRRITS  354
            PSPDW++G++GL+LC E+C+W      +L+PWD GTD+G SYMSP+   +PP+ + RIT+
Sbjct  4    PSPDWVVGISGLDLCTEDCSWKESMDFDLFPWDAGTDSGISYMSPNSETQPPERMYRITT  63

Query  355  TSPNDQRSPFYEETGKPMKALATLYVRRKKLYERECDSGEVMPL---------------E  399
              P D R+PFY    + M  LA LY+RR+K+  R CD   +  L               E
Sbjct  64   MYPEDPRAPFYNPKSREMTPLAKLYLRREKIVSRNCDDEFLQALQLEVSDDAEEQDTRAE  123

Query  400  CATHPWSTWSECTTRCGPGTQYRTRAYKDPDLAASFSCQVVLRQAQKCIGEQCRIP----  455
            C    +S WS C+  CG G + R+R Y  P  A    C   L   + C+     IP    
Sbjct  124  CRVGDYSAWSPCSVSCGKGIRMRSRQYLYPAAADQNKCARQLVAKEMCVAA---IPECAD  180

Query  456  ------DVEPDETE---------------AAGCELTPWSTWSVCSRRCGRGHMTRSREYL  494
                  D + DE E               A  C+ +PWS WS CS  CG G   R+R ++
Sbjct  181  GPAQSKDRDDDEGENLANSQSLVGSNGEGAGLCKTSPWSVWSECSASCGIGITMRTRTFV  240

Query  495  NPYEREQCLNDNPVELEQRRDCDARDC  521
            N   R++C +   + + ++  C   DC
Sbjct  241  NHLGRKRCPH---ITIVEKNKCMRPDC  264


 Score = 130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/170 (38%), Positives = 95/170 (56%), Gaps = 11/170 (6%)

Query  1086  PSPDWIVGVSGLELCMSNCTWLERKTVTLYPWDVGTDAGPSYTSPDQPQIPAAVIQRMRS  1145
             PSPDW+VG+SGL+LC  +C+W E     L+PWD GTD+G SY SP+    P   + R+ +
Sbjct  4     PSPDWVVGISGLDLCTEDCSWKESMDFDLFPWDAGTDSGISYMSPNSETQPPERMYRITT  63

Query  1146  DMPNDPRSPFFDDKGGKMKPLAILDIKRQRLYERLCEDEESNNL-----------DVPRE  1194
               P DPR+PF++ K  +M PLA L ++R+++  R C+DE    L           D   E
Sbjct  64    MYPEDPRAPFYNPKSREMTPLAKLYLRREKIVSRNCDDEFLQALQLEVSDDAEEQDTRAE  123

Query  1195  CFTHPWTAWTECTSKCGEGRQFRTRVYKQPDLADIFKCEVETRQDRTCMG  1244
             C    ++AW+ C+  CG+G + R+R Y  P  AD  KC  +      C+ 
Sbjct  124   CRVGDYSAWSPCSVSCGKGIRMRSRQYLYPAAADQNKCARQLVAKEMCVA  173


 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 59/120 (49%), Gaps = 10/120 (8%)

Query  400  CATHPWSTWSECTTRCGPGTQYRTRAYKDPDLAASFSCQVVLRQAQKCIGEQCRIPDVE-  458
            C T PWS WSEC+  CG G   RTR + +  L       + + +  KC+   C    VE 
Sbjct  213  CKTSPWSVWSECSASCGIGITMRTRTFVN-HLGRKRCPHITIVEKNKCMRPDCTYEQVEL  271

Query  459  PDETEAAGCELTPWSTWSVCSRRCGRGHMTRSREYL--NPYEREQCLNDNPVELEQRRDC  516
            PD      C  + WS WS CS  CGRG   R+R  L  N  ++E C     +EL Q+++C
Sbjct  272  PDPQ----CPTSQWSDWSPCSSTCGRGVTIRTRLLLLENGPDKESCTQR--MELHQQKEC  325


 Score = 38.5 bits (88),  Expect = 0.042, Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 18/27 (67%), Gaps = 0/27 (0%)

Query  1195  CFTHPWTAWTECTSKCGEGRQFRTRVY  1221
             C T PW+ W+EC++ CG G   RTR +
Sbjct  213   CKTSPWSVWSECSASCGIGITMRTRTF  239


 Score = 33.9 bits (76),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 17/52 (33%), Positives = 26/52 (50%), Gaps = 2/52 (4%)

Query  1194  ECFTHPWTAWTECTSKCGEGRQFRTRVYKQPDLADIFKC--EVETRQDRTCM  1243
             +C T  W+ W+ C+S CG G   RTR+    +  D   C   +E  Q + C+
Sbjct  275   QCPTSQWSDWSPCSSTCGRGVTIRTRLLLLENGPDKESCTQRMELHQQKECV  326


 Score = 33.1 bits (74),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 16/26 (62%), Gaps = 0/26 (0%)

Query  399  ECATHPWSTWSECTTRCGPGTQYRTR  424
            +C T  WS WS C++ CG G   RTR
Sbjct  275  QCPTSQWSDWSPCSSTCGRGVTIRTR  300


 Score = 32.3 bits (72),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 16/28 (57%), Gaps = 0/28 (0%)

Query  1186  SNNLDVPRECFTHPWTAWTECTSKCGEG  1213
             S+ +D PR C    W+ W+ C+  CG G
Sbjct  400   SSRVDQPRACVLSDWSVWSPCSVSCGVG  427


 Score = 31.2 bits (69),  Expect = 8.4, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 18/29 (62%), Gaps = 1/29 (3%)

Query  466  GCELTPWSTWSVCSRRCGRGHMTRSREYL  494
             C L+ WS WS CS  CG G ++ SR Y+
Sbjct  408  ACVLSDWSVWSPCSVSCGVG-VSESRRYV  435



Lambda      K        H
   0.320    0.136    0.408 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2184764352


Query= XP_014085162.1 PREDICTED: uncharacterized protein LOC106614128
[Bactrocera oleae]

Length=582
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A1Z8P2_DROME  unnamed protein product                                 83.6    1e-16
A1ZA16_DROME  unnamed protein product                                 58.9    7e-09
IR25A_DROME  unnamed protein product                                  37.4    0.043


>A1Z8P2_DROME unnamed protein product
Length=561

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 91/408 (22%), Positives = 171/408 (42%), Gaps = 33/408 (8%)

Query  158  ILYYYSSNRTNELFAYSLYPEYHLVNRSNFLEYLMQTFKRLVAGGMNMLGYKLYTPLRQD  217
            +L Y S  RT   ++   YP Y  +  ++  EY+     R      N++GY L   +  D
Sbjct  136  VLIYNSQQRT---WSIKPYP-YLQIRPTSLKEYIENRNTR------NLMGYPLRVLVTND  185

Query  218  LPHVFSYKNS--TGQTIWRGSAYTLLKFFTDYGNASLVSYEMPEDELGGNVIDMKAALNL  275
             PH F  K+        ++GS  T+LK F D  NA+  +    E             + +
Sbjct  186  PPHCFVDKDELPGSPNRYKGSIVTMLKIFADQLNATFQANPFREFRRYSTA----DCVQM  241

Query  276  IRHKKVDIMAHAYALFKEDDELGKSYPLMVVRWCLMVPIWNSISTMYYPLEPFDDLVWFI  335
            +   ++D      ++F        S P+ + R  +M P  N I   YY   PFD  VW I
Sbjct  242  VSDDEIDACG---SIFIRTYTYATSQPVRLNRVVIMAPFGNPIEKFYYFFRPFDLYVW-I  297

Query  336  IVGVFVALLSV-KCLWCCWQSTH-QLAQRLNDTVLECFCLSIGICTPNYYGAATLLDFLI  393
              G+ V  ++V   L   W      + Q L   V       + +       +++   F++
Sbjct  298  GTGIIVVYIAVMGSLLHRWHFKEWNVGQYLLLAVQTLLNRELSLPQ-----SSSGSKFML  352

Query  394  FTTIYFYGFFLTANYTSLLGSIFTVTLFRTQINTMDELIATNISVMIIDYELE--FLLAD  451
               ++  GF L+  Y +LL  + T  L++  I  + +L A N+++++  + +    +   
Sbjct  353  LLLLFAIGFILSNLYVALLSMMLTTKLYQRPIENLADLKAANVNILLQTHNIRPNSVYGS  412

Query  452  GDQLSANFSRLLLPVDAATFTQHQVQLNTSFAYFITEEKWNFLELQQKYLKQRLFKFTDI  511
             ++L   F    L V+ +   + +  L+ S+AY  +E++ +F   QQK+L++R  K    
Sbjct  413  SEELRERF----LLVEESQHLEKRNGLDPSYAYVDSEDRMDFYLYQQKFLRRRRMKKLSN  468

Query  512  CFGSYHLAYPLQPDYTLYRNLEYYIYRMHSSGMLGHYQSTAFDYAVHA  559
              G       ++ ++ L ++   ++ R   +G+         + AV A
Sbjct  469  PVGYTWAVQVIKQNWVLEKHYNDHVQRFFETGLQNKLVDDVHELAVKA  516


>A1ZA16_DROME unnamed protein product
Length=599

 Score = 58.9 bits (141),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 72/326 (22%), Positives = 144/326 (44%), Gaps = 18/326 (6%)

Query  204  NMLGYKLYTPLRQDLPHVFSYKNS-TGQTIWRGSAYTLLKFFTDYGNASL-VSYEMPEDE  261
            NM G  + T   ++ P    Y +S TG+  ++G    L+  F    NA++ +  ++ +D+
Sbjct  180  NMHGAPIRTLSDKEPPRTIPYIDSKTGEEKFKGYVGMLISQFVKKVNATMQIREDLIKDD  239

Query  262  LGGNVIDMKAALNLIRHKKVDIMAHAYALFKEDDELGKSYPLMVVRWCLMVPIWNSI--S  319
               + +D+    N   +  +DI        +  +    SYP ++  +C M P+ +S+  S
Sbjct  240  EEVSFVDIT---NFTSNDILDIGICEARTLEMSNYDAISYPYLMSSYCFMAPLPDSLPFS  296

Query  320  TMYYPLEPFDDLVWFIIVGVFVALLSVKCLWCCWQSTHQLAQRLNDTVLECFCLSIGICT  379
             +Y  +     L+ F+I+    ++L +      ++S    +  +ND  L  F L+     
Sbjct  297  DVYMAIVAPSILIMFLIIFCICSVLIIYIQERSYRSLTIRSVLMNDICLRGF-LAQPFPF  355

Query  380  PNYYGAATLLDFLIFTTIYFYGFFLTANYTSLLGSIFTVTLFRTQINTMDELIATNISVM  439
            P  Y     L   IF  + F     T  YT+ L +         ++ + D++  +  ++ 
Sbjct  356  PRQYNRKLKL---IFMLVCFSSLISTTMYTAYLQAFLWGPPIEPRLTSFDDVKKSRYTMA  412

Query  440  IIDYELEFLLADGDQLSANFSRLLLPVDAATFTQHQVQLNTSFAYFITEEKWNFLELQQK  499
            I  YE EFL A    L+ +   + +  D   F++ +   NT++ + +T  +W  +  +QK
Sbjct  413  INIYEREFLEA----LNVSLEDVEI-YDYGKFSKLRSTFNTNYLFPVTALQWFTINEEQK  467

Query  500  YLKQRLFKFTD-ICFGSYH-LAYPLQ  523
              K ++F + D  C   +  L+ PL+
Sbjct  468  LFKYKIFYYCDAFCLNQFDILSIPLR  493


>IR25A_DROME unnamed protein product
Length=947

 Score = 37.4 bits (85),  Expect = 0.043, Method: Compositional matrix adjust.
 Identities = 20/65 (31%), Positives = 33/65 (51%), Gaps = 2/65 (3%)

Query  369  ECFCLSIGICTPNYYGAA--TLLDFLIFTTIYFYGFFLTANYTSLLGSIFTVTLFRTQIN  426
            EC    +   TP   G A   L   L+  T + +GF + A+YT+ L +  TV+   T + 
Sbjct  611  ECLWFCMTSLTPQGGGEAPKNLSGRLVAATWWLFGFIIIASYTANLAAFLTVSRLDTPVE  670

Query  427  TMDEL  431
            ++D+L
Sbjct  671  SLDDL  675



Lambda      K        H
   0.320    0.136    0.408 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2184764352


Query= XP_014085163.1 PREDICTED: LOW QUALITY PROTEIN: uncharacterized
protein LOC106614129 [Bactrocera oleae]

Length=414
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A1Z8P2_DROME  unnamed protein product                                 67.8    5e-12
A1ZA17_DROME  unnamed protein product                                 67.4    8e-12
A1ZA16_DROME  unnamed protein product                                 58.9    4e-09


>A1Z8P2_DROME unnamed protein product
Length=561

 Score = 67.8 bits (164),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 75/311 (24%), Positives = 138/311 (44%), Gaps = 18/311 (6%)

Query  94   SYPLYWVKNCIMVPLEDELPKYWYIVWPFGRYIYACLLFGIFYIAILMRYIEYPTNATKP  153
            S P+   +  IM P  + + K++Y   PF  Y++      + YIA++   +         
Sbjct  263  SQPVRLNRVVIMAPFGNPIEKFYYFFRPFDLYVWIGTGIIVVYIAVMGSLLH---RWHFK  319

Query  154  TRSITRNILHSSAIIMFSSNMNVQLKNAHTRVLF-FYMLLFVFGFILAAYHAPYLTAYNM  212
              ++ + +L +   ++   N  + L  + +   F   +LLF  GFIL+  +   L+    
Sbjct  320  EWNVGQYLLLAVQTLL---NRELSLPQSSSGSKFMLLLLLFAIGFILSNLYVALLSMMLT  376

Query  213  KPVFVPPINTVDDLLSANINVLITLTDFAEIKHNSVEHILALSRLLRE----VPXQEFQD  268
              ++  PI  + DL +AN+N+L+   +   I+ NSV      S  LRE    V   +  +
Sbjct  377  TKLYQRPIENLADLKAANVNILLQTHN---IRPNSV---YGSSEELRERFLLVEESQHLE  430

Query  269  VLDKLNRHYAYVVTEDQWNFLNRQQRILIQPYFHLSKICFGTVFKAIPLQRDAVWLETLN  328
              + L+  YAYV +ED+ +F   QQ+ L +          G  +    ++++ V  +  N
Sbjct  431  KRNGLDPSYAYVDSEDRMDFYLYQQKFLRRRRMKKLSNPVGYTWAVQVIKQNWVLEKHYN  490

Query  329  LFILIVRESGLWGQWEERAFNEAVRAKYAQIF-TDTYPVESLNLRFFTIAWIVLASGLLL  387
              +    E+GL  +  +     AV+A +   F T T  +E L L    +A +VL  G  L
Sbjct  491  DHVQRFFETGLQNKLVDDVHELAVKAGFLHFFPTQTQTIEPLRLEDIVMAAMVLGGGHAL  550

Query  388  SSLVFAIEYYV  398
            + + F +E + 
Sbjct  551  AVICFLVELFA  561


>A1ZA17_DROME unnamed protein product
Length=594

 Score = 67.4 bits (163),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 69/312 (22%), Positives = 137/312 (44%), Gaps = 23/312 (7%)

Query  94   SYPLYWVKNCIMVPLEDELPK---YWYIVWPFGRYIYACLLFGIFYI-AILMRYIEYPTN  149
            SYP      C MVPL D +P    Y  IV P        +L  IF I ++++ YI+    
Sbjct  275  SYPYLMTSTCFMVPLPDMMPNSEIYMGIVDP----PVLVVLIAIFCIFSVMLNYIK---Q  327

Query  150  ATKPTRSITRNILHSSAIIMFSSNMNVQLKNAHTRVLFFYMLLFVFGFILAAYHAPYLTA  209
             +  + S+   +L+   +  F +      + ++ ++    ML+  F  I    +  YL +
Sbjct  328  RSWRSLSLVNVLLNDICLRGFLAQPFPFPRQSNRKLKLISMLVCFFSVITTTMYTSYLQS  387

Query  210  YNMKPVFVPPINTVDDLLSANINVLITLTDFAEIK--HNSVEHILALSRLLREVPXQEFQ  267
            +   P   P + +  DL ++   + I   D   ++  + S++H++            + +
Sbjct  388  FMWGPPIDPKMCSFADLENSRYKLAIRRYDIEMLRPFNVSMDHVVVFDE------SSQLE  441

Query  268  DVLDKLNRHYAYVVTEDQWNFLNRQQRILIQPYFHLS-KICFGTV-FKAIPLQRDAVWLE  325
             + D  + +Y Y ++   W+    QQ++   P F+ S K+C   + F + P++R   + +
Sbjct  442  YLRDSFDDNYMYPMSALSWSAFKEQQKLFAFPLFYYSEKLCLKPISFFSFPIRRHLPYRD  501

Query  326  TLNLFILIVRESGLWGQWEERAFNEAVRAKYAQIFTDTYPVESLNLRFFTIAWI--VLAS  383
                 +L   E GL   W +R+F++ VR K A +   + P     +    ++W+  +  +
Sbjct  502  LFEEHMLQQNEFGLSTYWIDRSFSDMVRLKLATMNDFSPPRLEDYIEVSDLSWVFGMYFT  561

Query  384  GLLLSSLVFAIE  395
            GL +S   F +E
Sbjct  562  GLGISCCCFGLE  573


>A1ZA16_DROME unnamed protein product
Length=599

 Score = 58.9 bits (141),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 89/401 (22%), Positives = 162/401 (40%), Gaps = 44/401 (11%)

Query  9    LRTPFYDDVPRAFVRSGENISDSTLFGPYAQTIWNFANRHQMFLEINRDLSENYSE-TYE  67
            +RT    + PR          +    G     I  F  +    ++I  DL ++  E ++ 
Sbjct  186  IRTLSDKEPPRTIPYIDSKTGEEKFKGYVGMLISQFVKKVNATMQIREDLIKDDEEVSFV  245

Query  68   RIHNGEYN----LAMNGATLVNHFKFNVQFSYPLYWVKNCIMVPLEDELP---KYWYIVW  120
             I N   N    + +  A  +    ++   SYP      C M PL D LP    Y  IV 
Sbjct  246  DITNFTSNDILDIGICEARTLEMSNYDA-ISYPYLMSSYCFMAPLPDSLPFSDVYMAIVA  304

Query  121  PFGRYIYACLLFGIFYIAILMRYIEYPTNATKPTRSITRNILHSSAIIM----FSSNMNV  176
            P    I   ++F I   ++L+ YI+  +  +   RS+  N +     +     F    N 
Sbjct  305  P-SILIMFLIIFCI--CSVLIIYIQERSYRSLTIRSVLMNDICLRGFLAQPFPFPRQYNR  361

Query  177  QLKNAHTRVLFFYMLLFVFGFILAAYHAPYLTAYNMKPVFVPPINTVDDLLSANINVLIT  236
            +LK         +ML+     I    +  YL A+   P   P + + DD+  +   + I 
Sbjct  362  KLK-------LIFMLVCFSSLISTTMYTAYLQAFLWGPPIEPRLTSFDDVKKSRYTMAIN  414

Query  237  L--TDFAEIKHNSVEHILALSRLLREV-PXQEFQDVLDKLNRHYAYVVTEDQWNFLNRQQ  293
            +   +F E  + S+E +        E+    +F  +    N +Y + VT  QW  +N +Q
Sbjct  415  IYEREFLEALNVSLEDV--------EIYDYGKFSKLRSTFNTNYLFPVTALQWFTINEEQ  466

Query  294  RIL-IQPYFHLSKICFGTV-FKAIPLQRDAVWLETLNLFILIVRESGLWGQWEERAFNEA  351
            ++   + +++    C       +IPL+R   + +     +L+ +E GL   W ++++ + 
Sbjct  467  KLFKYKIFYYCDAFCLNQFDILSIPLRRHLPYRDIFEEHMLLQKEFGLTKYWIDQSYRDM  526

Query  352  VRAKYAQIFTDTYP------VESLNLRF-FTIAWIVLASGL  385
            +RA     F D  P      +E  NL + FT+ ++ +  GL
Sbjct  527  IRANLT-TFKDFSPLLENDYIEVHNLYWVFTMYFVGMGMGL  566



Lambda      K        H
   0.320    0.136    0.408 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2184764352


Query= XP_014085164.1 PREDICTED: uncharacterized protein LOC106614130
[Bactrocera oleae]

Length=629
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A1Z8P2_DROME  unnamed protein product                                 71.6    8e-13
A1ZA16_DROME  unnamed protein product                                 58.5    1e-08
A1ZA17_DROME  unnamed protein product                                 42.7    9e-04


>A1Z8P2_DROME unnamed protein product
Length=561

 Score = 71.6 bits (174),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 88/407 (22%), Positives = 173/407 (43%), Gaps = 33/407 (8%)

Query  205  MGYEICTPLRQDLPGVFIAPNA-SGEIASWQGSSFSLLKLFTDYINATLVSYEMPKDRL-  262
            MGY +   +  D P  F+  +   G    ++GS  ++LK+F D +NAT  +    + R  
Sbjct  174  MGYPLRVLVTNDPPHCFVDKDELPGSPNRYKGSIVTMLKIFADQLNATFQANPFREFRRY  233

Query  263  -GGNVIDMKAAMDLLRHDNITFLAHAYALFYEDDIISLSYPIGVVRWCLMVPIWNSVTTI  321
               + + M +  ++    +I    + YA          S P+ + R  +M P  N +   
Sbjct  234  STADCVQMVSDDEIDACGSIFIRTYTYAT---------SQPVRLNRVVIMAPFGNPIEKF  284

Query  322  FYPLEPFDDLTW--WCIVVVFGALLLVQTLCCLLHGTHELAARLSDGILRSFCLSTGISG  379
            +Y   PFD   W    I+VV+ A++       LLH  H     +   +L    + T ++ 
Sbjct  285  YYFFRPFDLYVWIGTGIIVVYIAVM-----GSLLHRWHFKEWNVGQYLL--LAVQTLLNR  337

Query  380  P-SLMAAPNALDFFIFTTFFFYGFFLTANYTSLLGSILTVTSFRAQFNTIDDLITANLSV  438
              SL  + +   F +    F  GF L+  Y +LL  +LT   ++     + DL  AN+++
Sbjct  338  ELSLPQSSSGSKFMLLLLLFAIGFILSNLYVALLSMMLTTKLYQRPIENLADLKAANVNI  397

Query  439  LIIDYELE----FLHSGGLRLPANFSRLIQPVDVATFIKYQYSFNTNYAYFVTEEKWHFL  494
            L+  + +     +  S  LR      R +  V+ +  ++ +   + +YAY  +E++  F 
Sbjct  398  LLQTHNIRPNSVYGSSEELR-----ERFLL-VEESQHLEKRNGLDPSYAYVDSEDRMDFY  451

Query  495  DLQQQYLKPGIFKFSKICFGSFFLAFPMQRDSLFYRSLEYYTFRMHSSGLMHHYERTAFD  554
              QQ++L+    K      G  +    ++++ +  +    +  R   +GL +       +
Sbjct  452  LYQQKFLRRRRMKKLSNPVGYTWAVQVIKQNWVLEKHYNDHVQRFFETGLQNKLVDDVHE  511

Query  555  YAVHAGLVKRL-AQNPDYTSAGMQHLFVVFLMLITMHAVSFLIFLLE  600
             AV AG +     Q        ++ + +  ++L   HA++ + FL+E
Sbjct  512  LAVKAGFLHFFPTQTQTIEPLRLEDIVMAAMVLGGGHALAVICFLVE  558


>A1ZA16_DROME unnamed protein product
Length=599

 Score = 58.5 bits (140),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 74/318 (23%), Positives = 131/318 (41%), Gaps = 29/318 (9%)

Query  298  SLSYPIGVVRWCLMVPIWNSVTTIFYPLEPFDDLTWWCIVV--VFGALLLVQTLC-CLLH  354
            ++SYP  +  +C M P+ +S+        PF D+ +  IV   +    L++  +C  L+ 
Sbjct  273  AISYPYLMSSYCFMAPLPDSL--------PFSDV-YMAIVAPSILIMFLIIFCICSVLII  323

Query  355  GTHELAAR---LSDGILRSFCLSTGISGP-SLMAAPNALDFFIFTTFFFYGFFLTANYTS  410
               E + R   +   ++   CL   ++ P       N     IF    F     T  YT+
Sbjct  324  YIQERSYRSLTIRSVLMNDICLRGFLAQPFPFPRQYNRKLKLIFMLVCFSSLISTTMYTA  383

Query  411  LLGSILTVTSFRAQFNTIDDLITANLSVLIIDYELEFLHSGGLRLPANFSRLIQPVDVAT  470
             L + L       +  + DD+  +  ++ I  YE EFL +  + L       ++  D   
Sbjct  384  YLQAFLWGPPIEPRLTSFDDVKKSRYTMAINIYEREFLEALNVSLED-----VEIYDYGK  438

Query  471  FIKYQYSFNTNYAYFVTEEKWHFLDLQQQYLKPGIFKFSK-ICFGSF-FLAFPMQRDSLF  528
            F K + +FNTNY + VT  +W  ++ +Q+  K  IF +    C   F  L+ P++R   +
Sbjct  439  FSKLRSTFNTNYLFPVTALQWFTINEEQKLFKYKIFYYCDAFCLNQFDILSIPLRRHLPY  498

Query  529  YRSLEYYTFRMHSSGLMHHYERTAFDYAVHAGLVKRLAQNP----DYTSAGMQHLFVVFL  584
                E +       GL  ++   ++   + A L      +P    DY    + +L+ VF 
Sbjct  499  RDIFEEHMLLQKEFGLTKYWIDQSYRDMIRANLTTFKDFSPLLENDYIE--VHNLYWVFT  556

Query  585  MLITMHAVSFLIFLLERL  602
            M      +    F+LE L
Sbjct  557  MYFVGMGMGLCFFILEIL  574


>A1ZA17_DROME unnamed protein product
Length=594

 Score = 42.7 bits (99),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 89/384 (23%), Positives = 153/384 (40%), Gaps = 36/384 (9%)

Query  235  GSSFSLLKLFTDYINATL---VSYEMPKDRLGGNVIDMKAAMDLLRHDNITFLAHAYALF  291
            G   +LL  F + +NATL   V       +     I   A+ DL+       +  +YA +
Sbjct  212  GYVANLLNNFVEKVNATLDMQVKLHKAGKKTSFYNITKWASEDLVD------IGMSYAAY  265

Query  292  YE-DDIISLSYPIGVVRWCLMVPIWNSVTTIFYPLEPFDDLTWWCIVVVFGALLLVQTLC  350
            +E  +  ++SYP  +   C MVP+ + +      +   D      +VV+     +   + 
Sbjct  266  FEMTNFDTISYPYLMTSTCFMVPLPDMMPNSEIYMGIVDPPV---LVVLIAIFCIFSVML  322

Query  351  CLLHGTHELAARLSDGILRSFCLSTGISGP-SLMAAPNALDFFIFTTFFFYGFFLTANYT  409
              +      +  L + +L   CL   ++ P       N     I     F+    T  YT
Sbjct  323  NYIKQRSWRSLSLVNVLLNDICLRGFLAQPFPFPRQSNRKLKLISMLVCFFSVITTTMYT  382

Query  410  SLLGSILTVTSFRAQFNTIDDLITANLSVLIIDYELEFLHSGGLRLPANFS-RLIQPVDV  468
            S L S +       +  +  DL  +   + I  Y++E L       P N S   +   D 
Sbjct  383  SYLQSFMWGPPIDPKMCSFADLENSRYKLAIRRYDIEMLR------PFNVSMDHVVVFDE  436

Query  469  ATFIKY-QYSFNTNYAYFVTEEKWHFLDLQQQYLKPGIFKFS-KICFGSF-FLAFPMQRD  525
            ++ ++Y + SF+ NY Y ++   W     QQ+     +F +S K+C     F +FP++R 
Sbjct  437  SSQLEYLRDSFDDNYMYPMSALSWSAFKEQQKLFAFPLFYYSEKLCLKPISFFSFPIRR-  495

Query  526  SLFYRSL-EYYTFRMHSSGLMHHYERTAFDYAVHAGLVKRLAQNPDYTSAGMQ------H  578
             L YR L E +  + +  GL  ++   +F   V      +LA   D++   ++       
Sbjct  496  HLPYRDLFEEHMLQQNEFGLSTYWIDRSFSDMVRL----KLATMNDFSPPRLEDYIEVSD  551

Query  579  LFVVFLMLITMHAVSFLIFLLERL  602
            L  VF M  T   +S   F LE L
Sbjct  552  LSWVFGMYFTGLGISCCCFGLELL  575



Lambda      K        H
   0.320    0.136    0.408 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2184764352


Query= XP_014085165.1 PREDICTED: homeobox protein orthopedia [Bactrocera
oleae]

Length=364
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

UNC4_CAEEL  unnamed protein product                                   115     6e-30
Q8T0V5_DROME  unnamed protein product                                 114     1e-28
Q9XZU0_DROME  unnamed protein product                                 114     1e-28


>UNC4_CAEEL unnamed protein product
Length=252

 Score = 115 bits (288),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 93/161 (58%), Gaps = 9/161 (6%)

Query  97   RDESPTNMDNGLDVDNDDELSNSLNSGHDLGDMERPRKVRRSRTTFTTFQLHQLERAFEK  156
            R++S +  D+ L ++ DD ++  L   +D G  E   K RR+RT F+ +QL +LE AFE 
Sbjct  54   REQSTSPDDDNLLMNEDDGIA--LEDDNDTG--ESAAKRRRTRTNFSGWQLEELESAFEA  109

Query  157  TQYPDVFTREDLAMRLDLSEARVQVWFQNRRAKWRKREKFMN-----QDKNGYLLPDQGL  211
            + YPDVF RE LAMRLDL E+RVQVWFQNRRAKWRKRE+  N     +  +G  +  + L
Sbjct  110  SHYPDVFMREALAMRLDLLESRVQVWFQNRRAKWRKREQNRNGSSEIKKDDGEQMETKAL  169

Query  212  PDFPLGLPIPHGIPGHPATLPPEFWPPHFALHQHFNPALLP  252
            P FP  +     +   P    P    P     ++ +P ++P
Sbjct  170  PTFPFSIDSILAVSRVPRGRRPNAKYPRVQACKNLSPFMIP  210


>Q8T0V5_DROME unnamed protein product
Length=357

 Score = 114 bits (286),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 60/72 (83%), Gaps = 2/72 (3%)

Query  125  DLGDMERPRKVRRSRTTFTTFQLHQLERAFEKTQYPDVFTREDLAMRLDLSEARVQVWFQ  184
            D G M+R  K RR RTTF T QL +LERAF++T YPDVF RE+LA+R+DL+EARVQVWFQ
Sbjct  2    DKGTMKR--KQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQ  59

Query  185  NRRAKWRKREKF  196
            NRRAKWRK+EK 
Sbjct  60   NRRAKWRKQEKI  71


>Q9XZU0_DROME unnamed protein product
Length=357

 Score = 114 bits (285),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 60/72 (83%), Gaps = 2/72 (3%)

Query  125  DLGDMERPRKVRRSRTTFTTFQLHQLERAFEKTQYPDVFTREDLAMRLDLSEARVQVWFQ  184
            D G M+R  K RR RTTF T QL +LERAF++T YPDVF RE+LA+R+DL+EARVQVWFQ
Sbjct  2    DKGTMKR--KQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQ  59

Query  185  NRRAKWRKREKF  196
            NRRAKWRK+EK 
Sbjct  60   NRRAKWRKQEKI  71



Lambda      K        H
   0.320    0.136    0.408 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2184764352


Query= XP_014085166.1 PREDICTED: uncharacterized protein LOC106614131
[Bactrocera oleae]

Length=620
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A1ZA17_DROME  unnamed protein product                                 63.2    4e-10
A1Z8P2_DROME  unnamed protein product                                 55.1    1e-07
A1ZA16_DROME  unnamed protein product                                 51.2    2e-06


>A1ZA17_DROME unnamed protein product
Length=594

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 92/418 (22%), Positives = 175/418 (42%), Gaps = 35/418 (8%)

Query  188  DLQGYTLSTPAENDLPRIFFVRQQRDKATKIRGFAYQIFVNFVRRMNMTLRISNPNQVHD  247
            ++QG  L +   N +P     R  +    K  G+   +  NFV ++N TL +    ++H 
Sbjct  180  NMQGALLKSITFNLIPGSMAYRDPKTGQEKHIGYVANLLNNFVEKVNATLDMQ--VKLHK  237

Query  248  ITSSVNMSIIVEKIAKQQLEISIQPYTSIREHQGI--MSYPIFKLECCLMVPVQNEIPRC  305
                 +   I +  ++  ++I +  Y +  E      +SYP      C MVP+ + +P  
Sbjct  238  AGKKTSFYNITKWASEDLVDIGMS-YAAYFEMTNFDTISYPYLMTSTCFMVPLPDMMPNS  296

Query  306  LYTVRPLKLGSWLMIFAAIVYISVML------AWTSPCVPPDAPFLTKLSRTFLESIAQV  359
               +  +     +++ A     SVML      +W S            L    L  I   
Sbjct  297  EIYMGIVDPPVLVVLIAIFCIFSVMLNYIKQRSWRS----------LSLVNVLLNDICLR  346

Query  360  VFLPSTYQSHQPSMRYL-LVYLQLALFGFLLTSWYNNLLSSFFTTILVGEQLDTFESLIE  418
             FL   +   + S R L L+ + +  F  + T+ Y + L SF     +  ++ +F  L  
Sbjct  347  GFLAQPFPFPRQSNRKLKLISMLVCFFSVITTTMYTSYLQSFMWGPPIDPKMCSFADLEN  406

Query  419  AQLPILTKFHEIDMVLEQVPPALVSKVKKLIVGANSSVQMAHLLN-FNNSYAYPVTEERW  477
            ++  +  + ++I+M    + P  VS     +V  + S Q+ +L + F+++Y YP++   W
Sbjct  407  SRYKLAIRRYDIEM----LRPFNVS--MDHVVVFDESSQLEYLRDSFDDNYMYPMSALSW  460

Query  478  YFLSLQEQYANKPINRFS-KICLGS-PCISYPMRLDSHLEEPLTRFILDVQMAGLDFYWL  535
                 Q++    P+  +S K+CL      S+P+R      +     +L     GL  YW+
Sbjct  461  SAFKEQQKLFAFPLFYYSEKLCLKPISFFSFPIRRHLPYRDLFEEHMLQQNEFGLSTYWI  520

Query  536  TSDFKDALLAGYVKLVNNVFPFKALDLYTLYP-AWV--LLIGGLIIASLVFLVEIRGV  590
               F D ++   +  +N+  P +  D   +   +WV  +   GL I+   F +E+ G+
Sbjct  521  DRSFSD-MVRLKLATMNDFSPPRLEDYIEVSDLSWVFGMYFTGLGISCCCFGLELLGL  577


>A1Z8P2_DROME unnamed protein product
Length=561

 Score = 55.1 bits (131),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 106/474 (22%), Positives = 190/474 (40%), Gaps = 62/474 (13%)

Query  139  EIFAKLWQLQFLHVVLL-CNNTVYRYTPFPHLNVYE------VHNRSADLFPPPPTDLQG  191
            +I    W   F  V++       +   P+P+L +        + NR+         +L G
Sbjct  123  DIRKAYWNAGFSQVLIYNSQQRTWSIKPYPYLQIRPTSLKEYIENRNT-------RNLMG  175

Query  192  YTLSTPAENDLPRIFFVRQQRDKA-TKIRGFAYQIFVNFVRRMNMTLRISNPNQVHDITS  250
            Y L     ND P  F  + +   +  + +G    +   F  ++N T + +NP +     S
Sbjct  176  YPLRVLVTNDPPHCFVDKDELPGSPNRYKGSIVTMLKIFADQLNATFQ-ANPFREFRRYS  234

Query  251  SVNMSIIVEKIAKQQLEISIQPYTSIREHQGIMSYPIFKLECCLMVPVQNEIPRCLYTVR  310
            + +    V+ ++  +++     +  IR +    S P+      +M P  N I +  Y  R
Sbjct  235  TAD---CVQMVSDDEIDACGSIF--IRTYTYATSQPVRLNRVVIMAPFGNPIEKFYYFFR  289

Query  311  PLKLGSWLMIFAAIVYISVMLAWTSPCVPPD---APFLTKLSRTFLESIAQVVFLPSTYQ  367
            P  L  W+     +VYI+VM +        +     +L    +T L    + + LP   Q
Sbjct  290  PFDLYVWIGTGIIVVYIAVMGSLLHRWHFKEWNVGQYLLLAVQTLLN---RELSLP---Q  343

Query  368  SHQPSMRYLLVYLQLALFGFLLTSWYNNLLSSFFTTILVGEQLDTFESLIEAQLPILTKF  427
            S   S +++L+ L  A+ GF+L++ Y  LLS   TT L    ++    L  A + IL + 
Sbjct  344  SSSGS-KFMLLLLLFAI-GFILSNLYVALLSMMLTTKLYQRPIENLADLKAANVNILLQT  401

Query  428  HEIDMVLEQVPPALVSKVKKL---IVGANSSVQMAHLLNFNNSYAYPVTEERWYFLSLQE  484
            H I       P ++    ++L    +    S  +      + SYAY  +E+R  F   Q+
Sbjct  402  HNIR------PNSVYGSSEELRERFLLVEESQHLEKRNGLDPSYAYVDSEDRMDFYLYQQ  455

Query  485  QYANKPINRFSKIC------LGSPCISYPMRLDSHLEEPLTRFILDVQMAGLDFYWLTSD  538
            ++  +   R  K+            I     L+ H  + + RF       GL    +   
Sbjct  456  KFLRR--RRMKKLSNPVGYTWAVQVIKQNWVLEKHYNDHVQRFF----ETGLQNKLVDDV  509

Query  539  FKDALLAGYVKLVNNVFP-----FKALDLYTLYPAWVLLIGGLIIASLVFLVEI  587
             + A+ AG++      FP      + L L  +  A ++L GG  +A + FLVE+
Sbjct  510  HELAVKAGFLHF----FPTQTQTIEPLRLEDIVMAAMVLGGGHALAVICFLVEL  559


>A1ZA16_DROME unnamed protein product
Length=599

 Score = 51.2 bits (121),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 89/447 (20%), Positives = 186/447 (42%), Gaps = 30/447 (7%)

Query  150  LHVVLLCNNTVYRYTPFPHLNVYEVHNRSADLFPPPPTDLQGYTLSTPAENDLPRIFFVR  209
            L VV  C   +++   +  LN+++  +   D F     ++ G  + T ++ + PR     
Sbjct  148  LEVVYSCR--LFQDQNYEKLNLFDGKSIYKDQF----RNMHGAPIRTLSDKEPPRTIPYI  201

Query  210  QQRDKATKIRGFAYQIFVNFVRRMNMTLRISNPNQVHDITSSVNMSIIVEKIAKQQLEIS  269
              +    K +G+   +   FV+++N T++I   + + D    V+   I    +   L+I 
Sbjct  202  DSKTGEEKFKGYVGMLISQFVKKVNATMQIRE-DLIKD-DEEVSFVDITNFTSNDILDIG  259

Query  270  I-QPYTSIREHQGIMSYPIFKLECCLMVPVQNEIPRC---LYTVRPLKLGSWLMIFAAIV  325
            I +  T    +   +SYP      C M P+ + +P     +  V P  L  +L+IF    
Sbjct  260  ICEARTLEMSNYDAISYPYLMSSYCFMAPLPDSLPFSDVYMAIVAPSILIMFLIIFCI--  317

Query  326  YISVMLAWTSPCVPPDAPFLTKLSRTFLESIAQVVFLPSTYQSHQPSMRYLLVYLQLALF  385
              SV++ +    +   +     +    +  I    FL   +   +   R L +   L  F
Sbjct  318  -CSVLIIY----IQERSYRSLTIRSVLMNDICLRGFLAQPFPFPRQYNRKLKLIFMLVCF  372

Query  386  GFLL-TSWYNNLLSSFFTTILVGEQLDTFESLIEAQLPILTKFHEIDMVLEQVPPALVSK  444
              L+ T+ Y   L +F     +  +L +F+ + +++  +    +E +  LE +  +L   
Sbjct  373  SSLISTTMYTAYLQAFLWGPPIEPRLTSFDDVKKSRYTMAINIYEREF-LEALNVSL-ED  430

Query  445  VKKLIVGANSSVQMAHLLNFNNSYAYPVTEERWYFLSLQEQ-YANKPINRFSKICLGS-P  502
            V+    G  S ++      FN +Y +PVT  +W+ ++ +++ +  K        CL    
Sbjct  431  VEIYDYGKFSKLRST----FNTNYLFPVTALQWFTINEEQKLFKYKIFYYCDAFCLNQFD  486

Query  503  CISYPMRLDSHLEEPLTRFILDVQMAGLDFYWLTSDFKDALLAGYV--KLVNNVFPFKAL  560
             +S P+R      +     +L  +  GL  YW+   ++D + A     K  + +     +
Sbjct  487  ILSIPLRRHLPYRDIFEEHMLLQKEFGLTKYWIDQSYRDMIRANLTTFKDFSPLLENDYI  546

Query  561  DLYTLYPAWVLLIGGLIIASLVFLVEI  587
            +++ LY  + +   G+ +    F++EI
Sbjct  547  EVHNLYWVFTMYFVGMGMGLCFFILEI  573



Lambda      K        H
   0.320    0.136    0.408 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2184764352


Query= XP_014085167.1 PREDICTED: uncharacterized protein LOC106614132
[Bactrocera oleae]

Length=609
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A1Z8P2_DROME  unnamed protein product                                 78.6    5e-15
A1ZA16_DROME  unnamed protein product                                 72.0    5e-13
A1ZA17_DROME  unnamed protein product                                 62.4    6e-10


>A1Z8P2_DROME unnamed protein product
Length=561

 Score = 78.6 bits (192),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 89/355 (25%), Positives = 146/355 (41%), Gaps = 39/355 (11%)

Query  153  WREQFLNTILLTVRDNIYILEPYPELKIVNKTQNWLVKDFFIDYYDNLKGYVLNTIILYD  212
            W   F   ++   +   + ++PYP L+I   +    +++       NL GY L  ++  D
Sbjct  129  WNAGFSQVLIYNSQQRTWSIKPYPYLQIRPTSLKEYIEN---RNTRNLMGYPLRVLVTND  185

Query  213  LPRVFDRRYE--NGELKISGTSGKLFTTFLKSINVTLADSDVARSPFAPALMGDVIELID  270
             P  F  + E      +  G+   +   F   +N T   +      F      D ++++ 
Sbjct  186  PPHCFVDKDELPGSPNRYKGSIVTMLKIFADQLNATFQANPFRE--FRRYSTADCVQMVS  243

Query  271  NRTIEM--SPHSQTALYAMNHIGTSYPIGINDWCIMVPFYNRSAEHLYLLRSFQNSTWLL  328
            +  I+   S   +T  YA     TS P+ +N   IM PF N   +  Y  R F    W+ 
Sbjct  244  DDEIDACGSIFIRTYTYA-----TSQPVRLNRVVIMAPFGNPIEKFYYFFRPFDLYVWIG  298

Query  329  VLFAVVYISFALWLCAPQRPKEYSNALLQAICSMLSIAPTTLFNTLNRRMSF--------  380
                VVYI+    L      KE++      +   L +A  TL   LNR +S         
Sbjct  299  TGIIVVYIAVMGSLLHRWHFKEWN------VGQYLLLAVQTL---LNRELSLPQSSSGSK  349

Query  381  --LFFNLFILGFITSNWYTTKIASYLMTSLPSAQIDTMDDVVRANIRI--KVFDYEYERL  436
              L   LF +GFI SN Y   ++  L T L    I+ + D+  AN+ I  +  +     +
Sbjct  350  FMLLLLLFAIGFILSNLYVALLSMMLTTKLYQRPIENLADLKAANVNILLQTHNIRPNSV  409

Query  437  KSMSAQYTQRFLEQLDIVDKPFMDQHRDTLNTSYGYSTQTDRWKFLNMQQQFLQK  491
               S +  +RFL    +V++    + R+ L+ SY Y    DR  F   QQ+FL++
Sbjct  410  YGSSEELRERFL----LVEESQHLEKRNGLDPSYAYVDSEDRMDFYLYQQKFLRR  460


>A1ZA16_DROME unnamed protein product
Length=599

 Score = 72.0 bits (175),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 89/421 (21%), Positives = 175/421 (42%), Gaps = 66/421 (16%)

Query  165  VRDNIYILEPYPELKIVNKTQNWLV------KDFFIDYYDNLKGYVLNTIILYDLPRVFD  218
            V++N Y LE     ++  + QN+        K  + D + N+ G  + T+   + PR   
Sbjct  141  VKENFYQLEVVYSCRLF-QDQNYEKLNLFDGKSIYKDQFRNMHGAPIRTLSDKEPPRTIP  199

Query  219  R-RYENGELKISGTSGKLFTTFLKSINVTLA--------DSDVARSPFAPALMGDVIEL-  268
                + GE K  G  G L + F+K +N T+         D +V+          D++++ 
Sbjct  200  YIDSKTGEEKFKGYVGMLISQFVKKVNATMQIREDLIKDDEEVSFVDITNFTSNDILDIG  259

Query  269  -IDNRTIEMSPHSQTALYAMNHIGTSYPIGINDWCIMVPFYNR---SAEHLYLLRSFQNS  324
              + RT+EMS          N+   SYP  ++ +C M P  +    S  ++ ++     +
Sbjct  260  ICEARTLEMS----------NYDAISYPYLMSSYCFMAPLPDSLPFSDVYMAIV-----A  304

Query  325  TWLLVLFAVVYISFALWLCAPQ----RPKEYSNALLQAICSMLSIA-PTTLFNTLNRRMS  379
              +L++F +++   ++ +   Q    R     + L+  IC    +A P       NR++ 
Sbjct  305  PSILIMFLIIFCICSVLIIYIQERSYRSLTIRSVLMNDICLRGFLAQPFPFPRQYNRKLK  364

Query  380  FLFFNLFILGFITSNWYTTKIASYLMTSLPSAQIDTMDDVVRANIRIKVFDYEYERLKSM  439
             +F  +     I++  YT  + ++L       ++ + DDV ++   + +  YE E L+++
Sbjct  365  LIFMLVCFSSLISTTMYTAYLQAFLWGPPIEPRLTSFDDVKKSRYTMAINIYEREFLEAL  424

Query  440  SAQYTQRFLEQLDIVDKPFMDQHRDTLNTSYGYSTQTDRWKFLNMQQQFLQKPVF-RLSH  498
            +       LE ++I D     + R T NT+Y +     +W  +N +Q+  +  +F     
Sbjct  425  NVS-----LEDVEIYDYGKFSKLRSTFNTNYLFPVTALQWFTINEEQKLFKYKIFYYCDA  479

Query  499  ICMGPFHHVFPMYADSHLQIPLKYFILY----------ATQSGLLAYWQKSAFAEALRLR  548
             C+  F           L IPL+  + Y            + GL  YW   ++ + +R  
Sbjct  480  FCLNQF---------DILSIPLRRHLPYRDIFEEHMLLQKEFGLTKYWIDQSYRDMIRAN  530

Query  549  L  549
            L
Sbjct  531  L  531


>A1ZA17_DROME unnamed protein product
Length=594

 Score = 62.4 bits (150),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 83/405 (20%), Positives = 165/405 (41%), Gaps = 21/405 (5%)

Query  193  FIDYYDNLKGYVLNTIILYDLPRVFD-RRYENGELKISGTSGKLFTTFLKSINVTLADSD  251
            ++D + N++G +L +I    +P     R  + G+ K  G    L   F++ +N TL    
Sbjct  174  YVDQFRNMQGALLKSITFNLIPGSMAYRDPKTGQEKHIGYVANLLNNFVEKVNATLDMQV  233

Query  252  VARSPFAPALMGDVIELIDNRTIEMSPHSQTALYAMNHIGT-SYPIGINDWCIMVPFYNR  310
                        ++ +      +++   S  A + M +  T SYP  +   C MVP  + 
Sbjct  234  KLHKAGKKTSFYNITKWASEDLVDIG-MSYAAYFEMTNFDTISYPYLMTSTCFMVPLPDM  292

Query  311  -SAEHLYLLRSFQNSTWLLVLFAVVYISFALWLCAPQRP-KEYS--NALLQAICSMLSIA  366
                 +Y+     +   L+VL A+  I   +     QR  +  S  N LL  IC    +A
Sbjct  293  MPNSEIYM--GIVDPPVLVVLIAIFCIFSVMLNYIKQRSWRSLSLVNVLLNDICLRGFLA  350

Query  367  -PTTLFNTLNRRMSFLFFNLFILGFITSNWYTTKIASYLMTSLPSAQIDTMDDVVRANIR  425
             P       NR++  +   +     IT+  YT+ + S++       ++ +  D+  +  +
Sbjct  351  QPFPFPRQSNRKLKLISMLVCFFSVITTTMYTSYLQSFMWGPPIDPKMCSFADLENSRYK  410

Query  426  IKVFDYEYERLKSMSAQYTQRFLEQLDIVDKPFMDQH-RDTLNTSYGYSTQTDRWKFLNM  484
            + +  Y+ E L+  +       ++ + + D+    ++ RD+ + +Y Y      W     
Sbjct  411  LAIRRYDIEMLRPFNVS-----MDHVVVFDESSQLEYLRDSFDDNYMYPMSALSWSAFKE  465

Query  485  QQQFLQKPVFRLSH-ICMGPFHHV-FPMYADSHLQIPLKYFILYATQSGLLAYWQKSAFA  542
            QQ+    P+F  S  +C+ P     FP+      +   +  +L   + GL  YW   +F+
Sbjct  466  QQKLFAFPLFYYSEKLCLKPISFFSFPIRRHLPYRDLFEEHMLQQNEFGLSTYWIDRSFS  525

Query  543  EALRLRLVKIMLIHEDPRPLSMRFLRPIWYVWWFGLILAGVVFLC  587
            + +RL+L     +++   P    ++      W FG+   G+   C
Sbjct  526  DMVRLKLAT---MNDFSPPRLEDYIEVSDLSWVFGMYFTGLGISC  567



Lambda      K        H
   0.320    0.136    0.408 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2184764352


Query= XP_014085168.1 PREDICTED: uncharacterized protein LOC106614133
[Bactrocera oleae]

Length=546
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A1ZA16_DROME  unnamed protein product                                 73.9    1e-13
A1ZA17_DROME  unnamed protein product                                 65.9    4e-11
A1Z8P2_DROME  unnamed protein product                                 63.9    1e-10


>A1ZA16_DROME unnamed protein product
Length=599

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 86/355 (24%), Positives = 154/355 (43%), Gaps = 28/355 (8%)

Query  176  KYRNVFGYNFQLSYFNDTP--IVYKQVTNNRTELRGLIGNVLNILMKRINGTFTVF-DLP  232
            ++RN+ G   +     + P  I Y        + +G +G +++  +K++N T  +  DL 
Sbjct  177  QFRNMHGAPIRTLSDKEPPRTIPYIDSKTGEEKFKGYVGMLISQFVKKVNATMQIREDLI  236

Query  233  MNE---SMMDMIDMTANLV-------SRTDLIHPAMERSYPVFQTKACIMVPFESGIPLS  282
             ++   S +D+ + T+N +       +RT  +      SYP   +  C M P    +P S
Sbjct  237  KDDEEVSFVDITNFTSNDILDIGICEARTLEMSNYDAISYPYLMSSYCFMAPLPDSLPFS  296

Query  283  -WYLLYPFDSLTWQLLGFHFILIVLLFIVIHRNYRHSCDLVQHVLF---VLKLFLAQPVF  338
              Y+     S+    L    I  VL+  +  R+YR     ++ VL     L+ FLAQP  
Sbjct  297  DVYMAIVAPSILIMFLIIFCICSVLIIYIQERSYRSL--TIRSVLMNDICLRGFLAQPFP  354

Query  339  LPGIRSVTRGVFLIYFGGLFVVIVS--VYEGSLTSLFSTHVRMPAVRTPEDLLKTDLKIA  396
             P  R   R + LI+    F  ++S  +Y   L +        P + + +D+ K+   +A
Sbjct  355  FP--RQYNRKLKLIFMLVCFSSLISTTMYTAYLQAFLWGPPIEPRLTSFDDVKKSRYTMA  412

Query  397  IANIERELYFAAKLLPASLES-RVYNIGDFSAIESLNGSISFAYIMTSHKWLWYEKRQKH  455
            I   ERE   A   L  SLE   +Y+ G FS + S   + ++ + +T+ +W    + QK 
Sbjct  413  INIYEREFLEA---LNVSLEDVEIYDYGKFSKLRS-TFNTNYLFPVTALQWFTINEEQKL  468

Query  456  LEIPVFRITTGNLCTPNILQCFALQKHSPFERMLKMISLELQEFGFVNHWLAQIY  510
             +  +F            +    L++H P+  + +   L  +EFG   +W+ Q Y
Sbjct  469  FKYKIFYYCDAFCLNQFDILSIPLRRHLPYRDIFEEHMLLQKEFGLTKYWIDQSY  523


>A1ZA17_DROME unnamed protein product
Length=594

 Score = 65.9 bits (159),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 110/502 (22%), Positives = 202/502 (40%), Gaps = 62/502 (12%)

Query  44   FASDGIIQELHQRLHIPQVIVKNVTTPNIKKFMSMKSIALIFMERLDKSHTWTLVAESLH  103
            +  D     L +RL +P ++V + +T     + S+  I     +   + +  TL    ++
Sbjct  52   YGEDCAFSSLSRRLQVPTILVSSGSTSFEWNYSSLALILTCEFKAEREENYQTLKKLQMN  111

Query  104  HHSYIPMIFLSQTVPRLDEQLRFF------------NYFRQQNMLNTVMLFRMNNTLMVR  151
                  +I L+  + + D    F+            N F Q  ++    LF+  N   V 
Sbjct  112  RR----LILLNGNI-KPDSVCDFYSKKDQYNIAMVNNNFHQVGIIYACRLFQERNYEKVY  166

Query  152  TAIAYPKTQIIAVDPSNFSGFVWPKYRNVFGYNFQLSYFNDTP--IVYKQVTNNRTELRG  209
             +   P    I VD          ++RN+ G   +   FN  P  + Y+     + +  G
Sbjct  167  LSEGNP----IYVD----------QFRNMQGALLKSITFNLIPGSMAYRDPKTGQEKHIG  212

Query  210  LIGNVLNILMKRINGTF------------TVFDLPMNESMMDMIDMTANLVSRTDLIHPA  257
             + N+LN  ++++N T             T F      +  D++D+  +  +  ++ +  
Sbjct  213  YVANLLNNFVEKVNATLDMQVKLHKAGKKTSFYNITKWASEDLVDIGMSYAAYFEMTNFD  272

Query  258  MERSYPVFQTKACIMVPFESGIPLSWYLLYPFDS-LTWQLLGFHFILIVLLFIVIHRNYR  316
               SYP   T  C MVP    +P S   +   D  +   L+    I  V+L  +  R++R
Sbjct  273  -TISYPYLMTSTCFMVPLPDMMPNSEIYMGIVDPPVLVVLIAIFCIFSVMLNYIKQRSWR  331

Query  317  HSCDLVQHVL--FVLKLFLAQPVFLPGIRSVTRGVFLIYFGGLF--VVIVSVYEGSLTSL  372
             S  LV  +L    L+ FLAQP   P  R   R + LI     F  V+  ++Y   L S 
Sbjct  332  -SLSLVNVLLNDICLRGFLAQPFPFP--RQSNRKLKLISMLVCFFSVITTTMYTSYLQSF  388

Query  373  FSTHVRMPAVRTPEDLLKTDLKIAIANIERELYFAAKLLPASLE-SRVYNIGDFSAIESL  431
                   P + +  DL  +  K+AI   + E+     L P ++    V    + S +E L
Sbjct  389  MWGPPIDPKMCSFADLENSRYKLAIRRYDIEM-----LRPFNVSMDHVVVFDESSQLEYL  443

Query  432  NGSI--SFAYIMTSHKWLWYEKRQKHLEIPVFRITTGNLCTPNILQCFALQKHSPFERML  489
              S   ++ Y M++  W  ++++QK    P+F  +      P     F +++H P+  + 
Sbjct  444  RDSFDDNYMYPMSALSWSAFKEQQKLFAFPLFYYSEKLCLKPISFFSFPIRRHLPYRDLF  503

Query  490  KMISLELQEFGFVNHWLAQIYN  511
            +   L+  EFG   +W+ + ++
Sbjct  504  EEHMLQQNEFGLSTYWIDRSFS  525


>A1Z8P2_DROME unnamed protein product
Length=561

 Score = 63.9 bits (154),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 70/318 (22%), Positives = 135/318 (42%), Gaps = 27/318 (8%)

Query  156  YPKTQIIAVDPSNFSGFVWPK-YRNVFGYNFQLSYFNDTPIVY---KQVTNNRTELRGLI  211
            YP  QI    P++   ++  +  RN+ GY  ++   ND P  +    ++  +    +G I
Sbjct  151  YPYLQI---RPTSLKEYIENRNTRNLMGYPLRVLVTNDPPHCFVDKDELPGSPNRYKGSI  207

Query  212  GNVLNILMKRINGTFTVFDLPMNE----SMMDMIDMTANLVSRTDLIHPAMERSY-----  262
              +L I   ++N TF     P  E    S  D + M ++     D       R+Y     
Sbjct  208  VTMLKIFADQLNATFQAN--PFREFRRYSTADCVQMVSD--DEIDACGSIFIRTYTYATS  263

Query  263  -PVFQTKACIMVPFESGIPLSWYLLYPFDSLTWQLLGFHFILIVLLFIVIHRNYRHSCDL  321
             PV   +  IM PF + I   +Y   PFD   W   G   + I ++  ++HR +    ++
Sbjct  264  QPVRLNRVVIMAPFGNPIEKFYYFFRPFDLYVWIGTGIIVVYIAVMGSLLHRWHFKEWNV  323

Query  322  VQHVLFVLKLFLAQPVFLPGIRSVTRGVFLIYFGGLFVVIVSVYEGSLTSLFSTHVRMPA  381
             Q++L  ++  L + + LP   S ++ + L+    +  ++ ++Y   L+ + +T +    
Sbjct  324  GQYLLLAVQTLLNRELSLPQSSSGSKFMLLLLLFAIGFILSNLYVALLSMMLTTKLYQRP  383

Query  382  VRTPEDLLKTDLKIAIA--NIERELYFAAKLLPASLESRVYNIGDFSAIESLNG-SISFA  438
            +    DL   ++ I +   NI     + +      L  R   + +   +E  NG   S+A
Sbjct  384  IENLADLKAANVNILLQTHNIRPNSVYGSS---EELRERFLLVEESQHLEKRNGLDPSYA  440

Query  439  YIMTSHKWLWYEKRQKHL  456
            Y+ +  +  +Y  +QK L
Sbjct  441  YVDSEDRMDFYLYQQKFL  458



Lambda      K        H
   0.320    0.136    0.408 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2184764352


Query= XP_014085169.1 PREDICTED: chitinase-like protein PB1E7.04c
[Bactrocera oleae]

Length=1041
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TTN1_CAEEL  unnamed protein product                                   40.4    0.010
Q8IBB0_PLAF7  unnamed protein product                                 35.0    0.39 


>TTN1_CAEEL unnamed protein product
Length=18562

 Score = 40.4 bits (93),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 77/251 (31%), Positives = 115/251 (46%), Gaps = 24/251 (10%)

Query  193   ESLMNSVVKPMEI--DRDVAQTPTTSPTIMRPTAAVSITKPTELTESLMISVVKPLEI-D  249
             ES   S V+P EI   +DV    T++PT+  PT  V    P E  E+   S V+P EI +
Sbjct  5992  ESKETSEVEPAEIVEQKDVPVPETSAPTV-EPT--VEKLAPVESKET---SEVQPAEIVE  6045

Query  250   RDTVQTPTTSPTIMKPTATVYITKPTELTE-SLMKPMEI-DRAAAETPTIMRPTAAVSIT  307
                VQ P TS   ++P  T+    P E  E S ++P EI ++     P    PT   +I 
Sbjct  6046  HKDVQVPETSAPTVEP--TIEKLAPVESKETSEVEPAEIVEQKDVSVPETSAPTVEPTIE  6103

Query  308   KSTELNESLMISVVKPLEI-DRDTVQTPTTSPTIMKPTAAVSITKPTELTKSLIFPVVKP  366
             K   + ES   S V+P EI +   VQ P TS   ++PT  V    P E  ++     V+P
Sbjct  6104  KLAPV-ESKETSEVQPAEIVEHKDVQVPETSSPTVEPT--VEKLAPVESKET---SEVQP  6157

Query  367   MEI--DRDVAQTPETTATTSEITSGMF--SAATITTAEIENLKSITTKTTVTEIESSSCN  422
              EI   +DV    E     +E+   +F   A   +  E++ L   +   T +  + S+  
Sbjct  6158  AEIVEQKDVTCEEEIKELLTEVEVELFFSQAEVFSGLELDLLMECSEYVTTSIQKGSTAA  6217

Query  423   TTSKASMEKLA  433
                + ++EKLA
Sbjct  6218  PAHEPTVEKLA  6228


 Score = 38.1 bits (87),  Expect = 0.054, Method: Compositional matrix adjust.
 Identities = 80/252 (32%), Positives = 120/252 (48%), Gaps = 31/252 (12%)

Query  193   ESLMNSVVKPMEI--DRDVAQTPTTSPTIMRPTAAVSITKPTELTESLMISVVKPLEI-D  249
             ES   S V+P EI   +DV    T+SPT+  PT  V    P E  E+   S V+P EI +
Sbjct  6543  ESKETSEVQPAEIVEHKDVQVPETSSPTV-EPT--VEKLAPVESKET---SEVEPAEIVE  6596

Query  250   RDTVQTPTTSPTIMKPTATVYITKPTELTE-SLMKPMEI-DRAAAETPTIMRPTAAVSIT  307
             +  V  P TS   ++PT  V    P E  E S ++P EI ++     P    PT   ++ 
Sbjct  6597  QKDVPVPETSAPTVEPT--VEKLAPVESKETSEVEPAEIVEQKDVPVPETSAPTVEPTVE  6654

Query  308   KSTELNESLMISVVKPLEI-DRDTVQTPTTSPTIMKPT----AAVSITKPTELTKSLIFP  362
             K   + ES   S V+P EI +   VQ P T+ T  +PT    A V   + +E+  + I  
Sbjct  6655  KLAPV-ESKETSEVQPAEIVEHKDVQVPETTATTFEPTKEKLAPVDSKETSEVQTAEI--  6711

Query  363   VVKPMEIDRDVAQTPETTATTSEITSGMFS-AATITTAEIENLKSITTKTTVTEIESSSC  421
                   +++     PET+ATT E T    +   +  T+E++   +I  +  V   E+S+ 
Sbjct  6712  ------VEQKDVPVPETSATTVEPTKEKLAPGESKETSEVQQA-AIVEQKDVAVPETSA-  6763

Query  422   NTTSKASMEKLA  433
              TT + + EKLA
Sbjct  6764  -TTVEPTKEKLA  6774


 Score = 38.1 bits (87),  Expect = 0.055, Method: Compositional matrix adjust.
 Identities = 71/203 (35%), Positives = 98/203 (48%), Gaps = 23/203 (11%)

Query  193   ESLMNSVVKPMEI--DRDVAQTPTTSPTIMRPTAAVSITKPTELTESLMISVVKPLEI-D  249
             ES   S V+P EI   +DV    T++PT+  PT  V    P E  E+   S V+P EI +
Sbjct  5836  ESKETSEVEPAEIVEQKDVPVPETSAPTV-EPT--VEKLAPVESKET---SEVQPAEIVE  5889

Query  250   RDTVQTPTTSPTIMKPTATVYITKPTELTE-SLMKPMEI-DRAAAETPTIMRPTAAVSIT  307
             +  V  P TS   ++P  TV    P E  E S ++P EI ++     P    PT   ++ 
Sbjct  5890  QKDVSVPETSAPTVEP--TVEKLAPVESKETSEVQPAEIVEQKDVPVPETSAPTVEPTVE  5947

Query  308   KSTELNESLMISVVKPLEI-DRDTVQTPTTSPTIMKPTAAVSITKPTELTKSLIFPVVKP  366
             K   + ES   S V+P EI +   VQ P TS   ++PT  V    P E  ++     V+P
Sbjct  5948  KLAPV-ESKETSEVQPAEIVEHKDVQVPETSSPTVEPT--VEKLAPVESKET---SEVEP  6001

Query  367   MEI--DRDVAQTPETTATTSEIT  387
              EI   +DV   PET+A T E T
Sbjct  6002  AEIVEQKDVP-VPETSAPTVEPT  6023


 Score = 37.7 bits (86),  Expect = 0.077, Method: Compositional matrix adjust.
 Identities = 70/203 (34%), Positives = 99/203 (49%), Gaps = 23/203 (11%)

Query  193   ESLMNSVVKPMEI--DRDVAQTPTTSPTIMRPTAAVSITKPTELTESLMISVVKPLEI-D  249
             ES   S V+P EI   +DV+   T++PT+  PT  +    P E  E+   S V+P EI +
Sbjct  5641  ESKETSEVEPAEIVEQKDVSVPETSAPTV-EPT--IEKLAPVESKET---SEVEPAEIVE  5694

Query  250   RDTVQTPTTSPTIMKPTATVYITKPTELTE-SLMKPMEI-DRAAAETPTIMRPTAAVSIT  307
             +  V  P TS   ++P  TV    P E  E S ++P EI ++     P    PT   ++ 
Sbjct  5695  QKDVSVPETSAPTVEP--TVEKLAPVESKETSEVEPAEIVEQKDVPVPETSAPTVEPTVE  5752

Query  308   KSTELNESLMISVVKPLEI-DRDTVQTPTTSPTIMKPTAAVSITKPTELTKSLIFPVVKP  366
             K   + ES   S V+P EI +   VQ P TS   ++PT  V    P E  ++     V+P
Sbjct  5753  KLAPV-ESKETSEVQPAEIVEHKDVQVPETSSPTVEPT--VEKLAPVESKET---SEVEP  5806

Query  367   MEI--DRDVAQTPETTATTSEIT  387
              EI   +DV   PET+A T E T
Sbjct  5807  AEIVEQKDVP-VPETSAPTVEPT  5828


 Score = 37.7 bits (86),  Expect = 0.077, Method: Compositional matrix adjust.
 Identities = 70/203 (34%), Positives = 99/203 (49%), Gaps = 23/203 (11%)

Query  193   ESLMNSVVKPMEI--DRDVAQTPTTSPTIMRPTAAVSITKPTELTESLMISVVKPLEI-D  249
             ES   S V+P EI   +DV+   T++PT+  PT  +    P E  E+   S V+P EI +
Sbjct  6426  ESKETSEVEPAEIVEQKDVSVPETSAPTV-EPT--IEKLAPVESKET---SEVEPAEIVE  6479

Query  250   RDTVQTPTTSPTIMKPTATVYITKPTELTE-SLMKPMEI-DRAAAETPTIMRPTAAVSIT  307
             +  V  P TS   ++P  TV    P E  E S ++P EI ++     P    PT   ++ 
Sbjct  6480  QKDVSVPETSAPTVEP--TVEKLAPVESKETSEVEPAEIVEQKDVPVPETSAPTVEPTVE  6537

Query  308   KSTELNESLMISVVKPLEI-DRDTVQTPTTSPTIMKPTAAVSITKPTELTKSLIFPVVKP  366
             K   + ES   S V+P EI +   VQ P TS   ++PT  V    P E  ++     V+P
Sbjct  6538  KLAPV-ESKETSEVQPAEIVEHKDVQVPETSSPTVEPT--VEKLAPVESKET---SEVEP  6591

Query  367   MEI--DRDVAQTPETTATTSEIT  387
              EI   +DV   PET+A T E T
Sbjct  6592  AEIVEQKDVP-VPETSAPTVEPT  6613


 Score = 32.7 bits (73),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 68/207 (33%), Positives = 96/207 (46%), Gaps = 31/207 (15%)

Query  193   ESLMNSVVKPMEI--DRDV----AQTPTTSPTIMRPTAAVSITKPTELTESLMISVVKPL  246
             ES   S V+P EI   +DV       PT  PTI +         P E  E+   S V+P 
Sbjct  5602  ESKETSEVEPAEIVEQKDVPVPETSAPTVEPTIEK-------LAPVESKET---SEVEPA  5651

Query  247   EI-DRDTVQTPTTSPTIMKPTATVYITKPTELTE-SLMKPMEI-DRAAAETPTIMRPTAA  303
             EI ++  V  P TS   ++P  T+    P E  E S ++P EI ++     P    PT  
Sbjct  5652  EIVEQKDVSVPETSAPTVEP--TIEKLAPVESKETSEVEPAEIVEQKDVSVPETSAPTVE  5709

Query  304   VSITKSTELNESLMISVVKPLEI-DRDTVQTPTTSPTIMKPTAAVSITKPTELTKSLIFP  362
              ++ K   + ES   S V+P EI ++  V  P TS   ++PT  V    P E  ++    
Sbjct  5710  PTVEKLAPV-ESKETSEVEPAEIVEQKDVPVPETSAPTVEPT--VEKLAPVESKET---S  5763

Query  363   VVKPMEI--DRDVAQTPETTATTSEIT  387
              V+P EI   +DV Q PET++ T E T
Sbjct  5764  EVQPAEIVEHKDV-QVPETSSPTVEPT  5789


 Score = 32.0 bits (71),  Expect = 4.1, Method: Compositional matrix adjust.
 Identities = 80/263 (30%), Positives = 120/263 (46%), Gaps = 37/263 (14%)

Query  193   ESLMNSVVKPMEI--DRDVAQTPTTSPTIMRPTAAVSITKPTELTESLMISVVKPLEI-D  249
             ES   S V+P EI   +D+    T++PT+  PT  V    P E   S   S V+P EI +
Sbjct  6270  ESKETSEVEPAEIVEQKDLPVPETSAPTV-EPT--VEKLAPVE---SKKTSEVEPAEIVE  6323

Query  250   RDTVQTPTTSPTIMKPTATVYITKPTELTE-SLMKPMEI-DRAAAETPTIMRPTAAVSIT  307
             +  V  P TS   ++P  TV    P E  E S ++P EI ++     P    PT   ++ 
Sbjct  6324  QKDVPVPETSAPTVEP--TVEKLAPVESKETSEVEPAEIVEQKDVPVPETSAPTVEPTVE  6381

Query  308   KSTELNESLMISVVKPLEI-DRDTVQTPTTSPTIMKPTAAVSITKPTELTKSLIFPVVKP  366
             K   + ES   S V+P EI ++  V  P TS   ++PT  +    P E  ++     V+P
Sbjct  6382  KLAPV-ESKETSEVEPAEIVEQKDVPVPETSAPTVEPT--IEKLAPVESKET---SEVEP  6435

Query  367   MEI--DRDVAQTPETTATTSEITSGMFSAATITTAEIENLKSITTKTTVTEIESSSCNTT  424
              EI   +DV+  PET+A T E T             IE L  + +K T +E+E +     
Sbjct  6436  AEIVEQKDVS-VPETSAPTVEPT-------------IEKLAPVESKET-SEVEPAEIVEQ  6480

Query  425   SKASMEKLAAEKNEKATTKIIPI  447
                S+ + +A   E    K+ P+
Sbjct  6481  KDVSVPETSAPTVEPTVEKLAPV  6503


>Q8IBB0_PLAF7 unnamed protein product
Length=2399

 Score = 35.0 bits (79),  Expect = 0.39, Method: Compositional matrix adjust.
 Identities = 18/85 (21%), Positives = 52/85 (61%), Gaps = 0/85 (0%)

Query  850  ESTVGIENLRDAESAEKTKDLNVMDAADGTINLKDIESAKFIDSLIDLETTESADNLKDV  909
            E+ +  +N++D E  +  +D+  M+      ++K++E  K ++ + ++E  ++ +++K++
Sbjct  598  ENYLKYDNMKDMEDRKNMEDMKNMEDRKNMEDMKNMEYMKNMEYMKNMEYMKNMEDMKNM  657

Query  910  GSTGSSKDLKNIETTENTINLKDVE  934
                + +D+KN+E  +N  ++K++E
Sbjct  658  EDMKNMEDMKNMEDMKNMEDMKNME  682


 Score = 34.3 bits (77),  Expect = 0.83, Method: Compositional matrix adjust.
 Identities = 22/77 (29%), Positives = 42/77 (55%), Gaps = 3/77 (4%)

Query  898  ETTESADNLKDVGSTGSSKDLKNIETTENTINLKDVEL---TERTENFTYMESTECADNR  954
            E     DN+KD+    + +D+KN+E  +N  ++K++E     E  +N  YM++ E   N 
Sbjct  598  ENYLKYDNMKDMEDRKNMEDMKNMEDRKNMEDMKNMEYMKNMEYMKNMEYMKNMEDMKNM  657

Query  955  KNIATTADMGNQIDIES  971
            +++    DM N  D+++
Sbjct  658  EDMKNMEDMKNMEDMKN  674



Lambda      K        H
   0.320    0.136    0.408 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2184764352


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jan 6, 2022  5:17 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_014085170.1 PREDICTED: uncharacterized protein LOC106614135
[Bactrocera oleae]

Length=596
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

QRFPR_BRAFL  unnamed protein product                                  59.3    4e-09
Q9VW75_DROME  unnamed protein product                                 55.5    9e-08
Q71EB3_DROME  unnamed protein product                                 53.5    3e-07


>QRFPR_BRAFL unnamed protein product
Length=380

 Score = 59.3 bits (142),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 60/108 (56%), Gaps = 13/108 (12%)

Query  109  SLAFSDLINTTFLTAAYLSQISQEFVQVWILGRGMCHVVPFITNAAILVSSITLVGIAMD  168
            SLA SDL+ T       L Q     +Q WI+G  MC +VPFI   A+  S +TL GIA++
Sbjct  88   SLAASDLLITIVCIPVTLMQ---NMLQNWIMGDFMCKLVPFIQTIAVASSILTLTGIAIE  144

Query  169  RYFAVM-----RAVISFWNPGVIFCVLSMLSLWVAAIGASWPVFRVYE  211
            RY+A++     + ++S    G+I  +     +WV ++G + P+  V++
Sbjct  145  RYYAIIHPLKVKYLLSKTRAGIILAL-----VWVVSVGVATPMLFVHK  187


>Q9VW75_DROME unnamed protein product
Length=600

 Score = 55.5 bits (132),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 77/157 (49%), Gaps = 22/157 (14%)

Query  55   GILKEDLLQLTATERISFTTVMSLLLIISLCGNICSLHANMR-RQIRPFFRACLISLAFS  113
            GI+    +Q      I F  + + + ++ + GN+   +  +R R ++      + +LA S
Sbjct  55   GIIHNQFVQ------IFFYVLYATVFVLGVFGNVLVCYVVLRNRAMQTVTNIFITNLALS  108

Query  114  DLINTTF---LTAAYLSQISQEFVQVWILGRGMCHVVPFITNAAILVSSITLVGIAMDRY  170
            D++        T  Y       F+  W  GR +CH+V F    +I +S++TL  IA+DRY
Sbjct  109  DILLCVLAVPFTPLY------TFMGRWAFGRSLCHLVSFAQGCSIYISTLTLTSIAIDRY  162

Query  171  FAVMRAVISFWNPGVIF--CVLSMLSLWVAAIGASWP  205
            F ++      ++P +    C+  ++S+WV A+ A+ P
Sbjct  163  FVIIYP----FHPRMKLSTCIGIIVSIWVIALLATVP  195


>Q71EB3_DROME unnamed protein product
Length=455

 Score = 53.5 bits (127),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 67/134 (50%), Gaps = 9/134 (7%)

Query  74   TVMSLLLIISLCGNICSLHANMRRQIRPFFRA--CLISLAFSDLINTTFLTAAYLSQISQ  131
            TV S+L +IS  GN   L+   +R++R   R    L+ LA +DL+ T  L      +I  
Sbjct  43   TVYSILFVISTIGNSTVLYLLTKRRLRGPLRIDIMLMHLAIADLMVTLLLMPM---EIVW  99

Query  132  EFVQVWILGRGMCHVVPFITNAAILVSSITLVGIAMDRYFAVMRAVISFWNPGVIFCVLS  191
             +   W+    MC ++ F     + +SS  +V I++DRYFA+++ +   +N G I    +
Sbjct  100  AWTVQWLSTDLMCRLMSFFRVFGLYLSSYVMVCISLDRYFAILKPLKRSYNRGRIMLACA  159

Query  192  MLSLWVAAIGASWP  205
                W+ ++  S P
Sbjct  160  ----WLGSVVCSIP  169



Lambda      K        H
   0.324    0.134    0.407 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7057096832


Query= XP_014085171.1 PREDICTED: uncharacterized protein LOC106614136
[Bactrocera oleae]

Length=235
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

INP5E_DROME  unnamed protein product                                  33.1    0.20 
Q8IN24_DROME  unnamed protein product                                 29.3    3.3  
E1JHL3_DROME  unnamed protein product                                 29.3    3.4  


>INP5E_DROME unnamed protein product
Length=747

 Score = 33.1 bits (74),  Expect = 0.20, Method: Compositional matrix adjust.
 Identities = 18/49 (37%), Positives = 26/49 (53%), Gaps = 0/49 (0%)

Query  117  KAKMMPLEQKGSLLIAGHFRSKKSLTGGSPLGGRTCMDCVADGDGGVGV  165
            K++ +PLE+  S LI+ H R+K S + G     R   D  +  DGG  V
Sbjct  87   KSQTLPLEKSHSGLISFHRRAKPSSSKGKNHSHRHSTDAGSQSDGGADV  135


>Q8IN24_DROME unnamed protein product
Length=1220

 Score = 29.3 bits (64),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 13/49 (27%), Positives = 23/49 (47%), Gaps = 4/49 (8%)

Query  85   TASSSYWTITPCWWQPNRCRIEEFTGTQRQSTKAKMMPLEQKGSLLIAG  133
            T S+ +W +T    Q + C +EE       +    ++PL   G + +AG
Sbjct  259  TYSTDWWNVT----QDSECSVEEIATALEGAILVDLLPLSTSGDITVAG  303


>E1JHL3_DROME unnamed protein product
Length=470

 Score = 29.3 bits (64),  Expect = 3.4, Method: Compositional matrix adjust.
 Identities = 17/59 (29%), Positives = 27/59 (46%), Gaps = 1/59 (2%)

Query  95   PCWWQPNRCRIEEFTGTQRQSTKAKMMPLEQKGSLLIAGHFRSKKSLTGGSPLGGRTCM  153
            P    P++CR +EF GT  +  + +   L  + +   A  FRS + L+   P  G   M
Sbjct  32   PEQLDPSQCR-DEFIGTFIREHELRASSLRPRSTFRAASEFRSSQDLSDQGPEKGAEAM  89



Lambda      K        H
   0.324    0.134    0.407 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7057096832


Query= XP_014085172.1 PREDICTED: ubiquitin-associated domain-containing
protein 1 isoform X1 [Bactrocera oleae]

Length=560
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8SYN6_DROME  unnamed protein product                                 43.1    4e-04
Q9VSC5_DROME  unnamed protein product                                 43.1    4e-04
RAD23_DICDI  unnamed protein product                                  35.0    0.15 


>Q8SYN6_DROME unnamed protein product
Length=330

 Score = 43.1 bits (100),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 28/37 (76%), Gaps = 3/37 (8%)

Query  346  LQCLVDMGFKKEKAEYALKVT--QGVYSTALEWLIQH  380
            +Q L+DMGF +E+ EYAL+VT  +GV   A+EWL+ H
Sbjct  4    VQTLMDMGFPRERVEYALEVTSNKGV-EPAMEWLLAH  39


>Q9VSC5_DROME unnamed protein product
Length=331

 Score = 43.1 bits (100),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 28/37 (76%), Gaps = 3/37 (8%)

Query  346  LQCLVDMGFKKEKAEYALKVT--QGVYSTALEWLIQH  380
            +Q L+DMGF +E+ EYAL+VT  +GV   A+EWL+ H
Sbjct  4    VQTLMDMGFPRERVEYALEVTSNKGV-EPAMEWLLAH  39


>RAD23_DICDI unnamed protein product
Length=342

 Score = 35.0 bits (79),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 1/37 (3%)

Query  437  TINSLVEMGFEETEVLKALKKTCNNKAAACEWLC-GN  472
            TI ++ +MGF   +VL+AL+ T NN   A E+L  GN
Sbjct  166  TIKNITDMGFARDQVLRALRLTFNNAERAIEYLVSGN  202



Lambda      K        H
   0.324    0.134    0.407 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7057096832


Query= XP_014085173.1 PREDICTED: ubiquitin-associated domain-containing
protein 1 isoform X2 [Bactrocera oleae]

Length=441
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8SYN6_DROME  unnamed protein product                                 43.1    3e-04
Q9VSC5_DROME  unnamed protein product                                 43.1    3e-04
Q9VZU7_DROME  unnamed protein product                                 35.4    0.11 


>Q8SYN6_DROME unnamed protein product
Length=330

 Score = 43.1 bits (100),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 28/37 (76%), Gaps = 3/37 (8%)

Query  227  LQCLVDMGFKKEKAEYALKVT--QGVYSTALEWLIQH  261
            +Q L+DMGF +E+ EYAL+VT  +GV   A+EWL+ H
Sbjct  4    VQTLMDMGFPRERVEYALEVTSNKGV-EPAMEWLLAH  39


>Q9VSC5_DROME unnamed protein product
Length=331

 Score = 43.1 bits (100),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 28/37 (76%), Gaps = 3/37 (8%)

Query  227  LQCLVDMGFKKEKAEYALKVT--QGVYSTALEWLIQH  261
            +Q L+DMGF +E+ EYAL+VT  +GV   A+EWL+ H
Sbjct  4    VQTLMDMGFPRERVEYALEVTSNKGV-EPAMEWLLAH  39


>Q9VZU7_DROME unnamed protein product
Length=827

 Score = 35.4 bits (80),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 53/122 (43%), Gaps = 27/122 (22%)

Query  230  LVDMGFKKEKAEYALKVTQGV-YSTALEWLIQHQSEESSLEEAAMGLQKSQSVLSPSGIL  288
            L+ MGF  E  + A   T+      A  WL++H ++E                +S   ++
Sbjct  637  LLTMGFPPEACKRACYHTKNSGLEAASNWLMEHIADED---------------ISEPFVV  681

Query  289  TNDSIVENTEALLEIVRIYSHRDMPPTPETINSLVEMGFEETEVLKALKKTCNNKAAACE  348
             N+SI +   A  + V           PE++  L+ MGF+E + + ALK T  N   A +
Sbjct  682  PNNSIGDC--AANQFVA---------NPESLAMLMSMGFDERQAVAALKATDGNVERATD  730

Query  349  WL  350
            W+
Sbjct  731  WI  732


 Score = 32.0 bits (71),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 14/37 (38%), Positives = 21/37 (57%), Gaps = 0/37 (0%)

Query  225  DTLQCLVDMGFKKEKAEYALKVTQGVYSTALEWLIQH  261
            ++L  L+ MGF + +A  ALK T G    A +W+  H
Sbjct  699  ESLAMLMSMGFDERQAVAALKATDGNVERATDWIFSH  735



Lambda      K        H
   0.324    0.134    0.407 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7057096832


Query= XP_014085174.1 PREDICTED: serine/threonine-protein kinase prpf4B
[Bactrocera oleae]

Length=240
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7K1H5_DROME  unnamed protein product                                 107     2e-28
Q9VM49_DROME  unnamed protein product                                 36.2    0.020
CWC22_DROME  unnamed protein product                                  35.8    0.026


>Q7K1H5_DROME unnamed protein product
Length=219

 Score = 107 bits (268),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 99/209 (47%), Positives = 132/209 (63%), Gaps = 13/209 (6%)

Query  35   RDRDRERYGERDRDRHYARKYHSKSKSPSRSSRSKKSKKSKKSKKYSRRSPSSSSSSSSS  94
            R+RDRER  +R        +   +   P +    K  K S++S+  SR +  SSSSS SS
Sbjct  21   RERDRERDRDRRHRSKSPSRSSRQVSKPKKKKAKKSKKYSRRSRSSSRSTSRSSSSSRSS  80

Query  95   SYSVASRSSRNSH-KSRSQA-RSTRAPSSEENSRTAASAAVAVATLKGIDAIDAQVRKAL  152
            S S  S+S    H KSRS + R TR PSSE NSR+A +   A A +K ID  D +V+KAL
Sbjct  81   SRSTHSKSRTRDHHKSRSISQRKTRGPSSESNSRSATTP--AAAPVKAIDLFDTKVQKAL  138

Query  153  DAIEEEAFQPKTFFSTRDREAPEKKPLPEKVIIDLESETVKLP-KPNDASKDTNADEKIF  211
            + I+E+ F+P++FFS+RD      K   +KVIIDL +ETV +  KP  A ++   ++ IF
Sbjct  139  ETIDEDTFKPESFFSSRD-----SKETSDKVIIDLNNETVTVASKPATAVRN---EDVIF  190

Query  212  HPNFIGDADLKAEKWLRKLYNYRQRYYQE  240
            HPNF+GD D+KAEKWLRKLYNYRQ+Y QE
Sbjct  191  HPNFLGDPDMKAEKWLRKLYNYRQKYMQE  219


>Q9VM49_DROME unnamed protein product
Length=594

 Score = 36.2 bits (82),  Expect = 0.020, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 23/34 (68%), Gaps = 5/34 (15%)

Query  17   RDRGRDRDKERDRDRERDRDRDRERYGERDRDRH  50
            RDRG +R   RD+D+ERDR+RD       DRDRH
Sbjct  82   RDRGNERSSHRDKDKERDRNRD-----GGDRDRH  110


 Score = 30.4 bits (67),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 15/24 (63%), Positives = 19/24 (79%), Gaps = 0/24 (0%)

Query  9    SRRDRDRDRDRGRDRDKERDRDRE  32
            SRRDR  +R   RD+DKERDR+R+
Sbjct  80   SRRDRGNERSSHRDKDKERDRNRD  103


>CWC22_DROME unnamed protein product
Length=1330

 Score = 35.8 bits (81),  Expect = 0.026, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 30/45 (67%), Gaps = 2/45 (4%)

Query  7     KSSRRDRDRDRDRGR--DRDKERDRDRERDRDRDRERYGERDRDR  49
             +  R DR    DRG   DR+KER R +ER+RDRDR+  G+R+R R
Sbjct  1263  RGERSDRGERSDRGERSDREKERSRAKERERDRDRDLKGQRERKR  1307


 Score = 29.3 bits (64),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 22/31 (71%), Gaps = 0/31 (0%)

Query  16    DRDRGRDRDKERDRDRERDRDRDRERYGERD  46
             DR++ R R KER+RDR+RD    RER  ERD
Sbjct  1280  DREKERSRAKERERDRDRDLKGQRERKRERD  1310



Lambda      K        H
   0.324    0.134    0.407 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7057096832


Query= XP_014085175.1 PREDICTED: 39S ribosomal protein L41, mitochondrial
[Bactrocera oleae]

Length=168
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q38CM1_TRYB2  unnamed protein product                                 33.5    0.073
Q38DK6_TRYB2  unnamed protein product                                 30.0    0.95 
C4D21_DROME  unnamed protein product                                  29.3    1.7  


>Q38CM1_TRYB2 unnamed protein product
Length=427

 Score = 33.5 bits (75),  Expect = 0.073, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 36/78 (46%), Gaps = 7/78 (9%)

Query  93   TDCKLKP------YVSYKSPEVIQSEFTSLDLFNAVYSKKLIEDFKEGKLNDDGSPVNPS  146
            TDC L P        +Y    V  S FT LD   +   + L +  K G +N D  P NPS
Sbjct  24   TDCALSPEEWPLLLKNYDRLNVRSSHFTVLDCGWSPLRRPLSQYVKYGMINLD-KPSNPS  82

Query  147  KDEQLTADEALIRARKTG  164
              E ++  + +++  KTG
Sbjct  83   SHEVVSWIKRILKCEKTG  100


>Q38DK6_TRYB2 unnamed protein product
Length=440

 Score = 30.0 bits (66),  Expect = 0.95, Method: Compositional matrix adjust.
 Identities = 29/104 (28%), Positives = 47/104 (45%), Gaps = 4/104 (4%)

Query  48   KEAQKTLA--NPPVPIDKRGVRDTGVTIDGRFVEIPERIPELIVPDLTDCKLKPYVSYKS  105
            KE  K +A  N P P++  G        DG  VE+PE +    + +  D   KP+  + S
Sbjct  162  KELDKYVAGKNEPYPLNFVGQMPFLEDGDGNIVEVPESLLSNHMAEHPDSTAKPHEPHTS  221

Query  106  PEVIQSEFTSLDLFNAVYSKKLIEDFKEGKLNDDGSPVNPSKDE  149
              + ++      +  A+ S K  ED KE  L DD   ++ + D+
Sbjct  222  SSISEAAAFEERMLRAMVSAKE-EDLKEW-LGDDSRALSETIDD  263


>C4D21_DROME unnamed protein product
Length=511

 Score = 29.3 bits (64),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 28/61 (46%), Gaps = 14/61 (23%)

Query  47   VKEAQKTLANPPVPIDKRGVRDTGVTIDGRFVEIPERIPELIVPDLTDCKLKPYVSYKSP  106
            +KE  +   +PPVPI             GR++    +I E+ +P  T   L PY  Y+ P
Sbjct  373  IKETMRL--HPPVPIL------------GRYIPEDLKIGEITIPGNTSILLMPYYVYRDP  418

Query  107  E  107
            E
Sbjct  419  E  419



Lambda      K        H
   0.324    0.134    0.407 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7057096832


Query= XP_014085176.1 PREDICTED: vacuolar protein sorting-associated
protein 51 homolog [Bactrocera oleae]

Length=733
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

VPS51_CAEEL  unnamed protein product                                  240     4e-69
G8XYY4_CAEEL  unnamed protein product                                 161     7e-42
COG8_DROME  unnamed protein product                                   42.7    0.001


>VPS51_CAEEL unnamed protein product
Length=700

 Score = 240 bits (613),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 189/732 (26%), Positives = 357/732 (49%), Gaps = 53/732 (7%)

Query  6    SNPYDMDSSAFDSEKYLEKLLKDCTLKQIMDTETAVIKDTQTLHSDMQTLVYENYNKFIS  65
            S+  D+    FD E ++ KLL++ +L  ++  E  ++   + L SD+  +VYENYNKF++
Sbjct  2    SSVLDVTKPDFDVEAFVVKLLREKSLDGLVKEEEEMVSAVRRLDSDVHQIVYENYNKFLT  61

Query  66   ATDTIRKMKNDFKEMESDMNLLRNKMNSITSFSEQITDTLQGTRSQLCRLAEKHSLLKRL  125
            AT+T+RK++++F +++S+M  L   M++I++    +   L   R  + +L   + ++  L
Sbjct  62   ATNTVRKIQDEFTQLDSEMKSLSRSMSTISTLIGNLDGVLGEKRDDILQLGSSYKVVNSL  121

Query  126  QFLSSLPAKLKGLIEEQNYTQAVQDYLHAQMVFAQYGRQPSFDGIQRDCVSILLDLKGRL  185
            + +  LP  L+   +E+NY + ++ +  A+   +QY   P+   + +    I    + +L
Sbjct  122  KHIFDLPHVLRSEFDERNYGEVLRMFKLAEESLSQYKDVPTVQLVLQKSKKIYDMTENQL  181

Query  186  RIDFQKASNSAQSLSEIGELLLQLDEKPTDLANEMLTCAAKRLHEQIVLLQDQTERDMIE  245
                +  ++ A+ +SE  +LLL +     ++   +LTC+ + L   +  L      D+++
Sbjct  182  MDQLRNPASGAELVSEAVDLLLTIGRDEDEVQKVLLTCSEQSLRVDLKELS-ANHSDVLD  240

Query  246  FVDMGIEGFLNDLTLVVTSYFDMFVTKSYDKESDDFQEHSLRQLNVFLNQNVDKYLTLVH  305
             VD   E F+ +LTL+ T++  +F  K  D             L   L   ++    LV 
Sbjct  241  LVDKASESFIPNLTLIATTHDRLFEDKRED-------------LITVLKTEMNSLHALVS  287

Query  306  DRVESDIGFGDTQILLRALDRLHRRLLAMRNICRGLEIQRNTVDIIIAAAHQLCEAHSKS  365
                S     D  I++RALDR  R++   R +  GL+    T+++I A +    +     
Sbjct  288  KVFLSSSDAKDCSIVVRALDRYFRKISTCRYVIPGLDFLPLTIELINAVSKHEIDLSLTR  347

Query  366  LKDHFSDSLSSVRLALVSAKSDNNTGANLNELITNLYMSMVEKVKGVLQDLLVFLQTDWS  425
            +K+   + L+ VR AL++ + D      L+ L + +    V +VK  L +LL+F  +D +
Sbjct  348  IKEELKNGLNEVRKALINEEKD------LSALASKIEQVFVHQVKTALANLLLFTASDVT  401

Query  426  F-NIKAD-YKGGLCVEGIRESLLIGFMRHISKVMCSFAEISSP---SPPNLLLVLSKTCL  480
            F N+  D ++         E LL+      S++   +   +       P + LV +    
Sbjct  402  FANLPPDEFRQSFSFNA-HERLLVQAFHRFSELADEYESGAGEIRFVDPRVHLVFAVALQ  460

Query  481  EMEQNGVHILITLVDDLYEIDSENSAVLTHETEICAEMRETAQTLLDAYVRLQGTNISQM  540
             +       L+ L  + + +  ++   LT  T + +E++  AQ L+  Y    G ++ + 
Sbjct  461  HLSNKSAVYLLNLCREQFSLSPDDG--LTDITVVMSEVKTRAQKLVRCYAEKTGLSMGET  518

Query  541  MRKSVETRDWLNCLEPRSVRAVMKRVVEELGSIETVVASLYEAGVRTTASSDSSRKTHFS  600
            + K            P +VRA ++R+VEE+ + ++ + +L   G      S  SR+    
Sbjct  519  LIKGCAML-VQPAATPSAVRASVRRLVEEMNTCDSEL-TLLLGGDSKPKDSRVSRR----  572

Query  601  TLTTTKQHYRSNWSNYTPSQLESSYVSNIHRLFSERIDIFTNVDFSKVSIVTGIIKIGLK  660
             +TT     R +                   L+ ERID    + F++ SI+T I+K+ LK
Sbjct  573  PITTALDAARDS-------------------LWCERIDFHLQIHFNRASIITVIVKVVLK  613

Query  661  TLLECVRFRTFSKFGLQQVQVDTHYLQMNLWRFVADENLVNFLLDEILGSAVHRCLESIL  720
              +E +R +T+SKFG++QVQVD +YLQ  L   V+DE +VN ++D+ L SA+ RC + +L
Sbjct  614  IFIESIRLQTYSKFGVEQVQVDCYYLQRCLAALVSDEVVVNSMVDQALSSALKRCQDPVL  673

Query  721  MEPNAVEIICER  732
            + P+ +  +CE+
Sbjct  674  VHPSRLAQLCEQ  685


>G8XYY4_CAEEL unnamed protein product
Length=585

 Score = 161 bits (408),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 141/594 (24%), Positives = 279/594 (47%), Gaps = 29/594 (5%)

Query  6    SNPYDMDSSAFDSEKYLEKLLKDCTLKQIMDTETAVIKDTQTLHSDMQTLVYENYNKFIS  65
            S+  D+    FD E ++ KLL++ +L  ++  E  ++   + L SD+  +VYENYNKF++
Sbjct  2    SSVLDVTKPDFDVEAFVVKLLREKSLDGLVKEEEEMVSAVRRLDSDVHQIVYENYNKFLT  61

Query  66   ATDTIRKMKNDFKEMESDMNLLRNKMNSITSFSEQITDTLQGTRSQLCRLAEKHSLLKRL  125
            AT+T+RK++++F +++S+M  L   M++I++    +   L   R  + +L   + ++  L
Sbjct  62   ATNTVRKIQDEFTQLDSEMKSLSRSMSTISTLIGNLDGVLGEKRDDILQLGSSYKVVNSL  121

Query  126  QFLSSLPAKLKGLIEEQNYTQAVQDYLHAQMVFAQYGRQPSFDGIQRDCVSILLDLKGRL  185
            + +  LP  L+   +E+NY + ++ +  A+   +QY   P+   + +    I    + +L
Sbjct  122  KHIFDLPHVLRSEFDERNYGEVLRMFKLAEESLSQYKDVPTVQLVLQKSKKIYDMTENQL  181

Query  186  RIDFQKASNSAQSLSEIGELLLQLDEKPTDLANEMLTCAAKRLHEQIVLLQDQTERDMIE  245
                +  ++ A+ +SE  +LLL +     ++   +LTC+ + L   +  L      D+++
Sbjct  182  MDQLRNPASGAELVSEAVDLLLTIGRDEDEVQKVLLTCSEQSLRVDLKELS-ANHSDVLD  240

Query  246  FVDMGIEGFLNDLTLVVTSYFDMFVTKSYDKESDDFQEHSLRQLNVFLNQNVDKYLTLVH  305
             VD   E F+ +LTL+ T++  +F  K  D             L   L   ++    LV 
Sbjct  241  LVDKASESFIPNLTLIATTHDRLFEDKRED-------------LITVLKTEMNSLHALVS  287

Query  306  DRVESDIGFGDTQILLRALDRLHRRLLAMRNICRGLEIQRNTVDIIIAAAHQLCEAHSKS  365
                S     D  I++RALDR  R++   R +  GL+    T+++I A +    +     
Sbjct  288  KVFLSSSDAKDCSIVVRALDRYFRKISTCRYVIPGLDFLPLTIELINAVSKHEIDLSLTR  347

Query  366  LKDHFSDSLSSVRLALVSAKSDNNTGANLNELITNLYMSMVEKVKGVLQDLLVFLQTDWS  425
            +K+   + L+ VR AL++ + D      L+ L + +    V +VK  L +LL+F  +D +
Sbjct  348  IKEELKNGLNEVRKALINEEKD------LSALASKIEQVFVHQVKTALANLLLFTASDVT  401

Query  426  F-NIKAD-YKGGLCVEGIRESLLIGFMRHISKVMCSFAEISSP---SPPNLLLVLSKTCL  480
            F N+  D ++         E LL+      S++   +   +       P + LV +    
Sbjct  402  FANLPPDEFRQSFSFNA-HERLLVQAFHRFSELADEYESGAGEIRFVDPRVHLVFAVALQ  460

Query  481  EMEQNGVHILITLVDDLYEIDSENSAVLTHETEICAEMRETAQTLLDAYVRLQGTNISQM  540
             +       L+ L  + + +  ++   LT  T + +E++  AQ L+  Y    G ++ + 
Sbjct  461  HLSNKSAVYLLNLCREQFSLSPDDG--LTDITVVMSEVKTRAQKLVRCYAEKTGLSMGET  518

Query  541  MRKSVETRDWLNCLEPRSVRAVMKRVVEELGSIETVVASLYEAGVRTTASSDSS  594
            + K            P +VRA ++R+VEE+ + ++ +  L     +   S  SS
Sbjct  519  LIKGCAML-VQPAATPSAVRASVRRLVEEMNTCDSELTLLLGGDSKPKDSRSSS  571


>COG8_DROME unnamed protein product
Length=570

 Score = 42.7 bits (99),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 77/178 (43%), Gaps = 9/178 (5%)

Query  19   EKYLEKLLKDCTLKQIMDTETAVIKDTQTLHSDMQTLVYENYNKFISATDTIRKMKNDFK  78
            + YL KL   C ++Q+   +T + ++ +T+    Q L   NY  FI+  +  R + ++F 
Sbjct  34   DNYLAKL-GTCKVEQLKKEQTRLAEEARTILEQTQDLAISNYRTFITTAENSRSIFSEFL  92

Query  79   EMESDMNLLRNKMNSITSFSEQITDTLQGTRSQLCRLAEKHSLLKRLQFLS--SLPAKLK  136
              E  ++ L +K+  ++   E+          Q  R     +L K  Q L    LP  ++
Sbjct  93   RSEQQLDTLVSKLPDLSVQCERFLQDSAELNEQ--RRLNSITLQKNAQLLEVLELPQLME  150

Query  137  GLIEEQNYTQAVQDYLHAQMVFAQYGRQPSFDGIQRDCVSI----LLDLKGRLRIDFQ  190
              I E  Y +A++   +A  +    G  P    I R   ++    L+ L  +LR D Q
Sbjct  151  RCIREGRYEEALELAAYATRLGQHQGHIPVVTSIVRSVEALWHNMLVQLVAQLRTDLQ  208



Lambda      K        H
   0.324    0.134    0.407 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7057096832


Query= XP_014085177.1 PREDICTED: spondin-1-like [Bactrocera oleae]

Length=904
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7KN04_DROME  unnamed protein product                                 403     6e-128
Q19305_CAEEL  unnamed protein product                                 349     7e-107
Q95S22_DROME  unnamed protein product                                 188     1e-51 


>Q7KN04_DROME unnamed protein product
Length=763

 Score = 403 bits (1036),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 224/566 (40%), Positives = 310/566 (55%), Gaps = 39/566 (7%)

Query  4    LALIISISATINIALGCSRVPPGTT-SPKSPVDESFMVSIAGNPQSYIPGQKYNITL---  59
            + LI+ I  TI++   C R P       ++  D  + + +A  P  Y+PG+ YN+ L   
Sbjct  9    IRLIVVIWLTISMVTACPRAPTHLNHGRRTRGDNGYKLIVADGPNGYVPGKTYNLLLLGS  68

Query  60   -TAYNDLSFISFILALESASEA--DGQSDFGRLGYFEITDLAETRFSPRCPNLVENTNTN  116
             T      F  F +  E+ + A     +   R+G F++   + T+F+ RC N V   +  
Sbjct  69   RTHLKVQHFTHFTITAEAHTGARRPQAASPRRVGRFQLFSDSLTQFNDRCVNTVSEADDL  128

Query  117  VKTRVEVTWVAPSTTGNGCVLIKATVTQHRDVWFMDDGFLTKRICEEEVDDVDTQPTIMD  176
             KT V+V WVAP + G+GCV + A V +    WF DDG L+  ICE + D    Q     
Sbjct  129  PKTEVQVMWVAPES-GSGCVSLSAMVYEGPRAWFADDGNLSTVICERKPDAAAAQ----K  183

Query  177  PCCACDEAKYELTFEGKWSRHTHPKDFPANSWRTRFSDIIGASHTIDYRFWTYGELASEG  236
             CCACDEAKY   FEG WS  THPKD+P   W T FSD+IGASH  ++ FW    +A+ G
Sbjct  184  ECCACDEAKYSFVFEGIWSNETHPKDYPFAIWLTHFSDVIGASHESNFSFWGENHIATAG  243

Query  237  LREVAEHGSTRTLESELKDQSDQIRTIIKARGISYPNVTGKTFAVFRVDSKHHVISLVSM  296
             R +AE GS   LE+EL+    ++RT+IKA G+ YPNV   T + FRVD KH  +SLVSM
Sbjct  244  FRSLAEWGSPAALETELRANGPKLRTLIKAAGLWYPNVNQNTSSKFRVDRKHPKVSLVSM  303

Query  297  IDPSPDWIVGISGLELCLANCSWVENKVHNLYPWDAGTDSGPSYMSADQPQVPPDVIRRI  356
              PSPDW+VGISGL+LC  +CSW E+   +L+PWDAGTDSG SYMS +    PP+ + RI
Sbjct  304  FGPSPDWVVGISGLDLCTEDCSWKESMDFDLFPWDAGTDSGISYMSPNSETQPPERMYRI  363

Query  357  KSNFPNDPRSPFYDPTGAPMKPLATLHINRRRLYEKTC--------------KKPEEDES  402
             + +P DPR+PFY+P    M PLA L++ R ++  + C                 E+D  
Sbjct  364  TTMYPEDPRAPFYNPKSREMTPLAKLYLRREKIVSRNCDDEFLQALQLEVSDDAEEQDTR  423

Query  403  EECATYPWGHWSECSAKCGPGTQQRTREYKQPAVARRSKCRSALREEQPCNGR--RC---  457
             EC    +  WS CS  CG G + R+R+Y  PA A ++KC   L  ++ C      C   
Sbjct  424  AECRVGDYSAWSPCSVSCGKGIRMRSRQYLYPAAADQNKCARQLVAKEMCVAAIPECADG  483

Query  458  -GSTNEENTEEGENPDEIQIGPHENPE----CAISDWSEWSSCSATCGAGVIVRTRHYLN  512
               + + + +EGEN    Q     N E    C  S WS WS CSA+CG G+ +RTR ++N
Sbjct  484  PAQSKDRDDDEGENLANSQSLVGSNGEGAGLCKTSPWSVWSECSASCGIGITMRTRTFVN  543

Query  513  PRAKKKCQKVSRVRLQETRKCEGPEC  538
               +K+C  ++ V   E  KC  P+C
Sbjct  544  HLGRKRCPHITIV---EKNKCMRPDC  566


 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 86/279 (31%), Positives = 116/279 (42%), Gaps = 47/279 (17%)

Query  405  CATYPWGHWSECSAKCGPGTQQRTREYKQPAVARRSKCRSALREEQPCNGRRCGSTNEEN  464
            C T PW  WSECSA CG G   RTR +    + R+      + E+  C    C       
Sbjct  515  CKTSPWSVWSECSASCGIGITMRTRTFVN-HLGRKRCPHITIVEKNKCMRPDC------T  567

Query  465  TEEGENPDEIQIGPHENPECAISDWSEWSSCSATCGAGVIVRTRHYLNPRAKKKCQKVSR  524
             E+ E PD         P+C  S WS+WS CS+TCG GV +RTR  L      K     R
Sbjct  568  YEQVELPD---------PQCPTSQWSDWSPCSSTCGRGVTIRTRLLLLENGPDKESCTQR  618

Query  525  VRLQETRKCEGP-------ECGGDL-ANAGAEAEANGEGDEAAAEEGNAVENELSEG---  573
            + L + ++C  P       E   D+   A       G     A +  N      + G   
Sbjct  619  MELHQQKECVNPIDCHINAEQAKDICVQAPDPGPCRGTYMRYAYDPQNQHCYSFTYGGCR  678

Query  574  --TSSFYGDNN--NGFRQFKSYSQKREDYIPPECGVSPWSDFSPCIGSCGSVGYRQRQRK  629
               ++F  +N+  N     +S    R D  P  C +S WS +SPC  SCG VG  + +R 
Sbjct  679  GNRNNFLTENDCLNTCNVLRSPYSSRVDQ-PRACVLSDWSVWSPCSVSCG-VGVSESRR-  735

Query  630  IWNNDEVYGVVNPKSDGSNPC--RHIKREEIVNCTNPAC  666
                   Y V  P+ +G  PC  R +K     +C  PAC
Sbjct  736  -------YVVTEPQ-NGGQPCSKRLVKSR---SCAMPAC  763


 Score = 57.0 bits (136),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 46/163 (28%), Positives = 70/163 (43%), Gaps = 9/163 (6%)

Query  731  QKLDLQSESLRLEQQP-VDCIVSEWDA-RPCNVTCGEGMLIKTRRVLRRAKYGGKPCPKH  788
            Q L L+      EQ    +C V ++ A  PC+V+CG+G+ +++R+ L  A      C + 
Sbjct  407  QALQLEVSDDAEEQDTRAECRVGDYSAWSPCSVSCGKGIRMRSRQYLYPAAADQNKCARQ  466

Query  789  LVRLEKCYQSCDEVYTISGGINFGGNTNDPSDYDAVNRNRGTYVSARQVAKKDDCRYSEW  848
            LV  E C      V  I    +    + D  D +  N      +          C+ S W
Sbjct  467  LVAKEMC------VAAIPECADGPAQSKDRDDDEGENLANSQSLVGSNGEGAGLCKTSPW  520

Query  849  TAWTPCTASCGDNSMRQKTRTLLNTEISYRCKDRVRVEKCTVM  891
            + W+ C+ASCG   +  +TRT +N     RC     VEK   M
Sbjct  521  SVWSECSASCGIG-ITMRTRTFVNHLGRKRCPHITIVEKNKCM  562


 Score = 38.1 bits (87),  Expect = 0.040, Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 59/152 (39%), Gaps = 43/152 (28%)

Query  749  CIVSEW-DARPCNVTCGEGMLIKTRRVLRRAKYGGKPCPKHLVRLEK-------------  794
            C  S+W D  PC+ TCG G+ I+TR +L       + C + +   ++             
Sbjct  578  CPTSQWSDWSPCSSTCGRGVTIRTRLLLLENGPDKESCTQRMELHQQKECVNPIDCHINA  637

Query  795  ------CYQSCD------------------EVYTISGGINFGGNTNDPSDYDAVNR---N  827
                  C Q+ D                    Y+ + G   G   N  ++ D +N     
Sbjct  638  EQAKDICVQAPDPGPCRGTYMRYAYDPQNQHCYSFTYGGCRGNRNNFLTENDCLNTCNVL  697

Query  828  RGTYVSARQVAKKDDCRYSEWTAWTPCTASCG  859
            R  Y S  +V +   C  S+W+ W+PC+ SCG
Sbjct  698  RSPYSS--RVDQPRACVLSDWSVWSPCSVSCG  727


 Score = 33.1 bits (74),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 28/59 (47%), Gaps = 12/59 (20%)

Query  383  HINRRR-----LYEKT-CKKPE------EDESEECATYPWGHWSECSAKCGPGTQQRTR  429
            H+ R+R     + EK  C +P+      E    +C T  W  WS CS+ CG G   RTR
Sbjct  544  HLGRKRCPHITIVEKNKCMRPDCTYEQVELPDPQCPTSQWSDWSPCSSTCGRGVTIRTR  602


>Q19305_CAEEL unnamed protein product
Length=819

 Score = 349 bits (896),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 252/891 (28%), Positives = 398/891 (45%), Gaps = 182/891 (20%)

Query  20   CSRVPPGTTSPKSPVDESFMVSIAGN-------PQSYIPGQKYNITL----TAYNDLSFI  68
            C+  P      KSP    +++ I G         + ++PG+ Y +++    T Y   +F 
Sbjct  27   CTIKPYEAKGDKSPGSNGYVIEINGTTTKSMDISKGFVPGEIYKVSIRGWRTQYTVKTFR  86

Query  69   SFILALESASEADGQSDFGRLGYFEITDLAETRFSPRC-PNLVENTNTNVKTRVEVTWVA  127
             F+++          S      +  +    + R SP C  + V + N   KT V + W A
Sbjct  87   GFVVSSLFEDNTSAGS------WQVVKGHGDARISPGCRQSGVSHANLKSKTSVHMMWKA  140

Query  128  PSTTGNGCVLIKATVTQHRDVWFMDDGFLTKRICEEEVDDVDTQPTIMDP---CCACDEA  184
            P  + +GCV+ +A+V + + +WF +   LT ++C ++   +  +P + DP   CCACD A
Sbjct  141  PEVS-SGCVVFRASVIETKYIWFTEAEGLTVKLCIQKGTQI-LKP-VDDPSATCCACDIA  197

Query  185  KYELTFEGKWSRHTHPKDFPANSWRTRFSDIIGASHTIDYRFWTYGELASEGLREVAEHG  244
            +Y+L F G WS++THPKD+P     T F+D++G+SH+ +Y  WT G ++++G++E+AE G
Sbjct  198  QYDLEFTGIWSKNTHPKDYPTLEHLTHFTDMLGSSHSSNYSLWTIGGISTDGMKEIAEWG  257

Query  245  STRTLESELKDQSDQIRTIIKARGISYPNVTGKTFAVFRVDSKHHVISLVSMIDPSPDWI  304
            +T   E+E K ++ ++R+++K +G+ +P+V G T + F V+  HH +SL +M  PSPDW 
Sbjct  258  NTYKAEAEAKAKASEVRSLMKVKGLWFPDVQGTTKSQFVVNKYHHFVSLATMFGPSPDWC  317

Query  305  VGISGLELCLANCSWVENKVHNLYPWDAGTDSGPSYMSADQPQVPPDVIRRIKSNFPNDP  364
            VG+S + LCL +C+W E +   L P+DAGTDSGP+YMS ++P  P + I  I +    +P
Sbjct  318  VGLSSVNLCLPDCTWAEERTFELQPFDAGTDSGPTYMSPNEPTEPREPIHWITTKL--NP  375

Query  365  RSPFYDPTGAPMKPLATLHINRRRLYEKTCKKPE-------------EDES----EECAT  407
             SPFY+     +  LA + + R+ +    CK  +             EDE      EC  
Sbjct  376  LSPFYNSKSDTIPTLAKVILRRKNVTSSECKSDDILKAEAHNITNTSEDEEYKDRRECMM  435

Query  408  YPWGHWSECSAKCGPGTQQRTREYKQPAVARRSKCRSALREEQPCNGRRCGSTNEENTEE  467
              W  WS CSA CG G + R+R Y  P  A+   C     E+Q CN +           E
Sbjct  436  TQWEPWSLCSATCGKGIRIRSRVYVFPIKAQVFHCHRQTTEKQFCNAK---------INE  486

Query  468  GENPDEIQIGPHENPECAISDWSEWSSCSATCGAGVIVRTRHYLNPRAKKKCQKVSRVRL  527
             EN +        + +C +S W  W  CS  CG G+  R R +LNP  K           
Sbjct  487  CENSEAF------SSKCQVSSWGSWGECSVQCGHGMRSRNRTFLNPATKSG---------  531

Query  528  QETRKCEGPECGGDLANAGAEAEANGEGDEAAAEEGNAVENELSEGTSSFYGDNNNGFRQ  587
                     +C  DL         NG       ++ N   + L + T+            
Sbjct  532  ---------DCSVDLERKDICVGENG-------DDCNVTPDPLCKTTA------------  563

Query  588  FKSYSQKREDYIPPECGVSPWSDFSPCIGSCGSVGYRQRQRKIWNNDEVYGVVNPKSDGS  647
                                WSD+SPC  SC   G R R R  +            S+  
Sbjct  564  --------------------WSDWSPCSASCDE-GVRVRTRLFF-----------YSEHE  591

Query  648  NPCRHIKREEIVNCTNPACDTIV----PHFCYANLKISPCRDGEVTNYWYYDYPTDQCAI  703
              C H+  +E   C   +C   +       C  + +   C  G    YW Y++   QC  
Sbjct  592  KRCMHVNLQEKDTCVMQSCRRFIEINSEEICQEDKQAGQCA-GNFPRYW-YNHEKTQCER  649

Query  704  FWADKCDKNQNKFPSKEECEETC---------RRPRQKL--DLQSESLRLEQQPVDCIVS  752
            F    C  N+N+F ++EEC++ C           P  +L  D  +  +    + VDC VS
Sbjct  650  FIFTGCKGNRNQFETEEECKQICLPGYEKSKSLIPNNQLLEDFGNTEVDDGGERVDCEVS  709

Query  753  EWDA-RPCNVTCGEGMLIKTRRVLRRAKYGGKPCPKHLVRLEKCYQSCDEVYTISGGINF  811
            +W A   C+V+CG G   ++R V++ A+ GG  C +HL++  +C                
Sbjct  710  KWTAWGSCSVSCGRGKKSRSRHVVKLARNGGHQCSEHLMQELQC----------------  753

Query  812  GGNTNDPSDYDAVNRNRGTYVSARQVAKKDDCRYSEWTAWTPCTASCGDNS  862
                                   R    K  C+   W+ W+PC+ SCG+ S
Sbjct  754  ---------------------RLRPCPVKLTCQVGPWSRWSPCSVSCGEGS  783


 Score = 41.6 bits (96),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 61/158 (39%), Gaps = 39/158 (25%)

Query  749  CIVSEWDA-RPCNVTCGEGMLIKTRRVLRRAKYGGKPCPKHLVRLEKCYQSCDEVYTISG  807
            C VS W +   C+V CG GM  + R  L  A   G  C   L R + C            
Sbjct  497  CQVSSWGSWGECSVQCGHGMRSRNRTFLNPATKSGD-CSVDLERKDIC------------  543

Query  808  GINFGGNTNDPSDYDAVNRNRGTYVSARQVAKKDDCRYSEWTAWTPCTASCGDNSMRQKT  867
                G N +D +                 V     C+ + W+ W+PC+ASC D  +R +T
Sbjct  544  ---VGENGDDCN-----------------VTPDPLCKTTAWSDWSPCSASC-DEGVRVRT  582

Query  868  RTLLNTEISYRCKDRVRVEK--CTVMPC--LLESNDQD  901
            R    +E   RC      EK  C +  C   +E N ++
Sbjct  583  RLFFYSEHEKRCMHVNLQEKDTCVMQSCRRFIEINSEE  620


 Score = 35.4 bits (80),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 20/69 (29%), Positives = 33/69 (48%), Gaps = 2/69 (3%)

Query  838  AKKDDCRYSEWTAWTPCTASCG-DNSMRQKTRTLLNTEISYRCKDRVRVE-KCTVMPCLL  895
             ++ DC  S+WTAW  C+ SCG     R +    L     ++C + +  E +C + PC +
Sbjct  701  GERVDCEVSKWTAWGSCSVSCGRGKKSRSRHVVKLARNGGHQCSEHLMQELQCRLRPCPV  760

Query  896  ESNDQDSEW  904
            +   Q   W
Sbjct  761  KLTCQVGPW  769


>Q95S22_DROME unnamed protein product
Length=461

 Score = 188 bits (478),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 104/267 (39%), Positives = 145/267 (54%), Gaps = 27/267 (10%)

Query  296  MIDPSPDWIVGISGLELCLANCSWVENKVHNLYPWDAGTDSGPSYMSADQPQVPPDVIRR  355
            M  PSPDW+VGISGL+LC  +CSW E+   +L+PWDAGTDSG SYMS +    PP+ + R
Sbjct  1    MFGPSPDWVVGISGLDLCTEDCSWKESMDFDLFPWDAGTDSGISYMSPNSETQPPERMYR  60

Query  356  IKSNFPNDPRSPFYDPTGAPMKPLATLHINRRRLYEKTC--------------KKPEEDE  401
            I + +P DPR+PFY+P    M PLA L++ R ++  + C                 E+D 
Sbjct  61   ITTMYPEDPRAPFYNPKSREMTPLAKLYLRREKIVSRNCDDEFLQALQLEVSDDAEEQDT  120

Query  402  SEECATYPWGHWSECSAKCGPGTQQRTREYKQPAVARRSKCRSALREEQPCNGR--RC--  457
              EC    +  WS CS  CG G + R+R+Y  PA A ++KC   L  ++ C      C  
Sbjct  121  RAECRVGDYSAWSPCSVSCGKGIRMRSRQYLYPAAADQNKCARQLVAKEMCVAAIPECAD  180

Query  458  --GSTNEENTEEGENPDEIQIGPHENPE----CAISDWSEWSSCSATCGAGVIVRTRHYL  511
                + + + +EGEN    Q     N E    C  S WS WS CSA+CG G+ +RTR ++
Sbjct  181  GPAQSKDRDDDEGENLANSQSLVGSNGEGAGLCKTSPWSVWSECSASCGIGITMRTRTFV  240

Query  512  NPRAKKKCQKVSRVRLQETRKCEGPEC  538
            N   +K+C  ++ V   E  KC  P+C
Sbjct  241  NHLGRKRCPHITIV---EKNKCMRPDC  264


 Score = 102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 98/353 (28%), Positives = 146/353 (41%), Gaps = 59/353 (17%)

Query  483  ECAISDWSEWSSCSATCGAGVIVRTRHYLNPRAKKKCQKVSRVRLQETRKCEGPEC----  538
            EC + D+S WS CS +CG G+ +R+R YL P A  + +   ++  +E      PEC    
Sbjct  123  ECRVGDYSAWSPCSVSCGKGIRMRSRQYLYPAAADQNKCARQLVAKEMCVAAIPECADGP  182

Query  539  ----------GGDLANAGAEAEANGEGDEAAAEEGNAVENELSEG--------TSSFYG-  579
                      G +LAN+ +   +NGEG         +V +E S          T +F   
Sbjct  183  AQSKDRDDDEGENLANSQSLVGSNGEGAGLCKTSPWSVWSECSASCGIGITMRTRTFVNH  242

Query  580  ------------DNNNGFRQFKSYSQKREDYIPPECGVSPWSDFSPCIGSCGSVGYRQRQ  627
                        + N   R   +Y Q   +   P+C  S WSD+SPC  +CG  G   R 
Sbjct  243  LGRKRCPHITIVEKNKCMRPDCTYEQV--ELPDPQCPTSQWSDWSPCSSTCGR-GVTIRT  299

Query  628  RKIWNNDEVYGVVNPKSDGSNPCRHIKREEIVNCTNPACDTI----VPHFCYANLKISPC  683
            R +        ++    D  +  + ++  +   C NP    I        C       PC
Sbjct  300  RLL--------LLENGPDKESCTQRMELHQQKECVNPIDCHINAEQAKDICVQAPDPGPC  351

Query  684  RDGEVTNYWYYDYPTDQCAIFWADKCDKNQNKFPSKEECEETCRRPRQKLDLQSESLRLE  743
            R G    Y  YD     C  F    C  N+N F ++ +C  TC   R        S R++
Sbjct  352  R-GTYMRY-AYDPQNQHCYSFTYGGCRGNRNNFLTENDCLNTCNVLRSPY-----SSRVD  404

Query  744  QQPVDCIVSEWDA-RPCNVTCGEGMLIKTRRVLRRAKYGGKPCPKHLVRLEKC  795
             QP  C++S+W    PC+V+CG G+    R V+   + GG+PC K LV+   C
Sbjct  405  -QPRACVLSDWSVWSPCSVSCGVGVSESRRYVVTEPQNGGQPCSKRLVKSRSC  456


 Score = 82.4 bits (202),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 86/279 (31%), Positives = 116/279 (42%), Gaps = 47/279 (17%)

Query  405  CATYPWGHWSECSAKCGPGTQQRTREYKQPAVARRSKCRSALREEQPCNGRRCGSTNEEN  464
            C T PW  WSECSA CG G   RTR +    + R+      + E+  C    C       
Sbjct  213  CKTSPWSVWSECSASCGIGITMRTRTFVN-HLGRKRCPHITIVEKNKCMRPDC------T  265

Query  465  TEEGENPDEIQIGPHENPECAISDWSEWSSCSATCGAGVIVRTRHYLNPRAKKKCQKVSR  524
             E+ E PD         P+C  S WS+WS CS+TCG GV +RTR  L      K     R
Sbjct  266  YEQVELPD---------PQCPTSQWSDWSPCSSTCGRGVTIRTRLLLLENGPDKESCTQR  316

Query  525  VRLQETRKCEGP-------ECGGDL-ANAGAEAEANGEGDEAAAEEGNAVENELSEG---  573
            + L + ++C  P       E   D+   A       G     A +  N      + G   
Sbjct  317  MELHQQKECVNPIDCHINAEQAKDICVQAPDPGPCRGTYMRYAYDPQNQHCYSFTYGGCR  376

Query  574  --TSSFYGDNN--NGFRQFKSYSQKREDYIPPECGVSPWSDFSPCIGSCGSVGYRQRQRK  629
               ++F  +N+  N     +S    R D  P  C +S WS +SPC  SCG VG  + +R 
Sbjct  377  GNRNNFLTENDCLNTCNVLRSPYSSRVDQ-PRACVLSDWSVWSPCSVSCG-VGVSESRR-  433

Query  630  IWNNDEVYGVVNPKSDGSNPC--RHIKREEIVNCTNPAC  666
                   Y V  P+ +G  PC  R +K     +C  PAC
Sbjct  434  -------YVVTEPQ-NGGQPCSKRLVKSR---SCAMPAC  461


 Score = 56.2 bits (134),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 45/163 (28%), Positives = 71/163 (44%), Gaps = 9/163 (6%)

Query  731  QKLDLQ-SESLRLEQQPVDCIVSEWDA-RPCNVTCGEGMLIKTRRVLRRAKYGGKPCPKH  788
            Q L L+ S+    +    +C V ++ A  PC+V+CG+G+ +++R+ L  A      C + 
Sbjct  105  QALQLEVSDDAEEQDTRAECRVGDYSAWSPCSVSCGKGIRMRSRQYLYPAAADQNKCARQ  164

Query  789  LVRLEKCYQSCDEVYTISGGINFGGNTNDPSDYDAVNRNRGTYVSARQVAKKDDCRYSEW  848
            LV  E C      V  I    +    + D  D +  N      +          C+ S W
Sbjct  165  LVAKEMC------VAAIPECADGPAQSKDRDDDEGENLANSQSLVGSNGEGAGLCKTSPW  218

Query  849  TAWTPCTASCGDNSMRQKTRTLLNTEISYRCKDRVRVEKCTVM  891
            + W+ C+ASCG   +  +TRT +N     RC     VEK   M
Sbjct  219  SVWSECSASCGIG-ITMRTRTFVNHLGRKRCPHITIVEKNKCM  260


 Score = 37.4 bits (85),  Expect = 0.047, Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 59/152 (39%), Gaps = 43/152 (28%)

Query  749  CIVSEW-DARPCNVTCGEGMLIKTRRVLRRAKYGGKPCPKHLVRLEK-------------  794
            C  S+W D  PC+ TCG G+ I+TR +L       + C + +   ++             
Sbjct  276  CPTSQWSDWSPCSSTCGRGVTIRTRLLLLENGPDKESCTQRMELHQQKECVNPIDCHINA  335

Query  795  ------CYQSCD------------------EVYTISGGINFGGNTNDPSDYDAVNRN---  827
                  C Q+ D                    Y+ + G   G   N  ++ D +N     
Sbjct  336  EQAKDICVQAPDPGPCRGTYMRYAYDPQNQHCYSFTYGGCRGNRNNFLTENDCLNTCNVL  395

Query  828  RGTYVSARQVAKKDDCRYSEWTAWTPCTASCG  859
            R  Y S  +V +   C  S+W+ W+PC+ SCG
Sbjct  396  RSPYSS--RVDQPRACVLSDWSVWSPCSVSCG  425


 Score = 32.7 bits (73),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 28/59 (47%), Gaps = 12/59 (20%)

Query  383  HINRRR-----LYEKT-CKKPE------EDESEECATYPWGHWSECSAKCGPGTQQRTR  429
            H+ R+R     + EK  C +P+      E    +C T  W  WS CS+ CG G   RTR
Sbjct  242  HLGRKRCPHITIVEKNKCMRPDCTYEQVELPDPQCPTSQWSDWSPCSSTCGRGVTIRTR  300



Lambda      K        H
   0.324    0.134    0.407 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7057096832


Query= XP_014085178.1 PREDICTED: protein HID1 [Bactrocera oleae]

Length=874
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7Z135_CAEEL  unnamed protein product                                 660     0.0  
G5EG65_CAEEL  unnamed protein product                                 660     0.0  
Q57TS7_TRYB2  unnamed protein product                                 82.8    5e-16


>Q7Z135_CAEEL unnamed protein product
Length=709

 Score = 660 bits (1704),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/627 (54%), Positives = 437/627 (70%), Gaps = 66/627 (11%)

Query  1    MGNSDSKLNFRKAIVQLTQKNQKIDDTDNQFWDQFWYGHQTTLEDVFALVTSAEIRNIRN  60
            MG   S+++F++ ++ +T K  K D+T   FWDQ W+    ++ ++FA+++  +IR +R+
Sbjct  1    MGAQGSRVDFKQVVLDVTSKPGKDDET---FWDQAWW--PDSVNEIFAMISGEDIRKLRD  55

Query  61   DNPANLATLCYKAVEKLALAVDNSCRTHVEQQCVLNCVRLLIRILPYIFEDEKWREFFWS  120
            ++P NLATL YK VEKL  + ++     ++Q+  +N +RLL RI+PY+ ED +WR +FWS
Sbjct  56   ESPKNLATLVYKTVEKLQFSRNHPAT--IDQKKTINAIRLLTRIVPYLLEDAEWRGYFWS  113

Query  121  SLPTRNTPTSADAIEVLRENSPRLTGTQPVPLAQSLINALCDLLFCPDFTVTATRRAGPD  180
             +P                      G    PLA  L+  L DLLFCP+FT+T    A   
Sbjct  114  PIPH---------------------GDAAKPLAAVLLETLSDLLFCPEFTIT---HANGQ  149

Query  181  KAEELANIDSCEYIWEAGVGFAHSPPKNANMEKRRTEILKLLLTCFSETIYS-LTDEPN-  238
            K ++L+ IDSCEYIWEAGVG  + PP  A   + RTEILKLLLTCF+E IY+ ++DE   
Sbjct  150  KIDDLSTIDSCEYIWEAGVGSGNKPPMVALHYQNRTEILKLLLTCFAELIYAPVSDETRL  209

Query  239  RWIAYFTSADNRHALPLFTSLLNTVCAYDPVGLGVPYNHLLFQDTTEPLVEACLQILIVT  298
            RW+ +FTS  N H LP+FTSLLN VCAYDPVG G+PYN+LLF D+ EPLVE  LQ+LIV 
Sbjct  210  RWVIHFTSVTNPHVLPIFTSLLNIVCAYDPVGYGLPYNYLLFNDSREPLVEIALQVLIVC  269

Query  299  LDHDMIIHQQQQLELRRQMQGLTTTTTTPPAANSYDDGFGDNLFINYLSRVHRDEDFHFI  358
            LD +                      T P   N+ D G+ DN FINYLSR+HR+EDF F+
Sbjct  270  LDKE----------------------TQP---NTDDSGYKDNYFINYLSRIHREEDFDFM  304

Query  359  LKGITRLLNNPL--LQNYLPNSTKRLHCHQELLILFWKVCDFNKKFLYFVLKSSDVLDIL  416
            LKGITRLL+NP+    +YLPNSTKR++ HQELL+L WK C+ N+KF+++VLK+SDVLDIL
Sbjct  305  LKGITRLLSNPIHSSSSYLPNSTKRVNFHQELLVLLWKCCEINQKFMFYVLKTSDVLDIL  364

Query  417  IPILYHLNYSRADQSRVGLMHIGVFILLLLSGERNFGVRLNKPYTATVPMDIPVFTGTHA  476
            +PILYH++ +R D  RVGL+H+GVFI+LLLSGERNFGVRLNKPYTA   +++  FTGTHA
Sbjct  365  VPILYHISDARNDSGRVGLIHMGVFIILLLSGERNFGVRLNKPYTAKANINVQTFTGTHA  424

Query  477  DLLITVFHKIIATGHQRLQPLFDCLLTILVNVSPYLKTLSMVASVKLLHLLEAFSTPWFL  536
            DLLI V HK+I TG+ RLQ LFDC LTI+VNVSPY+K+LSMVA+ KL+HL+EAFSTPWFL
Sbjct  425  DLLILVIHKLITTGNYRLQTLFDCFLTIMVNVSPYMKSLSMVAANKLVHLVEAFSTPWFL  484

Query  537  LSAPNNHHLVFFLLEIFNNIIQYQFDGNSNLVYTIIRKRHVFHAMANLPADMAGIAKCLS  596
             S+P N  LVF LLE+FNN+IQYQFDGNSNL+YTIIRKR+VF+ ++NL  D A IAK LS
Sbjct  485  FSSPTNPQLVFSLLEVFNNVIQYQFDGNSNLIYTIIRKRNVFYQLSNLSTDAASIAKTLS  544

Query  597  GRKVGKFNIPPV------PHSNASPHI  617
            GRK    N   +      P S A P I
Sbjct  545  GRKSKSANRDEMVDQLKSPTSTAPPEI  571


 Score = 167 bits (422),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 77/99 (78%), Positives = 86/99 (87%), Gaps = 1/99 (1%)

Query  757  PNATGDH-WSPTPEWIVSWRSKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEILKFLQH  815
            P ++ D+ W  T EW  +W+SKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEILKFLQH
Sbjct  611  PESSQDNEWIATQEWADAWKSKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEILKFLQH  670

Query  816  GTLVGLLPVPHPILIRKYQANAGTTAWFRTYIWGVIYLR  854
            GTLVGLLPVPHPI+IR+YQ N GT  WFR Y+WGVIYL+
Sbjct  671  GTLVGLLPVPHPIVIRRYQTNIGTNHWFRIYMWGVIYLK  709


>G5EG65_CAEEL unnamed protein product
Length=729

 Score = 660 bits (1704),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/627 (54%), Positives = 437/627 (70%), Gaps = 66/627 (11%)

Query  1    MGNSDSKLNFRKAIVQLTQKNQKIDDTDNQFWDQFWYGHQTTLEDVFALVTSAEIRNIRN  60
            MG   S+++F++ ++ +T K  K D+T   FWDQ W+    ++ ++FA+++  +IR +R+
Sbjct  1    MGAQGSRVDFKQVVLDVTSKPGKDDET---FWDQAWW--PDSVNEIFAMISGEDIRKLRD  55

Query  61   DNPANLATLCYKAVEKLALAVDNSCRTHVEQQCVLNCVRLLIRILPYIFEDEKWREFFWS  120
            ++P NLATL YK VEKL  + ++     ++Q+  +N +RLL RI+PY+ ED +WR +FWS
Sbjct  56   ESPKNLATLVYKTVEKLQFSRNHPAT--IDQKKTINAIRLLTRIVPYLLEDAEWRGYFWS  113

Query  121  SLPTRNTPTSADAIEVLRENSPRLTGTQPVPLAQSLINALCDLLFCPDFTVTATRRAGPD  180
             +P                      G    PLA  L+  L DLLFCP+FT+T    A   
Sbjct  114  PIPH---------------------GDAAKPLAAVLLETLSDLLFCPEFTIT---HANGQ  149

Query  181  KAEELANIDSCEYIWEAGVGFAHSPPKNANMEKRRTEILKLLLTCFSETIYS-LTDEPN-  238
            K ++L+ IDSCEYIWEAGVG  + PP  A   + RTEILKLLLTCF+E IY+ ++DE   
Sbjct  150  KIDDLSTIDSCEYIWEAGVGSGNKPPMVALHYQNRTEILKLLLTCFAELIYAPVSDETRL  209

Query  239  RWIAYFTSADNRHALPLFTSLLNTVCAYDPVGLGVPYNHLLFQDTTEPLVEACLQILIVT  298
            RW+ +FTS  N H LP+FTSLLN VCAYDPVG G+PYN+LLF D+ EPLVE  LQ+LIV 
Sbjct  210  RWVIHFTSVTNPHVLPIFTSLLNIVCAYDPVGYGLPYNYLLFNDSREPLVEIALQVLIVC  269

Query  299  LDHDMIIHQQQQLELRRQMQGLTTTTTTPPAANSYDDGFGDNLFINYLSRVHRDEDFHFI  358
            LD +                      T P   N+ D G+ DN FINYLSR+HR+EDF F+
Sbjct  270  LDKE----------------------TQP---NTDDSGYKDNYFINYLSRIHREEDFDFM  304

Query  359  LKGITRLLNNPL--LQNYLPNSTKRLHCHQELLILFWKVCDFNKKFLYFVLKSSDVLDIL  416
            LKGITRLL+NP+    +YLPNSTKR++ HQELL+L WK C+ N+KF+++VLK+SDVLDIL
Sbjct  305  LKGITRLLSNPIHSSSSYLPNSTKRVNFHQELLVLLWKCCEINQKFMFYVLKTSDVLDIL  364

Query  417  IPILYHLNYSRADQSRVGLMHIGVFILLLLSGERNFGVRLNKPYTATVPMDIPVFTGTHA  476
            +PILYH++ +R D  RVGL+H+GVFI+LLLSGERNFGVRLNKPYTA   +++  FTGTHA
Sbjct  365  VPILYHISDARNDSGRVGLIHMGVFIILLLSGERNFGVRLNKPYTAKANINVQTFTGTHA  424

Query  477  DLLITVFHKIIATGHQRLQPLFDCLLTILVNVSPYLKTLSMVASVKLLHLLEAFSTPWFL  536
            DLLI V HK+I TG+ RLQ LFDC LTI+VNVSPY+K+LSMVA+ KL+HL+EAFSTPWFL
Sbjct  425  DLLILVIHKLITTGNYRLQTLFDCFLTIMVNVSPYMKSLSMVAANKLVHLVEAFSTPWFL  484

Query  537  LSAPNNHHLVFFLLEIFNNIIQYQFDGNSNLVYTIIRKRHVFHAMANLPADMAGIAKCLS  596
             S+P N  LVF LLE+FNN+IQYQFDGNSNL+YTIIRKR+VF+ ++NL  D A IAK LS
Sbjct  485  FSSPTNPQLVFSLLEVFNNVIQYQFDGNSNLIYTIIRKRNVFYQLSNLSTDAASIAKTLS  544

Query  597  GRKVGKFNIPPV------PHSNASPHI  617
            GRK    N   +      P S A P I
Sbjct  545  GRKSKSANRDEMVDQLKSPTSTAPPEI  571


 Score = 198 bits (503),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 104/124 (84%), Gaps = 1/124 (1%)

Query  751  GSIRMVPNATGDH-WSPTPEWIVSWRSKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEI  809
            G+    P ++ D+ W  T EW  +W+SKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEI
Sbjct  605  GNWEERPESSQDNEWIATQEWADAWKSKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEI  664

Query  810  LKFLQHGTLVGLLPVPHPILIRKYQANAGTTAWFRTYIWGVIYLRNVGPSIWYDTDVKLF  869
            LKFLQHGTLVGLLPVPHPI+IR+YQ N GT  WFR Y+WGVIYL++  P IWYDTDVKLF
Sbjct  665  LKFLQHGTLVGLLPVPHPIVIRRYQTNIGTNHWFRIYMWGVIYLKHTQPPIWYDTDVKLF  724

Query  870  EIQR  873
            E+QR
Sbjct  725  EVQR  728


>Q57TS7_TRYB2 unnamed protein product
Length=748

 Score = 82.8 bits (203),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 147/664 (22%), Positives = 258/664 (39%), Gaps = 112/664 (17%)

Query  1    MGNSDSKLNFRKAIVQLTQKNQKIDDTDNQFWDQFWYGHQTTLEDVFALVTSAEIRNIRN  60
            MG S S ++  +A+  +T  +  I D   Q        H+  L+      T   +R +R+
Sbjct  1    MGTSGSTIDVARALRTMT-SDVPISDGVLQLLLDTPLSHEE-LQRALPFHT---LRTMRH  55

Query  61   DNPANLATLCYKAVEKLALAVDNSCRTH------VEQQCVLNCVRLLIRILPYIFED---  111
                N A L  K VE LA     SCR+       V  Q  LN +R++ RILP   ED   
Sbjct  56   CYTRNFALLLLKCVEVLA-NTAASCRSSNSKGQVVGVQPFLNALRVMRRILPIAMEDGGT  114

Query  112  ------------------------------------------EKWREFFWSSLPTRNTPT  129
                                                        + E F  S   R    
Sbjct  115  PCEEVDGSSAEVTGSSDNSKADGGDAVPMQASSKALRDKRKRTAFTEMFVQSFFARGCVC  174

Query  130  SADAIEVLRENSPRLTGTQPVPLAQSLINALCDLLFCPDFTVTATRRAGPDKAEELANID  189
            + +  E   E  P L G Q  PL + L+  L D  F     + A     P +     + D
Sbjct  175  NDEQPE---ETFPPLPG-QSEPLGKFLVRLLLDCCFLEG--LGAGVGTTPTETSGCTHSD  228

Query  190  SCEYIWEAGVG----FAHSPPKNANMEKRRTEILKLLLTCFSETIYSLTDEPNRWIAYFT  245
                +W +GV      A S    A     R E+L  L    S  +    + P+    +FT
Sbjct  229  -VSLLWYSGVAGQRVAAESKAVTATTHAVRHELLGTLTVLLSYPLLLPPNTPD---VFFT  284

Query  246  ----SADNRHAL-PLFTSLLNTVCAYDPVGLGVPY-NHLLFQDTTEPLVEACLQILIVTL  299
                S +N   L PL  S LN + +Y P GL +PY ++ + ++    L+ A     ++  
Sbjct  285  EVLLSPENASLLKPLVASTLNALLSYVPYGL-LPYTSYWVGEEEDVVLMSARFLSSVICY  343

Query  300  DHDMIIHQQQQLELRRQMQGLTTTTTTPPAANSYDDGFGDNLFINYLSRVHRDEDFHFIL  359
                + +     E  +   G         AA+      G   F   L+R    E+   I+
Sbjct  344  PSAPVGNTGASCECDQLEDG--------SAASGVAVSQGARDFFRCLTR----EEATHIV  391

Query  360  KGITRLLNNPLL--QNYLPNSTKRLHCHQELLILFWKVCDFNKKFLYFVLKSSDVLDILI  417
              +  ++   L   + YLP+S +R     E ++L W++ D +             L  ++
Sbjct  392  HNLQNIVGLRLYAKRTYLPDSQRRFAASNESMMLLWRLIDLSPACSQAFGCEQVTLKYIL  451

Query  418  PIL-YHLNYSRADQ--SRVGLMHIGVFILLLLSGERNFGVRLNKPYTATVPMDIPVFTGT  474
            P++ Y L+  R+ +  SR+ L+   +FIL+ L+G  +F ++ N P+  ++P     F GT
Sbjct  452  PLVDYALDARRSPRLSSRLQLV---LFILMRLTGSSSFCLQCNTPFRESIPFSFDTFVGT  508

Query  475  HADLLITVFHKIIATGHQRLQPLFDCLLTILVNVSPYLKTLSMVASVKLLHLLEAFSTPW  534
            + DL++      +   H  ++ L      ++ N++P++ T+S V + KL  +  + +T  
Sbjct  509  YNDLIVITLCYFLLMPHHSIRLLSPMCSAVISNMAPFVTTVSPVTAEKLSLVFTSVATRC  568

Query  535  F----LLSAPN----------NHHLVFFLLEIFNNIIQYQFDGNSNLVYTIIRKRHVFHA  580
                 +LSA +          +   +  ++E   +++Q +  G + L+   + KR +   
Sbjct  569  LAYESVLSASSAAVENNVVVADEVTMVNVVETVCDVVQRRATGAAGLLSAFVPKRGLIEN  628

Query  581  MANL  584
            +A +
Sbjct  629  VAEV  632



Lambda      K        H
   0.324    0.134    0.407 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7057096832


Query= XP_014085179.1 PREDICTED: 12 kDa FK506-binding protein [Bactrocera
oleae]

Length=108
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

FKB12_DROME  unnamed protein product                                  210     3e-72
Q57WF7_TRYB2  unnamed protein product                                 115     1e-34
FKB59_DROME  unnamed protein product                                  119     5e-33


>FKB12_DROME unnamed protein product
Length=108

 Score = 210 bits (534),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 99/108 (92%), Positives = 106/108 (98%), Gaps = 0/108 (0%)

Query  1    MGVQVVPISPGDGSTFPKTGQVVSVHYTGTLDNGTKFDSSRDRNKPFKFTLGRGEVIRGW  60
            MGVQVVPI+PGDGST+PK GQ V+VHYTGTLD+GTKFDSSRDRNKPFKFT+G+GEVIRGW
Sbjct  1    MGVQVVPIAPGDGSTYPKNGQKVTVHYTGTLDDGTKFDSSRDRNKPFKFTIGKGEVIRGW  60

Query  61   DEGVAQLSVGQRAKLICSPDYAYGSRGHPGVIPPNATLTFDVELLKVE  108
            DEGVAQLSVGQRAKLICSPDYAYGSRGHPGVIPPN+TLTFDVELLKVE
Sbjct  61   DEGVAQLSVGQRAKLICSPDYAYGSRGHPGVIPPNSTLTFDVELLKVE  108


>Q57WF7_TRYB2 unnamed protein product
Length=112

 Score = 115 bits (287),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 70/100 (70%), Gaps = 0/100 (0%)

Query  8    ISPGDGSTFPKTGQVVSVHYTGTLDNGTKFDSSRDRNKPFKFTLGRGEVIRGWDEGVAQL  67
            I  GDG T P+ G +V++ Y G L +G KFDS+ +R KPF F +G GEVI+GWDEG+ Q+
Sbjct  12   IIEGDGKTIPRQGSIVTLDYVGYLPDGRKFDSTIERGKPFVFRVGCGEVIKGWDEGIVQM  71

Query  68   SVGQRAKLICSPDYAYGSRGHPGVIPPNATLTFDVELLKV  107
            S G+R++L   P  A+GS G PG+IPPN  + F+V LL V
Sbjct  72   SKGERSRLTMPPSLAFGSTGFPGIIPPNTVIVFEVTLLDV  111


>FKB59_DROME unnamed protein product
Length=439

 Score = 119 bits (297),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 51/98 (52%), Positives = 73/98 (74%), Gaps = 0/98 (0%)

Query  8    ISPGDGSTFPKTGQVVSVHYTGTLDNGTKFDSSRDRNKPFKFTLGRGEVIRGWDEGVAQL  67
            +  G G+  P +G  VS+HYTG L +GT+FDSS  RN+PF+F+LG+G VI+ +D GVA +
Sbjct  20   LKEGTGTETPHSGCTVSLHYTGRLVDGTEFDSSLSRNEPFEFSLGKGNVIKAFDMGVATM  79

Query  68   SVGQRAKLICSPDYAYGSRGHPGVIPPNATLTFDVELL  105
             +G+R  L C+P+YAYG+ G P  IPP+ATL F++E+L
Sbjct  80   KLGERCFLTCAPNYAYGAAGSPPAIPPDATLIFELEML  117


 Score = 46.6 bits (109),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 28/100 (28%), Positives = 54/100 (54%), Gaps = 6/100 (6%)

Query  8    ISPGDGSTFPKTGQVVSVHYTGTLDNGTKFDSSRDRNKPFKFTLGRG-EVIRGWDEGVAQ  66
            +   D    P  G  V  H +G+ + G  F+   DR+  F +  G+   +I G +  + +
Sbjct  137  LEASDKKRTPSDGAFVKAHISGSFE-GRVFE---DRDVEFDYGEGKAIGIIDGVEIALEK  192

Query  67   LSVGQRAKLICSPDYAYGSRGHPGV-IPPNATLTFDVELL  105
            ++VG+ +++     YA+G++G+    IPPNAT+ + V+L+
Sbjct  193  MNVGETSRIKIQAKYAFGAKGNEEFKIPPNATVEYTVKLV  232



Lambda      K        H
   0.324    0.134    0.407 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7057096832


Query= XP_014085180.1 PREDICTED: uncharacterized protein LOC106614144
isoform X1 [Bactrocera oleae]

Length=293
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A0A0B4K6M2_DROME  unnamed protein product                             32.0    0.66 
A0A0B4K6B1_DROME  unnamed protein product                             32.0    0.66 


>A0A0B4K6M2_DROME unnamed protein product
Length=2798

 Score = 32.0 bits (71),  Expect = 0.66, Method: Composition-based stats.
 Identities = 20/83 (24%), Positives = 36/83 (43%), Gaps = 5/83 (6%)

Query  88    KEALDKKYPSAYGYSSFVSKLPRLPPTDM-----SRFPPIGAYNVEPKKKIKQAARPFNI  142
             +E ++   P  + +S F S  P LPP        + +PP  +  ++P  +   AA P  +
Sbjct  1743  EEMMEPLDPHLHPHSVFYSPSPHLPPQPFDIDIDTIYPPRRSNGLKPNVQATAAAYPLPL  1802

Query  143   GTKRVQIKKLVTPCPADYAADQP  165
                  Q K++ TP    + +  P
Sbjct  1803  LPSFEQFKRITTPITNFFRSSSP  1825


>A0A0B4K6B1_DROME unnamed protein product
Length=2792

 Score = 32.0 bits (71),  Expect = 0.66, Method: Composition-based stats.
 Identities = 20/83 (24%), Positives = 36/83 (43%), Gaps = 5/83 (6%)

Query  88    KEALDKKYPSAYGYSSFVSKLPRLPPTDM-----SRFPPIGAYNVEPKKKIKQAARPFNI  142
             +E ++   P  + +S F S  P LPP        + +PP  +  ++P  +   AA P  +
Sbjct  1743  EEMMEPLDPHLHPHSVFYSPSPHLPPQPFDIDIDTIYPPRRSNGLKPNVQATAAAYPLPL  1802

Query  143   GTKRVQIKKLVTPCPADYAADQP  165
                  Q K++ TP    + +  P
Sbjct  1803  LPSFEQFKRITTPITNFFRSSSP  1825



Lambda      K        H
   0.324    0.134    0.407 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7057096832


Query= XP_014085181.1 PREDICTED: uncharacterized protein LOC106614144
isoform X2 [Bactrocera oleae]

Length=263
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A0A0B4K6B1_DROME  unnamed protein product                             32.3    0.50 
A0A0B4K6M2_DROME  unnamed protein product                             32.3    0.50 


>A0A0B4K6B1_DROME unnamed protein product
Length=2792

 Score = 32.3 bits (72),  Expect = 0.50, Method: Composition-based stats.
 Identities = 20/83 (24%), Positives = 36/83 (43%), Gaps = 5/83 (6%)

Query  58    KEALDKKYPSAYGYSSFVSKLPRLPPTDM-----SRFPPIGAYNVEPKKKIKQAARPFNI  112
             +E ++   P  + +S F S  P LPP        + +PP  +  ++P  +   AA P  +
Sbjct  1743  EEMMEPLDPHLHPHSVFYSPSPHLPPQPFDIDIDTIYPPRRSNGLKPNVQATAAAYPLPL  1802

Query  113   GTKRVQIKKLVTPCPADYAADQP  135
                  Q K++ TP    + +  P
Sbjct  1803  LPSFEQFKRITTPITNFFRSSSP  1825


>A0A0B4K6M2_DROME unnamed protein product
Length=2798

 Score = 32.3 bits (72),  Expect = 0.50, Method: Composition-based stats.
 Identities = 20/83 (24%), Positives = 36/83 (43%), Gaps = 5/83 (6%)

Query  58    KEALDKKYPSAYGYSSFVSKLPRLPPTDM-----SRFPPIGAYNVEPKKKIKQAARPFNI  112
             +E ++   P  + +S F S  P LPP        + +PP  +  ++P  +   AA P  +
Sbjct  1743  EEMMEPLDPHLHPHSVFYSPSPHLPPQPFDIDIDTIYPPRRSNGLKPNVQATAAAYPLPL  1802

Query  113   GTKRVQIKKLVTPCPADYAADQP  135
                  Q K++ TP    + +  P
Sbjct  1803  LPSFEQFKRITTPITNFFRSSSP  1825



Lambda      K        H
   0.324    0.134    0.407 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7057096832


Query= XP_014085182.1 PREDICTED: uncharacterized protein LOC106614144
isoform X3 [Bactrocera oleae]

Length=242
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A0A0B4K6B1_DROME  unnamed protein product                             32.3    0.46 
A0A0B4K6M2_DROME  unnamed protein product                             32.3    0.46 


>A0A0B4K6B1_DROME unnamed protein product
Length=2792

 Score = 32.3 bits (72),  Expect = 0.46, Method: Composition-based stats.
 Identities = 20/83 (24%), Positives = 36/83 (43%), Gaps = 5/83 (6%)

Query  37    KEALDKKYPSAYGYSSFVSKLPRLPPTDM-----SRFPPIGAYNVEPKKKIKQAARPFNI  91
             +E ++   P  + +S F S  P LPP        + +PP  +  ++P  +   AA P  +
Sbjct  1743  EEMMEPLDPHLHPHSVFYSPSPHLPPQPFDIDIDTIYPPRRSNGLKPNVQATAAAYPLPL  1802

Query  92    GTKRVQIKKLVTPCPADYAADQP  114
                  Q K++ TP    + +  P
Sbjct  1803  LPSFEQFKRITTPITNFFRSSSP  1825


>A0A0B4K6M2_DROME unnamed protein product
Length=2798

 Score = 32.3 bits (72),  Expect = 0.46, Method: Composition-based stats.
 Identities = 20/83 (24%), Positives = 36/83 (43%), Gaps = 5/83 (6%)

Query  37    KEALDKKYPSAYGYSSFVSKLPRLPPTDM-----SRFPPIGAYNVEPKKKIKQAARPFNI  91
             +E ++   P  + +S F S  P LPP        + +PP  +  ++P  +   AA P  +
Sbjct  1743  EEMMEPLDPHLHPHSVFYSPSPHLPPQPFDIDIDTIYPPRRSNGLKPNVQATAAAYPLPL  1802

Query  92    GTKRVQIKKLVTPCPADYAADQP  114
                  Q K++ TP    + +  P
Sbjct  1803  LPSFEQFKRITTPITNFFRSSSP  1825



Lambda      K        H
   0.324    0.134    0.407 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7057096832


Query= XP_014085183.1 PREDICTED: lipase 3 [Bactrocera oleae]

Length=393
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q4V6L4_DROME  unnamed protein product                                 270     2e-87
LIP1_DROME  unnamed protein product                                   246     2e-77
Q9VKS9_DROME  unnamed protein product                                 219     8e-67


>Q4V6L4_DROME unnamed protein product
Length=398

 Score = 270 bits (691),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 146/367 (40%), Positives = 207/367 (56%), Gaps = 7/367 (2%)

Query  23   IITANQYACERHLVRTADGYELMLHRIP-PKNTTISQQYPPFILMHGLIGSAADFVLTGR  81
            I+  + Y  E H V+T+DGY L +HRIP  KNT      P   LMHGL+ S++D+VL G 
Sbjct  34   IVRGHGYEIEEHEVQTSDGYILTMHRIPYSKNTGYDGPRPVVFLMHGLLCSSSDWVLAGP  93

Query  82   KRSLGCILHEQGYDVWLPNARGNTYSKRHLHMDSSNSSFWNFSWHDIGYYDVPAVVDYVR  141
               L  +L E GYDVW+ NARGNTYSKRH         FWNF WHDIG YD+PA++DYV 
Sbjct  94   HSGLAYLLSEAGYDVWMGNARGNTYSKRHASKSPLLQPFWNFEWHDIGIYDLPAMMDYVL  153

Query  142  ETTVQQQVHFVAHSQGSTVFFVLLAERPEYNEKFASASLLAPVVFLANIRSPPFKIMTAK  201
              T   Q+ +V HSQG+T FFVL +  P +  +  SA LLAPV ++ ++ SP   +    
Sbjct  154  YWTNVTQLTYVGHSQGTTSFFVLNSMIPRFKSRIRSAHLLAPVAWMEHMESPLATVGGPL  213

Query  202  LEEIEVLLNHLGLYELFPSTALNQLGGHLLCSQDAPTYNLCLLFTFLTVGFSDYQMDRNL  261
            L +    +   G  E  P+T L  L G LLCS +A +  +C    FL  G++   ++  L
Sbjct  214  LGQPNAFVELFGSAEFLPNTQLMNLFGALLCSDEAISQFMCTNTLFLLGGWNSPYINETL  273

Query  262  LPRILETTPAGISKNQFKHFGQLIRTGKFQKFDYQSKDENLRQYKRQTPPEYNLRNVRVP  321
            LP I+ TTPAG S NQ  H+ Q   +G F++FDY S   N ++Y  +TPPEY++  + VP
Sbjct  274  LPDIMATTPAGCSVNQIFHYLQEYNSGYFRQFDYGST-RNKKEYSSKTPPEYDVEGIDVP  332

Query  322  LHLFVGTRDLLLTKEDAIRLTKELK----NTKYTLHELRGFNHIDLLYSSMAPRLIYKHI  377
             +L+    D   +  D  RL   +      + Y + E + +NHID L+      ++Y  +
Sbjct  333  TYLYYSDNDYFASLIDVDRLRYTMNPSALKSAYRMPEEK-WNHIDFLWGLNIKEILYDRV  391

Query  378  LNNVKNV  384
            +N++ N 
Sbjct  392  INDINNA  398


>LIP1_DROME unnamed protein product
Length=439

 Score = 246 bits (627),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 139/380 (37%), Positives = 204/380 (54%), Gaps = 26/380 (7%)

Query  20   VCRIITANQYACERHLVRTADGYELMLHRIPPKNTTISQQYPPFILMHGLIGSAADFVLT  79
            V ++I    Y  E H V T DGY L +HRI        Q  PPF+L HGL+ S+A FV+ 
Sbjct  68   VDKLIAKYGYESEVHHVTTEDGYILTMHRIR------KQGAPPFLLQHGLVDSSAGFVVM  121

Query  80   GRKRSLGCILHEQGYDVWLPNARGNTYSKRHLHMDSSNSSFWNFSWHDIGYYDVPAVVDY  139
            G   SL  +L +  YDVWL NARGN YS+ H  +D   S FW+FSWH+IG YD+PA++D+
Sbjct  122  GPNVSLAYLLADHNYDVWLGNARGNRYSRNHTTLDPDESKFWDFSWHEIGMYDLPAMIDH  181

Query  140  VRETTVQQQVHFVAHSQGSTVFFVLLAERPEYNEKFASASLLAPVVFLANIRSPPFKIMT  199
            V + T   ++H+  HSQG T FFV+ + RP YN+K  S   LAP V+       P+    
Sbjct  182  VLKVTGFPKLHYAGHSQGCTSFFVMCSMRPAYNDKVVSMQALAPAVYAKETEDHPY----  237

Query  200  AKLEEIEVLLNHLGLYELFPSTALNQLGGH--LLCSQDAPTYNLCLLFTFLTVGFSDYQM  257
              +  I +  N      L  S+      G    LC     T  LC+   F  VG +  + 
Sbjct  238  --IRAISLYFN-----SLVGSSIREMFNGEFRFLCRMTEETERLCIEAVFGIVGRNWNEF  290

Query  258  DRNLLPRILETTPAGISKNQFKHFGQLIRTGKFQKFDYQSKDENLRQYKRQTPPEYNLRN  317
            +R + P IL   PAG++  Q KHF Q+I++G+F  + Y S ++N++ Y+   PP YNL  
Sbjct  291  NRKMFPVILGHYPAGVAAKQVKHFIQIIKSGRFAPYSYSS-NKNMQLYRDHLPPRYNLSL  349

Query  318  VRVPLHLFVGTRDLLLTKEDAIRLTKELKNT--KYTLHELRGFNHIDLLYSSMAPRLIYK  375
            V VP  ++  T DLL   +D   +  +L N   KY + + + FNH+D L++    +++Y+
Sbjct  350  VTVPTFVYYSTNDLLCHPKDVESMCDDLGNVTGKYLVPQ-KEFNHMDFLWAIDVRKMLYR  408

Query  376  ---HILNNVKNVTPVSVSRA  392
                +L  V   +P   +R+
Sbjct  409  RMLQVLGKVPEGSPEEANRS  428


>Q9VKS9_DROME unnamed protein product
Length=457

 Score = 219 bits (557),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 125/359 (35%), Positives = 187/359 (52%), Gaps = 9/359 (3%)

Query  22   RIITANQYACERHLVRTADGYELMLHRIPPKNTTISQQYPPFILMHGLIGSAADFVLTGR  81
            ++I+   +  E H   TADGY+L LHRIP    T      P +L+HGL+ S+A +V  G 
Sbjct  101  KMISKYGHQVETHYAFTADGYKLCLHRIPRSGAT------PVLLVHGLMASSATWVQFGP  154

Query  82   KRSLGCILHEQGYDVWLPNARGNTYSKRHLHMDSSNSSFWNFSWHDIGYYDVPAVVDYVR  141
             + L  IL + GYDVW+ N RGN YS+  L    S+  FW+FS+H+IG YD+PA +D + 
Sbjct  155  SQGLAYILSQSGYDVWMLNTRGNVYSEERLAGRESDKIFWDFSFHEIGQYDLPAAIDLIL  214

Query  142  ETTVQQQVHFVAHSQGSTVFFVLLAERPEYNEKFASASLLAPVVFLANIRSPPFKIMTAK  201
              T    + ++ HSQGST FFV+ +ERPEY  K +    L+P V++   RSP  K M   
Sbjct  215  LQTKMPSIQYIGHSQGSTAFFVMCSERPEYAGKISLMQSLSPSVYMEGTRSPALKFMKLF  274

Query  202  LEEIEVLLNHLGLYELFPSTALNQLGGHLLCSQDAPTYNLCLLFTFLTVGFSDYQMDRNL  261
                 +LLN LG +++     +  +  + +C++  P+  +C +F F+  GF+    +  L
Sbjct  275  SGGFTMLLNLLGGHKISLKNKIVDMFRNHICTKLIPS-RICAIFEFVVCGFNFNSFNMTL  333

Query  262  LPRILETTPAGISKNQFKHFGQLIRTGKFQKFDYQSKDENLRQYKRQTPPEYNLRNVRVP  321
             P +      G S  Q  HF QL     FQK+DY      +R Y+   PP YNL      
Sbjct  334  SPILEGHASQGSSAKQIYHFAQLQGNSAFQKYDYGLILNKIR-YQSIFPPLYNLSLALGK  392

Query  322  LHLFVGTRDLLLTKEDAIRLTKELKNTKYTLH-ELRGFNHIDLLYSSMAPRLIYKHILN  379
            + L  G  D L ++ D +RL ++L N     +    GF+H D   S     L+Y  +++
Sbjct  393  VALHRGDGDWLGSESDVLRLERDLPNCIENRNIRFEGFSHFDFTISKDVRSLVYDRVIS  451



Lambda      K        H
   0.324    0.134    0.407 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7057096832


Query= XP_014085184.1 PREDICTED: 7-methylguanosine phosphate-specific
5'-nucleotidase [Bactrocera oleae]

Length=322
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

5NT3B_DROME  unnamed protein product                                  394     5e-138
Q387D9_TRYB2  unnamed protein product                                 30.0    3.7   
Q387D8_TRYB2  unnamed protein product                                 29.6    4.0   


>5NT3B_DROME unnamed protein product
Length=319

 Score = 394 bits (1011),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 181/292 (62%), Positives = 235/292 (80%), Gaps = 2/292 (1%)

Query  25   LLLEDVPILNNDNCKIKDKQRVKRILNEFIGGGHKRLQIVSDFDFTITKQRTSNGAPIPS  84
            L L+D+P L  D+C+++D   V+RI+NEF+ GG +R+QIVSDFD+TITKQRT +G  +PS
Sbjct  14   LRLQDIPALTQDHCRMRDPAEVERIINEFVIGGPERMQIVSDFDYTITKQRTEDGGAVPS  73

Query  85   SFGIFEECKSLPPNFVKAARELHDMYRPIEVNPHILREEKVKAMIEWWTRSGENLMGFTF  144
            SFGIF  C+SLP NF     +L+  YRPIE++PH+   EKV+ MIEWWT+SGE   GF F
Sbjct  74   SFGIFNACQSLPENFKAETDKLYHKYRPIEIDPHMPIAEKVQYMIEWWTKSGELTSGFPF  133

Query  145  DLKEIDEIAKKYAYSMRDNSHELFRDLDALNIPVLVFSAGLGNCVIAMLRQAGLLYPNMK  204
            D  EID+IA KY +++RD +HE F DL  L IP LVFSAGLGN V+++LRQA +L+PN+K
Sbjct  134  DQSEIDQIASKYTHALRDRTHEFFADLQRLGIPTLVFSAGLGNSVVSVLRQANVLHPNVK  193

Query  205  VISNFLQFKDDTMLNGFKEPIIHTFNKNETML-EGTEYYDLVHSRDHIILMGDSLADSGM  263
            V+SNFLQF+ D +L+GF++P+IHTFNKNET+L E +EYYDLVH+RDHII+MGDS+ D+ M
Sbjct  194  VVSNFLQFR-DGLLDGFQQPMIHTFNKNETVLNETSEYYDLVHTRDHIIVMGDSIGDADM  252

Query  264  ADGVPASSHVLKIGFLFHHANEYLEEYMNTFDIVLIDDQTMNVPLTLLKLIE  315
            A GVPASSH++KIGFLF H    +++YM+TFDIVL+DDQTM+VP TLL LIE
Sbjct  253  ASGVPASSHIMKIGFLFDHVEANMKKYMDTFDIVLVDDQTMDVPRTLLSLIE  304


>Q387D9_TRYB2 unnamed protein product
Length=5799

 Score = 30.0 bits (66),  Expect = 3.7, Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 0/38 (0%)

Query  276   IGFLFHHANEYLEEYMNTFDIVLIDDQTMNVPLTLLKL  313
             +G L   ANE  EEY+ T     ++ + + VPL LL L
Sbjct  3884  VGRLNARANELAEEYLRTDRASYLNPEQLGVPLDLLSL  3921


>Q387D8_TRYB2 unnamed protein product
Length=1649

 Score = 29.6 bits (65),  Expect = 4.0, Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 0/38 (0%)

Query  276  IGFLFHHANEYLEEYMNTFDIVLIDDQTMNVPLTLLKL  313
            +G L   ANE  EEY+ T     ++ + + VPL LL L
Sbjct  133  VGRLNARANELAEEYLRTDRASYLNPEQLGVPLDLLSL  170



Lambda      K        H
   0.324    0.134    0.407 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7057096832


Query= XP_014085185.1 PREDICTED: chitinase-like protein Idgf5 [Bactrocera
oleae]

Length=432
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

IDGF5_DROME  unnamed protein product                                  499     4e-176
IDGF4_DROME  unnamed protein product                                  477     4e-167
C5210_DROME  unnamed protein product                                  456     6e-159


>IDGF5_DROME unnamed protein product
Length=444

 Score = 499 bits (1286),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 237/420 (56%), Positives = 302/420 (72%), Gaps = 6/420 (1%)

Query  17   EAAKMVCYYDSASQFREGPAKLTLQDLEPALQFCNYLVYGYAAIDPETYQLKPLHKNLDI  76
            E  K+VC+YD+ S  REGPA+++L +LEPALQFCN+LVYGYA ID  TY++K L  +L  
Sbjct  27   EVGKLVCFYDAQSFVREGPAQMSLAELEPALQFCNFLVYGYAGIDAVTYKIKSLDPSLTN  86

Query  77   TLNHYRNITNLRRNHPELLILLSVGGDRDLFEE--TPSSSYLSVLENQAHRNAFINSAIA  134
               HYR+IT LR+ +P +  LLSVGGDRD+  E    S  YL +LE   HR +F  S +A
Sbjct  87   DRQHYRHITALRKKYPHVRFLLSVGGDRDVNSEGVADSDKYLRLLEQSEHRKSFQASVLA  146

Query  135  HLKTYDFDGLDLAWQFPKNKPKIVEHIIRRFWRKFKGWFSSPKLVDENAAEHKEQFTTLV  194
             L    FDG+DLAWQFPKN+PK+ + + +R W   +GWFSS   VDE + EH+EQF TL+
Sbjct  147  ELNNNGFDGIDLAWQFPKNRPKLQQGVFKRVWGSLRGWFSSSS-VDEKSEEHREQFATLL  205

Query  195  RELTDALKFDGLILTLTMLPHVDPKLFIDVPAIIGNVDFVNLGSYDFQTPDRDPKVADHS  254
             EL   L+  G +LT++MLPHV  +LFIDVP ++ NVDFVNLG+YDFQTP+RDPKVAD  
Sbjct  206  EELQSDLRRGGQLLTVSMLPHVSAELFIDVPKVLSNVDFVNLGTYDFQTPERDPKVADLP  265

Query  255  APIYEMFERDPTHNIDYQVQYWLNNSA--PSNKINIGVPAYGLTWTMSCKSGITGYPPIE  312
             P+Y M++RDP+HN+ YQVQYW+N ++    +K+++GV +YG  W M+  SGITGYPPI 
Sbjct  266  TPLYAMYDRDPSHNVQYQVQYWMNQTSEISVHKLHVGVTSYGRAWNMTRNSGITGYPPIP  325

Query  313  KTLGRGAAGKQLRQPGLMSWPEICEKLQADKELGGEDALLRKVGDPRQRYGSYAYRAADK  372
               G    G+Q   PGL+SWPEIC+ LQ   +   E   LRKVGDP +R+G YAYRAAD 
Sbjct  326  AANGAAPPGRQTVTPGLLSWPEICDLLQQQPQ-DREVPHLRKVGDPTKRFGIYAYRAADD  384

Query  373  NAHNGLWISYEEPSTAATKASYVFAKGLGGVALFDLSLDDFRGHCAGDKYPILRSIKFKL  432
               NGLW+ YE+P TAA KA +V A+GLGGVA  DLS+DDFRG CAG+K+PILRSIKFKL
Sbjct  385  QGENGLWVGYEDPLTAAIKAGFVHAQGLGGVAFHDLSMDDFRGQCAGEKFPILRSIKFKL  444


>IDGF4_DROME unnamed protein product
Length=442

 Score = 477 bits (1227),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 236/436 (54%), Positives = 309/436 (71%), Gaps = 9/436 (2%)

Query  5    TFLLITLVIGSIEAA---KMVCYYDSASQFREGPAKLTLQDLEPALQFCNYLVYGYAAID  61
            + L+ +L IG I AA    ++CYYD  S  REG +KL L DLEPALQ+C +LVYGYA I+
Sbjct  8    SLLVGSLAIGQISAAGSHHLLCYYDGNSFVREGLSKLILTDLEPALQYCTHLVYGYAGIN  67

Query  62   PETYQLKPLHKNLDITLNH--YRNITNLRRNHPELLILLSVGGDRDLFEETPSSSYLSVL  119
            P + +L   ++ LD+ L    +R +T L+R +P L +LLSVGGD+D  +   ++ YL++L
Sbjct  68   PSSNKLVSNNEKLDLDLGSSLFRQVTGLKRKYPALKVLLSVGGDKDTVDPE-NNKYLTLL  126

Query  120  ENQAHRNAFINSAIAHLKTYDFDGLDLAWQFPKNKPKIVEHIIRRFWRKFKGWFSSPKLV  179
            E+   R  FINSA + +KTY FDGLDL WQFPKNKPK V   I +FW+ FK  FS   +V
Sbjct  127  ESSNARIPFINSAHSLVKTYGFDGLDLGWQFPKNKPKKVHGSIGKFWKGFKKIFSGDHVV  186

Query  180  DENAAEHKEQFTTLVRELTDALKFDGLILTLTMLPHVDPKLFIDVPAIIGNVDFVNLGSY  239
            DE A EHKE FT LVREL +A + DG IL L++LP+V+  LF DVPAII N+D+VNL +Y
Sbjct  187  DEKAEEHKEAFTALVRELKNAFRPDGYILGLSVLPNVNSSLFFDVPAIINNLDYVNLHTY  246

Query  240  DFQTPDRDPKVADHSAPIYEMFERDPTHNIDYQVQYWLNNSAPSNKINIGVPAYGLTWTM  299
            DFQTP+R+ +VAD  APIYE+ ER+P  N++YQV+YW  N AP+ KIN+G+  YG  W +
Sbjct  247  DFQTPERNNEVADFPAPIYELNERNPEFNVNYQVKYWTGNRAPAAKINVGIATYGRAWKL  306

Query  300  SCKSGITGYPPIEKTLGRGAAGKQLRQPGLMSWPEICEKL--QADKELGGEDALLRKVGD  357
            +  SG+TG PP+ +  G   AG Q + PGL+SWPE+C KL   A++ L G D  LRKVGD
Sbjct  307  TKDSGLTGLPPVAEADGVAPAGTQTQIPGLLSWPEVCAKLPNPANQHLKGADGPLRKVGD  366

Query  358  PRQRYGSYAYRAADKNAHNGLWISYEEPSTAATKASYVFAKGLGGVALFDLSLDDFRGHC  417
            P +R+GSYAYR+AD +  NG+W+ YE+P TAA KA YV  +GLGG+A+ DLS DDFRG C
Sbjct  367  PTKRFGSYAYRSADDSGENGVWVGYEDPDTAAIKAEYVKREGLGGIAVVDLSFDDFRGGC  426

Query  418  AG-DKYPILRSIKFKL  432
             G DK+PILR +K KL
Sbjct  427  TGHDKFPILRQVKSKL  442


>C5210_DROME unnamed protein product
Length=452

 Score = 456 bits (1174),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 224/451 (50%), Positives = 310/451 (69%), Gaps = 20/451 (4%)

Query  1    MLKVTFLLITLVIGSIEAAK----------MVCYYDSASQFREGPAKLTLQDLEPALQFC  50
            M+     +++L + SI+A+K          +VCYYDSAS  +EG  KL + +LEPALQFC
Sbjct  1    MIIKALAIVSLCLASIQASKVGAPQLPKKHLVCYYDSASFVKEGLGKLVIDELEPALQFC  60

Query  51   NYLVYGYAAIDPETYQLKPLHKNLDITLNH--YRNITNLRRNHPELLILLSVGGDRDL--  106
            +YLVYGYA I+ ++++   L++ LD+ L    YR +T L+R +P + ILLSVGGD+D+  
Sbjct  61   DYLVYGYAGIERDSHKAVSLNQQLDLDLGKGLYRTVTRLKRKYPNVKILLSVGGDKDIEL  120

Query  107  ---FEETPSSSYLSVLENQAHRNAFINSAIAHLKTYDFDGLDLAWQFPKNKPKIVEHIIR  163
                +E P+  YL +LE+   R  F+N+  + +KTY FDGLD+AWQFPKNKPK V   I 
Sbjct  121  DKDAKELPNK-YLELLESPTGRTRFVNTVYSLVKTYGFDGLDVAWQFPKNKPKKVHSGIG  179

Query  164  RFWRKFKGWFSSPKLVDENAAEHKEQFTTLVRELTDALKFDGLILTLTMLPHVDPKLFID  223
              W+ FK  FS   +VDE + EHKEQFT L+R++ +A + D L+L+ T+LP+V+  LF D
Sbjct  180  SLWKGFKKVFSGDSIVDEKSEEHKEQFTALLRDVKNAFRPDNLLLSTTVLPNVNSSLFYD  239

Query  224  VPAIIGNVDFVNLGSYDFQTPDRDPKVADHSAPIYEMFERDPTHNIDYQVQYWLNNSAPS  283
            +PA++  +DFVNLG++DF TP R+P+VAD++APIYE+ ER+P  N+  QV+YWL N+ P+
Sbjct  240  IPAVVNYLDFVNLGTFDFFTPQRNPEVADYAAPIYELSERNPEFNVAAQVKYWLRNNCPA  299

Query  284  NKINIGVPAYGLTWTMSCKSGITGYPPIEKTLGRGAAGKQLRQPGLMSWPEICEKL--QA  341
            +KIN+GV  YG  W ++  SG TG PP++        G   + PG+ SWPE+C  L  Q 
Sbjct  300  SKINVGVATYGRPWKLTDDSGDTGVPPVKDVKDEAPVGGNTQVPGIYSWPEVCALLPNQN  359

Query  342  DKELGGEDALLRKVGDPRQRYGSYAYRAADKNAHNGLWISYEEPSTAATKASYVFAKGLG  401
            +  L G +A L KV DP +R+GSYAYRAADK   NG+W+S+E+P TAA KA YV  + LG
Sbjct  360  NAYLKGANAPLIKVQDPAKRFGSYAYRAADKKGDNGIWVSFEDPDTAADKAGYVRTENLG  419

Query  402  GVALFDLSLDDFRGHCAGDKYPILRSIKFKL  432
            GVALFDLS DDFRG C  +KYPILR+IK++L
Sbjct  420  GVALFDLSYDDFRGLCTNEKYPILRAIKYRL  450



Lambda      K        H
   0.324    0.134    0.407 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7057096832


Query= XP_014085186.1 PREDICTED: uncharacterized protein LOC106614149
[Bactrocera oleae]

Length=425
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SGO1_DROME  unnamed protein product                                   35.0    0.11 
HIG_DROME  unnamed protein product                                    30.0    4.4  


>SGO1_DROME unnamed protein product
Length=401

 Score = 35.0 bits (79),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 19/28 (68%), Gaps = 3/28 (11%)

Query  388  SLC---GRPSRRCAPTTLAEPSLRAKLR  412
            S C    RPSR C PT+L EPSL+ KLR
Sbjct  363  SFCNNSARPSRSCRPTSLVEPSLKNKLR  390


 Score = 30.4 bits (67),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 31/62 (50%), Gaps = 8/62 (13%)

Query  4   YKLLNKELVDANRELKQTITTYQNELVLTRAELM--------EQHRIRVEGEREYRDRVL  55
           YKLLN EL+D  ++ +  I  Y+  ++    E+M        + HR R+E     R  +L
Sbjct  9   YKLLNAELMDQVQKQRLEIGEYRKRVISLEREIMDIREEHVLQNHRQRMENISIVRSLML  68

Query  56  SL  57
           SL
Sbjct  69  SL  70


>HIG_DROME unnamed protein product
Length=958

 Score = 30.0 bits (66),  Expect = 4.4, Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 37/75 (49%), Gaps = 6/75 (8%)

Query  135  YASHAIIEQTETSKLEESESGSDMDLDNSINKDNVIDVELEESYEN----ADLHCIK-EA  189
            Y  HAI+  TE S   +  +GS +  +  +   ++ D+ L+    N    + LH +K +A
Sbjct  184  YKRHAILHDTEASPETDRWAGSKLAAEGDVYYVHIADI-LKSREPNRELKSKLHKLKMKA  242

Query  190  SEEECEENGGGKKCT  204
               +C   GG +KCT
Sbjct  243  RLNKCLAEGGKEKCT  257



Lambda      K        H
   0.324    0.134    0.407 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7057096832


Query= XP_014085187.1 PREDICTED: uncharacterized protein LOC106614150
[Bactrocera oleae]

Length=262
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ABHD_DICDI  unnamed protein product                                   29.3    3.6  
Q38EI1_TRYB2  unnamed protein product                                 29.3    3.8  
VEIN_DROME  unnamed protein product                                   28.9    5.7  


>ABHD_DICDI unnamed protein product
Length=395

 Score = 29.3 bits (64),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 23/77 (30%), Positives = 40/77 (52%), Gaps = 7/77 (9%)

Query  62   GCSPL-VSHTPRFSALKEDDIPAVGQYITENAKPIKQCKKPFNVGDALKRE--PKFLTPA  118
            GC+   ++    +SA++ DDI  V +Y+T+ A P+   KK F VG +L       ++  A
Sbjct  156  GCAGNPITADRAYSAVQLDDIKFVTEYLTKTALPL--VKKWFLVGFSLGSAILVNYMADA  213

Query  119  PTTYPY--HIKIPDRLD  133
                PY  H+ I + ++
Sbjct  214  GKDSPYLAHVSISNPMN  230


>Q38EI1_TRYB2 unnamed protein product
Length=1351

 Score = 29.3 bits (64),  Expect = 3.8, Method: Composition-based stats.
 Identities = 18/59 (31%), Positives = 26/59 (44%), Gaps = 6/59 (10%)

Query  32   LWPNEPRESTASFWSVPSFSSLNKEYPSKYGCSPLVSHTPRFSALKEDDIPAVGQYITE  90
            L   EP+ +   F     FS L+  YP      PL+  T +F+       P  G+Y+TE
Sbjct  279  LQEKEPKNAALFFEYAQCFSRLSGSYP------PLLGVTMQFAEAAHRMAPQRGEYLTE  331


>VEIN_DROME unnamed protein product
Length=623

 Score = 28.9 bits (63),  Expect = 5.7, Method: Compositional matrix adjust.
 Identities = 20/87 (23%), Positives = 34/87 (39%), Gaps = 4/87 (5%)

Query  97   QCKKPFNVGDALKREPKFLTPAPTTYPYH---IKIPDRLDYCLAFGTRRVIWPATPIFCS  153
            +C+       A+ +    +  +P  +P       IP   DYC   GT R+I     ++C 
Sbjct  530  ECRAKNKASKAIAKRRIMIKASPVHFPTDRSASGIPCNFDYCFHNGTCRMIPDINEVYCR  589

Query  154  ARNYMKCLRCQQQ-PDGDYYHNFKSQL  179
                    RC+ + PD  Y+     Q+
Sbjct  590  CPTEYFGNRCENKWPDSRYFVAIYGQI  616



Lambda      K        H
   0.324    0.134    0.407 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7057096832


Query= XP_014085188.1 PREDICTED: transcription factor grauzone [Bactrocera
oleae]

Length=658
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GRAU_DROME  unnamed protein product                                   303     1e-94
O96395_DROME  unnamed protein product                                 119     8e-28
M9PF60_DROME  unnamed protein product                                 118     1e-27


>GRAU_DROME unnamed protein product
Length=570

 Score = 303 bits (776),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 208/616 (34%), Positives = 310/616 (50%), Gaps = 87/616 (14%)

Query  2    ICRLCLKHFKDV---INIFDEIGIELNVAAVLAKYFWFEPRSDDPISTAICNSCWISVSN  58
            ICRLCL+        + IFD    E  VA VL ++FWFE   +D IS  ICN CW  VS 
Sbjct  3    ICRLCLRGVSGAQMCLQIFDVDSGESKVAEVLRQHFWFEVLPNDEISKVICNVCWTQVSE  62

Query  59   FNEFYLGVEEAHRLLTERFSLKTDIEPNCRKRRNYSITEEKDVNAWLDQNLSTTIPKNDF  118
            F++FY+ ++EA  +       K D E       N S  EE              +P +  
Sbjct  63   FHQFYVSIQEAQVIYATTSKFKQDPE-----MVNTSWPEE------------VLMPADVL  105

Query  119  SNDDELINNRQNICTLDKPAVKGLNCVEPKELNGEQSLDGDEPYINSESFMEEVMGIVEE  178
            + D++ +  + N+  LD+     L+  +P  ++ E S  G    I +E    ++  + E+
Sbjct  106  AVDND-VGAQINVNPLDE-----LDLSQP--MSPEDSKVG----IKTERQSPDMELLFED  153

Query  179  SEDALALPLERQ----------LRSTRSKTKNFLEPSKSISDCGSKIIGNECQKTDLGKR  228
            + +      E             RS R + ++  +P+K+    G+  +G +      GK 
Sbjct  154  ANNEQDEDYEDDEDDDTDDLIVTRSGRKRKRDVAKPAKTKR--GTVSVGRK------GKE  205

Query  229  K---RRGRPPKIKSEKKDKKGRTKSKIDTNEEDDSQQESYEERMRQIDEKIAQCIRLVCD  285
            K   +RG P +I                       + E      ++ +E I + I + C+
Sbjct  206  KMVVKRGPPKRI----------------------FKMERLPPFCKEDEELIKRYIVMGCE  243

Query  286  ICATEQQTFSQLRKHMEKIHQC-KGYATCCNKKFNKRALLVGHIEKHINPDCYRCESCDK  344
            +C    + F  +R+H +  H   + Y  CC +K NKR L+  H  +H NP+  +C+ C K
Sbjct  244  LCIFLAEDFDGIREHFKDKHPDERPYIKCCGRKLNKRCLIQEHARRHENPEYIKCKDCGK  303

Query  345  TFADKQCMRNHFLIKHQPEEEKQYQCEHCPKRFARPYILEQHRLIH---EERSHICDICK  401
             FA+   +R H+L+ H P+EE  +QCE C KRF+R  +LE H+  H    ER  IC  C 
Sbjct  304  VFANSSVLRAHWLVHHVPDEECDFQCEDCGKRFSRRNLLELHKGSHVPVNERKFICPQCP  363

Query  402  R--GFASANMLSTHMKTMHSSYGATMCDVCAKVIRGRTAFARHQLEHSGIVLPKVQCEK-  458
            +   FA+   +  H+   H    A +C VC K I+ +  F +H   H     P+++C + 
Sbjct  364  KHNAFATEYHMQVHISMQHRK-AANICHVCGKKIKDKAVFEKHVRLHFEESGPRIKCPRP  422

Query  459  -CGSWHKDKYSLQKHKRRHNDDGTLHVCSICGKVAPNRSALLSHQRYVHKSERVFECSVC  517
             C SW KD+ +L++H RRHND+G L +CS CGK   N  AL+ H+RY H S  ++ C  C
Sbjct  423  DCESWLKDEDNLKQHLRRHNDEGKLFICSECGKSCKNSRALIGHKRYSH-SNVIYTCEQC  481

Query  518  KKAFKKAISLKEHMTMHTGEVLYSCPHCPKTFNSNANMHSHRKKMHPKEFEETRKQRREN  577
             K FKK ISLKEHM  HTGE LY CP CP+TFNSNANMHSH+KKMHP E++  RK +  +
Sbjct  482  GKTFKKDISLKEHMAQHTGEPLYKCPFCPRTFNSNANMHSHKKKMHPVEWDIWRKTKTGS  541

Query  578  AAK--PDAYVEKIDKD  591
            + K  P A V ++ +D
Sbjct  542  SQKVLPSAQVAQMFRD  557


>O96395_DROME unnamed protein product
Length=583

 Score = 119 bits (297),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 89/294 (30%), Positives = 139/294 (47%), Gaps = 20/294 (7%)

Query  283  VCDICATEQQTFSQLRKHMEKIHQCKGYATC--CNKKFNKRALLVGHIEKHINPDCYRCE  340
            +CD C    +T +QL  H  + H  +    C  C K +     L  H+  H     ++C 
Sbjct  273  LCDFCGRGFRTNAQLTTHRRR-HTGERPFKCPLCPKAYTHGPTLKSHMHTHDEEKGHKCP  331

Query  341  SCDKTFADKQCMRNHFLIKHQPEEEKQYQCEHCPKRFARPYILEQHRLIH-EERSHICDI  399
             CDKTF  +  +R H + +H    E+ Y+C  CP+ FA+   L+ H  +H EER   C++
Sbjct  332  QCDKTFYTRGNLRAH-IQRHT--GERPYKCPDCPQTFAKNSGLKLHSRLHKEERPFKCEL  388

Query  400  CKRGFASANMLSTHMKTMHSSYGATMCDVCAKVIRGRTAFARHQLEHSGIVLPKVQCEKC  459
            C +GF     L TH++ +H+      C  C K    ++   +HQ  HSGI     +CE+C
Sbjct  389  CGKGFVQNQHLITHLR-VHNGDRQFKCPDCDKSFFEKSNMMKHQRTHSGIK--PFKCEEC  445

Query  460  GSWHKDKYSLQKHKRRHNDDGTLHVCSICGKVAPNRSALLSHQRY-VHKSERVFECSVCK  518
            G      + L+ H R H  +   + C  CGK      +L+ H  + V  ++R F+CS C 
Sbjct  446  GQAFSHNHHLKSHLRIHTGEKP-YKCDQCGKGFSANQSLMKHTLWHVDNNDRPFKCSQCP  504

Query  519  KAFKKAISLKEHMTMHTG----EVLYSCPHCPKTF----NSNANMHSHRKKMHP  564
            KA+    SL+ H   H      + L+ CPHC   F      + ++ SH+ + HP
Sbjct  505  KAYDTQQSLRGHEKTHKNPDEPKTLHQCPHCDVRFALKKTLDKHITSHKIRPHP  558


 Score = 87.8 bits (216),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 77/284 (27%), Positives = 114/284 (40%), Gaps = 44/284 (15%)

Query  282  LVCDICATEQQTFSQLRKHMEKIHQCKG------YATCCNKKFNKRALLVGHIEKHINPD  335
            L+C  C     T   L +H+ K H+ +G          C + F   A L  H  +H    
Sbjct  240  LLCTECGVSYSTQKALARHVAK-HKEQGDTQKPHLCDFCGRGFRTNAQLTTHRRRHTGER  298

Query  336  CYRCESCDKTFADKQCMRNHFLIKHQPEEEKQYQCEHCPKRFARPYILEQHRLIHE-ERS  394
             ++C  C K +     +++H    H  +EEK ++C  C K F     L  H   H  ER 
Sbjct  299  PFKCPLCPKAYTHGPTLKSHM---HTHDEEKGHKCPQCDKTFYTRGNLRAHIQRHTGERP  355

Query  395  HICDICKRGFASANMLSTHMKTMHSSYGATMCDVCAKVIRGRTAFARHQLEHSGIVLPKV  454
            + C  C + FA  + L  H + +H       C++C K       F ++Q           
Sbjct  356  YKCPDCPQTFAKNSGLKLHSR-LHKEERPFKCELCGK------GFVQNQ-----------  397

Query  455  QCEKCGSWHKDKYSLQKHKRRHNDDGTLHVCSICGKVAPNRSALLSHQRYVHKSERVFEC  514
                          L  H R HN D     C  C K    +S ++ HQR  H   + F+C
Sbjct  398  -------------HLITHLRVHNGDRQF-KCPDCDKSFFEKSNMMKHQR-THSGIKPFKC  442

Query  515  SVCKKAFKKAISLKEHMTMHTGEVLYSCPHCPKTFNSNANMHSH  558
              C +AF     LK H+ +HTGE  Y C  C K F++N ++  H
Sbjct  443  EECGQAFSHNHHLKSHLRIHTGEKPYKCDQCGKGFSANQSLMKH  486


 Score = 82.0 bits (201),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 56/196 (29%), Positives = 87/196 (44%), Gaps = 10/196 (5%)

Query  370  CEHCPKRFARPYILEQHRLIHEE-----RSHICDICKRGFASANMLSTHMKTMHSSYGAT  424
            C  C   ++    L +H   H+E     + H+CD C RGF +   L+TH +  H+     
Sbjct  242  CTECGVSYSTQKALARHVAKHKEQGDTQKPHLCDFCGRGFRTNAQLTTHRR-RHTGERPF  300

Query  425  MCDVCAKVIRGRTAFARHQLEHSGIVLPKVQCEKCGSWHKDKYSLQKHKRRHNDDGTLHV  484
             C +C K          H   H      K  C +C      + +L+ H +RH  +   + 
Sbjct  301  KCPLCPKAYTHGPTLKSHMHTHDEEKGHK--CPQCDKTFYTRGNLRAHIQRHTGERP-YK  357

Query  485  CSICGKVAPNRSALLSHQRYVHKSERVFECSVCKKAFKKAISLKEHMTMHTGEVLYSCPH  544
            C  C +     S L  H R +HK ER F+C +C K F +   L  H+ +H G+  + CP 
Sbjct  358  CPDCPQTFAKNSGLKLHSR-LHKEERPFKCELCGKGFVQNQHLITHLRVHNGDRQFKCPD  416

Query  545  CPKTFNSNANMHSHRK  560
            C K+F   +NM  H++
Sbjct  417  CDKSFFEKSNMMKHQR  432


 Score = 61.2 bits (147),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/137 (31%), Positives = 62/137 (45%), Gaps = 6/137 (4%)

Query  284  CDICATEQQTFSQLRKHMEKIHQCKGYATC--CNKKFNKRALLVGHIEKHI--NPDCYRC  339
            C+ C         L+ H+ +IH  +    C  C K F+    L+ H   H+  N   ++C
Sbjct  442  CEECGQAFSHNHHLKSHL-RIHTGEKPYKCDQCGKGFSANQSLMKHTLWHVDNNDRPFKC  500

Query  340  ESCDKTFADKQCMRNHFLIKHQPEEEKQ-YQCEHCPKRFARPYILEQHRLIHEERSHICD  398
              C K +  +Q +R H      P+E K  +QC HC  RFA    L++H   H+ R H C 
Sbjct  501  SQCPKAYDTQQSLRGHEKTHKNPDEPKTLHQCPHCDVRFALKKTLDKHITSHKIRPHPCP  560

Query  399  ICKRGFASANMLSTHMK  415
             C  GF S   L  H++
Sbjct  561  QCPEGFFSQKSLKKHLR  577


 Score = 53.1 bits (126),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 49/197 (25%), Positives = 78/197 (40%), Gaps = 38/197 (19%)

Query  314  CNKKFNKRALLVGHIEKHINPDCYRCESCDKTFADKQCMRNHFLIKHQPEEE--KQYQCE  371
            C K F +   L+ H+  H     ++C  CDK+F +K  M     +KHQ      K ++CE
Sbjct  389  CGKGFVQNQHLITHLRVHNGDRQFKCPDCDKSFFEKSNM-----MKHQRTHSGIKPFKCE  443

Query  372  HCPKRFARPYILEQHRLIHE-ERSHICDICKRGFASANMLSTH-MKTMHSSYGATMCDVC  429
             C + F+  + L+ H  IH  E+ + CD C +GF++   L  H +  + ++     C  C
Sbjct  444  ECGQAFSHNHHLKSHLRIHTGEKPYKCDQCGKGFSANQSLMKHTLWHVDNNDRPFKCSQC  503

Query  430  AKVIRGRTAFARHQLEHSGIVLPKV-----------------------------QCEKCG  460
             K    + +   H+  H     PK                               C +C 
Sbjct  504  PKAYDTQQSLRGHEKTHKNPDEPKTLHQCPHCDVRFALKKTLDKHITSHKIRPHPCPQCP  563

Query  461  SWHKDKYSLQKHKRRHN  477
                 + SL+KH R HN
Sbjct  564  EGFFSQKSLKKHLRLHN  580


>M9PF60_DROME unnamed protein product
Length=571

 Score = 118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 89/294 (30%), Positives = 139/294 (47%), Gaps = 20/294 (7%)

Query  283  VCDICATEQQTFSQLRKHMEKIHQCKGYATC--CNKKFNKRALLVGHIEKHINPDCYRCE  340
            +CD C    +T +QL  H  + H  +    C  C K +     L  H+  H     ++C 
Sbjct  261  LCDFCGRGFRTNAQLTTHRRR-HTGERPFKCPLCPKAYTHGPTLKSHMHTHDEEKGHKCP  319

Query  341  SCDKTFADKQCMRNHFLIKHQPEEEKQYQCEHCPKRFARPYILEQHRLIH-EERSHICDI  399
             CDKTF  +  +R H + +H    E+ Y+C  CP+ FA+   L+ H  +H EER   C++
Sbjct  320  QCDKTFYTRGNLRAH-IQRHT--GERPYKCPDCPQTFAKNSGLKLHSRLHKEERPFKCEL  376

Query  400  CKRGFASANMLSTHMKTMHSSYGATMCDVCAKVIRGRTAFARHQLEHSGIVLPKVQCEKC  459
            C +GF     L TH++ +H+      C  C K    ++   +HQ  HSGI     +CE+C
Sbjct  377  CGKGFVQNQHLITHLR-VHNGDRQFKCPDCDKSFFEKSNMMKHQRTHSGIK--PFKCEEC  433

Query  460  GSWHKDKYSLQKHKRRHNDDGTLHVCSICGKVAPNRSALLSHQRY-VHKSERVFECSVCK  518
            G      + L+ H R H  +   + C  CGK      +L+ H  + V  ++R F+CS C 
Sbjct  434  GQAFSHNHHLKSHLRIHTGEKP-YKCDQCGKGFSANQSLMKHTLWHVDNNDRPFKCSQCP  492

Query  519  KAFKKAISLKEHMTMHTG----EVLYSCPHCPKTF----NSNANMHSHRKKMHP  564
            KA+    SL+ H   H      + L+ CPHC   F      + ++ SH+ + HP
Sbjct  493  KAYDTQQSLRGHEKTHKNPDEPKTLHQCPHCDVRFALKKTLDKHITSHKIRPHP  546


 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 77/284 (27%), Positives = 114/284 (40%), Gaps = 44/284 (15%)

Query  282  LVCDICATEQQTFSQLRKHMEKIHQCKG------YATCCNKKFNKRALLVGHIEKHINPD  335
            L+C  C     T   L +H+ K H+ +G          C + F   A L  H  +H    
Sbjct  228  LLCTECGVSYSTQKALARHVAK-HKEQGDTQKPHLCDFCGRGFRTNAQLTTHRRRHTGER  286

Query  336  CYRCESCDKTFADKQCMRNHFLIKHQPEEEKQYQCEHCPKRFARPYILEQHRLIHE-ERS  394
             ++C  C K +     +++H    H  +EEK ++C  C K F     L  H   H  ER 
Sbjct  287  PFKCPLCPKAYTHGPTLKSHM---HTHDEEKGHKCPQCDKTFYTRGNLRAHIQRHTGERP  343

Query  395  HICDICKRGFASANMLSTHMKTMHSSYGATMCDVCAKVIRGRTAFARHQLEHSGIVLPKV  454
            + C  C + FA  + L  H + +H       C++C K       F ++Q           
Sbjct  344  YKCPDCPQTFAKNSGLKLHSR-LHKEERPFKCELCGK------GFVQNQ-----------  385

Query  455  QCEKCGSWHKDKYSLQKHKRRHNDDGTLHVCSICGKVAPNRSALLSHQRYVHKSERVFEC  514
                          L  H R HN D     C  C K    +S ++ HQR  H   + F+C
Sbjct  386  -------------HLITHLRVHNGDRQF-KCPDCDKSFFEKSNMMKHQR-THSGIKPFKC  430

Query  515  SVCKKAFKKAISLKEHMTMHTGEVLYSCPHCPKTFNSNANMHSH  558
              C +AF     LK H+ +HTGE  Y C  C K F++N ++  H
Sbjct  431  EECGQAFSHNHHLKSHLRIHTGEKPYKCDQCGKGFSANQSLMKH  474


 Score = 81.6 bits (200),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 56/196 (29%), Positives = 87/196 (44%), Gaps = 10/196 (5%)

Query  370  CEHCPKRFARPYILEQHRLIHEE-----RSHICDICKRGFASANMLSTHMKTMHSSYGAT  424
            C  C   ++    L +H   H+E     + H+CD C RGF +   L+TH +  H+     
Sbjct  230  CTECGVSYSTQKALARHVAKHKEQGDTQKPHLCDFCGRGFRTNAQLTTHRR-RHTGERPF  288

Query  425  MCDVCAKVIRGRTAFARHQLEHSGIVLPKVQCEKCGSWHKDKYSLQKHKRRHNDDGTLHV  484
             C +C K          H   H      K  C +C      + +L+ H +RH  +   + 
Sbjct  289  KCPLCPKAYTHGPTLKSHMHTHDEEKGHK--CPQCDKTFYTRGNLRAHIQRHTGERP-YK  345

Query  485  CSICGKVAPNRSALLSHQRYVHKSERVFECSVCKKAFKKAISLKEHMTMHTGEVLYSCPH  544
            C  C +     S L  H R +HK ER F+C +C K F +   L  H+ +H G+  + CP 
Sbjct  346  CPDCPQTFAKNSGLKLHSR-LHKEERPFKCELCGKGFVQNQHLITHLRVHNGDRQFKCPD  404

Query  545  CPKTFNSNANMHSHRK  560
            C K+F   +NM  H++
Sbjct  405  CDKSFFEKSNMMKHQR  420


 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/137 (31%), Positives = 62/137 (45%), Gaps = 6/137 (4%)

Query  284  CDICATEQQTFSQLRKHMEKIHQCKGYATC--CNKKFNKRALLVGHIEKHI--NPDCYRC  339
            C+ C         L+ H+ +IH  +    C  C K F+    L+ H   H+  N   ++C
Sbjct  430  CEECGQAFSHNHHLKSHL-RIHTGEKPYKCDQCGKGFSANQSLMKHTLWHVDNNDRPFKC  488

Query  340  ESCDKTFADKQCMRNHFLIKHQPEEEKQ-YQCEHCPKRFARPYILEQHRLIHEERSHICD  398
              C K +  +Q +R H      P+E K  +QC HC  RFA    L++H   H+ R H C 
Sbjct  489  SQCPKAYDTQQSLRGHEKTHKNPDEPKTLHQCPHCDVRFALKKTLDKHITSHKIRPHPCP  548

Query  399  ICKRGFASANMLSTHMK  415
             C  GF S   L  H++
Sbjct  549  QCPEGFFSQKSLKKHLR  565


 Score = 53.1 bits (126),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 49/197 (25%), Positives = 78/197 (40%), Gaps = 38/197 (19%)

Query  314  CNKKFNKRALLVGHIEKHINPDCYRCESCDKTFADKQCMRNHFLIKHQPEEE--KQYQCE  371
            C K F +   L+ H+  H     ++C  CDK+F +K  M     +KHQ      K ++CE
Sbjct  377  CGKGFVQNQHLITHLRVHNGDRQFKCPDCDKSFFEKSNM-----MKHQRTHSGIKPFKCE  431

Query  372  HCPKRFARPYILEQHRLIHE-ERSHICDICKRGFASANMLSTH-MKTMHSSYGATMCDVC  429
             C + F+  + L+ H  IH  E+ + CD C +GF++   L  H +  + ++     C  C
Sbjct  432  ECGQAFSHNHHLKSHLRIHTGEKPYKCDQCGKGFSANQSLMKHTLWHVDNNDRPFKCSQC  491

Query  430  AKVIRGRTAFARHQLEHSGIVLPKV-----------------------------QCEKCG  460
             K    + +   H+  H     PK                               C +C 
Sbjct  492  PKAYDTQQSLRGHEKTHKNPDEPKTLHQCPHCDVRFALKKTLDKHITSHKIRPHPCPQCP  551

Query  461  SWHKDKYSLQKHKRRHN  477
                 + SL+KH R HN
Sbjct  552  EGFFSQKSLKKHLRLHN  568



Lambda      K        H
   0.324    0.134    0.407 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7057096832


Query= XP_014085189.1 PREDICTED: sodium-dependent nutrient amino acid
transporter 1 [Bactrocera oleae]

Length=636
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VSV2_DROME  unnamed protein product                                 651     0.0  
Q86P29_DROME  unnamed protein product                                 650     0.0  
A1ZBC7_DROME  unnamed protein product                                 646     0.0  


>Q9VSV2_DROME unnamed protein product
Length=629

 Score = 651 bits (1679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/585 (52%), Positives = 421/585 (72%), Gaps = 15/585 (3%)

Query  61   REKWSREIEFLFSCIALSVGLGNVWRFPFIALANGGGAFVIPYVIVLLLIGRPVYYMEVL  120
            R+ W   +EFL SCIALSVGLGNVWRFPF AL NGGGAF+IPY++VL ++G+P+YYME+L
Sbjct  51   RDNWGSSLEFLMSCIALSVGLGNVWRFPFTALENGGGAFLIPYLVVLFVVGKPIYYMEML  110

Query  121  IGQFASRGAVGVFDMAPIMKGIAYGQVYATALATTYYAAIMALTIKYLLASFAEILPWAT  180
            +GQF+SRG V VFD AP+M+G+ Y Q+ A  +  TYYA++MALT++Y   SFA  LPW+ 
Sbjct  111  LGQFSSRGIVQVFDFAPLMRGVGYAQLLALGVLATYYASVMALTLRYFFDSFASELPWSF  170

Query  181  CLPEWGDNCVSITSYNSSANDNATEGMLI----SSAELYFTKVALREKDNIEDGIGAPNR  236
            C  EWGD CVS      ++     +G L     SS +LY  ++ L E D++E+GIG P+ 
Sbjct  171  CREEWGDGCVS------ASGGQPLQGQLSRNFSSSTQLYLQRIVLNETDSLEEGIGYPSG  224

Query  237  DLVIYLFLVWVLIAITLIKGIHSSGKASYFLALFPYVILFILLGRALTLPGAWDGIVYFL  296
             L + L + W+ + + +I+G+ SSGKA+Y LALFPYV++FILL RALTLPGA+DG++YFL
Sbjct  225  SLALMLGISWLTVTLIIIRGVKSSGKAAYVLALFPYVVMFILLVRALTLPGAYDGVMYFL  284

Query  297  KPQWDQLLNADVWYAAITQMFFSLAICFGTLIMYASFNNFHKRVHKDVIIVTTIDSCTSI  356
             PQW++LL   VWY A+TQ+FFSLA+CFG +IMY+S+N F   V++D  IVTT+D+ TS+
Sbjct  285  TPQWEKLLEPQVWYNAVTQVFFSLAVCFGVIIMYSSYNRFGHNVYRDANIVTTLDTFTSL  344

Query  357  LAGCVIFGILGNLALETNTKDISKVVKGGAGLAFISYPEAIAKFKLLPQLFSVLFFFMLF  416
            L+G +IFGILGNLA E+ TKDI+ VVK G GLAFISYP+AIAKFK+ PQ+FS+LFF MLF
Sbjct  345  LSGVIIFGILGNLAHESGTKDIASVVKAGPGLAFISYPDAIAKFKMFPQVFSLLFFAMLF  404

Query  417  VLGIGSNIGMSSCVITVFKDRFKHLPQWVITIGFSICSFLCGLIYTTPGGQFLLNLIDFF  476
            +LG+GSN+GM SC++TV KD+F ++  W+I +  S+  FL GLIY TPGGQ ++ L+DF 
Sbjct  405  MLGVGSNVGMVSCIMTVLKDQFVNVKLWIIVVSLSVIGFLVGLIYITPGGQHIITLMDFH  464

Query  477  GCSFIALFLAIGEIVTISWIYGVKRFCKDIEFMCDLKTGIYWRICWAIFTPGLMFLVLVY  536
            G +F++L  AI E++ + WIYG KR C+D E+M ++KT  Y+RICW+I TP +M ++LVY
Sbjct  465  GVTFVSLVSAIFELIAVGWIYGTKRLCQDAEYMLNIKTSNYYRICWSIVTPLVMLVILVY  524

Query  537  TLVTYKPLVYKDVAYPDYIMNIAWLLWFIGVGQLPFWALYTVYQQPGGTLKEKFRQAIQP  596
            +L+T +PL Y    +P     + W +    +GQL +WA Y  ++QP G+LK +   +I+P
Sbjct  525  SLLTMRPLSYNGQEFPLVYRVVGWCVSGCIIGQLFYWAGYANFKQPKGSLKSRINNSIKP  584

Query  597  KSNWGPASPDKYEKYLLFMKHSQQIPDDSWTTRIY-----DNIFG  636
             S+WGP+ P K   Y +F+++  +    +   R       D IFG
Sbjct  585  HSDWGPSDPKKLMDYQMFLRNKDEENSKNVNRRCVCYTAGDRIFG  629


>Q86P29_DROME unnamed protein product
Length=629

 Score = 650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/585 (52%), Positives = 420/585 (72%), Gaps = 15/585 (3%)

Query  61   REKWSREIEFLFSCIALSVGLGNVWRFPFIALANGGGAFVIPYVIVLLLIGRPVYYMEVL  120
            R+ W   +EFL SCIALSVGLGNVWRFPF AL NGGGAF+IPY++VL ++G+P+YYME+L
Sbjct  51   RDNWGSSLEFLMSCIALSVGLGNVWRFPFTALENGGGAFLIPYLVVLFVVGKPIYYMEML  110

Query  121  IGQFASRGAVGVFDMAPIMKGIAYGQVYATALATTYYAAIMALTIKYLLASFAEILPWAT  180
            +GQF+SRG V VFD AP+M+G+ Y Q+ A  +  TYYA++MALT++Y   SFA  LPW+ 
Sbjct  111  LGQFSSRGIVQVFDFAPLMRGVGYAQLLALGVLATYYASVMALTLRYFFDSFASELPWSF  170

Query  181  CLPEWGDNCVSITSYNSSANDNATEGMLI----SSAELYFTKVALREKDNIEDGIGAPNR  236
            C  EWGD CVS      ++     +G L     SS +LY  ++ L E D++E GIG P+ 
Sbjct  171  CREEWGDGCVS------ASGGQPLQGQLSRNFSSSTQLYLQRIVLNETDSLEKGIGYPSG  224

Query  237  DLVIYLFLVWVLIAITLIKGIHSSGKASYFLALFPYVILFILLGRALTLPGAWDGIVYFL  296
             L + L + W+ + + +I+G+ SSGKA+Y LALFPYV++FILL RALTLPGA+DG++YFL
Sbjct  225  SLALMLGISWLTVTLIIIRGVKSSGKAAYVLALFPYVVMFILLVRALTLPGAYDGVMYFL  284

Query  297  KPQWDQLLNADVWYAAITQMFFSLAICFGTLIMYASFNNFHKRVHKDVIIVTTIDSCTSI  356
             PQW++LL   VWY A+TQ+FFSLA+CFG +IMY+S+N F   V++D  IVTT+D+ TS+
Sbjct  285  TPQWEKLLEPQVWYNAVTQVFFSLAVCFGVIIMYSSYNRFGHNVYRDANIVTTLDTFTSL  344

Query  357  LAGCVIFGILGNLALETNTKDISKVVKGGAGLAFISYPEAIAKFKLLPQLFSVLFFFMLF  416
            L+G +IFGILGNLA E+ TKDI+ VVK G GLAFISYP+AIAKFK+ PQ+FS+LFF MLF
Sbjct  345  LSGVIIFGILGNLAHESGTKDIASVVKAGPGLAFISYPDAIAKFKMFPQVFSLLFFAMLF  404

Query  417  VLGIGSNIGMSSCVITVFKDRFKHLPQWVITIGFSICSFLCGLIYTTPGGQFLLNLIDFF  476
            +LG+GSN+GM SC++TV KD+F ++  W+I +  S+  FL GLIY TPGGQ ++ L+DF 
Sbjct  405  MLGVGSNVGMVSCIMTVLKDQFVNVKLWIIVVSLSVIGFLVGLIYITPGGQHIITLMDFH  464

Query  477  GCSFIALFLAIGEIVTISWIYGVKRFCKDIEFMCDLKTGIYWRICWAIFTPGLMFLVLVY  536
            G +F++L  AI E++ + WIYG KR C+D E+M ++KT  Y+RICW+I TP +M ++LVY
Sbjct  465  GVTFVSLVSAIFELIAVGWIYGTKRLCQDAEYMLNIKTSNYYRICWSIVTPLVMLVILVY  524

Query  537  TLVTYKPLVYKDVAYPDYIMNIAWLLWFIGVGQLPFWALYTVYQQPGGTLKEKFRQAIQP  596
            +L+T +PL Y    +P     + W +    +GQL +WA Y  ++QP G+LK +   +I+P
Sbjct  525  SLLTMRPLSYNGQEFPLVYRVVGWCVSGCIIGQLFYWAGYANFKQPKGSLKSRINNSIKP  584

Query  597  KSNWGPASPDKYEKYLLFMKHSQQIPDDSWTTRIY-----DNIFG  636
             S+WGP+ P K   Y +F+++  +    +   R       D IFG
Sbjct  585  HSDWGPSDPKKLMDYQMFLRNKDEENSKNVNRRCVCYTAGDRIFG  629


>A1ZBC7_DROME unnamed protein product
Length=564

 Score = 646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/547 (57%), Positives = 402/547 (73%), Gaps = 12/547 (2%)

Query  62   EKWSREIEFLFSCIALSVGLGNVWRFPFIALANGGGAFVIPYVIVLLLIGRPVYYMEVLI  121
            E+W   +EFLFSCI+LSVGLGN+WRFP+IA  NGGG FVIPY+I LL+IGRPVYY+E+ +
Sbjct  19   EQWGNGLEFLFSCISLSVGLGNIWRFPYIAFQNGGGTFVIPYLIALLVIGRPVYYLEISL  78

Query  122  GQFASRGAVGVFDMAPIMKGIAYGQVYATALATTYYAAIMALTIKYLLASFAEILPWATC  181
            GQF  RG V  FDMAP++KG+A GQV ATA + TYY++IMALT+++ LASF   LPW+ C
Sbjct  79   GQFTGRGVVKAFDMAPLLKGVALGQVLATAASITYYSSIMALTLRFWLASFGSELPWSRC  138

Query  182  LPEWGDNCVSITSYNSSANDNATEGMLISSAELYFTKVALREKDNIEDGIGAPNRDLVIY  241
               WG +C    + NSS          +S A+LYF +  L E  NI++G+  PN  LV  
Sbjct  139  WESWGTDCHDGNAQNSSGK--------MSPAQLYFEREILHEVPNIDNGLSLPNWQLVAC  190

Query  242  LFLVWVLIAITLIKGIHSSGKASYFLALFPYVILFILLGRALTLPGAWDGIVYFLKPQWD  301
            L + W++I   LI+GI SSGKA+YFL +FPYV+L ILL RA+TLPGA DGI+YF KPQW 
Sbjct  191  LAIAWLVIGGVLIRGIKSSGKAAYFLGVFPYVVLLILLLRAVTLPGAIDGIIYFFKPQWR  250

Query  302  QLLNADVWYAAITQMFFSLAICFGTLIMYASFNNFHKRVHKDVIIVTTIDSCTSILAGCV  361
            +LLN  VWYAA+TQ+FFSLAICFGTLI YAS+NNF++ V+ D++I+TT+DSC+SI+AGC+
Sbjct  251  ELLNPLVWYAAVTQVFFSLAICFGTLITYASYNNFNRNVYNDIVIITTMDSCSSIIAGCI  310

Query  362  IFGILGNLALETNTKDISKVVKGGAGLAFISYPEAIAKFKLLPQLFSVLFFFMLFVLGIG  421
             FGILGNLA ET   DI  VVKGGAGLAFISYPEAIAKF+ +PQ+F+VLFF MLFVLGIG
Sbjct  311  TFGILGNLARETGNPDIGSVVKGGAGLAFISYPEAIAKFEYVPQMFAVLFFLMLFVLGIG  370

Query  422  SNIGMSSCVITVFKDRF--KHLPQWVITIGFSICSFLCGLIYTTPGGQFLLNLIDFFGCS  479
            S +GM SC++ V +D+F  +  P W +  G ++  F   ++Y TPGGQF+LNL+DF+G S
Sbjct  371  STVGMGSCILRVIRDQFGLRSPPIWKLASGLTVLGFSVSIVYMTPGGQFILNLVDFYGVS  430

Query  480  FIALFLAIGEIVTISWIYGVKRFCKDIEFMCDLKTGIYWRICWAIFTPGLMFLVLVYTLV  539
            F AL LAIGE+V ++WIYGV RFC+DI+FM  ++TG YWR+CW   TPGLM  VL+Y L+
Sbjct  431  FTALILAIGELVAVAWIYGVNRFCEDIKFMMGIETGWYWRLCWRFITPGLMTAVLIYMLL  490

Query  540  TYKPLVYKDVAYPDYIMNIAWLLWFIGVGQLPFWALYTVYQQPG--GTLKEKFRQAIQPK  597
                L YK V YP         L  +G+ QLP WA+Y +Y++ G  G+  ++ R A +P 
Sbjct  491  DMSALEYKGVGYPTLAHVFGCFLATLGLIQLPGWAIYAIYKKRGHNGSFWQRIRAACKPS  550

Query  598  SNWGPAS  604
              WGPA+
Sbjct  551  DTWGPAN  557



Lambda      K        H
   0.324    0.134    0.407 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7057096832


Query= XP_014085190.1 PREDICTED: uncharacterized protein LOC106614152
[Bactrocera oleae]

Length=226
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q385B1_TRYB2  unnamed protein product                                 30.4    1.4  
Q9W263_DROME  unnamed protein product                                 29.3    3.5  
A8DYM1_DROME  unnamed protein product                                 28.9    3.9  


>Q385B1_TRYB2 unnamed protein product
Length=713

 Score = 30.4 bits (67),  Expect = 1.4, Method: Composition-based stats.
 Identities = 15/67 (22%), Positives = 37/67 (55%), Gaps = 3/67 (4%)

Query  4    LLQRSTRTLLYSFVHQNVQLSACVRTKKTGATSAPSSTTPASGAGITQQQS---TNPLSK  60
            +L+   + +L SFV+ N++L     ++ +   + P + +P+S AG+   ++   T  L +
Sbjct  433  VLRSRLQAMLSSFVYSNLKLGTTRSSELSVGGATPVTQSPSSAAGLRADETPRATLRLKR  492

Query  61   ITLVQPN  67
            + + +P+
Sbjct  493  LRVTEPS  499


>Q9W263_DROME unnamed protein product
Length=1023

 Score = 29.3 bits (64),  Expect = 3.5, Method: Composition-based stats.
 Identities = 29/126 (23%), Positives = 46/126 (37%), Gaps = 12/126 (10%)

Query  33   GATSAPSSTTPASGAGITQQQSTNPLSKITLVQPNQTMTVTTFKEAQKLAKRRELHLVKQ  92
            G  +AP     ASG G   ++    L        NQ +T+   ++  +  K   L  VKQ
Sbjct  206  GVDTAPEMEAVASGEGSAAKERIERLESELRSVKNQLLTMRLERKKLRTDKSDLLGQVKQ  265

Query  93   ------------QDFDTKTQRAVYKLVTAAEMLSEDLDESAVDKKSSTEKKSEKSLTLGS  140
                        +DF    Q  V +  T    +S D D            ++E+SL L  
Sbjct  266  LCASLQEKEQELRDFIRNYQERVRETETTNAKISGDRDRERFQLLKQARDEAERSLALAQ  325

Query  141  RITEHD  146
            +++  D
Sbjct  326  QLSARD  331


>A8DYM1_DROME unnamed protein product
Length=852

 Score = 28.9 bits (63),  Expect = 3.9, Method: Composition-based stats.
 Identities = 29/126 (23%), Positives = 46/126 (37%), Gaps = 12/126 (10%)

Query  33   GATSAPSSTTPASGAGITQQQSTNPLSKITLVQPNQTMTVTTFKEAQKLAKRRELHLVKQ  92
            G  +AP     ASG G   ++    L        NQ +T+   ++  +  K   L  VKQ
Sbjct  206  GVDTAPEMEAVASGEGSAAKERIERLESELRSVKNQLLTMRLERKKLRTDKSDLLGQVKQ  265

Query  93   ------------QDFDTKTQRAVYKLVTAAEMLSEDLDESAVDKKSSTEKKSEKSLTLGS  140
                        +DF    Q  V +  T    +S D D            ++E+SL L  
Sbjct  266  LCASLQEKEQELRDFIRNYQERVRETETTNAKISGDRDRERFQLLKQARDEAERSLALAQ  325

Query  141  RITEHD  146
            +++  D
Sbjct  326  QLSARD  331



Lambda      K        H
   0.324    0.134    0.407 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7057096832


Query= XP_014085191.1 PREDICTED: uncharacterized protein LOC106614153
[Bactrocera oleae]

Length=278
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PF92_PLAF7  unnamed protein product                                   32.0    0.62 


>PF92_PLAF7 unnamed protein product
Length=796

 Score = 32.0 bits (71),  Expect = 0.62, Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 23/42 (55%), Gaps = 2/42 (5%)

Query  84   NRSPRFKLPPESQYPAPNAYD--YVKPETAVKISYPFNASDA  123
            N++  F  P +S Y   N +D  Y+K +T VKI Y F  +D 
Sbjct  607  NKTIGFVCPVKSSYDGLNCFDNVYIKNKTLVKIEYLFGENDI  648



Lambda      K        H
   0.324    0.134    0.407 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7057096832


Query= XP_014085192.1 PREDICTED: F-box only protein 39 [Bactrocera oleae]

Length=509
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7KYI0_DROME  unnamed protein product                                 31.2    0.56 
Q7JWD6_DROME  unnamed protein product                                 31.2    0.61 
FBXA_DICDI  unnamed protein product                                   31.2    2.5  


>Q7KYI0_DROME unnamed protein product
Length=98

 Score = 31.2 bits (69),  Expect = 0.56, Method: Composition-based stats.
 Identities = 12/36 (33%), Positives = 22/36 (61%), Gaps = 0/36 (0%)

Query  38  ELAENDSNYSQWHTLPDILLEEIFSYLTYRERYYAS  73
           + AEN++N   +  +P  +L+++  Y TY+ RY  S
Sbjct  37  QFAENEANEVHFREIPSHVLQKVCMYFTYKVRYTNS  72


>Q7JWD6_DROME unnamed protein product
Length=117

 Score = 31.2 bits (69),  Expect = 0.61, Method: Composition-based stats.
 Identities = 12/36 (33%), Positives = 22/36 (61%), Gaps = 0/36 (0%)

Query  38  ELAENDSNYSQWHTLPDILLEEIFSYLTYRERYYAS  73
           + AEN++N   +  +P  +L+++  Y TY+ RY  S
Sbjct  56  QFAENEANEVHFREIPSHVLQKVCMYFTYKVRYTNS  91


>FBXA_DICDI unnamed protein product
Length=1247

 Score = 31.2 bits (69),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 16/46 (35%), Positives = 27/46 (59%), Gaps = 0/46 (0%)

Query  47   SQWHTLPDILLEEIFSYLTYRERYYASLVCKQWYNAFYLPLVWRNF  92
            S +  LP+ +++ IFS L+       SLVCK++  A   P++W+N 
Sbjct  632  SGFDNLPEEVVQIIFSNLSAINIVNLSLVCKRFKMATDSPILWKNL  677



Lambda      K        H
   0.324    0.134    0.407 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7057096832


Query= XP_014085193.1 PREDICTED: protein windbeutel [Bactrocera oleae]

Length=265
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

WBL_DROME  unnamed protein product                                    324     2e-112
Q57WS0_TRYB2  unnamed protein product                                 53.5    5e-08 
PDI1_DICDI  unnamed protein product                                   46.2    1e-05 


>WBL_DROME unnamed protein product
Length=257

 Score = 324 bits (831),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 161/255 (63%), Positives = 201/255 (79%), Gaps = 4/255 (2%)

Query  12   QLLASIVLVAY--TPTAVASSCAGCVDLDELNFDQTIERFPYALVKFDIAFPYGDKHEAF  69
             +L +++LVA    PT  A +C GCVDLDEL+F++T+ERFPY++VKFDIA+PYG+KHEAF
Sbjct  3    HILVTLLLVAIHSIPTTWAVTCTGCVDLDELSFEKTVERFPYSVVKFDIAYPYGEKHEAF  62

Query  70   AAFSKIAHKVTKELLVATVGIKDYGENENKELGLRFKVDDKNFPGILLFKHGKVDEFERF  129
             AFSK AHK TK+LL+ATVG+KDYGE ENK LG R+KVDDKNFP I LFK G  DE+ + 
Sbjct  63   TAFSKSAHKATKDLLIATVGVKDYGELENKALGDRYKVDDKNFPSIFLFK-GNADEYVQL  121

Query  130  PAHLDVTLDNLKQFVTQHTDLYIGRDGCLKDFEELVKKYANKVDAEQVALIAKAEQMLQS  189
            P+H+DVTLDNLK FV+ +T LYIGRDGC+K+F E++K YAN  DAEQ+ LI K +   + 
Sbjct  122  PSHVDVTLDNLKAFVSANTPLYIGRDGCIKEFNEVLKNYANIPDAEQLKLIEKLQAKQEQ  181

Query  190  LEGDETKTASAKAYLIYMRKINEKGYDYVEDETKRLQRLKAGKVTDAKKLELQQKLNILE  249
            L  D  +  +A+AYLIYMRKI+E GYD++E+ETKRL RLKAGKVT+AKK EL +KLNILE
Sbjct  182  L-TDPEQQQNARAYLIYMRKIHEVGYDFLEEETKRLLRLKAGKVTEAKKEELLRKLNILE  240

Query  250  AFRVTKLTKVKSSDE  264
             FRV K+TK     E
Sbjct  241  VFRVHKVTKTAPEKE  255


>Q57WS0_TRYB2 unnamed protein product
Length=377

 Score = 53.5 bits (127),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 60/232 (26%), Positives = 110/232 (47%), Gaps = 32/232 (14%)

Query  37   LDELNFDQ-TIERFPYALVKFDIAFPYGDK--HEAFAAFSKIAHKVTKELLVATVGIKDY  93
            LD+ NFD+  ++    A V F   +    K  H +F + +K+ ++  K+L++A V   D 
Sbjct  160  LDQSNFDKVALDEGKDAFVLFYAPWCGHCKRLHPSFESLAKV-YQNEKDLIIANV---DA  215

Query  94   GENENKELGLRFKVDDKNFPGILLFKHGKVDEFERFPAHLD--VTLDNLKQFVTQHT---  148
             +  N E+  R+KV+   +P ++ F  G        P + +   TLD++ +FV + T   
Sbjct  216  DDKSNSEVTKRYKVE--GYPTLVFFPKGNKGN----PVNYEEGRTLDDMIKFVNERTGKK  269

Query  149  -------DLYIGRDGCLKDF-EELVKKYANKVDAEQVALIAKAEQMLQSLEGDETKTASA  200
                   D  +G D  + +  +E+ +   NK + E+  L+A+ +Q +      E     A
Sbjct  270  RTSSGDFDKTVGVDETVTNLMKEMAQSSKNKEERER--LLAQIQQAVSPKALGE----GA  323

Query  201  KAYLIYMRKINEKGYDYVEDETKRLQRLKAGKVTDAKKLELQQKLNILEAFR  252
              Y+     + E G++Y+  E +R+ RL  G +T  K+  L  + NIL A +
Sbjct  324  MHYIRIATNVLENGHEYISKEHERVGRLLKGSLTGPKRDSLTIRFNILSAIK  375


 Score = 36.2 bits (82),  Expect = 0.024, Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 53/117 (45%), Gaps = 14/117 (12%)

Query  12   QLLASIVLVAYTPTAVAS-----SCAGCVDLDELNFDQTIERFPYALVKFDIAFPYGDKH  66
             LL +I + AY  +A  +     +  G VDL   NFD ++ +   ALV+F   +    K+
Sbjct  10   SLLKAICIFAYFASAAHANEPDAALEGVVDLTSNNFDSSVGKDVAALVEFYAPWCGHCKN  69

Query  67   --EAFAAFSKIAHKVTKELLVATVGIKDYGENENKELGLRFKVDDKNFPGILLFKHG  121
                FA   + A     ++L+A V          K+L  RF+V+   +P IL F  G
Sbjct  70   LVPEFAKLGRAAAGAKDKVLIAKVDA-----TAQKDLATRFEVN--GYPTILFFPAG  119


>PDI1_DICDI unnamed protein product
Length=363

 Score = 46.2 bits (108),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 45/74 (61%), Gaps = 2/74 (3%)

Query  179  LIAKAEQMLQSLEGDETKTASAKAYLIYMRKINEKGYDYVEDETKRLQRLKAGKVTDAKK  238
            L+ KA+ ++ SL  +E +T  +  Y+  M+ I EK  D+V  E  R+ +L +G ++  K 
Sbjct  290  LVKKAQTVVDSLP-EELRTEGS-YYVKVMKTIAEKSIDFVTTEIARITKLVSGSMSGKKA  347

Query  239  LELQQKLNILEAFR  252
             E  +KLNILE+F+
Sbjct  348  DEFAKKLNILESFK  361



Lambda      K        H
   0.324    0.134    0.407 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7057096832


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jan 6, 2022  5:17 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_014085194.1 PREDICTED: vacuolar protein-sorting-associated
protein 25 [Bactrocera oleae]

Length=175
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

VPS25_DROME  unnamed protein product                                  271     3e-94
VPS25_DICDI  unnamed protein product                                  110     6e-31
Q38BD1_TRYB2  unnamed protein product                                 43.1    3e-05


>VPS25_DROME unnamed protein product
Length=174

 Score = 271 bits (693),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 148/174 (85%), Gaps = 0/174 (0%)

Query  2    MTEFEWPWEYTFPPFFTLQPHEETRNQQIKVWSDLFLRYLKHLNKFQVNINENTFPLFHN  61
            M EF+WPWEYTFPPFFTLQPHEETR QQ+KVW+DLFL+YL+H N+F ++I +   PLFHN
Sbjct  1    MAEFQWPWEYTFPPFFTLQPHEETRQQQLKVWTDLFLKYLRHTNRFTLSIGDQNSPLFHN  60

Query  62   DGIKRRLTPETITVILEQLQRTGHAAPLDKRRIEWQVYSYTLEEYANMVYDWIQQTGQLN  121
            + +KRRL+PE +  IL +L+R+GHA PLDKRR EWQVY +TLEEY NMVYDW+Q+TGQ N
Sbjct  61   EALKRRLSPELVLAILGELERSGHANPLDKRRQEWQVYWFTLEEYGNMVYDWVQETGQTN  120

Query  122  TICTLYEIASGENSEGTEFHGVDEAVLLNAFRTLENKGKCEVVQLDDSFGIKFF  175
            TICTLYEIASGEN+   +F+GVDEAVLL+A R LE KG+CE++++D S G+KFF
Sbjct  121  TICTLYEIASGENTSHLDFYGVDEAVLLSALRLLEEKGRCELIEMDGSHGVKFF  174


>VPS25_DICDI unnamed protein product
Length=194

 Score = 110 bits (276),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 58/191 (30%), Positives = 107/191 (56%), Gaps = 24/191 (13%)

Query  5    FEWPWEYTFPPFFTLQPHEETRNQQIKVWSDLFLRYLKHLNKFQVNINENTFP---LFHN  61
            F++P  Y   PFFT+QP   TR +Q ++W DL L+Y ++   ++++INE+      LF+N
Sbjct  6    FQFPPYYHKEPFFTIQPILNTRKKQFQMWQDLILQYCRYYKIYELDINESIKSNSVLFNN  65

Query  62   DGIKRRLTPETITVILEQLQRTGHA-----------------APLDKRRIEWQVYSYTLE  104
            + I R+L+ E +  I++ +   G A                    ++  I W+      +
Sbjct  66   EKINRKLSREALKSIIDDIIENGFAEWVDKEKEKEKEKDKDNNNNNRVLIMWR----KPD  121

Query  105  EYANMVYDWIQQTGQLNTICTLYEIASGENSEGTEFHGVDEAVLLNAFRTLENKGKCEVV  164
            E+A+++Y W+   G LNT+ T++EI +G++S+  EFH ++  +L+ + + LE + KC+  
Sbjct  122  EWASLIYKWVADCGLLNTVLTVWEIQNGDDSKKQEFHQLNTTILMKSLKVLEKQSKCQTF  181

Query  165  QLDDSFGIKFF  175
              D++ G+KFF
Sbjct  182  SQDENVGVKFF  192


>Q38BD1_TRYB2 unnamed protein product
Length=234

 Score = 43.1 bits (100),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 36/80 (45%), Gaps = 13/80 (16%)

Query  11  YTFPPFFTLQPHEETRNQQIKVWSDLFLRYLKHLNKFQVNINENTFP----------LFH  60
           +  PPFFTLQP      +Q+ +W +L    + H      +   +T P          LF 
Sbjct  11  FKLPPFFTLQPSPSALERQMALWGNLV---MDHAAFHAQHRKRDTCPLLRLYSCNSGLFR  67

Query  61  NDGIKRRLTPETITVILEQL  80
           N+ I RRL PE +  ++  L
Sbjct  68  NETINRRLRPEDVKKVISSL  87



Lambda      K        H
   0.321    0.137    0.430 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1183107040


Query= XP_014085195.1 PREDICTED: uncharacterized protein LOC106614157
[Bactrocera oleae]

Length=130
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A1Z7I6_DROME  unnamed protein product                                 53.1    1e-09
Q25266_LEIDO  unnamed protein product                                 31.2    0.17 
Q9U1Q7_CAEEL  unnamed protein product                                 29.6    0.71 


>A1Z7I6_DROME unnamed protein product
Length=149

 Score = 53.1 bits (126),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 44/82 (54%), Gaps = 3/82 (4%)

Query  25   SRNAFMHFLSEYRRVCNR---RSPAWLTATEAGEVWSRMPLNDKYCYIEAARNAGYVYTA  81
             RN F  FL+ +R+  N      P+      AG+VW+ M L++K  +I AAR   Y Y +
Sbjct  38   GRNPFFQFLAYFRKCSNNCLGHLPSDRVTLIAGKVWNYMSLSEKEPFIAAARRFNYTYRS  97

Query  82   RDRRMNRVMRHLRKSLTDNEHR  103
            R R++N V+  LRKS    E R
Sbjct  98   RSRKVNWVLAQLRKSAAGEECR  119


>Q25266_LEIDO unnamed protein product
Length=341

 Score = 31.2 bits (69),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 5/48 (10%)

Query  56   VWSRMPLNDKYCYIEAARNAGYVYTARDRRMNRVMRHLRKSLTDNEHR  103
            V+ + P    Y  I  A +AG++YT  + R NR      K+ +D EH+
Sbjct  271  VFHQFPTATGYLGIMIALSAGFLYTHLNIRANR-----AKASSDTEHQ  313


>Q9U1Q7_CAEEL unnamed protein product
Length=1467

 Score = 29.6 bits (65),  Expect = 0.71, Method: Composition-based stats.
 Identities = 16/58 (28%), Positives = 28/58 (48%), Gaps = 3/58 (5%)

Query  11   KQTATSSTTAKASYSRNAFMHFLSEYRRVCNRRSPAWLTATEAGEVWSRMPLND-KYC  67
            +Q  T++      + R    + + +++RV N   P     +E GEV  R P++  KYC
Sbjct  199  RQKMTAAAADNNEFERTYLWNLIEKFKRVLNSLEPNEAQESEEGEV--RDPIDSIKYC  254



Lambda      K        H
   0.321    0.137    0.430 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1183107040


Query= XP_014085196.1 PREDICTED: peptidoglycan-recognition protein SC2
[Bactrocera oleae]

Length=185
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PGSC2_DROME  unnamed protein product                                  287     3e-100
SC1B_DROME  unnamed protein product                                   228     5e-77 
SC1A_DROME  unnamed protein product                                   228     5e-77 


>PGSC2_DROME unnamed protein product
Length=184

 Score = 287 bits (734),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 137/185 (74%), Positives = 157/185 (85%), Gaps = 1/185 (1%)

Query  1    MAFKTLLTLLAVLLCANAVFGVNVISKATWGGRAATGRSNLASNLSYVVIHHTAGTYCST  60
            MA K L+ LLAVL CA AV GV +ISK+ WGGR+AT +++LA+ LSY VIHHTAG YCST
Sbjct  1    MANKALI-LLAVLFCAQAVLGVTIISKSEWGGRSATSKTSLANYLSYAVIHHTAGNYCST  59

Query  61   KTACSQQMRNMQNYHMDSLGWADIGYNFLIGGDGQVYEGRGWNTLGAHATSWNSKSIGIS  120
            K AC  Q++N+Q YHMDSLGWADIGYNFLIGGDG VYEGRGWN +GAHAT+WNSKSIGIS
Sbjct  60   KAACITQLQNIQAYHMDSLGWADIGYNFLIGGDGNVYEGRGWNVMGAHATNWNSKSIGIS  119

Query  121  FMGNYNNNVPTTAQIAAAKALLADAVSRGQIKSNYILYGHRQVGSTECPGNNLYAEIKKW  180
            F+GNYN N  T+AQI AAK LL+DAVSRGQI S YILYGHRQVGSTECPG N++ EI+ W
Sbjct  120  FLGNYNTNTLTSAQITAAKGLLSDAVSRGQIVSGYILYGHRQVGSTECPGTNIWNEIRTW  179

Query  181  SNWRA  185
            SNW+A
Sbjct  180  SNWKA  184


>SC1B_DROME unnamed protein product
Length=185

 Score = 228 bits (581),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 134/176 (76%), Gaps = 1/176 (1%)

Query  9    LLAVLLCANAVF-GVNVISKATWGGRAATGRSNLASNLSYVVIHHTAGTYCSTKTACSQQ  67
            LLAVL+C+  +  GV V+SKA WGGR A     L + LSY +IHHTAG+YC T+  C+  
Sbjct  8    LLAVLVCSQYMAQGVYVVSKAEWGGRGAKWTVGLGNYLSYAIIHHTAGSYCETRAQCNAV  67

Query  68   MRNMQNYHMDSLGWADIGYNFLIGGDGQVYEGRGWNTLGAHATSWNSKSIGISFMGNYNN  127
            ++++QNYHMDSLGW DIGYNFLIGGDG VYEGRGWN +GAHA  WN  SIGISF+GNYN 
Sbjct  68   LQSVQNYHMDSLGWPDIGYNFLIGGDGNVYEGRGWNNMGAHAAEWNPYSIGISFLGNYNW  127

Query  128  NVPTTAQIAAAKALLADAVSRGQIKSNYILYGHRQVGSTECPGNNLYAEIKKWSNW  183
            +      I+AA+ LL DAV+RGQ+ S YILYGHRQV +TECPG +++ EI+ WS+W
Sbjct  128  DTLEPNMISAAQQLLNDAVNRGQLSSGYILYGHRQVSATECPGTHIWNEIRGWSHW  183


>SC1A_DROME unnamed protein product
Length=185

 Score = 228 bits (581),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 134/176 (76%), Gaps = 1/176 (1%)

Query  9    LLAVLLCANAVF-GVNVISKATWGGRAATGRSNLASNLSYVVIHHTAGTYCSTKTACSQQ  67
            LLAVL+C+  +  GV V+SKA WGGR A     L + LSY +IHHTAG+YC T+  C+  
Sbjct  8    LLAVLVCSQYMAQGVYVVSKAEWGGRGAKWTVGLGNYLSYAIIHHTAGSYCETRAQCNAV  67

Query  68   MRNMQNYHMDSLGWADIGYNFLIGGDGQVYEGRGWNTLGAHATSWNSKSIGISFMGNYNN  127
            ++++QNYHMDSLGW DIGYNFLIGGDG VYEGRGWN +GAHA  WN  SIGISF+GNYN 
Sbjct  68   LQSVQNYHMDSLGWPDIGYNFLIGGDGNVYEGRGWNNMGAHAAEWNPYSIGISFLGNYNW  127

Query  128  NVPTTAQIAAAKALLADAVSRGQIKSNYILYGHRQVGSTECPGNNLYAEIKKWSNW  183
            +      I+AA+ LL DAV+RGQ+ S YILYGHRQV +TECPG +++ EI+ WS+W
Sbjct  128  DTLEPNMISAAQQLLNDAVNRGQLSSGYILYGHRQVSATECPGTHIWNEIRGWSHW  183



Lambda      K        H
   0.321    0.137    0.430 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1183107040


Query= XP_014085197.1 PREDICTED: uncharacterized protein LOC106614160
[Bactrocera oleae]

Length=446


***** No hits found *****



Lambda      K        H
   0.321    0.137    0.430 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1183107040


Query= XP_014085198.1 PREDICTED: uncharacterized protein LOC106614161
[Bactrocera oleae]

Length=585
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q384Z7_TRYB2  unnamed protein product                                 31.6    2.2  
Q381N9_TRYB2  unnamed protein product                                 30.4    4.6  


>Q384Z7_TRYB2 unnamed protein product
Length=1057

 Score = 31.6 bits (70),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 19/58 (33%), Positives = 28/58 (48%), Gaps = 1/58 (2%)

Query  255  YPGSLVDHIWLRPPE-RAKKIDVRNVNIICTGAHTQQLLRGVLPNLTYYLDIFGVHTR  311
            Y    VD+IW   PE R+  +    +     G+H  +LLRG  P++ Y  D F +  R
Sbjct  631  YNNEYVDYIWDSAPELRSGSVIECVLKRSDDGSHWWELLRGRGPDMGYQPDTFDIVER  688


>Q381N9_TRYB2 unnamed protein product
Length=725

 Score = 30.4 bits (67),  Expect = 4.6, Method: Compositional matrix adjust.
 Identities = 29/98 (30%), Positives = 46/98 (47%), Gaps = 15/98 (15%)

Query  146  VLPCALRGHYDIFVQARQRGSIKIEAH------------AAHPQSNWPL-LNRTHHIRIR  192
            V+P AL+G YD+  QA Q GS K  A             +  P   + L L+ T  + ++
Sbjct  193  VIPYALQG-YDLLGQA-QTGSGKTLAFCVPVLHSIIGLVSKRPNVTYSLMLSPTKELCVQ  250

Query  193  TQNLVRNRQMIVKWDKSKFDFHAVHYCLVVNTQRRQLN  230
            T +++R     +  D + F  H +     V+ +RRQLN
Sbjct  251  THDVLRGICQHISSDIAAFSVHLITGGTKVSEERRQLN  288



Lambda      K        H
   0.321    0.137    0.430 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1183107040


Query= XP_014085199.1 PREDICTED: armadillo repeat-containing protein 6
homolog [Bactrocera oleae]

Length=470
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

AARA_DICDI  unnamed protein product                                   60.1    2e-09
Q584T5_TRYB2  unnamed protein product                                 40.0    0.005
O76521_DROME  unnamed protein product                                 33.1    0.47 


>AARA_DICDI unnamed protein product
Length=757

 Score = 60.1 bits (144),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 82/178 (46%), Gaps = 16/178 (9%)

Query  289  EDAGGIKFVFDIMTANQTSVRVNREAFKLLRALG----GNDTVKAHIVQQGAAPIIKQVL  344
            +++G IK +  +M  N  +  + RE   +L+ L       D  ++ I + G   +I Q +
Sbjct  404  DESGQIKKIIGVMNENLHNPMILRETCYILKRLSYRQRKEDEHESLIARYGGISLILQAM  463

Query  345  ETHLSNENVVTAALACIATLT--------LRVKDNSVAFFATGIAETIVEAVRMHPKNKI  396
            + H  +  V   A   +  LT        L   DN ++    G  + I++A++ H  N  
Sbjct  464  KNHPYDAGVQEDACGALGNLTCDSPNNMGLYSNDNYLSVVEQGGIQLILQAMKNHMMNPG  523

Query  397  VQRNGAWAIRNMVSRSRDQCESWISYGIEDLLNTALSSHPS---IQQDVKAALRDLGC  451
            VQ N ++ +RN+      +    I  GI+ +  TA+ +HP+   IQ     ALR+LGC
Sbjct  524  VQYNTSFVLRNLARNDVSESRVAIEGGIQSIA-TAMKNHPNHIGIQTQGCGALRNLGC  580


 Score = 51.2 bits (121),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 75/181 (41%), Gaps = 8/181 (4%)

Query  263  NDPNILSDLLLTIGALAVRQEFCTTIEDA-----GGIKFVFDIMTANQTSVRVNREAFKL  317
            N PN +   + T G  A+R   C           GGI  +   M +  +   +       
Sbjct  560  NHPNHIG--IQTQGCGALRNLGCNDSNKVLSAKEGGIGLILRAMRSFSSHPDLQLNGCGA  617

Query  318  LRALGGNDTVKAHIVQQGAAPIIKQVLETHLSNENVVTAALACIATLTLRVKDNSVAFFA  377
            LR L  N+  K  I +Q    ++   +  H  + +V     A +  L  + + N      
Sbjct  618  LRNLARNEDNKNMISRQNGIQLVLGAMSNHPDDPDVQDEGCAALINLAYQDEANEETIAR  677

Query  378  TGIAETIVEAVRMHPKNKIVQRNGAWAIRNMVSRSRDQCESWISYGIEDLLNTALSSHPS  437
             G    I++A+R HP +  VQ  G  A++N+    +++     S GIE L+N A+ +HP+
Sbjct  678  EGGINLILKAMRNHPFHSGVQMQGRGALKNLSCNPKNKLTIARSGGIE-LMNIAMQNHPN  736

Query  438  I  438
             
Sbjct  737  F  737


 Score = 46.2 bits (108),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 49/178 (28%), Positives = 84/178 (47%), Gaps = 11/178 (6%)

Query  287  TIEDAGGIKFVFDIMTANQTSVRVNREAFKLLRALGGNDTVKAHIVQQGAAPIIKQVLET  346
            ++ + GGI+ +   M  +  +  V      +LR L  ND  ++ +  +G    I   ++ 
Sbjct  501  SVVEQGGIQLILQAMKNHMMNPGVQYNTSFVLRNLARNDVSESRVAIEGGIQSIATAMKN  560

Query  347  HLSNENVVTAALACIATLTLRVKD-NSVAFFATGIAETIVEAVRMHPKNKIVQRNGAWAI  405
            H ++  + T    C A   L   D N V     G    I+ A+R    +  +Q NG  A+
Sbjct  561  HPNHIGIQTQ--GCGALRNLGCNDSNKVLSAKEGGIGLILRAMRSFSSHPDLQLNGCGAL  618

Query  406  RNMVSRSRDQCESWISY--GIEDLLNTALSSH---PSIQQDVKAALRDLGCRVELREE  458
            RN+ +R+ D  ++ IS   GI+ +L  A+S+H   P +Q +  AAL +L  + E  EE
Sbjct  619  RNL-ARNEDN-KNMISRQNGIQLVL-GAMSNHPDDPDVQDEGCAALINLAYQDEANEE  673


>Q584T5_TRYB2 unnamed protein product
Length=1128

 Score = 40.0 bits (92),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 33/161 (20%), Positives = 67/161 (42%), Gaps = 4/161 (2%)

Query  293  GIKFVFDIMTANQTSVRVNREAFKLLRALGGNDTVKAHIVQQGAAPIIKQVLETHLSNEN  352
            G+  + + M   + S R+       L  +  N  +KA +++ G   +I + L  H +N  
Sbjct  419  GVALILEAMGRGK-SARLQDNGCLALGTMCWNSDLKADVIRYGGVQMIMRALAAHYTNAG  477

Query  353  VVTAALACIATLTLRVKDNSVAFFATGIAETIVEAVRMHPKNKIVQRNGAWAIRNMVSRS  412
            +V  A   +A +    +       A+G+   I++ +  HP    VQ +G  A+  +   +
Sbjct  478  LVKNACRALAQVAFNCEAYRDDMHASGVIPLIMKGMAEHPNYDRVQMHGCVALSYLSWNN  537

Query  413  RDQCESWISYGIEDLLNTALSSH---PSIQQDVKAALRDLG  450
                   IS     ++  A+ +H     +Q+    AL ++G
Sbjct  538  EQNSAQIISNNGYAVIINAMRNHAHNAEVQEHASRALANIG  578


 Score = 30.0 bits (66),  Expect = 5.5, Method: Compositional matrix adjust.
 Identities = 33/150 (22%), Positives = 61/150 (41%), Gaps = 2/150 (1%)

Query  288  IEDAGGIKFVFDIMTANQTSVRVNREAFKLLRALGGNDTVKAHIVQQGAAPIIKQVLETH  347
            I D GG+  +   M  N   +R+      +L  L  N  +K  +    A P I + +  H
Sbjct  715  IYDLGGVACIIRAME-NFERLRMLELGCSVLGTLAWNSEIKESVAVV-AIPEILKAMRVH  772

Query  348  LSNENVVTAALACIATLTLRVKDNSVAFFATGIAETIVEAVRMHPKNKIVQRNGAWAIRN  407
              +  +  +    I+      + N      +G    IV A+R H     +  +G  A+  
Sbjct  773  HDSPLLQKSTCRAISQFAFNSESNRKLLAESGAIPLIVLAMRTHVTTDKLLVHGIKALTY  832

Query  408  MVSRSRDQCESWISYGIEDLLNTALSSHPS  437
            +   +    E+ IS GIE++L   + ++P+
Sbjct  833  LCWENSQVAEAIISEGIEEVLQHVIDTYPA  862


>O76521_DROME unnamed protein product
Length=543

 Score = 33.1 bits (74),  Expect = 0.47, Method: Compositional matrix adjust.
 Identities = 52/273 (19%), Positives = 107/273 (39%), Gaps = 57/273 (21%)

Query  153  IFDAEALAVILKLLSIEHENIIIFTLQWLQKASIMHEINRQNIVNAGVVKKLKPFVSKQS  212
            + +A A+ + + LLS  H+++    +  L   +    + R +++ +G+++ L   +S   
Sbjct  176  VIEAGAVPIFIDLLSSPHDDVQEQAVWALGNIAGDSPMCRDHLLGSGILEPLLHVLSNSD  235

Query  213  SLKLIREVLAVMRYLVLDDDIRVEFGCAHEHARRIASEYIVDLTKLLGEYNDPNILSDLL  272
             + +IR  +  +  L        +F        +I S  +  L +LL +Y D ++LSD  
Sbjct  236  RITMIRNAVWTLSNLCRGKSPPADFA-------KI-SHGLPILARLL-KYTDADVLSDTC  286

Query  273  LTIGALAVRQEFCTTIEDAGGIKFVFDIMTANQTSVRVNREAFKLLRALGGNDTVKAHIV  332
              IG L+                                          G ND ++A I 
Sbjct  287  WAIGYLSD-----------------------------------------GPNDKIQAVI-  304

Query  333  QQGAAPIIKQVLETHL-SNENVVTAALACIATLTLRVKDNSVAFFATGIAETIVEAVRMH  391
                A + ++++E  L   +NV TAAL  +  +     D+       G       +  +H
Sbjct  305  ---DAGVCRRLVELLLHPQQNVSTAALRAVGNIV--TGDDQQTQVILGYNALTCISHLLH  359

Query  392  PKNKIVQRNGAWAIRNMVSRSRDQCESWISYGI  424
               + +++   W I N+ + +R+Q ++ I+  I
Sbjct  360  STAETIKKESCWTISNIAAGNREQIQALINANI  392



Lambda      K        H
   0.321    0.137    0.430 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1183107040


Query= XP_014085200.1 PREDICTED: centrosomin isoform X1 [Bactrocera oleae]

Length=1347
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CNN_DROME  unnamed protein product                                    574     0.0  
Q54RX7_DICDI  unnamed protein product                                 34.7    0.74 
Q57UV7_TRYB2  unnamed protein product                                 32.7    3.2  


>CNN_DROME unnamed protein product
Length=1320

 Score = 574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/976 (41%), Positives = 555/976 (57%), Gaps = 196/976 (20%)

Query  379   LADKLCELDDTQQELVKLRKSYDTACRTLQQLLQR----EK-------------NQQQDG  421
             LADK+CEL + Q++L +  + ++ ACRT+Q+L+Q+    EK             N++ D 
Sbjct  471   LADKICELQEAQEKLKERERIHEQACRTIQKLMQKLSSQEKEIKKLNQENEQSANKENDC  530

Query  422   GNRALS---------DSEA----------LQNHLQKCDHENTIKNLEAEVKKKTAALQNL  462
                 +S         D+EA          ++  L+  + E  IK L+ EVKKKTA LQNL
Sbjct  531   AKTVISPSSSGRSMSDNEASSQEMSTNLRVRYELKINEQEEKIKQLQTEVKKKTANLQNL  590

Query  463   VNNELWQKNREIERLTKLLNANTTSPLSPTAARKNLESLQLQQSFTESDYAKALEHNKLL  522
             VN ELW+KNRE+ERLTKLL AN    L P  + ++     LQQSFTE++Y +ALE NKLL
Sbjct  591   VNKELWEKNREVERLTKLL-ANQQKTL-PQISEESAGEADLQQSFTEAEYMRALERNKLL  648

Query  523   QRKVDVLNQRLISGRSNEALIEELRSEARTARAEADNAETCRRAYAKVFGALSDRLYELA  582
             QRKVDVL QRL   + N A+I +LR E + AR E + A+  R     V   L++RL ELA
Sbjct  649   QRKVDVLFQRLADDQQNSAVIGQLRLELQQARTEVETADKWRLECVDVCSVLTNRLEELA  708

Query  583   GFLNSLMKHKEVLSFLSTDRRRAMRTAVDCSLDLSTSIRETL-----TTGDQSFEGLSNL  637
             GFLNSL+KHK+VL  L+ DRR AMR AVD SLDLS S+  TL     +  DQS   L NL
Sbjct  709   GFLNSLLKHKDVLGVLAADRRNAMRKAVDRSLDLSKSLNMTLNITATSLADQSLAQLCNL  768

Query  638   SRLLLDDDEHEVVGLTNKTFNSHENMPARHSF----DVLRSENKALRKILDSRRSCGGTA  693
             S +L  + +      ++KTFNSHE + A  S     + L++ENKAL+K L+ RRS  G  
Sbjct  769   SEILYTEGDA-----SHKTFNSHEELHAATSMAPTVENLKAENKALKKELEKRRSSEGQR  823

Query  694   DYTKDVKDRRSLP-PF-LLDNLSESEAWSEPDRQVSMARIGLEELGAAAANVSAKDAISK  751
                   K+RRSLP P    DN SESEAWSEPDR+VS+ARIGL+E           ++++ 
Sbjct  824   ------KERRSLPLPSQQFDNQSESEAWSEPDRKVSLARIGLDE---------TSNSLAA  868

Query  752   QTPATADTDSESESDALQQSRTTKLRNQERIMQLEKLIAQRDERILMVQFQLVEADNNLK  811
                A ++++SE  + A +Q R    RN ERI QLE+ IAQ+DER+L VQ Q+VE DN  K
Sbjct  869   PEQAISESESEGRTCATRQDRN---RNSERIAQLEEQIAQKDERMLNVQCQMVELDNRYK  925

Query  812   KESLRAITLTQEVEQLRQRNEELITDLIAIGSEQSNNSTAANNSSLIQRQIDEKTRAVEQ  871
             +E LR + +TQ++EQLR  NE L  DL AIGS +            +QRQ++ K + ++Q
Sbjct  926   QEQLRCLDITQQLEQLRAINEALTADLHAIGSHEEERMVE------LQRQLELKNQQIDQ  979

Query  872   LQGERDRIAVEARLAEMQVGALKADIEDIKQKYEIQLK-LASEKERKRLDTLKHELEELM  930
             L+     +  ++++ EM++ AL+  +++I+Q +   ++ L S+ ++ +LD +        
Sbjct  980   LKLAHSTLTADSQITEMELQALQQQMQEIEQLHADSVETLQSQLQKLKLDAV--------  1031

Query  931   QQRLKEQERIHKDMLTREWTTRTTYEECKAQLTELQTQYIESQRTIDYLTDNEQELKQTL  990
              Q+L+E ER+H++ L R+W   TTY+E   QL EL       QR++DY  +NE+ELKQTL
Sbjct  1032  -QQLEEHERLHREALERDWVALTTYQEQAQQLLEL-------QRSLDYHQENEKELKQTL  1083

Query  991   ITSEMEVRSLKKQLDESVLQASKFITERTKLCNEKLQLEKRLMDLQQQLSAAEIQHTTTT  1050
             + +E+  R+LKKQLDES LQASK + ERTK  N+KLQLEKR  +L+ QL A + +H    
Sbjct  1084  VENELATRALKKQLDESTLQASKAVMERTKAYNDKLQLEKRSEELRLQLEALKEEHQKLL  1143

Query  1051  QRVTELEALQQTLSEQLAQAQAALAAKRLNASDASQSGYASDEV---------QKSSTK-  1100
             Q                         KR N+SD SQSGY S+EV         Q ++ K 
Sbjct  1144  Q-------------------------KRSNSSDVSQSGYTSEEVAVPMGPPSGQATTCKQ  1178

Query  1101  --------RESNSSPDLGIHSDTGRVSSVELSNLQHSLLKTVPMPSAGEKVTKEDIKYSK  1152
                     R + SSPDLGI SD GR+SSVE+SN Q ++LKTV M + G            
Sbjct  1179  AAAAVLGQRVNTSSPDLGIESDAGRISSVEVSNAQRAMLKTVEMKTEG------------  1226

Query  1153  QDKSNMNAFASKRPQHSSSSDLGIESDTGRISSMDIKNESPTRTETDDSNTENKMSVANV  1212
                                                  + SP     + ++ ++K +VA  
Sbjct  1227  -------------------------------------SASPKAKSEESTSPDSKSNVAT-  1248

Query  1213  NSATTANAGTHPIHDCIKVEQENAELRRKLVQTKRAFEETYKKLHVANQRKETFQKEIKD  1272
                     G   +HDC KV+ ENAELRRKL++TKRAFE+TY+KL +AN+ K   +K+IK+
Sbjct  1249  --------GAATVHDCAKVDLENAELRRKLIRTKRAFEDTYEKLRMANKAKAQVEKDIKN  1300

Query  1273  QILKTKNVLKYARLHM  1288
             QILKT NVL+  R +M
Sbjct  1301  QILKTHNVLRNVRSNM  1316


 Score = 156 bits (394),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 104/296 (35%), Positives = 176/296 (59%), Gaps = 27/296 (9%)

Query  85   SYGVGFPCVSLQGHGTTSPPVQGRSVREFEEQMASLRKENFNLKLRLYFLEESVPGYHQA  144
            S+ V  P     G G +  P QGRSVRE EEQM++LRKENFNLKLR+YFLEE  PG   A
Sbjct  21   SFDVPRP----PGGGNSPLPSQGRSVRELEEQMSALRKENFNLKLRIYFLEEGQPG---A  73

Query  145  NAEGH-ESLMKQLIETKVEIEILRKELEQKQELLKEAAQAMNHMEEIQKETEMKGQAFIE  203
             A+   ESL KQLI+ K+EI  LRK ++ K ELLK+AA+A++H EE+Q++ ++  QA I+
Sbjct  74   RADSSTESLSKQLIDAKIEIATLRKTVDVKMELLKDAARAISHHEELQRKADIDSQAIID  133

Query  204  ELKQKIQFLEMERDLDKTQQSGFMNDLLGHSEISENVNTLQKIRELEGMVTQSESKIMSM  263
            EL+++I   +M        +SG         +  EN+   +K+  LE  V + E +++++
Sbjct  134  ELQEQIHAYQM-------AESG--------GQPVENIAKTRKMLRLESEVQRLEEELVNI  178

Query  264  QTQN----NNFEEIIAKRDETIKEYEEKVKELAFQNAELLEMMENKEKDMANIELNLKSL  319
            + +N    N  E ++A+R E++   E K++ELA +N+EL+E +E +     +    + SL
Sbjct  179  EARNVAARNELEFMLAERLESLTACEGKIQELAIKNSELVERLEKETASAESSNEAIDSL  238

Query  320  RLCNADLKEDNSSLIEALKSTQDNFHKEFSNMKVCEKRMREQQDALSQMQRELKEK  375
            ++     +++N  L+ ++++ + +  ++  +MK     M  Q+ ++  ++  +K K
Sbjct  239  KVELEACRKENQDLVTSIRTLKHDMKRQVRSMKEAANTMDVQRQSILLLEATIKRK  294


>Q54RX7_DICDI unnamed protein product
Length=1381

 Score = 34.7 bits (78),  Expect = 0.74, Method: Compositional matrix adjust.
 Identities = 17/71 (24%), Positives = 46/71 (65%), Gaps = 5/71 (7%)

Query  107  GRSVREFEEQMASLRKENFNLKLRLYFLEESVPGYHQANAEGHESLMKQLIETKVEIEIL  166
            G +++E  + + + +KENF+LK+R+++++ S+     +     +++ +Q I+ KV+++  
Sbjct  161  GETLKEMIKTIENYKKENFDLKMRIFYMDSSL-----SMTSEEKNMFQQNIDLKVQLDEK  215

Query  167  RKELEQKQELL  177
             K+LE++  ++
Sbjct  216  TKQLEERDNVI  226


>Q57UV7_TRYB2 unnamed protein product
Length=1456

 Score = 32.7 bits (73),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 62/289 (21%), Positives = 134/289 (46%), Gaps = 46/289 (16%)

Query  192  KETEMKGQAFIEELKQKIQFLEMERDLDKTQQSGFMNDLLG-HSEISENVNTL-QKIREL  249
            KE   K    ++E++  ++ L       +T+  G++  L   +S +S  ++TL Q+++E 
Sbjct  662  KEDLRKTDGLVDEMQMALEELGDASKATETELYGYVEQLRSENSRLSTAIDTLRQQLKES  721

Query  250  EGMV-------TQSESKIMSMQTQNNNFEEIIAKRDETIKEYEEKVKELAFQNAELLEMM  302
            E  V        + E  + +++ Q    E  +  RD  +KE+EE +  L  Q  E    +
Sbjct  722  EASVEDRDNRLKEHEESLDTLRQQLKESEASVEDRDNRLKEHEESLNTLRQQLKESEASV  781

Query  303  ENKEKDMANIELNLKSLRLCNADLKEDNSSL----------IEALKSTQDNFHKEFSNMK  352
            E+++  +   E +L +LR     LKE  +S+           E+L + +    +  ++++
Sbjct  782  EDRDNRLKEHETSLDTLR---QQLKESEASVEDRDNRLKEHEESLNTLRQQLKESEASVE  838

Query  353  VCEKRMREQQDALSQMQRELKEKKIALADKLCELDDTQQELVKLRKSYDTACRTLQQLLQ  412
              + R++E + +L  ++++LKE + ++ D+   L           K ++T+  TL+Q L+
Sbjct  839  DRDNRLKEHETSLDTLRQQLKESEASVEDRDNRL-----------KEHETSLNTLRQQLK  887

Query  413  REKNQQQDGGNRALSDSEALQNHLQKCDHENTIKNLEAEVKKKTAALQN  461
              +   +D  NR               +HE ++  L  ++K+  A+++N
Sbjct  888  ESEASVEDRDNRLK-------------EHEESLNTLRQQLKESEASVEN  923



Lambda      K        H
   0.321    0.137    0.430 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1183107040


Query= XP_014085201.1 PREDICTED: centrosomin isoform X2 [Bactrocera oleae]

Length=1334
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CNN_DROME  unnamed protein product                                    574     0.0  
Q54RX7_DICDI  unnamed protein product                                 34.7    0.72 
Q57UV7_TRYB2  unnamed protein product                                 32.7    2.9  


>CNN_DROME unnamed protein product
Length=1320

 Score = 574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/976 (41%), Positives = 553/976 (57%), Gaps = 196/976 (20%)

Query  379   LADKLCELDDTQQELVKLRKSYDTACRTLQQLLQR-----------------EKNQQQDG  421
             LADK+CEL + Q++L +  + ++ ACRT+Q+L+Q+                   N++ D 
Sbjct  471   LADKICELQEAQEKLKERERIHEQACRTIQKLMQKLSSQEKEIKKLNQENEQSANKENDC  530

Query  422   GNRALS---------DSEA----------LQNHLQKCDHENTIKNLEAEVKKKTAALQNL  462
                 +S         D+EA          ++  L+  + E  IK L+ EVKKKTA LQNL
Sbjct  531   AKTVISPSSSGRSMSDNEASSQEMSTNLRVRYELKINEQEEKIKQLQTEVKKKTANLQNL  590

Query  463   VNNELWQKNREIERLTKLLNANTTSPLSPTAARKNLESLQLQQSFTESDYAKALEHNKLL  522
             VN ELW+KNRE+ERLTKLL AN    L P  + ++     LQQSFTE++Y +ALE NKLL
Sbjct  591   VNKELWEKNREVERLTKLL-ANQQKTL-PQISEESAGEADLQQSFTEAEYMRALERNKLL  648

Query  523   QRKVDVLNQRLISGRSNEALIEELRSEARTARAEADNAETCRRAYAKVFGALSDRLYELA  582
             QRKVDVL QRL   + N A+I +LR E + AR E + A+  R     V   L++RL ELA
Sbjct  649   QRKVDVLFQRLADDQQNSAVIGQLRLELQQARTEVETADKWRLECVDVCSVLTNRLEELA  708

Query  583   GFLNSLMKHKEVLSFLSTDRRRAMRTAVDCSLDLSTSIRETL-----TTGDQSFEGLSNL  637
             GFLNSL+KHK+VL  L+ DRR AMR AVD SLDLS S+  TL     +  DQS   L NL
Sbjct  709   GFLNSLLKHKDVLGVLAADRRNAMRKAVDRSLDLSKSLNMTLNITATSLADQSLAQLCNL  768

Query  638   SRLLLDDDEHEVVGLTNKTFNSHENMPARHSF----DVLRSENKALRKILDSRRSCGGTA  693
             S +L  + +      ++KTFNSHE + A  S     + L++ENKAL+K L+ RRS  G  
Sbjct  769   SEILYTEGDA-----SHKTFNSHEELHAATSMAPTVENLKAENKALKKELEKRRSSEGQR  823

Query  694   DYTKDVKDRRSLP-PF-LLDNLSESEAWSEPDRQVSMARIGLEELGAAAANVSAKDAISK  751
                   K+RRSLP P    DN SESEAWSEPDR+VS+ARIGL+E           ++++ 
Sbjct  824   ------KERRSLPLPSQQFDNQSESEAWSEPDRKVSLARIGLDE---------TSNSLAA  868

Query  752   QTPATADTDSESESDALQQSRTTKLRNQERIMQLEKLIAQRDERILMVQFQLVEADNNLK  811
                A ++++SE  + A +Q R    RN ERI QLE+ IAQ+DER+L VQ Q+VE DN  K
Sbjct  869   PEQAISESESEGRTCATRQDRN---RNSERIAQLEEQIAQKDERMLNVQCQMVELDNRYK  925

Query  812   KESLRAITLTQEVEQLRQRNEELITDLIAIGSEQSNNSTAANNSSLIQRQIDEKTRAVEQ  871
             +E LR + +TQ++EQLR  NE L  DL AIGS +            +QRQ++ K + ++Q
Sbjct  926   QEQLRCLDITQQLEQLRAINEALTADLHAIGSHEEERMVE------LQRQLELKNQQIDQ  979

Query  872   LQGERDRIAVEARLAEMQVGALKADIEDIKQKYEIQLK-LASEKERKRLDTLKHELEELM  930
             L+     +  ++++ EM++ AL+  +++I+Q +   ++ L S+ ++ +LD +        
Sbjct  980   LKLAHSTLTADSQITEMELQALQQQMQEIEQLHADSVETLQSQLQKLKLDAV--------  1031

Query  931   QQRLKEQERIHKDMLTREWTTRTTYEECKAQLTELQTQYIESQRTIDYLTDNEQELKQTL  990
              Q+L+E ER+H++ L R+W   TTY+E   QL EL       QR++DY  +NE+ELKQTL
Sbjct  1032  -QQLEEHERLHREALERDWVALTTYQEQAQQLLEL-------QRSLDYHQENEKELKQTL  1083

Query  991   ITSEMEVRSLKKQLDESVLQASKFITERTKLCNEKLQLEKRLMDLQQQLSAAEIQHTTTT  1050
             + +E+  R+LKKQLDES LQASK + ERTK  N+KLQLEKR  +L+ QL A + +H    
Sbjct  1084  VENELATRALKKQLDESTLQASKAVMERTKAYNDKLQLEKRSEELRLQLEALKEEHQKLL  1143

Query  1051  QRVTELEALQQTLSEQLAQAQAALAAKRLNASDASQSGYASDEV---------QKSSTK-  1100
             Q                         KR N+SD SQSGY S+EV         Q ++ K 
Sbjct  1144  Q-------------------------KRSNSSDVSQSGYTSEEVAVPMGPPSGQATTCKQ  1178

Query  1101  --------RESNSSPDLGIHSDTGRVSSVELSNLQHSLLKTVPMPSAGEKVTKEDIKYSK  1152
                     R + SSPDLGI SD GR+SSVE+SN Q ++LKTV M + G            
Sbjct  1179  AAAAVLGQRVNTSSPDLGIESDAGRISSVEVSNAQRAMLKTVEMKTEG------------  1226

Query  1153  QDKSNMNAFASKRPQHSSSSDLGIESDTGRISSMDIKNESPTRTETDDSNTENKMSVANV  1212
                                                  + SP     + ++ ++K +VA  
Sbjct  1227  -------------------------------------SASPKAKSEESTSPDSKSNVAT-  1248

Query  1213  NSATTANAGTHPIHDCIKVEQENAELRRKLVQTKRAFEETYKKLHVANQRKETFQKEIKD  1272
                     G   +HDC KV+ ENAELRRKL++TKRAFE+TY+KL +AN+ K   +K+IK+
Sbjct  1249  --------GAATVHDCAKVDLENAELRRKLIRTKRAFEDTYEKLRMANKAKAQVEKDIKN  1300

Query  1273  QILKTKNVLKYARLHM  1288
             QILKT NVL+  R +M
Sbjct  1301  QILKTHNVLRNVRSNM  1316


 Score = 156 bits (394),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 104/296 (35%), Positives = 176/296 (59%), Gaps = 27/296 (9%)

Query  85   SYGVGFPCVSLQGHGTTSPPVQGRSVREFEEQMASLRKENFNLKLRLYFLEESVPGYHQA  144
            S+ V  P     G G +  P QGRSVRE EEQM++LRKENFNLKLR+YFLEE  PG   A
Sbjct  21   SFDVPRP----PGGGNSPLPSQGRSVRELEEQMSALRKENFNLKLRIYFLEEGQPG---A  73

Query  145  NAEGH-ESLMKQLIETKVEIEILRKELEQKQELLKEAAQAMNHMEEIQKETEMKGQAFIE  203
             A+   ESL KQLI+ K+EI  LRK ++ K ELLK+AA+A++H EE+Q++ ++  QA I+
Sbjct  74   RADSSTESLSKQLIDAKIEIATLRKTVDVKMELLKDAARAISHHEELQRKADIDSQAIID  133

Query  204  ELKQKIQFLEMERDLDKTQQSGFMNDLLGHSEISENVNTLQKIRELEGMVTQSESKIMSM  263
            EL+++I   +M        +SG         +  EN+   +K+  LE  V + E +++++
Sbjct  134  ELQEQIHAYQM-------AESG--------GQPVENIAKTRKMLRLESEVQRLEEELVNI  178

Query  264  QTQN----NNFEEIIAKRDETIKEYEEKVKELAFQNAELLEMMENKEKDMANIELNLKSL  319
            + +N    N  E ++A+R E++   E K++ELA +N+EL+E +E +     +    + SL
Sbjct  179  EARNVAARNELEFMLAERLESLTACEGKIQELAIKNSELVERLEKETASAESSNEAIDSL  238

Query  320  RLCNADLKEDNSSLIEALKSTQDNFHKEFSNMKVCEKRMREQQDALSQMQRELKEK  375
            ++     +++N  L+ ++++ + +  ++  +MK     M  Q+ ++  ++  +K K
Sbjct  239  KVELEACRKENQDLVTSIRTLKHDMKRQVRSMKEAANTMDVQRQSILLLEATIKRK  294


>Q54RX7_DICDI unnamed protein product
Length=1381

 Score = 34.7 bits (78),  Expect = 0.72, Method: Compositional matrix adjust.
 Identities = 17/71 (24%), Positives = 46/71 (65%), Gaps = 5/71 (7%)

Query  107  GRSVREFEEQMASLRKENFNLKLRLYFLEESVPGYHQANAEGHESLMKQLIETKVEIEIL  166
            G +++E  + + + +KENF+LK+R+++++ S+     +     +++ +Q I+ KV+++  
Sbjct  161  GETLKEMIKTIENYKKENFDLKMRIFYMDSSL-----SMTSEEKNMFQQNIDLKVQLDEK  215

Query  167  RKELEQKQELL  177
             K+LE++  ++
Sbjct  216  TKQLEERDNVI  226


>Q57UV7_TRYB2 unnamed protein product
Length=1456

 Score = 32.7 bits (73),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 63/292 (22%), Positives = 135/292 (46%), Gaps = 46/292 (16%)

Query  192  KETEMKGQAFIEELKQKIQFLEMERDLDKTQQSGFMNDLLG-HSEISENVNTL-QKIREL  249
            KE   K    ++E++  ++ L       +T+  G++  L   +S +S  ++TL Q+++E 
Sbjct  662  KEDLRKTDGLVDEMQMALEELGDASKATETELYGYVEQLRSENSRLSTAIDTLRQQLKES  721

Query  250  EGMV-------TQSESKIMSMQTQNNNFEEIIAKRDETIKEYEEKVKELAFQNAELLEMM  302
            E  V        + E  + +++ Q    E  +  RD  +KE+EE +  L  Q  E    +
Sbjct  722  EASVEDRDNRLKEHEESLDTLRQQLKESEASVEDRDNRLKEHEESLNTLRQQLKESEASV  781

Query  303  ENKEKDMANIELNLKSLRLCNADLKEDNSSL----------IEALKSTQDNFHKEFSNMK  352
            E+++  +   E +L +LR     LKE  +S+           E+L + +    +  ++++
Sbjct  782  EDRDNRLKEHETSLDTLR---QQLKESEASVEDRDNRLKEHEESLNTLRQQLKESEASVE  838

Query  353  VCEKRMREQQDALSQMQRELKEKKIALADKLCELDDTQQELVKLRKSYDTACRTLQQLLQ  412
              + R++E + +L  ++++LKE + ++ D+   L           K ++T+  TL+Q L+
Sbjct  839  DRDNRLKEHETSLDTLRQQLKESEASVEDRDNRL-----------KEHETSLNTLRQQLK  887

Query  413  REKNQQQDGGNRALSDSEALQNHLQKCDHENTIKNLEAEVKKKTAALQNLVN  464
              +   +D  NR               +HE ++  L  ++K+  A+++N  N
Sbjct  888  ESEASVEDRDNRLK-------------EHEESLNTLRQQLKESEASVENRDN  926


 Score = 30.8 bits (68),  Expect = 9.7, Method: Compositional matrix adjust.
 Identities = 68/304 (22%), Positives = 142/304 (47%), Gaps = 57/304 (19%)

Query  155   QLIETKVEIEILRKEL-------EQKQELLKEAAQAMNHMEEIQKETEMKGQAFIEELKQ  207
             +L E +  ++ LR++L       E +   LKE  +++N + +  KE+E    A +E+   
Sbjct  787   RLKEHETSLDTLRQQLKESEASVEDRDNRLKEHEESLNTLRQQLKESE----ASVEDRDN  842

Query  208   KIQFLEMERDLDKTQQSGFMNDLLGHSEISENVNTLQKIRELEGMVTQSESKIMSMQTQN  267
             +++  E E  LD  +Q       L  SE S        + + +  + + E+ + +++ Q 
Sbjct  843   RLK--EHETSLDTLRQQ------LKESEAS--------VEDRDNRLKEHETSLNTLRQQL  886

Query  268   NNFEEIIAKRDETIKEYEEKVKELAFQNAELLEMMENKEKDMANIELNLKSLRLCNADLK  327
                E  +  RD  +KE+EE +  L  Q  E    +EN++  +   E +L +LR     LK
Sbjct  887   KESEASVEDRDNRLKEHEESLNTLRQQLKESEASVENRDNRLKEHEESLNTLR---QQLK  943

Query  328   EDNSSL----------IEALKSTQDNFHKEFSNMKVCEKRMREQQDALSQMQRELKEKKI  377
             E  +S+           E+L + +    +  ++++  + R++E +++L+ ++++LKE + 
Sbjct  944   ESEASVEDRDNRLKEHEESLNTLRQQLKESEASVEDRDNRLKEHEESLNTLRQQLKESEA  1003

Query  378   ALADKLCELDDTQQELVKLR-----------------KSYDTACRTLQQLLQREKNQQQD  420
             ++ D+   L + ++ L  LR                 K ++T+  TL+Q L+  +   +D
Sbjct  1004  SVEDRDNRLKEHEESLNTLRQQLKESEASVEDRDNRLKEHETSLNTLRQQLKESEASVED  1063

Query  421   GGNR  424
               NR
Sbjct  1064  RDNR  1067



Lambda      K        H
   0.321    0.137    0.430 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1183107040


Query= XP_014085202.1 PREDICTED: centrosomin isoform X3 [Bactrocera oleae]

Length=1315
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CNN_DROME  unnamed protein product                                    574     0.0  
Q54RX7_DICDI  unnamed protein product                                 34.7    0.66 
Q38FY7_TRYB2  unnamed protein product                                 31.6    6.1  


>CNN_DROME unnamed protein product
Length=1320

 Score = 574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/976 (41%), Positives = 555/976 (57%), Gaps = 196/976 (20%)

Query  347   LADKLCELDDTQQELVKLRKSYDTACRTLQQLLQR----EK-------------NQQQDG  389
             LADK+CEL + Q++L +  + ++ ACRT+Q+L+Q+    EK             N++ D 
Sbjct  471   LADKICELQEAQEKLKERERIHEQACRTIQKLMQKLSSQEKEIKKLNQENEQSANKENDC  530

Query  390   GNRALS---------DSEA----------LQNHLQKCDHENTIKNLEAEVKKKTAALQNL  430
                 +S         D+EA          ++  L+  + E  IK L+ EVKKKTA LQNL
Sbjct  531   AKTVISPSSSGRSMSDNEASSQEMSTNLRVRYELKINEQEEKIKQLQTEVKKKTANLQNL  590

Query  431   VNNELWQKNREIERLTKLLNANTTSPLSPTAARKNLESLQLQQSFTESDYAKALEHNKLL  490
             VN ELW+KNRE+ERLTKLL AN    L P  + ++     LQQSFTE++Y +ALE NKLL
Sbjct  591   VNKELWEKNREVERLTKLL-ANQQKTL-PQISEESAGEADLQQSFTEAEYMRALERNKLL  648

Query  491   QRKVDVLNQRLISGRSNEALIEELRSEARTARAEADNAETCRRAYAKVFGALSDRLYELA  550
             QRKVDVL QRL   + N A+I +LR E + AR E + A+  R     V   L++RL ELA
Sbjct  649   QRKVDVLFQRLADDQQNSAVIGQLRLELQQARTEVETADKWRLECVDVCSVLTNRLEELA  708

Query  551   GFLNSLMKHKEVLSFLSTDRRRAMRTAVDCSLDLSTSIRETL-----TTGDQSFEGLSNL  605
             GFLNSL+KHK+VL  L+ DRR AMR AVD SLDLS S+  TL     +  DQS   L NL
Sbjct  709   GFLNSLLKHKDVLGVLAADRRNAMRKAVDRSLDLSKSLNMTLNITATSLADQSLAQLCNL  768

Query  606   SRLLLDDDEHEVVGLTNKTFNSHENMPARHSF----DVLRSENKALRKILDSRRSCGGTA  661
             S +L  + +      ++KTFNSHE + A  S     + L++ENKAL+K L+ RRS  G  
Sbjct  769   SEILYTEGDA-----SHKTFNSHEELHAATSMAPTVENLKAENKALKKELEKRRSSEGQR  823

Query  662   DYTKDVKDRRSLP-PF-LLDNLSESEAWSEPDRQVSMARIGLEELGAAAANVSAKDAISK  719
                   K+RRSLP P    DN SESEAWSEPDR+VS+ARIGL+E           ++++ 
Sbjct  824   ------KERRSLPLPSQQFDNQSESEAWSEPDRKVSLARIGLDE---------TSNSLAA  868

Query  720   QTPATADTDSESESDALQQSRTTKLRNQERIMQLEKLIAQRDERILMVQFQLVEADNNLK  779
                A ++++SE  + A +Q R    RN ERI QLE+ IAQ+DER+L VQ Q+VE DN  K
Sbjct  869   PEQAISESESEGRTCATRQDRN---RNSERIAQLEEQIAQKDERMLNVQCQMVELDNRYK  925

Query  780   KESLRAITLTQEVEQLRQRNEELITDLIAIGSEQSNNSTAANNSSLIQRQIDEKTRAVEQ  839
             +E LR + +TQ++EQLR  NE L  DL AIGS +            +QRQ++ K + ++Q
Sbjct  926   QEQLRCLDITQQLEQLRAINEALTADLHAIGSHEEERMVE------LQRQLELKNQQIDQ  979

Query  840   LQGERDRIAVEARLAEMQVGALKADIEDIKQKYEIQLK-LASEKERKRLDTLKHELEELM  898
             L+     +  ++++ EM++ AL+  +++I+Q +   ++ L S+ ++ +LD +        
Sbjct  980   LKLAHSTLTADSQITEMELQALQQQMQEIEQLHADSVETLQSQLQKLKLDAV--------  1031

Query  899   QQRLKEQERIHKDMLTREWTTRTTYEECKAQLTELQTQYIESQRTIDYLTDNEQELKQTL  958
              Q+L+E ER+H++ L R+W   TTY+E   QL EL       QR++DY  +NE+ELKQTL
Sbjct  1032  -QQLEEHERLHREALERDWVALTTYQEQAQQLLEL-------QRSLDYHQENEKELKQTL  1083

Query  959   ITSEMEVRSLKKQLDESVLQASKFITERTKLCNEKLQLEKRLMDLQQQLSAAEIQHTTTT  1018
             + +E+  R+LKKQLDES LQASK + ERTK  N+KLQLEKR  +L+ QL A + +H    
Sbjct  1084  VENELATRALKKQLDESTLQASKAVMERTKAYNDKLQLEKRSEELRLQLEALKEEHQKLL  1143

Query  1019  QRVTELEALQQTLSEQLAQAQAALAAKRLNASDASQSGYASDEV---------QKSSTK-  1068
             Q                         KR N+SD SQSGY S+EV         Q ++ K 
Sbjct  1144  Q-------------------------KRSNSSDVSQSGYTSEEVAVPMGPPSGQATTCKQ  1178

Query  1069  --------RESNSSPDLGIHSDTGRVSSVELSNLQHSLLKTVPMPSAGEKVTKEDIKYSK  1120
                     R + SSPDLGI SD GR+SSVE+SN Q ++LKTV M + G            
Sbjct  1179  AAAAVLGQRVNTSSPDLGIESDAGRISSVEVSNAQRAMLKTVEMKTEG------------  1226

Query  1121  QDKSNMNAFASKRPQHSSSSDLGIESDTGRISSMDIKNESPTRTETDDSNTENKMSVANV  1180
                                                  + SP     + ++ ++K +VA  
Sbjct  1227  -------------------------------------SASPKAKSEESTSPDSKSNVAT-  1248

Query  1181  NSATTANAGTHPIHDCIKVEQENAELRRKLVQTKRAFEETYKKLHVANQRKETFQKEIKD  1240
                     G   +HDC KV+ ENAELRRKL++TKRAFE+TY+KL +AN+ K   +K+IK+
Sbjct  1249  --------GAATVHDCAKVDLENAELRRKLIRTKRAFEDTYEKLRMANKAKAQVEKDIKN  1300

Query  1241  QILKTKNVLKYARLHM  1256
             QILKT NVL+  R +M
Sbjct  1301  QILKTHNVLRNVRSNM  1316


 Score = 151 bits (382),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 99/281 (35%), Positives = 167/281 (59%), Gaps = 29/281 (10%)

Query  85   SYGVGFPCVSLQGHGTTSPPVQGRSVREFEEQMASLRKENFNLKLRLYFLEESVPGYHQA  144
            S+ V  P     G G +  P QGRSVRE EEQM++LRKENFNLKLR+YFLEE  PG   A
Sbjct  21   SFDVPRP----PGGGNSPLPSQGRSVRELEEQMSALRKENFNLKLRIYFLEEGQPG---A  73

Query  145  NAEGH-ESLMKQLIETKVEIEILRKELEQKQELLKEAAQAMNHMEEIQKETEMKGQAFIE  203
             A+   ESL KQLI+ K+EI  LRK ++ K ELLK+AA+A++H EE+Q++ ++  QA I+
Sbjct  74   RADSSTESLSKQLIDAKIEIATLRKTVDVKMELLKDAARAISHHEELQRKADIDSQAIID  133

Query  204  ELKQKIQFLEIRE-----------------LEGMVTQSESKIMSMQTQN----NNFEEII  242
            EL+++I   ++ E                 LE  V + E ++++++ +N    N  E ++
Sbjct  134  ELQEQIHAYQMAESGGQPVENIAKTRKMLRLESEVQRLEEELVNIEARNVAARNELEFML  193

Query  243  AKRDETIKEYEEKVKELAFQNAELLEMMENKEKDMANIELNLKSLRLCNADLKEDNSSLI  302
            A+R E++   E K++ELA +N+EL+E +E +     +    + SL++     +++N  L+
Sbjct  194  AERLESLTACEGKIQELAIKNSELVERLEKETASAESSNEAIDSLKVELEACRKENQDLV  253

Query  303  EALKSTQDNFHKEFSNMKVCEKRMREQQDALSQMQRELKEK  343
             ++++ + +  ++  +MK     M  Q+ ++  ++  +K K
Sbjct  254  TSIRTLKHDMKRQVRSMKEAANTMDVQRQSILLLEATIKRK  294


>Q54RX7_DICDI unnamed protein product
Length=1381

 Score = 34.7 bits (78),  Expect = 0.66, Method: Compositional matrix adjust.
 Identities = 17/71 (24%), Positives = 46/71 (65%), Gaps = 5/71 (7%)

Query  107  GRSVREFEEQMASLRKENFNLKLRLYFLEESVPGYHQANAEGHESLMKQLIETKVEIEIL  166
            G +++E  + + + +KENF+LK+R+++++ S+     +     +++ +Q I+ KV+++  
Sbjct  161  GETLKEMIKTIENYKKENFDLKMRIFYMDSSL-----SMTSEEKNMFQQNIDLKVQLDEK  215

Query  167  RKELEQKQELL  177
             K+LE++  ++
Sbjct  216  TKQLEERDNVI  226


>Q38FY7_TRYB2 unnamed protein product
Length=1605

 Score = 31.6 bits (70),  Expect = 6.1, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 61/125 (49%), Gaps = 9/125 (7%)

Query  927   KAQLTELQT--QYIESQR-TIDYLTDNEQELKQTLITSEMEVRSLKKQLDESVLQASKFI  983
             K QL E Q   Q + S+R ++    DN+   +QTL + E EV +L K+  E  ++  + +
Sbjct  499   KVQLGETQADLQRVGSERASLQDTVDNQ---RQTLKSREDEVAALVKESAELRVEVCRLM  555

Query  984   TERTKLCNEKLQLEKRLMDLQ---QQLSAAEIQHTTTTQRVTELEALQQTLSEQLAQAQA  1040
              E  KLC +   LE +L +LQ   ++L A  +        V      +  L +QL + QA
Sbjct  556   EENNKLCGQNTTLEGQLNELQLRMEELEANSLVFNDLRSEVDRHRIREDELRDQLQRLQA  615

Query  1041  ALAAK  1045
              L AK
Sbjct  616   ELQAK  620


 Score = 31.2 bits (69),  Expect = 7.3, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 44/81 (54%), Gaps = 6/81 (7%)

Query  927   KAQLTELQT--QYIESQR-TIDYLTDNEQELKQTLITSEMEVRSLKKQLDESVLQASKFI  983
             K QL E Q   Q + S+R ++    DN+   +QTL + E EV +L K+  E  ++  + +
Sbjct  902   KVQLGETQADLQRVGSERASLQDTVDNQ---RQTLKSREDEVAALVKESAELRVEVCRLM  958

Query  984   TERTKLCNEKLQLEKRLMDLQ  1004
              E  KLC +   LE +L +LQ
Sbjct  959   EENNKLCGQNTTLEGQLNELQ  979



Lambda      K        H
   0.321    0.137    0.430 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1183107040


Query= XP_014085203.1 PREDICTED: centrosomin isoform X4 [Bactrocera oleae]

Length=1304
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CNN_DROME  unnamed protein product                                    574     0.0  
Q54RX7_DICDI  unnamed protein product                                 34.7    0.64 
Q57UV7_TRYB2  unnamed protein product                                 32.7    2.4  


>CNN_DROME unnamed protein product
Length=1320

 Score = 574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/976 (41%), Positives = 555/976 (57%), Gaps = 196/976 (20%)

Query  336   LADKLCELDDTQQELVKLRKSYDTACRTLQQLLQR----EK-------------NQQQDG  378
             LADK+CEL + Q++L +  + ++ ACRT+Q+L+Q+    EK             N++ D 
Sbjct  471   LADKICELQEAQEKLKERERIHEQACRTIQKLMQKLSSQEKEIKKLNQENEQSANKENDC  530

Query  379   GNRALS---------DSEA----------LQNHLQKCDHENTIKNLEAEVKKKTAALQNL  419
                 +S         D+EA          ++  L+  + E  IK L+ EVKKKTA LQNL
Sbjct  531   AKTVISPSSSGRSMSDNEASSQEMSTNLRVRYELKINEQEEKIKQLQTEVKKKTANLQNL  590

Query  420   VNNELWQKNREIERLTKLLNANTTSPLSPTAARKNLESLQLQQSFTESDYAKALEHNKLL  479
             VN ELW+KNRE+ERLTKLL AN    L P  + ++     LQQSFTE++Y +ALE NKLL
Sbjct  591   VNKELWEKNREVERLTKLL-ANQQKTL-PQISEESAGEADLQQSFTEAEYMRALERNKLL  648

Query  480   QRKVDVLNQRLISGRSNEALIEELRSEARTARAEADNAETCRRAYAKVFGALSDRLYELA  539
             QRKVDVL QRL   + N A+I +LR E + AR E + A+  R     V   L++RL ELA
Sbjct  649   QRKVDVLFQRLADDQQNSAVIGQLRLELQQARTEVETADKWRLECVDVCSVLTNRLEELA  708

Query  540   GFLNSLMKHKEVLSFLSTDRRRAMRTAVDCSLDLSTSIRETL-----TTGDQSFEGLSNL  594
             GFLNSL+KHK+VL  L+ DRR AMR AVD SLDLS S+  TL     +  DQS   L NL
Sbjct  709   GFLNSLLKHKDVLGVLAADRRNAMRKAVDRSLDLSKSLNMTLNITATSLADQSLAQLCNL  768

Query  595   SRLLLDDDEHEVVGLTNKTFNSHENMPARHSF----DVLRSENKALRKILDSRRSCGGTA  650
             S +L  + +      ++KTFNSHE + A  S     + L++ENKAL+K L+ RRS  G  
Sbjct  769   SEILYTEGDA-----SHKTFNSHEELHAATSMAPTVENLKAENKALKKELEKRRSSEGQR  823

Query  651   DYTKDVKDRRSLP-PF-LLDNLSESEAWSEPDRQVSMARIGLEELGAAAANVSAKDAISK  708
                   K+RRSLP P    DN SESEAWSEPDR+VS+ARIGL+E           ++++ 
Sbjct  824   ------KERRSLPLPSQQFDNQSESEAWSEPDRKVSLARIGLDE---------TSNSLAA  868

Query  709   QTPATADTDSESESDALQQSRTTKLRNQERIMQLEKLIAQRDERILMVQFQLVEADNNLK  768
                A ++++SE  + A +Q R    RN ERI QLE+ IAQ+DER+L VQ Q+VE DN  K
Sbjct  869   PEQAISESESEGRTCATRQDRN---RNSERIAQLEEQIAQKDERMLNVQCQMVELDNRYK  925

Query  769   KESLRAITLTQEVEQLRQRNEELITDLIAIGSEQSNNSTAANNSSLIQRQIDEKTRAVEQ  828
             +E LR + +TQ++EQLR  NE L  DL AIGS +            +QRQ++ K + ++Q
Sbjct  926   QEQLRCLDITQQLEQLRAINEALTADLHAIGSHEEERMVE------LQRQLELKNQQIDQ  979

Query  829   LQGERDRIAVEARLAEMQVGALKADIEDIKQKYEIQLK-LASEKERKRLDTLKHELEELM  887
             L+     +  ++++ EM++ AL+  +++I+Q +   ++ L S+ ++ +LD +        
Sbjct  980   LKLAHSTLTADSQITEMELQALQQQMQEIEQLHADSVETLQSQLQKLKLDAV--------  1031

Query  888   QQRLKEQERIHKDMLTREWTTRTTYEECKAQLTELQTQYIESQRTIDYLTDNEQELKQTL  947
              Q+L+E ER+H++ L R+W   TTY+E   QL EL       QR++DY  +NE+ELKQTL
Sbjct  1032  -QQLEEHERLHREALERDWVALTTYQEQAQQLLEL-------QRSLDYHQENEKELKQTL  1083

Query  948   ITSEMEVRSLKKQLDESVLQASKFITERTKLCNEKLQLEKRLMDLQQQLSAAEIQHTTTT  1007
             + +E+  R+LKKQLDES LQASK + ERTK  N+KLQLEKR  +L+ QL A + +H    
Sbjct  1084  VENELATRALKKQLDESTLQASKAVMERTKAYNDKLQLEKRSEELRLQLEALKEEHQKLL  1143

Query  1008  QRVTELEALQQTLSEQLAQAQAALAAKRLNASDASQSGYASDEV---------QKSSTK-  1057
             Q                         KR N+SD SQSGY S+EV         Q ++ K 
Sbjct  1144  Q-------------------------KRSNSSDVSQSGYTSEEVAVPMGPPSGQATTCKQ  1178

Query  1058  --------RESNSSPDLGIHSDTGRVSSVELSNLQHSLLKTVPMPSAGEKVTKEDIKYSK  1109
                     R + SSPDLGI SD GR+SSVE+SN Q ++LKTV M + G            
Sbjct  1179  AAAAVLGQRVNTSSPDLGIESDAGRISSVEVSNAQRAMLKTVEMKTEG------------  1226

Query  1110  QDKSNMNAFASKRPQHSSSSDLGIESDTGRISSMDIKNESPTRTETDDSNTENKMSVANV  1169
                                                  + SP     + ++ ++K +VA  
Sbjct  1227  -------------------------------------SASPKAKSEESTSPDSKSNVAT-  1248

Query  1170  NSATTANAGTHPIHDCIKVEQENAELRRKLVQTKRAFEETYKKLHVANQRKETFQKEIKD  1229
                     G   +HDC KV+ ENAELRRKL++TKRAFE+TY+KL +AN+ K   +K+IK+
Sbjct  1249  --------GAATVHDCAKVDLENAELRRKLIRTKRAFEDTYEKLRMANKAKAQVEKDIKN  1300

Query  1230  QILKTKNVLKYARLHM  1245
             QILKT NVL+  R +M
Sbjct  1301  QILKTHNVLRNVRSNM  1316


 Score = 156 bits (395),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 104/296 (35%), Positives = 176/296 (59%), Gaps = 27/296 (9%)

Query  42   SYGVGFPCVSLQGHGTTSPPVQGRSVREFEEQMASLRKENFNLKLRLYFLEESVPGYHQA  101
            S+ V  P     G G +  P QGRSVRE EEQM++LRKENFNLKLR+YFLEE  PG   A
Sbjct  21   SFDVPRP----PGGGNSPLPSQGRSVRELEEQMSALRKENFNLKLRIYFLEEGQPG---A  73

Query  102  NAEGH-ESLMKQLIETKVEIEILRKELEQKQELLKEAAQAMNHMEEIQKETEMKGQAFIE  160
             A+   ESL KQLI+ K+EI  LRK ++ K ELLK+AA+A++H EE+Q++ ++  QA I+
Sbjct  74   RADSSTESLSKQLIDAKIEIATLRKTVDVKMELLKDAARAISHHEELQRKADIDSQAIID  133

Query  161  ELKQKIQFLEMERDLDKTQQSGFMNDLLGHSEISENVNTLQKIRELEGMVTQSESKIMSM  220
            EL+++I   +M        +SG         +  EN+   +K+  LE  V + E +++++
Sbjct  134  ELQEQIHAYQM-------AESG--------GQPVENIAKTRKMLRLESEVQRLEEELVNI  178

Query  221  QTQN----NNFEEIIAKRDETIKEYEEKVKELAFQNAELLEMMENKEKDMANIELNLKSL  276
            + +N    N  E ++A+R E++   E K++ELA +N+EL+E +E +     +    + SL
Sbjct  179  EARNVAARNELEFMLAERLESLTACEGKIQELAIKNSELVERLEKETASAESSNEAIDSL  238

Query  277  RLCNADLKEDNSSLIEALKSTQDNFHKEFSNMKVCEKRMREQQDALSQMQRELKEK  332
            ++     +++N  L+ ++++ + +  ++  +MK     M  Q+ ++  ++  +K K
Sbjct  239  KVELEACRKENQDLVTSIRTLKHDMKRQVRSMKEAANTMDVQRQSILLLEATIKRK  294


>Q54RX7_DICDI unnamed protein product
Length=1381

 Score = 34.7 bits (78),  Expect = 0.64, Method: Compositional matrix adjust.
 Identities = 17/71 (24%), Positives = 46/71 (65%), Gaps = 5/71 (7%)

Query  64   GRSVREFEEQMASLRKENFNLKLRLYFLEESVPGYHQANAEGHESLMKQLIETKVEIEIL  123
            G +++E  + + + +KENF+LK+R+++++ S+     +     +++ +Q I+ KV+++  
Sbjct  161  GETLKEMIKTIENYKKENFDLKMRIFYMDSSL-----SMTSEEKNMFQQNIDLKVQLDEK  215

Query  124  RKELEQKQELL  134
             K+LE++  ++
Sbjct  216  TKQLEERDNVI  226


>Q57UV7_TRYB2 unnamed protein product
Length=1456

 Score = 32.7 bits (73),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 62/289 (21%), Positives = 134/289 (46%), Gaps = 46/289 (16%)

Query  149  KETEMKGQAFIEELKQKIQFLEMERDLDKTQQSGFMNDLLG-HSEISENVNTL-QKIREL  206
            KE   K    ++E++  ++ L       +T+  G++  L   +S +S  ++TL Q+++E 
Sbjct  662  KEDLRKTDGLVDEMQMALEELGDASKATETELYGYVEQLRSENSRLSTAIDTLRQQLKES  721

Query  207  EGMV-------TQSESKIMSMQTQNNNFEEIIAKRDETIKEYEEKVKELAFQNAELLEMM  259
            E  V        + E  + +++ Q    E  +  RD  +KE+EE +  L  Q  E    +
Sbjct  722  EASVEDRDNRLKEHEESLDTLRQQLKESEASVEDRDNRLKEHEESLNTLRQQLKESEASV  781

Query  260  ENKEKDMANIELNLKSLRLCNADLKEDNSSL----------IEALKSTQDNFHKEFSNMK  309
            E+++  +   E +L +LR     LKE  +S+           E+L + +    +  ++++
Sbjct  782  EDRDNRLKEHETSLDTLR---QQLKESEASVEDRDNRLKEHEESLNTLRQQLKESEASVE  838

Query  310  VCEKRMREQQDALSQMQRELKEKKIALADKLCELDDTQQELVKLRKSYDTACRTLQQLLQ  369
              + R++E + +L  ++++LKE + ++ D+   L           K ++T+  TL+Q L+
Sbjct  839  DRDNRLKEHETSLDTLRQQLKESEASVEDRDNRL-----------KEHETSLNTLRQQLK  887

Query  370  REKNQQQDGGNRALSDSEALQNHLQKCDHENTIKNLEAEVKKKTAALQN  418
              +   +D  NR               +HE ++  L  ++K+  A+++N
Sbjct  888  ESEASVEDRDNRLK-------------EHEESLNTLRQQLKESEASVEN  923


 Score = 31.2 bits (69),  Expect = 9.0, Method: Compositional matrix adjust.
 Identities = 68/304 (22%), Positives = 142/304 (47%), Gaps = 57/304 (19%)

Query  112   QLIETKVEIEILRKEL-------EQKQELLKEAAQAMNHMEEIQKETEMKGQAFIEELKQ  164
             +L E +  ++ LR++L       E +   LKE  +++N + +  KE+E    A +E+   
Sbjct  787   RLKEHETSLDTLRQQLKESEASVEDRDNRLKEHEESLNTLRQQLKESE----ASVEDRDN  842

Query  165   KIQFLEMERDLDKTQQSGFMNDLLGHSEISENVNTLQKIRELEGMVTQSESKIMSMQTQN  224
             +++  E E  LD  +Q       L  SE S        + + +  + + E+ + +++ Q 
Sbjct  843   RLK--EHETSLDTLRQQ------LKESEAS--------VEDRDNRLKEHETSLNTLRQQL  886

Query  225   NNFEEIIAKRDETIKEYEEKVKELAFQNAELLEMMENKEKDMANIELNLKSLRLCNADLK  284
                E  +  RD  +KE+EE +  L  Q  E    +EN++  +   E +L +LR     LK
Sbjct  887   KESEASVEDRDNRLKEHEESLNTLRQQLKESEASVENRDNRLKEHEESLNTLR---QQLK  943

Query  285   EDNSSL----------IEALKSTQDNFHKEFSNMKVCEKRMREQQDALSQMQRELKEKKI  334
             E  +S+           E+L + +    +  ++++  + R++E +++L+ ++++LKE + 
Sbjct  944   ESEASVEDRDNRLKEHEESLNTLRQQLKESEASVEDRDNRLKEHEESLNTLRQQLKESEA  1003

Query  335   ALADKLCELDDTQQELVKLR-----------------KSYDTACRTLQQLLQREKNQQQD  377
             ++ D+   L + ++ L  LR                 K ++T+  TL+Q L+  +   +D
Sbjct  1004  SVEDRDNRLKEHEESLNTLRQQLKESEASVEDRDNRLKEHETSLNTLRQQLKESEASVED  1063

Query  378   GGNR  381
               NR
Sbjct  1064  RDNR  1067



Lambda      K        H
   0.321    0.137    0.430 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1183107040


Query= XP_014085204.1 PREDICTED: centrosomin isoform X5 [Bactrocera oleae]

Length=1299
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CNN_DROME  unnamed protein product                                    573     0.0  
Q54RX7_DICDI  unnamed protein product                                 34.7    0.68 
Q57UV7_TRYB2  unnamed protein product                                 32.7    2.9  


>CNN_DROME unnamed protein product
Length=1320

 Score = 573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/976 (41%), Positives = 553/976 (57%), Gaps = 196/976 (20%)

Query  331   LADKLCELDDTQQELVKLRKSYDTACRTLQQLLQR-----------------EKNQQQDG  373
             LADK+CEL + Q++L +  + ++ ACRT+Q+L+Q+                   N++ D 
Sbjct  471   LADKICELQEAQEKLKERERIHEQACRTIQKLMQKLSSQEKEIKKLNQENEQSANKENDC  530

Query  374   GNRALS---------DSEA----------LQNHLQKCDHENTIKNLEAEVKKKTAALQNL  414
                 +S         D+EA          ++  L+  + E  IK L+ EVKKKTA LQNL
Sbjct  531   AKTVISPSSSGRSMSDNEASSQEMSTNLRVRYELKINEQEEKIKQLQTEVKKKTANLQNL  590

Query  415   VNNELWQKNREIERLTKLLNANTTSPLSPTAARKNLESLQLQQSFTESDYAKALEHNKLL  474
             VN ELW+KNRE+ERLTKLL AN    L P  + ++     LQQSFTE++Y +ALE NKLL
Sbjct  591   VNKELWEKNREVERLTKLL-ANQQKTL-PQISEESAGEADLQQSFTEAEYMRALERNKLL  648

Query  475   QRKVDVLNQRLISGRSNEALIEELRSEARTARAEADNAETCRRAYAKVFGALSDRLYELA  534
             QRKVDVL QRL   + N A+I +LR E + AR E + A+  R     V   L++RL ELA
Sbjct  649   QRKVDVLFQRLADDQQNSAVIGQLRLELQQARTEVETADKWRLECVDVCSVLTNRLEELA  708

Query  535   GFLNSLMKHKEVLSFLSTDRRRAMRTAVDCSLDLSTSIRETL-----TTGDQSFEGLSNL  589
             GFLNSL+KHK+VL  L+ DRR AMR AVD SLDLS S+  TL     +  DQS   L NL
Sbjct  709   GFLNSLLKHKDVLGVLAADRRNAMRKAVDRSLDLSKSLNMTLNITATSLADQSLAQLCNL  768

Query  590   SRLLLDDDEHEVVGLTNKTFNSHENMPARHSF----DVLRSENKALRKILDSRRSCGGTA  645
             S +L  + +      ++KTFNSHE + A  S     + L++ENKAL+K L+ RRS  G  
Sbjct  769   SEILYTEGDA-----SHKTFNSHEELHAATSMAPTVENLKAENKALKKELEKRRSSEGQR  823

Query  646   DYTKDVKDRRSLP-PF-LLDNLSESEAWSEPDRQVSMARIGLEELGAAAANVSAKDAISK  703
                   K+RRSLP P    DN SESEAWSEPDR+VS+ARIGL+E           ++++ 
Sbjct  824   ------KERRSLPLPSQQFDNQSESEAWSEPDRKVSLARIGLDE---------TSNSLAA  868

Query  704   QTPATADTDSESESDALQQSRTTKLRNQERIMQLEKLIAQRDERILMVQFQLVEADNNLK  763
                A ++++SE  + A +Q R    RN ERI QLE+ IAQ+DER+L VQ Q+VE DN  K
Sbjct  869   PEQAISESESEGRTCATRQDRN---RNSERIAQLEEQIAQKDERMLNVQCQMVELDNRYK  925

Query  764   KESLRAITLTQEVEQLRQRNEELITDLIAIGSEQSNNSTAANNSSLIQRQIDEKTRAVEQ  823
             +E LR + +TQ++EQLR  NE L  DL AIGS +            +QRQ++ K + ++Q
Sbjct  926   QEQLRCLDITQQLEQLRAINEALTADLHAIGSHEEERMVE------LQRQLELKNQQIDQ  979

Query  824   LQGERDRIAVEARLAEMQVGALKADIEDIKQKYEIQLK-LASEKERKRLDTLKHELEELM  882
             L+     +  ++++ EM++ AL+  +++I+Q +   ++ L S+ ++ +LD +        
Sbjct  980   LKLAHSTLTADSQITEMELQALQQQMQEIEQLHADSVETLQSQLQKLKLDAV--------  1031

Query  883   QQRLKEQERIHKDMLTREWTTRTTYEECKAQLTELQTQYIESQRTIDYLTDNEQELKQTL  942
              Q+L+E ER+H++ L R+W   TTY+E   QL EL       QR++DY  +NE+ELKQTL
Sbjct  1032  -QQLEEHERLHREALERDWVALTTYQEQAQQLLEL-------QRSLDYHQENEKELKQTL  1083

Query  943   ITSEMEVRSLKKQLDESVLQASKFITERTKLCNEKLQLEKRLMDLQQQLSAAEIQHTTTT  1002
             + +E+  R+LKKQLDES LQASK + ERTK  N+KLQLEKR  +L+ QL A + +H    
Sbjct  1084  VENELATRALKKQLDESTLQASKAVMERTKAYNDKLQLEKRSEELRLQLEALKEEHQKLL  1143

Query  1003  QRVTELEALQQTLSEQLAQAQAALAAKRLNASDASQSGYASDEV---------QKSSTK-  1052
             Q                         KR N+SD SQSGY S+EV         Q ++ K 
Sbjct  1144  Q-------------------------KRSNSSDVSQSGYTSEEVAVPMGPPSGQATTCKQ  1178

Query  1053  --------RESNSSPDLGIHSDTGRVSSVELSNLQHSLLKTVPMPSAGEKVTKEDIKYSK  1104
                     R + SSPDLGI SD GR+SSVE+SN Q ++LKTV M + G            
Sbjct  1179  AAAAVLGQRVNTSSPDLGIESDAGRISSVEVSNAQRAMLKTVEMKTEG------------  1226

Query  1105  QDKSNMNAFASKRPQHSSSSDLGIESDTGRISSMDIKNESPTRTETDDSNTENKMSVANV  1164
                                                  + SP     + ++ ++K +VA  
Sbjct  1227  -------------------------------------SASPKAKSEESTSPDSKSNVAT-  1248

Query  1165  NSATTANAGTHPIHDCIKVEQENAELRRKLVQTKRAFEETYKKLHVANQRKETFQKEIKD  1224
                     G   +HDC KV+ ENAELRRKL++TKRAFE+TY+KL +AN+ K   +K+IK+
Sbjct  1249  --------GAATVHDCAKVDLENAELRRKLIRTKRAFEDTYEKLRMANKAKAQVEKDIKN  1300

Query  1225  QILKTKNVLKYARLHM  1240
             QILKT NVL+  R +M
Sbjct  1301  QILKTHNVLRNVRSNM  1316


 Score = 155 bits (392),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 101/284 (36%), Positives = 172/284 (61%), Gaps = 23/284 (8%)

Query  49   GHGTTSPPVQGRSVREFEEQMASLRKENFNLKLRLYFLEESVPGYHQANAEGH-ESLMKQ  107
            G G +  P QGRSVRE EEQM++LRKENFNLKLR+YFLEE  PG   A A+   ESL KQ
Sbjct  29   GGGNSPLPSQGRSVRELEEQMSALRKENFNLKLRIYFLEEGQPG---ARADSSTESLSKQ  85

Query  108  LIETKVEIEILRKELEQKQELLKEAAQAMNHMEEIQKETEMKGQAFIEELKQKIQFLEME  167
            LI+ K+EI  LRK ++ K ELLK+AA+A++H EE+Q++ ++  QA I+EL+++I   +M 
Sbjct  86   LIDAKIEIATLRKTVDVKMELLKDAARAISHHEELQRKADIDSQAIIDELQEQIHAYQM-  144

Query  168  RDLDKTQQSGFMNDLLGHSEISENVNTLQKIRELEGMVTQSESKIMSMQTQN----NNFE  223
                   +SG         +  EN+   +K+  LE  V + E ++++++ +N    N  E
Sbjct  145  ------AESG--------GQPVENIAKTRKMLRLESEVQRLEEELVNIEARNVAARNELE  190

Query  224  EIIAKRDETIKEYEEKVKELAFQNAELLEMMENKEKDMANIELNLKSLRLCNADLKEDNS  283
             ++A+R E++   E K++ELA +N+EL+E +E +     +    + SL++     +++N 
Sbjct  191  FMLAERLESLTACEGKIQELAIKNSELVERLEKETASAESSNEAIDSLKVELEACRKENQ  250

Query  284  SLIEALKSTQDNFHKEFSNMKVCEKRMREQQDALSQMQRELKEK  327
             L+ ++++ + +  ++  +MK     M  Q+ ++  ++  +K K
Sbjct  251  DLVTSIRTLKHDMKRQVRSMKEAANTMDVQRQSILLLEATIKRK  294


>Q54RX7_DICDI unnamed protein product
Length=1381

 Score = 34.7 bits (78),  Expect = 0.68, Method: Compositional matrix adjust.
 Identities = 17/71 (24%), Positives = 46/71 (65%), Gaps = 5/71 (7%)

Query  59   GRSVREFEEQMASLRKENFNLKLRLYFLEESVPGYHQANAEGHESLMKQLIETKVEIEIL  118
            G +++E  + + + +KENF+LK+R+++++ S+     +     +++ +Q I+ KV+++  
Sbjct  161  GETLKEMIKTIENYKKENFDLKMRIFYMDSSL-----SMTSEEKNMFQQNIDLKVQLDEK  215

Query  119  RKELEQKQELL  129
             K+LE++  ++
Sbjct  216  TKQLEERDNVI  226


>Q57UV7_TRYB2 unnamed protein product
Length=1456

 Score = 32.7 bits (73),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 62/289 (21%), Positives = 134/289 (46%), Gaps = 46/289 (16%)

Query  144  KETEMKGQAFIEELKQKIQFLEMERDLDKTQQSGFMNDLLG-HSEISENVNTL-QKIREL  201
            KE   K    ++E++  ++ L       +T+  G++  L   +S +S  ++TL Q+++E 
Sbjct  662  KEDLRKTDGLVDEMQMALEELGDASKATETELYGYVEQLRSENSRLSTAIDTLRQQLKES  721

Query  202  EGMV-------TQSESKIMSMQTQNNNFEEIIAKRDETIKEYEEKVKELAFQNAELLEMM  254
            E  V        + E  + +++ Q    E  +  RD  +KE+EE +  L  Q  E    +
Sbjct  722  EASVEDRDNRLKEHEESLDTLRQQLKESEASVEDRDNRLKEHEESLNTLRQQLKESEASV  781

Query  255  ENKEKDMANIELNLKSLRLCNADLKEDNSSL----------IEALKSTQDNFHKEFSNMK  304
            E+++  +   E +L +LR     LKE  +S+           E+L + +    +  ++++
Sbjct  782  EDRDNRLKEHETSLDTLR---QQLKESEASVEDRDNRLKEHEESLNTLRQQLKESEASVE  838

Query  305  VCEKRMREQQDALSQMQRELKEKKIALADKLCELDDTQQELVKLRKSYDTACRTLQQLLQ  364
              + R++E + +L  ++++LKE + ++ D+   L           K ++T+  TL+Q L+
Sbjct  839  DRDNRLKEHETSLDTLRQQLKESEASVEDRDNRL-----------KEHETSLNTLRQQLK  887

Query  365  REKNQQQDGGNRALSDSEALQNHLQKCDHENTIKNLEAEVKKKTAALQN  413
              +   +D  NR               +HE ++  L  ++K+  A+++N
Sbjct  888  ESEASVEDRDNRLK-------------EHEESLNTLRQQLKESEASVEN  923



Lambda      K        H
   0.321    0.137    0.430 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1183107040


Query= XP_014085205.1 PREDICTED: centrosomin isoform X6 [Bactrocera oleae]

Length=1291
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CNN_DROME  unnamed protein product                                    575     0.0  
H2L0I2_CAEEL  unnamed protein product                                 35.0    0.54 
H2L0I3_CAEEL  unnamed protein product                                 34.7    0.64 


>CNN_DROME unnamed protein product
Length=1320

 Score = 575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/976 (41%), Positives = 555/976 (57%), Gaps = 196/976 (20%)

Query  323   LADKLCELDDTQQELVKLRKSYDTACRTLQQLLQR----EK-------------NQQQDG  365
             LADK+CEL + Q++L +  + ++ ACRT+Q+L+Q+    EK             N++ D 
Sbjct  471   LADKICELQEAQEKLKERERIHEQACRTIQKLMQKLSSQEKEIKKLNQENEQSANKENDC  530

Query  366   GNRALS---------DSEA----------LQNHLQKCDHENTIKNLEAEVKKKTAALQNL  406
                 +S         D+EA          ++  L+  + E  IK L+ EVKKKTA LQNL
Sbjct  531   AKTVISPSSSGRSMSDNEASSQEMSTNLRVRYELKINEQEEKIKQLQTEVKKKTANLQNL  590

Query  407   VNNELWQKNREIERLTKLLNANTTSPLSPTAARKNLESLQLQQSFTESDYAKALEHNKLL  466
             VN ELW+KNRE+ERLTKLL AN    L P  + ++     LQQSFTE++Y +ALE NKLL
Sbjct  591   VNKELWEKNREVERLTKLL-ANQQKTL-PQISEESAGEADLQQSFTEAEYMRALERNKLL  648

Query  467   QRKVDVLNQRLISGRSNEALIEELRSEARTARAEADNAETCRRAYAKVFGALSDRLYELA  526
             QRKVDVL QRL   + N A+I +LR E + AR E + A+  R     V   L++RL ELA
Sbjct  649   QRKVDVLFQRLADDQQNSAVIGQLRLELQQARTEVETADKWRLECVDVCSVLTNRLEELA  708

Query  527   GFLNSLMKHKEVLSFLSTDRRRAMRTAVDCSLDLSTSIRETL-----TTGDQSFEGLSNL  581
             GFLNSL+KHK+VL  L+ DRR AMR AVD SLDLS S+  TL     +  DQS   L NL
Sbjct  709   GFLNSLLKHKDVLGVLAADRRNAMRKAVDRSLDLSKSLNMTLNITATSLADQSLAQLCNL  768

Query  582   SRLLLDDDEHEVVGLTNKTFNSHENMPARHSF----DVLRSENKALRKILDSRRSCGGTA  637
             S +L  + +      ++KTFNSHE + A  S     + L++ENKAL+K L+ RRS  G  
Sbjct  769   SEILYTEGDA-----SHKTFNSHEELHAATSMAPTVENLKAENKALKKELEKRRSSEGQR  823

Query  638   DYTKDVKDRRSLP-PF-LLDNLSESEAWSEPDRQVSMARIGLEELGAAAANVSAKDAISK  695
                   K+RRSLP P    DN SESEAWSEPDR+VS+ARIGL+E           ++++ 
Sbjct  824   ------KERRSLPLPSQQFDNQSESEAWSEPDRKVSLARIGLDE---------TSNSLAA  868

Query  696   QTPATADTDSESESDALQQSRTTKLRNQERIMQLEKLIAQRDERILMVQFQLVEADNNLK  755
                A ++++SE  + A +Q R    RN ERI QLE+ IAQ+DER+L VQ Q+VE DN  K
Sbjct  869   PEQAISESESEGRTCATRQDRN---RNSERIAQLEEQIAQKDERMLNVQCQMVELDNRYK  925

Query  756   KESLRAITLTQEVEQLRQRNEELITDLIAIGSEQSNNSTAANNSSLIQRQIDEKTRAVEQ  815
             +E LR + +TQ++EQLR  NE L  DL AIGS +            +QRQ++ K + ++Q
Sbjct  926   QEQLRCLDITQQLEQLRAINEALTADLHAIGSHEEERMVE------LQRQLELKNQQIDQ  979

Query  816   LQGERDRIAVEARLAEMQVGALKADIEDIKQKYEIQLK-LASEKERKRLDTLKHELEELM  874
             L+     +  ++++ EM++ AL+  +++I+Q +   ++ L S+ ++ +LD +        
Sbjct  980   LKLAHSTLTADSQITEMELQALQQQMQEIEQLHADSVETLQSQLQKLKLDAV--------  1031

Query  875   QQRLKEQERIHKDMLTREWTTRTTYEECKAQLTELQTQYIESQRTIDYLTDNEQELKQTL  934
              Q+L+E ER+H++ L R+W   TTY+E   QL EL       QR++DY  +NE+ELKQTL
Sbjct  1032  -QQLEEHERLHREALERDWVALTTYQEQAQQLLEL-------QRSLDYHQENEKELKQTL  1083

Query  935   ITSEMEVRSLKKQLDESVLQASKFITERTKLCNEKLQLEKRLMDLQQQLSAAEIQHTTTT  994
             + +E+  R+LKKQLDES LQASK + ERTK  N+KLQLEKR  +L+ QL A + +H    
Sbjct  1084  VENELATRALKKQLDESTLQASKAVMERTKAYNDKLQLEKRSEELRLQLEALKEEHQKLL  1143

Query  995   QRVTELEALQQTLSEQLAQAQAALAAKRLNASDASQSGYASDEV---------QKSSTK-  1044
             Q                         KR N+SD SQSGY S+EV         Q ++ K 
Sbjct  1144  Q-------------------------KRSNSSDVSQSGYTSEEVAVPMGPPSGQATTCKQ  1178

Query  1045  --------RESNSSPDLGIHSDTGRVSSVELSNLQHSLLKTVPMPSAGEKVTKEDIKYSK  1096
                     R + SSPDLGI SD GR+SSVE+SN Q ++LKTV M + G            
Sbjct  1179  AAAAVLGQRVNTSSPDLGIESDAGRISSVEVSNAQRAMLKTVEMKTEG------------  1226

Query  1097  QDKSNMNAFASKRPQHSSSSDLGIESDTGRISSMDIKNESPTRTETDDSNTENKMSVANV  1156
                                                  + SP     + ++ ++K +VA  
Sbjct  1227  -------------------------------------SASPKAKSEESTSPDSKSNVAT-  1248

Query  1157  NSATTANAGTHPIHDCIKVEQENAELRRKLVQTKRAFEETYKKLHVANQRKETFQKEIKD  1216
                     G   +HDC KV+ ENAELRRKL++TKRAFE+TY+KL +AN+ K   +K+IK+
Sbjct  1249  --------GAATVHDCAKVDLENAELRRKLIRTKRAFEDTYEKLRMANKAKAQVEKDIKN  1300

Query  1217  QILKTKNVLKYARLHM  1232
             QILKT NVL+  R +M
Sbjct  1301  QILKTHNVLRNVRSNM  1316


 Score = 151 bits (382),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 94/224 (42%), Positives = 142/224 (63%), Gaps = 27/224 (12%)

Query  85   SYGVGFPCVSLQGHGTTSPPVQGRSVREFEEQMASLRKENFNLKLRLYFLEESVPGYHQA  144
            S+ V  P     G G +  P QGRSVRE EEQM++LRKENFNLKLR+YFLEE  PG   A
Sbjct  21   SFDVPRP----PGGGNSPLPSQGRSVRELEEQMSALRKENFNLKLRIYFLEEGQPG---A  73

Query  145  NAEGH-ESLMKQLIETKVEIEILRKELEQKQELLKEAAQAMNHMEEIQKETEMKGQAFIE  203
             A+   ESL KQLI+ K+EI  LRK ++ K ELLK+AA+A++H EE+Q++ ++  QA I+
Sbjct  74   RADSSTESLSKQLIDAKIEIATLRKTVDVKMELLKDAARAISHHEELQRKADIDSQAIID  133

Query  204  ELKQKIQFLEMERDLDKTQQSGFMNDLLGHSEISENVNTLQKIRELEGMVTQSESKIMSM  263
            EL+++I   +M        +SG         +  EN+   +K+  LE  V + E +++++
Sbjct  134  ELQEQIHAYQM-------AESG--------GQPVENIAKTRKMLRLESEVQRLEEELVNI  178

Query  264  QTQN----NNFEEIIAKRDETIKEYEEKVKELAFQNAELLEMME  303
            + +N    N  E ++A+R E++   E K++ELA +N+EL+E +E
Sbjct  179  EARNVAARNELEFMLAERLESLTACEGKIQELAIKNSELVERLE  222


>H2L0I2_CAEEL unnamed protein product
Length=2396

 Score = 35.0 bits (79),  Expect = 0.54, Method: Compositional matrix adjust.
 Identities = 49/188 (26%), Positives = 89/188 (47%), Gaps = 9/188 (5%)

Query  240  VNTLQ-KIRELEGMVTQSESKIMSMQTQNNNFEEIIAKRDETIKEYEEKVKELAFQNAEL  298
            VN L+ K R+LE     ++ +I   +TQ    ++I     + + +  EK   +   N ++
Sbjct  758  VNPLKDKYRDLENEYNSTQRRIEEKETQIRYSDDIRRNIQKDLDDLREKYDRVHTDNEKI  817

Query  299  LEMMENKEKDMANIERELKEKKIALADKLCELDDTQQELVKLRKSYDTACRTLQQLLQR-  357
            L  +E+ +K     E++LKE KI   D   + D+  + L  +R   +T  +  Q L +  
Sbjct  818  LGELEHAQKAAHLAEQQLKEIKIQRDDYQKQKDEHARHLFDIRHKLETEIKGRQDLEKNG  877

Query  358  -EKNQQQDGGNRALSDSEALQNHLQKCDHENTIKNLEAEVKKKTAALQNLVNNELWQKNR  416
               N + D   + +SD E+  N L++ + E     L+  +K     + +L  NEL  ++ 
Sbjct  878  ARNNDELDKLRQTISDYESQINLLRRHNDE-----LDTTIKGHQGKITHL-ENELHSRSG  931

Query  417  EIERLTKL  424
            EIE+L  L
Sbjct  932  EIEKLNDL  939


>H2L0I3_CAEEL unnamed protein product
Length=2350

 Score = 34.7 bits (78),  Expect = 0.64, Method: Compositional matrix adjust.
 Identities = 49/188 (26%), Positives = 89/188 (47%), Gaps = 9/188 (5%)

Query  240  VNTLQ-KIRELEGMVTQSESKIMSMQTQNNNFEEIIAKRDETIKEYEEKVKELAFQNAEL  298
            VN L+ K R+LE     ++ +I   +TQ    ++I     + + +  EK   +   N ++
Sbjct  685  VNPLKDKYRDLENEYNSTQRRIEEKETQIRYSDDIRRNIQKDLDDLREKYDRVHTDNEKI  744

Query  299  LEMMENKEKDMANIERELKEKKIALADKLCELDDTQQELVKLRKSYDTACRTLQQLLQR-  357
            L  +E+ +K     E++LKE KI   D   + D+  + L  +R   +T  +  Q L +  
Sbjct  745  LGELEHAQKAAHLAEQQLKEIKIQRDDYQKQKDEHARHLFDIRHKLETEIKGRQDLEKNG  804

Query  358  -EKNQQQDGGNRALSDSEALQNHLQKCDHENTIKNLEAEVKKKTAALQNLVNNELWQKNR  416
               N + D   + +SD E+  N L++ + E     L+  +K     + +L  NEL  ++ 
Sbjct  805  ARNNDELDKLRQTISDYESQINLLRRHNDE-----LDTTIKGHQGKITHL-ENELHSRSG  858

Query  417  EIERLTKL  424
            EIE+L  L
Sbjct  859  EIEKLNDL  866



Lambda      K        H
   0.321    0.137    0.430 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1183107040


Query= XP_014085206.1 PREDICTED: Golgi pH regulator [Bactrocera oleae]

Length=453
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q3ZAN1_DROME  unnamed protein product                                 722     0.0   
GPHR_DICDI  unnamed protein product                                   355     1e-117
Q38BI3_TRYB2  unnamed protein product                                 33.9    0.36  


>Q3ZAN1_DROME unnamed protein product
Length=455

 Score = 722 bits (1863),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/446 (79%), Positives = 405/446 (91%), Gaps = 0/446 (0%)

Query  1    MAFFEDCIIVFVSQILFFTGGWLFFMKQLFKNYEIRHISVQLIFSVCFALSLTMFELIIF  60
            MAF  DC+IVFVSQ++FF GGWLFF K+LFK+YEIRHISVQLIFS  FALS+TMFELIIF
Sbjct  1    MAFLGDCVIVFVSQMIFFAGGWLFFNKELFKHYEIRHISVQLIFSSTFALSITMFELIIF  60

Query  61   EILGVLESSSRYFHWRLGLTLLLLMVIAVIPLYILYSVIHSLSFVSDKAVRILTVLCWFV  120
            EI+ VLESSSRYFHWRLGLTLLL M  AVIP+YI YSVIHS+SF SDK VRILT  CWF+
Sbjct  61   EIIDVLESSSRYFHWRLGLTLLLFMTTAVIPIYICYSVIHSISFFSDKWVRILTTFCWFI  120

Query  121  FLYGLWKIGDPFPLLSVSHGIFTIEQGVSRIGVIGVTVMAVLSGFGAVNCPYQSMTYFIK  180
            F+YGLW+IGDPFPLLS SHGIFTIEQGVSRI VIGVTVMA+LSGFGAVN PY SM+YFIK
Sbjct  121  FIYGLWRIGDPFPLLSASHGIFTIEQGVSRISVIGVTVMAILSGFGAVNYPYTSMSYFIK  180

Query  181  PVSQSDIINLERRLQLTVDMIVAKKKRIALEMHRRKKETQNKKGLWNILSSAVNRLDSSG  240
            PVS++DII  ERRL LTV+M+ AKK++IA+ ++   K   +K  +W++L+SAV R  +SG
Sbjct  181  PVSRNDIICFERRLALTVEMLSAKKRKIAMAIYNHNKLNPSKPRIWDMLASAVQRNTNSG  240

Query  241  QDIGQLRLEIYGLEELMRQLFMEINSMKNMQERQRWSQTLQGRYFNVLGHFFSIYCLYKI  300
            +DI QL+ E+YGLEEL+R +F+E++S+KNM+ERQRWSQTL+G+YFNVLGHFFS+YC+YKI
Sbjct  241  EDINQLKQEVYGLEELLRSVFLELSSLKNMEERQRWSQTLKGKYFNVLGHFFSVYCVYKI  300

Query  301  FICTVNIIFDRVGRKDPVTRGLEIAVHWCGFDIDLAFWNQHISFLLVGCIVVTSIRGLLL  360
            F+C +NIIFDRVGRKDPVTRGLEIA+HWCGF+ID AFWNQHISFLLVGCIV+TSIRGLLL
Sbjct  301  FMCCINIIFDRVGRKDPVTRGLEIAIHWCGFNIDFAFWNQHISFLLVGCIVITSIRGLLL  360

Query  361  TLTKFFYRISSSKSSNIIVLIMAQIMGMYFCSSVLLMRMNLPAEYRVIITEVLGSLHFNF  420
            TLTKFFYRISSSKSSNIIVLI+ QIMGMYFCSSVLLMRMN+PAEYRVIITEVLG+LHFNF
Sbjct  361  TLTKFFYRISSSKSSNIIVLILGQIMGMYFCSSVLLMRMNMPAEYRVIITEVLGNLHFNF  420

Query  421  YHRWFDVIFLVSALSTILVLYLSQKP  446
            YHRWFDVIFLVSAL+TI+VLYLS+KP
Sbjct  421  YHRWFDVIFLVSALTTIIVLYLSRKP  446


>GPHR_DICDI unnamed protein product
Length=547

 Score = 355 bits (910),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 208/489 (43%), Positives = 290/489 (59%), Gaps = 56/489 (11%)

Query  7    CIIVFV-SQILFFTGGWLFFMKQLFKNYEIRHISVQLIFSVCFALSLTMFELIIFEILGV  65
             I VFV S ILFF  GW +F+K LF++YE++ + VQL FS+ FALSLT+FELI FEI+  
Sbjct  56   TIAVFVLSFILFFMFGWFYFLKILFRDYEVKKVFVQLSFSITFALSLTLFELIFFEIMDF  115

Query  66   LESSSRYFHWRLGLTLLLLMVIAVIPLYILYSVIHSLSFVSDKAVRILTVLCWFVFLYGL  125
            ++   RY  W   LTL+ + +I V+P Y  Y ++ +  F S +     +++   ++L   
Sbjct  116  MDREWRYRFWEFDLTLMSINLILVLPYYQFYLLVLAYGF-SKRKTLFFSLVLLVLYLILF  174

Query  126  WKIGDPFPLLSVSHGIFTIEQGVSRIGVIGVTVMAVLSGFGAVNCPYQSMTYFIKPVSQS  185
            WKIGDPFP+L    G+ ++E G+ RIG++G TVM++LSG+GAV  PY  +TYF+KPV   
Sbjct  175  WKIGDPFPILKEYTGLVSLEMGIGRIGIVGCTVMSLLSGYGAVYVPYSYITYFLKPVKDV  234

Query  186  DIINLERRLQLTVDMIVAKKKRIAL---EMHRRKKETQNKK-------------------  223
             I  LE++    +D I  KKKR+ L   E+ RR     N                     
Sbjct  235  TITKLEKQFNHALDKIFNKKKRVVLLKRELTRRNVNNNNNNNNNYDTYNYNNNYNNNSNN  294

Query  224  --------------------------GLWNILSSAVNRLDSSGQDIGQLRLEIYGLEELM  257
                                       LWN+     ++L     DI QL  EI  LE+L 
Sbjct  295  NNNNNNSNNNNNNNLPIIGPIFSKIYNLWNV--GYHHQLSRPIDDIKQLEREIKQLEDLN  352

Query  258  RQLFMEINSMKNMQERQRWSQTLQGRYFNVLGHFFSIYCLYKIFICTVNIIFDRVGRKDP  317
            R LF +I+ +K  + R ++S TL+G+++N LG+FFSIY   K     +NI+FDR G  DP
Sbjct  353  RDLFTQIHELKLERLRIQFSTTLRGKFYNWLGYFFSIYWKKK---SALNIVFDRRGGMDP  409

Query  318  VTRGLEIAVHWCGFDIDLAFWNQHISFLLVGCIVVTSIRGLLLTLTKFFYRISSSKSSNI  377
            VTRGL+IA+ +  F +D+ FW+QHISF+LVG +  +SIRG L  + K F+  SSS SSN 
Sbjct  410  VTRGLDIALRYFHFQVDVTFWSQHISFILVGLMTASSIRGFLNQILKVFHEYSSSLSSNN  469

Query  378  IVLIMAQIMGMYFCSSVLLMRMNLPAEY-RVIITEVLGSLHFNFYHRWFDVIFLVSALST  436
            IVLI+AQ+MGMYF SSVL+MR ++P  Y R I+T++LG + F+FYHRWFD IF+ SA+ T
Sbjct  470  IVLILAQVMGMYFISSVLMMRTSMPEIYTRFIVTQILGDIEFSFYHRWFDFIFIPSAIIT  529

Query  437  ILVLYLSQK  445
             L L    K
Sbjct  530  TLALIFMSK  538


>Q38BI3_TRYB2 unnamed protein product
Length=2539

 Score = 33.9 bits (76),  Expect = 0.36, Method: Composition-based stats.
 Identities = 29/101 (29%), Positives = 50/101 (50%), Gaps = 12/101 (12%)

Query  184  QSDIINLERRLQLTVDMIVAKKKRIALEMHRRKKET--QNKKGLWNILSSAVNRLDSSGQ  241
            ++ ++    +LQL    +VAK KR+ +E H   KE   + ++   + L    + L    Q
Sbjct  187  KASVVQENAKLQLEYKHLVAKHKRV-IEKHNSVKEMLRETRRSEVDRLQDDESELKRLRQ  245

Query  242  DIGQLRLEIYGL-------EELMRQLFMEINSMKNMQERQR  275
             + +L+LE + L       EEL  Q  ME  ++K+M E Q+
Sbjct  246  KVRELQLENHNLIQLRNRAEELCEQREME--ALKDMTELQK  284



Lambda      K        H
   0.321    0.137    0.430 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1183107040


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jan 6, 2022  5:17 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_014085207.1 PREDICTED: lysozyme 1-like [Bactrocera oleae]

Length=200
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

LYSE_DROME  unnamed protein product                                   135     6e-41
LYSD_DROME  unnamed protein product                                   133     5e-40
Q95V68_ORNMO  unnamed protein product                                 101     2e-27


>LYSE_DROME unnamed protein product
Length=140

 Score = 135 bits (341),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 91/137 (66%), Gaps = 3/137 (2%)

Query  49   LLLMHAPAPTQTRRLQRCELAGQLYILDVPKSELSLWLCIAHYESRYNTHVVGNRNADGS  108
            L+ +   AP   R L RC LA ++  L VP+ +L+ W CIA +ES Y T VVG  N +GS
Sbjct  7    LVALAMAAPALGRTLDRCSLAREMSNLGVPRDQLARWACIAEHESSYRTGVVGPENYNGS  66

Query  109  SDYGLFQISSRYWCQPDNGTKYYAFNECNVKCSALLLDDITEAVACARTIQRRQGWSAWS  168
            +DYG+FQI++ YWC P +G   +++NEC + C+ALL DDIT +V CA+ +  +QGWSAWS
Sbjct  67   NDYGIFQINNYYWCAPPSGR--FSYNECGLSCNALLTDDITHSVRCAQKVLSQQGWSAWS  124

Query  169  VYSVYCNRTLNEVDACF  185
             +  YC+  L  +D CF
Sbjct  125  TWH-YCSGWLPSIDGCF  140


>LYSD_DROME unnamed protein product
Length=140

 Score = 133 bits (335),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 90/137 (66%), Gaps = 3/137 (2%)

Query  49   LLLMHAPAPTQTRRLQRCELAGQLYILDVPKSELSLWLCIAHYESRYNTHVVGNRNADGS  108
            L+ +   AP   R + RC LA ++  L VP+ +L+ W CIA +ES Y T VVG  N +GS
Sbjct  7    LVALACAAPAFGRTMDRCSLAREMSNLGVPRDQLARWACIAEHESSYRTGVVGPENYNGS  66

Query  109  SDYGLFQISSRYWCQPDNGTKYYAFNECNVKCSALLLDDITEAVACARTIQRRQGWSAWS  168
            +DYG+FQI+  YWC P +G   +++NEC + C+ALL DDIT +V CA+ +  +QGWSAWS
Sbjct  67   NDYGIFQINDYYWCAPPSGR--FSYNECGLSCNALLTDDITHSVRCAQKVLSQQGWSAWS  124

Query  169  VYSVYCNRTLNEVDACF  185
             +  YC+  L  +D CF
Sbjct  125  TWH-YCSGWLPSIDDCF  140


>Q95V68_ORNMO unnamed protein product
Length=146

 Score = 101 bits (251),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 71/118 (60%), Gaps = 6/118 (5%)

Query  58   TQTRRLQRCELAGQL-YILDVPKSELSLWLCIAHYESRYNTHVVGNRNADGSSDYGLFQI  116
             + +   RC LA +L +  ++PK +++ W+CIA +ES +NT  +G  N+DGS D+GLFQI
Sbjct  20   VEGKVYDRCSLASELRWKYNLPKDQIADWVCIAEHESSFNTAALGRPNSDGSQDHGLFQI  79

Query  117  SSRYWCQPDNGTKYYAFNECNVKCSALLLDDITEAVACARTIQRRQGWSAWSVYSVYC  174
            + RYWC P         N+C V C+AL  D+I + V C R I  R G+SAW  +   C
Sbjct  80   NDRYWCSPPG-----PHNDCGVSCAALRDDNIDDDVKCIRKIYARHGFSAWVAWKNNC  132



Lambda      K        H
   0.322    0.131    0.423 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1518059526


Query= XP_014085208.1 PREDICTED: CCAAT/enhancer-binding protein [Bactrocera
oleae]

Length=457
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CEBP_DROME  unnamed protein product                                   493     3e-173
BZPN_DICDI  unnamed protein product                                   38.1    0.018 
Q8IQ98_DROME  unnamed protein product                                 35.8    0.084 


>CEBP_DROME unnamed protein product
Length=449

 Score = 493 bits (1270),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 317/502 (63%), Positives = 340/502 (68%), Gaps = 98/502 (20%)

Query  1    MLNMESPQMY-DTVQTLSQLDLKKQPPPQQAIIGQITLTAMSSGQQQQNNNNANNINSNN  59
            MLNMESPQMY D VQTL+QLDLKK+PP QQA IGQITLTAMS+ QQQQ            
Sbjct  1    MLNMESPQMYADAVQTLAQLDLKKEPPLQQATIGQITLTAMSTAQQQQQQQQQQQQQQQQ  60

Query  60   PNSNLNNSNG---TDANNNNSNNVGNLAAAAAVAAQQQQNAGLVVKQHAVHQMQHAAAAL  116
                         TDANNN S                 Q+A L+VKQHA+HQMQ  AA  
Sbjct  61   QQQQQQQQPQQQTTDANNNTS-----------------QDAALLVKQHAMHQMQQVAALG  103

Query  117  NNNNNASAINANVNNVNNLLQKQMLQQY-TQSDLDELTAQEITLDLQHLIDDQFREQEGL  175
            +NNN              LLQKQMLQQY TQ+DLDELT QEITLDLQHLIDDQFR+ E L
Sbjct  104  SNNN--------------LLQKQMLQQYSTQTDLDELTTQEITLDLQHLIDDQFRDTETL  149

Query  176  GIFSDMVTSPGGLSATLPPNGMVSAAAKVLQQHQLQQQTLRTQQHNYGRS-------ALA  228
            GIFSDMVTSPGGLSATLPP+GMVSAAAKVLQQ     QTLR Q    GR        ALA
Sbjct  150  GIFSDMVTSPGGLSATLPPSGMVSAAAKVLQQ-----QTLRNQHGYGGRGGGGGAGGALA  204

Query  229  YMPQAVHSGAAYSNNSSDENSSVGSDSSTIKEEPIDPEYRRHLQETNANNAAAAAFITNS  288
            YMPQ VH  A Y NNSSDENSSVGSDSSTIKEEPIDPEYRRHLQE  +  AA   F+ N 
Sbjct  205  YMPQPVH--ATY-NNSSDENSSVGSDSSTIKEEPIDPEYRRHLQEAASQQAA---FMGN-  257

Query  289  GANGLYNPY------------------QTASNNGQVGNNGGMSNGVGGAAPNFTNLTSAN  330
            GA GLYN Y                   T S+NG  G+ G  SNG       FTNLT+AN
Sbjct  258  GA-GLYNGYGSGANGLTGGGNPLNGGNTTPSSNGSNGSTGS-SNG-----SQFTNLTTAN  310

Query  331  VLAHHSVNLPHLAA--GAH-LLKHHNKQLH------------HQRKSSLKHVDKGSEEYR  375
            VLAHH  NLPHLAA  GAH LLK H+K LH              RK S KHVDKG++EYR
Sbjct  311  VLAHH--NLPHLAAAAGAHNLLKQHSK-LHAQQQHQQHQQQQQHRKHSNKHVDKGTDEYR  367

Query  376  RRRERNNIAVRKSREKAKVRSREVEERVKTLLKEKEALLRQLQEMTNEIQLHKQIYMQLM  435
            RRRERNNIAVRKSREKAKVRSREVEERVK+LLKEK+AL+RQL EMTNE+QLHKQIYMQLM
Sbjct  368  RRRERNNIAVRKSREKAKVRSREVEERVKSLLKEKDALIRQLGEMTNELQLHKQIYMQLM  427

Query  436  NHANPEVSRVCRSFLNTNDHGL  457
            NHANPEVSRVCRSFLNTN+H L
Sbjct  428  NHANPEVSRVCRSFLNTNEHSL  449


>BZPN_DICDI unnamed protein product
Length=999

 Score = 38.1 bits (87),  Expect = 0.018, Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 37/64 (58%), Gaps = 2/64 (3%)

Query  356  LHHQRKSSLKHVDKGSEEYRRRRERNNIAVRKSREKAKVRSREVEERVKTLLKEKEALLR  415
            L H  + +L H+ +  ++  RRR   N+A R  R++ K    EVE+R+  +++E E L +
Sbjct  588  LPHDFEETLAHLSE--KQKTRRRASQNLASRNYRQRKKQYVNEVEDRLDDIVQENERLKK  645

Query  416  QLQE  419
            +L +
Sbjct  646  ELYD  649


>Q8IQ98_DROME unnamed protein product
Length=570

 Score = 35.8 bits (81),  Expect = 0.084, Method: Compositional matrix adjust.
 Identities = 15/52 (29%), Positives = 32/52 (62%), Gaps = 0/52 (0%)

Query  372  EEYRRRRERNNIAVRKSREKAKVRSREVEERVKTLLKEKEALLRQLQEMTNE  423
            ++Y  RR +NNIA ++SR+  + +  ++  R + L KE   L ++++++  E
Sbjct  505  DKYWARRRKNNIAAKRSRDARRQKENQIAMRARYLEKENATLHQEVEQLKQE  556



Lambda      K        H
   0.322    0.131    0.423 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1518059526


Query= XP_014085209.1 PREDICTED: probable cytochrome P450 6g2, partial
[Bactrocera oleae]

Length=373
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CP6G2_DROME  unnamed protein product                                  335     1e-111
CP6G1_DROME  unnamed protein product                                  306     5e-100
CP6W1_DROME  unnamed protein product                                  265     4e-84 


>CP6G2_DROME unnamed protein product
Length=519

 Score = 335 bits (860),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 170/354 (48%), Positives = 231/354 (65%), Gaps = 5/354 (1%)

Query  21   ILATLAFICFALYIWLQYQYSYWRRHRMPYIEPTMIFGNLKGIINSDADPCAWFQHLYNH  80
            ++A+L  I F   + LQ  YSYWRR  +  I P  I GNL G++N    P  +   LYNH
Sbjct  8    LVASLIGIAF---LALQQHYSYWRRMGVREIRPKWIVGNLMGLLNMRMSPAEFISQLYNH  64

Query  81   EKAKNHAAVGIYVFNKPSLLIRDVELIKTILVKDFNYFSDRNSGSDPHYDSLGSNNLSFA  140
              A+N   VGI+VF+KP+LL+RD E+++ ILVKDF  FS+R S SDP  D LGS N+ F 
Sbjct  65   PDAENEPFVGIHVFHKPALLLRDPEMVRNILVKDFAGFSNRYSSSDPKGDPLGSQNIFFL  124

Query  141  KNPRWKEIRVKLTPVFSSGKIKQMFPLVAEIAREYDKYLCALKM-DAKTNSTILEVTEPN  199
            KNP WKE+R+KL+P F+  ++KQMFPL+ E+    D +L    + + +     LE  E  
Sbjct  125  KNPAWKEVRLKLSPFFTGNRLKQMFPLIEEVGASLDAHLRQQPLHNERMRCFDLEAKELC  184

Query  200  ALYTTDVIAITAYGIQANSLNEPNGSFRRNGKKIFHFTKFRSLEVKILFFLPILVKIFRL  259
            ALYTTDVIA  AYG+ ANS  +P   FRR+G+ +F F   R+ E  ++FFLP LV   R 
Sbjct  185  ALYTTDVIATVAYGVSANSFTDPKCEFRRHGRSVFEFNLLRAAEFTLVFFLPHLVPFVRF  244

Query  260  KLFSKEASIFLRETVNHVMEERIKRGNVRNDLIDILIKFKQEAEEELKEG-KKSFFLEKD  318
            K+   EA+ FLR+T+N+VM ER K G  RNDLIDILI+F++  +     G K  F  E D
Sbjct  245  KVVPAEATRFLRKTINYVMSEREKSGQKRNDLIDILIEFRRSTQLAKASGIKDQFVFEGD  304

Query  319  ALAAQAAIFFSAGFETSSTTMSFFMFEMAHNPDVQRRLREELYEAYKNNDGKIT  372
             L AQA +FF+AGFE+SS+TM+F M+E+A + DVQ+RLREE+ +A   + G++T
Sbjct  305  ILVAQAVLFFTAGFESSSSTMAFAMYELAKDTDVQQRLREEIKDALVESGGQVT  358


>CP6G1_DROME unnamed protein product
Length=524

 Score = 306 bits (783),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 168/358 (47%), Positives = 233/358 (65%), Gaps = 7/358 (2%)

Query  18   LTEILATLAFICFALYIWLQYQYSYWRRHRMPYIEPTMIFGNLKGIINSDADPCAWFQHL  77
            LTE+L  +     ALY W Q  +SYW+R  +PYI PT I GN K +   +         +
Sbjct  3    LTEVLFVVVAALVALYTWFQRNHSYWQRKGIPYIPPTPIIGNTKVVFKMENSFGMHLSEI  62

Query  78   YNHEKAKNHAAVGIYVFNKPSLLIRDVELIKTILVKDFNYFSDRNSGSDPHYDSLGSNNL  137
            YN  + K+ A VGIY  NKP L+IRD+ELIK+IL+KDFN F +R +  DPH D LG NNL
Sbjct  63   YNDPRLKDEAVVGIYSMNKPGLIIRDIELIKSILIKDFNRFHNRYARCDPHGDPLGYNNL  122

Query  138  SFAKNPRWKEIRVKLTPVFSSGKIKQMFPLVAEIAREYDKYLCALKMDAKTNST--ILEV  195
             F ++  WK IR KLTPVF+SGK+KQM+ L+ EI ++ +    AL+   + NS   I E+
Sbjct  123  FFVRDAHWKGIRTKLTPVFTSGKVKQMYTLMQEIGKDLE---LALQRRGEKNSGSFITEI  179

Query  196  TEPNALYTTDVIAITAYGIQANSLNEPNGSFRRNGKKIFHFTKFRSLEVKILFFLPILVK  255
             E  A ++TD IA  A+GI+ANSL  PN  FR  G+K+F FT  R+ +  + FFLP LV 
Sbjct  180  KEICAQFSTDSIATIAFGIRANSLENPNAEFRNYGRKMFTFTVARAKDFFVAFFLPKLVS  239

Query  256  IFRLKLFSKEASIFLRETVNHVMEERIKRGNVRNDLIDILIKFKQEAEEELKEGKKSFFL  315
            + R++ F+ + S F+R T+ HVMEER + G +RNDLID+L+  ++EA  E    K  +  
Sbjct  240  LMRIQFFTADFSHFMRSTIGHVMEERERSGLLRNDLIDVLVSLRKEAAAE--PSKPHYAK  297

Query  316  EKDALAAQAAIFFSAGFETSSTTMSFFMFEMAHNPDVQRRLREELYEAYKNNDGKITY  373
             +D L AQA +FF+AGFETSS+TMSF ++EMA +P++Q+RLR+E+ EA     G ++Y
Sbjct  298  NQDFLVAQAGVFFTAGFETSSSTMSFALYEMAKHPEMQKRLRDEINEALVEGGGSLSY  355


>CP6W1_DROME unnamed protein product
Length=514

 Score = 265 bits (676),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 133/341 (39%), Positives = 216/341 (63%), Gaps = 7/341 (2%)

Query  28   ICFALYIWLQYQYSYWRRHRMPYIEPTMIFGNLKGIINSDADPCAWFQHLYNHEKAKNHA  87
            +    YIW +   S+W RH + YI P  + G  +  + +        Q  +     +N  
Sbjct  10   LTIVFYIWQRRTLSFWERHGVKYIRPFPVVGCTREFLTAKVPFFEQIQKFHEAPGFENEP  69

Query  88   AVGIYVFNKPSLLIRDVELIKTILVKDFNYFSDRNSGSDPHYDSLGSNNLSFAKNPRWKE  147
             VG+Y+ ++P+L+IRD+ELIKT+++K F YF++R   +DPH D+LG  NL FA++P W+E
Sbjct  70   FVGVYMTHRPALVIRDLELIKTVMIKKFQYFNNRVLQTDPHNDALGYKNLFFARSPGWRE  129

Query  148  IRVKLTPVFSSGKIKQMFPLVAEIAREYDKYLCALKMDAKTNSTILEVTEPNALYTTDVI  207
            +R K++PVF+SGKIKQM+PL+ +I +       A ++ + T    ++V +  + +TTD+I
Sbjct  130  LRTKISPVFTSGKIKQMYPLMVKIGKNLQD--SAERLGSGTE---VQVKDLCSRFTTDLI  184

Query  208  AITAYGIQANSLNEPNGSFRRNGKKIFHFTKFRSLEVKILFFLPILVKIFRLKLFSKEAS  267
            A  A+G++AN+L +    F  + + IF  T  R ++  I+F +P L  + R+KLFS+E +
Sbjct  185  ATIAFGVEANALQDAKSEFFYHNRAIFSLTLSRGIDFAIIFMIPALASLARVKLFSRETT  244

Query  268  IFLRETVNHVMEERIKRGNVRNDLIDILIKFKQEAEEELKEGKKSFFLEKDALAAQAAIF  327
             F+R +VN+V++ER + G  RNDLIDIL+  K+EA      GK S  ++ D L AQAA+F
Sbjct  245  KFIRSSVNYVLKERERTGEKRNDLIDILLALKREAAA--NPGKMSKEVDLDYLVAQAAVF  302

Query  328  FSAGFETSSTTMSFFMFEMAHNPDVQRRLREELYEAYKNND  368
             +AGFETS++TM+  ++E+A N  +Q RLR+E+ + + + D
Sbjct  303  QTAGFETSASTMTMTLYELAKNEALQDRLRQEIVDFFGDED  343



Lambda      K        H
   0.322    0.131    0.423 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1518059526


Query= XP_014085210.1 PREDICTED: protein EFR3 homolog B-like [Bactrocera
oleae]

Length=81
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

EFR3_DROME  unnamed protein product                                   39.3    9e-05
B2ZWB7_TRYB2  unnamed protein product                                 29.3    0.30 
O02360_CAEEL  unnamed protein product                                 26.9    2.1  


>EFR3_DROME unnamed protein product
Length=834

 Score = 39.3 bits (90),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 18/53 (34%), Positives = 30/53 (57%), Gaps = 0/53 (0%)

Query  5   FKARHKRLVSQIYPKNPYEGLRRGNLKKMLLYAHMDTKNYNQVLLYLTIKLKK  57
            + R+KRLV  I+P NP +GL + N++K+  Y+       +++  YL  K  K
Sbjct  37  LRPRYKRLVDNIFPVNPEDGLVKSNMEKLTFYSLSSPDKLDRIGEYLYQKATK  89


>B2ZWB7_TRYB2 unnamed protein product
Length=829

 Score = 29.3 bits (64),  Expect = 0.30, Method: Composition-based stats.
 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 0/48 (0%)

Query  22   YEGLRRGNLKKMLLYAHMDTKNYNQVLLYLTIKLKKYAIIDEEAYINL  69
            YEGLR   L + LL   ++T N   V + + +K  +  I+D E   N+
Sbjct  74   YEGLRDMTLHEFLLNKFLNTYNTRNVAMDVFVKNPRRYIVDAEVLENI  121


>O02360_CAEEL unnamed protein product
Length=739

 Score = 26.9 bits (58),  Expect = 2.1, Method: Composition-based stats.
 Identities = 12/29 (41%), Positives = 17/29 (59%), Gaps = 1/29 (3%)

Query  21   PYEGLRR-GNLKKMLLYAHMDTKNYNQVL  48
            PYE + + GNL     Y ++D  NY QV+
Sbjct  110  PYEVISKTGNLTFFATYTYIDMTNYQQVI  138



Lambda      K        H
   0.322    0.131    0.423 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1518059526


Query= XP_014085211.1 PREDICTED: protein argonaute-2 isoform X1 [Bactrocera
oleae]

Length=982
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q32KD4_DROME  unnamed protein product                                 1904    0.0  
Q7KY08_DROME  unnamed protein product                                 1850    0.0  
S4W2D1_LOCMI  unnamed protein product                                 1730    0.0  


>Q32KD4_DROME unnamed protein product
Length=984

 Score = 1904 bits (4932),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 927/988 (94%), Positives = 945/988 (96%), Gaps = 10/988 (1%)

Query  1    MSTERELAPGGPAQLH--TLPVAFSDLGTTLQLNTAVRIIGKVYESQWTPSPPRPQSPTQ  58
            MSTERELAPGGPAQLH  TLP+ F DL    Q+ + V IIGKVYESQWTPSP RPQSP+Q
Sbjct  1    MSTERELAPGGPAQLHPHTLPLTFPDL----QMTSTVGIIGKVYESQWTPSPTRPQSPSQ  56

Query  59   SQTSFENLTSPPATGSSVNPTAVTSPSAQNVAVGGATVGGAGAAGLATQ---ASAVASPL  115
            +QTSF+ LTSPPA GSSVNPTAVTSPSAQNVA GGATV GA A          +   S  
Sbjct  57   AQTSFDTLTSPPAPGSSVNPTAVTSPSAQNVAAGGATVAGAAATAAQVASALGATTGSVT  116

Query  116  GATAAASPTTQPELPVFTCPRRPNLGREGRPIVLRANHFQVSMPRGYVHHYDINIQPDKC  175
             A A A+P TQP++PVFTCPRRPNLGREGRPIVLRANHFQV+MPRGYVHHYDINIQPDKC
Sbjct  117  PAIATATPATQPDMPVFTCPRRPNLGREGRPIVLRANHFQVTMPRGYVHHYDINIQPDKC  176

Query  176  PRKVNREIIETMVHAYSKIFGVLKPVFDGRNNLYTRDPLPIGNDRLELEVTLPGEGKDRI  235
            PRKVNREIIETMVHAYSKIFGVLKPVFDGRNNLYTRDPLPIGN+RLELEVTLPGEGKDRI
Sbjct  177  PRKVNREIIETMVHAYSKIFGVLKPVFDGRNNLYTRDPLPIGNERLELEVTLPGEGKDRI  236

Query  236  FRVTIKWMAQVSLFNLEEALEGRTRQIPYDAILALDVVMRHLPSMTYTPVGRSFFSSPDG  295
            FRVTIKW AQVSLFNLEEALEGRTRQIPYDAILALDVVMRHLPSMTYTPVGRSFFSSP+G
Sbjct  237  FRVTIKWQAQVSLFNLEEALEGRTRQIPYDAILALDVVMRHLPSMTYTPVGRSFFSSPEG  296

Query  296  YYHPLGGGREVWFGFHQSVRPSQWKMMLNIDVSATAFYKAQPVIDFMCEVLDIRDINEQR  355
            YYHPLGGGREVWFGFHQSVRPSQWKMMLNIDVSATAFYKAQPVIDFMCEVLDIRDINEQR
Sbjct  297  YYHPLGGGREVWFGFHQSVRPSQWKMMLNIDVSATAFYKAQPVIDFMCEVLDIRDINEQR  356

Query  356  KPLTDSQRVKFTKEIKGLKIEITHCGAMRRKYRVCNVTRRPAQMQSFPLQLENGQTVECT  415
            KPLTDSQRVKFTKEIKGLKIEITHCG MRRKYRVCNVTRRPAQMQSFPLQLENGQTVECT
Sbjct  357  KPLTDSQRVKFTKEIKGLKIEITHCGQMRRKYRVCNVTRRPAQMQSFPLQLENGQTVECT  416

Query  416  VAKYFLDKYRMKLRYPHLPCLQVGQEHKHTYLPLEVCNIVAGQRCIKKLTDMQTSTMIKA  475
            VAKYFLDKYRMKLRYPHLPCLQVGQEHKHTYLPLEVCNIVAGQRCIKKLTDMQTSTMIKA
Sbjct  417  VAKYFLDKYRMKLRYPHLPCLQVGQEHKHTYLPLEVCNIVAGQRCIKKLTDMQTSTMIKA  476

Query  476  TARSAPDREREINNLVKRADFNNDSYVQEFGLTISNSMMEVRGRVLPPPKLQYGGRVSS-  534
            TARSAPDREREINNLVKRADFNNDSYVQEFGLTISNSMMEVRGRVLPPPKLQYGGRVS+ 
Sbjct  477  TARSAPDREREINNLVKRADFNNDSYVQEFGLTISNSMMEVRGRVLPPPKLQYGGRVSTG  536

Query  535  MTGQQLFPPQNKVSLASPNQGVWDMRGKQFFTGVEIRVWAIACFAPQRTVREDALRNFTQ  594
            +TGQQLFPPQNKVSLASPNQGVWDMRGKQFFTGVEIR+WAIACFAPQRTVREDALRNFTQ
Sbjct  537  LTGQQLFPPQNKVSLASPNQGVWDMRGKQFFTGVEIRIWAIACFAPQRTVREDALRNFTQ  596

Query  595  QLQKISNDAGMPIIGQPCFCKYATGPDQVEPMFRYLKNSFNALQLVVVVLPGKTPVYAEV  654
            QLQKISNDAGMPIIGQPCFCKYATGPDQVEPMFRYLK +F  LQLVVVVLPGKTPVYAEV
Sbjct  597  QLQKISNDAGMPIIGQPCFCKYATGPDQVEPMFRYLKITFPGLQLVVVVLPGKTPVYAEV  656

Query  655  KRVGDTVLGMATQCVQAKNVNKTSPQTLSNLCLKINVKLGGINSILVPSIRPKVFNEPVI  714
            KRVGDTVLGMATQCVQAKNVNKTSPQTLSNLCLKINVKLGGINSILVPSIRPKVFNEPVI
Sbjct  657  KRVGDTVLGMATQCVQAKNVNKTSPQTLSNLCLKINVKLGGINSILVPSIRPKVFNEPVI  716

Query  715  FLGADVTHPPAGDNKKPSIAAVVGSMDAHPSRYAATVRVQQHRQEIIQELSSMVRELLIM  774
            FLGADVTHPPAGDNKKPSIAAVVGSMDAHPSRYAATVRVQQHRQEIIQELSSMVRELLIM
Sbjct  717  FLGADVTHPPAGDNKKPSIAAVVGSMDAHPSRYAATVRVQQHRQEIIQELSSMVRELLIM  776

Query  775  FYKSTGGYKPHRIILYRDGVSEGQFPHVLQHELTAIREACIKLEADYRPGITFIVVQKRH  834
            FYKSTGGYKPHRIILYRDGVSEGQFPHVLQHELTAIREACIKLE +YRPGITFIVVQKRH
Sbjct  777  FYKSTGGYKPHRIILYRDGVSEGQFPHVLQHELTAIREACIKLEPEYRPGITFIVVQKRH  836

Query  835  HTRLFCAEKKEQSGKSGNIPAGTTVDVGITHPTEFDFYLCSHQGIQGTSRPSHYHVLWDD  894
            HTRLFCAEKKEQSGKSGNIPAGTTVDVGITHPTEFDFYLCSHQGIQGTSRPSHYHVLWDD
Sbjct  837  HTRLFCAEKKEQSGKSGNIPAGTTVDVGITHPTEFDFYLCSHQGIQGTSRPSHYHVLWDD  896

Query  895  NHFDSDELQCLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVEKEHDSGEGSHQS  954
            NHFDSDELQCLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVEKEHDSGEGSHQS
Sbjct  897  NHFDSDELQCLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVEKEHDSGEGSHQS  956

Query  955  GCSEDRTPGAMARAITVHADTKKVMYFA  982
            GCSEDRTPGAMARAITVHADTKKVMYFA
Sbjct  957  GCSEDRTPGAMARAITVHADTKKVMYFA  984


>Q7KY08_DROME unnamed protein product
Length=950

 Score = 1850 bits (4792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 896/944 (95%), Positives = 912/944 (97%), Gaps = 4/944 (0%)

Query  43   ESQWTPSPPRPQSPTQSQTSFENLTSPPATGSSVNPTAVTSPSAQNVAVGGATVGGAGAA  102
            +SQWTPSP RPQSP+Q+QTSF+ LTSPPA GSSVNPTAVTSPSAQNVA GGATV GA A 
Sbjct  7    QSQWTPSPTRPQSPSQAQTSFDTLTSPPAPGSSVNPTAVTSPSAQNVAAGGATVAGAAAT  66

Query  103  GLATQ---ASAVASPLGATAAASPTTQPELPVFTCPRRPNLGREGRPIVLRANHFQVSMP  159
                     +   S   A A A+P TQP++PVFTCPRRPNLGREGRPIVLRANHFQV+MP
Sbjct  67   AAQVASALGATTGSVTPAIATATPATQPDMPVFTCPRRPNLGREGRPIVLRANHFQVTMP  126

Query  160  RGYVHHYDINIQPDKCPRKVNREIIETMVHAYSKIFGVLKPVFDGRNNLYTRDPLPIGND  219
            RGYVHHYDINIQPDKCPRKVNREIIETMVHAYSKIFGVLKPVFDGRNNLYTRDPLPIGN+
Sbjct  127  RGYVHHYDINIQPDKCPRKVNREIIETMVHAYSKIFGVLKPVFDGRNNLYTRDPLPIGNE  186

Query  220  RLELEVTLPGEGKDRIFRVTIKWMAQVSLFNLEEALEGRTRQIPYDAILALDVVMRHLPS  279
            RLELEVTLPGEGKDRIFRVTIKW AQVSLFNLEEALEGRTRQIPYDAILALDVVMRHLPS
Sbjct  187  RLELEVTLPGEGKDRIFRVTIKWQAQVSLFNLEEALEGRTRQIPYDAILALDVVMRHLPS  246

Query  280  MTYTPVGRSFFSSPDGYYHPLGGGREVWFGFHQSVRPSQWKMMLNIDVSATAFYKAQPVI  339
            MTYTPVGRSFFSSP+GYYHPLGGGREVWFGFHQSVRPSQWKMMLNIDVSATAFYKAQPVI
Sbjct  247  MTYTPVGRSFFSSPEGYYHPLGGGREVWFGFHQSVRPSQWKMMLNIDVSATAFYKAQPVI  306

Query  340  DFMCEVLDIRDINEQRKPLTDSQRVKFTKEIKGLKIEITHCGAMRRKYRVCNVTRRPAQM  399
            DFMCEVLDIRDINEQRKPLTDSQRVKFTKEIKGLKIEITHCG MRRKYRVCNVTRRPAQM
Sbjct  307  DFMCEVLDIRDINEQRKPLTDSQRVKFTKEIKGLKIEITHCGQMRRKYRVCNVTRRPAQM  366

Query  400  QSFPLQLENGQTVECTVAKYFLDKYRMKLRYPHLPCLQVGQEHKHTYLPLEVCNIVAGQR  459
            QSFPLQLENGQTVECTVAKYFLDKYRMKLRYPHLPCLQVGQEHKHTYLPLEVCNIVAGQR
Sbjct  367  QSFPLQLENGQTVECTVAKYFLDKYRMKLRYPHLPCLQVGQEHKHTYLPLEVCNIVAGQR  426

Query  460  CIKKLTDMQTSTMIKATARSAPDREREINNLVKRADFNNDSYVQEFGLTISNSMMEVRGR  519
            CIKKLTDMQTSTMIKATARSAPDREREINNLVKRADFNNDSYVQEFGLTISNSMMEVRGR
Sbjct  427  CIKKLTDMQTSTMIKATARSAPDREREINNLVKRADFNNDSYVQEFGLTISNSMMEVRGR  486

Query  520  VLPPPKLQYGGRVSS-MTGQQLFPPQNKVSLASPNQGVWDMRGKQFFTGVEIRVWAIACF  578
            VLPPPKLQYGGRVS+ +TGQQLFPPQNKVSLASPNQGVWDMRGKQFFTGVEIR+WAIACF
Sbjct  487  VLPPPKLQYGGRVSTGLTGQQLFPPQNKVSLASPNQGVWDMRGKQFFTGVEIRIWAIACF  546

Query  579  APQRTVREDALRNFTQQLQKISNDAGMPIIGQPCFCKYATGPDQVEPMFRYLKNSFNALQ  638
            APQRTVREDALRNFTQQLQKISNDAGMPIIGQPCFCKYATGPDQVEPMFRYLK +F  LQ
Sbjct  547  APQRTVREDALRNFTQQLQKISNDAGMPIIGQPCFCKYATGPDQVEPMFRYLKITFPGLQ  606

Query  639  LVVVVLPGKTPVYAEVKRVGDTVLGMATQCVQAKNVNKTSPQTLSNLCLKINVKLGGINS  698
            LVVVVLPGKTPVYAEVKRVGDTVLGMATQCVQAKNVNKTSPQTLSNLCLKINVKLGGINS
Sbjct  607  LVVVVLPGKTPVYAEVKRVGDTVLGMATQCVQAKNVNKTSPQTLSNLCLKINVKLGGINS  666

Query  699  ILVPSIRPKVFNEPVIFLGADVTHPPAGDNKKPSIAAVVGSMDAHPSRYAATVRVQQHRQ  758
            ILVPSIRPKVFNEPVIFLGADVTHPPAGDNKKPSIAAVVGSMDAHPSRYAATVRVQQHRQ
Sbjct  667  ILVPSIRPKVFNEPVIFLGADVTHPPAGDNKKPSIAAVVGSMDAHPSRYAATVRVQQHRQ  726

Query  759  EIIQELSSMVRELLIMFYKSTGGYKPHRIILYRDGVSEGQFPHVLQHELTAIREACIKLE  818
            EIIQELSSMVRELLIMFYKSTGGYKPHRIILYRDGVSEGQFPHVLQHELTAIREACIKLE
Sbjct  727  EIIQELSSMVRELLIMFYKSTGGYKPHRIILYRDGVSEGQFPHVLQHELTAIREACIKLE  786

Query  819  ADYRPGITFIVVQKRHHTRLFCAEKKEQSGKSGNIPAGTTVDVGITHPTEFDFYLCSHQG  878
             +YRPGITFIVVQKRHHTRLFCAEKKEQSGKSGNIPAGTTVDVGITHPTEFDFYLCSHQG
Sbjct  787  PEYRPGITFIVVQKRHHTRLFCAEKKEQSGKSGNIPAGTTVDVGITHPTEFDFYLCSHQG  846

Query  879  IQGTSRPSHYHVLWDDNHFDSDELQCLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARY  938
            IQGTSRPSHYHVLWDDNHFDSDELQCLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARY
Sbjct  847  IQGTSRPSHYHVLWDDNHFDSDELQCLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARY  906

Query  939  HLVEKEHDSGEGSHQSGCSEDRTPGAMARAITVHADTKKVMYFA  982
            HLVEKEHDSGEGSHQSGCSEDRTPGAMARAITVHADTKKVMYFA
Sbjct  907  HLVEKEHDSGEGSHQSGCSEDRTPGAMARAITVHADTKKVMYFA  950


>S4W2D1_LOCMI unnamed protein product
Length=848

 Score = 1730 bits (4481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 819/855 (96%), Positives = 836/855 (98%), Gaps = 7/855 (1%)

Query  128  ELPVFTCPRRPNLGREGRPIVLRANHFQVSMPRGYVHHYDINIQPDKCPRKVNREIIETM  187
            ELP+F CPRRPNLGREGRPIVLRANHFQ+SMPRG+VHHYDINIQPDKCPRKVNREIIETM
Sbjct  1    ELPMFNCPRRPNLGREGRPIVLRANHFQISMPRGFVHHYDINIQPDKCPRKVNREIIETM  60

Query  188  VHAYSKIFGVLKPVFDGRNNLYTRDPLPIGNDRLELEVTLPGEGKDRIFRVTIKWMAQVS  247
            VHAYSKIFG LKPVFDGRNNLYTRDPLPIGNDR+ELEVTLPGEGKDR+FRVTIKW+AQVS
Sbjct  61   VHAYSKIFGTLKPVFDGRNNLYTRDPLPIGNDRVELEVTLPGEGKDRVFRVTIKWIAQVS  120

Query  248  LFNLEEALEGRTRQIPYDAILALDVVMRHLPSMTYTPVGRSFFSSPDGYYHPLGGGREVW  307
            LF LEEALEGRTRQIPYDAILALDVVMRHLPSMTYTPVGRSFFSSPDGYYHPLGGGREVW
Sbjct  121  LFALEEALEGRTRQIPYDAILALDVVMRHLPSMTYTPVGRSFFSSPDGYYHPLGGGREVW  180

Query  308  FGFHQSVRPSQWKMMLNIDVSATAFYKAQPVIDFMCEVLDIRDINEQRKPLTDSQRVKFT  367
            FGFHQSVRPSQWKMMLNIDVSATAFYKAQPVI+FMCEVLDIRDINEQRKPLTDSQRVKFT
Sbjct  181  FGFHQSVRPSQWKMMLNIDVSATAFYKAQPVIEFMCEVLDIRDINEQRKPLTDSQRVKFT  240

Query  368  KEIKGLKIEITHCGAMRRKYRVCNVTRRPAQMQSFPLQLENGQTVECTVAKYFLDKYRMK  427
            KEIKGLKIEITHCG MRRKYRVCNVTRRPAQMQSFPLQLENGQTVECTVAKYFLDKY+MK
Sbjct  241  KEIKGLKIEITHCGTMRRKYRVCNVTRRPAQMQSFPLQLENGQTVECTVAKYFLDKYKMK  300

Query  428  LRYPHLPCLQVGQEHKHTYLPLEVCNIVAGQRCIKKLTDMQTSTMIKATARSAPDREREI  487
            LRYPHLPCLQVGQEHKHTYLPLEVCNIVAGQRCIKKLTDMQTSTMIKATARSAPDREREI
Sbjct  301  LRYPHLPCLQVGQEHKHTYLPLEVCNIVAGQRCIKKLTDMQTSTMIKATARSAPDREREI  360

Query  488  NNLVKRADFNNDSYVQEFGLTISNSMMEVRGRVLPPPKLQYGGRVSSMTGQQLFPPQNKV  547
            N+LV+RADFNND+YVQEFGLTISN+MMEVRGRVLPPPKLQYGGRVSS++GQ         
Sbjct  361  NSLVRRADFNNDAYVQEFGLTISNNMMEVRGRVLPPPKLQYGGRVSSLSGQ-------TK  413

Query  548  SLASPNQGVWDMRGKQFFTGVEIRVWAIACFAPQRTVREDALRNFTQQLQKISNDAGMPI  607
              A PNQGVWDMRGKQFFTGVEIRVWAIACFAPQRTVREDALRNFTQQLQKISNDAGMPI
Sbjct  414  QQAMPNQGVWDMRGKQFFTGVEIRVWAIACFAPQRTVREDALRNFTQQLQKISNDAGMPI  473

Query  608  IGQPCFCKYATGPDQVEPMFRYLKNSFNALQLVVVVLPGKTPVYAEVKRVGDTVLGMATQ  667
            IGQPCFCKYATGPDQVEPMFRYLK+SF ALQLVVVVLPGKTPVYAEVKRVGDTVLGMATQ
Sbjct  474  IGQPCFCKYATGPDQVEPMFRYLKSSFTALQLVVVVLPGKTPVYAEVKRVGDTVLGMATQ  533

Query  668  CVQAKNVNKTSPQTLSNLCLKINVKLGGINSILVPSIRPKVFNEPVIFLGADVTHPPAGD  727
            CVQAKNVNKTSPQTLSNLCLKINVKLGGINSILVPSIRPKVFNEPVIFLGADVTHPPAGD
Sbjct  534  CVQAKNVNKTSPQTLSNLCLKINVKLGGINSILVPSIRPKVFNEPVIFLGADVTHPPAGD  593

Query  728  NKKPSIAAVVGSMDAHPSRYAATVRVQQHRQEIIQELSSMVRELLIMFYKSTGGYKPHRI  787
            NKKPSIAAVVGSMDAHPSRYAATVRVQQHRQEIIQELSSMVRELLIMFYKSTGGYKPHRI
Sbjct  594  NKKPSIAAVVGSMDAHPSRYAATVRVQQHRQEIIQELSSMVRELLIMFYKSTGGYKPHRI  653

Query  788  ILYRDGVSEGQFPHVLQHELTAIREACIKLEADYRPGITFIVVQKRHHTRLFCAEKKEQS  847
            ILYRDGVSEGQF HVLQHELTAIREACIKLE DY+PGITFIVVQKRHHTRLFCA+KKEQS
Sbjct  654  ILYRDGVSEGQFLHVLQHELTAIREACIKLEGDYKPGITFIVVQKRHHTRLFCADKKEQS  713

Query  848  GKSGNIPAGTTVDVGITHPTEFDFYLCSHQGIQGTSRPSHYHVLWDDNHFDSDELQCLTY  907
            GKSGNIPAGTTVDVGITHPTEFDFYLCSHQGIQGTSRPSHYHVLWDDNHFDSDELQCLTY
Sbjct  714  GKSGNIPAGTTVDVGITHPTEFDFYLCSHQGIQGTSRPSHYHVLWDDNHFDSDELQCLTY  773

Query  908  QLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVEKEHDSGEGSHQSGCSEDRTPGAMAR  967
            QLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVEKEHDSGEGSHQSGCSEDRTPGAMAR
Sbjct  774  QLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVEKEHDSGEGSHQSGCSEDRTPGAMAR  833

Query  968  AITVHADTKKVMYFA  982
            AITVHADTKKVMYFA
Sbjct  834  AITVHADTKKVMYFA  848



Lambda      K        H
   0.322    0.131    0.423 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1518059526


Query= XP_014085212.1 PREDICTED: E3 ubiquitin-protein ligase TRAIP
[Bactrocera oleae]

Length=430
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7K2X1_DROME  unnamed protein product                                 410     6e-141
A0A0B4KFV0_DROME  unnamed protein product                             404     1e-138
Q7K1R6_DROME  unnamed protein product                                 78.2    4e-16 


>Q7K2X1_DROME unnamed protein product
Length=435

 Score = 410 bits (1053),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 226/452 (50%), Positives = 295/452 (65%), Gaps = 39/452 (9%)

Query  1    MLNLNCVICAELFVASDDVRATNCGHMFHIACLKQWMERSKSCPQCRTKCTDRNIFRIYF  60
            MLNLNCVICAELF  +D+V AT CGHMFH  CL QW++RSK+CPQCR KCT RNIFR+YF
Sbjct  1    MLNLNCVICAELFGQADEVFATVCGHMFHHNCLNQWLDRSKTCPQCRNKCTTRNIFRVYF  60

Query  61   NLANLDLSTIDVGSLQEQVDNASLQLKMKEKELNKTQQQIKDLKECQIKAAQTIQAMEQR  120
            NLANLD+S IDVGSLQEQ+DNA L +KM EKE NK +QQI+DLKE Q K  +TI  +EQ+
Sbjct  61   NLANLDVSHIDVGSLQEQLDNAMLSMKMVEKERNKDEQQIRDLKETQKKCLKTIAGLEQK  120

Query  121  IQKNDFVILTYSEQLKIFKTEAKMAEDLRKEVERLKQQIKTIESVQSVLAATTVEAEKML  180
            +QK DF+I +Y EQ+ + K++A + + LRKE + LK QI+++E + ++LAA + +A+++L
Sbjct  121  VQKKDFLISSYVEQIGVLKSDAHVVDGLRKENKTLKSQIQSMEGISAILAAGSADADRLL  180

Query  181  KIEKDPVRLCTWVAALKRELRTCETKKTDLRRAMKVMQDNLRQEMAAKKSFEERISQLES  240
            K E DP  L  WV+ LKRELR CE+KKT+LR  +KV+Q++LR+E+  K+  EER+S LES
Sbjct  181  KNEADPHVLANWVSTLKRELRQCESKKTELRNVVKVVQNDLRKEIELKRKLEERVSHLES  240

Query  241  ENYQLQQKMKAVENKGPISFMSDQCRQSTESAPNALP----EKRQTLSPTIKENLKKIED  296
            + YQ Q+K++A ENK   +++ D    S     N L     E+R T+SPT+KEN+K+IE+
Sbjct  241  DLYQAQEKLQAFENK--TAYL-DSPNASCGLNSNILALKREERRTTISPTVKENIKRIEE  297

Query  297  SNSPYLNIKSSSIGLLPLFKRNQDNLPERTGITTTKLATLKISPKKADKDSAANSIGSSL  356
            S SPYLNIKSSS+GL  L      N     G     LA  KISP K         +  + 
Sbjct  298  STSPYLNIKSSSVGLAHLL-----NTKGNIG-----LAKSKISPIKG----VGGGVSMTS  343

Query  357  GMLRKAQSDITEKYSIMKKPR--LAISSSSTTAKHFGMNF---EPSSTRAVSPTKPR---  408
            G +RK  SD++EKYSI KKPR  L  SSSS      G NF       +  V P   R   
Sbjct  344  GTIRKTSSDLSEKYSIFKKPRLLLGSSSSSALTATTGSNFVYNGMGGSEKVDPFAQRAEE  403

Query  409  ----------PIGSNLDSRLKAGGLRKFKLNK  430
                       +  N++ RLKAG LR F L K
Sbjct  404  EGLSTIRSSTALSRNVNQRLKAGSLRNFNLGK  435


>A0A0B4KFV0_DROME unnamed protein product
Length=434

 Score = 404 bits (1037),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 225/452 (50%), Positives = 294/452 (65%), Gaps = 40/452 (9%)

Query  1    MLNLNCVICAELFVASDDVRATNCGHMFHIACLKQWMERSKSCPQCRTKCTDRNIFRIYF  60
            MLNLNCVICAELF  +D+V AT CGHMFH  CL QW++RSK+CPQCR KCT RNIFR+YF
Sbjct  1    MLNLNCVICAELFGQADEVFATVCGHMFHHNCLNQWLDRSKTCPQCRNKCTTRNIFRVYF  60

Query  61   NLANLDLSTIDVGSLQEQVDNASLQLKMKEKELNKTQQQIKDLKECQIKAAQTIQAMEQR  120
            NLANLD+S IDVGSLQEQ+DNA L +KM EKE NK +QQI+DLKE Q K  +TI  +EQ+
Sbjct  61   NLANLDVSHIDVGSLQEQLDNAMLSMKMVEKERNKDEQQIRDLKETQKKCLKTIAGLEQK  120

Query  121  IQKNDFVILTYSEQLKIFKTEAKMAEDLRKEVERLKQQIKTIESVQSVLAATTVEAEKML  180
            +QK DF+I +Y EQ+ + K++A + + LRKE + LK QI+++E + ++LAA + +A+++L
Sbjct  121  VQKKDFLISSYVEQIGVLKSDAHVVDGLRKENKTLKSQIQSMEGISAILAAGSADADRLL  180

Query  181  KIEKDPVRLCTWVAALKRELRTCETKKTDLRRAMKVMQDNLRQEMAAKKSFEERISQLES  240
            K E DP  L  WV+ LKRELR CE+KKT+LR  +KV+Q++LR+E+  K+  EER+S LES
Sbjct  181  KNEADPHVLANWVSTLKRELRQCESKKTELRNVVKVVQNDLRKEIELKRKLEERVSHLES  240

Query  241  ENYQLQQKMKAVENKGPISFMSDQCRQSTESAPNALP----EKRQTLSPTIKENLKKIED  296
            + YQ Q+K++A ENK   +++ D    S     N L     E+R T+SPT+ EN+K+IE+
Sbjct  241  DLYQAQEKLQAFENK--TAYL-DSPNASCGLNSNILALKREERRTTISPTV-ENIKRIEE  296

Query  297  SNSPYLNIKSSSIGLLPLFKRNQDNLPERTGITTTKLATLKISPKKADKDSAANSIGSSL  356
            S SPYLNIKSSS+GL  L      N     G     LA  KISP K         +  + 
Sbjct  297  STSPYLNIKSSSVGLAHLL-----NTKGNIG-----LAKSKISPIKG----VGGGVSMTS  342

Query  357  GMLRKAQSDITEKYSIMKKPR--LAISSSSTTAKHFGMNF---EPSSTRAVSPTKPR---  408
            G +RK  SD++EKYSI KKPR  L  SSSS      G NF       +  V P   R   
Sbjct  343  GTIRKTSSDLSEKYSIFKKPRLLLGSSSSSALTATTGSNFVYNGMGGSEKVDPFAQRAEE  402

Query  409  ----------PIGSNLDSRLKAGGLRKFKLNK  430
                       +  N++ RLKAG LR F L K
Sbjct  403  EGLSTIRSSTALSRNVNQRLKAGSLRNFNLGK  434


>Q7K1R6_DROME unnamed protein product
Length=263

 Score = 78.2 bits (191),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 43/63 (68%), Gaps = 1/63 (2%)

Query  2   LNLNCVICAELFVASDDVRATN-CGHMFHIACLKQWMERSKSCPQCRTKCTDRNIFRIYF  60
           LN+ C IC E F A+D + +T+ CGH+FH  CL +W+ RS++CPQCR  C  R + R+Y 
Sbjct  28  LNILCAICNEFFRANDIIFSTSRCGHVFHKDCLTRWLNRSRTCPQCRDPCDRRRVHRLYL  87

Query  61  NLA  63
           N A
Sbjct  88  NFA  90



Lambda      K        H
   0.322    0.131    0.423 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1518059526


Query= XP_014085213.1 PREDICTED: protein argonaute-2 isoform X1 [Bactrocera
oleae]

Length=982
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q32KD4_DROME  unnamed protein product                                 1904    0.0  
Q7KY08_DROME  unnamed protein product                                 1850    0.0  
S4W2D1_LOCMI  unnamed protein product                                 1730    0.0  


>Q32KD4_DROME unnamed protein product
Length=984

 Score = 1904 bits (4932),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 927/988 (94%), Positives = 945/988 (96%), Gaps = 10/988 (1%)

Query  1    MSTERELAPGGPAQLH--TLPVAFSDLGTTLQLNTAVRIIGKVYESQWTPSPPRPQSPTQ  58
            MSTERELAPGGPAQLH  TLP+ F DL    Q+ + V IIGKVYESQWTPSP RPQSP+Q
Sbjct  1    MSTERELAPGGPAQLHPHTLPLTFPDL----QMTSTVGIIGKVYESQWTPSPTRPQSPSQ  56

Query  59   SQTSFENLTSPPATGSSVNPTAVTSPSAQNVAVGGATVGGAGAAGLATQ---ASAVASPL  115
            +QTSF+ LTSPPA GSSVNPTAVTSPSAQNVA GGATV GA A          +   S  
Sbjct  57   AQTSFDTLTSPPAPGSSVNPTAVTSPSAQNVAAGGATVAGAAATAAQVASALGATTGSVT  116

Query  116  GATAAASPTTQPELPVFTCPRRPNLGREGRPIVLRANHFQVSMPRGYVHHYDINIQPDKC  175
             A A A+P TQP++PVFTCPRRPNLGREGRPIVLRANHFQV+MPRGYVHHYDINIQPDKC
Sbjct  117  PAIATATPATQPDMPVFTCPRRPNLGREGRPIVLRANHFQVTMPRGYVHHYDINIQPDKC  176

Query  176  PRKVNREIIETMVHAYSKIFGVLKPVFDGRNNLYTRDPLPIGNDRLELEVTLPGEGKDRI  235
            PRKVNREIIETMVHAYSKIFGVLKPVFDGRNNLYTRDPLPIGN+RLELEVTLPGEGKDRI
Sbjct  177  PRKVNREIIETMVHAYSKIFGVLKPVFDGRNNLYTRDPLPIGNERLELEVTLPGEGKDRI  236

Query  236  FRVTIKWMAQVSLFNLEEALEGRTRQIPYDAILALDVVMRHLPSMTYTPVGRSFFSSPDG  295
            FRVTIKW AQVSLFNLEEALEGRTRQIPYDAILALDVVMRHLPSMTYTPVGRSFFSSP+G
Sbjct  237  FRVTIKWQAQVSLFNLEEALEGRTRQIPYDAILALDVVMRHLPSMTYTPVGRSFFSSPEG  296

Query  296  YYHPLGGGREVWFGFHQSVRPSQWKMMLNIDVSATAFYKAQPVIDFMCEVLDIRDINEQR  355
            YYHPLGGGREVWFGFHQSVRPSQWKMMLNIDVSATAFYKAQPVIDFMCEVLDIRDINEQR
Sbjct  297  YYHPLGGGREVWFGFHQSVRPSQWKMMLNIDVSATAFYKAQPVIDFMCEVLDIRDINEQR  356

Query  356  KPLTDSQRVKFTKEIKGLKIEITHCGAMRRKYRVCNVTRRPAQMQSFPLQLENGQTVECT  415
            KPLTDSQRVKFTKEIKGLKIEITHCG MRRKYRVCNVTRRPAQMQSFPLQLENGQTVECT
Sbjct  357  KPLTDSQRVKFTKEIKGLKIEITHCGQMRRKYRVCNVTRRPAQMQSFPLQLENGQTVECT  416

Query  416  VAKYFLDKYRMKLRYPHLPCLQVGQEHKHTYLPLEVCNIVAGQRCIKKLTDMQTSTMIKA  475
            VAKYFLDKYRMKLRYPHLPCLQVGQEHKHTYLPLEVCNIVAGQRCIKKLTDMQTSTMIKA
Sbjct  417  VAKYFLDKYRMKLRYPHLPCLQVGQEHKHTYLPLEVCNIVAGQRCIKKLTDMQTSTMIKA  476

Query  476  TARSAPDREREINNLVKRADFNNDSYVQEFGLTISNSMMEVRGRVLPPPKLQYGGRVSS-  534
            TARSAPDREREINNLVKRADFNNDSYVQEFGLTISNSMMEVRGRVLPPPKLQYGGRVS+ 
Sbjct  477  TARSAPDREREINNLVKRADFNNDSYVQEFGLTISNSMMEVRGRVLPPPKLQYGGRVSTG  536

Query  535  MTGQQLFPPQNKVSLASPNQGVWDMRGKQFFTGVEIRVWAIACFAPQRTVREDALRNFTQ  594
            +TGQQLFPPQNKVSLASPNQGVWDMRGKQFFTGVEIR+WAIACFAPQRTVREDALRNFTQ
Sbjct  537  LTGQQLFPPQNKVSLASPNQGVWDMRGKQFFTGVEIRIWAIACFAPQRTVREDALRNFTQ  596

Query  595  QLQKISNDAGMPIIGQPCFCKYATGPDQVEPMFRYLKNSFNALQLVVVVLPGKTPVYAEV  654
            QLQKISNDAGMPIIGQPCFCKYATGPDQVEPMFRYLK +F  LQLVVVVLPGKTPVYAEV
Sbjct  597  QLQKISNDAGMPIIGQPCFCKYATGPDQVEPMFRYLKITFPGLQLVVVVLPGKTPVYAEV  656

Query  655  KRVGDTVLGMATQCVQAKNVNKTSPQTLSNLCLKINVKLGGINSILVPSIRPKVFNEPVI  714
            KRVGDTVLGMATQCVQAKNVNKTSPQTLSNLCLKINVKLGGINSILVPSIRPKVFNEPVI
Sbjct  657  KRVGDTVLGMATQCVQAKNVNKTSPQTLSNLCLKINVKLGGINSILVPSIRPKVFNEPVI  716

Query  715  FLGADVTHPPAGDNKKPSIAAVVGSMDAHPSRYAATVRVQQHRQEIIQELSSMVRELLIM  774
            FLGADVTHPPAGDNKKPSIAAVVGSMDAHPSRYAATVRVQQHRQEIIQELSSMVRELLIM
Sbjct  717  FLGADVTHPPAGDNKKPSIAAVVGSMDAHPSRYAATVRVQQHRQEIIQELSSMVRELLIM  776

Query  775  FYKSTGGYKPHRIILYRDGVSEGQFPHVLQHELTAIREACIKLEADYRPGITFIVVQKRH  834
            FYKSTGGYKPHRIILYRDGVSEGQFPHVLQHELTAIREACIKLE +YRPGITFIVVQKRH
Sbjct  777  FYKSTGGYKPHRIILYRDGVSEGQFPHVLQHELTAIREACIKLEPEYRPGITFIVVQKRH  836

Query  835  HTRLFCAEKKEQSGKSGNIPAGTTVDVGITHPTEFDFYLCSHQGIQGTSRPSHYHVLWDD  894
            HTRLFCAEKKEQSGKSGNIPAGTTVDVGITHPTEFDFYLCSHQGIQGTSRPSHYHVLWDD
Sbjct  837  HTRLFCAEKKEQSGKSGNIPAGTTVDVGITHPTEFDFYLCSHQGIQGTSRPSHYHVLWDD  896

Query  895  NHFDSDELQCLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVEKEHDSGEGSHQS  954
            NHFDSDELQCLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVEKEHDSGEGSHQS
Sbjct  897  NHFDSDELQCLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVEKEHDSGEGSHQS  956

Query  955  GCSEDRTPGAMARAITVHADTKKVMYFA  982
            GCSEDRTPGAMARAITVHADTKKVMYFA
Sbjct  957  GCSEDRTPGAMARAITVHADTKKVMYFA  984


>Q7KY08_DROME unnamed protein product
Length=950

 Score = 1850 bits (4792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 896/944 (95%), Positives = 912/944 (97%), Gaps = 4/944 (0%)

Query  43   ESQWTPSPPRPQSPTQSQTSFENLTSPPATGSSVNPTAVTSPSAQNVAVGGATVGGAGAA  102
            +SQWTPSP RPQSP+Q+QTSF+ LTSPPA GSSVNPTAVTSPSAQNVA GGATV GA A 
Sbjct  7    QSQWTPSPTRPQSPSQAQTSFDTLTSPPAPGSSVNPTAVTSPSAQNVAAGGATVAGAAAT  66

Query  103  GLATQ---ASAVASPLGATAAASPTTQPELPVFTCPRRPNLGREGRPIVLRANHFQVSMP  159
                     +   S   A A A+P TQP++PVFTCPRRPNLGREGRPIVLRANHFQV+MP
Sbjct  67   AAQVASALGATTGSVTPAIATATPATQPDMPVFTCPRRPNLGREGRPIVLRANHFQVTMP  126

Query  160  RGYVHHYDINIQPDKCPRKVNREIIETMVHAYSKIFGVLKPVFDGRNNLYTRDPLPIGND  219
            RGYVHHYDINIQPDKCPRKVNREIIETMVHAYSKIFGVLKPVFDGRNNLYTRDPLPIGN+
Sbjct  127  RGYVHHYDINIQPDKCPRKVNREIIETMVHAYSKIFGVLKPVFDGRNNLYTRDPLPIGNE  186

Query  220  RLELEVTLPGEGKDRIFRVTIKWMAQVSLFNLEEALEGRTRQIPYDAILALDVVMRHLPS  279
            RLELEVTLPGEGKDRIFRVTIKW AQVSLFNLEEALEGRTRQIPYDAILALDVVMRHLPS
Sbjct  187  RLELEVTLPGEGKDRIFRVTIKWQAQVSLFNLEEALEGRTRQIPYDAILALDVVMRHLPS  246

Query  280  MTYTPVGRSFFSSPDGYYHPLGGGREVWFGFHQSVRPSQWKMMLNIDVSATAFYKAQPVI  339
            MTYTPVGRSFFSSP+GYYHPLGGGREVWFGFHQSVRPSQWKMMLNIDVSATAFYKAQPVI
Sbjct  247  MTYTPVGRSFFSSPEGYYHPLGGGREVWFGFHQSVRPSQWKMMLNIDVSATAFYKAQPVI  306

Query  340  DFMCEVLDIRDINEQRKPLTDSQRVKFTKEIKGLKIEITHCGAMRRKYRVCNVTRRPAQM  399
            DFMCEVLDIRDINEQRKPLTDSQRVKFTKEIKGLKIEITHCG MRRKYRVCNVTRRPAQM
Sbjct  307  DFMCEVLDIRDINEQRKPLTDSQRVKFTKEIKGLKIEITHCGQMRRKYRVCNVTRRPAQM  366

Query  400  QSFPLQLENGQTVECTVAKYFLDKYRMKLRYPHLPCLQVGQEHKHTYLPLEVCNIVAGQR  459
            QSFPLQLENGQTVECTVAKYFLDKYRMKLRYPHLPCLQVGQEHKHTYLPLEVCNIVAGQR
Sbjct  367  QSFPLQLENGQTVECTVAKYFLDKYRMKLRYPHLPCLQVGQEHKHTYLPLEVCNIVAGQR  426

Query  460  CIKKLTDMQTSTMIKATARSAPDREREINNLVKRADFNNDSYVQEFGLTISNSMMEVRGR  519
            CIKKLTDMQTSTMIKATARSAPDREREINNLVKRADFNNDSYVQEFGLTISNSMMEVRGR
Sbjct  427  CIKKLTDMQTSTMIKATARSAPDREREINNLVKRADFNNDSYVQEFGLTISNSMMEVRGR  486

Query  520  VLPPPKLQYGGRVSS-MTGQQLFPPQNKVSLASPNQGVWDMRGKQFFTGVEIRVWAIACF  578
            VLPPPKLQYGGRVS+ +TGQQLFPPQNKVSLASPNQGVWDMRGKQFFTGVEIR+WAIACF
Sbjct  487  VLPPPKLQYGGRVSTGLTGQQLFPPQNKVSLASPNQGVWDMRGKQFFTGVEIRIWAIACF  546

Query  579  APQRTVREDALRNFTQQLQKISNDAGMPIIGQPCFCKYATGPDQVEPMFRYLKNSFNALQ  638
            APQRTVREDALRNFTQQLQKISNDAGMPIIGQPCFCKYATGPDQVEPMFRYLK +F  LQ
Sbjct  547  APQRTVREDALRNFTQQLQKISNDAGMPIIGQPCFCKYATGPDQVEPMFRYLKITFPGLQ  606

Query  639  LVVVVLPGKTPVYAEVKRVGDTVLGMATQCVQAKNVNKTSPQTLSNLCLKINVKLGGINS  698
            LVVVVLPGKTPVYAEVKRVGDTVLGMATQCVQAKNVNKTSPQTLSNLCLKINVKLGGINS
Sbjct  607  LVVVVLPGKTPVYAEVKRVGDTVLGMATQCVQAKNVNKTSPQTLSNLCLKINVKLGGINS  666

Query  699  ILVPSIRPKVFNEPVIFLGADVTHPPAGDNKKPSIAAVVGSMDAHPSRYAATVRVQQHRQ  758
            ILVPSIRPKVFNEPVIFLGADVTHPPAGDNKKPSIAAVVGSMDAHPSRYAATVRVQQHRQ
Sbjct  667  ILVPSIRPKVFNEPVIFLGADVTHPPAGDNKKPSIAAVVGSMDAHPSRYAATVRVQQHRQ  726

Query  759  EIIQELSSMVRELLIMFYKSTGGYKPHRIILYRDGVSEGQFPHVLQHELTAIREACIKLE  818
            EIIQELSSMVRELLIMFYKSTGGYKPHRIILYRDGVSEGQFPHVLQHELTAIREACIKLE
Sbjct  727  EIIQELSSMVRELLIMFYKSTGGYKPHRIILYRDGVSEGQFPHVLQHELTAIREACIKLE  786

Query  819  ADYRPGITFIVVQKRHHTRLFCAEKKEQSGKSGNIPAGTTVDVGITHPTEFDFYLCSHQG  878
             +YRPGITFIVVQKRHHTRLFCAEKKEQSGKSGNIPAGTTVDVGITHPTEFDFYLCSHQG
Sbjct  787  PEYRPGITFIVVQKRHHTRLFCAEKKEQSGKSGNIPAGTTVDVGITHPTEFDFYLCSHQG  846

Query  879  IQGTSRPSHYHVLWDDNHFDSDELQCLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARY  938
            IQGTSRPSHYHVLWDDNHFDSDELQCLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARY
Sbjct  847  IQGTSRPSHYHVLWDDNHFDSDELQCLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARY  906

Query  939  HLVEKEHDSGEGSHQSGCSEDRTPGAMARAITVHADTKKVMYFA  982
            HLVEKEHDSGEGSHQSGCSEDRTPGAMARAITVHADTKKVMYFA
Sbjct  907  HLVEKEHDSGEGSHQSGCSEDRTPGAMARAITVHADTKKVMYFA  950


>S4W2D1_LOCMI unnamed protein product
Length=848

 Score = 1730 bits (4481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 819/855 (96%), Positives = 836/855 (98%), Gaps = 7/855 (1%)

Query  128  ELPVFTCPRRPNLGREGRPIVLRANHFQVSMPRGYVHHYDINIQPDKCPRKVNREIIETM  187
            ELP+F CPRRPNLGREGRPIVLRANHFQ+SMPRG+VHHYDINIQPDKCPRKVNREIIETM
Sbjct  1    ELPMFNCPRRPNLGREGRPIVLRANHFQISMPRGFVHHYDINIQPDKCPRKVNREIIETM  60

Query  188  VHAYSKIFGVLKPVFDGRNNLYTRDPLPIGNDRLELEVTLPGEGKDRIFRVTIKWMAQVS  247
            VHAYSKIFG LKPVFDGRNNLYTRDPLPIGNDR+ELEVTLPGEGKDR+FRVTIKW+AQVS
Sbjct  61   VHAYSKIFGTLKPVFDGRNNLYTRDPLPIGNDRVELEVTLPGEGKDRVFRVTIKWIAQVS  120

Query  248  LFNLEEALEGRTRQIPYDAILALDVVMRHLPSMTYTPVGRSFFSSPDGYYHPLGGGREVW  307
            LF LEEALEGRTRQIPYDAILALDVVMRHLPSMTYTPVGRSFFSSPDGYYHPLGGGREVW
Sbjct  121  LFALEEALEGRTRQIPYDAILALDVVMRHLPSMTYTPVGRSFFSSPDGYYHPLGGGREVW  180

Query  308  FGFHQSVRPSQWKMMLNIDVSATAFYKAQPVIDFMCEVLDIRDINEQRKPLTDSQRVKFT  367
            FGFHQSVRPSQWKMMLNIDVSATAFYKAQPVI+FMCEVLDIRDINEQRKPLTDSQRVKFT
Sbjct  181  FGFHQSVRPSQWKMMLNIDVSATAFYKAQPVIEFMCEVLDIRDINEQRKPLTDSQRVKFT  240

Query  368  KEIKGLKIEITHCGAMRRKYRVCNVTRRPAQMQSFPLQLENGQTVECTVAKYFLDKYRMK  427
            KEIKGLKIEITHCG MRRKYRVCNVTRRPAQMQSFPLQLENGQTVECTVAKYFLDKY+MK
Sbjct  241  KEIKGLKIEITHCGTMRRKYRVCNVTRRPAQMQSFPLQLENGQTVECTVAKYFLDKYKMK  300

Query  428  LRYPHLPCLQVGQEHKHTYLPLEVCNIVAGQRCIKKLTDMQTSTMIKATARSAPDREREI  487
            LRYPHLPCLQVGQEHKHTYLPLEVCNIVAGQRCIKKLTDMQTSTMIKATARSAPDREREI
Sbjct  301  LRYPHLPCLQVGQEHKHTYLPLEVCNIVAGQRCIKKLTDMQTSTMIKATARSAPDREREI  360

Query  488  NNLVKRADFNNDSYVQEFGLTISNSMMEVRGRVLPPPKLQYGGRVSSMTGQQLFPPQNKV  547
            N+LV+RADFNND+YVQEFGLTISN+MMEVRGRVLPPPKLQYGGRVSS++GQ         
Sbjct  361  NSLVRRADFNNDAYVQEFGLTISNNMMEVRGRVLPPPKLQYGGRVSSLSGQ-------TK  413

Query  548  SLASPNQGVWDMRGKQFFTGVEIRVWAIACFAPQRTVREDALRNFTQQLQKISNDAGMPI  607
              A PNQGVWDMRGKQFFTGVEIRVWAIACFAPQRTVREDALRNFTQQLQKISNDAGMPI
Sbjct  414  QQAMPNQGVWDMRGKQFFTGVEIRVWAIACFAPQRTVREDALRNFTQQLQKISNDAGMPI  473

Query  608  IGQPCFCKYATGPDQVEPMFRYLKNSFNALQLVVVVLPGKTPVYAEVKRVGDTVLGMATQ  667
            IGQPCFCKYATGPDQVEPMFRYLK+SF ALQLVVVVLPGKTPVYAEVKRVGDTVLGMATQ
Sbjct  474  IGQPCFCKYATGPDQVEPMFRYLKSSFTALQLVVVVLPGKTPVYAEVKRVGDTVLGMATQ  533

Query  668  CVQAKNVNKTSPQTLSNLCLKINVKLGGINSILVPSIRPKVFNEPVIFLGADVTHPPAGD  727
            CVQAKNVNKTSPQTLSNLCLKINVKLGGINSILVPSIRPKVFNEPVIFLGADVTHPPAGD
Sbjct  534  CVQAKNVNKTSPQTLSNLCLKINVKLGGINSILVPSIRPKVFNEPVIFLGADVTHPPAGD  593

Query  728  NKKPSIAAVVGSMDAHPSRYAATVRVQQHRQEIIQELSSMVRELLIMFYKSTGGYKPHRI  787
            NKKPSIAAVVGSMDAHPSRYAATVRVQQHRQEIIQELSSMVRELLIMFYKSTGGYKPHRI
Sbjct  594  NKKPSIAAVVGSMDAHPSRYAATVRVQQHRQEIIQELSSMVRELLIMFYKSTGGYKPHRI  653

Query  788  ILYRDGVSEGQFPHVLQHELTAIREACIKLEADYRPGITFIVVQKRHHTRLFCAEKKEQS  847
            ILYRDGVSEGQF HVLQHELTAIREACIKLE DY+PGITFIVVQKRHHTRLFCA+KKEQS
Sbjct  654  ILYRDGVSEGQFLHVLQHELTAIREACIKLEGDYKPGITFIVVQKRHHTRLFCADKKEQS  713

Query  848  GKSGNIPAGTTVDVGITHPTEFDFYLCSHQGIQGTSRPSHYHVLWDDNHFDSDELQCLTY  907
            GKSGNIPAGTTVDVGITHPTEFDFYLCSHQGIQGTSRPSHYHVLWDDNHFDSDELQCLTY
Sbjct  714  GKSGNIPAGTTVDVGITHPTEFDFYLCSHQGIQGTSRPSHYHVLWDDNHFDSDELQCLTY  773

Query  908  QLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVEKEHDSGEGSHQSGCSEDRTPGAMAR  967
            QLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVEKEHDSGEGSHQSGCSEDRTPGAMAR
Sbjct  774  QLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVEKEHDSGEGSHQSGCSEDRTPGAMAR  833

Query  968  AITVHADTKKVMYFA  982
            AITVHADTKKVMYFA
Sbjct  834  AITVHADTKKVMYFA  848



Lambda      K        H
   0.322    0.131    0.423 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1518059526


Query= XP_014085214.1 PREDICTED: protein argonaute-2 isoform X1 [Bactrocera
oleae]

Length=982
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q32KD4_DROME  unnamed protein product                                 1904    0.0  
Q7KY08_DROME  unnamed protein product                                 1850    0.0  
S4W2D1_LOCMI  unnamed protein product                                 1730    0.0  


>Q32KD4_DROME unnamed protein product
Length=984

 Score = 1904 bits (4932),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 927/988 (94%), Positives = 945/988 (96%), Gaps = 10/988 (1%)

Query  1    MSTERELAPGGPAQLH--TLPVAFSDLGTTLQLNTAVRIIGKVYESQWTPSPPRPQSPTQ  58
            MSTERELAPGGPAQLH  TLP+ F DL    Q+ + V IIGKVYESQWTPSP RPQSP+Q
Sbjct  1    MSTERELAPGGPAQLHPHTLPLTFPDL----QMTSTVGIIGKVYESQWTPSPTRPQSPSQ  56

Query  59   SQTSFENLTSPPATGSSVNPTAVTSPSAQNVAVGGATVGGAGAAGLATQ---ASAVASPL  115
            +QTSF+ LTSPPA GSSVNPTAVTSPSAQNVA GGATV GA A          +   S  
Sbjct  57   AQTSFDTLTSPPAPGSSVNPTAVTSPSAQNVAAGGATVAGAAATAAQVASALGATTGSVT  116

Query  116  GATAAASPTTQPELPVFTCPRRPNLGREGRPIVLRANHFQVSMPRGYVHHYDINIQPDKC  175
             A A A+P TQP++PVFTCPRRPNLGREGRPIVLRANHFQV+MPRGYVHHYDINIQPDKC
Sbjct  117  PAIATATPATQPDMPVFTCPRRPNLGREGRPIVLRANHFQVTMPRGYVHHYDINIQPDKC  176

Query  176  PRKVNREIIETMVHAYSKIFGVLKPVFDGRNNLYTRDPLPIGNDRLELEVTLPGEGKDRI  235
            PRKVNREIIETMVHAYSKIFGVLKPVFDGRNNLYTRDPLPIGN+RLELEVTLPGEGKDRI
Sbjct  177  PRKVNREIIETMVHAYSKIFGVLKPVFDGRNNLYTRDPLPIGNERLELEVTLPGEGKDRI  236

Query  236  FRVTIKWMAQVSLFNLEEALEGRTRQIPYDAILALDVVMRHLPSMTYTPVGRSFFSSPDG  295
            FRVTIKW AQVSLFNLEEALEGRTRQIPYDAILALDVVMRHLPSMTYTPVGRSFFSSP+G
Sbjct  237  FRVTIKWQAQVSLFNLEEALEGRTRQIPYDAILALDVVMRHLPSMTYTPVGRSFFSSPEG  296

Query  296  YYHPLGGGREVWFGFHQSVRPSQWKMMLNIDVSATAFYKAQPVIDFMCEVLDIRDINEQR  355
            YYHPLGGGREVWFGFHQSVRPSQWKMMLNIDVSATAFYKAQPVIDFMCEVLDIRDINEQR
Sbjct  297  YYHPLGGGREVWFGFHQSVRPSQWKMMLNIDVSATAFYKAQPVIDFMCEVLDIRDINEQR  356

Query  356  KPLTDSQRVKFTKEIKGLKIEITHCGAMRRKYRVCNVTRRPAQMQSFPLQLENGQTVECT  415
            KPLTDSQRVKFTKEIKGLKIEITHCG MRRKYRVCNVTRRPAQMQSFPLQLENGQTVECT
Sbjct  357  KPLTDSQRVKFTKEIKGLKIEITHCGQMRRKYRVCNVTRRPAQMQSFPLQLENGQTVECT  416

Query  416  VAKYFLDKYRMKLRYPHLPCLQVGQEHKHTYLPLEVCNIVAGQRCIKKLTDMQTSTMIKA  475
            VAKYFLDKYRMKLRYPHLPCLQVGQEHKHTYLPLEVCNIVAGQRCIKKLTDMQTSTMIKA
Sbjct  417  VAKYFLDKYRMKLRYPHLPCLQVGQEHKHTYLPLEVCNIVAGQRCIKKLTDMQTSTMIKA  476

Query  476  TARSAPDREREINNLVKRADFNNDSYVQEFGLTISNSMMEVRGRVLPPPKLQYGGRVSS-  534
            TARSAPDREREINNLVKRADFNNDSYVQEFGLTISNSMMEVRGRVLPPPKLQYGGRVS+ 
Sbjct  477  TARSAPDREREINNLVKRADFNNDSYVQEFGLTISNSMMEVRGRVLPPPKLQYGGRVSTG  536

Query  535  MTGQQLFPPQNKVSLASPNQGVWDMRGKQFFTGVEIRVWAIACFAPQRTVREDALRNFTQ  594
            +TGQQLFPPQNKVSLASPNQGVWDMRGKQFFTGVEIR+WAIACFAPQRTVREDALRNFTQ
Sbjct  537  LTGQQLFPPQNKVSLASPNQGVWDMRGKQFFTGVEIRIWAIACFAPQRTVREDALRNFTQ  596

Query  595  QLQKISNDAGMPIIGQPCFCKYATGPDQVEPMFRYLKNSFNALQLVVVVLPGKTPVYAEV  654
            QLQKISNDAGMPIIGQPCFCKYATGPDQVEPMFRYLK +F  LQLVVVVLPGKTPVYAEV
Sbjct  597  QLQKISNDAGMPIIGQPCFCKYATGPDQVEPMFRYLKITFPGLQLVVVVLPGKTPVYAEV  656

Query  655  KRVGDTVLGMATQCVQAKNVNKTSPQTLSNLCLKINVKLGGINSILVPSIRPKVFNEPVI  714
            KRVGDTVLGMATQCVQAKNVNKTSPQTLSNLCLKINVKLGGINSILVPSIRPKVFNEPVI
Sbjct  657  KRVGDTVLGMATQCVQAKNVNKTSPQTLSNLCLKINVKLGGINSILVPSIRPKVFNEPVI  716

Query  715  FLGADVTHPPAGDNKKPSIAAVVGSMDAHPSRYAATVRVQQHRQEIIQELSSMVRELLIM  774
            FLGADVTHPPAGDNKKPSIAAVVGSMDAHPSRYAATVRVQQHRQEIIQELSSMVRELLIM
Sbjct  717  FLGADVTHPPAGDNKKPSIAAVVGSMDAHPSRYAATVRVQQHRQEIIQELSSMVRELLIM  776

Query  775  FYKSTGGYKPHRIILYRDGVSEGQFPHVLQHELTAIREACIKLEADYRPGITFIVVQKRH  834
            FYKSTGGYKPHRIILYRDGVSEGQFPHVLQHELTAIREACIKLE +YRPGITFIVVQKRH
Sbjct  777  FYKSTGGYKPHRIILYRDGVSEGQFPHVLQHELTAIREACIKLEPEYRPGITFIVVQKRH  836

Query  835  HTRLFCAEKKEQSGKSGNIPAGTTVDVGITHPTEFDFYLCSHQGIQGTSRPSHYHVLWDD  894
            HTRLFCAEKKEQSGKSGNIPAGTTVDVGITHPTEFDFYLCSHQGIQGTSRPSHYHVLWDD
Sbjct  837  HTRLFCAEKKEQSGKSGNIPAGTTVDVGITHPTEFDFYLCSHQGIQGTSRPSHYHVLWDD  896

Query  895  NHFDSDELQCLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVEKEHDSGEGSHQS  954
            NHFDSDELQCLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVEKEHDSGEGSHQS
Sbjct  897  NHFDSDELQCLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVEKEHDSGEGSHQS  956

Query  955  GCSEDRTPGAMARAITVHADTKKVMYFA  982
            GCSEDRTPGAMARAITVHADTKKVMYFA
Sbjct  957  GCSEDRTPGAMARAITVHADTKKVMYFA  984


>Q7KY08_DROME unnamed protein product
Length=950

 Score = 1850 bits (4792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 896/944 (95%), Positives = 912/944 (97%), Gaps = 4/944 (0%)

Query  43   ESQWTPSPPRPQSPTQSQTSFENLTSPPATGSSVNPTAVTSPSAQNVAVGGATVGGAGAA  102
            +SQWTPSP RPQSP+Q+QTSF+ LTSPPA GSSVNPTAVTSPSAQNVA GGATV GA A 
Sbjct  7    QSQWTPSPTRPQSPSQAQTSFDTLTSPPAPGSSVNPTAVTSPSAQNVAAGGATVAGAAAT  66

Query  103  GLATQ---ASAVASPLGATAAASPTTQPELPVFTCPRRPNLGREGRPIVLRANHFQVSMP  159
                     +   S   A A A+P TQP++PVFTCPRRPNLGREGRPIVLRANHFQV+MP
Sbjct  67   AAQVASALGATTGSVTPAIATATPATQPDMPVFTCPRRPNLGREGRPIVLRANHFQVTMP  126

Query  160  RGYVHHYDINIQPDKCPRKVNREIIETMVHAYSKIFGVLKPVFDGRNNLYTRDPLPIGND  219
            RGYVHHYDINIQPDKCPRKVNREIIETMVHAYSKIFGVLKPVFDGRNNLYTRDPLPIGN+
Sbjct  127  RGYVHHYDINIQPDKCPRKVNREIIETMVHAYSKIFGVLKPVFDGRNNLYTRDPLPIGNE  186

Query  220  RLELEVTLPGEGKDRIFRVTIKWMAQVSLFNLEEALEGRTRQIPYDAILALDVVMRHLPS  279
            RLELEVTLPGEGKDRIFRVTIKW AQVSLFNLEEALEGRTRQIPYDAILALDVVMRHLPS
Sbjct  187  RLELEVTLPGEGKDRIFRVTIKWQAQVSLFNLEEALEGRTRQIPYDAILALDVVMRHLPS  246

Query  280  MTYTPVGRSFFSSPDGYYHPLGGGREVWFGFHQSVRPSQWKMMLNIDVSATAFYKAQPVI  339
            MTYTPVGRSFFSSP+GYYHPLGGGREVWFGFHQSVRPSQWKMMLNIDVSATAFYKAQPVI
Sbjct  247  MTYTPVGRSFFSSPEGYYHPLGGGREVWFGFHQSVRPSQWKMMLNIDVSATAFYKAQPVI  306

Query  340  DFMCEVLDIRDINEQRKPLTDSQRVKFTKEIKGLKIEITHCGAMRRKYRVCNVTRRPAQM  399
            DFMCEVLDIRDINEQRKPLTDSQRVKFTKEIKGLKIEITHCG MRRKYRVCNVTRRPAQM
Sbjct  307  DFMCEVLDIRDINEQRKPLTDSQRVKFTKEIKGLKIEITHCGQMRRKYRVCNVTRRPAQM  366

Query  400  QSFPLQLENGQTVECTVAKYFLDKYRMKLRYPHLPCLQVGQEHKHTYLPLEVCNIVAGQR  459
            QSFPLQLENGQTVECTVAKYFLDKYRMKLRYPHLPCLQVGQEHKHTYLPLEVCNIVAGQR
Sbjct  367  QSFPLQLENGQTVECTVAKYFLDKYRMKLRYPHLPCLQVGQEHKHTYLPLEVCNIVAGQR  426

Query  460  CIKKLTDMQTSTMIKATARSAPDREREINNLVKRADFNNDSYVQEFGLTISNSMMEVRGR  519
            CIKKLTDMQTSTMIKATARSAPDREREINNLVKRADFNNDSYVQEFGLTISNSMMEVRGR
Sbjct  427  CIKKLTDMQTSTMIKATARSAPDREREINNLVKRADFNNDSYVQEFGLTISNSMMEVRGR  486

Query  520  VLPPPKLQYGGRVSS-MTGQQLFPPQNKVSLASPNQGVWDMRGKQFFTGVEIRVWAIACF  578
            VLPPPKLQYGGRVS+ +TGQQLFPPQNKVSLASPNQGVWDMRGKQFFTGVEIR+WAIACF
Sbjct  487  VLPPPKLQYGGRVSTGLTGQQLFPPQNKVSLASPNQGVWDMRGKQFFTGVEIRIWAIACF  546

Query  579  APQRTVREDALRNFTQQLQKISNDAGMPIIGQPCFCKYATGPDQVEPMFRYLKNSFNALQ  638
            APQRTVREDALRNFTQQLQKISNDAGMPIIGQPCFCKYATGPDQVEPMFRYLK +F  LQ
Sbjct  547  APQRTVREDALRNFTQQLQKISNDAGMPIIGQPCFCKYATGPDQVEPMFRYLKITFPGLQ  606

Query  639  LVVVVLPGKTPVYAEVKRVGDTVLGMATQCVQAKNVNKTSPQTLSNLCLKINVKLGGINS  698
            LVVVVLPGKTPVYAEVKRVGDTVLGMATQCVQAKNVNKTSPQTLSNLCLKINVKLGGINS
Sbjct  607  LVVVVLPGKTPVYAEVKRVGDTVLGMATQCVQAKNVNKTSPQTLSNLCLKINVKLGGINS  666

Query  699  ILVPSIRPKVFNEPVIFLGADVTHPPAGDNKKPSIAAVVGSMDAHPSRYAATVRVQQHRQ  758
            ILVPSIRPKVFNEPVIFLGADVTHPPAGDNKKPSIAAVVGSMDAHPSRYAATVRVQQHRQ
Sbjct  667  ILVPSIRPKVFNEPVIFLGADVTHPPAGDNKKPSIAAVVGSMDAHPSRYAATVRVQQHRQ  726

Query  759  EIIQELSSMVRELLIMFYKSTGGYKPHRIILYRDGVSEGQFPHVLQHELTAIREACIKLE  818
            EIIQELSSMVRELLIMFYKSTGGYKPHRIILYRDGVSEGQFPHVLQHELTAIREACIKLE
Sbjct  727  EIIQELSSMVRELLIMFYKSTGGYKPHRIILYRDGVSEGQFPHVLQHELTAIREACIKLE  786

Query  819  ADYRPGITFIVVQKRHHTRLFCAEKKEQSGKSGNIPAGTTVDVGITHPTEFDFYLCSHQG  878
             +YRPGITFIVVQKRHHTRLFCAEKKEQSGKSGNIPAGTTVDVGITHPTEFDFYLCSHQG
Sbjct  787  PEYRPGITFIVVQKRHHTRLFCAEKKEQSGKSGNIPAGTTVDVGITHPTEFDFYLCSHQG  846

Query  879  IQGTSRPSHYHVLWDDNHFDSDELQCLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARY  938
            IQGTSRPSHYHVLWDDNHFDSDELQCLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARY
Sbjct  847  IQGTSRPSHYHVLWDDNHFDSDELQCLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARY  906

Query  939  HLVEKEHDSGEGSHQSGCSEDRTPGAMARAITVHADTKKVMYFA  982
            HLVEKEHDSGEGSHQSGCSEDRTPGAMARAITVHADTKKVMYFA
Sbjct  907  HLVEKEHDSGEGSHQSGCSEDRTPGAMARAITVHADTKKVMYFA  950


>S4W2D1_LOCMI unnamed protein product
Length=848

 Score = 1730 bits (4481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 819/855 (96%), Positives = 836/855 (98%), Gaps = 7/855 (1%)

Query  128  ELPVFTCPRRPNLGREGRPIVLRANHFQVSMPRGYVHHYDINIQPDKCPRKVNREIIETM  187
            ELP+F CPRRPNLGREGRPIVLRANHFQ+SMPRG+VHHYDINIQPDKCPRKVNREIIETM
Sbjct  1    ELPMFNCPRRPNLGREGRPIVLRANHFQISMPRGFVHHYDINIQPDKCPRKVNREIIETM  60

Query  188  VHAYSKIFGVLKPVFDGRNNLYTRDPLPIGNDRLELEVTLPGEGKDRIFRVTIKWMAQVS  247
            VHAYSKIFG LKPVFDGRNNLYTRDPLPIGNDR+ELEVTLPGEGKDR+FRVTIKW+AQVS
Sbjct  61   VHAYSKIFGTLKPVFDGRNNLYTRDPLPIGNDRVELEVTLPGEGKDRVFRVTIKWIAQVS  120

Query  248  LFNLEEALEGRTRQIPYDAILALDVVMRHLPSMTYTPVGRSFFSSPDGYYHPLGGGREVW  307
            LF LEEALEGRTRQIPYDAILALDVVMRHLPSMTYTPVGRSFFSSPDGYYHPLGGGREVW
Sbjct  121  LFALEEALEGRTRQIPYDAILALDVVMRHLPSMTYTPVGRSFFSSPDGYYHPLGGGREVW  180

Query  308  FGFHQSVRPSQWKMMLNIDVSATAFYKAQPVIDFMCEVLDIRDINEQRKPLTDSQRVKFT  367
            FGFHQSVRPSQWKMMLNIDVSATAFYKAQPVI+FMCEVLDIRDINEQRKPLTDSQRVKFT
Sbjct  181  FGFHQSVRPSQWKMMLNIDVSATAFYKAQPVIEFMCEVLDIRDINEQRKPLTDSQRVKFT  240

Query  368  KEIKGLKIEITHCGAMRRKYRVCNVTRRPAQMQSFPLQLENGQTVECTVAKYFLDKYRMK  427
            KEIKGLKIEITHCG MRRKYRVCNVTRRPAQMQSFPLQLENGQTVECTVAKYFLDKY+MK
Sbjct  241  KEIKGLKIEITHCGTMRRKYRVCNVTRRPAQMQSFPLQLENGQTVECTVAKYFLDKYKMK  300

Query  428  LRYPHLPCLQVGQEHKHTYLPLEVCNIVAGQRCIKKLTDMQTSTMIKATARSAPDREREI  487
            LRYPHLPCLQVGQEHKHTYLPLEVCNIVAGQRCIKKLTDMQTSTMIKATARSAPDREREI
Sbjct  301  LRYPHLPCLQVGQEHKHTYLPLEVCNIVAGQRCIKKLTDMQTSTMIKATARSAPDREREI  360

Query  488  NNLVKRADFNNDSYVQEFGLTISNSMMEVRGRVLPPPKLQYGGRVSSMTGQQLFPPQNKV  547
            N+LV+RADFNND+YVQEFGLTISN+MMEVRGRVLPPPKLQYGGRVSS++GQ         
Sbjct  361  NSLVRRADFNNDAYVQEFGLTISNNMMEVRGRVLPPPKLQYGGRVSSLSGQ-------TK  413

Query  548  SLASPNQGVWDMRGKQFFTGVEIRVWAIACFAPQRTVREDALRNFTQQLQKISNDAGMPI  607
              A PNQGVWDMRGKQFFTGVEIRVWAIACFAPQRTVREDALRNFTQQLQKISNDAGMPI
Sbjct  414  QQAMPNQGVWDMRGKQFFTGVEIRVWAIACFAPQRTVREDALRNFTQQLQKISNDAGMPI  473

Query  608  IGQPCFCKYATGPDQVEPMFRYLKNSFNALQLVVVVLPGKTPVYAEVKRVGDTVLGMATQ  667
            IGQPCFCKYATGPDQVEPMFRYLK+SF ALQLVVVVLPGKTPVYAEVKRVGDTVLGMATQ
Sbjct  474  IGQPCFCKYATGPDQVEPMFRYLKSSFTALQLVVVVLPGKTPVYAEVKRVGDTVLGMATQ  533

Query  668  CVQAKNVNKTSPQTLSNLCLKINVKLGGINSILVPSIRPKVFNEPVIFLGADVTHPPAGD  727
            CVQAKNVNKTSPQTLSNLCLKINVKLGGINSILVPSIRPKVFNEPVIFLGADVTHPPAGD
Sbjct  534  CVQAKNVNKTSPQTLSNLCLKINVKLGGINSILVPSIRPKVFNEPVIFLGADVTHPPAGD  593

Query  728  NKKPSIAAVVGSMDAHPSRYAATVRVQQHRQEIIQELSSMVRELLIMFYKSTGGYKPHRI  787
            NKKPSIAAVVGSMDAHPSRYAATVRVQQHRQEIIQELSSMVRELLIMFYKSTGGYKPHRI
Sbjct  594  NKKPSIAAVVGSMDAHPSRYAATVRVQQHRQEIIQELSSMVRELLIMFYKSTGGYKPHRI  653

Query  788  ILYRDGVSEGQFPHVLQHELTAIREACIKLEADYRPGITFIVVQKRHHTRLFCAEKKEQS  847
            ILYRDGVSEGQF HVLQHELTAIREACIKLE DY+PGITFIVVQKRHHTRLFCA+KKEQS
Sbjct  654  ILYRDGVSEGQFLHVLQHELTAIREACIKLEGDYKPGITFIVVQKRHHTRLFCADKKEQS  713

Query  848  GKSGNIPAGTTVDVGITHPTEFDFYLCSHQGIQGTSRPSHYHVLWDDNHFDSDELQCLTY  907
            GKSGNIPAGTTVDVGITHPTEFDFYLCSHQGIQGTSRPSHYHVLWDDNHFDSDELQCLTY
Sbjct  714  GKSGNIPAGTTVDVGITHPTEFDFYLCSHQGIQGTSRPSHYHVLWDDNHFDSDELQCLTY  773

Query  908  QLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVEKEHDSGEGSHQSGCSEDRTPGAMAR  967
            QLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVEKEHDSGEGSHQSGCSEDRTPGAMAR
Sbjct  774  QLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVEKEHDSGEGSHQSGCSEDRTPGAMAR  833

Query  968  AITVHADTKKVMYFA  982
            AITVHADTKKVMYFA
Sbjct  834  AITVHADTKKVMYFA  848



Lambda      K        H
   0.322    0.131    0.423 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1518059526


Query= XP_014085215.1 PREDICTED: protein argonaute-2 isoform X2 [Bactrocera
oleae]

Length=946
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7KY08_DROME  unnamed protein product                                 1860    0.0  
Q32KD4_DROME  unnamed protein product                                 1850    0.0  
S4W2D1_LOCMI  unnamed protein product                                 1728    0.0  


>Q7KY08_DROME unnamed protein product
Length=950

 Score = 1860 bits (4817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 902/950 (95%), Positives = 917/950 (97%), Gaps = 4/950 (0%)

Query  1    MYPHGQQSQWTPSPPRPQSPTQSQTSFENLTSPPATGSSVNPTAVTSPSAQNVAVGGATV  60
            MYP GQQSQWTPSP RPQSP+Q+QTSF+ LTSPPA GSSVNPTAVTSPSAQNVA GGATV
Sbjct  1    MYPVGQQSQWTPSPTRPQSPSQAQTSFDTLTSPPAPGSSVNPTAVTSPSAQNVAAGGATV  60

Query  61   GGAGAAGLATQ---ASAVASPLGATAAASPTTQPELPVFTCPRRPNLGREGRPIVLRANH  117
             GA A          +   S   A A A+P TQP++PVFTCPRRPNLGREGRPIVLRANH
Sbjct  61   AGAAATAAQVASALGATTGSVTPAIATATPATQPDMPVFTCPRRPNLGREGRPIVLRANH  120

Query  118  FQVSMPRGYVHHYDINIQPDKCPRKVNREIIETMVHAYSKIFGVLKPVFDGRNNLYTRDP  177
            FQV+MPRGYVHHYDINIQPDKCPRKVNREIIETMVHAYSKIFGVLKPVFDGRNNLYTRDP
Sbjct  121  FQVTMPRGYVHHYDINIQPDKCPRKVNREIIETMVHAYSKIFGVLKPVFDGRNNLYTRDP  180

Query  178  LPIGNDRLELEVTLPGEGKDRIFRVTIKWMAQVSLFNLEEALEGRTRQIPYDAILALDVV  237
            LPIGN+RLELEVTLPGEGKDRIFRVTIKW AQVSLFNLEEALEGRTRQIPYDAILALDVV
Sbjct  181  LPIGNERLELEVTLPGEGKDRIFRVTIKWQAQVSLFNLEEALEGRTRQIPYDAILALDVV  240

Query  238  MRHLPSMTYTPVGRSFFSSPDGYYHPLGGGREVWFGFHQSVRPSQWKMMLNIDVSATAFY  297
            MRHLPSMTYTPVGRSFFSSP+GYYHPLGGGREVWFGFHQSVRPSQWKMMLNIDVSATAFY
Sbjct  241  MRHLPSMTYTPVGRSFFSSPEGYYHPLGGGREVWFGFHQSVRPSQWKMMLNIDVSATAFY  300

Query  298  KAQPVIDFMCEVLDIRDINEQRKPLTDSQRVKFTKEIKGLKIEITHCGAMRRKYRVCNVT  357
            KAQPVIDFMCEVLDIRDINEQRKPLTDSQRVKFTKEIKGLKIEITHCG MRRKYRVCNVT
Sbjct  301  KAQPVIDFMCEVLDIRDINEQRKPLTDSQRVKFTKEIKGLKIEITHCGQMRRKYRVCNVT  360

Query  358  RRPAQMQSFPLQLENGQTVECTVAKYFLDKYRMKLRYPHLPCLQVGQEHKHTYLPLEVCN  417
            RRPAQMQSFPLQLENGQTVECTVAKYFLDKYRMKLRYPHLPCLQVGQEHKHTYLPLEVCN
Sbjct  361  RRPAQMQSFPLQLENGQTVECTVAKYFLDKYRMKLRYPHLPCLQVGQEHKHTYLPLEVCN  420

Query  418  IVAGQRCIKKLTDMQTSTMIKATARSAPDREREINNLVKRADFNNDSYVQEFGLTISNSM  477
            IVAGQRCIKKLTDMQTSTMIKATARSAPDREREINNLVKRADFNNDSYVQEFGLTISNSM
Sbjct  421  IVAGQRCIKKLTDMQTSTMIKATARSAPDREREINNLVKRADFNNDSYVQEFGLTISNSM  480

Query  478  MEVRGRVLPPPKLQYGGRVSS-MTGQQLFPPQNKVSLASPNQGVWDMRGKQFFTGVEIRV  536
            MEVRGRVLPPPKLQYGGRVS+ +TGQQLFPPQNKVSLASPNQGVWDMRGKQFFTGVEIR+
Sbjct  481  MEVRGRVLPPPKLQYGGRVSTGLTGQQLFPPQNKVSLASPNQGVWDMRGKQFFTGVEIRI  540

Query  537  WAIACFAPQRTVREDALRNFTQQLQKISNDAGMPIIGQPCFCKYATGPDQVEPMFRYLKN  596
            WAIACFAPQRTVREDALRNFTQQLQKISNDAGMPIIGQPCFCKYATGPDQVEPMFRYLK 
Sbjct  541  WAIACFAPQRTVREDALRNFTQQLQKISNDAGMPIIGQPCFCKYATGPDQVEPMFRYLKI  600

Query  597  SFNALQLVVVVLPGKTPVYAEVKRVGDTVLGMATQCVQAKNVNKTSPQTLSNLCLKINVK  656
            +F  LQLVVVVLPGKTPVYAEVKRVGDTVLGMATQCVQAKNVNKTSPQTLSNLCLKINVK
Sbjct  601  TFPGLQLVVVVLPGKTPVYAEVKRVGDTVLGMATQCVQAKNVNKTSPQTLSNLCLKINVK  660

Query  657  LGGINSILVPSIRPKVFNEPVIFLGADVTHPPAGDNKKPSIAAVVGSMDAHPSRYAATVR  716
            LGGINSILVPSIRPKVFNEPVIFLGADVTHPPAGDNKKPSIAAVVGSMDAHPSRYAATVR
Sbjct  661  LGGINSILVPSIRPKVFNEPVIFLGADVTHPPAGDNKKPSIAAVVGSMDAHPSRYAATVR  720

Query  717  VQQHRQEIIQELSSMVRELLIMFYKSTGGYKPHRIILYRDGVSEGQFPHVLQHELTAIRE  776
            VQQHRQEIIQELSSMVRELLIMFYKSTGGYKPHRIILYRDGVSEGQFPHVLQHELTAIRE
Sbjct  721  VQQHRQEIIQELSSMVRELLIMFYKSTGGYKPHRIILYRDGVSEGQFPHVLQHELTAIRE  780

Query  777  ACIKLEADYRPGITFIVVQKRHHTRLFCAEKKEQSGKSGNIPAGTTVDVGITHPTEFDFY  836
            ACIKLE +YRPGITFIVVQKRHHTRLFCAEKKEQSGKSGNIPAGTTVDVGITHPTEFDFY
Sbjct  781  ACIKLEPEYRPGITFIVVQKRHHTRLFCAEKKEQSGKSGNIPAGTTVDVGITHPTEFDFY  840

Query  837  LCSHQGIQGTSRPSHYHVLWDDNHFDSDELQCLTYQLCHTYVRCTRSVSIPAPAYYAHLV  896
            LCSHQGIQGTSRPSHYHVLWDDNHFDSDELQCLTYQLCHTYVRCTRSVSIPAPAYYAHLV
Sbjct  841  LCSHQGIQGTSRPSHYHVLWDDNHFDSDELQCLTYQLCHTYVRCTRSVSIPAPAYYAHLV  900

Query  897  AFRARYHLVEKEHDSGEGSHQSGCSEDRTPGAMARAITVHADTKKVMYFA  946
            AFRARYHLVEKEHDSGEGSHQSGCSEDRTPGAMARAITVHADTKKVMYFA
Sbjct  901  AFRARYHLVEKEHDSGEGSHQSGCSEDRTPGAMARAITVHADTKKVMYFA  950


>Q32KD4_DROME unnamed protein product
Length=984

 Score = 1850 bits (4793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 896/944 (95%), Positives = 912/944 (97%), Gaps = 4/944 (0%)

Query  7    QSQWTPSPPRPQSPTQSQTSFENLTSPPATGSSVNPTAVTSPSAQNVAVGGATVGGAGAA  66
            +SQWTPSP RPQSP+Q+QTSF+ LTSPPA GSSVNPTAVTSPSAQNVA GGATV GA A 
Sbjct  41   ESQWTPSPTRPQSPSQAQTSFDTLTSPPAPGSSVNPTAVTSPSAQNVAAGGATVAGAAAT  100

Query  67   GLATQ---ASAVASPLGATAAASPTTQPELPVFTCPRRPNLGREGRPIVLRANHFQVSMP  123
                     +   S   A A A+P TQP++PVFTCPRRPNLGREGRPIVLRANHFQV+MP
Sbjct  101  AAQVASALGATTGSVTPAIATATPATQPDMPVFTCPRRPNLGREGRPIVLRANHFQVTMP  160

Query  124  RGYVHHYDINIQPDKCPRKVNREIIETMVHAYSKIFGVLKPVFDGRNNLYTRDPLPIGND  183
            RGYVHHYDINIQPDKCPRKVNREIIETMVHAYSKIFGVLKPVFDGRNNLYTRDPLPIGN+
Sbjct  161  RGYVHHYDINIQPDKCPRKVNREIIETMVHAYSKIFGVLKPVFDGRNNLYTRDPLPIGNE  220

Query  184  RLELEVTLPGEGKDRIFRVTIKWMAQVSLFNLEEALEGRTRQIPYDAILALDVVMRHLPS  243
            RLELEVTLPGEGKDRIFRVTIKW AQVSLFNLEEALEGRTRQIPYDAILALDVVMRHLPS
Sbjct  221  RLELEVTLPGEGKDRIFRVTIKWQAQVSLFNLEEALEGRTRQIPYDAILALDVVMRHLPS  280

Query  244  MTYTPVGRSFFSSPDGYYHPLGGGREVWFGFHQSVRPSQWKMMLNIDVSATAFYKAQPVI  303
            MTYTPVGRSFFSSP+GYYHPLGGGREVWFGFHQSVRPSQWKMMLNIDVSATAFYKAQPVI
Sbjct  281  MTYTPVGRSFFSSPEGYYHPLGGGREVWFGFHQSVRPSQWKMMLNIDVSATAFYKAQPVI  340

Query  304  DFMCEVLDIRDINEQRKPLTDSQRVKFTKEIKGLKIEITHCGAMRRKYRVCNVTRRPAQM  363
            DFMCEVLDIRDINEQRKPLTDSQRVKFTKEIKGLKIEITHCG MRRKYRVCNVTRRPAQM
Sbjct  341  DFMCEVLDIRDINEQRKPLTDSQRVKFTKEIKGLKIEITHCGQMRRKYRVCNVTRRPAQM  400

Query  364  QSFPLQLENGQTVECTVAKYFLDKYRMKLRYPHLPCLQVGQEHKHTYLPLEVCNIVAGQR  423
            QSFPLQLENGQTVECTVAKYFLDKYRMKLRYPHLPCLQVGQEHKHTYLPLEVCNIVAGQR
Sbjct  401  QSFPLQLENGQTVECTVAKYFLDKYRMKLRYPHLPCLQVGQEHKHTYLPLEVCNIVAGQR  460

Query  424  CIKKLTDMQTSTMIKATARSAPDREREINNLVKRADFNNDSYVQEFGLTISNSMMEVRGR  483
            CIKKLTDMQTSTMIKATARSAPDREREINNLVKRADFNNDSYVQEFGLTISNSMMEVRGR
Sbjct  461  CIKKLTDMQTSTMIKATARSAPDREREINNLVKRADFNNDSYVQEFGLTISNSMMEVRGR  520

Query  484  VLPPPKLQYGGRVSS-MTGQQLFPPQNKVSLASPNQGVWDMRGKQFFTGVEIRVWAIACF  542
            VLPPPKLQYGGRVS+ +TGQQLFPPQNKVSLASPNQGVWDMRGKQFFTGVEIR+WAIACF
Sbjct  521  VLPPPKLQYGGRVSTGLTGQQLFPPQNKVSLASPNQGVWDMRGKQFFTGVEIRIWAIACF  580

Query  543  APQRTVREDALRNFTQQLQKISNDAGMPIIGQPCFCKYATGPDQVEPMFRYLKNSFNALQ  602
            APQRTVREDALRNFTQQLQKISNDAGMPIIGQPCFCKYATGPDQVEPMFRYLK +F  LQ
Sbjct  581  APQRTVREDALRNFTQQLQKISNDAGMPIIGQPCFCKYATGPDQVEPMFRYLKITFPGLQ  640

Query  603  LVVVVLPGKTPVYAEVKRVGDTVLGMATQCVQAKNVNKTSPQTLSNLCLKINVKLGGINS  662
            LVVVVLPGKTPVYAEVKRVGDTVLGMATQCVQAKNVNKTSPQTLSNLCLKINVKLGGINS
Sbjct  641  LVVVVLPGKTPVYAEVKRVGDTVLGMATQCVQAKNVNKTSPQTLSNLCLKINVKLGGINS  700

Query  663  ILVPSIRPKVFNEPVIFLGADVTHPPAGDNKKPSIAAVVGSMDAHPSRYAATVRVQQHRQ  722
            ILVPSIRPKVFNEPVIFLGADVTHPPAGDNKKPSIAAVVGSMDAHPSRYAATVRVQQHRQ
Sbjct  701  ILVPSIRPKVFNEPVIFLGADVTHPPAGDNKKPSIAAVVGSMDAHPSRYAATVRVQQHRQ  760

Query  723  EIIQELSSMVRELLIMFYKSTGGYKPHRIILYRDGVSEGQFPHVLQHELTAIREACIKLE  782
            EIIQELSSMVRELLIMFYKSTGGYKPHRIILYRDGVSEGQFPHVLQHELTAIREACIKLE
Sbjct  761  EIIQELSSMVRELLIMFYKSTGGYKPHRIILYRDGVSEGQFPHVLQHELTAIREACIKLE  820

Query  783  ADYRPGITFIVVQKRHHTRLFCAEKKEQSGKSGNIPAGTTVDVGITHPTEFDFYLCSHQG  842
             +YRPGITFIVVQKRHHTRLFCAEKKEQSGKSGNIPAGTTVDVGITHPTEFDFYLCSHQG
Sbjct  821  PEYRPGITFIVVQKRHHTRLFCAEKKEQSGKSGNIPAGTTVDVGITHPTEFDFYLCSHQG  880

Query  843  IQGTSRPSHYHVLWDDNHFDSDELQCLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARY  902
            IQGTSRPSHYHVLWDDNHFDSDELQCLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARY
Sbjct  881  IQGTSRPSHYHVLWDDNHFDSDELQCLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARY  940

Query  903  HLVEKEHDSGEGSHQSGCSEDRTPGAMARAITVHADTKKVMYFA  946
            HLVEKEHDSGEGSHQSGCSEDRTPGAMARAITVHADTKKVMYFA
Sbjct  941  HLVEKEHDSGEGSHQSGCSEDRTPGAMARAITVHADTKKVMYFA  984


>S4W2D1_LOCMI unnamed protein product
Length=848

 Score = 1728 bits (4475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 819/855 (96%), Positives = 836/855 (98%), Gaps = 7/855 (1%)

Query  92   ELPVFTCPRRPNLGREGRPIVLRANHFQVSMPRGYVHHYDINIQPDKCPRKVNREIIETM  151
            ELP+F CPRRPNLGREGRPIVLRANHFQ+SMPRG+VHHYDINIQPDKCPRKVNREIIETM
Sbjct  1    ELPMFNCPRRPNLGREGRPIVLRANHFQISMPRGFVHHYDINIQPDKCPRKVNREIIETM  60

Query  152  VHAYSKIFGVLKPVFDGRNNLYTRDPLPIGNDRLELEVTLPGEGKDRIFRVTIKWMAQVS  211
            VHAYSKIFG LKPVFDGRNNLYTRDPLPIGNDR+ELEVTLPGEGKDR+FRVTIKW+AQVS
Sbjct  61   VHAYSKIFGTLKPVFDGRNNLYTRDPLPIGNDRVELEVTLPGEGKDRVFRVTIKWIAQVS  120

Query  212  LFNLEEALEGRTRQIPYDAILALDVVMRHLPSMTYTPVGRSFFSSPDGYYHPLGGGREVW  271
            LF LEEALEGRTRQIPYDAILALDVVMRHLPSMTYTPVGRSFFSSPDGYYHPLGGGREVW
Sbjct  121  LFALEEALEGRTRQIPYDAILALDVVMRHLPSMTYTPVGRSFFSSPDGYYHPLGGGREVW  180

Query  272  FGFHQSVRPSQWKMMLNIDVSATAFYKAQPVIDFMCEVLDIRDINEQRKPLTDSQRVKFT  331
            FGFHQSVRPSQWKMMLNIDVSATAFYKAQPVI+FMCEVLDIRDINEQRKPLTDSQRVKFT
Sbjct  181  FGFHQSVRPSQWKMMLNIDVSATAFYKAQPVIEFMCEVLDIRDINEQRKPLTDSQRVKFT  240

Query  332  KEIKGLKIEITHCGAMRRKYRVCNVTRRPAQMQSFPLQLENGQTVECTVAKYFLDKYRMK  391
            KEIKGLKIEITHCG MRRKYRVCNVTRRPAQMQSFPLQLENGQTVECTVAKYFLDKY+MK
Sbjct  241  KEIKGLKIEITHCGTMRRKYRVCNVTRRPAQMQSFPLQLENGQTVECTVAKYFLDKYKMK  300

Query  392  LRYPHLPCLQVGQEHKHTYLPLEVCNIVAGQRCIKKLTDMQTSTMIKATARSAPDREREI  451
            LRYPHLPCLQVGQEHKHTYLPLEVCNIVAGQRCIKKLTDMQTSTMIKATARSAPDREREI
Sbjct  301  LRYPHLPCLQVGQEHKHTYLPLEVCNIVAGQRCIKKLTDMQTSTMIKATARSAPDREREI  360

Query  452  NNLVKRADFNNDSYVQEFGLTISNSMMEVRGRVLPPPKLQYGGRVSSMTGQQLFPPQNKV  511
            N+LV+RADFNND+YVQEFGLTISN+MMEVRGRVLPPPKLQYGGRVSS++GQ         
Sbjct  361  NSLVRRADFNNDAYVQEFGLTISNNMMEVRGRVLPPPKLQYGGRVSSLSGQ-------TK  413

Query  512  SLASPNQGVWDMRGKQFFTGVEIRVWAIACFAPQRTVREDALRNFTQQLQKISNDAGMPI  571
              A PNQGVWDMRGKQFFTGVEIRVWAIACFAPQRTVREDALRNFTQQLQKISNDAGMPI
Sbjct  414  QQAMPNQGVWDMRGKQFFTGVEIRVWAIACFAPQRTVREDALRNFTQQLQKISNDAGMPI  473

Query  572  IGQPCFCKYATGPDQVEPMFRYLKNSFNALQLVVVVLPGKTPVYAEVKRVGDTVLGMATQ  631
            IGQPCFCKYATGPDQVEPMFRYLK+SF ALQLVVVVLPGKTPVYAEVKRVGDTVLGMATQ
Sbjct  474  IGQPCFCKYATGPDQVEPMFRYLKSSFTALQLVVVVLPGKTPVYAEVKRVGDTVLGMATQ  533

Query  632  CVQAKNVNKTSPQTLSNLCLKINVKLGGINSILVPSIRPKVFNEPVIFLGADVTHPPAGD  691
            CVQAKNVNKTSPQTLSNLCLKINVKLGGINSILVPSIRPKVFNEPVIFLGADVTHPPAGD
Sbjct  534  CVQAKNVNKTSPQTLSNLCLKINVKLGGINSILVPSIRPKVFNEPVIFLGADVTHPPAGD  593

Query  692  NKKPSIAAVVGSMDAHPSRYAATVRVQQHRQEIIQELSSMVRELLIMFYKSTGGYKPHRI  751
            NKKPSIAAVVGSMDAHPSRYAATVRVQQHRQEIIQELSSMVRELLIMFYKSTGGYKPHRI
Sbjct  594  NKKPSIAAVVGSMDAHPSRYAATVRVQQHRQEIIQELSSMVRELLIMFYKSTGGYKPHRI  653

Query  752  ILYRDGVSEGQFPHVLQHELTAIREACIKLEADYRPGITFIVVQKRHHTRLFCAEKKEQS  811
            ILYRDGVSEGQF HVLQHELTAIREACIKLE DY+PGITFIVVQKRHHTRLFCA+KKEQS
Sbjct  654  ILYRDGVSEGQFLHVLQHELTAIREACIKLEGDYKPGITFIVVQKRHHTRLFCADKKEQS  713

Query  812  GKSGNIPAGTTVDVGITHPTEFDFYLCSHQGIQGTSRPSHYHVLWDDNHFDSDELQCLTY  871
            GKSGNIPAGTTVDVGITHPTEFDFYLCSHQGIQGTSRPSHYHVLWDDNHFDSDELQCLTY
Sbjct  714  GKSGNIPAGTTVDVGITHPTEFDFYLCSHQGIQGTSRPSHYHVLWDDNHFDSDELQCLTY  773

Query  872  QLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVEKEHDSGEGSHQSGCSEDRTPGAMAR  931
            QLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVEKEHDSGEGSHQSGCSEDRTPGAMAR
Sbjct  774  QLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVEKEHDSGEGSHQSGCSEDRTPGAMAR  833

Query  932  AITVHADTKKVMYFA  946
            AITVHADTKKVMYFA
Sbjct  834  AITVHADTKKVMYFA  848



Lambda      K        H
   0.322    0.131    0.423 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1518059526


Query= XP_014085216.1 PREDICTED: anaphase-promoting complex subunit 5
[Bactrocera oleae]

Length=759
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8MRX0_DROME  unnamed protein product                                 723     0.0  
Q9VZL2_DROME  unnamed protein product                                 716     0.0  
Q8TA45_DROME  unnamed protein product                                 677     0.0  


>Q8MRX0_DROME unnamed protein product
Length=777

 Score = 723 bits (1865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/759 (51%), Positives = 522/759 (69%), Gaps = 13/759 (2%)

Query  3    YEELEALDPRNTTYATRIETPPPHKVAVLILVQQYLKVKNAATDAGVAYPLQARRNFCML  62
            +EEL+ LDP       RIETP  HK+ VLIL++QY+  K    D G++   Q RR F ML
Sbjct  25   FEELDTLDPSFKLEPPRIETPTAHKITVLILLKQYVINKKNCLDTGISMRTQRRRMFYML  84

Query  63   LLKLIQYPDMTYNDLYQLLTSPRYKINALHLESFEKAMSNIFTLGIETLCDFAERQNWDN  122
            + KLIQ  D +YN+L+ LLT+ +YK++ L LESFEKAMS      IE L DF+E QN D 
Sbjct  85   VFKLIQEQDKSYNELHSLLTTGKYKLDTLMLESFEKAMSEFCAGSIEALFDFSEIQNIDE  144

Query  123  LLSEELGVSQFSIVGLYIRRVCVILERMSFPEIMALYKNICLYYEKGVRTLAIGPRR-VG  181
            +L+E  G+SQFS+VG+Y+RRV V+LER+SFPE+M +YKN+C YYE+GVR  A G R  V 
Sbjct  145  ILNENYGISQFSMVGVYVRRVGVVLERLSFPEMMDMYKNVCSYYERGVRAAASGSRMAVA  204

Query  182  GALTSAQDNLFPHAGGRGSDDPGNTLEESALDTETVHQDRNPHSKWSPKQADLFVAQQCK  241
            G +   ++   P+      +DP    +  A+    + Q+RNP SKW+PKQA  F+ +Q +
Sbjct  205  GGILHREETPPPNPITEKPEDPKPKKKVEAV--ARIAQERNPLSKWAPKQAKFFINKQSE  262

Query  242  LLENNELRALPPIDLQTKINEIIQDNPLNSQAYFLGYMNQLRLRDFYGAMDALHRAFDRS  301
            LLENNE +ALPP++LQ K+ EII D PL +  YFLGYMNQLR+RD+Y A+ ALHRA DRS
Sbjct  263  LLENNERKALPPLELQKKVQEIIHDLPLTTTPYFLGYMNQLRVRDYYNALSALHRALDRS  322

Query  302  PMQTATQYEQKGFQYFSVNLAVLHACFDHRREALNALKECIMLAQECGDKRCLDLANSWY  361
            P++  +Q  +KG+QYF VNLAVLHA F HR EAL AL+E IMLAQE GDKR L+LAN+WY
Sbjct  323  PVRLMSQ--EKGYQYFCVNLAVLHATFGHRDEALAALRESIMLAQEHGDKRSLNLANTWY  380

Query  362  CLLNSN-KIDPFEKSLPDIQ--DPGLVQSLSLAIQYVVKFGAQCGYLPLDLFELLLKSDE  418
            CLL     +   +KS+ D    D  L+Q+ +LA+ + VK G   GY PL LF+LL  SD 
Sbjct  381  CLLRDELPLSAVQKSVQDANEVDGSLLQNYTLALHFAVKLGTVAGYQPLRLFDLLQHSDN  440

Query  419  LNNKNSILEHASDSLALRSALWCLYGRHEISSLYAQLLLQLKKTWAFGDIGNSESVSKVL  478
            L N+N+  +HAS++LALRSA+W  YGRHE+++LY+Q+LL  +  +  G  G    +   L
Sbjct  441  LTNRNNFADHASEALALRSAVWSAYGRHELAALYSQVLLTGRDRFGSGSAG----LGSAL  496

Query  479  ASLSLWLNVQGEHQMSAVVQSHARSRFPRHPNAKNWMISEYHIVIQQCIYRCRWQEALKA  538
            AS +LWL +QGE Q+S V+  HA+ RFPR P+A+ WMIS+ H+VIQ  IY+CRW +ALKA
Sbjct  497  ASFALWLQLQGEPQLSKVLLHHAKQRFPRLPSAEGWMISQCHVVIQAGIYQCRWHDALKA  556

Query  539  CSQLYLLDKNAGNLQHASVYIAKGYLNTARRIICKLQHSANLDVLTQVRVLVLQAYATIG  598
            C QLYL+D +    Q AS+Y+AK     ARR++ KL    N+  L ++RV VL  Y  + 
Sbjct  557  CDQLYLIDPSDSLFQRASIYVAKREFFNARRLLDKLAVQDNIPFLLRMRVQVLLGYCGMA  616

Query  599  EDTVSSETAEFLIRASVLATSAYMEYEQAVIDMVLAQVLLKMKMPQKAFQAAKNCMEKIY  658
                SSET   L+R S   + A M+YE A++D++LAQ LL + MPQKA+QA K CM  I+
Sbjct  617  NGRFSSETTMLLLRVSEEMSEAQMDYELALVDLLLAQQLLLLGMPQKAYQAIKRCMHDIH  676

Query  659  ENGGIYDRAKMDFIFVCCMVAASESDA-RKKVNLQKGISILERAVVCFKKLEAHAKVLDI  717
             NGG+Y+RAK DF+FV C++A +++DA ++K  L K   IL+RA   FKKL AHAKVLD+
Sbjct  677  INGGLYERAKTDFVFVRCLLAVNQNDAEKRKAQLLKSQVILQRAAQSFKKLSAHAKVLDV  736

Query  718  FVYLAKTYHELNELDERNKYACKFKHYYTEYPIAREYLG  756
            +V+LA+ ++E  + + RNKYA +F+ Y+T++PI REYLG
Sbjct  737  YVFLAQRFNEFGDRNLRNKYAGEFRRYFTDHPIPREYLG  775


>Q9VZL2_DROME unnamed protein product
Length=777

 Score = 716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/759 (51%), Positives = 521/759 (69%), Gaps = 13/759 (2%)

Query  3    YEELEALDPRNTTYATRIETPPPHKVAVLILVQQYLKVKNAATDAGVAYPLQARRNFCML  62
            +EEL+ LDP       RIETP  HK+ VLIL++QY+  K    D G++   Q RR F ML
Sbjct  25   FEELDTLDPSFKLEPPRIETPTAHKITVLILLKQYVINKKNCLDTGISMRTQRRRMFYML  84

Query  63   LLKLIQYPDMTYNDLYQLLTSPRYKINALHLESFEKAMSNIFTLGIETLCDFAERQNWDN  122
            + KLIQ  D +YN+L+ LLT+ +YK++ L LESFEKAMS      IE L DF+E QN D 
Sbjct  85   VFKLIQEQDKSYNELHSLLTTGKYKLDTLMLESFEKAMSEFCAGSIEALFDFSEIQNIDE  144

Query  123  LLSEELGVSQFSIVGLYIRRVCVILERMSFPEIMALYKNICLYYEKGVRTLAIGPRR-VG  181
            +L+E  G+SQFS+VG+Y+RRV V+LER+SFPE+M +YKN+C YYE+GVR  A G R  V 
Sbjct  145  ILNENYGISQFSMVGVYVRRVGVVLERLSFPEMMDMYKNVCSYYERGVRAAASGSRMAVA  204

Query  182  GALTSAQDNLFPHAGGRGSDDPGNTLEESALDTETVHQDRNPHSKWSPKQADLFVAQQCK  241
            G +   ++   P+      +DP    +  A+    + Q+RNP SKW+PKQA  F+ +Q +
Sbjct  205  GGILHREETPPPNPITEKPEDPKPKKKVEAV--ARIAQERNPLSKWAPKQAKFFINKQSE  262

Query  242  LLENNELRALPPIDLQTKINEIIQDNPLNSQAYFLGYMNQLRLRDFYGAMDALHRAFDRS  301
            LLENNE +ALPP++LQ K+ EII D PL +  YFLGYMNQLR+RD+Y A+ ALHRA DRS
Sbjct  263  LLENNERKALPPLELQKKVQEIIHDLPLTTTPYFLGYMNQLRVRDYYNALSALHRALDRS  322

Query  302  PMQTATQYEQKGFQYFSVNLAVLHACFDHRREALNALKECIMLAQECGDKRCLDLANSWY  361
            P++  +Q  +KG+QYF VNLAVLHA F HR EAL AL+E IMLAQE GDKR L+LAN+WY
Sbjct  323  PVRLMSQ--EKGYQYFCVNLAVLHATFGHRDEALAALRESIMLAQEHGDKRSLNLANTWY  380

Query  362  CLLNSN-KIDPFEKSLPDIQ--DPGLVQSLSLAIQYVVKFGAQCGYLPLDLFELLLKSDE  418
            CLL     +   +KS+ D    D  L+Q+ +LA+ + VK G   GY PL LF+LL  SD 
Sbjct  381  CLLRDELPLSAVQKSVQDANEVDGSLLQNYTLALHFAVKLGTVAGYQPLRLFDLLQHSDN  440

Query  419  LNNKNSILEHASDSLALRSALWCLYGRHEISSLYAQLLLQLKKTWAFGDIGNSESVSKVL  478
            L N+N+  +HAS++LALRSA+W  YGRHE+++LY+Q+LL  +  +  G  G    +   L
Sbjct  441  LTNRNNFADHASEALALRSAVWSAYGRHELAALYSQVLLTGRDRFGSGSAG----LGSAL  496

Query  479  ASLSLWLNVQGEHQMSAVVQSHARSRFPRHPNAKNWMISEYHIVIQQCIYRCRWQEALKA  538
            AS +LWL +QGE Q+S V+  HA+ RFPR P+A+ WMIS+ H+VIQ  IY+CRW +ALKA
Sbjct  497  ASFALWLQLQGEPQLSKVLLHHAKQRFPRLPSAEGWMISQCHVVIQAGIYQCRWHDALKA  556

Query  539  CSQLYLLDKNAGNLQHASVYIAKGYLNTARRIICKLQHSANLDVLTQVRVLVLQAYATIG  598
            C QLYL+D +    Q AS+Y+AK     ARR++ KL    N+  L ++RV VL  Y  + 
Sbjct  557  CDQLYLIDPSDSLFQRASIYVAKREFFNARRLLDKLAVQDNIPFLLRMRVQVLLGYCGMA  616

Query  599  EDTVSSETAEFLIRASVLATSAYMEYEQAVIDMVLAQVLLKMKMPQKAFQAAKNCMEKIY  658
                SSET   L+R S   + A M+YE A++D++LA  LL + MPQKA+QA K CM  I+
Sbjct  617  NGRFSSETTMLLLRVSEEMSEAQMDYELALVDLLLALQLLLLGMPQKAYQAIKRCMHDIH  676

Query  659  ENGGIYDRAKMDFIFVCCMVAASESDA-RKKVNLQKGISILERAVVCFKKLEAHAKVLDI  717
             NGG+Y+RAK DF+FV C++A +++DA ++K  L K   IL+RA   FKKL AHAKVLD+
Sbjct  677  INGGLYERAKTDFVFVRCLLAVNQNDAEKRKAQLLKSQVILQRAAQSFKKLSAHAKVLDV  736

Query  718  FVYLAKTYHELNELDERNKYACKFKHYYTEYPIAREYLG  756
            +V+LA+ ++E  + + RNKYA +F+ Y+T++PI REYLG
Sbjct  737  YVFLAQRFNEFGDRNLRNKYAGEFRRYFTDHPIPREYLG  775


>Q8TA45_DROME unnamed protein product
Length=751

 Score = 677 bits (1746),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/720 (51%), Positives = 490/720 (68%), Gaps = 13/720 (2%)

Query  3    YEELEALDPRNTTYATRIETPPPHKVAVLILVQQYLKVKNAATDAGVAYPLQARRNFCML  62
            +EEL+ LDP       RIETP  HK+ VLIL++QY+  K    D G++   Q RR F ML
Sbjct  25   FEELDTLDPSFKLEPPRIETPTAHKITVLILLKQYVINKKNCLDTGISMRTQRRRMFYML  84

Query  63   LLKLIQYPDMTYNDLYQLLTSPRYKINALHLESFEKAMSNIFTLGIETLCDFAERQNWDN  122
            + KLIQ  D +YN+L+ LLT+ +YK++ L LESFEKAMS      IE L DF+E QN D 
Sbjct  85   VFKLIQEQDKSYNELHSLLTTGKYKLDTLMLESFEKAMSEFCAGSIEALFDFSEIQNIDE  144

Query  123  LLSEELGVSQFSIVGLYIRRVCVILERMSFPEIMALYKNICLYYEKGVRTLAIGPRR-VG  181
            +L+E  G+SQFS+VG+Y+RRV V+LER+SFPE+M +YKN+C YYE+GVR  A G R  V 
Sbjct  145  ILNENYGISQFSMVGVYVRRVGVVLERLSFPEMMDMYKNVCSYYERGVRAAASGSRMAVA  204

Query  182  GALTSAQDNLFPHAGGRGSDDPGNTLEESALDTETVHQDRNPHSKWSPKQADLFVAQQCK  241
            G +   ++   P+      +DP    +  A+    + Q+RNP SKW+PKQA  F+ +Q +
Sbjct  205  GGILHREETPPPNPITEKPEDPKPKKKVEAV--ARIAQERNPMSKWAPKQAKFFINKQSE  262

Query  242  LLENNELRALPPIDLQTKINEIIQDNPLNSQAYFLGYMNQLRLRDFYGAMDALHRAFDRS  301
            LLENNE +ALPP++LQ K+ EII D PL +  YFLGYMN+LR+RD+Y A+ ALHRA DRS
Sbjct  263  LLENNERKALPPLELQKKVQEIIHDLPLTTTPYFLGYMNRLRVRDYYNALSALHRALDRS  322

Query  302  PMQTATQYEQKGFQYFSVNLAVLHACFDHRREALNALKECIMLAQECGDKRCLDLANSWY  361
            P++  +Q  +KG+QYF VNLAVLHA F HR EAL AL+E IMLAQE GDKR L+LAN+WY
Sbjct  323  PVRLMSQ--EKGYQYFCVNLAVLHATFGHRDEALAALRESIMLAQEHGDKRSLNLANTWY  380

Query  362  CLLNSN-KIDPFEKSLPDIQ--DPGLVQSLSLAIQYVVKFGAQCGYLPLDLFELLLKSDE  418
            CLL     +   +KS+ D    D  L+Q+ +LA+ + VK G   GY PL LF+LL  SD 
Sbjct  381  CLLRDELPLSAVQKSVQDANEVDGSLLQNYTLALHFAVKLGTVAGYQPLRLFDLLQHSDN  440

Query  419  LNNKNSILEHASDSLALRSALWCLYGRHEISSLYAQLLLQLKKTWAFGDIGNSESVSKVL  478
            L N+N+  +HAS++LALRSA+W  YGRHE+++LY+Q+LL  +  +  G  G    +   L
Sbjct  441  LTNRNNFADHASEALALRSAVWSAYGRHELAALYSQVLLTGRDRFGSGSAG----LGSAL  496

Query  479  ASLSLWLNVQGEHQMSAVVQSHARSRFPRHPNAKNWMISEYHIVIQQCIYRCRWQEALKA  538
            AS +LWL +QGE Q+S V+  HA+ RFPR P+A+ WMIS+ H+VIQ  IY+CRW +ALKA
Sbjct  497  ASFALWLQLQGEPQLSKVLLHHAKQRFPRLPSAEGWMISQCHVVIQAGIYQCRWHDALKA  556

Query  539  CSQLYLLDKNAGNLQHASVYIAKGYLNTARRIICKLQHSANLDVLTQVRVLVLQAYATIG  598
            C QLYL+D +    Q AS+Y+AK     ARR++ KL    N+  L ++RV VL  Y  + 
Sbjct  557  CDQLYLIDPSDSLFQRASIYVAKREFFNARRLLDKLAVQDNIPFLLRMRVQVLLGYCGMA  616

Query  599  EDTVSSETAEFLIRASVLATSAYMEYEQAVIDMVLAQVLLKMKMPQKAFQAAKNCMEKIY  658
                SSET   L+R S   + A M+YE A++D++LAQ LL + MPQKA+QA K CM  I+
Sbjct  617  NGRFSSETTMLLLRVSEEMSEAQMDYELALVDLLLAQQLLLLGMPQKAYQAIKRCMHDIH  676

Query  659  ENGGIYDRAKMDFIFVCCMVAASESDARK-KVNLQKGISILERAVVCFKKLEAHAKVLDI  717
             NGG+Y+RAK DF+FV C++A +++DA K K  L K   IL+RA   FKKL AHAKVLD+
Sbjct  677  INGGLYERAKTDFVFVRCLLAVNQNDAEKRKAQLLKSQVILQRAAQSFKKLSAHAKVLDV  736



Lambda      K        H
   0.322    0.131    0.423 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1518059526


Query= XP_014085217.1 PREDICTED: proteasomal ubiquitin receptor ADRM1
homolog [Bactrocera oleae]

Length=374
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ADRM1_DROME  unnamed protein product                                  481     8e-171
ADRM1_CAEEL  unnamed protein product                                  189     1e-56 
ADRM1_DICDI  unnamed protein product                                  81.3    3e-17 


>ADRM1_DROME unnamed protein product
Length=389

 Score = 481 bits (1239),  Expect = 8e-171, Method: Compositional matrix adjust.
 Identities = 255/368 (69%), Positives = 300/368 (82%), Gaps = 10/368 (3%)

Query  1    MFGRQSGIGGGNTSSSSNLVEFRAGRMNMIGKMVHPDARKGLVYLTQSEDGLMHFCWKDR  60
            MFGRQSG+G  ++S+SSNLVEFRAGRMNM+GKMVHPD RKGLVY+TQS+DGLMHFCWKDR
Sbjct  1    MFGRQSGLG--SSSNSSNLVEFRAGRMNMVGKMVHPDPRKGLVYMTQSDDGLMHFCWKDR  58

Query  61   TTGKVEDDLIVFPDDFEFKRVEQCKTGRVYVLKFKSSSRRMFFWMQEPKIEKDDELCRRV  120
            T+GKVEDDLIVFPDDFE+KRV+QCKTGRVYVLKFKSS+RRMFFWMQEPK +KDDE CRR+
Sbjct  59   TSGKVEDDLIVFPDDFEYKRVDQCKTGRVYVLKFKSSTRRMFFWMQEPKTDKDDEQCRRI  118

Query  121  NELMNNPPS-QQR--NNSDNGDLQYMLNNMSQQQLMQLFGGVGQMGGLTSLLGSMNRSEN  177
            NEL+NNPPS  QR    S++GDLQYMLNNMSQQQLMQLFGGVGQMGGL+SLLG MN    
Sbjct  119  NELLNNPPSAHQRGGGGSNDGDLQYMLNNMSQQQLMQLFGGVGQMGGLSSLLGQMNSRTP  178

Query  178  SSRTPARSGSNNAASNLLTPESNTAPKTPSAPKGKGSNRSSAGATTT---NVNTNLSTTA  234
            SSR    S     AS L TPE+ + P+TPSAP   GS+RSS+   +       +++   A
Sbjct  179  SSRN-TSSSGGGGASALQTPENVSVPRTPSAPSKSGSSRSSSNVNSQVGEGAGSSVDADA  237

Query  235  -SRTLSVDLSTAIQGSEAINQIISDPERAKTLSVHLPESEDADENKKQQIKDTIASPQFQ  293
              R+L++DLSTA+ G++AINQII+DPE  KTL VHLPESED D+++KQQIKD I SPQFQ
Sbjct  238  PGRSLNIDLSTALPGADAINQIIADPEHVKTLIVHLPESEDVDDDRKQQIKDNITSPQFQ  297

Query  294  QALSLFSNALQSAQLGPVVSQFELTAEAVAAAYAGNLEDFVKALEKSLPAGATMDTTKAK  353
            QAL+ FS+ALQSAQLGPV+ QFEL+ EAVAAA++GNLEDFV+ALEKSLP GATM    + 
Sbjct  298  QALAQFSSALQSAQLGPVIKQFELSNEAVAAAFSGNLEDFVRALEKSLPPGATMGGKPSA  357

Query  354  ESDKDKEP  361
               K  +P
Sbjct  358  SEKKASDP  365


>ADRM1_CAEEL unnamed protein product
Length=374

 Score = 189 bits (480),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 129/378 (34%), Positives = 200/378 (53%), Gaps = 37/378 (10%)

Query  14   SSSSNLVEFRAGRMNMIG------KMVHPDARKGLVYLTQSEDGLMHFCWKDRTTGKVED  67
            SSS ++VEF+AGR  +        + V  + +KGLV++ QS D L+HFCWKDR TG V D
Sbjct  13   SSSGHIVEFKAGRSRLEAGSGDTMRKVVAEPKKGLVFIKQSNDMLIHFCWKDRETGAVVD  72

Query  68   DLIVFPDDFEFKRVEQCKTGRVYVLKFKSSSRRMFFWMQEPKIEKDDELCRRVNELMNNP  127
            DLI+FPDD EFK V  C  G+VY+LKFKS   ++ FW+Q+   + D +L ++V + +N P
Sbjct  73   DLIIFPDDAEFKAVPGCPDGKVYMLKFKSGDMKL-FWIQDSTPDVDKDLVKKVTDALNKP  131

Query  128  P------SQQRNNSDNGDLQYMLNNM-SQQQLMQLFGGVGQMGGLTSLLGSMNRSENSSR  180
            P      S+   ++ N D Q    ++ S   +    GG+ Q G L SL+ S+ +  NS  
Sbjct  132  PTSRPAASRSAGSNANTDRQSAGGSLISSSDMNAPLGGIDQ-GQLMSLIQSL-QGGNSDT  189

Query  181  TPARSGSNNAASNLLTPESNTAPKTPSAPKGKGSNRSSAGATTTNVNTNLSTTASRTLSV  240
             P  S      +   + E++  P T +A +G  +  S        +  NL  +  + ++V
Sbjct  190  LPISSVPRGEDA---SSEADCEPSTNAAEEGSSNPLSLNNPAIQQIFNNLGRSQKKEVAV  246

Query  241  DLSTAIQGSEAINQIISDPER--AKTLSVHLPESEDADENKKQQIKDTIASPQFQQALSL  298
             L+TA+      N+ +++  R  A+ L+ HLP S+D      +++ +T+ +PQF+QA   
Sbjct  247  SLATALS-----NETVAEVARNHAEELAPHLPTSDD----PARELSETVRTPQFRQAADT  297

Query  299  FSNALQSAQLGPVVSQFELTAEAVAAAYAGNLEDFVKALEKSLPAGATMDTTKAKESDKD  358
              +ALQ+ QLGPVV+QF +    V +A  G++  F   L K   A    D  K + SD D
Sbjct  298  LGHALQTGQLGPVVAQFGMDEATVGSANQGDIRGFAANLTK---AEGGEDAAKTQNSDDD  354

Query  359  K----EPLKNESEENKTD  372
                 EP +N  +    D
Sbjct  355  ATREPEPKRNRPDNEDMD  372


>ADRM1_DICDI unnamed protein product
Length=287

 Score = 81.3 bits (199),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 56/97 (58%), Gaps = 0/97 (0%)

Query  20   VEFRAGRMNMIGKMVHPDARKGLVYLTQSEDGLMHFCWKDRTTGKVEDDLIVFPDDFEFK  79
            VEF+AG+  + G  V  D+RKG +    + +GL    W+ R +   ED+    P + +F 
Sbjct  8    VEFKAGKAKLTGTTVTSDSRKGYLKFGVTPEGLTCVQWRPRDSSAYEDEFYFAPGESKFI  67

Query  80   RVEQCKTGRVYVLKFKSSSRRMFFWMQEPKIEKDDEL  116
            +V  CKTGR+Y L F  S ++ F+W+QE  +E D ++
Sbjct  68   KVPACKTGRMYYLNFSGSDQKEFYWLQEANVEGDAKI  104


 Score = 30.0 bits (66),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 21/81 (26%), Positives = 33/81 (41%), Gaps = 3/81 (4%)

Query  233  TASRTLSVDLSTAIQGSEAINQIISDPERAKTLSVHLPESEDADENKKQQIKDTIASPQF  292
            T  +   + L   +     I  +  +PE  K L  +LPE    DEN    I + + S QF
Sbjct  178  TQPKQPQITLGKILTAENLIPFLRENPEIKKDLIQYLPEEYQKDEN---MINEVLHSAQF  234

Query  293  QQALSLFSNALQSAQLGPVVS  313
             Q++     A+       +VS
Sbjct  235  LQSIETLDYAIHEGHGPEIVS  255



Lambda      K        H
   0.322    0.131    0.423 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1518059526


Query= XP_014085218.1 PREDICTED: proteasomal ubiquitin receptor ADRM1
homolog [Bactrocera oleae]

Length=374
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ADRM1_DROME  unnamed protein product                                  481     8e-171
ADRM1_CAEEL  unnamed protein product                                  189     1e-56 
ADRM1_DICDI  unnamed protein product                                  81.3    3e-17 


>ADRM1_DROME unnamed protein product
Length=389

 Score = 481 bits (1239),  Expect = 8e-171, Method: Compositional matrix adjust.
 Identities = 255/368 (69%), Positives = 300/368 (82%), Gaps = 10/368 (3%)

Query  1    MFGRQSGIGGGNTSSSSNLVEFRAGRMNMIGKMVHPDARKGLVYLTQSEDGLMHFCWKDR  60
            MFGRQSG+G  ++S+SSNLVEFRAGRMNM+GKMVHPD RKGLVY+TQS+DGLMHFCWKDR
Sbjct  1    MFGRQSGLG--SSSNSSNLVEFRAGRMNMVGKMVHPDPRKGLVYMTQSDDGLMHFCWKDR  58

Query  61   TTGKVEDDLIVFPDDFEFKRVEQCKTGRVYVLKFKSSSRRMFFWMQEPKIEKDDELCRRV  120
            T+GKVEDDLIVFPDDFE+KRV+QCKTGRVYVLKFKSS+RRMFFWMQEPK +KDDE CRR+
Sbjct  59   TSGKVEDDLIVFPDDFEYKRVDQCKTGRVYVLKFKSSTRRMFFWMQEPKTDKDDEQCRRI  118

Query  121  NELMNNPPS-QQR--NNSDNGDLQYMLNNMSQQQLMQLFGGVGQMGGLTSLLGSMNRSEN  177
            NEL+NNPPS  QR    S++GDLQYMLNNMSQQQLMQLFGGVGQMGGL+SLLG MN    
Sbjct  119  NELLNNPPSAHQRGGGGSNDGDLQYMLNNMSQQQLMQLFGGVGQMGGLSSLLGQMNSRTP  178

Query  178  SSRTPARSGSNNAASNLLTPESNTAPKTPSAPKGKGSNRSSAGATTT---NVNTNLSTTA  234
            SSR    S     AS L TPE+ + P+TPSAP   GS+RSS+   +       +++   A
Sbjct  179  SSRN-TSSSGGGGASALQTPENVSVPRTPSAPSKSGSSRSSSNVNSQVGEGAGSSVDADA  237

Query  235  -SRTLSVDLSTAIQGSEAINQIISDPERAKTLSVHLPESEDADENKKQQIKDTIASPQFQ  293
              R+L++DLSTA+ G++AINQII+DPE  KTL VHLPESED D+++KQQIKD I SPQFQ
Sbjct  238  PGRSLNIDLSTALPGADAINQIIADPEHVKTLIVHLPESEDVDDDRKQQIKDNITSPQFQ  297

Query  294  QALSLFSNALQSAQLGPVVSQFELTAEAVAAAYAGNLEDFVKALEKSLPAGATMDTTKAK  353
            QAL+ FS+ALQSAQLGPV+ QFEL+ EAVAAA++GNLEDFV+ALEKSLP GATM    + 
Sbjct  298  QALAQFSSALQSAQLGPVIKQFELSNEAVAAAFSGNLEDFVRALEKSLPPGATMGGKPSA  357

Query  354  ESDKDKEP  361
               K  +P
Sbjct  358  SEKKASDP  365


>ADRM1_CAEEL unnamed protein product
Length=374

 Score = 189 bits (480),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 129/378 (34%), Positives = 200/378 (53%), Gaps = 37/378 (10%)

Query  14   SSSSNLVEFRAGRMNMIG------KMVHPDARKGLVYLTQSEDGLMHFCWKDRTTGKVED  67
            SSS ++VEF+AGR  +        + V  + +KGLV++ QS D L+HFCWKDR TG V D
Sbjct  13   SSSGHIVEFKAGRSRLEAGSGDTMRKVVAEPKKGLVFIKQSNDMLIHFCWKDRETGAVVD  72

Query  68   DLIVFPDDFEFKRVEQCKTGRVYVLKFKSSSRRMFFWMQEPKIEKDDELCRRVNELMNNP  127
            DLI+FPDD EFK V  C  G+VY+LKFKS   ++ FW+Q+   + D +L ++V + +N P
Sbjct  73   DLIIFPDDAEFKAVPGCPDGKVYMLKFKSGDMKL-FWIQDSTPDVDKDLVKKVTDALNKP  131

Query  128  P------SQQRNNSDNGDLQYMLNNM-SQQQLMQLFGGVGQMGGLTSLLGSMNRSENSSR  180
            P      S+   ++ N D Q    ++ S   +    GG+ Q G L SL+ S+ +  NS  
Sbjct  132  PTSRPAASRSAGSNANTDRQSAGGSLISSSDMNAPLGGIDQ-GQLMSLIQSL-QGGNSDT  189

Query  181  TPARSGSNNAASNLLTPESNTAPKTPSAPKGKGSNRSSAGATTTNVNTNLSTTASRTLSV  240
             P  S      +   + E++  P T +A +G  +  S        +  NL  +  + ++V
Sbjct  190  LPISSVPRGEDA---SSEADCEPSTNAAEEGSSNPLSLNNPAIQQIFNNLGRSQKKEVAV  246

Query  241  DLSTAIQGSEAINQIISDPER--AKTLSVHLPESEDADENKKQQIKDTIASPQFQQALSL  298
             L+TA+      N+ +++  R  A+ L+ HLP S+D      +++ +T+ +PQF+QA   
Sbjct  247  SLATALS-----NETVAEVARNHAEELAPHLPTSDD----PARELSETVRTPQFRQAADT  297

Query  299  FSNALQSAQLGPVVSQFELTAEAVAAAYAGNLEDFVKALEKSLPAGATMDTTKAKESDKD  358
              +ALQ+ QLGPVV+QF +    V +A  G++  F   L K   A    D  K + SD D
Sbjct  298  LGHALQTGQLGPVVAQFGMDEATVGSANQGDIRGFAANLTK---AEGGEDAAKTQNSDDD  354

Query  359  K----EPLKNESEENKTD  372
                 EP +N  +    D
Sbjct  355  ATREPEPKRNRPDNEDMD  372


>ADRM1_DICDI unnamed protein product
Length=287

 Score = 81.3 bits (199),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 56/97 (58%), Gaps = 0/97 (0%)

Query  20   VEFRAGRMNMIGKMVHPDARKGLVYLTQSEDGLMHFCWKDRTTGKVEDDLIVFPDDFEFK  79
            VEF+AG+  + G  V  D+RKG +    + +GL    W+ R +   ED+    P + +F 
Sbjct  8    VEFKAGKAKLTGTTVTSDSRKGYLKFGVTPEGLTCVQWRPRDSSAYEDEFYFAPGESKFI  67

Query  80   RVEQCKTGRVYVLKFKSSSRRMFFWMQEPKIEKDDEL  116
            +V  CKTGR+Y L F  S ++ F+W+QE  +E D ++
Sbjct  68   KVPACKTGRMYYLNFSGSDQKEFYWLQEANVEGDAKI  104


 Score = 30.0 bits (66),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 21/81 (26%), Positives = 33/81 (41%), Gaps = 3/81 (4%)

Query  233  TASRTLSVDLSTAIQGSEAINQIISDPERAKTLSVHLPESEDADENKKQQIKDTIASPQF  292
            T  +   + L   +     I  +  +PE  K L  +LPE    DEN    I + + S QF
Sbjct  178  TQPKQPQITLGKILTAENLIPFLRENPEIKKDLIQYLPEEYQKDEN---MINEVLHSAQF  234

Query  293  QQALSLFSNALQSAQLGPVVS  313
             Q++     A+       +VS
Sbjct  235  LQSIETLDYAIHEGHGPEIVS  255



Lambda      K        H
   0.322    0.131    0.423 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1518059526


Query= XP_014085219.1 PREDICTED: proteasomal ubiquitin receptor ADRM1
homolog [Bactrocera oleae]

Length=374
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ADRM1_DROME  unnamed protein product                                  481     8e-171
ADRM1_CAEEL  unnamed protein product                                  189     1e-56 
ADRM1_DICDI  unnamed protein product                                  81.3    3e-17 


>ADRM1_DROME unnamed protein product
Length=389

 Score = 481 bits (1239),  Expect = 8e-171, Method: Compositional matrix adjust.
 Identities = 255/368 (69%), Positives = 300/368 (82%), Gaps = 10/368 (3%)

Query  1    MFGRQSGIGGGNTSSSSNLVEFRAGRMNMIGKMVHPDARKGLVYLTQSEDGLMHFCWKDR  60
            MFGRQSG+G  ++S+SSNLVEFRAGRMNM+GKMVHPD RKGLVY+TQS+DGLMHFCWKDR
Sbjct  1    MFGRQSGLG--SSSNSSNLVEFRAGRMNMVGKMVHPDPRKGLVYMTQSDDGLMHFCWKDR  58

Query  61   TTGKVEDDLIVFPDDFEFKRVEQCKTGRVYVLKFKSSSRRMFFWMQEPKIEKDDELCRRV  120
            T+GKVEDDLIVFPDDFE+KRV+QCKTGRVYVLKFKSS+RRMFFWMQEPK +KDDE CRR+
Sbjct  59   TSGKVEDDLIVFPDDFEYKRVDQCKTGRVYVLKFKSSTRRMFFWMQEPKTDKDDEQCRRI  118

Query  121  NELMNNPPS-QQR--NNSDNGDLQYMLNNMSQQQLMQLFGGVGQMGGLTSLLGSMNRSEN  177
            NEL+NNPPS  QR    S++GDLQYMLNNMSQQQLMQLFGGVGQMGGL+SLLG MN    
Sbjct  119  NELLNNPPSAHQRGGGGSNDGDLQYMLNNMSQQQLMQLFGGVGQMGGLSSLLGQMNSRTP  178

Query  178  SSRTPARSGSNNAASNLLTPESNTAPKTPSAPKGKGSNRSSAGATTT---NVNTNLSTTA  234
            SSR    S     AS L TPE+ + P+TPSAP   GS+RSS+   +       +++   A
Sbjct  179  SSRN-TSSSGGGGASALQTPENVSVPRTPSAPSKSGSSRSSSNVNSQVGEGAGSSVDADA  237

Query  235  -SRTLSVDLSTAIQGSEAINQIISDPERAKTLSVHLPESEDADENKKQQIKDTIASPQFQ  293
              R+L++DLSTA+ G++AINQII+DPE  KTL VHLPESED D+++KQQIKD I SPQFQ
Sbjct  238  PGRSLNIDLSTALPGADAINQIIADPEHVKTLIVHLPESEDVDDDRKQQIKDNITSPQFQ  297

Query  294  QALSLFSNALQSAQLGPVVSQFELTAEAVAAAYAGNLEDFVKALEKSLPAGATMDTTKAK  353
            QAL+ FS+ALQSAQLGPV+ QFEL+ EAVAAA++GNLEDFV+ALEKSLP GATM    + 
Sbjct  298  QALAQFSSALQSAQLGPVIKQFELSNEAVAAAFSGNLEDFVRALEKSLPPGATMGGKPSA  357

Query  354  ESDKDKEP  361
               K  +P
Sbjct  358  SEKKASDP  365


>ADRM1_CAEEL unnamed protein product
Length=374

 Score = 189 bits (480),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 129/378 (34%), Positives = 200/378 (53%), Gaps = 37/378 (10%)

Query  14   SSSSNLVEFRAGRMNMIG------KMVHPDARKGLVYLTQSEDGLMHFCWKDRTTGKVED  67
            SSS ++VEF+AGR  +        + V  + +KGLV++ QS D L+HFCWKDR TG V D
Sbjct  13   SSSGHIVEFKAGRSRLEAGSGDTMRKVVAEPKKGLVFIKQSNDMLIHFCWKDRETGAVVD  72

Query  68   DLIVFPDDFEFKRVEQCKTGRVYVLKFKSSSRRMFFWMQEPKIEKDDELCRRVNELMNNP  127
            DLI+FPDD EFK V  C  G+VY+LKFKS   ++ FW+Q+   + D +L ++V + +N P
Sbjct  73   DLIIFPDDAEFKAVPGCPDGKVYMLKFKSGDMKL-FWIQDSTPDVDKDLVKKVTDALNKP  131

Query  128  P------SQQRNNSDNGDLQYMLNNM-SQQQLMQLFGGVGQMGGLTSLLGSMNRSENSSR  180
            P      S+   ++ N D Q    ++ S   +    GG+ Q G L SL+ S+ +  NS  
Sbjct  132  PTSRPAASRSAGSNANTDRQSAGGSLISSSDMNAPLGGIDQ-GQLMSLIQSL-QGGNSDT  189

Query  181  TPARSGSNNAASNLLTPESNTAPKTPSAPKGKGSNRSSAGATTTNVNTNLSTTASRTLSV  240
             P  S      +   + E++  P T +A +G  +  S        +  NL  +  + ++V
Sbjct  190  LPISSVPRGEDA---SSEADCEPSTNAAEEGSSNPLSLNNPAIQQIFNNLGRSQKKEVAV  246

Query  241  DLSTAIQGSEAINQIISDPER--AKTLSVHLPESEDADENKKQQIKDTIASPQFQQALSL  298
             L+TA+      N+ +++  R  A+ L+ HLP S+D      +++ +T+ +PQF+QA   
Sbjct  247  SLATALS-----NETVAEVARNHAEELAPHLPTSDD----PARELSETVRTPQFRQAADT  297

Query  299  FSNALQSAQLGPVVSQFELTAEAVAAAYAGNLEDFVKALEKSLPAGATMDTTKAKESDKD  358
              +ALQ+ QLGPVV+QF +    V +A  G++  F   L K   A    D  K + SD D
Sbjct  298  LGHALQTGQLGPVVAQFGMDEATVGSANQGDIRGFAANLTK---AEGGEDAAKTQNSDDD  354

Query  359  K----EPLKNESEENKTD  372
                 EP +N  +    D
Sbjct  355  ATREPEPKRNRPDNEDMD  372


>ADRM1_DICDI unnamed protein product
Length=287

 Score = 81.3 bits (199),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 56/97 (58%), Gaps = 0/97 (0%)

Query  20   VEFRAGRMNMIGKMVHPDARKGLVYLTQSEDGLMHFCWKDRTTGKVEDDLIVFPDDFEFK  79
            VEF+AG+  + G  V  D+RKG +    + +GL    W+ R +   ED+    P + +F 
Sbjct  8    VEFKAGKAKLTGTTVTSDSRKGYLKFGVTPEGLTCVQWRPRDSSAYEDEFYFAPGESKFI  67

Query  80   RVEQCKTGRVYVLKFKSSSRRMFFWMQEPKIEKDDEL  116
            +V  CKTGR+Y L F  S ++ F+W+QE  +E D ++
Sbjct  68   KVPACKTGRMYYLNFSGSDQKEFYWLQEANVEGDAKI  104


 Score = 30.0 bits (66),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 21/81 (26%), Positives = 33/81 (41%), Gaps = 3/81 (4%)

Query  233  TASRTLSVDLSTAIQGSEAINQIISDPERAKTLSVHLPESEDADENKKQQIKDTIASPQF  292
            T  +   + L   +     I  +  +PE  K L  +LPE    DEN    I + + S QF
Sbjct  178  TQPKQPQITLGKILTAENLIPFLRENPEIKKDLIQYLPEEYQKDEN---MINEVLHSAQF  234

Query  293  QQALSLFSNALQSAQLGPVVS  313
             Q++     A+       +VS
Sbjct  235  LQSIETLDYAIHEGHGPEIVS  255



Lambda      K        H
   0.322    0.131    0.423 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1518059526


Query= XP_014085220.1 PREDICTED: 39S ribosomal protein L53, mitochondrial
[Bactrocera oleae]

Length=154
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A1Z9J6_DROME  unnamed protein product                                 228     7e-78


>A1Z9J6_DROME unnamed protein product
Length=155

 Score = 228 bits (581),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 129/142 (91%), Gaps = 0/142 (0%)

Query  1    MSIPFSGALKRSNGIIAAISKQLKSVNLKGVKRITVTFDPYAENVRSTRDFLSLLSTPKI  60
            MS+PFSGAL+RS GI++AI KQLKSVNLKGVKRITV FDP+AENV+STR+FL LLSTPK+
Sbjct  1    MSVPFSGALRRSGGIVSAIGKQLKSVNLKGVKRITVQFDPFAENVKSTREFLFLLSTPKV  60

Query  61   SFTNPNCVIKTDVVCNRQPSEVKFSLIDSAQEKAKVKEIRFNSSNLTTLELLQLLNKHVS  120
            + TNP CV+K ++VC+RQP+ +KF+LIDSAQE+A+VKEIRFNS NL TLELLQL NKHVS
Sbjct  61   AATNPKCVVKPEIVCDRQPANIKFALIDSAQEQAQVKEIRFNSDNLNTLELLQLCNKHVS  120

Query  121  TLAPVEEITSKVTTKAEKQKLA  142
            +LAP EEIT+KV TKAEKQKLA
Sbjct  121  SLAPREEITNKVLTKAEKQKLA  142



Lambda      K        H
   0.322    0.131    0.423 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1518059526


Query= XP_014085221.1 PREDICTED: uncharacterized protein LOC106614175
[Bactrocera oleae]

Length=60
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q0E985_DROME  unnamed protein product                                 105     4e-32
Q9VRE6_DROME  unnamed protein product                                 26.6    1.2  
Q581D5_TRYB2  unnamed protein product                                 26.2    1.5  


>Q0E985_DROME unnamed protein product
Length=60

 Score = 105 bits (261),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 57/60 (95%), Gaps = 0/60 (0%)

Query  1   MVKKTKGTLAVIEQIYEDIPAFTDIFTEESFYTFVFCFVCATIIVAFILSRFITLKPVEF  60
           MV+K KGTLAVIE+IY+DIPAF+DIFTEESFY F FCFVCATI+VAFILSRFIT+KPV+F
Sbjct  1   MVRKHKGTLAVIEKIYQDIPAFSDIFTEESFYMFAFCFVCATILVAFILSRFITIKPVDF  60


>Q9VRE6_DROME unnamed protein product
Length=447

 Score = 26.6 bits (57),  Expect = 1.2, Method: Composition-based stats.
 Identities = 12/41 (29%), Positives = 20/41 (49%), Gaps = 0/41 (0%)

Query  20   PAFTDIFTEESFYTFVFCFVCATIIVAFILSRFITLKPVEF  60
            PA   +   +SF+ FVF F+    +    +  FI L+ V +
Sbjct  402  PALIKVSYGQSFFLFVFGFIVTEFVGVLNIFLFINLQEVSY  442


>Q581D5_TRYB2 unnamed protein product
Length=300

 Score = 26.2 bits (56),  Expect = 1.5, Method: Composition-based stats.
 Identities = 14/42 (33%), Positives = 23/42 (55%), Gaps = 5/42 (12%)

Query  5    TKGTLAVIEQIYEDIPAFTDIFTEESFYTFV----FCFVCAT  42
            T G  + I+ + EDI  F DI+   + + F+    FC +C+T
Sbjct  95   TSGIHSHIQGLKEDIRKFPDIYNSANAFNFILFTAFC-LCST  135



Lambda      K        H
   0.322    0.131    0.423 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1518059526


Query= XP_014085222.1 PREDICTED: mucin-5AC [Bactrocera oleae]

Length=3592
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A1Z9S6_DROME  unnamed protein product                                 146     3e-34
A1Z9S5_DROME  unnamed protein product                                 137     9e-32


>A1Z9S6_DROME unnamed protein product
Length=3257

 Score = 146 bits (369),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 137/475 (29%), Positives = 230/475 (48%), Gaps = 92/475 (19%)

Query  2987  EELVDEH----------ATPAQQTAAGITLGTSADNTATTNSLASRTLAIAAATNSA-LN  3035
             E+++DEH          A PA      IT        A  +++   TL ++ ++    L+
Sbjct  2641  EDIMDEHSPNEPMPMVAAAPATPQPHAIT------EDAGPDTIQVNTLGVSTSSRPLELH  2694

Query  3036  QTP-ANDATGYYGLTPTQLDTNGTRLYSFLHPAKYNRNHGCVLLDYCCPNLDGPMPAIDP  3094
               P A+D  G     P  +    T++YSFL+P +Y +++  V LD+CCPNLDGPM AID 
Sbjct  2695  SIPSASDPDG----NPNAI--GQTKMYSFLYPKRYKQSYDDVGLDFCCPNLDGPMRAIDF  2748

Query  3095  TRIHAQVQAGVRELPAYIVMSTKLITRADLEANKNVIPASIRQKVEKI------------  3142
             TR+H++ +  V E+P ++V++TK I++AD    KN +P+ +R K+E +            
Sbjct  2749  TRLHSKAEVPVLEIPQFLVITTKFISKAD----KN-MPSKVRAKLELLDKSKERDSSKLT  2803

Query  3143  ---TADASNTNTPTNQTSAPASTAIAA-PNTSIA-NVTTVPA-------NLTVSKPTTTT  3190
                T   ++   P++ + APAS   A  P  SI  N+ + P        + T   P+T+T
Sbjct  2804  PTATTPTADPTGPSSFSPAPASVGPATQPFPSIIQNLLSAPLPDPGLFNHPTTVDPSTST  2863

Query  3191  TALTPT---------ITALQKHLPSTTSIIPKLMPATST-PTMSS----LGTTPTSVTPQ  3236
               ++ +         + +L K LP  T +I K +   +T P+++     +  +P+ +  Q
Sbjct  2864  PVVSGSSSSTTISADLDSLSKQLPRGTKLIKKSVQQVATNPSLAGTSMVINASPSFI--Q  2921

Query  3237  LPVVS--DYQRSLLRTSVRQFDARLKKYYYRIAMLSFSERQTIIDGIINSTTLTPKDVDC  3294
             LP +   D QR  L+  V+ FD  L+    R A LS +ERQ  I+ I+ +++L   DVD 
Sbjct  2922  LPPICPNDKQRVELQARVQMFDLVLQTLSRRAANLSVAERQRTIEEIVRTSSLMAIDVDV  2981

Query  3295  AVRLIDEYAAQIGVAPTTSAGNVATAAKT-TTPA-IQSVSKAITTQTTNTVVRTTTIQQQ  3352
               +L++ Y   +         N AT+  T  TPA I S   A T+ T +  + T+ I QQ
Sbjct  2982  GTKLLENYVHYL---------NKATSTMTPLTPAQINSSLGASTSSTLSKSIATSDIPQQ  3032

Query  3353  SV-----NPNSQSSKTNQVAVLDKDNSLLGYQLAASPMPMNKSSISTRSSIMSSS  3402
                    +   +SS    + + D   + LG+     P   +KS+   +SS +++S
Sbjct  3033  GKKISADHAQQRSSLPATIPLYDGGRNTLGF-----PYSCSKSTAGRKSSYVATS  3082


 Score = 38.1 bits (87),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 40/78 (51%), Gaps = 8/78 (10%)

Query  1   MDEIEYLEEYEDLILPTMSTQATTTK----VRNRTNLAAMADDEDSSSIDQDIFDSLFDD  56
           M++IEYL+EY+DL+LP + + A T       R R   +  ++     +   DIF  LF  
Sbjct  1   MEDIEYLDEYKDLVLPGIKSSAPTASSAGVPRQRRISSDSSNSSSIDA---DIFQKLFHG  57

Query  57  NSDDESVMHKKGPAKLSQ  74
              D+ ++ K+G    SQ
Sbjct  58  KYLDDELL-KEGSGSKSQ  74


>A1Z9S5_DROME unnamed protein product
Length=1633

 Score = 137 bits (346),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 119/392 (30%), Positives = 199/392 (51%), Gaps = 68/392 (17%)

Query  3058  TRLYSFLHPAKYNRNHGCVLLDYCCPNLDGPMPAIDPTRIHAQVQAGVRELPAYIVMSTK  3117
             T++YSFL+P +Y +++  V LD+CCPNLDGPM AID TR+H++ +  V E+P ++V++TK
Sbjct  1088  TKMYSFLYPKRYKQSYDDVGLDFCCPNLDGPMRAIDFTRLHSKAEVPVLEIPQFLVITTK  1147

Query  3118  LITRADLEANKNVIPASIRQKVEKI---------------TADASNTNTPTNQTSAPAST  3162
              I++AD    KN +P+ +R K+E +               T   ++   P++ + APAS 
Sbjct  1148  FISKAD----KN-MPSKVRAKLELLDKSKERDSSKLTPTATTPTADPTGPSSFSPAPASV  1202

Query  3163  AIAA-PNTSIA-NVTTVPA-------NLTVSKPTTTTTALTPT---------ITALQKHL  3204
               A  P  SI  N+ + P        + T   P+T+T  ++ +         + +L K L
Sbjct  1203  GPATQPFPSIIQNLLSAPLPDPGLFNHPTTVDPSTSTPVVSGSSSSTTISADLDSLSKQL  1262

Query  3205  PSTTSIIPKLMPATST-PTMSS----LGTTPTSVTPQLPVVS--DYQRSLLRTSVRQFDA  3257
             P  T +I K +   +T P+++     +  +P+ +  QLP +   D QR  L+  V+ FD 
Sbjct  1263  PRGTKLIKKSVQQVATNPSLAGTSMVINASPSFI--QLPPICPNDKQRVELQARVQMFDL  1320

Query  3258  RLKKYYYRIAMLSFSERQTIIDGIINSTTLTPKDVDCAVRLIDEYAAQIGVAPTTSAGNV  3317
              L+    R A LS +ERQ  I+ I+ +++L   DVD   +L++ Y   +         N 
Sbjct  1321  VLQTLSRRAANLSVAERQRTIEEIVRTSSLMAIDVDVGTKLLENYVHYL---------NK  1371

Query  3318  ATAAKT-TTPA-IQSVSKAITTQTTNTVVRTTTIQQQSV-----NPNSQSSKTNQVAVLD  3370
             AT+  T  TPA I S   A T+ T +  + T+ I QQ       +   +SS    + + D
Sbjct  1372  ATSTMTPLTPAQINSSLGASTSSTLSKSIATSDIPQQGKKISADHAQQRSSLPATIPLYD  1431

Query  3371  KDNSLLGYQLAASPMPMNKSSISTRSSIMSSS  3402
                + LG+     P   +KS+   +SS +++S
Sbjct  1432  GGRNTLGF-----PYSCSKSTAGRKSSYVATS  1458


 Score = 38.5 bits (88),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 40/78 (51%), Gaps = 8/78 (10%)

Query  1   MDEIEYLEEYEDLILPTMSTQATTTK----VRNRTNLAAMADDEDSSSIDQDIFDSLFDD  56
           M++IEYL+EY+DL+LP + + A T       R R   +  ++     +   DIF  LF  
Sbjct  1   MEDIEYLDEYKDLVLPGIKSSAPTASSAGVPRQRRISSDSSNSSSIDA---DIFQKLFHG  57

Query  57  NSDDESVMHKKGPAKLSQ  74
              D+ ++ K+G    SQ
Sbjct  58  KYLDDELL-KEGSGSKSQ  74


 Score = 35.4 bits (80),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 23/70 (33%), Positives = 38/70 (54%), Gaps = 9/70 (13%)

Query  279  TTIIKPEK----PQIKDPAEDPLSLENIENESDSDTDSFIYSDVSADTFVTLSDVDCDER  334
             TI+KP+K    P   +P  DPL+L ++  +SDSD+     SD   D      D D ++ 
Sbjct  205  VTIVKPQKTDLRPSRLEPKTDPLNLGDLYGDSDSDSSYEYESDFYGD-----QDSDEEDE  259

Query  335  HIIELSNDSN  344
             +I++S D++
Sbjct  260  PVIDISTDTS  269



Lambda      K        H
   0.322    0.131    0.423 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1518059526


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jan 6, 2022  5:17 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_014085223.1 PREDICTED: uncharacterized protein LOC106614177
[Bactrocera oleae]

Length=2717
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9W198_DROME  unnamed protein product                                 859     0.0  
Q961M6_DROME  unnamed protein product                                 197     1e-50
M9PEI1_DROME  unnamed protein product                                 42.4    0.008


>Q9W198_DROME unnamed protein product
Length=2175

 Score = 859 bits (2220),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 551/1322 (42%), Positives = 752/1322 (57%), Gaps = 167/1322 (13%)

Query  14    IQRKYNVSIGFLKSNLGNIEKFLWYALSPRLIIKRVAIRKGSKQRVILNYYHLRRVLFDQ  73
             I+RKY VS  FL SN  N+E+F+ YALSPR +I+  A R+  + R +     +R +LFD 
Sbjct  21    IKRKYPVSKDFLHSNWWNVERFIVYALSPRCVIRNYAWRR-RRTRSVCIIRRVRILLFDP  79

Query  74    AERKVFKTRRRNVQLWSKQMVSYLRRKYGVKEHIEITTLSDNTETINKQQEEIASGANMA  133
               +++ K R +NV+ WSK +V+Y ++   ++EH E               E       +A
Sbjct  80    RLKRMIKRRLQNVRHWSKGLVNYYKKMGRIEEHEET--------------EVYRVAEPLA  125

Query  134   PDEVSKQLKEQLEILRSGKRTVPLIESETKSIVDELRKDAVDAATNNIPFQTTALLSQCA  193
              +E+SKQ+K+QLE+L++GKR++ LIE                        +TTA+     
Sbjct  126   AEELSKQMKQQLELLKTGKRSLSLIE------------------------ETTAIAEVPP  161

Query  194   TKNVDDSNQFSHIT--SKVLDKTESVVQNTLETTPEKQIMSSDETRSEQPKHSYKADRNM  251
              K      QF  IT  ++V++ ++    + L+  P KQ  +++ T ++ P          
Sbjct  162   KK----PKQFPDITEEARVINDSD----DRLDAAPSKQ--AAERTPTKSPAQV-------  204

Query  252   DIDGESVELP-PVDATIKISADFATKSATEMLQQCADKKTARSLSSNSNFLDMLMNKVRG  310
                  S ++P P   + + S   +T S+ E      DK     +   S FLDML++KVR 
Sbjct  205   ---AASEDVPTPATPSKEQSGQTSTCSSAEK----TDK--VEKVGGGSKFLDMLISKVRV  255

Query  311   NNVHTETANNTKAIQTPPTAKELVEINAYKTPDNNEHFTDSGEEFFGFDETERLPGMLLT  370
              N   E  NN  A    P+A        + T ++     +   +F GFDE+   PGMLLT
Sbjct  256   KNFARE--NNMPA---EPSAV------TFCTSED-----EGSADFVGFDESVHQPGMLLT  299

Query  371   PLVPFSAQSKGNANVAFISESLNEFMRENLLESSDCVADGIDNAAGRKHRQATLDGLVTP  430
             PLVP + ++    N AF+SESL+ +MRE+ +  SD   D         H     DG VT 
Sbjct  300   PLVPNNCKTT-EGNSAFVSESLDAYMREHHINDSDSQDDKDKLLEPMGH-----DGQVTS  353

Query  431   ECMPPQMQMPLVPESLQKLRTVAERRQFLQKFNRNHKLAIINNEAAICRELQRKIRHQKS  490
               MPP M MP VPE+LQ+LRTVAERRQ+LQ+  +NHK+ IINNEA + RELQRK R +K 
Sbjct  354   HSMPPPMDMPAVPEALQRLRTVAERRQYLQRC-KNHKMGIINNEANVYRELQRKQRQRKV  412

Query  491   KSVSQQSLQAPNSQMPFTRQGWQAASFVTTEFNHYYYQTVDVIDGNERERVRLPGVRGNN  550
             K  + Q+LQA +SQMPFTRQGWQAAS+V TE + YYYQ + V DG   E VRLPG +GNN
Sbjct  413   KIGAMQALQASDSQMPFTRQGWQAASYVATEHSKYYYQVIQV-DG---EMVRLPGAQGNN  468

Query  551   EERNKRPYLSRVSCQVLRN-KCNINNCSDALIGRDLK--PVKAEPDR--KKLNKTPLPSV  605
              +R K PYLSR+S +     KC+   C DA I ++LK  P +  P R  K LN+ PLP++
Sbjct  469   LKREKSPYLSRLSRKEQEELKCS-EQCLDARIQQELKVIPTRVSPPRNPKILNQYPLPAI  527

Query  606   FKPCPLSHKPFQKPLDDETAPLLLAGGSMAVVRMPIVELEVFPALGKPLHDVAKRYLDYI  665
             F+PCPLS KP Q+PLDD+TA LLLAGGSMAVV MP VEL+V P LG+PL ++AKRYL +I
Sbjct  528   FRPCPLSKKPLQRPLDDDTAALLLAGGSMAVVSMPNVELDVMPQLGRPLDEIAKRYLQHI  587

Query  666   LPHCDITREWAEFSVSTLQL-SADYKKTDDQSKQQAGDDMKIANASYTFPIPYMNDRSHI  724
             LPH DITREWAEFSVSTLQ   A  K  ++Q+ Q      K    S+TF IPY+NDR+HI
Sbjct  588   LPHHDITREWAEFSVSTLQAPPATMKDAEEQASQTPAGRRK----SFTFVIPYLNDRNHI  643

Query  725   LVRRVVDRSEKLDETFEATTSPTEDFSFRANI-DESDSELVECADVLSEMINSVAISCSE  783
             LVRRVVDRSE LD +F+   +  ++F+FR  +  + D+E+V CA+++S+MIN+VAISCSE
Sbjct  644   LVRRVVDRSEHLDRSFKEEPNKLQEFTFREMLPPQPDAEIVACAEMISDMINTVAISCSE  703

Query  784   NSFIKIDPDGVQTD---KEEDVELKQEKVAGKVKEEKSCNIKATDDSKLVNQAAANKKQN  840
             NSFI  DPD +      K  D+   +E+             K TD S    +   N KQ 
Sbjct  704   NSFISEDPDALDASSVPKSSDLCPAKEETG-----------KDTDKSGAKPKNLPN-KQK  751

Query  841   RLLLELRRLNATIIDAAVKAEKGAKPCTKEYCTFGCICQSLAD-DYPLRQHCGKSKCVIE  899
             RL  ELRRLNATIIDAA +     KPC+K+YC  GCIC SLA  + P+R HCG+++CV++
Sbjct  752   RLANELRRLNATIIDAAARKADANKPCSKDYCHLGCICASLAGTELPVRDHCGRAECVLD  811

Query  900   CTCKTPSQSRIMRLE-TDGRSITTEDAFMLRRQATARLARMEKEFTSTVVLTENETLLIN  958
             C C +  +SR+MRLE  DGR I+ EDAF LRR+ATARLA+MEK+FTST+VLT+NETLLIN
Sbjct  812   CRCLSAEESRVMRLEAADGRGISNEDAFNLRRKATARLAKMEKDFTSTLVLTDNETLLIN  871

Query  959   ESQYDKKRRCTKAPKRYEDFADT---EEDYARTSANTPPKKTQNTAVVAIEAATDTTLSS  1015
             ESQ DKKRRCTKAPKRYEDF D+   EE+    S  T  +K    A  A  AA     ++
Sbjct  872   ESQGDKKRRCTKAPKRYEDFDDSIYDEEEKDVVSPTTRKQKKHAAAAAAAAAAAAAAAAA  931

Query  1016  GFSETTTELREPIYVNDKVLEKLKHCTVPLIRFDNTQNMAVWCMVHELYKCYCGGRATEG  1075
                 +   L EP +V D  L KLKHC V L R  N +N+A +CM H+LYKC+CGG + +G
Sbjct  932   SAKISAPALSEPCFVKDTDLAKLKHCFVGLRRLSNVENLATFCMTHQLYKCFCGGDSPDG  991

Query  1076  KPLVIEKDSNVTTNNEQTNVGNKQNASTDEEYIVTSTKARYSFETVEQTVDEADAELREE  1135
             KP+VIEKD              + NA         + +A YSFE   +          ++
Sbjct  992   KPVVIEKD--------------QWNAPVTHFNPDLAVRAHYSFERPPEETSTKKKGKEKK  1037

Query  1136  NEIFRKRREKRKSADRKSQGSVVRYNSTDDERDESDREDDMLEESLGSEFAGDNGRAKRP  1195
              +   + +     AD+K Q   V       E  +        E    +    D    K  
Sbjct  1038  PKHKLESKSSNDVADQKPQTQAVETLPLKTESKQ--------EPPPANSLFKDESPLK--  1087

Query  1196  KLAKRLERRGRPSELTFINKYFITEADGCRRVVVVPRKTYLRINRKRRIEVEEFIAKNEN  1255
                       R +EL  I  YF +  D CRR + +P+ +Y R+N++R   V   IA+ E+
Sbjct  1088  ----------RSNELNKIFNYFRSRPDVCRRAISIPKNSYQRLNQRRADRVRHQIAREES  1137

Query  1256  KQSMLLLNEHIMRSVYYHKHEVEKQRKEAAQESLLLTKKRKLNDNELTGTEDASNKESKK  1315
              ++  +L   I  +V Y++ E+++QRK        L+KK  +     +   DAS ++ K 
Sbjct  1138  LKTNEMLKMRIQGAVVYYRKEIDRQRKRE------LSKKPVIEVRNESDASDASVRQKKI  1191

Query  1316  ET  1317
             ET
Sbjct  1192  ET  1193


 Score = 200 bits (508),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 161/518 (31%), Positives = 236/518 (46%), Gaps = 83/518 (16%)

Query  1774  MKTNIVFRKVMSHDIDEMNVLDITTEPHRWLVLELYRDFSHIYVPDFQELVSLDRIQKVM  1833
             +++NI FRKV  +D+DE+ + ++    HRW+VL+++ DFSHI+VP F +++SL RI  VM
Sbjct  1551  IRSNIEFRKVNHNDVDELQIPELHQTDHRWVVLDIFDDFSHIFVPSFSDMISLTRIHSVM  1610

Query  1834  AFSRQKQKIVKLQFFKDAAYDAFVIPNSERKIFFGPLKLNMPPPLLILLQSVDRKMMLRE  1893
               + ++QK+VKLQFF +A YDAFV P+S++KI+FGPL L+MPPP+L+LLQSVDRKMMLRE
Sbjct  1611  QVAEERQKVVKLQFFPNAPYDAFVTPSSKKKIYFGPLSLDMPPPVLVLLQSVDRKMMLRE  1670

Query  1894  TYQQMHNIQGGAKESTTAFWIVRKNGQVYVDHNLDGCAADATNSEKAPLEEAQAKETVQL  1953
              YQ+ H+I       + AFW+++ NGQV+ + + +  A  A   + A +        +++
Sbjct  1671  VYQREHSIPVQRHRRSMAFWVLQINGQVHFEIDTESTAKLAAQQKNA-IGTPPGLNVLKI  1729

Query  1954  PESDDDDCMIVEDEEPSGSFSALEPLPQTNITVKPLVELQTKLNSSISTRQL--------  2005
             P     +    +DE P                  P+V + +        RQL        
Sbjct  1730  PSQLSVEIEKNQDEVP------------------PVVVIDSDEEDDDGERQLVIDEQDDE  1771

Query  2006  ------------TNFTIQSSANSNRLQITNMGTTPIDDKSAAATAIETSAAQSKMLHNGN  2053
                         T FTIQ+  +S  LQIT   +   +  S  A  + T       +    
Sbjct  1772  QAETDVKQEVERTGFTIQTLPSSGALQITISDSA--ETSSHPAKDVNTCHFSGGFMPFIA  1829

Query  2054  NADLLTSTQLPHTSLTMPGPVNSQLVQLTNTSQS----LISPLADKQPAA----------  2099
             N         P T    P       VQ+T TSQS    L S  +   PA+          
Sbjct  1830  NVPAKFGETAPTTQFLTPQ------VQVT-TSQSGPETLTSSSSSHLPASKSAYPKINES  1882

Query  2100  ----ILCGLPPNAV-ITGVTPAPKEAPYGTTIYISNISSAVPVVANGAQSQDKQFAPTLE  2154
                    G+PP  + IT V    K  P  T   + N  S   +   G   Q         
Sbjct  1883  LQELFSSGVPPGGITITKVDSQEKTLPNETVQVVKNKKS---IAITGIHKQ--------V  1931

Query  2155  TNAQTSAKTSSQAVANTLENMS-NVRFLTPDVRVTATGDA-TANELFSTPVLTTMSNTNP  2212
             T A +S  T + A A  ++  S +V  + P +R  AT    T   L+  P L     + P
Sbjct  1932  TKAASSTATVTAARAPVVKPQSTSVSKVAPPIRPGATTQPKTLVRLYPKPALAAGRKSLP  1991

Query  2213  GLVSLPVS---QQQHSTCDKRGTVGISTQASTAENTVK  2247
                  PV+   Q Q   CDK   V  ST  +  E + +
Sbjct  1992  ANAKTPVATPRQSQPVACDKPPLVSGSTLPALVEPSAR  2029


 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 46/88 (52%), Gaps = 7/88 (8%)

Query  2565  NKTQLAKTKTSEQYGVFCSSSNDGAPRFWAKRMHNSYLIKVPGLSSVVHRIDLESADTYL  2624
             +K QLAK +    YG+  +      PRF AK   + ++IK+P    V        A ++L
Sbjct  2077  SKAQLAKEEIC--YGIMVAKD---LPRFRAKVEGSDFMIKIPE-HGVFRFKTFGLAASFL  2130

Query  2625  NQHLLKQSPAMKSKLPIKWKFVPSEQLN  2652
             ++H+ K  P +K  LP +WKF P EQ N
Sbjct  2131  SRHVAK-DPKLKQFLPAEWKFHPLEQFN  2157


>Q961M6_DROME unnamed protein product
Length=956

 Score = 197 bits (500),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 161/518 (31%), Positives = 236/518 (46%), Gaps = 83/518 (16%)

Query  1774  MKTNIVFRKVMSHDIDEMNVLDITTEPHRWLVLELYRDFSHIYVPDFQELVSLDRIQKVM  1833
             +++NI FRKV  +D+DE+ + ++    HRW+VL+++ DFSHI+VP F +++SL RI  VM
Sbjct  332   IRSNIEFRKVNHNDVDELQIPELHQTDHRWVVLDIFDDFSHIFVPSFSDMISLTRIHSVM  391

Query  1834  AFSRQKQKIVKLQFFKDAAYDAFVIPNSERKIFFGPLKLNMPPPLLILLQSVDRKMMLRE  1893
               + ++QK+VKLQFF +A YDAFV P+S++KI+FGPL L+MPPP+L+LLQSVDRKMMLRE
Sbjct  392   QVAEERQKVVKLQFFPNAPYDAFVTPSSKKKIYFGPLSLDMPPPVLVLLQSVDRKMMLRE  451

Query  1894  TYQQMHNIQGGAKESTTAFWIVRKNGQVYVDHNLDGCAADATNSEKAPLEEAQAKETVQL  1953
              YQ+ H+I       + AFW+++ NGQV+ + + +  A  A   + A +        +++
Sbjct  452   VYQREHSIPVQRHRRSMAFWVLQINGQVHFEIDTESTAKLAAQQKNA-IGTPPGLNVLKI  510

Query  1954  PESDDDDCMIVEDEEPSGSFSALEPLPQTNITVKPLVELQTKLNSSISTRQL--------  2005
             P     +    +DE P                  P+V + +        RQL        
Sbjct  511   PSQLSVEIEKNQDEVP------------------PVVVIDSDEEDDDGERQLVIDEQDDE  552

Query  2006  ------------TNFTIQSSANSNRLQITNMGTTPIDDKSAAATAIETSAAQSKMLHNGN  2053
                         T FTIQ+  +S  LQIT   +   +  S  A  + T       +    
Sbjct  553   QAETDVKQEVERTGFTIQTLPSSGALQITISDSA--ETSSHPAKDVNTCHFSGGFMPFIA  610

Query  2054  NADLLTSTQLPHTSLTMPGPVNSQLVQLTNTSQS----LISPLADKQPAA----------  2099
             N         P T    P       VQ+T TSQS    L S  +   PA+          
Sbjct  611   NVPAKFGETAPTTQFLTPQ------VQVT-TSQSGPETLTSSSSSHLPASKSAYPKINES  663

Query  2100  ----ILCGLPPNAV-ITGVTPAPKEAPYGTTIYISNISSAVPVVANGAQSQDKQFAPTLE  2154
                    G+PP  + IT V    K  P  T   + N  S   +   G   Q         
Sbjct  664   LQELFSSGVPPGGITITKVDSQEKTLPNETVQVVKNKKS---IAITGIHKQ--------V  712

Query  2155  TNAQTSAKTSSQAVANTLENMS-NVRFLTPDVRVTATGDA-TANELFSTPVLTTMSNTNP  2212
             T A +S  T + A A  ++  S +V  + P +R  AT    T   L+  P L     + P
Sbjct  713   TKAASSTATVTAARAPVVKPQSTSVSKVAPPIRPGATTQPKTLVRLYPKPALAAGRKSLP  772

Query  2213  GLVSLPVS---QQQHSTCDKRGTVGISTQASTAENTVK  2247
                  PV+   Q Q   CDK   V  ST  +  E + +
Sbjct  773   ANAKTPVATPRQSQPVACDKPPLVSGSTLPALVEPSAR  810


 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 46/88 (52%), Gaps = 7/88 (8%)

Query  2565  NKTQLAKTKTSEQYGVFCSSSNDGAPRFWAKRMHNSYLIKVPGLSSVVHRIDLESADTYL  2624
             +K QLAK +    YG+  +      PRF AK   + ++IK+P    V        A ++L
Sbjct  858   SKAQLAKEEIC--YGIMVAKD---LPRFRAKVEGSDFMIKIPE-HGVFRFKTFGLAASFL  911

Query  2625  NQHLLKQSPAMKSKLPIKWKFVPSEQLN  2652
             ++H+ K  P +K  LP +WKF P EQ N
Sbjct  912   SRHVAKD-PKLKQFLPAEWKFHPLEQFN  938


>M9PEI1_DROME unnamed protein product
Length=21657

 Score = 42.4 bits (98),  Expect = 0.008, Method: Composition-based stats.
 Identities = 110/525 (21%), Positives = 184/525 (35%), Gaps = 77/525 (15%)

Query  1931  AADATNSEKAPLEEAQAKETVQLPESDDDDCMIVEDEEPSGSFSALEPLPQTNITVKPLV  1990
             + D T   ++P                D       D   +  F A  P P T  T  P V
Sbjct  7653  STDRTTPSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPRPVTLETAVPSV  7712

Query  1991  ELQTKLN----SSISTRQLTNFTIQSSANSNRLQITNMGTTPIDDKSAAATAIETSAAQS  2046
               +T  N    S++++   TN  I S+      Q+    T P   +      +E S   S
Sbjct  7713  TSETTTNVPIGSTVTSETTTNVPIGSTGG----QVAGQTTAP-PSEVRTTIRVEESTLPS  7767

Query  2047  KMLHNGNNADLLTSTQLPHTSLTMPGPVNSQLVQLTNTSQSLISPLADKQPAAILCGLPP  2106
             +      +AD  T ++ P T  T+P    S      ++ Q+  S             +P 
Sbjct  7768  R------SADRTTPSESPETPTTLP----SDFTTRPHSEQTTESTR----------DVPT  7807

Query  2107  NAVITGVTPAPKEAPYGTTIYISNISSAVPVVANGAQSQDKQFAPTLETNAQTSAKTSSQ  2166
                    TP+P           S  ++ VP+ + G Q  ++       T++ +  +T+ +
Sbjct  7808  TRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQLTEQS------TSSPSEVRTTIR  7861

Query  2167  AVANTLENMSNVRFL---TPDVRVTATGDATANELF------STPVLTT--MSNTNPGLV  2215
                +TL + S  R     +P+   T   D T           +  VLTT     + P  V
Sbjct  7862  VEESTLPSRSTDRTFPSESPEKPTTLPSDFTTRPHLEQTTESTRDVLTTRPFETSTPSPV  7921

Query  2216  SL----PVSQQQHSTCDKRGTVG--ISTQAS------TAENTVKVTTAAERHNTSGELKS  2263
             SL    P    + ST    G+ G  ++ Q +      T E  VK T  A   +T+   + 
Sbjct  7922  SLETTVPSVTSETSTNVPIGSTGGQVTEQTTAPPSVRTTETIVKSTHPAVSPDTTIPSEI  7981

Query  2264  STSITPGDWKRFLLGDNGKRSTIGSTTITKMADKIETDGKLVMNIEGDEFEPAASVLIKP  2323
               +  P +    L  D  +    GST  T  +++ +   +L      +   P  +V  + 
Sbjct  7982  PATRVPLESTTRLYTD--QTIPPGSTDRTTSSERPDESTRLTSEESTETTRPVPTVSPRD  8039

Query  2324  NATTSLTTEAHELPLVAGVELNTNKCNLKGTTAITIGQSTAIATKPKTTTKTATTVAKK-  2382
                T++T+   E          T K    GT    + + T  +    TT +++  V ++ 
Sbjct  8040  ALETTVTSLITE----------TTKTTSGGTPRGQVTERTTKSVSELTTGRSSDVVTERT  8089

Query  2383  --PNTSATNTSITNLRFKSLPLQKEPKTAIPVTTTTVIFKSSAPT  2425
                N S+T T   N    S P+     T I +T T        PT
Sbjct  8090  MPSNISSTTTVFNN----SEPVSDNLPTTISITVTDSPTTVPVPT  8130


 Score = 38.9 bits (89),  Expect = 0.093, Method: Composition-based stats.
 Identities = 109/581 (19%), Positives = 188/581 (32%), Gaps = 90/581 (15%)

Query  1973  FSALEPLPQTNITVKPLVELQTKLNSSISTRQLTNFTIQSSANSNRLQITNMGTTPIDDK  2032
             F A  P P T  T  P V L+T  N  I +      T Q++A  + ++ T          
Sbjct  6675  FEASTPRPVTLETAVPSVTLETTTNVPIGSTG-GQVTGQTTATPSEVRTT----------  6723

Query  2033  SAAATAIETSAAQSKMLHNGNNADLLTSTQLPHTSLTMPGPVNSQLVQLTNTSQSLISPL  2092
                   +E S   S+      + D  T ++ P T  T+P    ++             P 
Sbjct  6724  ----IRVEESTLPSR------STDRTTPSESPETPTTLPSDFTTR-------------PH  6760

Query  2093  ADKQPAAILCGLPPNAVITGVTPAPKEAPYGTTIYISNISSAVPVVANGAQSQDKQFAPT  2152
             +D+   +    +P        TP+P           S  ++ VP+ + G Q  ++  +  
Sbjct  6761  SDQTTESTR-DVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTEQTTSSP  6819

Query  2153  LETNA-----QTSAKTSSQAVANTLENMSNVRFLTPDVRVTATGDATANELFSTPVLTTM  2207
              E        +++  + S    +  E+      L  D       D T       P     
Sbjct  6820  SEVRTTIGLEESTLPSRSTDRTSPSESPETPTTLPSDFITRPHSDQTTESTRDVPTTRPF  6879

Query  2208  SNTNPGLVSL----PVSQQQHSTCDKRGTVG--ISTQASTAENTVKVTTAAER-------  2254
               + P   SL    P    + +T    G+ G  ++ Q +++ + V+ T   E        
Sbjct  6880  EASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTEQTTSSPSEVRTTIGLEESTLPSRS  6939

Query  2255  --HNTSGELKSSTSITPGDWKRFLLGDNGKRSTIGSTTITKMADKIETDGKLVMNIEGDE  2312
                 +  E   + +  P D+      D    ST    T         +   L   +    
Sbjct  6940  TDRTSPSESPETPTTLPSDFITRPHSDQTTESTRDVPTTRPFEASTPSSASLETTVPSVT  6999

Query  2313  FEPAASVLIKPNA---TTSLTTEAHELPLVAGVELNTNKCNLKGTTAITIGQSTA-----  2364
              E   +V I       T   T+   E+     VE +T        T  +    T      
Sbjct  7000  LETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTTLPS  7059

Query  2365  -IATKPKT--TTKTATTVAKKPNTSATNTSITNLRFKSLPLQKEPKTAIPVTTT----TV  2417
                T+P +  TT+++  V       A+      L+   LP+  E  T +P+ +T    T 
Sbjct  7060  DFTTRPHSDQTTESSRDVPTTQPFEASTPRPVTLQTAVLPVTSETTTNVPIGSTGGQVTE  7119

Query  2418  IFKSSAPTLSVATRTKPTTLNLTAAMSKAPSTSITIANSMHQPLKQQLKIPPRSMKPSKA  2477
                SS   +    R + +TL   +     PS S     ++                PS  
Sbjct  7120  QTTSSPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTTL----------------PSDF  7163

Query  2478  QTLAARQSLTSSSRSLINSPITNGASVNSPKPLINIRPAIP  2518
              T       T SSR +   P T     ++P+P + +  A+P
Sbjct  7164  TTRPHSDQTTESSRDV---PTTQPFESSTPRP-VTLETAVP  7200


 Score = 38.5 bits (88),  Expect = 0.099, Method: Composition-based stats.
 Identities = 97/522 (19%), Positives = 167/522 (32%), Gaps = 45/522 (9%)

Query  2104  LPPNAVITGVTPAPKEAPYGTTIYISNISSAVPVVANGAQSQDKQFAPTLETNAQTSAKT  2163
             +P        TP+P           S  ++ VP+ + G Q   +  AP  E       + 
Sbjct  6567  VPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTGQTTAPPSEVRTTIRVEE  6626

Query  2164  SSQAVANT-----LENMSNVRFLTPDVRVTATGDATANELFSTPVLTTMSNTNPGLVSL-  2217
             S+    +T      E+      L  D       D T       P       + P  V+L 
Sbjct  6627  STLPSRSTDRTTPSESPETPTILPSDFTTRPHSDQTTESTRDVPTTRPFEASTPRPVTLE  6686

Query  2218  ---PVSQQQHSTCDKRGTVG--ISTQASTAENTVKVTTAAER---------HNTSGELKS  2263
                P    + +T    G+ G  ++ Q +   + V+ T   E            T  E   
Sbjct  6687  TAVPSVTLETTTNVPIGSTGGQVTGQTTATPSEVRTTIRVEESTLPSRSTDRTTPSESPE  6746

Query  2264  STSITPGDWKRFLLGDNGKRSTIGSTTITKMADKIETDGKLVMNIEGDEFEPAASVLIKP  2323
             + +  P D+      D    ST    T         +   L   +     E   +V I  
Sbjct  6747  TPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGS  6806

Query  2324  NA---TTSLTTEAHELPLVAGVELNTNKCNLKGTTAITIGQSTAIATKPKTTTKTATTVA  2380
                  T   T+   E+    G+E        + T        T+ +  P+T T   +   
Sbjct  6807  TGGQVTEQTTSSPSEVRTTIGLE--------ESTLPSRSTDRTSPSESPETPTTLPSDFI  6858

Query  2381  KKPNTSATNTSI----TNLRFK-SLPLQKEPKTAIPV----TTTTVIFKSSAPTLSVATR  2431
              +P++  T  S     T   F+ S P     +T +P     TTT V   S+   ++  T 
Sbjct  6859  TRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTEQTT  6918

Query  2432  TKPTTLNLTAAM--SKAPSTSITIANSMHQPLKQQLKIPPRSMKPSKAQTLAARQSLTSS  2489
             + P+ +  T  +  S  PS S    +    P            +P   QT  + + + ++
Sbjct  6919  SSPSEVRTTIGLEESTLPSRSTDRTSPSESPETPTTLPSDFITRPHSDQTTESTRDVPTT  6978

Query  2490  SRSLINSPITNGASVNSPKPLINIRPAIPIPQRAASATKANTQRLSDSALFTPNMLNNRR  2549
                  ++P +       P   +     +PI       T+  T   S S + T   +    
Sbjct  6979  RPFEASTPSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTTS--SPSEVRTTIRVEEST  7036

Query  2550  L-SVPNVATKPAETVKNKTQLAKTKTSEQYGVFCSSSNDGAP  2590
             L S     T P+E+ +  T L    T+  +    + S+   P
Sbjct  7037  LPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESSRDVP  7078


 Score = 34.7 bits (78),  Expect = 1.6, Method: Composition-based stats.
 Identities = 127/676 (19%), Positives = 230/676 (34%), Gaps = 77/676 (11%)

Query  1931  AADATNSEKAPLEEAQAKETVQLPESDDDDCMIVEDEEPSGSFSALEPLPQTNITVKPLV  1990
             +AD T   ++P       +    P S+        D   +  F A  P   +  T  P V
Sbjct  5469  SADRTTPSESPETPTLPSDFTTRPHSEQT-TESTRDVPTTRPFEASTPSSASLETTVPSV  5527

Query  1991  ELQTKLNSSISTR--QLTNFTIQSSANSNRLQITNMGTTPID--DKSAAATAIETSAAQS  2046
              L+T  N  I +   Q+T  T  S +           T P    D++  + + ET    S
Sbjct  5528  TLETTTNVPIGSTGGQVTEQTTSSPSEFRTTIRVEESTLPSRSADRTTPSESPETPTLPS  5587

Query  2047  KMLHNGNNADLLTSTQ-LPHT---SLTMPGPVNSQLVQLTNTSQSLISPLADKQPAAILC  2102
                   ++     ST+ +P T     + P P +     L  T  S+ S      P     
Sbjct  5588  DFTTRPHSEQTTESTRDVPTTRPFEASTPSPAS-----LETTVPSVTSETTTNVPIGSTG  5642

Query  2103  G-------LPPNAVITGVT-------------PAPKEAPYGTTIYISNISSAVPVVANGA  2142
             G        PP+ V T +                P E+P   TI  S+ ++         
Sbjct  5643  GQVTGQTTAPPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTILPSDSTTRTYSDQTTE  5702

Query  2143  QSQDKQFAPTLETNAQTSAKTSSQAVANTLENMSNVRFLTPDVRVTATGDATANELFST-  2201
              ++D       E +  + A   +   + TLE  +NV   +   +VT    AT +E+ +T 
Sbjct  5703  STRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVPIGSTGGQVTGQTTATPSEVRTTI  5762

Query  2202  -------PVLTT------MSNTNPGLVSLPVSQQQHSTCDKRGTVGIST----QASTA--  2242
                    P  +T       S   P  +    + + HS      T  + T    +AST   
Sbjct  5763  GVEESTLPSRSTDRTSPSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPSP  5822

Query  2243  ---ENTVKVTTAAERHN-----TSGELKSSTSITPGDWKRFLLGDNGKRSTIGSTTITKM  2294
                E TV   T+    N     T G++   T+ +P +  R  +G         ST  T  
Sbjct  5823  ASLETTVPSVTSETTTNVPIGSTGGQVTEQTTSSPSE-VRTTIGLEESTLPSRSTDRTSP  5881

Query  2295  ADKIETDGKL----VMNIEGDEFEPAASVL--IKPNATTSLTTEAHELPLVAGVELNTNK  2348
             ++  ET   L    +     D+   +   +   +P   ++ +  + E  + +     T  
Sbjct  5882  SESPETPTTLPSDFITRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTN  5941

Query  2349  CNLKGTTAITIGQSTAIATKPKTTT-------KTATTVAKKPNTSATNTSITNLRFKSLP  2401
               +  T     GQ+TA  ++ +TT         + +T    P+ S    +     F + P
Sbjct  5942  VPIGSTGGQVTGQTTAPPSEVRTTIGVEESTLPSRSTDRTSPSESPETPTTLPSDFITRP  6001

Query  2402  LQKEPKTAIPVTTTTVIFKSSAPTLSVATRTKPTTLNLTAAMSKAPSTSITIANSMHQPL  2461
               ++   +     TT  F++S P+ +    T P+  +         ST   I  +  +  
Sbjct  6002  HSEQTTESTRDVPTTRPFEASTPSPASLKTTVPSVTSEATTNVPIGSTGQRIGTTPSESP  6061

Query  2462  KQQLKIPPR-SMKPSKAQTLAARQSLTSSSRSLINSPITNGASVNSPKPLINIRPAIPIP  2520
             +    +P   + +P   +T  + + + ++     ++P         P   +     +PI 
Sbjct  6062  ETPTTLPSDFTTRPHSEKTTESTRDVPTTRPFETSTPSPASLETTVPSVTLETTTNVPIG  6121

Query  2521  QRAASATKANTQRLSD  2536
                   T+  T   S+
Sbjct  6122  STGGQVTEQTTSSPSE  6137


 Score = 33.9 bits (76),  Expect = 2.5, Method: Composition-based stats.
 Identities = 100/502 (20%), Positives = 181/502 (36%), Gaps = 84/502 (17%)

Query  2117  PKEAPYGTTIYISNISSAVPVVANGAQSQDKQFAPTLETNAQTSAKTSSQAVANTLENMS  2176
             P E+P   T   S+ ++          ++D       E +  + A   +   + TLE  +
Sbjct  7557  PSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLETTT  7616

Query  2177  NVRFLTPDVRVTATGDATANELFSTPVL------------TTMSNTNPGLVSLP--VSQQ  2222
             NV   +   +VT    AT +E+ +T  +            TT S +     +LP   + +
Sbjct  7617  NVPIGSTGGQVTGQTTATPSEVRTTIGVEESTLPSRSTDRTTPSESPETPTTLPSDFTTR  7676

Query  2223  QHSTCDKRGTVGIST----QASTAEN-TVKVTTAAERHNTSGELKSSTSITPGDWKRFLL  2277
              HS      T  + T    +AST    T++    +    T+  +   +++T        +
Sbjct  7677  PHSDQTTESTRDVPTTRPFEASTPRPVTLETAVPSVTSETTTNVPIGSTVTSETTTNVPI  7736

Query  2278  GDNGKRSTIGSTTI--TKMADKIETDGKLVMNIEGDEFEPAASVLIKPNATTSLTTEAH-  2334
             G  G +   G TT   +++   I  +   + +   D   P+ S        +  TT  H 
Sbjct  7737  GSTGGQ-VAGQTTAPPSEVRTTIRVEESTLPSRSADRTTPSESPETPTTLPSDFTTRPHS  7795

Query  2335  ------------------ELPLVAGVELNTNKCNLKGTTAITIG--------QSTAIATK  2368
                                 P  A +E        + TT + IG        QST+  ++
Sbjct  7796  EQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQLTEQSTSSPSE  7855

Query  2369  PKTTTKTATTVAKKPNTSATNTSITNLRFKSLPLQKEPKTAIPVTT-------TTVIFKS  2421
              +TT +   +     +T  T  S +  +  +LP     +  +  TT       TT  F++
Sbjct  7856  VRTTIRVEESTLPSRSTDRTFPSESPEKPTTLPSDFTTRPHLEQTTESTRDVLTTRPFET  7915

Query  2422  SAPT-----LSVATRTKPTTLN---------LTAAMSKAPS--TSITIANSMHQPLKQQL  2465
             S P+      +V + T  T+ N         +T   +  PS  T+ TI  S H  +    
Sbjct  7916  STPSPVSLETTVPSVTSETSTNVPIGSTGGQVTEQTTAPPSVRTTETIVKSTHPAVSPDT  7975

Query  2466  KIP---PRSMKPSKAQT-LAARQSL--------TSSSRSLINSPITNGASVNSPKPLINI  2513
              IP   P +  P ++ T L   Q++        TSS R   ++ +T+  S  + +P+  +
Sbjct  7976  TIPSEIPATRVPLESTTRLYTDQTIPPGSTDRTTSSERPDESTRLTSEESTETTRPVPTV  8035

Query  2514  RPAIPIPQRAASATKANTQRLS  2535
              P   +     S     T+  S
Sbjct  8036  SPRDALETTVTSLITETTKTTS  8057



Lambda      K        H
   0.312    0.126    0.350 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 36770632136


Query= XP_014085224.1 PREDICTED: uncharacterized protein LOC106614177
[Bactrocera oleae]

Length=2717
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9W198_DROME  unnamed protein product                                 859     0.0  
Q961M6_DROME  unnamed protein product                                 197     1e-50
M9PEI1_DROME  unnamed protein product                                 42.4    0.008


>Q9W198_DROME unnamed protein product
Length=2175

 Score = 859 bits (2220),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 551/1322 (42%), Positives = 752/1322 (57%), Gaps = 167/1322 (13%)

Query  14    IQRKYNVSIGFLKSNLGNIEKFLWYALSPRLIIKRVAIRKGSKQRVILNYYHLRRVLFDQ  73
             I+RKY VS  FL SN  N+E+F+ YALSPR +I+  A R+  + R +     +R +LFD 
Sbjct  21    IKRKYPVSKDFLHSNWWNVERFIVYALSPRCVIRNYAWRR-RRTRSVCIIRRVRILLFDP  79

Query  74    AERKVFKTRRRNVQLWSKQMVSYLRRKYGVKEHIEITTLSDNTETINKQQEEIASGANMA  133
               +++ K R +NV+ WSK +V+Y ++   ++EH E               E       +A
Sbjct  80    RLKRMIKRRLQNVRHWSKGLVNYYKKMGRIEEHEET--------------EVYRVAEPLA  125

Query  134   PDEVSKQLKEQLEILRSGKRTVPLIESETKSIVDELRKDAVDAATNNIPFQTTALLSQCA  193
              +E+SKQ+K+QLE+L++GKR++ LIE                        +TTA+     
Sbjct  126   AEELSKQMKQQLELLKTGKRSLSLIE------------------------ETTAIAEVPP  161

Query  194   TKNVDDSNQFSHIT--SKVLDKTESVVQNTLETTPEKQIMSSDETRSEQPKHSYKADRNM  251
              K      QF  IT  ++V++ ++    + L+  P KQ  +++ T ++ P          
Sbjct  162   KK----PKQFPDITEEARVINDSD----DRLDAAPSKQ--AAERTPTKSPAQV-------  204

Query  252   DIDGESVELP-PVDATIKISADFATKSATEMLQQCADKKTARSLSSNSNFLDMLMNKVRG  310
                  S ++P P   + + S   +T S+ E      DK     +   S FLDML++KVR 
Sbjct  205   ---AASEDVPTPATPSKEQSGQTSTCSSAEK----TDK--VEKVGGGSKFLDMLISKVRV  255

Query  311   NNVHTETANNTKAIQTPPTAKELVEINAYKTPDNNEHFTDSGEEFFGFDETERLPGMLLT  370
              N   E  NN  A    P+A        + T ++     +   +F GFDE+   PGMLLT
Sbjct  256   KNFARE--NNMPA---EPSAV------TFCTSED-----EGSADFVGFDESVHQPGMLLT  299

Query  371   PLVPFSAQSKGNANVAFISESLNEFMRENLLESSDCVADGIDNAAGRKHRQATLDGLVTP  430
             PLVP + ++    N AF+SESL+ +MRE+ +  SD   D         H     DG VT 
Sbjct  300   PLVPNNCKTT-EGNSAFVSESLDAYMREHHINDSDSQDDKDKLLEPMGH-----DGQVTS  353

Query  431   ECMPPQMQMPLVPESLQKLRTVAERRQFLQKFNRNHKLAIINNEAAICRELQRKIRHQKS  490
               MPP M MP VPE+LQ+LRTVAERRQ+LQ+  +NHK+ IINNEA + RELQRK R +K 
Sbjct  354   HSMPPPMDMPAVPEALQRLRTVAERRQYLQRC-KNHKMGIINNEANVYRELQRKQRQRKV  412

Query  491   KSVSQQSLQAPNSQMPFTRQGWQAASFVTTEFNHYYYQTVDVIDGNERERVRLPGVRGNN  550
             K  + Q+LQA +SQMPFTRQGWQAAS+V TE + YYYQ + V DG   E VRLPG +GNN
Sbjct  413   KIGAMQALQASDSQMPFTRQGWQAASYVATEHSKYYYQVIQV-DG---EMVRLPGAQGNN  468

Query  551   EERNKRPYLSRVSCQVLRN-KCNINNCSDALIGRDLK--PVKAEPDR--KKLNKTPLPSV  605
              +R K PYLSR+S +     KC+   C DA I ++LK  P +  P R  K LN+ PLP++
Sbjct  469   LKREKSPYLSRLSRKEQEELKCS-EQCLDARIQQELKVIPTRVSPPRNPKILNQYPLPAI  527

Query  606   FKPCPLSHKPFQKPLDDETAPLLLAGGSMAVVRMPIVELEVFPALGKPLHDVAKRYLDYI  665
             F+PCPLS KP Q+PLDD+TA LLLAGGSMAVV MP VEL+V P LG+PL ++AKRYL +I
Sbjct  528   FRPCPLSKKPLQRPLDDDTAALLLAGGSMAVVSMPNVELDVMPQLGRPLDEIAKRYLQHI  587

Query  666   LPHCDITREWAEFSVSTLQL-SADYKKTDDQSKQQAGDDMKIANASYTFPIPYMNDRSHI  724
             LPH DITREWAEFSVSTLQ   A  K  ++Q+ Q      K    S+TF IPY+NDR+HI
Sbjct  588   LPHHDITREWAEFSVSTLQAPPATMKDAEEQASQTPAGRRK----SFTFVIPYLNDRNHI  643

Query  725   LVRRVVDRSEKLDETFEATTSPTEDFSFRANI-DESDSELVECADVLSEMINSVAISCSE  783
             LVRRVVDRSE LD +F+   +  ++F+FR  +  + D+E+V CA+++S+MIN+VAISCSE
Sbjct  644   LVRRVVDRSEHLDRSFKEEPNKLQEFTFREMLPPQPDAEIVACAEMISDMINTVAISCSE  703

Query  784   NSFIKIDPDGVQTD---KEEDVELKQEKVAGKVKEEKSCNIKATDDSKLVNQAAANKKQN  840
             NSFI  DPD +      K  D+   +E+             K TD S    +   N KQ 
Sbjct  704   NSFISEDPDALDASSVPKSSDLCPAKEETG-----------KDTDKSGAKPKNLPN-KQK  751

Query  841   RLLLELRRLNATIIDAAVKAEKGAKPCTKEYCTFGCICQSLAD-DYPLRQHCGKSKCVIE  899
             RL  ELRRLNATIIDAA +     KPC+K+YC  GCIC SLA  + P+R HCG+++CV++
Sbjct  752   RLANELRRLNATIIDAAARKADANKPCSKDYCHLGCICASLAGTELPVRDHCGRAECVLD  811

Query  900   CTCKTPSQSRIMRLE-TDGRSITTEDAFMLRRQATARLARMEKEFTSTVVLTENETLLIN  958
             C C +  +SR+MRLE  DGR I+ EDAF LRR+ATARLA+MEK+FTST+VLT+NETLLIN
Sbjct  812   CRCLSAEESRVMRLEAADGRGISNEDAFNLRRKATARLAKMEKDFTSTLVLTDNETLLIN  871

Query  959   ESQYDKKRRCTKAPKRYEDFADT---EEDYARTSANTPPKKTQNTAVVAIEAATDTTLSS  1015
             ESQ DKKRRCTKAPKRYEDF D+   EE+    S  T  +K    A  A  AA     ++
Sbjct  872   ESQGDKKRRCTKAPKRYEDFDDSIYDEEEKDVVSPTTRKQKKHAAAAAAAAAAAAAAAAA  931

Query  1016  GFSETTTELREPIYVNDKVLEKLKHCTVPLIRFDNTQNMAVWCMVHELYKCYCGGRATEG  1075
                 +   L EP +V D  L KLKHC V L R  N +N+A +CM H+LYKC+CGG + +G
Sbjct  932   SAKISAPALSEPCFVKDTDLAKLKHCFVGLRRLSNVENLATFCMTHQLYKCFCGGDSPDG  991

Query  1076  KPLVIEKDSNVTTNNEQTNVGNKQNASTDEEYIVTSTKARYSFETVEQTVDEADAELREE  1135
             KP+VIEKD              + NA         + +A YSFE   +          ++
Sbjct  992   KPVVIEKD--------------QWNAPVTHFNPDLAVRAHYSFERPPEETSTKKKGKEKK  1037

Query  1136  NEIFRKRREKRKSADRKSQGSVVRYNSTDDERDESDREDDMLEESLGSEFAGDNGRAKRP  1195
              +   + +     AD+K Q   V       E  +        E    +    D    K  
Sbjct  1038  PKHKLESKSSNDVADQKPQTQAVETLPLKTESKQ--------EPPPANSLFKDESPLK--  1087

Query  1196  KLAKRLERRGRPSELTFINKYFITEADGCRRVVVVPRKTYLRINRKRRIEVEEFIAKNEN  1255
                       R +EL  I  YF +  D CRR + +P+ +Y R+N++R   V   IA+ E+
Sbjct  1088  ----------RSNELNKIFNYFRSRPDVCRRAISIPKNSYQRLNQRRADRVRHQIAREES  1137

Query  1256  KQSMLLLNEHIMRSVYYHKHEVEKQRKEAAQESLLLTKKRKLNDNELTGTEDASNKESKK  1315
              ++  +L   I  +V Y++ E+++QRK        L+KK  +     +   DAS ++ K 
Sbjct  1138  LKTNEMLKMRIQGAVVYYRKEIDRQRKRE------LSKKPVIEVRNESDASDASVRQKKI  1191

Query  1316  ET  1317
             ET
Sbjct  1192  ET  1193


 Score = 200 bits (508),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 161/518 (31%), Positives = 236/518 (46%), Gaps = 83/518 (16%)

Query  1774  MKTNIVFRKVMSHDIDEMNVLDITTEPHRWLVLELYRDFSHIYVPDFQELVSLDRIQKVM  1833
             +++NI FRKV  +D+DE+ + ++    HRW+VL+++ DFSHI+VP F +++SL RI  VM
Sbjct  1551  IRSNIEFRKVNHNDVDELQIPELHQTDHRWVVLDIFDDFSHIFVPSFSDMISLTRIHSVM  1610

Query  1834  AFSRQKQKIVKLQFFKDAAYDAFVIPNSERKIFFGPLKLNMPPPLLILLQSVDRKMMLRE  1893
               + ++QK+VKLQFF +A YDAFV P+S++KI+FGPL L+MPPP+L+LLQSVDRKMMLRE
Sbjct  1611  QVAEERQKVVKLQFFPNAPYDAFVTPSSKKKIYFGPLSLDMPPPVLVLLQSVDRKMMLRE  1670

Query  1894  TYQQMHNIQGGAKESTTAFWIVRKNGQVYVDHNLDGCAADATNSEKAPLEEAQAKETVQL  1953
              YQ+ H+I       + AFW+++ NGQV+ + + +  A  A   + A +        +++
Sbjct  1671  VYQREHSIPVQRHRRSMAFWVLQINGQVHFEIDTESTAKLAAQQKNA-IGTPPGLNVLKI  1729

Query  1954  PESDDDDCMIVEDEEPSGSFSALEPLPQTNITVKPLVELQTKLNSSISTRQL--------  2005
             P     +    +DE P                  P+V + +        RQL        
Sbjct  1730  PSQLSVEIEKNQDEVP------------------PVVVIDSDEEDDDGERQLVIDEQDDE  1771

Query  2006  ------------TNFTIQSSANSNRLQITNMGTTPIDDKSAAATAIETSAAQSKMLHNGN  2053
                         T FTIQ+  +S  LQIT   +   +  S  A  + T       +    
Sbjct  1772  QAETDVKQEVERTGFTIQTLPSSGALQITISDSA--ETSSHPAKDVNTCHFSGGFMPFIA  1829

Query  2054  NADLLTSTQLPHTSLTMPGPVNSQLVQLTNTSQS----LISPLADKQPAA----------  2099
             N         P T    P       VQ+T TSQS    L S  +   PA+          
Sbjct  1830  NVPAKFGETAPTTQFLTPQ------VQVT-TSQSGPETLTSSSSSHLPASKSAYPKINES  1882

Query  2100  ----ILCGLPPNAV-ITGVTPAPKEAPYGTTIYISNISSAVPVVANGAQSQDKQFAPTLE  2154
                    G+PP  + IT V    K  P  T   + N  S   +   G   Q         
Sbjct  1883  LQELFSSGVPPGGITITKVDSQEKTLPNETVQVVKNKKS---IAITGIHKQ--------V  1931

Query  2155  TNAQTSAKTSSQAVANTLENMS-NVRFLTPDVRVTATGDA-TANELFSTPVLTTMSNTNP  2212
             T A +S  T + A A  ++  S +V  + P +R  AT    T   L+  P L     + P
Sbjct  1932  TKAASSTATVTAARAPVVKPQSTSVSKVAPPIRPGATTQPKTLVRLYPKPALAAGRKSLP  1991

Query  2213  GLVSLPVS---QQQHSTCDKRGTVGISTQASTAENTVK  2247
                  PV+   Q Q   CDK   V  ST  +  E + +
Sbjct  1992  ANAKTPVATPRQSQPVACDKPPLVSGSTLPALVEPSAR  2029


 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 46/88 (52%), Gaps = 7/88 (8%)

Query  2565  NKTQLAKTKTSEQYGVFCSSSNDGAPRFWAKRMHNSYLIKVPGLSSVVHRIDLESADTYL  2624
             +K QLAK +    YG+  +      PRF AK   + ++IK+P    V        A ++L
Sbjct  2077  SKAQLAKEEIC--YGIMVAKD---LPRFRAKVEGSDFMIKIPE-HGVFRFKTFGLAASFL  2130

Query  2625  NQHLLKQSPAMKSKLPIKWKFVPSEQLN  2652
             ++H+ K  P +K  LP +WKF P EQ N
Sbjct  2131  SRHVAK-DPKLKQFLPAEWKFHPLEQFN  2157


>Q961M6_DROME unnamed protein product
Length=956

 Score = 197 bits (500),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 161/518 (31%), Positives = 236/518 (46%), Gaps = 83/518 (16%)

Query  1774  MKTNIVFRKVMSHDIDEMNVLDITTEPHRWLVLELYRDFSHIYVPDFQELVSLDRIQKVM  1833
             +++NI FRKV  +D+DE+ + ++    HRW+VL+++ DFSHI+VP F +++SL RI  VM
Sbjct  332   IRSNIEFRKVNHNDVDELQIPELHQTDHRWVVLDIFDDFSHIFVPSFSDMISLTRIHSVM  391

Query  1834  AFSRQKQKIVKLQFFKDAAYDAFVIPNSERKIFFGPLKLNMPPPLLILLQSVDRKMMLRE  1893
               + ++QK+VKLQFF +A YDAFV P+S++KI+FGPL L+MPPP+L+LLQSVDRKMMLRE
Sbjct  392   QVAEERQKVVKLQFFPNAPYDAFVTPSSKKKIYFGPLSLDMPPPVLVLLQSVDRKMMLRE  451

Query  1894  TYQQMHNIQGGAKESTTAFWIVRKNGQVYVDHNLDGCAADATNSEKAPLEEAQAKETVQL  1953
              YQ+ H+I       + AFW+++ NGQV+ + + +  A  A   + A +        +++
Sbjct  452   VYQREHSIPVQRHRRSMAFWVLQINGQVHFEIDTESTAKLAAQQKNA-IGTPPGLNVLKI  510

Query  1954  PESDDDDCMIVEDEEPSGSFSALEPLPQTNITVKPLVELQTKLNSSISTRQL--------  2005
             P     +    +DE P                  P+V + +        RQL        
Sbjct  511   PSQLSVEIEKNQDEVP------------------PVVVIDSDEEDDDGERQLVIDEQDDE  552

Query  2006  ------------TNFTIQSSANSNRLQITNMGTTPIDDKSAAATAIETSAAQSKMLHNGN  2053
                         T FTIQ+  +S  LQIT   +   +  S  A  + T       +    
Sbjct  553   QAETDVKQEVERTGFTIQTLPSSGALQITISDSA--ETSSHPAKDVNTCHFSGGFMPFIA  610

Query  2054  NADLLTSTQLPHTSLTMPGPVNSQLVQLTNTSQS----LISPLADKQPAA----------  2099
             N         P T    P       VQ+T TSQS    L S  +   PA+          
Sbjct  611   NVPAKFGETAPTTQFLTPQ------VQVT-TSQSGPETLTSSSSSHLPASKSAYPKINES  663

Query  2100  ----ILCGLPPNAV-ITGVTPAPKEAPYGTTIYISNISSAVPVVANGAQSQDKQFAPTLE  2154
                    G+PP  + IT V    K  P  T   + N  S   +   G   Q         
Sbjct  664   LQELFSSGVPPGGITITKVDSQEKTLPNETVQVVKNKKS---IAITGIHKQ--------V  712

Query  2155  TNAQTSAKTSSQAVANTLENMS-NVRFLTPDVRVTATGDA-TANELFSTPVLTTMSNTNP  2212
             T A +S  T + A A  ++  S +V  + P +R  AT    T   L+  P L     + P
Sbjct  713   TKAASSTATVTAARAPVVKPQSTSVSKVAPPIRPGATTQPKTLVRLYPKPALAAGRKSLP  772

Query  2213  GLVSLPVS---QQQHSTCDKRGTVGISTQASTAENTVK  2247
                  PV+   Q Q   CDK   V  ST  +  E + +
Sbjct  773   ANAKTPVATPRQSQPVACDKPPLVSGSTLPALVEPSAR  810


 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 46/88 (52%), Gaps = 7/88 (8%)

Query  2565  NKTQLAKTKTSEQYGVFCSSSNDGAPRFWAKRMHNSYLIKVPGLSSVVHRIDLESADTYL  2624
             +K QLAK +    YG+  +      PRF AK   + ++IK+P    V        A ++L
Sbjct  858   SKAQLAKEEIC--YGIMVAKD---LPRFRAKVEGSDFMIKIPE-HGVFRFKTFGLAASFL  911

Query  2625  NQHLLKQSPAMKSKLPIKWKFVPSEQLN  2652
             ++H+ K  P +K  LP +WKF P EQ N
Sbjct  912   SRHVAKD-PKLKQFLPAEWKFHPLEQFN  938


>M9PEI1_DROME unnamed protein product
Length=21657

 Score = 42.4 bits (98),  Expect = 0.008, Method: Composition-based stats.
 Identities = 110/525 (21%), Positives = 184/525 (35%), Gaps = 77/525 (15%)

Query  1931  AADATNSEKAPLEEAQAKETVQLPESDDDDCMIVEDEEPSGSFSALEPLPQTNITVKPLV  1990
             + D T   ++P                D       D   +  F A  P P T  T  P V
Sbjct  7653  STDRTTPSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPRPVTLETAVPSV  7712

Query  1991  ELQTKLN----SSISTRQLTNFTIQSSANSNRLQITNMGTTPIDDKSAAATAIETSAAQS  2046
               +T  N    S++++   TN  I S+      Q+    T P   +      +E S   S
Sbjct  7713  TSETTTNVPIGSTVTSETTTNVPIGSTGG----QVAGQTTAP-PSEVRTTIRVEESTLPS  7767

Query  2047  KMLHNGNNADLLTSTQLPHTSLTMPGPVNSQLVQLTNTSQSLISPLADKQPAAILCGLPP  2106
             +      +AD  T ++ P T  T+P    S      ++ Q+  S             +P 
Sbjct  7768  R------SADRTTPSESPETPTTLP----SDFTTRPHSEQTTESTR----------DVPT  7807

Query  2107  NAVITGVTPAPKEAPYGTTIYISNISSAVPVVANGAQSQDKQFAPTLETNAQTSAKTSSQ  2166
                    TP+P           S  ++ VP+ + G Q  ++       T++ +  +T+ +
Sbjct  7808  TRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQLTEQS------TSSPSEVRTTIR  7861

Query  2167  AVANTLENMSNVRFL---TPDVRVTATGDATANELF------STPVLTT--MSNTNPGLV  2215
                +TL + S  R     +P+   T   D T           +  VLTT     + P  V
Sbjct  7862  VEESTLPSRSTDRTFPSESPEKPTTLPSDFTTRPHLEQTTESTRDVLTTRPFETSTPSPV  7921

Query  2216  SL----PVSQQQHSTCDKRGTVG--ISTQAS------TAENTVKVTTAAERHNTSGELKS  2263
             SL    P    + ST    G+ G  ++ Q +      T E  VK T  A   +T+   + 
Sbjct  7922  SLETTVPSVTSETSTNVPIGSTGGQVTEQTTAPPSVRTTETIVKSTHPAVSPDTTIPSEI  7981

Query  2264  STSITPGDWKRFLLGDNGKRSTIGSTTITKMADKIETDGKLVMNIEGDEFEPAASVLIKP  2323
               +  P +    L  D  +    GST  T  +++ +   +L      +   P  +V  + 
Sbjct  7982  PATRVPLESTTRLYTD--QTIPPGSTDRTTSSERPDESTRLTSEESTETTRPVPTVSPRD  8039

Query  2324  NATTSLTTEAHELPLVAGVELNTNKCNLKGTTAITIGQSTAIATKPKTTTKTATTVAKK-  2382
                T++T+   E          T K    GT    + + T  +    TT +++  V ++ 
Sbjct  8040  ALETTVTSLITE----------TTKTTSGGTPRGQVTERTTKSVSELTTGRSSDVVTERT  8089

Query  2383  --PNTSATNTSITNLRFKSLPLQKEPKTAIPVTTTTVIFKSSAPT  2425
                N S+T T   N    S P+     T I +T T        PT
Sbjct  8090  MPSNISSTTTVFNN----SEPVSDNLPTTISITVTDSPTTVPVPT  8130


 Score = 38.9 bits (89),  Expect = 0.093, Method: Composition-based stats.
 Identities = 109/581 (19%), Positives = 188/581 (32%), Gaps = 90/581 (15%)

Query  1973  FSALEPLPQTNITVKPLVELQTKLNSSISTRQLTNFTIQSSANSNRLQITNMGTTPIDDK  2032
             F A  P P T  T  P V L+T  N  I +      T Q++A  + ++ T          
Sbjct  6675  FEASTPRPVTLETAVPSVTLETTTNVPIGSTG-GQVTGQTTATPSEVRTT----------  6723

Query  2033  SAAATAIETSAAQSKMLHNGNNADLLTSTQLPHTSLTMPGPVNSQLVQLTNTSQSLISPL  2092
                   +E S   S+      + D  T ++ P T  T+P    ++             P 
Sbjct  6724  ----IRVEESTLPSR------STDRTTPSESPETPTTLPSDFTTR-------------PH  6760

Query  2093  ADKQPAAILCGLPPNAVITGVTPAPKEAPYGTTIYISNISSAVPVVANGAQSQDKQFAPT  2152
             +D+   +    +P        TP+P           S  ++ VP+ + G Q  ++  +  
Sbjct  6761  SDQTTESTR-DVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTEQTTSSP  6819

Query  2153  LETNA-----QTSAKTSSQAVANTLENMSNVRFLTPDVRVTATGDATANELFSTPVLTTM  2207
              E        +++  + S    +  E+      L  D       D T       P     
Sbjct  6820  SEVRTTIGLEESTLPSRSTDRTSPSESPETPTTLPSDFITRPHSDQTTESTRDVPTTRPF  6879

Query  2208  SNTNPGLVSL----PVSQQQHSTCDKRGTVG--ISTQASTAENTVKVTTAAER-------  2254
               + P   SL    P    + +T    G+ G  ++ Q +++ + V+ T   E        
Sbjct  6880  EASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTEQTTSSPSEVRTTIGLEESTLPSRS  6939

Query  2255  --HNTSGELKSSTSITPGDWKRFLLGDNGKRSTIGSTTITKMADKIETDGKLVMNIEGDE  2312
                 +  E   + +  P D+      D    ST    T         +   L   +    
Sbjct  6940  TDRTSPSESPETPTTLPSDFITRPHSDQTTESTRDVPTTRPFEASTPSSASLETTVPSVT  6999

Query  2313  FEPAASVLIKPNA---TTSLTTEAHELPLVAGVELNTNKCNLKGTTAITIGQSTA-----  2364
              E   +V I       T   T+   E+     VE +T        T  +    T      
Sbjct  7000  LETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTTLPS  7059

Query  2365  -IATKPKT--TTKTATTVAKKPNTSATNTSITNLRFKSLPLQKEPKTAIPVTTT----TV  2417
                T+P +  TT+++  V       A+      L+   LP+  E  T +P+ +T    T 
Sbjct  7060  DFTTRPHSDQTTESSRDVPTTQPFEASTPRPVTLQTAVLPVTSETTTNVPIGSTGGQVTE  7119

Query  2418  IFKSSAPTLSVATRTKPTTLNLTAAMSKAPSTSITIANSMHQPLKQQLKIPPRSMKPSKA  2477
                SS   +    R + +TL   +     PS S     ++                PS  
Sbjct  7120  QTTSSPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTTL----------------PSDF  7163

Query  2478  QTLAARQSLTSSSRSLINSPITNGASVNSPKPLINIRPAIP  2518
              T       T SSR +   P T     ++P+P + +  A+P
Sbjct  7164  TTRPHSDQTTESSRDV---PTTQPFESSTPRP-VTLETAVP  7200


 Score = 38.5 bits (88),  Expect = 0.099, Method: Composition-based stats.
 Identities = 97/522 (19%), Positives = 167/522 (32%), Gaps = 45/522 (9%)

Query  2104  LPPNAVITGVTPAPKEAPYGTTIYISNISSAVPVVANGAQSQDKQFAPTLETNAQTSAKT  2163
             +P        TP+P           S  ++ VP+ + G Q   +  AP  E       + 
Sbjct  6567  VPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTGQTTAPPSEVRTTIRVEE  6626

Query  2164  SSQAVANT-----LENMSNVRFLTPDVRVTATGDATANELFSTPVLTTMSNTNPGLVSL-  2217
             S+    +T      E+      L  D       D T       P       + P  V+L 
Sbjct  6627  STLPSRSTDRTTPSESPETPTILPSDFTTRPHSDQTTESTRDVPTTRPFEASTPRPVTLE  6686

Query  2218  ---PVSQQQHSTCDKRGTVG--ISTQASTAENTVKVTTAAER---------HNTSGELKS  2263
                P    + +T    G+ G  ++ Q +   + V+ T   E            T  E   
Sbjct  6687  TAVPSVTLETTTNVPIGSTGGQVTGQTTATPSEVRTTIRVEESTLPSRSTDRTTPSESPE  6746

Query  2264  STSITPGDWKRFLLGDNGKRSTIGSTTITKMADKIETDGKLVMNIEGDEFEPAASVLIKP  2323
             + +  P D+      D    ST    T         +   L   +     E   +V I  
Sbjct  6747  TPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGS  6806

Query  2324  NA---TTSLTTEAHELPLVAGVELNTNKCNLKGTTAITIGQSTAIATKPKTTTKTATTVA  2380
                  T   T+   E+    G+E        + T        T+ +  P+T T   +   
Sbjct  6807  TGGQVTEQTTSSPSEVRTTIGLE--------ESTLPSRSTDRTSPSESPETPTTLPSDFI  6858

Query  2381  KKPNTSATNTSI----TNLRFK-SLPLQKEPKTAIPV----TTTTVIFKSSAPTLSVATR  2431
              +P++  T  S     T   F+ S P     +T +P     TTT V   S+   ++  T 
Sbjct  6859  TRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTEQTT  6918

Query  2432  TKPTTLNLTAAM--SKAPSTSITIANSMHQPLKQQLKIPPRSMKPSKAQTLAARQSLTSS  2489
             + P+ +  T  +  S  PS S    +    P            +P   QT  + + + ++
Sbjct  6919  SSPSEVRTTIGLEESTLPSRSTDRTSPSESPETPTTLPSDFITRPHSDQTTESTRDVPTT  6978

Query  2490  SRSLINSPITNGASVNSPKPLINIRPAIPIPQRAASATKANTQRLSDSALFTPNMLNNRR  2549
                  ++P +       P   +     +PI       T+  T   S S + T   +    
Sbjct  6979  RPFEASTPSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTTS--SPSEVRTTIRVEEST  7036

Query  2550  L-SVPNVATKPAETVKNKTQLAKTKTSEQYGVFCSSSNDGAP  2590
             L S     T P+E+ +  T L    T+  +    + S+   P
Sbjct  7037  LPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESSRDVP  7078


 Score = 34.7 bits (78),  Expect = 1.6, Method: Composition-based stats.
 Identities = 127/676 (19%), Positives = 230/676 (34%), Gaps = 77/676 (11%)

Query  1931  AADATNSEKAPLEEAQAKETVQLPESDDDDCMIVEDEEPSGSFSALEPLPQTNITVKPLV  1990
             +AD T   ++P       +    P S+        D   +  F A  P   +  T  P V
Sbjct  5469  SADRTTPSESPETPTLPSDFTTRPHSEQT-TESTRDVPTTRPFEASTPSSASLETTVPSV  5527

Query  1991  ELQTKLNSSISTR--QLTNFTIQSSANSNRLQITNMGTTPID--DKSAAATAIETSAAQS  2046
              L+T  N  I +   Q+T  T  S +           T P    D++  + + ET    S
Sbjct  5528  TLETTTNVPIGSTGGQVTEQTTSSPSEFRTTIRVEESTLPSRSADRTTPSESPETPTLPS  5587

Query  2047  KMLHNGNNADLLTSTQ-LPHT---SLTMPGPVNSQLVQLTNTSQSLISPLADKQPAAILC  2102
                   ++     ST+ +P T     + P P +     L  T  S+ S      P     
Sbjct  5588  DFTTRPHSEQTTESTRDVPTTRPFEASTPSPAS-----LETTVPSVTSETTTNVPIGSTG  5642

Query  2103  G-------LPPNAVITGVT-------------PAPKEAPYGTTIYISNISSAVPVVANGA  2142
             G        PP+ V T +                P E+P   TI  S+ ++         
Sbjct  5643  GQVTGQTTAPPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTILPSDSTTRTYSDQTTE  5702

Query  2143  QSQDKQFAPTLETNAQTSAKTSSQAVANTLENMSNVRFLTPDVRVTATGDATANELFST-  2201
              ++D       E +  + A   +   + TLE  +NV   +   +VT    AT +E+ +T 
Sbjct  5703  STRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVPIGSTGGQVTGQTTATPSEVRTTI  5762

Query  2202  -------PVLTT------MSNTNPGLVSLPVSQQQHSTCDKRGTVGIST----QASTA--  2242
                    P  +T       S   P  +    + + HS      T  + T    +AST   
Sbjct  5763  GVEESTLPSRSTDRTSPSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPSP  5822

Query  2243  ---ENTVKVTTAAERHN-----TSGELKSSTSITPGDWKRFLLGDNGKRSTIGSTTITKM  2294
                E TV   T+    N     T G++   T+ +P +  R  +G         ST  T  
Sbjct  5823  ASLETTVPSVTSETTTNVPIGSTGGQVTEQTTSSPSE-VRTTIGLEESTLPSRSTDRTSP  5881

Query  2295  ADKIETDGKL----VMNIEGDEFEPAASVL--IKPNATTSLTTEAHELPLVAGVELNTNK  2348
             ++  ET   L    +     D+   +   +   +P   ++ +  + E  + +     T  
Sbjct  5882  SESPETPTTLPSDFITRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTN  5941

Query  2349  CNLKGTTAITIGQSTAIATKPKTTT-------KTATTVAKKPNTSATNTSITNLRFKSLP  2401
               +  T     GQ+TA  ++ +TT         + +T    P+ S    +     F + P
Sbjct  5942  VPIGSTGGQVTGQTTAPPSEVRTTIGVEESTLPSRSTDRTSPSESPETPTTLPSDFITRP  6001

Query  2402  LQKEPKTAIPVTTTTVIFKSSAPTLSVATRTKPTTLNLTAAMSKAPSTSITIANSMHQPL  2461
               ++   +     TT  F++S P+ +    T P+  +         ST   I  +  +  
Sbjct  6002  HSEQTTESTRDVPTTRPFEASTPSPASLKTTVPSVTSEATTNVPIGSTGQRIGTTPSESP  6061

Query  2462  KQQLKIPPR-SMKPSKAQTLAARQSLTSSSRSLINSPITNGASVNSPKPLINIRPAIPIP  2520
             +    +P   + +P   +T  + + + ++     ++P         P   +     +PI 
Sbjct  6062  ETPTTLPSDFTTRPHSEKTTESTRDVPTTRPFETSTPSPASLETTVPSVTLETTTNVPIG  6121

Query  2521  QRAASATKANTQRLSD  2536
                   T+  T   S+
Sbjct  6122  STGGQVTEQTTSSPSE  6137


 Score = 33.9 bits (76),  Expect = 2.5, Method: Composition-based stats.
 Identities = 100/502 (20%), Positives = 181/502 (36%), Gaps = 84/502 (17%)

Query  2117  PKEAPYGTTIYISNISSAVPVVANGAQSQDKQFAPTLETNAQTSAKTSSQAVANTLENMS  2176
             P E+P   T   S+ ++          ++D       E +  + A   +   + TLE  +
Sbjct  7557  PSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLETTT  7616

Query  2177  NVRFLTPDVRVTATGDATANELFSTPVL------------TTMSNTNPGLVSLP--VSQQ  2222
             NV   +   +VT    AT +E+ +T  +            TT S +     +LP   + +
Sbjct  7617  NVPIGSTGGQVTGQTTATPSEVRTTIGVEESTLPSRSTDRTTPSESPETPTTLPSDFTTR  7676

Query  2223  QHSTCDKRGTVGIST----QASTAEN-TVKVTTAAERHNTSGELKSSTSITPGDWKRFLL  2277
              HS      T  + T    +AST    T++    +    T+  +   +++T        +
Sbjct  7677  PHSDQTTESTRDVPTTRPFEASTPRPVTLETAVPSVTSETTTNVPIGSTVTSETTTNVPI  7736

Query  2278  GDNGKRSTIGSTTI--TKMADKIETDGKLVMNIEGDEFEPAASVLIKPNATTSLTTEAH-  2334
             G  G +   G TT   +++   I  +   + +   D   P+ S        +  TT  H 
Sbjct  7737  GSTGGQ-VAGQTTAPPSEVRTTIRVEESTLPSRSADRTTPSESPETPTTLPSDFTTRPHS  7795

Query  2335  ------------------ELPLVAGVELNTNKCNLKGTTAITIG--------QSTAIATK  2368
                                 P  A +E        + TT + IG        QST+  ++
Sbjct  7796  EQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQLTEQSTSSPSE  7855

Query  2369  PKTTTKTATTVAKKPNTSATNTSITNLRFKSLPLQKEPKTAIPVTT-------TTVIFKS  2421
              +TT +   +     +T  T  S +  +  +LP     +  +  TT       TT  F++
Sbjct  7856  VRTTIRVEESTLPSRSTDRTFPSESPEKPTTLPSDFTTRPHLEQTTESTRDVLTTRPFET  7915

Query  2422  SAPT-----LSVATRTKPTTLN---------LTAAMSKAPS--TSITIANSMHQPLKQQL  2465
             S P+      +V + T  T+ N         +T   +  PS  T+ TI  S H  +    
Sbjct  7916  STPSPVSLETTVPSVTSETSTNVPIGSTGGQVTEQTTAPPSVRTTETIVKSTHPAVSPDT  7975

Query  2466  KIP---PRSMKPSKAQT-LAARQSL--------TSSSRSLINSPITNGASVNSPKPLINI  2513
              IP   P +  P ++ T L   Q++        TSS R   ++ +T+  S  + +P+  +
Sbjct  7976  TIPSEIPATRVPLESTTRLYTDQTIPPGSTDRTTSSERPDESTRLTSEESTETTRPVPTV  8035

Query  2514  RPAIPIPQRAASATKANTQRLS  2535
              P   +     S     T+  S
Sbjct  8036  SPRDALETTVTSLITETTKTTS  8057



Lambda      K        H
   0.312    0.126    0.350 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 36770632136


Query= XP_014085225.1 PREDICTED: F-actin-capping protein subunit alpha
[Bactrocera oleae]

Length=286
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CAPZA_DROME  unnamed protein product                                  527     0.0   
CAPZA_CAEEL  unnamed protein product                                  298     2e-101
CAPZA_DICDI  unnamed protein product                                  226     3e-73 


>CAPZA_DROME unnamed protein product
Length=286

 Score = 527 bits (1357),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/286 (86%), Positives = 267/286 (93%), Gaps = 0/286 (0%)

Query  1    MEQTQITDAEKVRIVSDFIMHAPPGEFNEVFTDVRQLLNNDTLLKEGASHAFALYNKEQL  60
            MEQT ITDAEKVRIVSDFI+HAPPGEFNEVF DVR+LL NDTLLK+GASHAFA YNK+QL
Sbjct  1    MEQTPITDAEKVRIVSDFILHAPPGEFNEVFNDVRELLKNDTLLKDGASHAFAQYNKDQL  60

Query  61   TPVHIEGSEYNALISEHNDIGNGRFYDPRTKQSFKFDHLRKEASDYQDMEPDVTAEPWRA  120
            TPV IEG+++NA+ISEHND+GNGRFYDPRTKQ+FK+DHLRKEASDYQD+E D TAEPWRA
Sbjct  61   TPVRIEGTDHNAIISEHNDLGNGRFYDPRTKQAFKYDHLRKEASDYQDVEADATAEPWRA  120

Query  121  ALDLETINYTNSHYRNGVSSVFGKTQGGQITLTVCIEDHQFQPKNYWNGRWRSQWSFALQ  180
            ALDLET+ YT SHYR+GVSSVFGK QG QITLT+CIEDHQFQPKNYWNGRWRSQW    Q
Sbjct  121  ALDLETLAYTASHYRHGVSSVFGKAQGNQITLTICIEDHQFQPKNYWNGRWRSQWHVTFQ  180

Query  181  PGSGSAELKGMLKLQVHYYEDGNVQLVSTKEFRESVVVSNEQQVAKEVIRLIEEAENEYQ  240
             GSG+AELKG+LK+QVHYYEDGNVQLVS+KE RESVVVSNEQQVAKEVIRLIE+AENEYQ
Sbjct  181  AGSGTAELKGVLKVQVHYYEDGNVQLVSSKECRESVVVSNEQQVAKEVIRLIEDAENEYQ  240

Query  241  LAISENYQTMSDTTFKAMRRLLPITRTKIDWGKIVTYSIGKELKTQ  286
            LAISENYQTMSDTTFKAMRR LPITRTKIDW KIV+YSIGKELKTQ
Sbjct  241  LAISENYQTMSDTTFKAMRRQLPITRTKIDWSKIVSYSIGKELKTQ  286


>CAPZA_CAEEL unnamed protein product
Length=282

 Score = 298 bits (762),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 156/286 (55%), Positives = 192/286 (67%), Gaps = 10/286 (3%)

Query  4    TQITDAEKVRIVSDFIMHAPPGEFNEVFTDVRQLLNNDTLLKEGASHAFALYNKEQLTPV  63
            ++I+DAEKVRI SDFI HAPPGEFNEVF  VR LL ND LLK    +A A YN  Q  PV
Sbjct  2    SEISDAEKVRIASDFIKHAPPGEFNEVFNSVRMLLENDDLLKNKCVNAIAQYNVGQFVPV  61

Query  64   HIEGSEYNALISEHNDIGNGRFYDPRTKQSFKFDHLRKEASDYQ--DMEPDVTAEPWRAA  121
             ++G     LI+ +ND+GNGRFYD  +K+SFK+DH+RKEA+D Q    E  +T E WR A
Sbjct  62   KLDGVAKQTLITPYNDLGNGRFYDEVSKKSFKYDHVRKEAADLQPHPAESGIT-EQWRQA  120

Query  122  LDLETINYTNSHY-RNGVSSVFGKTQGGQITLTVCIEDHQFQPKNYWNGRWRSQWSFALQ  180
            L  +   Y + HY ++G   VF +        T+CIE HQFQPKN+ NGRWRS+W+  + 
Sbjct  121  LQTQLDIYIDDHYAKSGTGVVFARNG----VFTICIESHQFQPKNFCNGRWRSEWNVPVG  176

Query  181  PG-SGSAELKGMLKLQVHYYEDGNVQLVSTKEFRESVVVSNE-QQVAKEVIRLIEEAENE  238
             G SGS E+KG +  QVHYYEDGNVQL S KE    V VS +  + AKE+I  I E E  
Sbjct  177  DGKSGSQEMKGKILSQVHYYEDGNVQLFSEKEPVLKVNVSADFDKTAKEIIHAISEEETI  236

Query  239  YQLAISENYQTMSDTTFKAMRRLLPITRTKIDWGKIVTYSIGKELK  284
            YQ A+ ENY  MSDTTFKA+RR LP+TR K+DW K  TY IG+E+K
Sbjct  237  YQNAVQENYANMSDTTFKALRRQLPVTRAKMDWNKAQTYRIGQEMK  282


>CAPZA_DICDI unnamed protein product
Length=281

 Score = 226 bits (576),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 112/281 (40%), Positives = 171/281 (61%), Gaps = 8/281 (3%)

Query  7    TDAEKVRIVSDFIMHAPPGEFNEVFTDVRQLLNNDTLLKEGASHAFALYNKEQLTPVHIE  66
            ++ E V+I ++F+++APP EF EV +DVR LL +++LL   A   F  YN  Q+  V ++
Sbjct  3    SNQELVQIATNFLLNAPPCEFMEVVSDVRALLPSESLLNASAGSTFREYNTSQM--VSVQ  60

Query  67   GSEYNALISEHNDIGNGRFYDPRTKQSFKFDHLRKEA----SDYQDMEPDVTAEPWRAAL  122
             S+ +ALI++  +I N  + DP+ KQ   +DH+++E     S   ++E D+  E +RAA 
Sbjct  61   TSKGSALITKEGEISNNEYLDPKNKQVITYDHIKQEVTGERSASGEIEQDI--EQYRAAF  118

Query  123  DLETINYTNSHYRNGVSSVFGKTQGGQITLTVCIEDHQFQPKNYWNGRWRSQWSFALQPG  182
            D E   Y N +Y NGVS+V+G      I +TVCI    ++P  +++GRWRS W+   +PG
Sbjct  119  DEEATKYCNEYYPNGVSAVYGTKVSEGIKITVCISTCIYKPNAFYSGRWRSVWTCTFKPG  178

Query  183  SGSAELKGMLKLQVHYYEDGNVQLVSTKEFRESVVVSNEQQVAKEVIRLIEEAENEYQLA  242
            SG+    G +++ VHY+EDGNVQL +  + + +   ++ Q  A    + I +AE     A
Sbjct  179  SGNVTSNGKVQVNVHYFEDGNVQLNTVTQKQTTSPSADAQSTAVNAFKAIGKAELNLHTA  238

Query  243  ISENYQTMSDTTFKAMRRLLPITRTKIDWGKIVTYSIGKEL  283
            +  NY TM DTTFKA+RR LPI RTKI+W K+  + I  EL
Sbjct  239  LDNNYSTMGDTTFKALRRALPINRTKINWQKVKNFKIANEL  279



Lambda      K        H
   0.312    0.126    0.350 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 36770632136


Query= XP_014085226.1 PREDICTED: heterogeneous nuclear ribonucleoprotein L
isoform X1 [Bactrocera oleae]

Length=532
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A0A0B4K8A1_DROME  unnamed protein product                             895     0.0  
A0A0B4K7I2_DROME  unnamed protein product                             887     0.0  
A0A0B4K7W3_DROME  unnamed protein product                             882     0.0  


>A0A0B4K8A1_DROME unnamed protein product
Length=515

 Score = 895 bits (2313),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/519 (85%), Positives = 461/519 (89%), Gaps = 34/519 (7%)

Query  21   ISDGPQNKKIRTGVQQPGEADAHLHARAVVQQSQQQALLNKSNDDLRRKRPETTRPNHIL  80
            +++GPQNKKIRTGVQQPGE D H+HAR     +QQQAL+NKSNDDLRRKRPETTRPNHIL
Sbjct  24   VTEGPQNKKIRTGVQQPGENDVHMHAR-----NQQQALMNKSNDDLRRKRPETTRPNHIL  78

Query  81   LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFDSLEAATRARENLNGAD  140
            LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFD+L+AATRARENLNGAD
Sbjct  79   LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFDNLDAATRARENLNGAD  138

Query  141  IYSGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLTA-----VKEIGNGRSPLLQEPLYGTR  195
            IY+GCCTLKIDYAKPEKLNVYKNEPDTSWDYTL+      +KEIGNGRSPLLQEPLYGTR
Sbjct  139  IYAGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLSTGEILPIKEIGNGRSPLLQEPLYGTR  198

Query  196  PQPYSKFQQNSFITTTTNSTIGLISTPTNFCQFK-EPPLLGPGAAFPPFGAAEFHPTTPE  254
            PQPYSK                L S P N    + +PPLLGPGAAFPPFGA E+H TTPE
Sbjct  199  PQPYSK---------------SLFSIPENVVMLESQPPLLGPGAAFPPFGAPEYHTTTPE  243

Query  255  NWKGATIHPTGLMKEPA-VVPGRNAPVTFATQAQGQDIIPSLQGAVMMVYGLDHDTSNTD  313
            NWKGA IHPTGLMKEPA VVPGRNAPV F  Q Q Q       GAVMMVYGLDHDTSNTD
Sbjct  244  NWKGAAIHPTGLMKEPAGVVPGRNAPVAFTPQGQAQ-------GAVMMVYGLDHDTSNTD  296

Query  314  KLFNLVCLYGNVARIKFLKTKEGTAMVQMGDSVAVERCVQHLNNIPVGNGGKIQIAFSKQ  373
            KLFNLVCLYGNVARIKFLKTKEGTAMVQMGD+VAVERCVQHLNNIPVG GGKIQIAFSKQ
Sbjct  297  KLFNLVCLYGNVARIKFLKTKEGTAMVQMGDAVAVERCVQHLNNIPVGTGGKIQIAFSKQ  356

Query  374  NFLSEVINPFLLPDHTPSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTED  433
            NFLSEVINPFLLPDH+PSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTED
Sbjct  357  NFLSEVINPFLLPDHSPSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTED  416

Query  434  QLIGIFNIKEVPATSVRLFPLKTERSSSGLIEFPNISQAVLAIMKCNHLPIEGKGTKFPF  493
            QLIGIFNIK+VPATSVRLFPLKTERSSSGLIEF NISQAVLAIMKCNHLPIEGKGTKFPF
Sbjct  417  QLIGIFNIKDVPATSVRLFPLKTERSSSGLIEFSNISQAVLAIMKCNHLPIEGKGTKFPF  476

Query  494  IMKLCFSSSKSMNGAWNNATNEGMIEKENEVEVKQDVYN  532
            IMKLCFSSSKSMNGAWNNA +EGMIEKENEV+ K D+YN
Sbjct  477  IMKLCFSSSKSMNGAWNNAASEGMIEKENEVDTKVDIYN  515


>A0A0B4K7I2_DROME unnamed protein product
Length=552

 Score = 887 bits (2292),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/536 (82%), Positives = 457/536 (85%), Gaps = 31/536 (6%)

Query  21   ISDGPQNKKIRTGVQQPGEADAHLHARAVVQQSQQQALLNKSNDDLRRKRPETTRPNHIL  80
            +++GPQNKKIRTGVQQPGE D H+HAR+  QQ+QQQAL+NKSNDDLRRKRPETTRPNHIL
Sbjct  24   VTEGPQNKKIRTGVQQPGENDVHMHARSTPQQNQQQALMNKSNDDLRRKRPETTRPNHIL  83

Query  81   LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFDSLEAATRARENLNGAD  140
            LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFD+L+AATRARENLNGAD
Sbjct  84   LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFDNLDAATRARENLNGAD  143

Query  141  IYSGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLTAVKEIGNGRSPLLQEPLY-GTRPQPY  199
            IY+GCCTLKIDYAKPEKLNVYKNEPDTSWDYTL+ VKEIGNGRSPLLQEPLY  T   P 
Sbjct  144  IYAGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLSTVKEIGNGRSPLLQEPLYVATLSTPQ  203

Query  200  SKFQQNSFITTTTNSTIGLI----------------------STPTNFCQFKEPPLLGPG  237
                                                      +   N  QFKEPPLLGPG
Sbjct  204  QHVSHQHHHHLRQQQQQQHQQQAPQQQPHPQHLHHQQQLVAPAQSHNLYQFKEPPLLGPG  263

Query  238  AAFPPFGAAEFHPTTPENWKGATIHPTGLMKEPA-VVPGRNAPVTFATQAQGQDIIPSLQ  296
            AAFPPFGA E+H TTPENWKGA IHPTGLMKEPA VVPGRNAPV F  Q Q Q       
Sbjct  264  AAFPPFGAPEYHTTTPENWKGAAIHPTGLMKEPAGVVPGRNAPVAFTPQGQAQ-------  316

Query  297  GAVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMGDSVAVERCVQHLN  356
            GAVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMGD+VAVERCVQHLN
Sbjct  317  GAVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMGDAVAVERCVQHLN  376

Query  357  NIPVGNGGKIQIAFSKQNFLSEVINPFLLPDHTPSFKEYTGSKNNRFLSPAQASKNRIQP  416
            NIPVG GGKIQIAFSKQNFLSEVINPFLLPDH+PSFKEYTGSKNNRFLSPAQASKNRIQP
Sbjct  377  NIPVGTGGKIQIAFSKQNFLSEVINPFLLPDHSPSFKEYTGSKNNRFLSPAQASKNRIQP  436

Query  417  PSKILHFFNTPPGLTEDQLIGIFNIKEVPATSVRLFPLKTERSSSGLIEFPNISQAVLAI  476
            PSKILHFFNTPPGLTEDQLIGIFNIK+VPATSVRLFPLKTERSSSGLIEF NISQAVLAI
Sbjct  437  PSKILHFFNTPPGLTEDQLIGIFNIKDVPATSVRLFPLKTERSSSGLIEFSNISQAVLAI  496

Query  477  MKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGAWNNATNEGMIEKENEVEVKQDVYN  532
            MKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGAWNNA +EGMIEKENEV+ K D+YN
Sbjct  497  MKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGAWNNAASEGMIEKENEVDTKVDIYN  552


>A0A0B4K7W3_DROME unnamed protein product
Length=492

 Score = 882 bits (2278),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/513 (84%), Positives = 450/513 (88%), Gaps = 45/513 (9%)

Query  21   ISDGPQNKKIRTGVQQPGEADAHLHARAVVQQSQQQALLNKSNDDLRRKRPETTRPNHIL  80
            +++GPQNKKIRTGVQQPGE D H+HAR+  QQ+QQQAL+NKSNDDLRRKRPETTRPNHIL
Sbjct  24   VTEGPQNKKIRTGVQQPGENDVHMHARSTPQQNQQQALMNKSNDDLRRKRPETTRPNHIL  83

Query  81   LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFDSLEAATRARENLNGAD  140
            LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFD+L+AATRARENLNGAD
Sbjct  84   LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFDNLDAATRARENLNGAD  143

Query  141  IYSGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLTAVKEIGNGRSPLLQEPLYGTRPQPYS  200
            IY+GCCTLKIDYAKPEKLNVYKNEPDTSWDYTL+ VKEIGNGRSPLLQEPLY        
Sbjct  144  IYAGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLSTVKEIGNGRSPLLQEPLY--------  195

Query  201  KFQQNSFITTTTNSTIGLISTPTNFCQFKEPPLLGPGAAFPPFGAAEFHPTTPENWKGAT  260
                                         EPPLLGPGAAFPPFGA E+H TTPENWKGA 
Sbjct  196  -----------------------------EPPLLGPGAAFPPFGAPEYHTTTPENWKGAA  226

Query  261  IHPTGLMKEPA-VVPGRNAPVTFATQAQGQDIIPSLQGAVMMVYGLDHDTSNTDKLFNLV  319
            IHPTGLMKEPA VVPGRNAPV F  Q Q Q       GAVMMVYGLDHDTSNTDKLFNLV
Sbjct  227  IHPTGLMKEPAGVVPGRNAPVAFTPQGQAQ-------GAVMMVYGLDHDTSNTDKLFNLV  279

Query  320  CLYGNVARIKFLKTKEGTAMVQMGDSVAVERCVQHLNNIPVGNGGKIQIAFSKQNFLSEV  379
            CLYGNVARIKFLKTKEGTAMVQMGD+VAVERCVQHLNNIPVG GGKIQIAFSKQNFLSEV
Sbjct  280  CLYGNVARIKFLKTKEGTAMVQMGDAVAVERCVQHLNNIPVGTGGKIQIAFSKQNFLSEV  339

Query  380  INPFLLPDHTPSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIF  439
            INPFLLPDH+PSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIF
Sbjct  340  INPFLLPDHSPSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIF  399

Query  440  NIKEVPATSVRLFPLKTERSSSGLIEFPNISQAVLAIMKCNHLPIEGKGTKFPFIMKLCF  499
            NIK+VPATSVRLFPLKTERSSSGLIEF NISQAVLAIMKCNHLPIEGKGTKFPFIMKLCF
Sbjct  400  NIKDVPATSVRLFPLKTERSSSGLIEFSNISQAVLAIMKCNHLPIEGKGTKFPFIMKLCF  459

Query  500  SSSKSMNGAWNNATNEGMIEKENEVEVKQDVYN  532
            SSSKSMNGAWNNA +EGMIEKENEV+ K D+YN
Sbjct  460  SSSKSMNGAWNNAASEGMIEKENEVDTKVDIYN  492



Lambda      K        H
   0.312    0.126    0.350 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 36770632136


Query= XP_014085227.1 PREDICTED: heterogeneous nuclear ribonucleoprotein L
isoform X1 [Bactrocera oleae]

Length=532
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A0A0B4K8A1_DROME  unnamed protein product                             895     0.0  
A0A0B4K7I2_DROME  unnamed protein product                             887     0.0  
A0A0B4K7W3_DROME  unnamed protein product                             882     0.0  


>A0A0B4K8A1_DROME unnamed protein product
Length=515

 Score = 895 bits (2313),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/519 (85%), Positives = 461/519 (89%), Gaps = 34/519 (7%)

Query  21   ISDGPQNKKIRTGVQQPGEADAHLHARAVVQQSQQQALLNKSNDDLRRKRPETTRPNHIL  80
            +++GPQNKKIRTGVQQPGE D H+HAR     +QQQAL+NKSNDDLRRKRPETTRPNHIL
Sbjct  24   VTEGPQNKKIRTGVQQPGENDVHMHAR-----NQQQALMNKSNDDLRRKRPETTRPNHIL  78

Query  81   LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFDSLEAATRARENLNGAD  140
            LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFD+L+AATRARENLNGAD
Sbjct  79   LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFDNLDAATRARENLNGAD  138

Query  141  IYSGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLTA-----VKEIGNGRSPLLQEPLYGTR  195
            IY+GCCTLKIDYAKPEKLNVYKNEPDTSWDYTL+      +KEIGNGRSPLLQEPLYGTR
Sbjct  139  IYAGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLSTGEILPIKEIGNGRSPLLQEPLYGTR  198

Query  196  PQPYSKFQQNSFITTTTNSTIGLISTPTNFCQFK-EPPLLGPGAAFPPFGAAEFHPTTPE  254
            PQPYSK                L S P N    + +PPLLGPGAAFPPFGA E+H TTPE
Sbjct  199  PQPYSK---------------SLFSIPENVVMLESQPPLLGPGAAFPPFGAPEYHTTTPE  243

Query  255  NWKGATIHPTGLMKEPA-VVPGRNAPVTFATQAQGQDIIPSLQGAVMMVYGLDHDTSNTD  313
            NWKGA IHPTGLMKEPA VVPGRNAPV F  Q Q Q       GAVMMVYGLDHDTSNTD
Sbjct  244  NWKGAAIHPTGLMKEPAGVVPGRNAPVAFTPQGQAQ-------GAVMMVYGLDHDTSNTD  296

Query  314  KLFNLVCLYGNVARIKFLKTKEGTAMVQMGDSVAVERCVQHLNNIPVGNGGKIQIAFSKQ  373
            KLFNLVCLYGNVARIKFLKTKEGTAMVQMGD+VAVERCVQHLNNIPVG GGKIQIAFSKQ
Sbjct  297  KLFNLVCLYGNVARIKFLKTKEGTAMVQMGDAVAVERCVQHLNNIPVGTGGKIQIAFSKQ  356

Query  374  NFLSEVINPFLLPDHTPSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTED  433
            NFLSEVINPFLLPDH+PSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTED
Sbjct  357  NFLSEVINPFLLPDHSPSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTED  416

Query  434  QLIGIFNIKEVPATSVRLFPLKTERSSSGLIEFPNISQAVLAIMKCNHLPIEGKGTKFPF  493
            QLIGIFNIK+VPATSVRLFPLKTERSSSGLIEF NISQAVLAIMKCNHLPIEGKGTKFPF
Sbjct  417  QLIGIFNIKDVPATSVRLFPLKTERSSSGLIEFSNISQAVLAIMKCNHLPIEGKGTKFPF  476

Query  494  IMKLCFSSSKSMNGAWNNATNEGMIEKENEVEVKQDVYN  532
            IMKLCFSSSKSMNGAWNNA +EGMIEKENEV+ K D+YN
Sbjct  477  IMKLCFSSSKSMNGAWNNAASEGMIEKENEVDTKVDIYN  515


>A0A0B4K7I2_DROME unnamed protein product
Length=552

 Score = 887 bits (2292),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/536 (82%), Positives = 457/536 (85%), Gaps = 31/536 (6%)

Query  21   ISDGPQNKKIRTGVQQPGEADAHLHARAVVQQSQQQALLNKSNDDLRRKRPETTRPNHIL  80
            +++GPQNKKIRTGVQQPGE D H+HAR+  QQ+QQQAL+NKSNDDLRRKRPETTRPNHIL
Sbjct  24   VTEGPQNKKIRTGVQQPGENDVHMHARSTPQQNQQQALMNKSNDDLRRKRPETTRPNHIL  83

Query  81   LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFDSLEAATRARENLNGAD  140
            LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFD+L+AATRARENLNGAD
Sbjct  84   LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFDNLDAATRARENLNGAD  143

Query  141  IYSGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLTAVKEIGNGRSPLLQEPLY-GTRPQPY  199
            IY+GCCTLKIDYAKPEKLNVYKNEPDTSWDYTL+ VKEIGNGRSPLLQEPLY  T   P 
Sbjct  144  IYAGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLSTVKEIGNGRSPLLQEPLYVATLSTPQ  203

Query  200  SKFQQNSFITTTTNSTIGLI----------------------STPTNFCQFKEPPLLGPG  237
                                                      +   N  QFKEPPLLGPG
Sbjct  204  QHVSHQHHHHLRQQQQQQHQQQAPQQQPHPQHLHHQQQLVAPAQSHNLYQFKEPPLLGPG  263

Query  238  AAFPPFGAAEFHPTTPENWKGATIHPTGLMKEPA-VVPGRNAPVTFATQAQGQDIIPSLQ  296
            AAFPPFGA E+H TTPENWKGA IHPTGLMKEPA VVPGRNAPV F  Q Q Q       
Sbjct  264  AAFPPFGAPEYHTTTPENWKGAAIHPTGLMKEPAGVVPGRNAPVAFTPQGQAQ-------  316

Query  297  GAVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMGDSVAVERCVQHLN  356
            GAVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMGD+VAVERCVQHLN
Sbjct  317  GAVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMGDAVAVERCVQHLN  376

Query  357  NIPVGNGGKIQIAFSKQNFLSEVINPFLLPDHTPSFKEYTGSKNNRFLSPAQASKNRIQP  416
            NIPVG GGKIQIAFSKQNFLSEVINPFLLPDH+PSFKEYTGSKNNRFLSPAQASKNRIQP
Sbjct  377  NIPVGTGGKIQIAFSKQNFLSEVINPFLLPDHSPSFKEYTGSKNNRFLSPAQASKNRIQP  436

Query  417  PSKILHFFNTPPGLTEDQLIGIFNIKEVPATSVRLFPLKTERSSSGLIEFPNISQAVLAI  476
            PSKILHFFNTPPGLTEDQLIGIFNIK+VPATSVRLFPLKTERSSSGLIEF NISQAVLAI
Sbjct  437  PSKILHFFNTPPGLTEDQLIGIFNIKDVPATSVRLFPLKTERSSSGLIEFSNISQAVLAI  496

Query  477  MKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGAWNNATNEGMIEKENEVEVKQDVYN  532
            MKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGAWNNA +EGMIEKENEV+ K D+YN
Sbjct  497  MKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGAWNNAASEGMIEKENEVDTKVDIYN  552


>A0A0B4K7W3_DROME unnamed protein product
Length=492

 Score = 882 bits (2278),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/513 (84%), Positives = 450/513 (88%), Gaps = 45/513 (9%)

Query  21   ISDGPQNKKIRTGVQQPGEADAHLHARAVVQQSQQQALLNKSNDDLRRKRPETTRPNHIL  80
            +++GPQNKKIRTGVQQPGE D H+HAR+  QQ+QQQAL+NKSNDDLRRKRPETTRPNHIL
Sbjct  24   VTEGPQNKKIRTGVQQPGENDVHMHARSTPQQNQQQALMNKSNDDLRRKRPETTRPNHIL  83

Query  81   LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFDSLEAATRARENLNGAD  140
            LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFD+L+AATRARENLNGAD
Sbjct  84   LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFDNLDAATRARENLNGAD  143

Query  141  IYSGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLTAVKEIGNGRSPLLQEPLYGTRPQPYS  200
            IY+GCCTLKIDYAKPEKLNVYKNEPDTSWDYTL+ VKEIGNGRSPLLQEPLY        
Sbjct  144  IYAGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLSTVKEIGNGRSPLLQEPLY--------  195

Query  201  KFQQNSFITTTTNSTIGLISTPTNFCQFKEPPLLGPGAAFPPFGAAEFHPTTPENWKGAT  260
                                         EPPLLGPGAAFPPFGA E+H TTPENWKGA 
Sbjct  196  -----------------------------EPPLLGPGAAFPPFGAPEYHTTTPENWKGAA  226

Query  261  IHPTGLMKEPA-VVPGRNAPVTFATQAQGQDIIPSLQGAVMMVYGLDHDTSNTDKLFNLV  319
            IHPTGLMKEPA VVPGRNAPV F  Q Q Q       GAVMMVYGLDHDTSNTDKLFNLV
Sbjct  227  IHPTGLMKEPAGVVPGRNAPVAFTPQGQAQ-------GAVMMVYGLDHDTSNTDKLFNLV  279

Query  320  CLYGNVARIKFLKTKEGTAMVQMGDSVAVERCVQHLNNIPVGNGGKIQIAFSKQNFLSEV  379
            CLYGNVARIKFLKTKEGTAMVQMGD+VAVERCVQHLNNIPVG GGKIQIAFSKQNFLSEV
Sbjct  280  CLYGNVARIKFLKTKEGTAMVQMGDAVAVERCVQHLNNIPVGTGGKIQIAFSKQNFLSEV  339

Query  380  INPFLLPDHTPSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIF  439
            INPFLLPDH+PSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIF
Sbjct  340  INPFLLPDHSPSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIF  399

Query  440  NIKEVPATSVRLFPLKTERSSSGLIEFPNISQAVLAIMKCNHLPIEGKGTKFPFIMKLCF  499
            NIK+VPATSVRLFPLKTERSSSGLIEF NISQAVLAIMKCNHLPIEGKGTKFPFIMKLCF
Sbjct  400  NIKDVPATSVRLFPLKTERSSSGLIEFSNISQAVLAIMKCNHLPIEGKGTKFPFIMKLCF  459

Query  500  SSSKSMNGAWNNATNEGMIEKENEVEVKQDVYN  532
            SSSKSMNGAWNNA +EGMIEKENEV+ K D+YN
Sbjct  460  SSSKSMNGAWNNAASEGMIEKENEVDTKVDIYN  492



Lambda      K        H
   0.312    0.126    0.350 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 36770632136


Query= XP_014085228.1 PREDICTED: heterogeneous nuclear ribonucleoprotein L
isoform X1 [Bactrocera oleae]

Length=532
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A0A0B4K8A1_DROME  unnamed protein product                             895     0.0  
A0A0B4K7I2_DROME  unnamed protein product                             887     0.0  
A0A0B4K7W3_DROME  unnamed protein product                             882     0.0  


>A0A0B4K8A1_DROME unnamed protein product
Length=515

 Score = 895 bits (2313),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/519 (85%), Positives = 461/519 (89%), Gaps = 34/519 (7%)

Query  21   ISDGPQNKKIRTGVQQPGEADAHLHARAVVQQSQQQALLNKSNDDLRRKRPETTRPNHIL  80
            +++GPQNKKIRTGVQQPGE D H+HAR     +QQQAL+NKSNDDLRRKRPETTRPNHIL
Sbjct  24   VTEGPQNKKIRTGVQQPGENDVHMHAR-----NQQQALMNKSNDDLRRKRPETTRPNHIL  78

Query  81   LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFDSLEAATRARENLNGAD  140
            LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFD+L+AATRARENLNGAD
Sbjct  79   LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFDNLDAATRARENLNGAD  138

Query  141  IYSGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLTA-----VKEIGNGRSPLLQEPLYGTR  195
            IY+GCCTLKIDYAKPEKLNVYKNEPDTSWDYTL+      +KEIGNGRSPLLQEPLYGTR
Sbjct  139  IYAGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLSTGEILPIKEIGNGRSPLLQEPLYGTR  198

Query  196  PQPYSKFQQNSFITTTTNSTIGLISTPTNFCQFK-EPPLLGPGAAFPPFGAAEFHPTTPE  254
            PQPYSK                L S P N    + +PPLLGPGAAFPPFGA E+H TTPE
Sbjct  199  PQPYSK---------------SLFSIPENVVMLESQPPLLGPGAAFPPFGAPEYHTTTPE  243

Query  255  NWKGATIHPTGLMKEPA-VVPGRNAPVTFATQAQGQDIIPSLQGAVMMVYGLDHDTSNTD  313
            NWKGA IHPTGLMKEPA VVPGRNAPV F  Q Q Q       GAVMMVYGLDHDTSNTD
Sbjct  244  NWKGAAIHPTGLMKEPAGVVPGRNAPVAFTPQGQAQ-------GAVMMVYGLDHDTSNTD  296

Query  314  KLFNLVCLYGNVARIKFLKTKEGTAMVQMGDSVAVERCVQHLNNIPVGNGGKIQIAFSKQ  373
            KLFNLVCLYGNVARIKFLKTKEGTAMVQMGD+VAVERCVQHLNNIPVG GGKIQIAFSKQ
Sbjct  297  KLFNLVCLYGNVARIKFLKTKEGTAMVQMGDAVAVERCVQHLNNIPVGTGGKIQIAFSKQ  356

Query  374  NFLSEVINPFLLPDHTPSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTED  433
            NFLSEVINPFLLPDH+PSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTED
Sbjct  357  NFLSEVINPFLLPDHSPSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTED  416

Query  434  QLIGIFNIKEVPATSVRLFPLKTERSSSGLIEFPNISQAVLAIMKCNHLPIEGKGTKFPF  493
            QLIGIFNIK+VPATSVRLFPLKTERSSSGLIEF NISQAVLAIMKCNHLPIEGKGTKFPF
Sbjct  417  QLIGIFNIKDVPATSVRLFPLKTERSSSGLIEFSNISQAVLAIMKCNHLPIEGKGTKFPF  476

Query  494  IMKLCFSSSKSMNGAWNNATNEGMIEKENEVEVKQDVYN  532
            IMKLCFSSSKSMNGAWNNA +EGMIEKENEV+ K D+YN
Sbjct  477  IMKLCFSSSKSMNGAWNNAASEGMIEKENEVDTKVDIYN  515


>A0A0B4K7I2_DROME unnamed protein product
Length=552

 Score = 887 bits (2292),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/536 (82%), Positives = 457/536 (85%), Gaps = 31/536 (6%)

Query  21   ISDGPQNKKIRTGVQQPGEADAHLHARAVVQQSQQQALLNKSNDDLRRKRPETTRPNHIL  80
            +++GPQNKKIRTGVQQPGE D H+HAR+  QQ+QQQAL+NKSNDDLRRKRPETTRPNHIL
Sbjct  24   VTEGPQNKKIRTGVQQPGENDVHMHARSTPQQNQQQALMNKSNDDLRRKRPETTRPNHIL  83

Query  81   LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFDSLEAATRARENLNGAD  140
            LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFD+L+AATRARENLNGAD
Sbjct  84   LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFDNLDAATRARENLNGAD  143

Query  141  IYSGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLTAVKEIGNGRSPLLQEPLY-GTRPQPY  199
            IY+GCCTLKIDYAKPEKLNVYKNEPDTSWDYTL+ VKEIGNGRSPLLQEPLY  T   P 
Sbjct  144  IYAGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLSTVKEIGNGRSPLLQEPLYVATLSTPQ  203

Query  200  SKFQQNSFITTTTNSTIGLI----------------------STPTNFCQFKEPPLLGPG  237
                                                      +   N  QFKEPPLLGPG
Sbjct  204  QHVSHQHHHHLRQQQQQQHQQQAPQQQPHPQHLHHQQQLVAPAQSHNLYQFKEPPLLGPG  263

Query  238  AAFPPFGAAEFHPTTPENWKGATIHPTGLMKEPA-VVPGRNAPVTFATQAQGQDIIPSLQ  296
            AAFPPFGA E+H TTPENWKGA IHPTGLMKEPA VVPGRNAPV F  Q Q Q       
Sbjct  264  AAFPPFGAPEYHTTTPENWKGAAIHPTGLMKEPAGVVPGRNAPVAFTPQGQAQ-------  316

Query  297  GAVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMGDSVAVERCVQHLN  356
            GAVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMGD+VAVERCVQHLN
Sbjct  317  GAVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMGDAVAVERCVQHLN  376

Query  357  NIPVGNGGKIQIAFSKQNFLSEVINPFLLPDHTPSFKEYTGSKNNRFLSPAQASKNRIQP  416
            NIPVG GGKIQIAFSKQNFLSEVINPFLLPDH+PSFKEYTGSKNNRFLSPAQASKNRIQP
Sbjct  377  NIPVGTGGKIQIAFSKQNFLSEVINPFLLPDHSPSFKEYTGSKNNRFLSPAQASKNRIQP  436

Query  417  PSKILHFFNTPPGLTEDQLIGIFNIKEVPATSVRLFPLKTERSSSGLIEFPNISQAVLAI  476
            PSKILHFFNTPPGLTEDQLIGIFNIK+VPATSVRLFPLKTERSSSGLIEF NISQAVLAI
Sbjct  437  PSKILHFFNTPPGLTEDQLIGIFNIKDVPATSVRLFPLKTERSSSGLIEFSNISQAVLAI  496

Query  477  MKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGAWNNATNEGMIEKENEVEVKQDVYN  532
            MKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGAWNNA +EGMIEKENEV+ K D+YN
Sbjct  497  MKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGAWNNAASEGMIEKENEVDTKVDIYN  552


>A0A0B4K7W3_DROME unnamed protein product
Length=492

 Score = 882 bits (2278),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/513 (84%), Positives = 450/513 (88%), Gaps = 45/513 (9%)

Query  21   ISDGPQNKKIRTGVQQPGEADAHLHARAVVQQSQQQALLNKSNDDLRRKRPETTRPNHIL  80
            +++GPQNKKIRTGVQQPGE D H+HAR+  QQ+QQQAL+NKSNDDLRRKRPETTRPNHIL
Sbjct  24   VTEGPQNKKIRTGVQQPGENDVHMHARSTPQQNQQQALMNKSNDDLRRKRPETTRPNHIL  83

Query  81   LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFDSLEAATRARENLNGAD  140
            LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFD+L+AATRARENLNGAD
Sbjct  84   LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFDNLDAATRARENLNGAD  143

Query  141  IYSGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLTAVKEIGNGRSPLLQEPLYGTRPQPYS  200
            IY+GCCTLKIDYAKPEKLNVYKNEPDTSWDYTL+ VKEIGNGRSPLLQEPLY        
Sbjct  144  IYAGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLSTVKEIGNGRSPLLQEPLY--------  195

Query  201  KFQQNSFITTTTNSTIGLISTPTNFCQFKEPPLLGPGAAFPPFGAAEFHPTTPENWKGAT  260
                                         EPPLLGPGAAFPPFGA E+H TTPENWKGA 
Sbjct  196  -----------------------------EPPLLGPGAAFPPFGAPEYHTTTPENWKGAA  226

Query  261  IHPTGLMKEPA-VVPGRNAPVTFATQAQGQDIIPSLQGAVMMVYGLDHDTSNTDKLFNLV  319
            IHPTGLMKEPA VVPGRNAPV F  Q Q Q       GAVMMVYGLDHDTSNTDKLFNLV
Sbjct  227  IHPTGLMKEPAGVVPGRNAPVAFTPQGQAQ-------GAVMMVYGLDHDTSNTDKLFNLV  279

Query  320  CLYGNVARIKFLKTKEGTAMVQMGDSVAVERCVQHLNNIPVGNGGKIQIAFSKQNFLSEV  379
            CLYGNVARIKFLKTKEGTAMVQMGD+VAVERCVQHLNNIPVG GGKIQIAFSKQNFLSEV
Sbjct  280  CLYGNVARIKFLKTKEGTAMVQMGDAVAVERCVQHLNNIPVGTGGKIQIAFSKQNFLSEV  339

Query  380  INPFLLPDHTPSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIF  439
            INPFLLPDH+PSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIF
Sbjct  340  INPFLLPDHSPSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIF  399

Query  440  NIKEVPATSVRLFPLKTERSSSGLIEFPNISQAVLAIMKCNHLPIEGKGTKFPFIMKLCF  499
            NIK+VPATSVRLFPLKTERSSSGLIEF NISQAVLAIMKCNHLPIEGKGTKFPFIMKLCF
Sbjct  400  NIKDVPATSVRLFPLKTERSSSGLIEFSNISQAVLAIMKCNHLPIEGKGTKFPFIMKLCF  459

Query  500  SSSKSMNGAWNNATNEGMIEKENEVEVKQDVYN  532
            SSSKSMNGAWNNA +EGMIEKENEV+ K D+YN
Sbjct  460  SSSKSMNGAWNNAASEGMIEKENEVDTKVDIYN  492



Lambda      K        H
   0.312    0.126    0.350 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 36770632136


Query= XP_014085229.1 PREDICTED: heterogeneous nuclear ribonucleoprotein L
isoform X1 [Bactrocera oleae]

Length=532
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A0A0B4K8A1_DROME  unnamed protein product                             895     0.0  
A0A0B4K7I2_DROME  unnamed protein product                             887     0.0  
A0A0B4K7W3_DROME  unnamed protein product                             882     0.0  


>A0A0B4K8A1_DROME unnamed protein product
Length=515

 Score = 895 bits (2313),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/519 (85%), Positives = 461/519 (89%), Gaps = 34/519 (7%)

Query  21   ISDGPQNKKIRTGVQQPGEADAHLHARAVVQQSQQQALLNKSNDDLRRKRPETTRPNHIL  80
            +++GPQNKKIRTGVQQPGE D H+HAR     +QQQAL+NKSNDDLRRKRPETTRPNHIL
Sbjct  24   VTEGPQNKKIRTGVQQPGENDVHMHAR-----NQQQALMNKSNDDLRRKRPETTRPNHIL  78

Query  81   LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFDSLEAATRARENLNGAD  140
            LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFD+L+AATRARENLNGAD
Sbjct  79   LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFDNLDAATRARENLNGAD  138

Query  141  IYSGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLTA-----VKEIGNGRSPLLQEPLYGTR  195
            IY+GCCTLKIDYAKPEKLNVYKNEPDTSWDYTL+      +KEIGNGRSPLLQEPLYGTR
Sbjct  139  IYAGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLSTGEILPIKEIGNGRSPLLQEPLYGTR  198

Query  196  PQPYSKFQQNSFITTTTNSTIGLISTPTNFCQFK-EPPLLGPGAAFPPFGAAEFHPTTPE  254
            PQPYSK                L S P N    + +PPLLGPGAAFPPFGA E+H TTPE
Sbjct  199  PQPYSK---------------SLFSIPENVVMLESQPPLLGPGAAFPPFGAPEYHTTTPE  243

Query  255  NWKGATIHPTGLMKEPA-VVPGRNAPVTFATQAQGQDIIPSLQGAVMMVYGLDHDTSNTD  313
            NWKGA IHPTGLMKEPA VVPGRNAPV F  Q Q Q       GAVMMVYGLDHDTSNTD
Sbjct  244  NWKGAAIHPTGLMKEPAGVVPGRNAPVAFTPQGQAQ-------GAVMMVYGLDHDTSNTD  296

Query  314  KLFNLVCLYGNVARIKFLKTKEGTAMVQMGDSVAVERCVQHLNNIPVGNGGKIQIAFSKQ  373
            KLFNLVCLYGNVARIKFLKTKEGTAMVQMGD+VAVERCVQHLNNIPVG GGKIQIAFSKQ
Sbjct  297  KLFNLVCLYGNVARIKFLKTKEGTAMVQMGDAVAVERCVQHLNNIPVGTGGKIQIAFSKQ  356

Query  374  NFLSEVINPFLLPDHTPSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTED  433
            NFLSEVINPFLLPDH+PSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTED
Sbjct  357  NFLSEVINPFLLPDHSPSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTED  416

Query  434  QLIGIFNIKEVPATSVRLFPLKTERSSSGLIEFPNISQAVLAIMKCNHLPIEGKGTKFPF  493
            QLIGIFNIK+VPATSVRLFPLKTERSSSGLIEF NISQAVLAIMKCNHLPIEGKGTKFPF
Sbjct  417  QLIGIFNIKDVPATSVRLFPLKTERSSSGLIEFSNISQAVLAIMKCNHLPIEGKGTKFPF  476

Query  494  IMKLCFSSSKSMNGAWNNATNEGMIEKENEVEVKQDVYN  532
            IMKLCFSSSKSMNGAWNNA +EGMIEKENEV+ K D+YN
Sbjct  477  IMKLCFSSSKSMNGAWNNAASEGMIEKENEVDTKVDIYN  515


>A0A0B4K7I2_DROME unnamed protein product
Length=552

 Score = 887 bits (2292),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/536 (82%), Positives = 457/536 (85%), Gaps = 31/536 (6%)

Query  21   ISDGPQNKKIRTGVQQPGEADAHLHARAVVQQSQQQALLNKSNDDLRRKRPETTRPNHIL  80
            +++GPQNKKIRTGVQQPGE D H+HAR+  QQ+QQQAL+NKSNDDLRRKRPETTRPNHIL
Sbjct  24   VTEGPQNKKIRTGVQQPGENDVHMHARSTPQQNQQQALMNKSNDDLRRKRPETTRPNHIL  83

Query  81   LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFDSLEAATRARENLNGAD  140
            LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFD+L+AATRARENLNGAD
Sbjct  84   LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFDNLDAATRARENLNGAD  143

Query  141  IYSGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLTAVKEIGNGRSPLLQEPLY-GTRPQPY  199
            IY+GCCTLKIDYAKPEKLNVYKNEPDTSWDYTL+ VKEIGNGRSPLLQEPLY  T   P 
Sbjct  144  IYAGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLSTVKEIGNGRSPLLQEPLYVATLSTPQ  203

Query  200  SKFQQNSFITTTTNSTIGLI----------------------STPTNFCQFKEPPLLGPG  237
                                                      +   N  QFKEPPLLGPG
Sbjct  204  QHVSHQHHHHLRQQQQQQHQQQAPQQQPHPQHLHHQQQLVAPAQSHNLYQFKEPPLLGPG  263

Query  238  AAFPPFGAAEFHPTTPENWKGATIHPTGLMKEPA-VVPGRNAPVTFATQAQGQDIIPSLQ  296
            AAFPPFGA E+H TTPENWKGA IHPTGLMKEPA VVPGRNAPV F  Q Q Q       
Sbjct  264  AAFPPFGAPEYHTTTPENWKGAAIHPTGLMKEPAGVVPGRNAPVAFTPQGQAQ-------  316

Query  297  GAVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMGDSVAVERCVQHLN  356
            GAVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMGD+VAVERCVQHLN
Sbjct  317  GAVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMGDAVAVERCVQHLN  376

Query  357  NIPVGNGGKIQIAFSKQNFLSEVINPFLLPDHTPSFKEYTGSKNNRFLSPAQASKNRIQP  416
            NIPVG GGKIQIAFSKQNFLSEVINPFLLPDH+PSFKEYTGSKNNRFLSPAQASKNRIQP
Sbjct  377  NIPVGTGGKIQIAFSKQNFLSEVINPFLLPDHSPSFKEYTGSKNNRFLSPAQASKNRIQP  436

Query  417  PSKILHFFNTPPGLTEDQLIGIFNIKEVPATSVRLFPLKTERSSSGLIEFPNISQAVLAI  476
            PSKILHFFNTPPGLTEDQLIGIFNIK+VPATSVRLFPLKTERSSSGLIEF NISQAVLAI
Sbjct  437  PSKILHFFNTPPGLTEDQLIGIFNIKDVPATSVRLFPLKTERSSSGLIEFSNISQAVLAI  496

Query  477  MKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGAWNNATNEGMIEKENEVEVKQDVYN  532
            MKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGAWNNA +EGMIEKENEV+ K D+YN
Sbjct  497  MKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGAWNNAASEGMIEKENEVDTKVDIYN  552


>A0A0B4K7W3_DROME unnamed protein product
Length=492

 Score = 882 bits (2278),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/513 (84%), Positives = 450/513 (88%), Gaps = 45/513 (9%)

Query  21   ISDGPQNKKIRTGVQQPGEADAHLHARAVVQQSQQQALLNKSNDDLRRKRPETTRPNHIL  80
            +++GPQNKKIRTGVQQPGE D H+HAR+  QQ+QQQAL+NKSNDDLRRKRPETTRPNHIL
Sbjct  24   VTEGPQNKKIRTGVQQPGENDVHMHARSTPQQNQQQALMNKSNDDLRRKRPETTRPNHIL  83

Query  81   LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFDSLEAATRARENLNGAD  140
            LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFD+L+AATRARENLNGAD
Sbjct  84   LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFDNLDAATRARENLNGAD  143

Query  141  IYSGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLTAVKEIGNGRSPLLQEPLYGTRPQPYS  200
            IY+GCCTLKIDYAKPEKLNVYKNEPDTSWDYTL+ VKEIGNGRSPLLQEPLY        
Sbjct  144  IYAGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLSTVKEIGNGRSPLLQEPLY--------  195

Query  201  KFQQNSFITTTTNSTIGLISTPTNFCQFKEPPLLGPGAAFPPFGAAEFHPTTPENWKGAT  260
                                         EPPLLGPGAAFPPFGA E+H TTPENWKGA 
Sbjct  196  -----------------------------EPPLLGPGAAFPPFGAPEYHTTTPENWKGAA  226

Query  261  IHPTGLMKEPA-VVPGRNAPVTFATQAQGQDIIPSLQGAVMMVYGLDHDTSNTDKLFNLV  319
            IHPTGLMKEPA VVPGRNAPV F  Q Q Q       GAVMMVYGLDHDTSNTDKLFNLV
Sbjct  227  IHPTGLMKEPAGVVPGRNAPVAFTPQGQAQ-------GAVMMVYGLDHDTSNTDKLFNLV  279

Query  320  CLYGNVARIKFLKTKEGTAMVQMGDSVAVERCVQHLNNIPVGNGGKIQIAFSKQNFLSEV  379
            CLYGNVARIKFLKTKEGTAMVQMGD+VAVERCVQHLNNIPVG GGKIQIAFSKQNFLSEV
Sbjct  280  CLYGNVARIKFLKTKEGTAMVQMGDAVAVERCVQHLNNIPVGTGGKIQIAFSKQNFLSEV  339

Query  380  INPFLLPDHTPSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIF  439
            INPFLLPDH+PSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIF
Sbjct  340  INPFLLPDHSPSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIF  399

Query  440  NIKEVPATSVRLFPLKTERSSSGLIEFPNISQAVLAIMKCNHLPIEGKGTKFPFIMKLCF  499
            NIK+VPATSVRLFPLKTERSSSGLIEF NISQAVLAIMKCNHLPIEGKGTKFPFIMKLCF
Sbjct  400  NIKDVPATSVRLFPLKTERSSSGLIEFSNISQAVLAIMKCNHLPIEGKGTKFPFIMKLCF  459

Query  500  SSSKSMNGAWNNATNEGMIEKENEVEVKQDVYN  532
            SSSKSMNGAWNNA +EGMIEKENEV+ K D+YN
Sbjct  460  SSSKSMNGAWNNAASEGMIEKENEVDTKVDIYN  492



Lambda      K        H
   0.312    0.126    0.350 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 36770632136


Query= XP_014085230.1 PREDICTED: heterogeneous nuclear ribonucleoprotein L
isoform X2 [Bactrocera oleae]

Length=525
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A0A0B4K8A1_DROME  unnamed protein product                             902     0.0  
A0A0B4K7I2_DROME  unnamed protein product                             894     0.0  
A0A0B4K7W3_DROME  unnamed protein product                             889     0.0  


>A0A0B4K8A1_DROME unnamed protein product
Length=515

 Score = 902 bits (2331),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/512 (86%), Positives = 461/512 (90%), Gaps = 27/512 (5%)

Query  21   ISDGPQNKKIRTGVQQPGEADAHLHARAVVQQSQQQALLNKSNDDLRRKRPETTRPNHIL  80
            +++GPQNKKIRTGVQQPGE D H+HAR     +QQQAL+NKSNDDLRRKRPETTRPNHIL
Sbjct  24   VTEGPQNKKIRTGVQQPGENDVHMHAR-----NQQQALMNKSNDDLRRKRPETTRPNHIL  78

Query  81   LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFDSLEAATRARENLNGAD  140
            LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFD+L+AATRARENLNGAD
Sbjct  79   LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFDNLDAATRARENLNGAD  138

Query  141  IYSGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLTA-----VKEIGNGRSPLLQEPLYGTR  195
            IY+GCCTLKIDYAKPEKLNVYKNEPDTSWDYTL+      +KEIGNGRSPLLQEPLYGTR
Sbjct  139  IYAGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLSTGEILPIKEIGNGRSPLLQEPLYGTR  198

Query  196  PQPYSKFQQNSFITTTTNSTIGLISTPTNFCQFK-EPPLLGPGAAFPPFGAAEFHPTTPE  254
            PQPYSK                L S P N    + +PPLLGPGAAFPPFGA E+H TTPE
Sbjct  199  PQPYSK---------------SLFSIPENVVMLESQPPLLGPGAAFPPFGAPEYHTTTPE  243

Query  255  NWKGATIHPTGLMKEPA-VVPGRNAPVTFATQAQGQGAVMMVYGLDHDTSNTDKLFNLVC  313
            NWKGA IHPTGLMKEPA VVPGRNAPV F  Q Q QGAVMMVYGLDHDTSNTDKLFNLVC
Sbjct  244  NWKGAAIHPTGLMKEPAGVVPGRNAPVAFTPQGQAQGAVMMVYGLDHDTSNTDKLFNLVC  303

Query  314  LYGNVARIKFLKTKEGTAMVQMGDSVAVERCVQHLNNIPVGNGGKIQIAFSKQNFLSEVI  373
            LYGNVARIKFLKTKEGTAMVQMGD+VAVERCVQHLNNIPVG GGKIQIAFSKQNFLSEVI
Sbjct  304  LYGNVARIKFLKTKEGTAMVQMGDAVAVERCVQHLNNIPVGTGGKIQIAFSKQNFLSEVI  363

Query  374  NPFLLPDHTPSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIFN  433
            NPFLLPDH+PSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIFN
Sbjct  364  NPFLLPDHSPSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIFN  423

Query  434  IKEVPATSVRLFPLKTERSSSGLIEFPNISQAVLAIMKCNHLPIEGKGTKFPFIMKLCFS  493
            IK+VPATSVRLFPLKTERSSSGLIEF NISQAVLAIMKCNHLPIEGKGTKFPFIMKLCFS
Sbjct  424  IKDVPATSVRLFPLKTERSSSGLIEFSNISQAVLAIMKCNHLPIEGKGTKFPFIMKLCFS  483

Query  494  SSKSMNGAWNNATNEGMIEKENEVEVKQDVYN  525
            SSKSMNGAWNNA +EGMIEKENEV+ K D+YN
Sbjct  484  SSKSMNGAWNNAASEGMIEKENEVDTKVDIYN  515


>A0A0B4K7I2_DROME unnamed protein product
Length=552

 Score = 894 bits (2309),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/529 (83%), Positives = 457/529 (86%), Gaps = 24/529 (5%)

Query  21   ISDGPQNKKIRTGVQQPGEADAHLHARAVVQQSQQQALLNKSNDDLRRKRPETTRPNHIL  80
            +++GPQNKKIRTGVQQPGE D H+HAR+  QQ+QQQAL+NKSNDDLRRKRPETTRPNHIL
Sbjct  24   VTEGPQNKKIRTGVQQPGENDVHMHARSTPQQNQQQALMNKSNDDLRRKRPETTRPNHIL  83

Query  81   LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFDSLEAATRARENLNGAD  140
            LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFD+L+AATRARENLNGAD
Sbjct  84   LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFDNLDAATRARENLNGAD  143

Query  141  IYSGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLTAVKEIGNGRSPLLQEPLY-GTRPQPY  199
            IY+GCCTLKIDYAKPEKLNVYKNEPDTSWDYTL+ VKEIGNGRSPLLQEPLY  T   P 
Sbjct  144  IYAGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLSTVKEIGNGRSPLLQEPLYVATLSTPQ  203

Query  200  SKFQQNSFITTTTNSTIGLI----------------------STPTNFCQFKEPPLLGPG  237
                                                      +   N  QFKEPPLLGPG
Sbjct  204  QHVSHQHHHHLRQQQQQQHQQQAPQQQPHPQHLHHQQQLVAPAQSHNLYQFKEPPLLGPG  263

Query  238  AAFPPFGAAEFHPTTPENWKGATIHPTGLMKEPA-VVPGRNAPVTFATQAQGQGAVMMVY  296
            AAFPPFGA E+H TTPENWKGA IHPTGLMKEPA VVPGRNAPV F  Q Q QGAVMMVY
Sbjct  264  AAFPPFGAPEYHTTTPENWKGAAIHPTGLMKEPAGVVPGRNAPVAFTPQGQAQGAVMMVY  323

Query  297  GLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMGDSVAVERCVQHLNNIPVGNG  356
            GLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMGD+VAVERCVQHLNNIPVG G
Sbjct  324  GLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMGDAVAVERCVQHLNNIPVGTG  383

Query  357  GKIQIAFSKQNFLSEVINPFLLPDHTPSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHF  416
            GKIQIAFSKQNFLSEVINPFLLPDH+PSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHF
Sbjct  384  GKIQIAFSKQNFLSEVINPFLLPDHSPSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHF  443

Query  417  FNTPPGLTEDQLIGIFNIKEVPATSVRLFPLKTERSSSGLIEFPNISQAVLAIMKCNHLP  476
            FNTPPGLTEDQLIGIFNIK+VPATSVRLFPLKTERSSSGLIEF NISQAVLAIMKCNHLP
Sbjct  444  FNTPPGLTEDQLIGIFNIKDVPATSVRLFPLKTERSSSGLIEFSNISQAVLAIMKCNHLP  503

Query  477  IEGKGTKFPFIMKLCFSSSKSMNGAWNNATNEGMIEKENEVEVKQDVYN  525
            IEGKGTKFPFIMKLCFSSSKSMNGAWNNA +EGMIEKENEV+ K D+YN
Sbjct  504  IEGKGTKFPFIMKLCFSSSKSMNGAWNNAASEGMIEKENEVDTKVDIYN  552


>A0A0B4K7W3_DROME unnamed protein product
Length=492

 Score = 889 bits (2296),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/506 (85%), Positives = 450/506 (89%), Gaps = 38/506 (8%)

Query  21   ISDGPQNKKIRTGVQQPGEADAHLHARAVVQQSQQQALLNKSNDDLRRKRPETTRPNHIL  80
            +++GPQNKKIRTGVQQPGE D H+HAR+  QQ+QQQAL+NKSNDDLRRKRPETTRPNHIL
Sbjct  24   VTEGPQNKKIRTGVQQPGENDVHMHARSTPQQNQQQALMNKSNDDLRRKRPETTRPNHIL  83

Query  81   LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFDSLEAATRARENLNGAD  140
            LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFD+L+AATRARENLNGAD
Sbjct  84   LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFDNLDAATRARENLNGAD  143

Query  141  IYSGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLTAVKEIGNGRSPLLQEPLYGTRPQPYS  200
            IY+GCCTLKIDYAKPEKLNVYKNEPDTSWDYTL+ VKEIGNGRSPLLQEPLY        
Sbjct  144  IYAGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLSTVKEIGNGRSPLLQEPLY--------  195

Query  201  KFQQNSFITTTTNSTIGLISTPTNFCQFKEPPLLGPGAAFPPFGAAEFHPTTPENWKGAT  260
                                         EPPLLGPGAAFPPFGA E+H TTPENWKGA 
Sbjct  196  -----------------------------EPPLLGPGAAFPPFGAPEYHTTTPENWKGAA  226

Query  261  IHPTGLMKEPA-VVPGRNAPVTFATQAQGQGAVMMVYGLDHDTSNTDKLFNLVCLYGNVA  319
            IHPTGLMKEPA VVPGRNAPV F  Q Q QGAVMMVYGLDHDTSNTDKLFNLVCLYGNVA
Sbjct  227  IHPTGLMKEPAGVVPGRNAPVAFTPQGQAQGAVMMVYGLDHDTSNTDKLFNLVCLYGNVA  286

Query  320  RIKFLKTKEGTAMVQMGDSVAVERCVQHLNNIPVGNGGKIQIAFSKQNFLSEVINPFLLP  379
            RIKFLKTKEGTAMVQMGD+VAVERCVQHLNNIPVG GGKIQIAFSKQNFLSEVINPFLLP
Sbjct  287  RIKFLKTKEGTAMVQMGDAVAVERCVQHLNNIPVGTGGKIQIAFSKQNFLSEVINPFLLP  346

Query  380  DHTPSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIFNIKEVPA  439
            DH+PSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIFNIK+VPA
Sbjct  347  DHSPSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIFNIKDVPA  406

Query  440  TSVRLFPLKTERSSSGLIEFPNISQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMN  499
            TSVRLFPLKTERSSSGLIEF NISQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMN
Sbjct  407  TSVRLFPLKTERSSSGLIEFSNISQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMN  466

Query  500  GAWNNATNEGMIEKENEVEVKQDVYN  525
            GAWNNA +EGMIEKENEV+ K D+YN
Sbjct  467  GAWNNAASEGMIEKENEVDTKVDIYN  492



Lambda      K        H
   0.312    0.126    0.350 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 36770632136


Query= XP_014085231.1 PREDICTED: heterogeneous nuclear ribonucleoprotein L
isoform X3 [Bactrocera oleae]

Length=518
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A0A0B4K8A1_DROME  unnamed protein product                             895     0.0  
A0A0B4K7W3_DROME  unnamed protein product                             886     0.0  
A0A0B4K852_DROME  unnamed protein product                             880     0.0  


>A0A0B4K8A1_DROME unnamed protein product
Length=515

 Score = 895 bits (2313),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/504 (87%), Positives = 458/504 (91%), Gaps = 18/504 (4%)

Query  21   ISDGPQNKKIRTGVQQPGEADAHLHARAVVQQSQQQALLNKSNDDLRRKRPETTRPNHIL  80
            +++GPQNKKIRTGVQQPGE D H+HAR     +QQQAL+NKSNDDLRRKRPETTRPNHIL
Sbjct  24   VTEGPQNKKIRTGVQQPGENDVHMHAR-----NQQQALMNKSNDDLRRKRPETTRPNHIL  78

Query  81   LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFDSLEAATRARENLNGAD  140
            LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFD+L+AATRARENLNGAD
Sbjct  79   LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFDNLDAATRARENLNGAD  138

Query  141  IYSGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLTA-----VKEIGNGRSPLLQEPLYGTR  195
            IY+GCCTLKIDYAKPEKLNVYKNEPDTSWDYTL+      +KEIGNGRSPLLQEPLYGTR
Sbjct  139  IYAGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLSTGEILPIKEIGNGRSPLLQEPLYGTR  198

Query  196  PQPYSKFQQNSFITTTTNSTKPPLLGPGAAFPPFGAAEFHPTTPENWKGATIHPTGLMKE  255
            PQPYSK   +         ++PPLLGPGAAFPPFGA E+H TTPENWKGA IHPTGLMKE
Sbjct  199  PQPYSKSLFSIPENVVMLESQPPLLGPGAAFPPFGAPEYHTTTPENWKGAAIHPTGLMKE  258

Query  256  PA-VVPGRNAPVTFATQAQGQDIIPSLQGAVMMVYGLDHDTSNTDKLFNLVCLYGNVARI  314
            PA VVPGRNAPV F  Q Q Q       GAVMMVYGLDHDTSNTDKLFNLVCLYGNVARI
Sbjct  259  PAGVVPGRNAPVAFTPQGQAQ-------GAVMMVYGLDHDTSNTDKLFNLVCLYGNVARI  311

Query  315  KFLKTKEGTAMVQMGDSVAVERCVQHLNNIPVGNGGKIQIAFSKQNFLSEVINPFLLPDH  374
            KFLKTKEGTAMVQMGD+VAVERCVQHLNNIPVG GGKIQIAFSKQNFLSEVINPFLLPDH
Sbjct  312  KFLKTKEGTAMVQMGDAVAVERCVQHLNNIPVGTGGKIQIAFSKQNFLSEVINPFLLPDH  371

Query  375  TPSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIFNIKEVPATS  434
            +PSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIFNIK+VPATS
Sbjct  372  SPSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIFNIKDVPATS  431

Query  435  VRLFPLKTERSSSGLIEFPNISQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGA  494
            VRLFPLKTERSSSGLIEF NISQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGA
Sbjct  432  VRLFPLKTERSSSGLIEFSNISQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGA  491

Query  495  WNNATNEGMIEKENEVEVKQDVYN  518
            WNNA +EGMIEKENEV+ K D+YN
Sbjct  492  WNNAASEGMIEKENEVDTKVDIYN  515


>A0A0B4K7W3_DROME unnamed protein product
Length=492

 Score = 886 bits (2289),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/499 (86%), Positives = 450/499 (90%), Gaps = 31/499 (6%)

Query  21   ISDGPQNKKIRTGVQQPGEADAHLHARAVVQQSQQQALLNKSNDDLRRKRPETTRPNHIL  80
            +++GPQNKKIRTGVQQPGE D H+HAR+  QQ+QQQAL+NKSNDDLRRKRPETTRPNHIL
Sbjct  24   VTEGPQNKKIRTGVQQPGENDVHMHARSTPQQNQQQALMNKSNDDLRRKRPETTRPNHIL  83

Query  81   LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFDSLEAATRARENLNGAD  140
            LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFD+L+AATRARENLNGAD
Sbjct  84   LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFDNLDAATRARENLNGAD  143

Query  141  IYSGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLTAVKEIGNGRSPLLQEPLYGTRPQPYS  200
            IY+GCCTLKIDYAKPEKLNVYKNEPDTSWDYTL+ VKEIGNGRSPLLQEPLY        
Sbjct  144  IYAGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLSTVKEIGNGRSPLLQEPLY--------  195

Query  201  KFQQNSFITTTTNSTKPPLLGPGAAFPPFGAAEFHPTTPENWKGATIHPTGLMKEPA-VV  259
                           +PPLLGPGAAFPPFGA E+H TTPENWKGA IHPTGLMKEPA VV
Sbjct  196  ---------------EPPLLGPGAAFPPFGAPEYHTTTPENWKGAAIHPTGLMKEPAGVV  240

Query  260  PGRNAPVTFATQAQGQDIIPSLQGAVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKT  319
            PGRNAPV F  Q Q Q       GAVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKT
Sbjct  241  PGRNAPVAFTPQGQAQ-------GAVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKT  293

Query  320  KEGTAMVQMGDSVAVERCVQHLNNIPVGNGGKIQIAFSKQNFLSEVINPFLLPDHTPSFK  379
            KEGTAMVQMGD+VAVERCVQHLNNIPVG GGKIQIAFSKQNFLSEVINPFLLPDH+PSFK
Sbjct  294  KEGTAMVQMGDAVAVERCVQHLNNIPVGTGGKIQIAFSKQNFLSEVINPFLLPDHSPSFK  353

Query  380  EYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIFNIKEVPATSVRLFP  439
            EYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIFNIK+VPATSVRLFP
Sbjct  354  EYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIFNIKDVPATSVRLFP  413

Query  440  LKTERSSSGLIEFPNISQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGAWNNAT  499
            LKTERSSSGLIEF NISQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGAWNNA 
Sbjct  414  LKTERSSSGLIEFSNISQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGAWNNAA  473

Query  500  NEGMIEKENEVEVKQDVYN  518
            +EGMIEKENEV+ K D+YN
Sbjct  474  SEGMIEKENEVDTKVDIYN  492


>A0A0B4K852_DROME unnamed protein product
Length=497

 Score = 880 bits (2273),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/504 (85%), Positives = 450/504 (89%), Gaps = 36/504 (7%)

Query  21   ISDGPQNKKIRTGVQQPGEADAHLHARAVVQQSQQQALLNKSNDDLRRKRPETTRPNHIL  80
            +++GPQNKKIRTGVQQPGE D H+HAR+  QQ+QQQAL+NKSNDDLRRKRPETTRPNHIL
Sbjct  24   VTEGPQNKKIRTGVQQPGENDVHMHARSTPQQNQQQALMNKSNDDLRRKRPETTRPNHIL  83

Query  81   LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFDSLEAATRARENLNGAD  140
            LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFD+L+AATRARENLNGAD
Sbjct  84   LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFDNLDAATRARENLNGAD  143

Query  141  IYSGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLTA-----VKEIGNGRSPLLQEPLYGTR  195
            IY+GCCTLKIDYAKPEKLNVYKNEPDTSWDYTL+      +KEIGNGRSPLLQEPLY   
Sbjct  144  IYAGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLSTGEILPIKEIGNGRSPLLQEPLY---  200

Query  196  PQPYSKFQQNSFITTTTNSTKPPLLGPGAAFPPFGAAEFHPTTPENWKGATIHPTGLMKE  255
                                +PPLLGPGAAFPPFGA E+H TTPENWKGA IHPTGLMKE
Sbjct  201  --------------------EPPLLGPGAAFPPFGAPEYHTTTPENWKGAAIHPTGLMKE  240

Query  256  PA-VVPGRNAPVTFATQAQGQDIIPSLQGAVMMVYGLDHDTSNTDKLFNLVCLYGNVARI  314
            PA VVPGRNAPV F  Q Q Q       GAVMMVYGLDHDTSNTDKLFNLVCLYGNVARI
Sbjct  241  PAGVVPGRNAPVAFTPQGQAQ-------GAVMMVYGLDHDTSNTDKLFNLVCLYGNVARI  293

Query  315  KFLKTKEGTAMVQMGDSVAVERCVQHLNNIPVGNGGKIQIAFSKQNFLSEVINPFLLPDH  374
            KFLKTKEGTAMVQMGD+VAVERCVQHLNNIPVG GGKIQIAFSKQNFLSEVINPFLLPDH
Sbjct  294  KFLKTKEGTAMVQMGDAVAVERCVQHLNNIPVGTGGKIQIAFSKQNFLSEVINPFLLPDH  353

Query  375  TPSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIFNIKEVPATS  434
            +PSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIFNIK+VPATS
Sbjct  354  SPSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIFNIKDVPATS  413

Query  435  VRLFPLKTERSSSGLIEFPNISQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGA  494
            VRLFPLKTERSSSGLIEF NISQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGA
Sbjct  414  VRLFPLKTERSSSGLIEFSNISQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGA  473

Query  495  WNNATNEGMIEKENEVEVKQDVYN  518
            WNNA +EGMIEKENEV+ K D+YN
Sbjct  474  WNNAASEGMIEKENEVDTKVDIYN  497



Lambda      K        H
   0.312    0.126    0.350 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 36770632136


Query= XP_014085232.1 PREDICTED: heterogeneous nuclear ribonucleoprotein L
isoform X4 [Bactrocera oleae]

Length=517
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A0A0B4K8A1_DROME  unnamed protein product                             856     0.0  
A0A0B4K7I2_DROME  unnamed protein product                             840     0.0  
A0A0B4K7W3_DROME  unnamed protein product                             837     0.0  


>A0A0B4K8A1_DROME unnamed protein product
Length=515

 Score = 856 bits (2211),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/488 (86%), Positives = 437/488 (90%), Gaps = 29/488 (6%)

Query  37   QSQQQALLNKSNDDLRRKRPETTRPNHILLFTIINPFYPITVDVLHKICHPHGQVLRIVI  96
            ++QQQAL+NKSNDDLRRKRPETTRPNHILLFTIINPFYPITVDVLHKICHPHGQVLRIVI
Sbjct  50   RNQQQALMNKSNDDLRRKRPETTRPNHILLFTIINPFYPITVDVLHKICHPHGQVLRIVI  109

Query  97   FKKNGVQAMVEFDSLEAATRARENLNGADIYSGCCTLKIDYAKPEKLNVYKNEPDTSWDY  156
            FKKNGVQAMVEFD+L+AATRARENLNGADIY+GCCTLKIDYAKPEKLNVYKNEPDTSWDY
Sbjct  110  FKKNGVQAMVEFDNLDAATRARENLNGADIYAGCCTLKIDYAKPEKLNVYKNEPDTSWDY  169

Query  157  TLTA-----VKEIGNGRSPLLQEPLYGTRPQPYSKFQQNSFITTTTNSTIGLISTPTNFC  211
            TL+      +KEIGNGRSPLLQEPLYGTRPQPYSK                L S P N  
Sbjct  170  TLSTGEILPIKEIGNGRSPLLQEPLYGTRPQPYSK---------------SLFSIPENVV  214

Query  212  QFK-EPPLLGPGAAFPPFGAAEFHPTTPENWKGATIHPTGLMKEPA-VVPGRNAPVTFAT  269
              + +PPLLGPGAAFPPFGA E+H TTPENWKGA IHPTGLMKEPA VVPGRNAPV F  
Sbjct  215  MLESQPPLLGPGAAFPPFGAPEYHTTTPENWKGAAIHPTGLMKEPAGVVPGRNAPVAFTP  274

Query  270  QAQGQDIIPSLQGAVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMGD  329
            Q Q Q       GAVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMGD
Sbjct  275  QGQAQ-------GAVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMGD  327

Query  330  SVAVERCVQHLNNIPVGNGGKIQIAFSKQNFLSEVINPFLLPDHTPSFKEYTGSKNNRFL  389
            +VAVERCVQHLNNIPVG GGKIQIAFSKQNFLSEVINPFLLPDH+PSFKEYTGSKNNRFL
Sbjct  328  AVAVERCVQHLNNIPVGTGGKIQIAFSKQNFLSEVINPFLLPDHSPSFKEYTGSKNNRFL  387

Query  390  SPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIFNIKEVPATSVRLFPLKTERSSSGLI  449
            SPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIFNIK+VPATSVRLFPLKTERSSSGLI
Sbjct  388  SPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIFNIKDVPATSVRLFPLKTERSSSGLI  447

Query  450  EFPNISQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGAWNNATNEGMIEKENEV  509
            EF NISQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGAWNNA +EGMIEKENEV
Sbjct  448  EFSNISQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGAWNNAASEGMIEKENEV  507

Query  510  EVKQDVYN  517
            + K D+YN
Sbjct  508  DTKVDIYN  515


>A0A0B4K7I2_DROME unnamed protein product
Length=552

 Score = 840 bits (2171),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/506 (82%), Positives = 431/506 (85%), Gaps = 31/506 (6%)

Query  36   QQSQQQALLNKSNDDLRRKRPETTRPNHILLFTIINPFYPITVDVLHKICHPHGQVLRIV  95
            QQ+QQQAL+NKSNDDLRRKRPETTRPNHILLFTIINPFYPITVDVLHKICHPHGQVLRIV
Sbjct  54   QQNQQQALMNKSNDDLRRKRPETTRPNHILLFTIINPFYPITVDVLHKICHPHGQVLRIV  113

Query  96   IFKKNGVQAMVEFDSLEAATRARENLNGADIYSGCCTLKIDYAKPEKLNVYKNEPDTSWD  155
            IFKKNGVQAMVEFD+L+AATRARENLNGADIY+GCCTLKIDYAKPEKLNVYKNEPDTSWD
Sbjct  114  IFKKNGVQAMVEFDNLDAATRARENLNGADIYAGCCTLKIDYAKPEKLNVYKNEPDTSWD  173

Query  156  YTLTAVKEIGNGRSPLLQEPLY-GTRPQPYSKFQQNSFITTTTNSTIGLI----------  204
            YTL+ VKEIGNGRSPLLQEPLY  T   P                               
Sbjct  174  YTLSTVKEIGNGRSPLLQEPLYVATLSTPQQHVSHQHHHHLRQQQQQQHQQQAPQQQPHP  233

Query  205  ------------STPTNFCQFKEPPLLGPGAAFPPFGAAEFHPTTPENWKGATIHPTGLM  252
                        +   N  QFKEPPLLGPGAAFPPFGA E+H TTPENWKGA IHPTGLM
Sbjct  234  QHLHHQQQLVAPAQSHNLYQFKEPPLLGPGAAFPPFGAPEYHTTTPENWKGAAIHPTGLM  293

Query  253  KEPA-VVPGRNAPVTFATQAQGQDIIPSLQGAVMMVYGLDHDTSNTDKLFNLVCLYGNVA  311
            KEPA VVPGRNAPV F  Q Q Q       GAVMMVYGLDHDTSNTDKLFNLVCLYGNVA
Sbjct  294  KEPAGVVPGRNAPVAFTPQGQAQ-------GAVMMVYGLDHDTSNTDKLFNLVCLYGNVA  346

Query  312  RIKFLKTKEGTAMVQMGDSVAVERCVQHLNNIPVGNGGKIQIAFSKQNFLSEVINPFLLP  371
            RIKFLKTKEGTAMVQMGD+VAVERCVQHLNNIPVG GGKIQIAFSKQNFLSEVINPFLLP
Sbjct  347  RIKFLKTKEGTAMVQMGDAVAVERCVQHLNNIPVGTGGKIQIAFSKQNFLSEVINPFLLP  406

Query  372  DHTPSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIFNIKEVPA  431
            DH+PSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIFNIK+VPA
Sbjct  407  DHSPSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIFNIKDVPA  466

Query  432  TSVRLFPLKTERSSSGLIEFPNISQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMN  491
            TSVRLFPLKTERSSSGLIEF NISQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMN
Sbjct  467  TSVRLFPLKTERSSSGLIEFSNISQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMN  526

Query  492  GAWNNATNEGMIEKENEVEVKQDVYN  517
            GAWNNA +EGMIEKENEV+ K D+YN
Sbjct  527  GAWNNAASEGMIEKENEVDTKVDIYN  552


>A0A0B4K7W3_DROME unnamed protein product
Length=492

 Score = 837 bits (2161),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/483 (85%), Positives = 424/483 (88%), Gaps = 45/483 (9%)

Query  36   QQSQQQALLNKSNDDLRRKRPETTRPNHILLFTIINPFYPITVDVLHKICHPHGQVLRIV  95
            QQ+QQQAL+NKSNDDLRRKRPETTRPNHILLFTIINPFYPITVDVLHKICHPHGQVLRIV
Sbjct  54   QQNQQQALMNKSNDDLRRKRPETTRPNHILLFTIINPFYPITVDVLHKICHPHGQVLRIV  113

Query  96   IFKKNGVQAMVEFDSLEAATRARENLNGADIYSGCCTLKIDYAKPEKLNVYKNEPDTSWD  155
            IFKKNGVQAMVEFD+L+AATRARENLNGADIY+GCCTLKIDYAKPEKLNVYKNEPDTSWD
Sbjct  114  IFKKNGVQAMVEFDNLDAATRARENLNGADIYAGCCTLKIDYAKPEKLNVYKNEPDTSWD  173

Query  156  YTLTAVKEIGNGRSPLLQEPLYGTRPQPYSKFQQNSFITTTTNSTIGLISTPTNFCQFKE  215
            YTL+ VKEIGNGRSPLLQEPLY                                     E
Sbjct  174  YTLSTVKEIGNGRSPLLQEPLY-------------------------------------E  196

Query  216  PPLLGPGAAFPPFGAAEFHPTTPENWKGATIHPTGLMKEPA-VVPGRNAPVTFATQAQGQ  274
            PPLLGPGAAFPPFGA E+H TTPENWKGA IHPTGLMKEPA VVPGRNAPV F  Q Q Q
Sbjct  197  PPLLGPGAAFPPFGAPEYHTTTPENWKGAAIHPTGLMKEPAGVVPGRNAPVAFTPQGQAQ  256

Query  275  DIIPSLQGAVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMGDSVAVE  334
                   GAVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMGD+VAVE
Sbjct  257  -------GAVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMGDAVAVE  309

Query  335  RCVQHLNNIPVGNGGKIQIAFSKQNFLSEVINPFLLPDHTPSFKEYTGSKNNRFLSPAQA  394
            RCVQHLNNIPVG GGKIQIAFSKQNFLSEVINPFLLPDH+PSFKEYTGSKNNRFLSPAQA
Sbjct  310  RCVQHLNNIPVGTGGKIQIAFSKQNFLSEVINPFLLPDHSPSFKEYTGSKNNRFLSPAQA  369

Query  395  SKNRIQPPSKILHFFNTPPGLTEDQLIGIFNIKEVPATSVRLFPLKTERSSSGLIEFPNI  454
            SKNRIQPPSKILHFFNTPPGLTEDQLIGIFNIK+VPATSVRLFPLKTERSSSGLIEF NI
Sbjct  370  SKNRIQPPSKILHFFNTPPGLTEDQLIGIFNIKDVPATSVRLFPLKTERSSSGLIEFSNI  429

Query  455  SQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGAWNNATNEGMIEKENEVEVKQD  514
            SQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGAWNNA +EGMIEKENEV+ K D
Sbjct  430  SQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGAWNNAASEGMIEKENEVDTKVD  489

Query  515  VYN  517
            +YN
Sbjct  490  IYN  492



Lambda      K        H
   0.312    0.126    0.350 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 36770632136


Query= XP_014085233.1 PREDICTED: heterogeneous nuclear ribonucleoprotein L
isoform X5 [Bactrocera oleae]

Length=516
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A0A0B4K8A1_DROME  unnamed protein product                             895     0.0  
A0A0B4K7W3_DROME  unnamed protein product                             887     0.0  
A0A0B4K7I2_DROME  unnamed protein product                             887     0.0  


>A0A0B4K8A1_DROME unnamed protein product
Length=515

 Score = 895 bits (2312),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/504 (87%), Positives = 459/504 (91%), Gaps = 20/504 (4%)

Query  21   ISDGPQNKKIRTGVQQPGEADAHLHARAVVQQSQQQALLNKSNDDLRRKRPETTRPNHIL  80
            +++GPQNKKIRTGVQQPGE D H+HAR     +QQQAL+NKSNDDLRRKRPETTRPNHIL
Sbjct  24   VTEGPQNKKIRTGVQQPGENDVHMHAR-----NQQQALMNKSNDDLRRKRPETTRPNHIL  78

Query  81   LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFDSLEAATRARENLNGAD  140
            LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFD+L+AATRARENLNGAD
Sbjct  79   LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFDNLDAATRARENLNGAD  138

Query  141  IYSGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLTA-----VKEIGNGRSPLLQEPLYGTR  195
            IY+GCCTLKIDYAKPEKLNVYKNEPDTSWDYTL+      +KEIGNGRSPLLQEPLYGTR
Sbjct  139  IYAGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLSTGEILPIKEIGNGRSPLLQEPLYGTR  198

Query  196  PQPYI-GLISTPTNFCQFK-EPPLLGPGAAFPPFGAAEFHPTTPENWKGATIHPTGLMKE  253
            PQPY   L S P N    + +PPLLGPGAAFPPFGA E+H TTPENWKGA IHPTGLMKE
Sbjct  199  PQPYSKSLFSIPENVVMLESQPPLLGPGAAFPPFGAPEYHTTTPENWKGAAIHPTGLMKE  258

Query  254  PA-VVPGRNAPVTFATQAQGQDIIPSLQGAVMMVYGLDHDTSNTDKLFNLVCLYGNVARI  312
            PA VVPGRNAPV F  Q Q Q       GAVMMVYGLDHDTSNTDKLFNLVCLYGNVARI
Sbjct  259  PAGVVPGRNAPVAFTPQGQAQ-------GAVMMVYGLDHDTSNTDKLFNLVCLYGNVARI  311

Query  313  KFLKTKEGTAMVQMGDSVAVERCVQHLNNIPVGNGGKIQIAFSKQNFLSEVINPFLLPDH  372
            KFLKTKEGTAMVQMGD+VAVERCVQHLNNIPVG GGKIQIAFSKQNFLSEVINPFLLPDH
Sbjct  312  KFLKTKEGTAMVQMGDAVAVERCVQHLNNIPVGTGGKIQIAFSKQNFLSEVINPFLLPDH  371

Query  373  TPSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIFNIKEVPATS  432
            +PSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIFNIK+VPATS
Sbjct  372  SPSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIFNIKDVPATS  431

Query  433  VRLFPLKTERSSSGLIEFPNISQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGA  492
            VRLFPLKTERSSSGLIEF NISQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGA
Sbjct  432  VRLFPLKTERSSSGLIEFSNISQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGA  491

Query  493  WNNATNEGMIEKENEVEVKQDVYN  516
            WNNA +EGMIEKENEV+ K D+YN
Sbjct  492  WNNAASEGMIEKENEVDTKVDIYN  515


>A0A0B4K7W3_DROME unnamed protein product
Length=492

 Score = 887 bits (2292),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/497 (87%), Positives = 450/497 (91%), Gaps = 29/497 (6%)

Query  21   ISDGPQNKKIRTGVQQPGEADAHLHARAVVQQSQQQALLNKSNDDLRRKRPETTRPNHIL  80
            +++GPQNKKIRTGVQQPGE D H+HAR+  QQ+QQQAL+NKSNDDLRRKRPETTRPNHIL
Sbjct  24   VTEGPQNKKIRTGVQQPGENDVHMHARSTPQQNQQQALMNKSNDDLRRKRPETTRPNHIL  83

Query  81   LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFDSLEAATRARENLNGAD  140
            LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFD+L+AATRARENLNGAD
Sbjct  84   LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFDNLDAATRARENLNGAD  143

Query  141  IYSGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLTAVKEIGNGRSPLLQEPLYGTRPQPYI  200
            IY+GCCTLKIDYAKPEKLNVYKNEPDTSWDYTL+ VKEIGNGRSPLLQEPLY        
Sbjct  144  IYAGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLSTVKEIGNGRSPLLQEPLY--------  195

Query  201  GLISTPTNFCQFKEPPLLGPGAAFPPFGAAEFHPTTPENWKGATIHPTGLMKEPA-VVPG  259
                         EPPLLGPGAAFPPFGA E+H TTPENWKGA IHPTGLMKEPA VVPG
Sbjct  196  -------------EPPLLGPGAAFPPFGAPEYHTTTPENWKGAAIHPTGLMKEPAGVVPG  242

Query  260  RNAPVTFATQAQGQDIIPSLQGAVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKE  319
            RNAPV F  Q Q Q       GAVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKE
Sbjct  243  RNAPVAFTPQGQAQ-------GAVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKE  295

Query  320  GTAMVQMGDSVAVERCVQHLNNIPVGNGGKIQIAFSKQNFLSEVINPFLLPDHTPSFKEY  379
            GTAMVQMGD+VAVERCVQHLNNIPVG GGKIQIAFSKQNFLSEVINPFLLPDH+PSFKEY
Sbjct  296  GTAMVQMGDAVAVERCVQHLNNIPVGTGGKIQIAFSKQNFLSEVINPFLLPDHSPSFKEY  355

Query  380  TGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIFNIKEVPATSVRLFPLK  439
            TGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIFNIK+VPATSVRLFPLK
Sbjct  356  TGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIFNIKDVPATSVRLFPLK  415

Query  440  TERSSSGLIEFPNISQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGAWNNATNE  499
            TERSSSGLIEF NISQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGAWNNA +E
Sbjct  416  TERSSSGLIEFSNISQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGAWNNAASE  475

Query  500  GMIEKENEVEVKQDVYN  516
            GMIEKENEV+ K D+YN
Sbjct  476  GMIEKENEVDTKVDIYN  492


>A0A0B4K7I2_DROME unnamed protein product
Length=552

 Score = 887 bits (2291),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/543 (81%), Positives = 459/543 (85%), Gaps = 61/543 (11%)

Query  21   ISDGPQNKKIRTGVQQPGEADAHLHARAVVQQSQQQALLNKSNDDLRRKRPETTRPNHIL  80
            +++GPQNKKIRTGVQQPGE D H+HAR+  QQ+QQQAL+NKSNDDLRRKRPETTRPNHIL
Sbjct  24   VTEGPQNKKIRTGVQQPGENDVHMHARSTPQQNQQQALMNKSNDDLRRKRPETTRPNHIL  83

Query  81   LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFDSLEAATRARENLNGAD  140
            LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFD+L+AATRARENLNGAD
Sbjct  84   LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFDNLDAATRARENLNGAD  143

Query  141  IYSGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLTAVKEIGNGRSPLLQEPLYGTRPQPYI  200
            IY+GCCTLKIDYAKPEKLNVYKNEPDTSWDYTL+ VKEIGNGRSPLLQEPLY       +
Sbjct  144  IYAGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLSTVKEIGNGRSPLLQEPLY-------V  196

Query  201  GLISTPT----------------------------------------------NFCQFKE  214
              +STP                                               N  QFKE
Sbjct  197  ATLSTPQQHVSHQHHHHLRQQQQQQHQQQAPQQQPHPQHLHHQQQLVAPAQSHNLYQFKE  256

Query  215  PPLLGPGAAFPPFGAAEFHPTTPENWKGATIHPTGLMKEPA-VVPGRNAPVTFATQAQGQ  273
            PPLLGPGAAFPPFGA E+H TTPENWKGA IHPTGLMKEPA VVPGRNAPV F  Q Q Q
Sbjct  257  PPLLGPGAAFPPFGAPEYHTTTPENWKGAAIHPTGLMKEPAGVVPGRNAPVAFTPQGQAQ  316

Query  274  DIIPSLQGAVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMGDSVAVE  333
                   GAVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMGD+VAVE
Sbjct  317  -------GAVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMGDAVAVE  369

Query  334  RCVQHLNNIPVGNGGKIQIAFSKQNFLSEVINPFLLPDHTPSFKEYTGSKNNRFLSPAQA  393
            RCVQHLNNIPVG GGKIQIAFSKQNFLSEVINPFLLPDH+PSFKEYTGSKNNRFLSPAQA
Sbjct  370  RCVQHLNNIPVGTGGKIQIAFSKQNFLSEVINPFLLPDHSPSFKEYTGSKNNRFLSPAQA  429

Query  394  SKNRIQPPSKILHFFNTPPGLTEDQLIGIFNIKEVPATSVRLFPLKTERSSSGLIEFPNI  453
            SKNRIQPPSKILHFFNTPPGLTEDQLIGIFNIK+VPATSVRLFPLKTERSSSGLIEF NI
Sbjct  430  SKNRIQPPSKILHFFNTPPGLTEDQLIGIFNIKDVPATSVRLFPLKTERSSSGLIEFSNI  489

Query  454  SQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGAWNNATNEGMIEKENEVEVKQD  513
            SQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGAWNNA +EGMIEKENEV+ K D
Sbjct  490  SQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGAWNNAASEGMIEKENEVDTKVD  549

Query  514  VYN  516
            +YN
Sbjct  550  IYN  552



Lambda      K        H
   0.312    0.126    0.350 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 36770632136


Query= XP_014085234.1 PREDICTED: heterogeneous nuclear ribonucleoprotein L
isoform X6 [Bactrocera oleae]

Length=508
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A0A0B4K7I6_DROME  unnamed protein product                             863     0.0  
A0A0B4KF04_DROME  unnamed protein product                             863     0.0  
A0A0B4K852_DROME  unnamed protein product                             859     0.0  


>A0A0B4K7I6_DROME unnamed protein product
Length=491

 Score = 863 bits (2230),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/490 (86%), Positives = 440/490 (90%), Gaps = 24/490 (5%)

Query  21   ISDGPQNKKIRTGVQQPGEADAHLHARAVVQQSQQQALLNKSNDDLRRKRPETTRPNHIL  80
            +++GPQNKKIRTGVQQPGE D H+HAR+  QQ+QQQAL+NKSNDDLRRKRPETTRPNHIL
Sbjct  24   VTEGPQNKKIRTGVQQPGENDVHMHARSTPQQNQQQALMNKSNDDLRRKRPETTRPNHIL  83

Query  81   LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFDSLEAATRARENLNGAD  140
            LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFD+L+AATRARENLNGAD
Sbjct  84   LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFDNLDAATRARENLNGAD  143

Query  141  IYSGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLTAGKFQQNSFITTTTNSTIGLISTPTN  200
            IY+GCCTLKIDYAKPEKLNVYKNEPDTSWDYTL+ GK                L S P N
Sbjct  144  IYAGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLSTGK---------------SLFSIPEN  188

Query  201  FCQFK-EPPLLGPGAAFPPFGAAEFHPTTPENWKGATIHPTGLMKEPA-VVPGRNAPVTF  258
                + +PPLLGPGAAFPPFGA E+H TTPENWKGA IHPTGLMKEPA VVPGRNAPV F
Sbjct  189  VVMLESQPPLLGPGAAFPPFGAPEYHTTTPENWKGAAIHPTGLMKEPAGVVPGRNAPVAF  248

Query  259  ATQAQGQDIIPSLQGAVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQM  318
              Q Q Q       GAVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQM
Sbjct  249  TPQGQAQ-------GAVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQM  301

Query  319  GDSVAVERCVQHLNNIPVGNGGKIQIAFSKQNFLSEVINPFLLPDHTPSFKEYTGSKNNR  378
            GD+VAVERCVQHLNNIPVG GGKIQIAFSKQNFLSEVINPFLLPDH+PSFKEYTGSKNNR
Sbjct  302  GDAVAVERCVQHLNNIPVGTGGKIQIAFSKQNFLSEVINPFLLPDHSPSFKEYTGSKNNR  361

Query  379  FLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIFNIKEVPATSVRLFPLKTERSSSG  438
            FLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIFNIK+VPATSVRLFPLKTERSSSG
Sbjct  362  FLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIFNIKDVPATSVRLFPLKTERSSSG  421

Query  439  LIEFPNISQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGAWNNATNEGMIEKEN  498
            LIEF NISQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGAWNNA +EGMIEKEN
Sbjct  422  LIEFSNISQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGAWNNAASEGMIEKEN  481

Query  499  EVEVKQDVYN  508
            EV+ K D+YN
Sbjct  482  EVDTKVDIYN  491


>A0A0B4KF04_DROME unnamed protein product
Length=509

 Score = 863 bits (2229),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/493 (85%), Positives = 440/493 (89%), Gaps = 12/493 (2%)

Query  21   ISDGPQNKKIRTGVQQPGEADAHLHARAVVQQSQQQALLNKSNDDLRRKRPETTRPNHIL  80
            +++GPQNKKIRTGVQQPGE D H+HAR+  QQ+QQQAL+NKSNDDLRRKRPETTRPNHIL
Sbjct  24   VTEGPQNKKIRTGVQQPGENDVHMHARSTPQQNQQQALMNKSNDDLRRKRPETTRPNHIL  83

Query  81   LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFDSLEAATRARENLNGAD  140
            LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFD+L+AATRARENLNGAD
Sbjct  84   LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFDNLDAATRARENLNGAD  143

Query  141  IYSGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLTAGKFQQNSFIT----TTTNSTIGLIS  196
            IY+GCCTLKIDYAKPEKLNVYKNEPDTSWDYTL+ G+ Q    +         +     S
Sbjct  144  IYAGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLSTGEMQSTVVVALDDAAEERAEKWENS  203

Query  197  TPTNFCQFKEPPLLGPGAAFPPFGAAEFHPTTPENWKGATIHPTGLMKEPA-VVPGRNAP  255
            T        +PPLLGPGAAFPPFGA E+H TTPENWKGA IHPTGLMKEPA VVPGRNAP
Sbjct  204  TEKRILWMLQPPLLGPGAAFPPFGAPEYHTTTPENWKGAAIHPTGLMKEPAGVVPGRNAP  263

Query  256  VTFATQAQGQDIIPSLQGAVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAM  315
            V F  Q Q Q       GAVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAM
Sbjct  264  VAFTPQGQAQ-------GAVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAM  316

Query  316  VQMGDSVAVERCVQHLNNIPVGNGGKIQIAFSKQNFLSEVINPFLLPDHTPSFKEYTGSK  375
            VQMGD+VAVERCVQHLNNIPVG GGKIQIAFSKQNFLSEVINPFLLPDH+PSFKEYTGSK
Sbjct  317  VQMGDAVAVERCVQHLNNIPVGTGGKIQIAFSKQNFLSEVINPFLLPDHSPSFKEYTGSK  376

Query  376  NNRFLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIFNIKEVPATSVRLFPLKTERS  435
            NNRFLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIFNIK+VPATSVRLFPLKTERS
Sbjct  377  NNRFLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIFNIKDVPATSVRLFPLKTERS  436

Query  436  SSGLIEFPNISQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGAWNNATNEGMIE  495
            SSGLIEF NISQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGAWNNA +EGMIE
Sbjct  437  SSGLIEFSNISQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGAWNNAASEGMIE  496

Query  496  KENEVEVKQDVYN  508
            KENEV+ K D+YN
Sbjct  497  KENEVDTKVDIYN  509


>A0A0B4K852_DROME unnamed protein product
Length=497

 Score = 859 bits (2220),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/489 (86%), Positives = 440/489 (90%), Gaps = 16/489 (3%)

Query  21   ISDGPQNKKIRTGVQQPGEADAHLHARAVVQQSQQQALLNKSNDDLRRKRPETTRPNHIL  80
            +++GPQNKKIRTGVQQPGE D H+HAR+  QQ+QQQAL+NKSNDDLRRKRPETTRPNHIL
Sbjct  24   VTEGPQNKKIRTGVQQPGENDVHMHARSTPQQNQQQALMNKSNDDLRRKRPETTRPNHIL  83

Query  81   LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFDSLEAATRARENLNGAD  140
            LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFD+L+AATRARENLNGAD
Sbjct  84   LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFDNLDAATRARENLNGAD  143

Query  141  IYSGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLTAGKFQQNSFITTTTNSTIGLISTPTN  200
            IY+GCCTLKIDYAKPEKLNVYKNEPDTSWDYTL+ G+      I    N    L+  P  
Sbjct  144  IYAGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLSTGEILP---IKEIGNGRSPLLQEP--  198

Query  201  FCQFKEPPLLGPGAAFPPFGAAEFHPTTPENWKGATIHPTGLMKEPA-VVPGRNAPVTFA  259
                 EPPLLGPGAAFPPFGA E+H TTPENWKGA IHPTGLMKEPA VVPGRNAPV F 
Sbjct  199  ---LYEPPLLGPGAAFPPFGAPEYHTTTPENWKGAAIHPTGLMKEPAGVVPGRNAPVAFT  255

Query  260  TQAQGQDIIPSLQGAVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMG  319
             Q Q Q       GAVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMG
Sbjct  256  PQGQAQ-------GAVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMG  308

Query  320  DSVAVERCVQHLNNIPVGNGGKIQIAFSKQNFLSEVINPFLLPDHTPSFKEYTGSKNNRF  379
            D+VAVERCVQHLNNIPVG GGKIQIAFSKQNFLSEVINPFLLPDH+PSFKEYTGSKNNRF
Sbjct  309  DAVAVERCVQHLNNIPVGTGGKIQIAFSKQNFLSEVINPFLLPDHSPSFKEYTGSKNNRF  368

Query  380  LSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIFNIKEVPATSVRLFPLKTERSSSGL  439
            LSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIFNIK+VPATSVRLFPLKTERSSSGL
Sbjct  369  LSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIFNIKDVPATSVRLFPLKTERSSSGL  428

Query  440  IEFPNISQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGAWNNATNEGMIEKENE  499
            IEF NISQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGAWNNA +EGMIEKENE
Sbjct  429  IEFSNISQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGAWNNAASEGMIEKENE  488

Query  500  VEVKQDVYN  508
            V+ K D+YN
Sbjct  489  VDTKVDIYN  497



Lambda      K        H
   0.312    0.126    0.350 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 36770632136


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jan 6, 2022  5:17 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_014085235.1 PREDICTED: heterogeneous nuclear ribonucleoprotein L
isoform X7 [Bactrocera oleae]

Length=504
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A0A0B4K8A1_DROME  unnamed protein product                             853     0.0  
A0A0B4K7I2_DROME  unnamed protein product                             839     0.0  
A0A0B4K7W3_DROME  unnamed protein product                             835     0.0  


>A0A0B4K8A1_DROME unnamed protein product
Length=515

 Score = 853 bits (2205),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/488 (86%), Positives = 437/488 (90%), Gaps = 29/488 (6%)

Query  24   QSQQQALLNKSNDDLRRKRPETTRPNHILLFTIINPFYPITVDVLHKICHPHGQVLRIVI  83
            ++QQQAL+NKSNDDLRRKRPETTRPNHILLFTIINPFYPITVDVLHKICHPHGQVLRIVI
Sbjct  50   RNQQQALMNKSNDDLRRKRPETTRPNHILLFTIINPFYPITVDVLHKICHPHGQVLRIVI  109

Query  84   FKKNGVQAMVEFDSLEAATRARENLNGADIYSGCCTLKIDYAKPEKLNVYKNEPDTSWDY  143
            FKKNGVQAMVEFD+L+AATRARENLNGADIY+GCCTLKIDYAKPEKLNVYKNEPDTSWDY
Sbjct  110  FKKNGVQAMVEFDNLDAATRARENLNGADIYAGCCTLKIDYAKPEKLNVYKNEPDTSWDY  169

Query  144  TLTA-----VKEIGNGRSPLLQEPLYGTRPQPYSKFQQNSFITTTTNSTIGLISTPTNFC  198
            TL+      +KEIGNGRSPLLQEPLYGTRPQPYSK                L S P N  
Sbjct  170  TLSTGEILPIKEIGNGRSPLLQEPLYGTRPQPYSK---------------SLFSIPENVV  214

Query  199  QFK-EPPLLGPGAAFPPFGAAEFHPTTPENWKGATIHPTGLMKEPA-VVPGRNAPVTFAT  256
              + +PPLLGPGAAFPPFGA E+H TTPENWKGA IHPTGLMKEPA VVPGRNAPV F  
Sbjct  215  MLESQPPLLGPGAAFPPFGAPEYHTTTPENWKGAAIHPTGLMKEPAGVVPGRNAPVAFTP  274

Query  257  QAQGQDIIPSLQGAVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMGD  316
            Q Q Q       GAVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMGD
Sbjct  275  QGQAQ-------GAVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMGD  327

Query  317  SVAVERCVQHLNNIPVGNGGKIQIAFSKQNFLSEVINPFLLPDHTPSFKEYTGSKNNRFL  376
            +VAVERCVQHLNNIPVG GGKIQIAFSKQNFLSEVINPFLLPDH+PSFKEYTGSKNNRFL
Sbjct  328  AVAVERCVQHLNNIPVGTGGKIQIAFSKQNFLSEVINPFLLPDHSPSFKEYTGSKNNRFL  387

Query  377  SPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIFNIKEVPATSVRLFPLKTERSSSGLI  436
            SPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIFNIK+VPATSVRLFPLKTERSSSGLI
Sbjct  388  SPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIFNIKDVPATSVRLFPLKTERSSSGLI  447

Query  437  EFPNISQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGAWNNATNEGMIEKENEV  496
            EF NISQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGAWNNA +EGMIEKENEV
Sbjct  448  EFSNISQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGAWNNAASEGMIEKENEV  507

Query  497  EVKQDVYN  504
            + K D+YN
Sbjct  508  DTKVDIYN  515


>A0A0B4K7I2_DROME unnamed protein product
Length=552

 Score = 839 bits (2168),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/506 (82%), Positives = 431/506 (85%), Gaps = 31/506 (6%)

Query  23   QQSQQQALLNKSNDDLRRKRPETTRPNHILLFTIINPFYPITVDVLHKICHPHGQVLRIV  82
            QQ+QQQAL+NKSNDDLRRKRPETTRPNHILLFTIINPFYPITVDVLHKICHPHGQVLRIV
Sbjct  54   QQNQQQALMNKSNDDLRRKRPETTRPNHILLFTIINPFYPITVDVLHKICHPHGQVLRIV  113

Query  83   IFKKNGVQAMVEFDSLEAATRARENLNGADIYSGCCTLKIDYAKPEKLNVYKNEPDTSWD  142
            IFKKNGVQAMVEFD+L+AATRARENLNGADIY+GCCTLKIDYAKPEKLNVYKNEPDTSWD
Sbjct  114  IFKKNGVQAMVEFDNLDAATRARENLNGADIYAGCCTLKIDYAKPEKLNVYKNEPDTSWD  173

Query  143  YTLTAVKEIGNGRSPLLQEPLY-GTRPQPYSKFQQNSFITTTTNSTIGLI----------  191
            YTL+ VKEIGNGRSPLLQEPLY  T   P                               
Sbjct  174  YTLSTVKEIGNGRSPLLQEPLYVATLSTPQQHVSHQHHHHLRQQQQQQHQQQAPQQQPHP  233

Query  192  ------------STPTNFCQFKEPPLLGPGAAFPPFGAAEFHPTTPENWKGATIHPTGLM  239
                        +   N  QFKEPPLLGPGAAFPPFGA E+H TTPENWKGA IHPTGLM
Sbjct  234  QHLHHQQQLVAPAQSHNLYQFKEPPLLGPGAAFPPFGAPEYHTTTPENWKGAAIHPTGLM  293

Query  240  KEPA-VVPGRNAPVTFATQAQGQDIIPSLQGAVMMVYGLDHDTSNTDKLFNLVCLYGNVA  298
            KEPA VVPGRNAPV F  Q Q Q       GAVMMVYGLDHDTSNTDKLFNLVCLYGNVA
Sbjct  294  KEPAGVVPGRNAPVAFTPQGQAQ-------GAVMMVYGLDHDTSNTDKLFNLVCLYGNVA  346

Query  299  RIKFLKTKEGTAMVQMGDSVAVERCVQHLNNIPVGNGGKIQIAFSKQNFLSEVINPFLLP  358
            RIKFLKTKEGTAMVQMGD+VAVERCVQHLNNIPVG GGKIQIAFSKQNFLSEVINPFLLP
Sbjct  347  RIKFLKTKEGTAMVQMGDAVAVERCVQHLNNIPVGTGGKIQIAFSKQNFLSEVINPFLLP  406

Query  359  DHTPSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIFNIKEVPA  418
            DH+PSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIFNIK+VPA
Sbjct  407  DHSPSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIFNIKDVPA  466

Query  419  TSVRLFPLKTERSSSGLIEFPNISQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMN  478
            TSVRLFPLKTERSSSGLIEF NISQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMN
Sbjct  467  TSVRLFPLKTERSSSGLIEFSNISQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMN  526

Query  479  GAWNNATNEGMIEKENEVEVKQDVYN  504
            GAWNNA +EGMIEKENEV+ K D+YN
Sbjct  527  GAWNNAASEGMIEKENEVDTKVDIYN  552


>A0A0B4K7W3_DROME unnamed protein product
Length=492

 Score = 835 bits (2157),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/483 (85%), Positives = 424/483 (88%), Gaps = 45/483 (9%)

Query  23   QQSQQQALLNKSNDDLRRKRPETTRPNHILLFTIINPFYPITVDVLHKICHPHGQVLRIV  82
            QQ+QQQAL+NKSNDDLRRKRPETTRPNHILLFTIINPFYPITVDVLHKICHPHGQVLRIV
Sbjct  54   QQNQQQALMNKSNDDLRRKRPETTRPNHILLFTIINPFYPITVDVLHKICHPHGQVLRIV  113

Query  83   IFKKNGVQAMVEFDSLEAATRARENLNGADIYSGCCTLKIDYAKPEKLNVYKNEPDTSWD  142
            IFKKNGVQAMVEFD+L+AATRARENLNGADIY+GCCTLKIDYAKPEKLNVYKNEPDTSWD
Sbjct  114  IFKKNGVQAMVEFDNLDAATRARENLNGADIYAGCCTLKIDYAKPEKLNVYKNEPDTSWD  173

Query  143  YTLTAVKEIGNGRSPLLQEPLYGTRPQPYSKFQQNSFITTTTNSTIGLISTPTNFCQFKE  202
            YTL+ VKEIGNGRSPLLQEPLY                                     E
Sbjct  174  YTLSTVKEIGNGRSPLLQEPLY-------------------------------------E  196

Query  203  PPLLGPGAAFPPFGAAEFHPTTPENWKGATIHPTGLMKEPA-VVPGRNAPVTFATQAQGQ  261
            PPLLGPGAAFPPFGA E+H TTPENWKGA IHPTGLMKEPA VVPGRNAPV F  Q Q Q
Sbjct  197  PPLLGPGAAFPPFGAPEYHTTTPENWKGAAIHPTGLMKEPAGVVPGRNAPVAFTPQGQAQ  256

Query  262  DIIPSLQGAVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMGDSVAVE  321
                   GAVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMGD+VAVE
Sbjct  257  -------GAVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMGDAVAVE  309

Query  322  RCVQHLNNIPVGNGGKIQIAFSKQNFLSEVINPFLLPDHTPSFKEYTGSKNNRFLSPAQA  381
            RCVQHLNNIPVG GGKIQIAFSKQNFLSEVINPFLLPDH+PSFKEYTGSKNNRFLSPAQA
Sbjct  310  RCVQHLNNIPVGTGGKIQIAFSKQNFLSEVINPFLLPDHSPSFKEYTGSKNNRFLSPAQA  369

Query  382  SKNRIQPPSKILHFFNTPPGLTEDQLIGIFNIKEVPATSVRLFPLKTERSSSGLIEFPNI  441
            SKNRIQPPSKILHFFNTPPGLTEDQLIGIFNIK+VPATSVRLFPLKTERSSSGLIEF NI
Sbjct  370  SKNRIQPPSKILHFFNTPPGLTEDQLIGIFNIKDVPATSVRLFPLKTERSSSGLIEFSNI  429

Query  442  SQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGAWNNATNEGMIEKENEVEVKQD  501
            SQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGAWNNA +EGMIEKENEV+ K D
Sbjct  430  SQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGAWNNAASEGMIEKENEVDTKVD  489

Query  502  VYN  504
            +YN
Sbjct  490  IYN  492



Lambda      K        H
   0.318    0.135    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5751125414


Query= XP_014085236.1 PREDICTED: heterogeneous nuclear ribonucleoprotein L
isoform X8 [Bactrocera oleae]

Length=492
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A0A0B4K7I6_DROME  unnamed protein product                             864     0.0  
A0A0B4K7H8_DROME  unnamed protein product                             860     0.0  
A0A0B4K7W3_DROME  unnamed protein product                             859     0.0  


>A0A0B4K7I6_DROME unnamed protein product
Length=491

 Score = 864 bits (2233),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/475 (88%), Positives = 438/475 (92%), Gaps = 10/475 (2%)

Query  21   ISDGPQNKKIRTGVQQPGEADAHLHARAVVQQSQQQALLNKSNDDLRRKRPETTRPNHIL  80
            +++GPQNKKIRTGVQQPGE D H+HAR+  QQ+QQQAL+NKSNDDLRRKRPETTRPNHIL
Sbjct  24   VTEGPQNKKIRTGVQQPGENDVHMHARSTPQQNQQQALMNKSNDDLRRKRPETTRPNHIL  83

Query  81   LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFDSLEAATRARENLNGAD  140
            LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFD+L+AATRARENLNGAD
Sbjct  84   LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFDNLDAATRARENLNGAD  143

Query  141  IYSGCCTLKIDYAKPEKLNVYKNEPDTSWDYTL-TAVGLISTPTNFCQFK-EPPLLGPGA  198
            IY+GCCTLKIDYAKPEKLNVYKNEPDTSWDYTL T   L S P N    + +PPLLGPGA
Sbjct  144  IYAGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLSTGKSLFSIPENVVMLESQPPLLGPGA  203

Query  199  AFPPFGAAEFHPTTPENWKGATIHPTGLMKEPA-VVPGRNAPVTFATQAQGQDIIPSLQG  257
            AFPPFGA E+H TTPENWKGA IHPTGLMKEPA VVPGRNAPV F  Q Q Q       G
Sbjct  204  AFPPFGAPEYHTTTPENWKGAAIHPTGLMKEPAGVVPGRNAPVAFTPQGQAQ-------G  256

Query  258  AVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMGDSVAVERCVQHLNN  317
            AVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMGD+VAVERCVQHLNN
Sbjct  257  AVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMGDAVAVERCVQHLNN  316

Query  318  IPVGNGGKIQIAFSKQNFLSEVINPFLLPDHTPSFKEYTGSKNNRFLSPAQASKNRIQPP  377
            IPVG GGKIQIAFSKQNFLSEVINPFLLPDH+PSFKEYTGSKNNRFLSPAQASKNRIQPP
Sbjct  317  IPVGTGGKIQIAFSKQNFLSEVINPFLLPDHSPSFKEYTGSKNNRFLSPAQASKNRIQPP  376

Query  378  SKILHFFNTPPGLTEDQLIGIFNIKEVPATSVRLFPLKTERSSSGLIEFPNISQAVLAIM  437
            SKILHFFNTPPGLTEDQLIGIFNIK+VPATSVRLFPLKTERSSSGLIEF NISQAVLAIM
Sbjct  377  SKILHFFNTPPGLTEDQLIGIFNIKDVPATSVRLFPLKTERSSSGLIEFSNISQAVLAIM  436

Query  438  KCNHLPIEGKGTKFPFIMKLCFSSSKSMNGAWNNATNEGMIEKENEVEVKQDVYN  492
            KCNHLPIEGKGTKFPFIMKLCFSSSKSMNGAWNNA +EGMIEKENEV+ K D+YN
Sbjct  437  KCNHLPIEGKGTKFPFIMKLCFSSSKSMNGAWNNAASEGMIEKENEVDTKVDIYN  491


>A0A0B4K7H8_DROME unnamed protein product
Length=535

 Score = 860 bits (2222),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/519 (82%), Positives = 442/519 (85%), Gaps = 54/519 (10%)

Query  21   ISDGPQNKKIRTGVQQPGEADAHLHARAVVQQSQQQALLNKSNDDLRRKRPETTRPNHIL  80
            +++GPQNKKIRTGVQQPGE D H+HAR+  QQ+QQQAL+NKSNDDLRRKRPETTRPNHIL
Sbjct  24   VTEGPQNKKIRTGVQQPGENDVHMHARSTPQQNQQQALMNKSNDDLRRKRPETTRPNHIL  83

Query  81   LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFDSLEAATRARENLNGAD  140
            LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFD+L+AATRARENLNGAD
Sbjct  84   LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFDNLDAATRARENLNGAD  143

Query  141  IYSGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLTAVGLISTPT-----------------  183
            IY+GCCTLKIDYAKPEKLNVYKNEPDTSWDYTL+ V  +STP                  
Sbjct  144  IYAGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLSTVATLSTPQQHVSHQHHHHLRQQQQQ  203

Query  184  -----------------------------NFCQFKEPPLLGPGAAFPPFGAAEFHPTTPE  214
                                         N  QFKEPPLLGPGAAFPPFGA E+H TTPE
Sbjct  204  QHQQQAPQQQPHPQHLHHQQQLVAPAQSHNLYQFKEPPLLGPGAAFPPFGAPEYHTTTPE  263

Query  215  NWKGATIHPTGLMKEPA-VVPGRNAPVTFATQAQGQDIIPSLQGAVMMVYGLDHDTSNTD  273
            NWKGA IHPTGLMKEPA VVPGRNAPV F  Q Q Q       GAVMMVYGLDHDTSNTD
Sbjct  264  NWKGAAIHPTGLMKEPAGVVPGRNAPVAFTPQGQAQ-------GAVMMVYGLDHDTSNTD  316

Query  274  KLFNLVCLYGNVARIKFLKTKEGTAMVQMGDSVAVERCVQHLNNIPVGNGGKIQIAFSKQ  333
            KLFNLVCLYGNVARIKFLKTKEGTAMVQMGD+VAVERCVQHLNNIPVG GGKIQIAFSKQ
Sbjct  317  KLFNLVCLYGNVARIKFLKTKEGTAMVQMGDAVAVERCVQHLNNIPVGTGGKIQIAFSKQ  376

Query  334  NFLSEVINPFLLPDHTPSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTED  393
            NFLSEVINPFLLPDH+PSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTED
Sbjct  377  NFLSEVINPFLLPDHSPSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTED  436

Query  394  QLIGIFNIKEVPATSVRLFPLKTERSSSGLIEFPNISQAVLAIMKCNHLPIEGKGTKFPF  453
            QLIGIFNIK+VPATSVRLFPLKTERSSSGLIEF NISQAVLAIMKCNHLPIEGKGTKFPF
Sbjct  437  QLIGIFNIKDVPATSVRLFPLKTERSSSGLIEFSNISQAVLAIMKCNHLPIEGKGTKFPF  496

Query  454  IMKLCFSSSKSMNGAWNNATNEGMIEKENEVEVKQDVYN  492
            IMKLCFSSSKSMNGAWNNA +EGMIEKENEV+ K D+YN
Sbjct  497  IMKLCFSSSKSMNGAWNNAASEGMIEKENEVDTKVDIYN  535


>A0A0B4K7W3_DROME unnamed protein product
Length=492

 Score = 859 bits (2220),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/476 (88%), Positives = 437/476 (92%), Gaps = 11/476 (2%)

Query  21   ISDGPQNKKIRTGVQQPGEADAHLHARAVVQQSQQQALLNKSNDDLRRKRPETTRPNHIL  80
            +++GPQNKKIRTGVQQPGE D H+HAR+  QQ+QQQAL+NKSNDDLRRKRPETTRPNHIL
Sbjct  24   VTEGPQNKKIRTGVQQPGENDVHMHARSTPQQNQQQALMNKSNDDLRRKRPETTRPNHIL  83

Query  81   LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFDSLEAATRARENLNGAD  140
            LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFD+L+AATRARENLNGAD
Sbjct  84   LFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFDNLDAATRARENLNGAD  143

Query  141  IYSGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLTAVGLI---STPTNFCQFKEPPLLGPG  197
            IY+GCCTLKIDYAKPEKLNVYKNEPDTSWDYTL+ V  I    +P       EPPLLGPG
Sbjct  144  IYAGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLSTVKEIGNGRSPLLQEPLYEPPLLGPG  203

Query  198  AAFPPFGAAEFHPTTPENWKGATIHPTGLMKEPA-VVPGRNAPVTFATQAQGQDIIPSLQ  256
            AAFPPFGA E+H TTPENWKGA IHPTGLMKEPA VVPGRNAPV F  Q Q Q       
Sbjct  204  AAFPPFGAPEYHTTTPENWKGAAIHPTGLMKEPAGVVPGRNAPVAFTPQGQAQ-------  256

Query  257  GAVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMGDSVAVERCVQHLN  316
            GAVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMGD+VAVERCVQHLN
Sbjct  257  GAVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMGDAVAVERCVQHLN  316

Query  317  NIPVGNGGKIQIAFSKQNFLSEVINPFLLPDHTPSFKEYTGSKNNRFLSPAQASKNRIQP  376
            NIPVG GGKIQIAFSKQNFLSEVINPFLLPDH+PSFKEYTGSKNNRFLSPAQASKNRIQP
Sbjct  317  NIPVGTGGKIQIAFSKQNFLSEVINPFLLPDHSPSFKEYTGSKNNRFLSPAQASKNRIQP  376

Query  377  PSKILHFFNTPPGLTEDQLIGIFNIKEVPATSVRLFPLKTERSSSGLIEFPNISQAVLAI  436
            PSKILHFFNTPPGLTEDQLIGIFNIK+VPATSVRLFPLKTERSSSGLIEF NISQAVLAI
Sbjct  377  PSKILHFFNTPPGLTEDQLIGIFNIKDVPATSVRLFPLKTERSSSGLIEFSNISQAVLAI  436

Query  437  MKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGAWNNATNEGMIEKENEVEVKQDVYN  492
            MKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGAWNNA +EGMIEKENEV+ K D+YN
Sbjct  437  MKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGAWNNAASEGMIEKENEVDTKVDIYN  492



Lambda      K        H
   0.318    0.135    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5751125414


Query= XP_014085237.1 PREDICTED: uncharacterized protein LOC106614181
[Bactrocera oleae]

Length=124
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

YQ53_CAEEL  unnamed protein product                                   28.1    2.0  
TUB1_CAEEL  unnamed protein product                                   27.7    3.2  
Q8IIF4_PLAF7  unnamed protein product                                 27.3    4.3  


>YQ53_CAEEL unnamed protein product
Length=1032

 Score = 28.1 bits (61),  Expect = 2.0, Method: Composition-based stats.
 Identities = 14/50 (28%), Positives = 26/50 (52%), Gaps = 0/50 (0%)

Query  67   YMQAKNQLLVLKRNEWSLLCKRKHREHCVLLPEYILITIVFSCRKKFHNI  116
            Y+Q + +  + K +E+   C R ++EH   LP  I+I  V +    F+ +
Sbjct  790  YLQTQKEYKLQKLDEFFPKCVRSYKEHSKTLPTRIVIYRVGAGEGNFNRV  839


>TUB1_CAEEL unnamed protein product
Length=426

 Score = 27.7 bits (60),  Expect = 3.2, Method: Composition-based stats.
 Identities = 16/53 (30%), Positives = 24/53 (45%), Gaps = 4/53 (8%)

Query  40   EDCVRYCGMDRPSCAIVAGLDKGSAPKYMQAKNQLLVLKRNEWSLLCKRKHRE  92
            E C+  C + R      +G+DKG  P Y     +    KR +  LL  RK ++
Sbjct  177  EHCLYKCSITRQK----SGVDKGMFPTYFLHLEEFDTDKRQKIFLLAARKRKK  225


>Q8IIF4_PLAF7 unnamed protein product
Length=1675

 Score = 27.3 bits (59),  Expect = 4.3, Method: Composition-based stats.
 Identities = 14/42 (33%), Positives = 26/42 (62%), Gaps = 2/42 (5%)

Query  66    KYMQAKNQLL--VLKRNEWSLLCKRKHREHCVLLPEYILITI  105
             +Y+  +N+ L  +LKRN  ++L +   R+HC+ L E ++  I
Sbjct  1535  EYLGRRNEFLEKILKRNISNILYECISRKHCLFLLEVLMKKI  1576



Lambda      K        H
   0.318    0.135    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5751125414


Query= XP_014085238.1 PREDICTED: DNA repair protein complementing XP-A
cells homolog [Bactrocera oleae]

Length=280
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

XPA_DROME  unnamed protein product                                    387     1e-136
Q21302_CAEEL  unnamed protein product                                 159     8e-48 
Q557Q0_DICDI  unnamed protein product                                 35.4    0.059 


>XPA_DROME unnamed protein product
Length=296

 Score = 387 bits (994),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 186/281 (66%), Positives = 222/281 (79%), Gaps = 13/281 (5%)

Query  9    FTEAEKARMERNRIKALHLRQAKLVAYPYRK----KNGSTNTDQ-----DSIIKVQGTKY  59
             T A+KAR+ERN+ KA  LR+AKLV++P+++    K G T+ +       S+IKVQGTKY
Sbjct  20   LTNAQKARIERNQAKAQKLREAKLVSHPFKELASNKEGGTHPEAALSQGSSVIKVQGTKY  79

Query  60   IDSGGGFLLEQPVIKTAESSGNIENGSGGSNTDIVKVFNDAINIPVNYEECLECGDAFVE  119
            IDSGGGFLLEQPV+ T    G    G   S  +   + +DAI IPV YEECLECGD F +
Sbjct  80   IDSGGGFLLEQPVMPT----GVGPAGLNKSGEEAPPILDDAIAIPVQYEECLECGDMFAD  135

Query  120  SYLFSNFGEAVCDKCRDPDGRHSLITRTEAKAEYLLKDCDFDKREPPLRYISRKNPHNVR  179
            SYLF+NFG +VCDKCRD D R++LITRTEAKAEYLLKDCDFDKREP LRYISRKNPHNVR
Sbjct  136  SYLFNNFGHSVCDKCRDKDERYALITRTEAKAEYLLKDCDFDKREPKLRYISRKNPHNVR  195

Query  180  WGEMKLYLLMQVEKRAMDVWVSEEELSRQHELREEKREVTKVKKYNKQMKQLRMEIRSSL  239
            WGEMKLYL +Q+ +RA++VW SEEEL RQHE RE+KRE  K +KYNK+MKQLRME+RSS+
Sbjct  196  WGEMKLYLHLQIHQRALEVWGSEEELVRQHEAREDKREEGKARKYNKKMKQLRMEVRSSI  255

Query  240  FTKKTKSIHEHDFGPDTYNENEDNYTHTCKTCSYAETYEKM  280
            +TKKT  +HEH+FGPDTY+E ED YTHTC TC Y+ETYEKM
Sbjct  256  YTKKTHEVHEHEFGPDTYDEEEDTYTHTCITCPYSETYEKM  296


>Q21302_CAEEL unnamed protein product
Length=241

 Score = 159 bits (403),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 83/182 (46%), Positives = 115/182 (63%), Gaps = 2/182 (1%)

Query  100  AINIPVNYEECLECGDAFVESYLFSNFGEAVCDKCRDPDGRHSLITRTEAKAEYLLKDCD  159
            A N+    E C +C    ++S+L+  +  AVCD CRD  G H L+ RTE K  YLLKDCD
Sbjct  61   AHNLIQAPENCEKCDKGLMDSWLWERYNCAVCDACRDDKGEHKLLARTEVKNTYLLKDCD  120

Query  160  FDKREPPLRYISRKNPHNVRWGEMKLYLLMQVEKRAMDVWVSEEELSRQHELREEKREVT  219
             D R+P LRY ++KNPHN R+G+MKLYL  Q+E R ++V  S E+L  + ELRE+ +EV 
Sbjct  121  LDLRKPKLRYWAKKNPHNPRYGDMKLYLKCQIETRVLEVHGSWEDLELKKELREQSKEVR  180

Query  220  KVKKYNKQMKQLRMEIRSSLFTK-KTKSIHEHDFGPDTYNENEDNYTHTCKTCSYAETYE  278
              K++ K++K LR +IR +   K      H H+FG +T+ E ED +  TC TC Y E +E
Sbjct  181  SEKRFEKKLKDLRQQIRGTSGVKVDFGRPHTHEFGKETHVE-EDTWRRTCITCEYEEVFE  239

Query  279  KM  280
            K+
Sbjct  240  KL  241


>Q557Q0_DICDI unnamed protein product
Length=5630

 Score = 35.4 bits (80),  Expect = 0.059, Method: Compositional matrix adjust.
 Identities = 18/61 (30%), Positives = 33/61 (54%), Gaps = 3/61 (5%)

Query  105   VNYEECLECGDAFVESYL-FSNFGEAVCDKCRDPDGRHSLITRTEAKAEYLLKDCDFDKR  163
             +N  + L   D F+ SYL F  +  ++      P+  +  + + ++ +E +LKDC+FD R
Sbjct  4910  INVNQVLSLCDIFINSYLGFRYYYSSIIPDPVQPNNDY--LIQFKSISESILKDCEFDIR  4967

Query  164   E  164
             E
Sbjct  4968  E  4968



Lambda      K        H
   0.318    0.135    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5751125414


Query= XP_014085239.1 PREDICTED: latrophilin Cirl isoform X1 [Bactrocera
oleae]

Length=1798
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

LPLT1_CAEEL  unnamed protein product                                  173     2e-43
LPLT2_CAEEL  unnamed protein product                                  172     1e-42
LPHN_DROME  unnamed protein product                                   102     3e-21


>LPLT1_CAEEL unnamed protein product
Length=1014

 Score = 173 bits (439),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 174/751 (23%), Positives = 307/751 (41%), Gaps = 151/751 (20%)

Query  335   LNMGLGAVAEDESNMFCGPTNARNLFWNITRVGDVNVQPCPGGATGIAKWRCVLMKRVNY  394
             LN  +    + + ++FC  TN R + W  T+ G  +  PCP G++G   W          
Sbjct  168   LNSDVIKPVKKKEDVFCSATNRRGVNWQNTKSGTTSSAPCPEGSSGKQLW----------  217

Query  395   KEEDAGAAETTTMRAIPRANCSSSNANSSCENAADRLNQRIGNFEPTWHPMTPDLTQCRS  454
                                         +C              E  W    P+   C S
Sbjct  218   ----------------------------ACTE------------EGQWLTEFPNSAGCES  237

Query  455   LWLNSLEVRVNQRESSVISIANDLSEV---------TSSKTLYGGDML----VTTKIIQT  501
              W++S     N   S VIS + D+S +          + + + GGD+     +  K +  
Sbjct  238   NWISSR----NSVLSGVIS-SEDVSGLPEFLRNLGSETRRPMVGGDLPKVLHLLEKTVNV  292

Query  502   MSEKMF-HDKETLPDQRQREAIILELLHGVVKTGSNLLDESQLSSWMDLNQEDQMRV-AT  559
             ++E+ + +    L ++   E +   L +  +    ++    + +S   L  E  M   A 
Sbjct  293   IAEESWAYQHLPLSNKGAVEVMNYMLRNQEIWGSWDVTKRKEFASRFILAAEKAMVASAK  352

Query  560   SLLTGLEYNAFLLADTIIRERNIVQKVKNILLSVRVLETKNIQGNEVFPDLEQWQISD-D  618
              ++T  E N             IVQ    + +S ++  +       +FP    W   + D
Sbjct  353   GMMTSAESNV------------IVQPAITVEISHKIKMSSQPTDYILFPSAALWNGQNVD  400

Query  619   RIELPRTALVENSEGGLVRIVFAAFDRLESILKPSYDHFDTKSSRSYVRNTALLASERND  678
              + +PR A+++ ++    ++ F++FD L + + PS                     +   
Sbjct  401   NVNIPRDAILKINKDE-TQVFFSSFDNLGAQMTPS---------------------DVTV  438

Query  679   SGASADLQQQRIRILNSKVISASL---GKGRHIQ-ISQPIKLVLRHIKT--ENVTNPTCV  732
             + A  D  + R R + S+++ ASL   GK R ++ ++QP+++   H ++   +++NPTCV
Sbjct  439   AIAGTDQTEVRKRRVVSRIVGASLIENGKERRVENLTQPVRITFYHKESSVRHLSNPTCV  498

Query  733   FWNYIDHAWSANGCTLESTNRTHSICMCNHLTNFAILMDVMDEHNHSLFGVFDGNMRILI  792
             +WN+ +  W  +GC L   N+T + C C HLT+FA+LMDV     H L  +    + +L 
Sbjct  499   WWNHHELKWKPSGCKLSYHNKTMTSCDCTHLTHFAVLMDV---RGHDLNEIDQTLLTLLT  555

Query  793   YISVAICLVFVVIALLTLKIF--NGVFIKSARTSIYRSIYICLLFIEILFLIGIEQNETS  850
             Y+   I ++ +++      IF  NG      R  I+ ++ + L   EI FL GI + E S
Sbjct  556   YVGCIISIICLLLTFFAYLIFSRNG----GDRVFIHENLCLSLAIAEITFLAGITRTEDS  611

Query  851   ILCGFTTVFLHCSILSAIAWFCFEAFQSYSTLTTDDMLLEVDQTS-KVNCYYLLSYGLSL  909
             + CG   V L    LSA+ W   E +  +       ML EV  +  +   Y L+ Y    
Sbjct  612   LQCGIIAVALMYMFLSALTWMLLEGYHIHR------MLTEVFPSDPRRFTYLLVGYIPPA  665

Query  910   TIVAISLVINPNTYTQNDFCVLMEANTLFYSSFVAPVLLFFLGALGYTFLSWVIMCRKSH  969
              I  ++ + N + +   D C L   N   +         FF G   + F +  ++  K+ 
Sbjct  666   IITLVAYLYNSDGFGTPDHCWLSTQNNFIW---------FFAGPACFIFCANSLVLVKTL  716

Query  970   TTLKNKEHTRLANVRFD----------IRCSFIFLLLLSAVWISAYYYLRLAKVEDDLAV  1019
              T+           R D          ++ S     LL   WI   ++     VED  ++
Sbjct  717   CTVYQHTSGGYLPCRHDVDSGRSIRNWVKGSLALASLLGVTWIFGLFW-----VEDSRSI  771

Query  1020  VCGYLFISFNTLMGLYIFVFHCIQNEKIRRE  1050
             V  Y+F   N+L GL+IF+FH +  EK+R++
Sbjct  772   VMAYVFTISNSLQGLFIFLFHVVFAEKMRKD  802


 Score = 71.2 bits (173),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 50/94 (53%), Gaps = 2/94 (2%)

Query  16   CEGKKLTIECDPGDLINLIRANYGRFSITIC-NDHGNVEWSVNCMFPKSLTVLNSKCAHK  74
            C+G+   + C  G +I+++  NYGRFS+ +C  D+  V  ++NC   K+ ++L  KC   
Sbjct  44   CDGEAAELSCPAGKVISIVLGNYGRFSVAVCLPDNDIVPSNINCQNHKTKSILEKKCNGD  103

Query  75   QSCSVLATTSMFG-DPCPGTHKYLEAHYQCISAA  107
              C        F  DPCP T KYLE  Y C+  A
Sbjct  104  SMCYFTVDKKTFTEDPCPNTPKYLEVKYNCVVPA  137


>LPLT2_CAEEL unnamed protein product
Length=1338

 Score = 172 bits (435),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 99/370 (27%), Positives = 185/370 (50%), Gaps = 24/370 (6%)

Query  692   ILNSKVISASLGKGRH---IQISQPIKLVLRHIKTENVTNPTCVFWNYIDHAWSANGCTL  748
             ++NS+VI AS+        + +  P+    +H+ T+ V+NP CV+W+ ++  WS  GCTL
Sbjct  799   LINSQVIGASIQNATQSVTLPVDHPVTFTFQHLTTKGVSNPRCVYWDLMESKWSTLGCTL  858

Query  749   ESTNRTHSICMCNHLTNFAILMDVMDEHNHSLFGVFDGNMRILIYISVAICLVFVVIALL  808
              +T+   S C C HLT+FAILMD+  +    L G     + ++  I  AI +V + +++ 
Sbjct  859   IATSSNSSQCSCTHLTSFAILMDISGQVGR-LSGGLASALDVVSTIGCAISIVCLALSVC  917

Query  809   TLKIFNGVFIKSARTSIYRSIYICLLFIEILFLIGIEQNETSILCGFTTVFLHCSILSAI  868
                 F    +++ R SI+R++ +CLL  E++F+IG+++      CG   + LH   LS+ 
Sbjct  918   VFTFFRN--LQNVRNSIHRNLCLCLLIAELVFVIGMDRTGNRTGCGVVAILLHYFFLSSF  975

Query  869   AWFCFEAFQSYSTLTTDDMLLEVDQ--TSKVNCYYLLSYGLSLTIVAISLVINPNTYTQN  926
              W   E +Q Y       ML++V +   +++  YYL  YG    +VAIS  I    Y  +
Sbjct  976   CWMLLEGYQLYM------MLIQVFEPNRTRIFLYYLFCYGTPAVVVAISAGIKWEDYGTD  1029

Query  927   DFCVLMEANTLFYSSFVAPVLLFFLGALGYTFLSWVIMCRKSHTTLKNKEHTRLANVRFD  986
              +C +  +    ++       +  +  +    + ++++  K   ++++++ T+   +   
Sbjct  1030  SYCWIDTSTPTIWA------FVAPIIVIIAANIIFLLIALKVVLSVQSRDRTKWGRIIGW  1083

Query  987   IRCSFIFLLLLSAVWISAYYYLRLAKVEDDLAVVCGYLFISFNTLMGLYIFVFHCIQNEK  1046
             ++ S   L LL   WI  +    L  V+        ++F   N   G++IFV H + NEK
Sbjct  1084  LKGSATLLCLLGITWIFGF----LTAVKGGTGTAFAWIFTILNCTQGIFIFVLHVVLNEK  1139

Query  1047  IRREYRKYVR  1056
             +R    +++R
Sbjct  1140  VRASIVRWLR  1149


 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 65/143 (45%), Gaps = 2/143 (1%)

Query  446  TPDLTQCRSLWLNSLE--VRVNQRESSVISIANDLSEVTSSKTLYGGDMLVTTKIIQTMS  503
            TPD T C   W+  +E  ++ NQ    + S  N   + T  +TL+GGD+  T ++   M 
Sbjct  528  TPDTTNCTHRWVAEMETAIKDNQPVEDISSTVNRQLKSTIERTLFGGDITGTVRLSNDML  587

Query  504  EKMFHDKETLPDQRQREAIILELLHGVVKTGSNLLDESQLSSWMDLNQEDQMRVATSLLT  563
                +    L D+  RE         +  +G  LL     + W  L+   +++ A+ L++
Sbjct  588  SLARNQFSVLNDRNLRENKARNFTENLGGSGDQLLSPVAATVWDQLSSTIRIQHASKLMS  647

Query  564  GLEYNAFLLADTIIRERNIVQKV  586
             LE +  LL D +  ++  +Q +
Sbjct  648  VLEQSVLLLGDYMTDQKLNLQYI  670


>LPHN_DROME unnamed protein product
Length=1697

 Score = 102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 77/195 (39%), Positives = 104/195 (53%), Gaps = 38/195 (19%)

Query  1624  PQGDERMRRLIALQDEEFQRRFQKQRKKAEASLNDKT---AAAAYFDHHNAAASSGAAVF  1680
             PQ DERMRRL+A+QDE+F+RRFQ+Q +K  A L+       A    +H+ A       V 
Sbjct  1521  PQSDERMRRLMAMQDEDFKRRFQRQLRKHGAPLDYGALPPGAGPQPEHNGAVFGVSGGVG  1580

Query  1681  GISGGGSGGASSIRAIKKISPNNRIGVHELFTTTHNSSGAANVGGGGSGLGPPLPPANQQ  1740
               S  G+      +A+   SP  R+ V+ELF            G G SG  PPLPPANQ 
Sbjct  1581  EGSLRGAFRQQQQQALNAKSPGGRLAVNELF------------GHGNSG--PPLPPANQT  1626

Query  1741  QAQQQQYPLSKRQQLSPTTLTAATTPSSS-----HTQPIIG------------RNISAML  1783
              AQ++Q    + Q+LSP + T++++ +S      H   +              R++SAML
Sbjct  1627  PAQKRQ----QLQKLSPQSTTSSSSHTSHSNPNPHPHQLTHPHPHQHPPHHQQRHLSAML  1682

Query  1784  DENNTVRCYLEPLPK  1798
             DENNTVRCYLEPL K
Sbjct  1683  DENNTVRCYLEPLAK  1697



Lambda      K        H
   0.318    0.135    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5751125414


Query= XP_014085240.1 PREDICTED: latrophilin Cirl isoform X1 [Bactrocera
oleae]

Length=1798
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

LPLT1_CAEEL  unnamed protein product                                  173     2e-43
LPLT2_CAEEL  unnamed protein product                                  172     1e-42
LPHN_DROME  unnamed protein product                                   102     3e-21


>LPLT1_CAEEL unnamed protein product
Length=1014

 Score = 173 bits (439),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 174/751 (23%), Positives = 307/751 (41%), Gaps = 151/751 (20%)

Query  335   LNMGLGAVAEDESNMFCGPTNARNLFWNITRVGDVNVQPCPGGATGIAKWRCVLMKRVNY  394
             LN  +    + + ++FC  TN R + W  T+ G  +  PCP G++G   W          
Sbjct  168   LNSDVIKPVKKKEDVFCSATNRRGVNWQNTKSGTTSSAPCPEGSSGKQLW----------  217

Query  395   KEEDAGAAETTTMRAIPRANCSSSNANSSCENAADRLNQRIGNFEPTWHPMTPDLTQCRS  454
                                         +C              E  W    P+   C S
Sbjct  218   ----------------------------ACTE------------EGQWLTEFPNSAGCES  237

Query  455   LWLNSLEVRVNQRESSVISIANDLSEV---------TSSKTLYGGDML----VTTKIIQT  501
              W++S     N   S VIS + D+S +          + + + GGD+     +  K +  
Sbjct  238   NWISSR----NSVLSGVIS-SEDVSGLPEFLRNLGSETRRPMVGGDLPKVLHLLEKTVNV  292

Query  502   MSEKMF-HDKETLPDQRQREAIILELLHGVVKTGSNLLDESQLSSWMDLNQEDQMRV-AT  559
             ++E+ + +    L ++   E +   L +  +    ++    + +S   L  E  M   A 
Sbjct  293   IAEESWAYQHLPLSNKGAVEVMNYMLRNQEIWGSWDVTKRKEFASRFILAAEKAMVASAK  352

Query  560   SLLTGLEYNAFLLADTIIRERNIVQKVKNILLSVRVLETKNIQGNEVFPDLEQWQISD-D  618
              ++T  E N             IVQ    + +S ++  +       +FP    W   + D
Sbjct  353   GMMTSAESNV------------IVQPAITVEISHKIKMSSQPTDYILFPSAALWNGQNVD  400

Query  619   RIELPRTALVENSEGGLVRIVFAAFDRLESILKPSYDHFDTKSSRSYVRNTALLASERND  678
              + +PR A+++ ++    ++ F++FD L + + PS                     +   
Sbjct  401   NVNIPRDAILKINKDE-TQVFFSSFDNLGAQMTPS---------------------DVTV  438

Query  679   SGASADLQQQRIRILNSKVISASL---GKGRHIQ-ISQPIKLVLRHIKT--ENVTNPTCV  732
             + A  D  + R R + S+++ ASL   GK R ++ ++QP+++   H ++   +++NPTCV
Sbjct  439   AIAGTDQTEVRKRRVVSRIVGASLIENGKERRVENLTQPVRITFYHKESSVRHLSNPTCV  498

Query  733   FWNYIDHAWSANGCTLESTNRTHSICMCNHLTNFAILMDVMDEHNHSLFGVFDGNMRILI  792
             +WN+ +  W  +GC L   N+T + C C HLT+FA+LMDV     H L  +    + +L 
Sbjct  499   WWNHHELKWKPSGCKLSYHNKTMTSCDCTHLTHFAVLMDV---RGHDLNEIDQTLLTLLT  555

Query  793   YISVAICLVFVVIALLTLKIF--NGVFIKSARTSIYRSIYICLLFIEILFLIGIEQNETS  850
             Y+   I ++ +++      IF  NG      R  I+ ++ + L   EI FL GI + E S
Sbjct  556   YVGCIISIICLLLTFFAYLIFSRNG----GDRVFIHENLCLSLAIAEITFLAGITRTEDS  611

Query  851   ILCGFTTVFLHCSILSAIAWFCFEAFQSYSTLTTDDMLLEVDQTS-KVNCYYLLSYGLSL  909
             + CG   V L    LSA+ W   E +  +       ML EV  +  +   Y L+ Y    
Sbjct  612   LQCGIIAVALMYMFLSALTWMLLEGYHIHR------MLTEVFPSDPRRFTYLLVGYIPPA  665

Query  910   TIVAISLVINPNTYTQNDFCVLMEANTLFYSSFVAPVLLFFLGALGYTFLSWVIMCRKSH  969
              I  ++ + N + +   D C L   N   +         FF G   + F +  ++  K+ 
Sbjct  666   IITLVAYLYNSDGFGTPDHCWLSTQNNFIW---------FFAGPACFIFCANSLVLVKTL  716

Query  970   TTLKNKEHTRLANVRFD----------IRCSFIFLLLLSAVWISAYYYLRLAKVEDDLAV  1019
              T+           R D          ++ S     LL   WI   ++     VED  ++
Sbjct  717   CTVYQHTSGGYLPCRHDVDSGRSIRNWVKGSLALASLLGVTWIFGLFW-----VEDSRSI  771

Query  1020  VCGYLFISFNTLMGLYIFVFHCIQNEKIRRE  1050
             V  Y+F   N+L GL+IF+FH +  EK+R++
Sbjct  772   VMAYVFTISNSLQGLFIFLFHVVFAEKMRKD  802


 Score = 71.2 bits (173),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 50/94 (53%), Gaps = 2/94 (2%)

Query  16   CEGKKLTIECDPGDLINLIRANYGRFSITIC-NDHGNVEWSVNCMFPKSLTVLNSKCAHK  74
            C+G+   + C  G +I+++  NYGRFS+ +C  D+  V  ++NC   K+ ++L  KC   
Sbjct  44   CDGEAAELSCPAGKVISIVLGNYGRFSVAVCLPDNDIVPSNINCQNHKTKSILEKKCNGD  103

Query  75   QSCSVLATTSMFG-DPCPGTHKYLEAHYQCISAA  107
              C        F  DPCP T KYLE  Y C+  A
Sbjct  104  SMCYFTVDKKTFTEDPCPNTPKYLEVKYNCVVPA  137


>LPLT2_CAEEL unnamed protein product
Length=1338

 Score = 172 bits (435),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 99/370 (27%), Positives = 185/370 (50%), Gaps = 24/370 (6%)

Query  692   ILNSKVISASLGKGRH---IQISQPIKLVLRHIKTENVTNPTCVFWNYIDHAWSANGCTL  748
             ++NS+VI AS+        + +  P+    +H+ T+ V+NP CV+W+ ++  WS  GCTL
Sbjct  799   LINSQVIGASIQNATQSVTLPVDHPVTFTFQHLTTKGVSNPRCVYWDLMESKWSTLGCTL  858

Query  749   ESTNRTHSICMCNHLTNFAILMDVMDEHNHSLFGVFDGNMRILIYISVAICLVFVVIALL  808
              +T+   S C C HLT+FAILMD+  +    L G     + ++  I  AI +V + +++ 
Sbjct  859   IATSSNSSQCSCTHLTSFAILMDISGQVGR-LSGGLASALDVVSTIGCAISIVCLALSVC  917

Query  809   TLKIFNGVFIKSARTSIYRSIYICLLFIEILFLIGIEQNETSILCGFTTVFLHCSILSAI  868
                 F    +++ R SI+R++ +CLL  E++F+IG+++      CG   + LH   LS+ 
Sbjct  918   VFTFFRN--LQNVRNSIHRNLCLCLLIAELVFVIGMDRTGNRTGCGVVAILLHYFFLSSF  975

Query  869   AWFCFEAFQSYSTLTTDDMLLEVDQ--TSKVNCYYLLSYGLSLTIVAISLVINPNTYTQN  926
              W   E +Q Y       ML++V +   +++  YYL  YG    +VAIS  I    Y  +
Sbjct  976   CWMLLEGYQLYM------MLIQVFEPNRTRIFLYYLFCYGTPAVVVAISAGIKWEDYGTD  1029

Query  927   DFCVLMEANTLFYSSFVAPVLLFFLGALGYTFLSWVIMCRKSHTTLKNKEHTRLANVRFD  986
              +C +  +    ++       +  +  +    + ++++  K   ++++++ T+   +   
Sbjct  1030  SYCWIDTSTPTIWA------FVAPIIVIIAANIIFLLIALKVVLSVQSRDRTKWGRIIGW  1083

Query  987   IRCSFIFLLLLSAVWISAYYYLRLAKVEDDLAVVCGYLFISFNTLMGLYIFVFHCIQNEK  1046
             ++ S   L LL   WI  +    L  V+        ++F   N   G++IFV H + NEK
Sbjct  1084  LKGSATLLCLLGITWIFGF----LTAVKGGTGTAFAWIFTILNCTQGIFIFVLHVVLNEK  1139

Query  1047  IRREYRKYVR  1056
             +R    +++R
Sbjct  1140  VRASIVRWLR  1149


 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 65/143 (45%), Gaps = 2/143 (1%)

Query  446  TPDLTQCRSLWLNSLE--VRVNQRESSVISIANDLSEVTSSKTLYGGDMLVTTKIIQTMS  503
            TPD T C   W+  +E  ++ NQ    + S  N   + T  +TL+GGD+  T ++   M 
Sbjct  528  TPDTTNCTHRWVAEMETAIKDNQPVEDISSTVNRQLKSTIERTLFGGDITGTVRLSNDML  587

Query  504  EKMFHDKETLPDQRQREAIILELLHGVVKTGSNLLDESQLSSWMDLNQEDQMRVATSLLT  563
                +    L D+  RE         +  +G  LL     + W  L+   +++ A+ L++
Sbjct  588  SLARNQFSVLNDRNLRENKARNFTENLGGSGDQLLSPVAATVWDQLSSTIRIQHASKLMS  647

Query  564  GLEYNAFLLADTIIRERNIVQKV  586
             LE +  LL D +  ++  +Q +
Sbjct  648  VLEQSVLLLGDYMTDQKLNLQYI  670


>LPHN_DROME unnamed protein product
Length=1697

 Score = 102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 77/195 (39%), Positives = 104/195 (53%), Gaps = 38/195 (19%)

Query  1624  PQGDERMRRLIALQDEEFQRRFQKQRKKAEASLNDKT---AAAAYFDHHNAAASSGAAVF  1680
             PQ DERMRRL+A+QDE+F+RRFQ+Q +K  A L+       A    +H+ A       V 
Sbjct  1521  PQSDERMRRLMAMQDEDFKRRFQRQLRKHGAPLDYGALPPGAGPQPEHNGAVFGVSGGVG  1580

Query  1681  GISGGGSGGASSIRAIKKISPNNRIGVHELFTTTHNSSGAANVGGGGSGLGPPLPPANQQ  1740
               S  G+      +A+   SP  R+ V+ELF            G G SG  PPLPPANQ 
Sbjct  1581  EGSLRGAFRQQQQQALNAKSPGGRLAVNELF------------GHGNSG--PPLPPANQT  1626

Query  1741  QAQQQQYPLSKRQQLSPTTLTAATTPSSS-----HTQPIIG------------RNISAML  1783
              AQ++Q    + Q+LSP + T++++ +S      H   +              R++SAML
Sbjct  1627  PAQKRQ----QLQKLSPQSTTSSSSHTSHSNPNPHPHQLTHPHPHQHPPHHQQRHLSAML  1682

Query  1784  DENNTVRCYLEPLPK  1798
             DENNTVRCYLEPL K
Sbjct  1683  DENNTVRCYLEPLAK  1697



Lambda      K        H
   0.318    0.135    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5751125414


Query= XP_014085241.1 PREDICTED: latrophilin Cirl isoform X1 [Bactrocera
oleae]

Length=1798
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

LPLT1_CAEEL  unnamed protein product                                  173     2e-43
LPLT2_CAEEL  unnamed protein product                                  172     1e-42
LPHN_DROME  unnamed protein product                                   102     3e-21


>LPLT1_CAEEL unnamed protein product
Length=1014

 Score = 173 bits (439),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 174/751 (23%), Positives = 307/751 (41%), Gaps = 151/751 (20%)

Query  335   LNMGLGAVAEDESNMFCGPTNARNLFWNITRVGDVNVQPCPGGATGIAKWRCVLMKRVNY  394
             LN  +    + + ++FC  TN R + W  T+ G  +  PCP G++G   W          
Sbjct  168   LNSDVIKPVKKKEDVFCSATNRRGVNWQNTKSGTTSSAPCPEGSSGKQLW----------  217

Query  395   KEEDAGAAETTTMRAIPRANCSSSNANSSCENAADRLNQRIGNFEPTWHPMTPDLTQCRS  454
                                         +C              E  W    P+   C S
Sbjct  218   ----------------------------ACTE------------EGQWLTEFPNSAGCES  237

Query  455   LWLNSLEVRVNQRESSVISIANDLSEV---------TSSKTLYGGDML----VTTKIIQT  501
              W++S     N   S VIS + D+S +          + + + GGD+     +  K +  
Sbjct  238   NWISSR----NSVLSGVIS-SEDVSGLPEFLRNLGSETRRPMVGGDLPKVLHLLEKTVNV  292

Query  502   MSEKMF-HDKETLPDQRQREAIILELLHGVVKTGSNLLDESQLSSWMDLNQEDQMRV-AT  559
             ++E+ + +    L ++   E +   L +  +    ++    + +S   L  E  M   A 
Sbjct  293   IAEESWAYQHLPLSNKGAVEVMNYMLRNQEIWGSWDVTKRKEFASRFILAAEKAMVASAK  352

Query  560   SLLTGLEYNAFLLADTIIRERNIVQKVKNILLSVRVLETKNIQGNEVFPDLEQWQISD-D  618
              ++T  E N             IVQ    + +S ++  +       +FP    W   + D
Sbjct  353   GMMTSAESNV------------IVQPAITVEISHKIKMSSQPTDYILFPSAALWNGQNVD  400

Query  619   RIELPRTALVENSEGGLVRIVFAAFDRLESILKPSYDHFDTKSSRSYVRNTALLASERND  678
              + +PR A+++ ++    ++ F++FD L + + PS                     +   
Sbjct  401   NVNIPRDAILKINKDE-TQVFFSSFDNLGAQMTPS---------------------DVTV  438

Query  679   SGASADLQQQRIRILNSKVISASL---GKGRHIQ-ISQPIKLVLRHIKT--ENVTNPTCV  732
             + A  D  + R R + S+++ ASL   GK R ++ ++QP+++   H ++   +++NPTCV
Sbjct  439   AIAGTDQTEVRKRRVVSRIVGASLIENGKERRVENLTQPVRITFYHKESSVRHLSNPTCV  498

Query  733   FWNYIDHAWSANGCTLESTNRTHSICMCNHLTNFAILMDVMDEHNHSLFGVFDGNMRILI  792
             +WN+ +  W  +GC L   N+T + C C HLT+FA+LMDV     H L  +    + +L 
Sbjct  499   WWNHHELKWKPSGCKLSYHNKTMTSCDCTHLTHFAVLMDV---RGHDLNEIDQTLLTLLT  555

Query  793   YISVAICLVFVVIALLTLKIF--NGVFIKSARTSIYRSIYICLLFIEILFLIGIEQNETS  850
             Y+   I ++ +++      IF  NG      R  I+ ++ + L   EI FL GI + E S
Sbjct  556   YVGCIISIICLLLTFFAYLIFSRNG----GDRVFIHENLCLSLAIAEITFLAGITRTEDS  611

Query  851   ILCGFTTVFLHCSILSAIAWFCFEAFQSYSTLTTDDMLLEVDQTS-KVNCYYLLSYGLSL  909
             + CG   V L    LSA+ W   E +  +       ML EV  +  +   Y L+ Y    
Sbjct  612   LQCGIIAVALMYMFLSALTWMLLEGYHIHR------MLTEVFPSDPRRFTYLLVGYIPPA  665

Query  910   TIVAISLVINPNTYTQNDFCVLMEANTLFYSSFVAPVLLFFLGALGYTFLSWVIMCRKSH  969
              I  ++ + N + +   D C L   N   +         FF G   + F +  ++  K+ 
Sbjct  666   IITLVAYLYNSDGFGTPDHCWLSTQNNFIW---------FFAGPACFIFCANSLVLVKTL  716

Query  970   TTLKNKEHTRLANVRFD----------IRCSFIFLLLLSAVWISAYYYLRLAKVEDDLAV  1019
              T+           R D          ++ S     LL   WI   ++     VED  ++
Sbjct  717   CTVYQHTSGGYLPCRHDVDSGRSIRNWVKGSLALASLLGVTWIFGLFW-----VEDSRSI  771

Query  1020  VCGYLFISFNTLMGLYIFVFHCIQNEKIRRE  1050
             V  Y+F   N+L GL+IF+FH +  EK+R++
Sbjct  772   VMAYVFTISNSLQGLFIFLFHVVFAEKMRKD  802


 Score = 71.2 bits (173),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 50/94 (53%), Gaps = 2/94 (2%)

Query  16   CEGKKLTIECDPGDLINLIRANYGRFSITIC-NDHGNVEWSVNCMFPKSLTVLNSKCAHK  74
            C+G+   + C  G +I+++  NYGRFS+ +C  D+  V  ++NC   K+ ++L  KC   
Sbjct  44   CDGEAAELSCPAGKVISIVLGNYGRFSVAVCLPDNDIVPSNINCQNHKTKSILEKKCNGD  103

Query  75   QSCSVLATTSMFG-DPCPGTHKYLEAHYQCISAA  107
              C        F  DPCP T KYLE  Y C+  A
Sbjct  104  SMCYFTVDKKTFTEDPCPNTPKYLEVKYNCVVPA  137


>LPLT2_CAEEL unnamed protein product
Length=1338

 Score = 172 bits (435),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 99/370 (27%), Positives = 185/370 (50%), Gaps = 24/370 (6%)

Query  692   ILNSKVISASLGKGRH---IQISQPIKLVLRHIKTENVTNPTCVFWNYIDHAWSANGCTL  748
             ++NS+VI AS+        + +  P+    +H+ T+ V+NP CV+W+ ++  WS  GCTL
Sbjct  799   LINSQVIGASIQNATQSVTLPVDHPVTFTFQHLTTKGVSNPRCVYWDLMESKWSTLGCTL  858

Query  749   ESTNRTHSICMCNHLTNFAILMDVMDEHNHSLFGVFDGNMRILIYISVAICLVFVVIALL  808
              +T+   S C C HLT+FAILMD+  +    L G     + ++  I  AI +V + +++ 
Sbjct  859   IATSSNSSQCSCTHLTSFAILMDISGQVGR-LSGGLASALDVVSTIGCAISIVCLALSVC  917

Query  809   TLKIFNGVFIKSARTSIYRSIYICLLFIEILFLIGIEQNETSILCGFTTVFLHCSILSAI  868
                 F    +++ R SI+R++ +CLL  E++F+IG+++      CG   + LH   LS+ 
Sbjct  918   VFTFFRN--LQNVRNSIHRNLCLCLLIAELVFVIGMDRTGNRTGCGVVAILLHYFFLSSF  975

Query  869   AWFCFEAFQSYSTLTTDDMLLEVDQ--TSKVNCYYLLSYGLSLTIVAISLVINPNTYTQN  926
              W   E +Q Y       ML++V +   +++  YYL  YG    +VAIS  I    Y  +
Sbjct  976   CWMLLEGYQLYM------MLIQVFEPNRTRIFLYYLFCYGTPAVVVAISAGIKWEDYGTD  1029

Query  927   DFCVLMEANTLFYSSFVAPVLLFFLGALGYTFLSWVIMCRKSHTTLKNKEHTRLANVRFD  986
              +C +  +    ++       +  +  +    + ++++  K   ++++++ T+   +   
Sbjct  1030  SYCWIDTSTPTIWA------FVAPIIVIIAANIIFLLIALKVVLSVQSRDRTKWGRIIGW  1083

Query  987   IRCSFIFLLLLSAVWISAYYYLRLAKVEDDLAVVCGYLFISFNTLMGLYIFVFHCIQNEK  1046
             ++ S   L LL   WI  +    L  V+        ++F   N   G++IFV H + NEK
Sbjct  1084  LKGSATLLCLLGITWIFGF----LTAVKGGTGTAFAWIFTILNCTQGIFIFVLHVVLNEK  1139

Query  1047  IRREYRKYVR  1056
             +R    +++R
Sbjct  1140  VRASIVRWLR  1149


 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 65/143 (45%), Gaps = 2/143 (1%)

Query  446  TPDLTQCRSLWLNSLE--VRVNQRESSVISIANDLSEVTSSKTLYGGDMLVTTKIIQTMS  503
            TPD T C   W+  +E  ++ NQ    + S  N   + T  +TL+GGD+  T ++   M 
Sbjct  528  TPDTTNCTHRWVAEMETAIKDNQPVEDISSTVNRQLKSTIERTLFGGDITGTVRLSNDML  587

Query  504  EKMFHDKETLPDQRQREAIILELLHGVVKTGSNLLDESQLSSWMDLNQEDQMRVATSLLT  563
                +    L D+  RE         +  +G  LL     + W  L+   +++ A+ L++
Sbjct  588  SLARNQFSVLNDRNLRENKARNFTENLGGSGDQLLSPVAATVWDQLSSTIRIQHASKLMS  647

Query  564  GLEYNAFLLADTIIRERNIVQKV  586
             LE +  LL D +  ++  +Q +
Sbjct  648  VLEQSVLLLGDYMTDQKLNLQYI  670


>LPHN_DROME unnamed protein product
Length=1697

 Score = 102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 77/195 (39%), Positives = 104/195 (53%), Gaps = 38/195 (19%)

Query  1624  PQGDERMRRLIALQDEEFQRRFQKQRKKAEASLNDKT---AAAAYFDHHNAAASSGAAVF  1680
             PQ DERMRRL+A+QDE+F+RRFQ+Q +K  A L+       A    +H+ A       V 
Sbjct  1521  PQSDERMRRLMAMQDEDFKRRFQRQLRKHGAPLDYGALPPGAGPQPEHNGAVFGVSGGVG  1580

Query  1681  GISGGGSGGASSIRAIKKISPNNRIGVHELFTTTHNSSGAANVGGGGSGLGPPLPPANQQ  1740
               S  G+      +A+   SP  R+ V+ELF            G G SG  PPLPPANQ 
Sbjct  1581  EGSLRGAFRQQQQQALNAKSPGGRLAVNELF------------GHGNSG--PPLPPANQT  1626

Query  1741  QAQQQQYPLSKRQQLSPTTLTAATTPSSS-----HTQPIIG------------RNISAML  1783
              AQ++Q    + Q+LSP + T++++ +S      H   +              R++SAML
Sbjct  1627  PAQKRQ----QLQKLSPQSTTSSSSHTSHSNPNPHPHQLTHPHPHQHPPHHQQRHLSAML  1682

Query  1784  DENNTVRCYLEPLPK  1798
             DENNTVRCYLEPL K
Sbjct  1683  DENNTVRCYLEPLAK  1697



Lambda      K        H
   0.318    0.135    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5751125414


Query= XP_014085242.1 PREDICTED: latrophilin Cirl isoform X1 [Bactrocera
oleae]

Length=1798
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

LPLT1_CAEEL  unnamed protein product                                  173     2e-43
LPLT2_CAEEL  unnamed protein product                                  172     1e-42
LPHN_DROME  unnamed protein product                                   102     3e-21


>LPLT1_CAEEL unnamed protein product
Length=1014

 Score = 173 bits (439),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 174/751 (23%), Positives = 307/751 (41%), Gaps = 151/751 (20%)

Query  335   LNMGLGAVAEDESNMFCGPTNARNLFWNITRVGDVNVQPCPGGATGIAKWRCVLMKRVNY  394
             LN  +    + + ++FC  TN R + W  T+ G  +  PCP G++G   W          
Sbjct  168   LNSDVIKPVKKKEDVFCSATNRRGVNWQNTKSGTTSSAPCPEGSSGKQLW----------  217

Query  395   KEEDAGAAETTTMRAIPRANCSSSNANSSCENAADRLNQRIGNFEPTWHPMTPDLTQCRS  454
                                         +C              E  W    P+   C S
Sbjct  218   ----------------------------ACTE------------EGQWLTEFPNSAGCES  237

Query  455   LWLNSLEVRVNQRESSVISIANDLSEV---------TSSKTLYGGDML----VTTKIIQT  501
              W++S     N   S VIS + D+S +          + + + GGD+     +  K +  
Sbjct  238   NWISSR----NSVLSGVIS-SEDVSGLPEFLRNLGSETRRPMVGGDLPKVLHLLEKTVNV  292

Query  502   MSEKMF-HDKETLPDQRQREAIILELLHGVVKTGSNLLDESQLSSWMDLNQEDQMRV-AT  559
             ++E+ + +    L ++   E +   L +  +    ++    + +S   L  E  M   A 
Sbjct  293   IAEESWAYQHLPLSNKGAVEVMNYMLRNQEIWGSWDVTKRKEFASRFILAAEKAMVASAK  352

Query  560   SLLTGLEYNAFLLADTIIRERNIVQKVKNILLSVRVLETKNIQGNEVFPDLEQWQISD-D  618
              ++T  E N             IVQ    + +S ++  +       +FP    W   + D
Sbjct  353   GMMTSAESNV------------IVQPAITVEISHKIKMSSQPTDYILFPSAALWNGQNVD  400

Query  619   RIELPRTALVENSEGGLVRIVFAAFDRLESILKPSYDHFDTKSSRSYVRNTALLASERND  678
              + +PR A+++ ++    ++ F++FD L + + PS                     +   
Sbjct  401   NVNIPRDAILKINKDE-TQVFFSSFDNLGAQMTPS---------------------DVTV  438

Query  679   SGASADLQQQRIRILNSKVISASL---GKGRHIQ-ISQPIKLVLRHIKT--ENVTNPTCV  732
             + A  D  + R R + S+++ ASL   GK R ++ ++QP+++   H ++   +++NPTCV
Sbjct  439   AIAGTDQTEVRKRRVVSRIVGASLIENGKERRVENLTQPVRITFYHKESSVRHLSNPTCV  498

Query  733   FWNYIDHAWSANGCTLESTNRTHSICMCNHLTNFAILMDVMDEHNHSLFGVFDGNMRILI  792
             +WN+ +  W  +GC L   N+T + C C HLT+FA+LMDV     H L  +    + +L 
Sbjct  499   WWNHHELKWKPSGCKLSYHNKTMTSCDCTHLTHFAVLMDV---RGHDLNEIDQTLLTLLT  555

Query  793   YISVAICLVFVVIALLTLKIF--NGVFIKSARTSIYRSIYICLLFIEILFLIGIEQNETS  850
             Y+   I ++ +++      IF  NG      R  I+ ++ + L   EI FL GI + E S
Sbjct  556   YVGCIISIICLLLTFFAYLIFSRNG----GDRVFIHENLCLSLAIAEITFLAGITRTEDS  611

Query  851   ILCGFTTVFLHCSILSAIAWFCFEAFQSYSTLTTDDMLLEVDQTS-KVNCYYLLSYGLSL  909
             + CG   V L    LSA+ W   E +  +       ML EV  +  +   Y L+ Y    
Sbjct  612   LQCGIIAVALMYMFLSALTWMLLEGYHIHR------MLTEVFPSDPRRFTYLLVGYIPPA  665

Query  910   TIVAISLVINPNTYTQNDFCVLMEANTLFYSSFVAPVLLFFLGALGYTFLSWVIMCRKSH  969
              I  ++ + N + +   D C L   N   +         FF G   + F +  ++  K+ 
Sbjct  666   IITLVAYLYNSDGFGTPDHCWLSTQNNFIW---------FFAGPACFIFCANSLVLVKTL  716

Query  970   TTLKNKEHTRLANVRFD----------IRCSFIFLLLLSAVWISAYYYLRLAKVEDDLAV  1019
              T+           R D          ++ S     LL   WI   ++     VED  ++
Sbjct  717   CTVYQHTSGGYLPCRHDVDSGRSIRNWVKGSLALASLLGVTWIFGLFW-----VEDSRSI  771

Query  1020  VCGYLFISFNTLMGLYIFVFHCIQNEKIRRE  1050
             V  Y+F   N+L GL+IF+FH +  EK+R++
Sbjct  772   VMAYVFTISNSLQGLFIFLFHVVFAEKMRKD  802


 Score = 71.2 bits (173),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 50/94 (53%), Gaps = 2/94 (2%)

Query  16   CEGKKLTIECDPGDLINLIRANYGRFSITIC-NDHGNVEWSVNCMFPKSLTVLNSKCAHK  74
            C+G+   + C  G +I+++  NYGRFS+ +C  D+  V  ++NC   K+ ++L  KC   
Sbjct  44   CDGEAAELSCPAGKVISIVLGNYGRFSVAVCLPDNDIVPSNINCQNHKTKSILEKKCNGD  103

Query  75   QSCSVLATTSMFG-DPCPGTHKYLEAHYQCISAA  107
              C        F  DPCP T KYLE  Y C+  A
Sbjct  104  SMCYFTVDKKTFTEDPCPNTPKYLEVKYNCVVPA  137


>LPLT2_CAEEL unnamed protein product
Length=1338

 Score = 172 bits (435),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 99/370 (27%), Positives = 185/370 (50%), Gaps = 24/370 (6%)

Query  692   ILNSKVISASLGKGRH---IQISQPIKLVLRHIKTENVTNPTCVFWNYIDHAWSANGCTL  748
             ++NS+VI AS+        + +  P+    +H+ T+ V+NP CV+W+ ++  WS  GCTL
Sbjct  799   LINSQVIGASIQNATQSVTLPVDHPVTFTFQHLTTKGVSNPRCVYWDLMESKWSTLGCTL  858

Query  749   ESTNRTHSICMCNHLTNFAILMDVMDEHNHSLFGVFDGNMRILIYISVAICLVFVVIALL  808
              +T+   S C C HLT+FAILMD+  +    L G     + ++  I  AI +V + +++ 
Sbjct  859   IATSSNSSQCSCTHLTSFAILMDISGQVGR-LSGGLASALDVVSTIGCAISIVCLALSVC  917

Query  809   TLKIFNGVFIKSARTSIYRSIYICLLFIEILFLIGIEQNETSILCGFTTVFLHCSILSAI  868
                 F    +++ R SI+R++ +CLL  E++F+IG+++      CG   + LH   LS+ 
Sbjct  918   VFTFFRN--LQNVRNSIHRNLCLCLLIAELVFVIGMDRTGNRTGCGVVAILLHYFFLSSF  975

Query  869   AWFCFEAFQSYSTLTTDDMLLEVDQ--TSKVNCYYLLSYGLSLTIVAISLVINPNTYTQN  926
              W   E +Q Y       ML++V +   +++  YYL  YG    +VAIS  I    Y  +
Sbjct  976   CWMLLEGYQLYM------MLIQVFEPNRTRIFLYYLFCYGTPAVVVAISAGIKWEDYGTD  1029

Query  927   DFCVLMEANTLFYSSFVAPVLLFFLGALGYTFLSWVIMCRKSHTTLKNKEHTRLANVRFD  986
              +C +  +    ++       +  +  +    + ++++  K   ++++++ T+   +   
Sbjct  1030  SYCWIDTSTPTIWA------FVAPIIVIIAANIIFLLIALKVVLSVQSRDRTKWGRIIGW  1083

Query  987   IRCSFIFLLLLSAVWISAYYYLRLAKVEDDLAVVCGYLFISFNTLMGLYIFVFHCIQNEK  1046
             ++ S   L LL   WI  +    L  V+        ++F   N   G++IFV H + NEK
Sbjct  1084  LKGSATLLCLLGITWIFGF----LTAVKGGTGTAFAWIFTILNCTQGIFIFVLHVVLNEK  1139

Query  1047  IRREYRKYVR  1056
             +R    +++R
Sbjct  1140  VRASIVRWLR  1149


 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 65/143 (45%), Gaps = 2/143 (1%)

Query  446  TPDLTQCRSLWLNSLE--VRVNQRESSVISIANDLSEVTSSKTLYGGDMLVTTKIIQTMS  503
            TPD T C   W+  +E  ++ NQ    + S  N   + T  +TL+GGD+  T ++   M 
Sbjct  528  TPDTTNCTHRWVAEMETAIKDNQPVEDISSTVNRQLKSTIERTLFGGDITGTVRLSNDML  587

Query  504  EKMFHDKETLPDQRQREAIILELLHGVVKTGSNLLDESQLSSWMDLNQEDQMRVATSLLT  563
                +    L D+  RE         +  +G  LL     + W  L+   +++ A+ L++
Sbjct  588  SLARNQFSVLNDRNLRENKARNFTENLGGSGDQLLSPVAATVWDQLSSTIRIQHASKLMS  647

Query  564  GLEYNAFLLADTIIRERNIVQKV  586
             LE +  LL D +  ++  +Q +
Sbjct  648  VLEQSVLLLGDYMTDQKLNLQYI  670


>LPHN_DROME unnamed protein product
Length=1697

 Score = 102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 77/195 (39%), Positives = 104/195 (53%), Gaps = 38/195 (19%)

Query  1624  PQGDERMRRLIALQDEEFQRRFQKQRKKAEASLNDKT---AAAAYFDHHNAAASSGAAVF  1680
             PQ DERMRRL+A+QDE+F+RRFQ+Q +K  A L+       A    +H+ A       V 
Sbjct  1521  PQSDERMRRLMAMQDEDFKRRFQRQLRKHGAPLDYGALPPGAGPQPEHNGAVFGVSGGVG  1580

Query  1681  GISGGGSGGASSIRAIKKISPNNRIGVHELFTTTHNSSGAANVGGGGSGLGPPLPPANQQ  1740
               S  G+      +A+   SP  R+ V+ELF            G G SG  PPLPPANQ 
Sbjct  1581  EGSLRGAFRQQQQQALNAKSPGGRLAVNELF------------GHGNSG--PPLPPANQT  1626

Query  1741  QAQQQQYPLSKRQQLSPTTLTAATTPSSS-----HTQPIIG------------RNISAML  1783
              AQ++Q    + Q+LSP + T++++ +S      H   +              R++SAML
Sbjct  1627  PAQKRQ----QLQKLSPQSTTSSSSHTSHSNPNPHPHQLTHPHPHQHPPHHQQRHLSAML  1682

Query  1784  DENNTVRCYLEPLPK  1798
             DENNTVRCYLEPL K
Sbjct  1683  DENNTVRCYLEPLAK  1697



Lambda      K        H
   0.318    0.135    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5751125414


Query= XP_014085243.1 PREDICTED: latrophilin Cirl isoform X2 [Bactrocera
oleae]

Length=1740
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

LPLT1_CAEEL  unnamed protein product                                  172     4e-43
LPLT2_CAEEL  unnamed protein product                                  171     1e-42
LPHN_DROME  unnamed protein product                                   102     3e-21


>LPLT1_CAEEL unnamed protein product
Length=1014

 Score = 172 bits (437),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 174/751 (23%), Positives = 307/751 (41%), Gaps = 151/751 (20%)

Query  277  LNMGLGAVAEDESNMFCGPTNARNLFWNITRVGDVNVQPCPGGATGIAKWRCVLMKRVNY  336
            LN  +    + + ++FC  TN R + W  T+ G  +  PCP G++G   W          
Sbjct  168  LNSDVIKPVKKKEDVFCSATNRRGVNWQNTKSGTTSSAPCPEGSSGKQLW----------  217

Query  337  KEEDAGAAETTTMRAIPRANCSSSNANSSCENAADRLNQRIGNFEPTWHPMTPDLTQCRS  396
                                        +C              E  W    P+   C S
Sbjct  218  ----------------------------ACTE------------EGQWLTEFPNSAGCES  237

Query  397  LWLNSLEVRVNQRESSVISIANDLSEV---------TSSKTLYGGDML----VTTKIIQT  443
             W++S     N   S VIS + D+S +          + + + GGD+     +  K +  
Sbjct  238  NWISSR----NSVLSGVIS-SEDVSGLPEFLRNLGSETRRPMVGGDLPKVLHLLEKTVNV  292

Query  444  MSEKMF-HDKETLPDQRQREAIILELLHGVVKTGSNLLDESQLSSWMDLNQEDQMRV-AT  501
            ++E+ + +    L ++   E +   L +  +    ++    + +S   L  E  M   A 
Sbjct  293  IAEESWAYQHLPLSNKGAVEVMNYMLRNQEIWGSWDVTKRKEFASRFILAAEKAMVASAK  352

Query  502  SLLTGLEYNAFLLADTIIRERNIVQKVKNILLSVRVLETKNIQGNEVFPDLEQWQISD-D  560
             ++T  E N             IVQ    + +S ++  +       +FP    W   + D
Sbjct  353  GMMTSAESNV------------IVQPAITVEISHKIKMSSQPTDYILFPSAALWNGQNVD  400

Query  561  RIELPRTALVENSEGGLVRIVFAAFDRLESILKPSYDHFDTKSSRSYVRNTALLASERND  620
             + +PR A+++ ++    ++ F++FD L + + PS                     +   
Sbjct  401  NVNIPRDAILKINKDE-TQVFFSSFDNLGAQMTPS---------------------DVTV  438

Query  621  SGASADLQQQRIRILNSKVISASL---GKGRHIQ-ISQPIKLVLRHIKT--ENVTNPTCV  674
            + A  D  + R R + S+++ ASL   GK R ++ ++QP+++   H ++   +++NPTCV
Sbjct  439  AIAGTDQTEVRKRRVVSRIVGASLIENGKERRVENLTQPVRITFYHKESSVRHLSNPTCV  498

Query  675  FWNYIDHAWSANGCTLESTNRTHSICMCNHLTNFAILMDVMDEHNHSLFGVFDGNMRILI  734
            +WN+ +  W  +GC L   N+T + C C HLT+FA+LMDV     H L  +    + +L 
Sbjct  499  WWNHHELKWKPSGCKLSYHNKTMTSCDCTHLTHFAVLMDV---RGHDLNEIDQTLLTLLT  555

Query  735  YISVAICLVFVVIALLTLKIF--NGVFIKSARTSIYRSIYICLLFIEILFLIGIEQNETS  792
            Y+   I ++ +++      IF  NG      R  I+ ++ + L   EI FL GI + E S
Sbjct  556  YVGCIISIICLLLTFFAYLIFSRNG----GDRVFIHENLCLSLAIAEITFLAGITRTEDS  611

Query  793  ILCGFTTVFLHCSILSAIAWFCFEAFQSYSTLTTDDMLLEVDQTS-KVNCYYLLSYGLSL  851
            + CG   V L    LSA+ W   E +  +       ML EV  +  +   Y L+ Y    
Sbjct  612  LQCGIIAVALMYMFLSALTWMLLEGYHIHR------MLTEVFPSDPRRFTYLLVGYIPPA  665

Query  852  TIVAISLVINPNTYTQNDFCVLMEANTLFYSSFVAPVLLFFLGALGYTFLSWVIMCRKSH  911
             I  ++ + N + +   D C L   N   +         FF G   + F +  ++  K+ 
Sbjct  666  IITLVAYLYNSDGFGTPDHCWLSTQNNFIW---------FFAGPACFIFCANSLVLVKTL  716

Query  912  TTLKNKEHTRLANVRFD----------IRCSFIFLLLLSAVWISAYYYLRLAKVEDDLAV  961
             T+           R D          ++ S     LL   WI   ++     VED  ++
Sbjct  717  CTVYQHTSGGYLPCRHDVDSGRSIRNWVKGSLALASLLGVTWIFGLFW-----VEDSRSI  771

Query  962  VCGYLFISFNTLMGLYIFVFHCIQNEKIRRE  992
            V  Y+F   N+L GL+IF+FH +  EK+R++
Sbjct  772  VMAYVFTISNSLQGLFIFLFHVVFAEKMRKD  802


 Score = 38.9 bits (89),  Expect = 0.042, Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 22/47 (47%), Gaps = 1/47 (2%)

Query  4    KSLTVLNSKCAHKQSCSVLATTSMFG-DPCPGTHKYLEAHYQCISAA  49
            K+ ++L  KC     C        F  DPCP T KYLE  Y C+  A
Sbjct  91   KTKSILEKKCNGDSMCYFTVDKKTFTEDPCPNTPKYLEVKYNCVVPA  137


>LPLT2_CAEEL unnamed protein product
Length=1338

 Score = 171 bits (434),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 99/370 (27%), Positives = 185/370 (50%), Gaps = 24/370 (6%)

Query  634   ILNSKVISASLGKGRH---IQISQPIKLVLRHIKTENVTNPTCVFWNYIDHAWSANGCTL  690
             ++NS+VI AS+        + +  P+    +H+ T+ V+NP CV+W+ ++  WS  GCTL
Sbjct  799   LINSQVIGASIQNATQSVTLPVDHPVTFTFQHLTTKGVSNPRCVYWDLMESKWSTLGCTL  858

Query  691   ESTNRTHSICMCNHLTNFAILMDVMDEHNHSLFGVFDGNMRILIYISVAICLVFVVIALL  750
              +T+   S C C HLT+FAILMD+  +    L G     + ++  I  AI +V + +++ 
Sbjct  859   IATSSNSSQCSCTHLTSFAILMDISGQVGR-LSGGLASALDVVSTIGCAISIVCLALSVC  917

Query  751   TLKIFNGVFIKSARTSIYRSIYICLLFIEILFLIGIEQNETSILCGFTTVFLHCSILSAI  810
                 F    +++ R SI+R++ +CLL  E++F+IG+++      CG   + LH   LS+ 
Sbjct  918   VFTFFRN--LQNVRNSIHRNLCLCLLIAELVFVIGMDRTGNRTGCGVVAILLHYFFLSSF  975

Query  811   AWFCFEAFQSYSTLTTDDMLLEVDQ--TSKVNCYYLLSYGLSLTIVAISLVINPNTYTQN  868
              W   E +Q Y       ML++V +   +++  YYL  YG    +VAIS  I    Y  +
Sbjct  976   CWMLLEGYQLYM------MLIQVFEPNRTRIFLYYLFCYGTPAVVVAISAGIKWEDYGTD  1029

Query  869   DFCVLMEANTLFYSSFVAPVLLFFLGALGYTFLSWVIMCRKSHTTLKNKEHTRLANVRFD  928
              +C +  +    ++       +  +  +    + ++++  K   ++++++ T+   +   
Sbjct  1030  SYCWIDTSTPTIWA------FVAPIIVIIAANIIFLLIALKVVLSVQSRDRTKWGRIIGW  1083

Query  929   IRCSFIFLLLLSAVWISAYYYLRLAKVEDDLAVVCGYLFISFNTLMGLYIFVFHCIQNEK  988
             ++ S   L LL   WI  +    L  V+        ++F   N   G++IFV H + NEK
Sbjct  1084  LKGSATLLCLLGITWIFGF----LTAVKGGTGTAFAWIFTILNCTQGIFIFVLHVVLNEK  1139

Query  989   IRREYRKYVR  998
             +R    +++R
Sbjct  1140  VRASIVRWLR  1149


 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 65/143 (45%), Gaps = 2/143 (1%)

Query  388  TPDLTQCRSLWLNSLE--VRVNQRESSVISIANDLSEVTSSKTLYGGDMLVTTKIIQTMS  445
            TPD T C   W+  +E  ++ NQ    + S  N   + T  +TL+GGD+  T ++   M 
Sbjct  528  TPDTTNCTHRWVAEMETAIKDNQPVEDISSTVNRQLKSTIERTLFGGDITGTVRLSNDML  587

Query  446  EKMFHDKETLPDQRQREAIILELLHGVVKTGSNLLDESQLSSWMDLNQEDQMRVATSLLT  505
                +    L D+  RE         +  +G  LL     + W  L+   +++ A+ L++
Sbjct  588  SLARNQFSVLNDRNLRENKARNFTENLGGSGDQLLSPVAATVWDQLSSTIRIQHASKLMS  647

Query  506  GLEYNAFLLADTIIRERNIVQKV  528
             LE +  LL D +  ++  +Q +
Sbjct  648  VLEQSVLLLGDYMTDQKLNLQYI  670


>LPHN_DROME unnamed protein product
Length=1697

 Score = 102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 77/195 (39%), Positives = 104/195 (53%), Gaps = 38/195 (19%)

Query  1566  PQGDERMRRLIALQDEEFQRRFQKQRKKAEASLNDKT---AAAAYFDHHNAAASSGAAVF  1622
             PQ DERMRRL+A+QDE+F+RRFQ+Q +K  A L+       A    +H+ A       V 
Sbjct  1521  PQSDERMRRLMAMQDEDFKRRFQRQLRKHGAPLDYGALPPGAGPQPEHNGAVFGVSGGVG  1580

Query  1623  GISGGGSGGASSIRAIKKISPNNRIGVHELFTTTHNSSGAANVGGGGSGLGPPLPPANQQ  1682
               S  G+      +A+   SP  R+ V+ELF            G G SG  PPLPPANQ 
Sbjct  1581  EGSLRGAFRQQQQQALNAKSPGGRLAVNELF------------GHGNSG--PPLPPANQT  1626

Query  1683  QAQQQQYPLSKRQQLSPTTLTAATTPSSS-----HTQPIIG------------RNISAML  1725
              AQ++Q    + Q+LSP + T++++ +S      H   +              R++SAML
Sbjct  1627  PAQKRQ----QLQKLSPQSTTSSSSHTSHSNPNPHPHQLTHPHPHQHPPHHQQRHLSAML  1682

Query  1726  DENNTVRCYLEPLPK  1740
             DENNTVRCYLEPL K
Sbjct  1683  DENNTVRCYLEPLAK  1697



Lambda      K        H
   0.318    0.135    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5751125414


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jan 6, 2022  5:17 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_014085244.1 PREDICTED: latrophilin Cirl isoform X3 [Bactrocera
oleae]

Length=1098
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

LPHN_DROME  unnamed protein product                                   1080    0.0  
LPLT1_CAEEL  unnamed protein product                                  94.0    4e-19
LPLT2_CAEEL  unnamed protein product                                  84.7    3e-16


>LPHN_DROME unnamed protein product
Length=1697

 Score = 1080 bits (2793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 561/841 (67%), Positives = 633/841 (75%), Gaps = 84/841 (10%)

Query  5    ILTPKYQTAYACEGKKLTIECDPGDLINLIRANYGRFSITICNDHGNVEWSVNCMFPKSL  64
            ++  KYQTAYACEGKKLTIECDPGD+INLIRANYGRFSITICNDHGNVEWSVNCMFPKSL
Sbjct  1    MILSKYQTAYACEGKKLTIECDPGDVINLIRANYGRFSITICNDHGNVEWSVNCMFPKSL  60

Query  65   TVLNSKCAHKQSCSVLATTSMFGDPCPGTHKYLEAHYQCISAAQTSTTTNRPSPP-WVLA  123
            +VLNS+CAHKQSC VLA TSMFGDPCPGTHKYLEAHYQCISAAQTSTTTNRPSPP WVL+
Sbjct  61   SVLNSRCAHKQSCGVLAATSMFGDPCPGTHKYLEAHYQCISAAQTSTTTNRPSPPPWVLS  120

Query  124  NNPPLLANGSTLINPSVPLQPQGPGRLPLPANGAIPSSGGSWHTLPPTPG----PPQPT-  178
            N PP+  NGS LI+P        P        G +  SG         PG    PPQ T 
Sbjct  121  NGPPIFGNGSGLIHPPGVGAGAPPPPRLPTLPGVVGISG--------NPGLFNVPPQHTA  172

Query  179  ------------LPGGRLKGNYNTTVIKN--SNRHDGLPPPPPLHHHHHTGHHATAPVEG  224
                        + GGRLKG   +T      + RHDGL                      
Sbjct  173  VTHSTPSSSTTAVGGGRLKGGATSTTTTKHPAGRHDGL------------PPPPQLHHHH  220

Query  225  INVIDSTVGNTRPTAKNDLSTRTPGTNQTKSHVGPSNTTTTPNTRILSGVGGSGTDDGTI  284
             +  + T   T+P      S++ P            N T+  NTRIL+GVGGSGTDDGT+
Sbjct  221  NHHGEDTASPTKP------SSKLPAGG---------NATSPSNTRILTGVGGSGTDDGTL  265

Query  285  LTAKTAQNRGNQQQSTATQQHAAGNNNNNAIGADASGGSNGIRTINNINNLNMGLGAVAE  344
            LT K++ NR      TA            A G+   G  + +RTINNIN LN    +  +
Sbjct  266  LTTKSSPNR---PPGTA------------ASGSVVPGNGSVVRTINNIN-LNAAGMSGGD  309

Query  345  DESNMFCGPTNARNLFWNITRVGDVNVQPCPGGATGIAKWRCVLMKRV---NYKEEDAGA  401
            DES +FCGPT+ARNL+WN+TRVGDVNVQPCPGGA GIAKWRCVLMKR+    Y E D   
Sbjct  310  DESKLFCGPTHARNLYWNMTRVGDVNVQPCPGGAAGIAKWRCVLMKRIPDSGYDEYDDDI  369

Query  402  AETTTMRAIPRANCSSSNANSSCE---NAADRLNQRIGNFEPTWHPMTPDLTQCRSLWLN  458
            + TT   A    +C  ++  SSCE   + A ++NQR+ NFEPTWHP TPDLTQCRSLWLN
Sbjct  370  SSTTP--APSGGDCLHNS--SSCEPPVSMAHKVNQRLRNFEPTWHPATPDLTQCRSLWLN  425

Query  459  SLEVRVNQRESSVISIANDLSEVTSSKTLYGGDMLVTTKIIQTMSEKMFHDKETLPDQRQ  518
            +LE+RVNQR+SS+ISIAND+SEVTSSKTLYGGDMLVTTKIIQT+SEKM HDKET PDQRQ
Sbjct  426  NLEMRVNQRDSSLISIANDMSEVTSSKTLYGGDMLVTTKIIQTVSEKMMHDKETFPDQRQ  485

Query  519  REAIILELLHGVVKTGSNLLDESQLSSWMDLNQEDQMRVATSLLTGLEYNAFLLADTIIR  578
            REA+I+ELLH VVKTGSNLLDESQLSSW+DLN EDQMRVATSLLTGLEYNAFLLADTIIR
Sbjct  486  REAMIMELLHCVVKTGSNLLDESQLSSWLDLNPEDQMRVATSLLTGLEYNAFLLADTIIR  545

Query  579  ERNIVQKVKNILLSVRVLETKNIQGNEVFPDLEQWQISDDRIELPRTALVENSEGGLVRI  638
            ER++VQKVKNILLSVRVLETK IQ + VFPD +QW +S DRIELPR AL++NSEGGLVRI
Sbjct  546  ERSVVQKVKNILLSVRVLETKTIQSSVVFPDSDQWPLSSDRIELPRAALIDNSEGGLVRI  605

Query  639  VFAAFDRLESILKPSYDHFDTKSSRSYVRNTALLASERNDSGASADLQQQRIRILNSKVI  698
            VFAAFDRLESILKPSYDHFD KSSRSYVRNTA+L+   NDS  +A   QQR+RILNSKVI
Sbjct  606  VFAAFDRLESILKPSYDHFDLKSSRSYVRNTAILS---NDSDVNAGEIQQRLRILNSKVI  662

Query  699  SASLGKGRHIQISQPIKLVLRHIKTENVTNPTCVFWNYIDHAWSANGCTLESTNRTHSIC  758
            SASLGKGRHIQ+SQPI L L+H+KTENVTNPTCVFWNYIDHAWSANGC+LESTNRTHS+C
Sbjct  663  SASLGKGRHIQLSQPITLTLKHLKTENVTNPTCVFWNYIDHAWSANGCSLESTNRTHSVC  722

Query  759  MCNHLTNFAILMDVMDEHNHSLFGVFDGNMRILIYISVAICLVFVVIALLTLKIFNGVFI  818
             CNHLTNFAILMDV+DEH HSLF +FDGNMRI IYIS+ IC+VF+VIALLTLK+FNGVF+
Sbjct  723  SCNHLTNFAILMDVVDEHQHSLFTMFDGNMRIFIYISIGICVVFIVIALLTLKLFNGVFV  782

Query  819  K  819
            K
Sbjct  783  K  783


>LPLT1_CAEEL unnamed protein product
Length=1014

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 67/249 (27%), Positives = 123/249 (49%), Gaps = 37/249 (15%)

Query  582  IVQKVKNILLSVRVLETKNIQGNEVFPDLEQWQISD-DRIELPRTALVENSEGGLVRIVF  640
            IVQ    + +S ++  +       +FP    W   + D + +PR A+++ ++    ++ F
Sbjct  363  IVQPAITVEISHKIKMSSQPTDYILFPSAALWNGQNVDNVNIPRDAILKINKDE-TQVFF  421

Query  641  AAFDRLESILKPSYDHFDTKSSRSYVRNTALLASERNDSGASADLQQQRIRILNSKVISA  700
            ++FD L + + PS                     +   + A  D  + R R + S+++ A
Sbjct  422  SSFDNLGAQMTPS---------------------DVTVAIAGTDQTEVRKRRVVSRIVGA  460

Query  701  SL---GKGRHIQ-ISQPIKLVLRHIKT--ENVTNPTCVFWNYIDHAWSANGCTLESTNRT  754
            SL   GK R ++ ++QP+++   H ++   +++NPTCV+WN+ +  W  +GC L   N+T
Sbjct  461  SLIENGKERRVENLTQPVRITFYHKESSVRHLSNPTCVWWNHHELKWKPSGCKLSYHNKT  520

Query  755  HSICMCNHLTNFAILMDVMDEHNHSLFGVFDGNMRILIYISVAICLVFVVIALLTLKIF-  813
             + C C HLT+FA+LMDV     H L  +    + +L Y+   I ++ +++      IF 
Sbjct  521  MTSCDCTHLTHFAVLMDV---RGHDLNEIDQTLLTLLTYVGCIISIICLLLTFFAYLIFS  577

Query  814  -NG---VFI  818
             NG   VFI
Sbjct  578  RNGGDRVFI  586


 Score = 70.9 bits (172),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 50/94 (53%), Gaps = 2/94 (2%)

Query  16   CEGKKLTIECDPGDLINLIRANYGRFSITIC-NDHGNVEWSVNCMFPKSLTVLNSKCAHK  74
            C+G+   + C  G +I+++  NYGRFS+ +C  D+  V  ++NC   K+ ++L  KC   
Sbjct  44   CDGEAAELSCPAGKVISIVLGNYGRFSVAVCLPDNDIVPSNINCQNHKTKSILEKKCNGD  103

Query  75   QSCSVLATTSMFG-DPCPGTHKYLEAHYQCISAA  107
              C        F  DPCP T KYLE  Y C+  A
Sbjct  104  SMCYFTVDKKTFTEDPCPNTPKYLEVKYNCVVPA  137


 Score = 39.7 bits (91),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 17/52 (33%), Positives = 27/52 (52%), Gaps = 0/52 (0%)

Query  335  LNMGLGAVAEDESNMFCGPTNARNLFWNITRVGDVNVQPCPGGATGIAKWRC  386
            LN  +    + + ++FC  TN R + W  T+ G  +  PCP G++G   W C
Sbjct  168  LNSDVIKPVKKKEDVFCSATNRRGVNWQNTKSGTTSSAPCPEGSSGKQLWAC  219


>LPLT2_CAEEL unnamed protein product
Length=1338

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/125 (33%), Positives = 69/125 (55%), Gaps = 4/125 (3%)

Query  692  ILNSKVISASLGKGRH---IQISQPIKLVLRHIKTENVTNPTCVFWNYIDHAWSANGCTL  748
            ++NS+VI AS+        + +  P+    +H+ T+ V+NP CV+W+ ++  WS  GCTL
Sbjct  799  LINSQVIGASIQNATQSVTLPVDHPVTFTFQHLTTKGVSNPRCVYWDLMESKWSTLGCTL  858

Query  749  ESTNRTHSICMCNHLTNFAILMDVMDEHNHSLFGVFDGNMRILIYISVAICLVFVVIALL  808
             +T+   S C C HLT+FAILMD+  +    L G     + ++  I  AI +V + +++ 
Sbjct  859  IATSSNSSQCSCTHLTSFAILMDISGQVGR-LSGGLASALDVVSTIGCAISIVCLALSVC  917

Query  809  TLKIF  813
                F
Sbjct  918  VFTFF  922


 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 65/143 (45%), Gaps = 2/143 (1%)

Query  446  TPDLTQCRSLWLNSLE--VRVNQRESSVISIANDLSEVTSSKTLYGGDMLVTTKIIQTMS  503
            TPD T C   W+  +E  ++ NQ    + S  N   + T  +TL+GGD+  T ++   M 
Sbjct  528  TPDTTNCTHRWVAEMETAIKDNQPVEDISSTVNRQLKSTIERTLFGGDITGTVRLSNDML  587

Query  504  EKMFHDKETLPDQRQREAIILELLHGVVKTGSNLLDESQLSSWMDLNQEDQMRVATSLLT  563
                +    L D+  RE         +  +G  LL     + W  L+   +++ A+ L++
Sbjct  588  SLARNQFSVLNDRNLRENKARNFTENLGGSGDQLLSPVAATVWDQLSSTIRIQHASKLMS  647

Query  564  GLEYNAFLLADTIIRERNIVQKV  586
             LE +  LL D +  ++  +Q +
Sbjct  648  VLEQSVLLLGDYMTDQKLNLQYI  670



Lambda      K        H
   0.314    0.128    0.382 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 14120244890


Query= XP_014085245.1 PREDICTED: poly(A) polymerase type 3 [Bactrocera
oleae]

Length=687
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A0A0B4KG96_DROME  unnamed protein product                             1023    0.0  
Q9N6D7_DROME  unnamed protein product                                 1018    0.0  
Q8MZ09_DROME  unnamed protein product                                 1016    0.0  


>A0A0B4KG96_DROME unnamed protein product
Length=827

 Score = 1023 bits (2644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 522/708 (74%), Positives = 565/708 (80%), Gaps = 70/708 (10%)

Query  1    MWNSDSRSQNGVSISSTGSPSYGGYNSSNGNGRNGSPHHQQQHQQQQVKQLGMTSAISLA  60
            MWNS+              P++  ++  NGN  +G P           KQLGMTSAISLA
Sbjct  1    MWNSE--------------PTHRQHHQHNGNSTSGGP---------PAKQLGMTSAISLA  37

Query  61   EPRTEDLQKTEELRKALEPFKVFETQDELNHRMEILAKLNTLVKQWVKDVSMSKNMPEVA  120
            EPR EDLQ+T+ELR +LEP+ VFE+QDELNHRMEILAKLNTLVKQWVK++S+SKNMPE A
Sbjct  38   EPRPEDLQRTDELRGSLEPYNVFESQDELNHRMEILAKLNTLVKQWVKEISVSKNMPESA  97

Query  121  AEKLGGKIYTFGSYRLGVHHKGADIDALCVAPRNIERTDYFTSFFDLLKKQSEVTECRSV  180
            AEKLGGKIYTFGSYRLGVHHKGADIDALCVAPRNIERTDYF SFF++LKKQ EVTECRSV
Sbjct  98   AEKLGGKIYTFGSYRLGVHHKGADIDALCVAPRNIERTDYFQSFFEVLKKQPEVTECRSV  157

Query  181  EEAFVPVIKMNFDGIEIDLLFARLSLKEIPDDFDLRDDNLLKNLDPRSVRSLNGCRVTDE  240
            EEAFVPVIKMNFDGIEIDLLFARLSLKEIPDDFDLRDDNLL+NLD RSVRSLNGCRVTDE
Sbjct  158  EEAFVPVIKMNFDGIEIDLLFARLSLKEIPDDFDLRDDNLLRNLDHRSVRSLNGCRVTDE  217

Query  241  ILALVPNIENFRLALRSIKLWAKKHGIYSNSLGYFGGVTWAMLVARTCQLYPNATASTLV  300
            ILALVPNIENFRLALR+IKLWAKKHGIYSNSLGYFGGVTWAMLVARTCQLYPNA A+TLV
Sbjct  218  ILALVPNIENFRLALRTIKLWAKKHGIYSNSLGYFGGVTWAMLVARTCQLYPNAAAATLV  277

Query  301  HKFFLVFSRWKWPNPVLLKHPDNVNLRFPVWDPRVNASDRYHLMPIITPAYPQQNSTFNV  360
            HKFFLVFSRWKWPNPVLLKHPDNVNLRF VWDPRVNASDRYHLMPIITPAYPQQNSTFNV
Sbjct  278  HKFFLVFSRWKWPNPVLLKHPDNVNLRFQVWDPRVNASDRYHLMPIITPAYPQQNSTFNV  337

Query  361  SESTKKVILNEFNRGMITTDEIMLGRATWDRLFEAPSFFYKYRHFIVLLVTSQTGDDQLE  420
            SESTKKVIL EFNRGM  TDEIMLGR  W+RLFEAPSFFY+YRHFIVLLV SQT DD LE
Sbjct  338  SESTKKVILTEFNRGMNITDEIMLGRIPWERLFEAPSFFYRYRHFIVLLVNSQTADDHLE  397

Query  421  WCGLVESKIRLLVGNLERNQHISLAHVNPTCFDYKK--IAVNTQVNSGNEDDKTQSGGNP  478
            WCGLVESK+RLL+GNLERN HI+LAHVNP CF++KK   A N+Q NSGNEDD  QS GN 
Sbjct  398  WCGLVESKVRLLIGNLERNPHIALAHVNPKCFEFKKGQSANNSQNNSGNEDDLKQSQGNQ  457

Query  479  T-VSPTPFCSMWFIGLEFERTENLNVDLTESIQNFTEHVIQHGVNIKMLKDGMHIEARHV  537
            + V+  PFCSMWFIGLEFER+ENLNVDLTESIQNFTEHV+ HGVNIKMLK+GM I+ARHV
Sbjct  458  SAVTSAPFCSMWFIGLEFERSENLNVDLTESIQNFTEHVMMHGVNIKMLKEGMTIDARHV  517

Query  538  KRKSLSQYLDTDFLKRERKSMEQHNNFNNAILANRKRLSTELSTQKE-------------  584
            KRK LS YLD+DFLKRERKSME HNNFNN +LANRKRLSTEL+  ++             
Sbjct  518  KRKQLSLYLDSDFLKRERKSMESHNNFNNTLLANRKRLSTELAQSQDPLPPGQQPSSGNR  577

Query  585  --GGSTKKARLSESQTEENSNASSDTGGITPTTQPT---SAPNFTPDAKSSTNNGGAGSG  639
                  K  RLS+S TEENSNASSD G  TPTT  T   SAP+F    KSS  NG     
Sbjct  578  GRDSGAKIQRLSDSLTEENSNASSDMGAGTPTTPTTAQLSAPSF----KSSGKNGSEIDV  633

Query  640  SGSGSNSPRNSNGNGGSNSVNNQNTNSNSNSTTTTAATAAATAEVACS  687
                   P N             N N++SN+TTT         EVACS
Sbjct  634  VEQEPTQPHN-------------NGNASSNTTTT---------EVACS  659


>Q9N6D7_DROME unnamed protein product
Length=659

 Score = 1018 bits (2632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 522/708 (74%), Positives = 565/708 (80%), Gaps = 70/708 (10%)

Query  1    MWNSDSRSQNGVSISSTGSPSYGGYNSSNGNGRNGSPHHQQQHQQQQVKQLGMTSAISLA  60
            MWNS+              P++  ++  NGN  +G P           KQLGMTSAISLA
Sbjct  1    MWNSE--------------PTHRQHHQHNGNSTSGGP---------PAKQLGMTSAISLA  37

Query  61   EPRTEDLQKTEELRKALEPFKVFETQDELNHRMEILAKLNTLVKQWVKDVSMSKNMPEVA  120
            EPR EDLQ+T+ELR +LEP+ VFE+QDELNHRMEILAKLNTLVKQWVK++S+SKNMPE A
Sbjct  38   EPRPEDLQRTDELRGSLEPYNVFESQDELNHRMEILAKLNTLVKQWVKEISVSKNMPESA  97

Query  121  AEKLGGKIYTFGSYRLGVHHKGADIDALCVAPRNIERTDYFTSFFDLLKKQSEVTECRSV  180
            AEKLGGKIYTFGSYRLGVHHKGADIDALCVAPRNIERTDYF SFF++LKKQ EVTECRSV
Sbjct  98   AEKLGGKIYTFGSYRLGVHHKGADIDALCVAPRNIERTDYFQSFFEVLKKQPEVTECRSV  157

Query  181  EEAFVPVIKMNFDGIEIDLLFARLSLKEIPDDFDLRDDNLLKNLDPRSVRSLNGCRVTDE  240
            EEAFVPVIKMNFDGIEIDLLFARLSLKEIPDDFDLRDDNLL+NLD RSVRSLNGCRVTDE
Sbjct  158  EEAFVPVIKMNFDGIEIDLLFARLSLKEIPDDFDLRDDNLLRNLDHRSVRSLNGCRVTDE  217

Query  241  ILALVPNIENFRLALRSIKLWAKKHGIYSNSLGYFGGVTWAMLVARTCQLYPNATASTLV  300
            ILALVPNIENFRLALR+IKLWAKKHGIYSNSLGYFGGVTWAMLVARTCQLYPNA A+TLV
Sbjct  218  ILALVPNIENFRLALRTIKLWAKKHGIYSNSLGYFGGVTWAMLVARTCQLYPNAAAATLV  277

Query  301  HKFFLVFSRWKWPNPVLLKHPDNVNLRFPVWDPRVNASDRYHLMPIITPAYPQQNSTFNV  360
            HKFFLVFSRWKWPNPVLLKHPDNVNLRF VWDPRVNASDRYHLMPIITPAYPQQNSTFNV
Sbjct  278  HKFFLVFSRWKWPNPVLLKHPDNVNLRFQVWDPRVNASDRYHLMPIITPAYPQQNSTFNV  337

Query  361  SESTKKVILNEFNRGMITTDEIMLGRATWDRLFEAPSFFYKYRHFIVLLVTSQTGDDQLE  420
            SESTKKVIL EFNRGM  TDEIMLGR  W+RLFEAPSFFY+YRHFIVLLV SQT DD LE
Sbjct  338  SESTKKVILTEFNRGMNITDEIMLGRIPWERLFEAPSFFYRYRHFIVLLVNSQTADDHLE  397

Query  421  WCGLVESKIRLLVGNLERNQHISLAHVNPTCFDYKK--IAVNTQVNSGNEDDKTQSGGNP  478
            WCGLVESK+RLL+GNLERN HI+LAHVNP CF++KK   A N+Q NSGNEDD  QS GN 
Sbjct  398  WCGLVESKVRLLIGNLERNPHIALAHVNPKCFEFKKGQSANNSQNNSGNEDDLKQSQGNQ  457

Query  479  T-VSPTPFCSMWFIGLEFERTENLNVDLTESIQNFTEHVIQHGVNIKMLKDGMHIEARHV  537
            + V+  PFCSMWFIGLEFER+ENLNVDLTESIQNFTEHV+ HGVNIKMLK+GM I+ARHV
Sbjct  458  SAVTSAPFCSMWFIGLEFERSENLNVDLTESIQNFTEHVMMHGVNIKMLKEGMTIDARHV  517

Query  538  KRKSLSQYLDTDFLKRERKSMEQHNNFNNAILANRKRLSTELSTQKE-------------  584
            KRK LS YLD+DFLKRERKSME HNNFNN +LANRKRLSTEL+  ++             
Sbjct  518  KRKQLSLYLDSDFLKRERKSMESHNNFNNTLLANRKRLSTELAQSQDPLPPGQQPSSGNR  577

Query  585  --GGSTKKARLSESQTEENSNASSDTGGITPTTQPT---SAPNFTPDAKSSTNNGGAGSG  639
                  K  RLS+S TEENSNASSD G  TPTT  T   SAP+F    KSS  NG     
Sbjct  578  GRDSGAKIQRLSDSLTEENSNASSDMGAGTPTTPTTAQLSAPSF----KSSGKNGSEIDV  633

Query  640  SGSGSNSPRNSNGNGGSNSVNNQNTNSNSNSTTTTAATAAATAEVACS  687
                   P N             N N++SN+TTT         EVACS
Sbjct  634  VEQEPTQPHN-------------NGNASSNTTTT---------EVACS  659


>Q8MZ09_DROME unnamed protein product
Length=659

 Score = 1016 bits (2626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 521/708 (74%), Positives = 564/708 (80%), Gaps = 70/708 (10%)

Query  1    MWNSDSRSQNGVSISSTGSPSYGGYNSSNGNGRNGSPHHQQQHQQQQVKQLGMTSAISLA  60
            MWNS+              P++  ++  NGN  +G P           KQLGMTSAISLA
Sbjct  1    MWNSE--------------PTHRQHHQHNGNSTSGGP---------PAKQLGMTSAISLA  37

Query  61   EPRTEDLQKTEELRKALEPFKVFETQDELNHRMEILAKLNTLVKQWVKDVSMSKNMPEVA  120
            EPR EDLQ+T+ELR +LEP+ VFE+QDELNHRMEILAKLNTLVKQWVK++S+SKNMPE A
Sbjct  38   EPRPEDLQRTDELRGSLEPYNVFESQDELNHRMEILAKLNTLVKQWVKEISVSKNMPESA  97

Query  121  AEKLGGKIYTFGSYRLGVHHKGADIDALCVAPRNIERTDYFTSFFDLLKKQSEVTECRSV  180
            AEKLGGKIYTFGSYRLGVHHKGADIDALCVAPRNIERTDYF SFF++LKKQ EVTECRSV
Sbjct  98   AEKLGGKIYTFGSYRLGVHHKGADIDALCVAPRNIERTDYFQSFFEVLKKQPEVTECRSV  157

Query  181  EEAFVPVIKMNFDGIEIDLLFARLSLKEIPDDFDLRDDNLLKNLDPRSVRSLNGCRVTDE  240
            EEAFVPVIKMNFDGIEIDLLFARLSLKEIPDDFDLRDDNLL+NLD RSVRSLNGCRVTDE
Sbjct  158  EEAFVPVIKMNFDGIEIDLLFARLSLKEIPDDFDLRDDNLLRNLDHRSVRSLNGCRVTDE  217

Query  241  ILALVPNIENFRLALRSIKLWAKKHGIYSNSLGYFGGVTWAMLVARTCQLYPNATASTLV  300
            ILALVPNIENFRLALR+IKLWAKKHGIYSNSLGYFGGVTWAMLVARTCQLYPNA A+TLV
Sbjct  218  ILALVPNIENFRLALRTIKLWAKKHGIYSNSLGYFGGVTWAMLVARTCQLYPNAAAATLV  277

Query  301  HKFFLVFSRWKWPNPVLLKHPDNVNLRFPVWDPRVNASDRYHLMPIITPAYPQQNSTFNV  360
            HKFFLVFSRWKWPNPVLLKHPDNVNLRF VWDPRVNASDRYHLMPIITPAYPQQNSTFNV
Sbjct  278  HKFFLVFSRWKWPNPVLLKHPDNVNLRFQVWDPRVNASDRYHLMPIITPAYPQQNSTFNV  337

Query  361  SESTKKVILNEFNRGMITTDEIMLGRATWDRLFEAPSFFYKYRHFIVLLVTSQTGDDQLE  420
            SESTKKVIL EFNRGM  TDEIMLGR  W+RLFEAPSFFY+YRHFIVLLV SQT DD LE
Sbjct  338  SESTKKVILTEFNRGMNITDEIMLGRIPWERLFEAPSFFYRYRHFIVLLVNSQTADDHLE  397

Query  421  WCGLVESKIRLLVGNLERNQHISLAHVNPTCFDYKK--IAVNTQVNSGNEDDKTQSGGNP  478
            WCGLVESK+RLL+ NLERN HI+LAHVNP CF++KK   A N+Q NSGNEDD  QS GN 
Sbjct  398  WCGLVESKVRLLISNLERNPHIALAHVNPKCFEFKKGQSANNSQNNSGNEDDLKQSQGNQ  457

Query  479  T-VSPTPFCSMWFIGLEFERTENLNVDLTESIQNFTEHVIQHGVNIKMLKDGMHIEARHV  537
            + V+  PFCSMWFIGLEFER+ENLNVDLTESIQNFTEHV+ HGVNIKMLK+GM I+ARHV
Sbjct  458  SAVTSAPFCSMWFIGLEFERSENLNVDLTESIQNFTEHVMMHGVNIKMLKEGMTIDARHV  517

Query  538  KRKSLSQYLDTDFLKRERKSMEQHNNFNNAILANRKRLSTELSTQKE-------------  584
            KRK LS YLD+DFLKRERKSME HNNFNN +LANRKRLSTEL+  ++             
Sbjct  518  KRKQLSLYLDSDFLKRERKSMESHNNFNNTLLANRKRLSTELAQSQDPLPPGQQPSSGNR  577

Query  585  --GGSTKKARLSESQTEENSNASSDTGGITPTTQPT---SAPNFTPDAKSSTNNGGAGSG  639
                  K  RLS+S TEENSNASSD G  TPTT  T   SAP+F    KSS  NG     
Sbjct  578  GRDSGAKIQRLSDSLTEENSNASSDMGAGTPTTPTTAQLSAPSF----KSSGKNGSEIDV  633

Query  640  SGSGSNSPRNSNGNGGSNSVNNQNTNSNSNSTTTTAATAAATAEVACS  687
                   P N             N N++SN+TTT         EVACS
Sbjct  634  VEQEPTQPHN-------------NGNASSNTTTT---------EVACS  659



Lambda      K        H
   0.314    0.128    0.382 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 14120244890


Query= XP_014085246.1 PREDICTED: poly(A) polymerase type 3 [Bactrocera
oleae]

Length=687
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A0A0B4KG96_DROME  unnamed protein product                             1023    0.0  
Q9N6D7_DROME  unnamed protein product                                 1018    0.0  
Q8MZ09_DROME  unnamed protein product                                 1016    0.0  


>A0A0B4KG96_DROME unnamed protein product
Length=827

 Score = 1023 bits (2644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 522/708 (74%), Positives = 565/708 (80%), Gaps = 70/708 (10%)

Query  1    MWNSDSRSQNGVSISSTGSPSYGGYNSSNGNGRNGSPHHQQQHQQQQVKQLGMTSAISLA  60
            MWNS+              P++  ++  NGN  +G P           KQLGMTSAISLA
Sbjct  1    MWNSE--------------PTHRQHHQHNGNSTSGGP---------PAKQLGMTSAISLA  37

Query  61   EPRTEDLQKTEELRKALEPFKVFETQDELNHRMEILAKLNTLVKQWVKDVSMSKNMPEVA  120
            EPR EDLQ+T+ELR +LEP+ VFE+QDELNHRMEILAKLNTLVKQWVK++S+SKNMPE A
Sbjct  38   EPRPEDLQRTDELRGSLEPYNVFESQDELNHRMEILAKLNTLVKQWVKEISVSKNMPESA  97

Query  121  AEKLGGKIYTFGSYRLGVHHKGADIDALCVAPRNIERTDYFTSFFDLLKKQSEVTECRSV  180
            AEKLGGKIYTFGSYRLGVHHKGADIDALCVAPRNIERTDYF SFF++LKKQ EVTECRSV
Sbjct  98   AEKLGGKIYTFGSYRLGVHHKGADIDALCVAPRNIERTDYFQSFFEVLKKQPEVTECRSV  157

Query  181  EEAFVPVIKMNFDGIEIDLLFARLSLKEIPDDFDLRDDNLLKNLDPRSVRSLNGCRVTDE  240
            EEAFVPVIKMNFDGIEIDLLFARLSLKEIPDDFDLRDDNLL+NLD RSVRSLNGCRVTDE
Sbjct  158  EEAFVPVIKMNFDGIEIDLLFARLSLKEIPDDFDLRDDNLLRNLDHRSVRSLNGCRVTDE  217

Query  241  ILALVPNIENFRLALRSIKLWAKKHGIYSNSLGYFGGVTWAMLVARTCQLYPNATASTLV  300
            ILALVPNIENFRLALR+IKLWAKKHGIYSNSLGYFGGVTWAMLVARTCQLYPNA A+TLV
Sbjct  218  ILALVPNIENFRLALRTIKLWAKKHGIYSNSLGYFGGVTWAMLVARTCQLYPNAAAATLV  277

Query  301  HKFFLVFSRWKWPNPVLLKHPDNVNLRFPVWDPRVNASDRYHLMPIITPAYPQQNSTFNV  360
            HKFFLVFSRWKWPNPVLLKHPDNVNLRF VWDPRVNASDRYHLMPIITPAYPQQNSTFNV
Sbjct  278  HKFFLVFSRWKWPNPVLLKHPDNVNLRFQVWDPRVNASDRYHLMPIITPAYPQQNSTFNV  337

Query  361  SESTKKVILNEFNRGMITTDEIMLGRATWDRLFEAPSFFYKYRHFIVLLVTSQTGDDQLE  420
            SESTKKVIL EFNRGM  TDEIMLGR  W+RLFEAPSFFY+YRHFIVLLV SQT DD LE
Sbjct  338  SESTKKVILTEFNRGMNITDEIMLGRIPWERLFEAPSFFYRYRHFIVLLVNSQTADDHLE  397

Query  421  WCGLVESKIRLLVGNLERNQHISLAHVNPTCFDYKK--IAVNTQVNSGNEDDKTQSGGNP  478
            WCGLVESK+RLL+GNLERN HI+LAHVNP CF++KK   A N+Q NSGNEDD  QS GN 
Sbjct  398  WCGLVESKVRLLIGNLERNPHIALAHVNPKCFEFKKGQSANNSQNNSGNEDDLKQSQGNQ  457

Query  479  T-VSPTPFCSMWFIGLEFERTENLNVDLTESIQNFTEHVIQHGVNIKMLKDGMHIEARHV  537
            + V+  PFCSMWFIGLEFER+ENLNVDLTESIQNFTEHV+ HGVNIKMLK+GM I+ARHV
Sbjct  458  SAVTSAPFCSMWFIGLEFERSENLNVDLTESIQNFTEHVMMHGVNIKMLKEGMTIDARHV  517

Query  538  KRKSLSQYLDTDFLKRERKSMEQHNNFNNAILANRKRLSTELSTQKE-------------  584
            KRK LS YLD+DFLKRERKSME HNNFNN +LANRKRLSTEL+  ++             
Sbjct  518  KRKQLSLYLDSDFLKRERKSMESHNNFNNTLLANRKRLSTELAQSQDPLPPGQQPSSGNR  577

Query  585  --GGSTKKARLSESQTEENSNASSDTGGITPTTQPT---SAPNFTPDAKSSTNNGGAGSG  639
                  K  RLS+S TEENSNASSD G  TPTT  T   SAP+F    KSS  NG     
Sbjct  578  GRDSGAKIQRLSDSLTEENSNASSDMGAGTPTTPTTAQLSAPSF----KSSGKNGSEIDV  633

Query  640  SGSGSNSPRNSNGNGGSNSVNNQNTNSNSNSTTTTAATAAATAEVACS  687
                   P N             N N++SN+TTT         EVACS
Sbjct  634  VEQEPTQPHN-------------NGNASSNTTTT---------EVACS  659


>Q9N6D7_DROME unnamed protein product
Length=659

 Score = 1018 bits (2632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 522/708 (74%), Positives = 565/708 (80%), Gaps = 70/708 (10%)

Query  1    MWNSDSRSQNGVSISSTGSPSYGGYNSSNGNGRNGSPHHQQQHQQQQVKQLGMTSAISLA  60
            MWNS+              P++  ++  NGN  +G P           KQLGMTSAISLA
Sbjct  1    MWNSE--------------PTHRQHHQHNGNSTSGGP---------PAKQLGMTSAISLA  37

Query  61   EPRTEDLQKTEELRKALEPFKVFETQDELNHRMEILAKLNTLVKQWVKDVSMSKNMPEVA  120
            EPR EDLQ+T+ELR +LEP+ VFE+QDELNHRMEILAKLNTLVKQWVK++S+SKNMPE A
Sbjct  38   EPRPEDLQRTDELRGSLEPYNVFESQDELNHRMEILAKLNTLVKQWVKEISVSKNMPESA  97

Query  121  AEKLGGKIYTFGSYRLGVHHKGADIDALCVAPRNIERTDYFTSFFDLLKKQSEVTECRSV  180
            AEKLGGKIYTFGSYRLGVHHKGADIDALCVAPRNIERTDYF SFF++LKKQ EVTECRSV
Sbjct  98   AEKLGGKIYTFGSYRLGVHHKGADIDALCVAPRNIERTDYFQSFFEVLKKQPEVTECRSV  157

Query  181  EEAFVPVIKMNFDGIEIDLLFARLSLKEIPDDFDLRDDNLLKNLDPRSVRSLNGCRVTDE  240
            EEAFVPVIKMNFDGIEIDLLFARLSLKEIPDDFDLRDDNLL+NLD RSVRSLNGCRVTDE
Sbjct  158  EEAFVPVIKMNFDGIEIDLLFARLSLKEIPDDFDLRDDNLLRNLDHRSVRSLNGCRVTDE  217

Query  241  ILALVPNIENFRLALRSIKLWAKKHGIYSNSLGYFGGVTWAMLVARTCQLYPNATASTLV  300
            ILALVPNIENFRLALR+IKLWAKKHGIYSNSLGYFGGVTWAMLVARTCQLYPNA A+TLV
Sbjct  218  ILALVPNIENFRLALRTIKLWAKKHGIYSNSLGYFGGVTWAMLVARTCQLYPNAAAATLV  277

Query  301  HKFFLVFSRWKWPNPVLLKHPDNVNLRFPVWDPRVNASDRYHLMPIITPAYPQQNSTFNV  360
            HKFFLVFSRWKWPNPVLLKHPDNVNLRF VWDPRVNASDRYHLMPIITPAYPQQNSTFNV
Sbjct  278  HKFFLVFSRWKWPNPVLLKHPDNVNLRFQVWDPRVNASDRYHLMPIITPAYPQQNSTFNV  337

Query  361  SESTKKVILNEFNRGMITTDEIMLGRATWDRLFEAPSFFYKYRHFIVLLVTSQTGDDQLE  420
            SESTKKVIL EFNRGM  TDEIMLGR  W+RLFEAPSFFY+YRHFIVLLV SQT DD LE
Sbjct  338  SESTKKVILTEFNRGMNITDEIMLGRIPWERLFEAPSFFYRYRHFIVLLVNSQTADDHLE  397

Query  421  WCGLVESKIRLLVGNLERNQHISLAHVNPTCFDYKK--IAVNTQVNSGNEDDKTQSGGNP  478
            WCGLVESK+RLL+GNLERN HI+LAHVNP CF++KK   A N+Q NSGNEDD  QS GN 
Sbjct  398  WCGLVESKVRLLIGNLERNPHIALAHVNPKCFEFKKGQSANNSQNNSGNEDDLKQSQGNQ  457

Query  479  T-VSPTPFCSMWFIGLEFERTENLNVDLTESIQNFTEHVIQHGVNIKMLKDGMHIEARHV  537
            + V+  PFCSMWFIGLEFER+ENLNVDLTESIQNFTEHV+ HGVNIKMLK+GM I+ARHV
Sbjct  458  SAVTSAPFCSMWFIGLEFERSENLNVDLTESIQNFTEHVMMHGVNIKMLKEGMTIDARHV  517

Query  538  KRKSLSQYLDTDFLKRERKSMEQHNNFNNAILANRKRLSTELSTQKE-------------  584
            KRK LS YLD+DFLKRERKSME HNNFNN +LANRKRLSTEL+  ++             
Sbjct  518  KRKQLSLYLDSDFLKRERKSMESHNNFNNTLLANRKRLSTELAQSQDPLPPGQQPSSGNR  577

Query  585  --GGSTKKARLSESQTEENSNASSDTGGITPTTQPT---SAPNFTPDAKSSTNNGGAGSG  639
                  K  RLS+S TEENSNASSD G  TPTT  T   SAP+F    KSS  NG     
Sbjct  578  GRDSGAKIQRLSDSLTEENSNASSDMGAGTPTTPTTAQLSAPSF----KSSGKNGSEIDV  633

Query  640  SGSGSNSPRNSNGNGGSNSVNNQNTNSNSNSTTTTAATAAATAEVACS  687
                   P N             N N++SN+TTT         EVACS
Sbjct  634  VEQEPTQPHN-------------NGNASSNTTTT---------EVACS  659


>Q8MZ09_DROME unnamed protein product
Length=659

 Score = 1016 bits (2626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 521/708 (74%), Positives = 564/708 (80%), Gaps = 70/708 (10%)

Query  1    MWNSDSRSQNGVSISSTGSPSYGGYNSSNGNGRNGSPHHQQQHQQQQVKQLGMTSAISLA  60
            MWNS+              P++  ++  NGN  +G P           KQLGMTSAISLA
Sbjct  1    MWNSE--------------PTHRQHHQHNGNSTSGGP---------PAKQLGMTSAISLA  37

Query  61   EPRTEDLQKTEELRKALEPFKVFETQDELNHRMEILAKLNTLVKQWVKDVSMSKNMPEVA  120
            EPR EDLQ+T+ELR +LEP+ VFE+QDELNHRMEILAKLNTLVKQWVK++S+SKNMPE A
Sbjct  38   EPRPEDLQRTDELRGSLEPYNVFESQDELNHRMEILAKLNTLVKQWVKEISVSKNMPESA  97

Query  121  AEKLGGKIYTFGSYRLGVHHKGADIDALCVAPRNIERTDYFTSFFDLLKKQSEVTECRSV  180
            AEKLGGKIYTFGSYRLGVHHKGADIDALCVAPRNIERTDYF SFF++LKKQ EVTECRSV
Sbjct  98   AEKLGGKIYTFGSYRLGVHHKGADIDALCVAPRNIERTDYFQSFFEVLKKQPEVTECRSV  157

Query  181  EEAFVPVIKMNFDGIEIDLLFARLSLKEIPDDFDLRDDNLLKNLDPRSVRSLNGCRVTDE  240
            EEAFVPVIKMNFDGIEIDLLFARLSLKEIPDDFDLRDDNLL+NLD RSVRSLNGCRVTDE
Sbjct  158  EEAFVPVIKMNFDGIEIDLLFARLSLKEIPDDFDLRDDNLLRNLDHRSVRSLNGCRVTDE  217

Query  241  ILALVPNIENFRLALRSIKLWAKKHGIYSNSLGYFGGVTWAMLVARTCQLYPNATASTLV  300
            ILALVPNIENFRLALR+IKLWAKKHGIYSNSLGYFGGVTWAMLVARTCQLYPNA A+TLV
Sbjct  218  ILALVPNIENFRLALRTIKLWAKKHGIYSNSLGYFGGVTWAMLVARTCQLYPNAAAATLV  277

Query  301  HKFFLVFSRWKWPNPVLLKHPDNVNLRFPVWDPRVNASDRYHLMPIITPAYPQQNSTFNV  360
            HKFFLVFSRWKWPNPVLLKHPDNVNLRF VWDPRVNASDRYHLMPIITPAYPQQNSTFNV
Sbjct  278  HKFFLVFSRWKWPNPVLLKHPDNVNLRFQVWDPRVNASDRYHLMPIITPAYPQQNSTFNV  337

Query  361  SESTKKVILNEFNRGMITTDEIMLGRATWDRLFEAPSFFYKYRHFIVLLVTSQTGDDQLE  420
            SESTKKVIL EFNRGM  TDEIMLGR  W+RLFEAPSFFY+YRHFIVLLV SQT DD LE
Sbjct  338  SESTKKVILTEFNRGMNITDEIMLGRIPWERLFEAPSFFYRYRHFIVLLVNSQTADDHLE  397

Query  421  WCGLVESKIRLLVGNLERNQHISLAHVNPTCFDYKK--IAVNTQVNSGNEDDKTQSGGNP  478
            WCGLVESK+RLL+ NLERN HI+LAHVNP CF++KK   A N+Q NSGNEDD  QS GN 
Sbjct  398  WCGLVESKVRLLISNLERNPHIALAHVNPKCFEFKKGQSANNSQNNSGNEDDLKQSQGNQ  457

Query  479  T-VSPTPFCSMWFIGLEFERTENLNVDLTESIQNFTEHVIQHGVNIKMLKDGMHIEARHV  537
            + V+  PFCSMWFIGLEFER+ENLNVDLTESIQNFTEHV+ HGVNIKMLK+GM I+ARHV
Sbjct  458  SAVTSAPFCSMWFIGLEFERSENLNVDLTESIQNFTEHVMMHGVNIKMLKEGMTIDARHV  517

Query  538  KRKSLSQYLDTDFLKRERKSMEQHNNFNNAILANRKRLSTELSTQKE-------------  584
            KRK LS YLD+DFLKRERKSME HNNFNN +LANRKRLSTEL+  ++             
Sbjct  518  KRKQLSLYLDSDFLKRERKSMESHNNFNNTLLANRKRLSTELAQSQDPLPPGQQPSSGNR  577

Query  585  --GGSTKKARLSESQTEENSNASSDTGGITPTTQPT---SAPNFTPDAKSSTNNGGAGSG  639
                  K  RLS+S TEENSNASSD G  TPTT  T   SAP+F    KSS  NG     
Sbjct  578  GRDSGAKIQRLSDSLTEENSNASSDMGAGTPTTPTTAQLSAPSF----KSSGKNGSEIDV  633

Query  640  SGSGSNSPRNSNGNGGSNSVNNQNTNSNSNSTTTTAATAAATAEVACS  687
                   P N             N N++SN+TTT         EVACS
Sbjct  634  VEQEPTQPHN-------------NGNASSNTTTT---------EVACS  659



Lambda      K        H
   0.314    0.128    0.382 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 14120244890


Query= XP_014085247.1 PREDICTED: poly(A) polymerase type 3 [Bactrocera
oleae]

Length=687
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A0A0B4KG96_DROME  unnamed protein product                             1023    0.0  
Q9N6D7_DROME  unnamed protein product                                 1018    0.0  
Q8MZ09_DROME  unnamed protein product                                 1016    0.0  


>A0A0B4KG96_DROME unnamed protein product
Length=827

 Score = 1023 bits (2644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 522/708 (74%), Positives = 565/708 (80%), Gaps = 70/708 (10%)

Query  1    MWNSDSRSQNGVSISSTGSPSYGGYNSSNGNGRNGSPHHQQQHQQQQVKQLGMTSAISLA  60
            MWNS+              P++  ++  NGN  +G P           KQLGMTSAISLA
Sbjct  1    MWNSE--------------PTHRQHHQHNGNSTSGGP---------PAKQLGMTSAISLA  37

Query  61   EPRTEDLQKTEELRKALEPFKVFETQDELNHRMEILAKLNTLVKQWVKDVSMSKNMPEVA  120
            EPR EDLQ+T+ELR +LEP+ VFE+QDELNHRMEILAKLNTLVKQWVK++S+SKNMPE A
Sbjct  38   EPRPEDLQRTDELRGSLEPYNVFESQDELNHRMEILAKLNTLVKQWVKEISVSKNMPESA  97

Query  121  AEKLGGKIYTFGSYRLGVHHKGADIDALCVAPRNIERTDYFTSFFDLLKKQSEVTECRSV  180
            AEKLGGKIYTFGSYRLGVHHKGADIDALCVAPRNIERTDYF SFF++LKKQ EVTECRSV
Sbjct  98   AEKLGGKIYTFGSYRLGVHHKGADIDALCVAPRNIERTDYFQSFFEVLKKQPEVTECRSV  157

Query  181  EEAFVPVIKMNFDGIEIDLLFARLSLKEIPDDFDLRDDNLLKNLDPRSVRSLNGCRVTDE  240
            EEAFVPVIKMNFDGIEIDLLFARLSLKEIPDDFDLRDDNLL+NLD RSVRSLNGCRVTDE
Sbjct  158  EEAFVPVIKMNFDGIEIDLLFARLSLKEIPDDFDLRDDNLLRNLDHRSVRSLNGCRVTDE  217

Query  241  ILALVPNIENFRLALRSIKLWAKKHGIYSNSLGYFGGVTWAMLVARTCQLYPNATASTLV  300
            ILALVPNIENFRLALR+IKLWAKKHGIYSNSLGYFGGVTWAMLVARTCQLYPNA A+TLV
Sbjct  218  ILALVPNIENFRLALRTIKLWAKKHGIYSNSLGYFGGVTWAMLVARTCQLYPNAAAATLV  277

Query  301  HKFFLVFSRWKWPNPVLLKHPDNVNLRFPVWDPRVNASDRYHLMPIITPAYPQQNSTFNV  360
            HKFFLVFSRWKWPNPVLLKHPDNVNLRF VWDPRVNASDRYHLMPIITPAYPQQNSTFNV
Sbjct  278  HKFFLVFSRWKWPNPVLLKHPDNVNLRFQVWDPRVNASDRYHLMPIITPAYPQQNSTFNV  337

Query  361  SESTKKVILNEFNRGMITTDEIMLGRATWDRLFEAPSFFYKYRHFIVLLVTSQTGDDQLE  420
            SESTKKVIL EFNRGM  TDEIMLGR  W+RLFEAPSFFY+YRHFIVLLV SQT DD LE
Sbjct  338  SESTKKVILTEFNRGMNITDEIMLGRIPWERLFEAPSFFYRYRHFIVLLVNSQTADDHLE  397

Query  421  WCGLVESKIRLLVGNLERNQHISLAHVNPTCFDYKK--IAVNTQVNSGNEDDKTQSGGNP  478
            WCGLVESK+RLL+GNLERN HI+LAHVNP CF++KK   A N+Q NSGNEDD  QS GN 
Sbjct  398  WCGLVESKVRLLIGNLERNPHIALAHVNPKCFEFKKGQSANNSQNNSGNEDDLKQSQGNQ  457

Query  479  T-VSPTPFCSMWFIGLEFERTENLNVDLTESIQNFTEHVIQHGVNIKMLKDGMHIEARHV  537
            + V+  PFCSMWFIGLEFER+ENLNVDLTESIQNFTEHV+ HGVNIKMLK+GM I+ARHV
Sbjct  458  SAVTSAPFCSMWFIGLEFERSENLNVDLTESIQNFTEHVMMHGVNIKMLKEGMTIDARHV  517

Query  538  KRKSLSQYLDTDFLKRERKSMEQHNNFNNAILANRKRLSTELSTQKE-------------  584
            KRK LS YLD+DFLKRERKSME HNNFNN +LANRKRLSTEL+  ++             
Sbjct  518  KRKQLSLYLDSDFLKRERKSMESHNNFNNTLLANRKRLSTELAQSQDPLPPGQQPSSGNR  577

Query  585  --GGSTKKARLSESQTEENSNASSDTGGITPTTQPT---SAPNFTPDAKSSTNNGGAGSG  639
                  K  RLS+S TEENSNASSD G  TPTT  T   SAP+F    KSS  NG     
Sbjct  578  GRDSGAKIQRLSDSLTEENSNASSDMGAGTPTTPTTAQLSAPSF----KSSGKNGSEIDV  633

Query  640  SGSGSNSPRNSNGNGGSNSVNNQNTNSNSNSTTTTAATAAATAEVACS  687
                   P N             N N++SN+TTT         EVACS
Sbjct  634  VEQEPTQPHN-------------NGNASSNTTTT---------EVACS  659


>Q9N6D7_DROME unnamed protein product
Length=659

 Score = 1018 bits (2632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 522/708 (74%), Positives = 565/708 (80%), Gaps = 70/708 (10%)

Query  1    MWNSDSRSQNGVSISSTGSPSYGGYNSSNGNGRNGSPHHQQQHQQQQVKQLGMTSAISLA  60
            MWNS+              P++  ++  NGN  +G P           KQLGMTSAISLA
Sbjct  1    MWNSE--------------PTHRQHHQHNGNSTSGGP---------PAKQLGMTSAISLA  37

Query  61   EPRTEDLQKTEELRKALEPFKVFETQDELNHRMEILAKLNTLVKQWVKDVSMSKNMPEVA  120
            EPR EDLQ+T+ELR +LEP+ VFE+QDELNHRMEILAKLNTLVKQWVK++S+SKNMPE A
Sbjct  38   EPRPEDLQRTDELRGSLEPYNVFESQDELNHRMEILAKLNTLVKQWVKEISVSKNMPESA  97

Query  121  AEKLGGKIYTFGSYRLGVHHKGADIDALCVAPRNIERTDYFTSFFDLLKKQSEVTECRSV  180
            AEKLGGKIYTFGSYRLGVHHKGADIDALCVAPRNIERTDYF SFF++LKKQ EVTECRSV
Sbjct  98   AEKLGGKIYTFGSYRLGVHHKGADIDALCVAPRNIERTDYFQSFFEVLKKQPEVTECRSV  157

Query  181  EEAFVPVIKMNFDGIEIDLLFARLSLKEIPDDFDLRDDNLLKNLDPRSVRSLNGCRVTDE  240
            EEAFVPVIKMNFDGIEIDLLFARLSLKEIPDDFDLRDDNLL+NLD RSVRSLNGCRVTDE
Sbjct  158  EEAFVPVIKMNFDGIEIDLLFARLSLKEIPDDFDLRDDNLLRNLDHRSVRSLNGCRVTDE  217

Query  241  ILALVPNIENFRLALRSIKLWAKKHGIYSNSLGYFGGVTWAMLVARTCQLYPNATASTLV  300
            ILALVPNIENFRLALR+IKLWAKKHGIYSNSLGYFGGVTWAMLVARTCQLYPNA A+TLV
Sbjct  218  ILALVPNIENFRLALRTIKLWAKKHGIYSNSLGYFGGVTWAMLVARTCQLYPNAAAATLV  277

Query  301  HKFFLVFSRWKWPNPVLLKHPDNVNLRFPVWDPRVNASDRYHLMPIITPAYPQQNSTFNV  360
            HKFFLVFSRWKWPNPVLLKHPDNVNLRF VWDPRVNASDRYHLMPIITPAYPQQNSTFNV
Sbjct  278  HKFFLVFSRWKWPNPVLLKHPDNVNLRFQVWDPRVNASDRYHLMPIITPAYPQQNSTFNV  337

Query  361  SESTKKVILNEFNRGMITTDEIMLGRATWDRLFEAPSFFYKYRHFIVLLVTSQTGDDQLE  420
            SESTKKVIL EFNRGM  TDEIMLGR  W+RLFEAPSFFY+YRHFIVLLV SQT DD LE
Sbjct  338  SESTKKVILTEFNRGMNITDEIMLGRIPWERLFEAPSFFYRYRHFIVLLVNSQTADDHLE  397

Query  421  WCGLVESKIRLLVGNLERNQHISLAHVNPTCFDYKK--IAVNTQVNSGNEDDKTQSGGNP  478
            WCGLVESK+RLL+GNLERN HI+LAHVNP CF++KK   A N+Q NSGNEDD  QS GN 
Sbjct  398  WCGLVESKVRLLIGNLERNPHIALAHVNPKCFEFKKGQSANNSQNNSGNEDDLKQSQGNQ  457

Query  479  T-VSPTPFCSMWFIGLEFERTENLNVDLTESIQNFTEHVIQHGVNIKMLKDGMHIEARHV  537
            + V+  PFCSMWFIGLEFER+ENLNVDLTESIQNFTEHV+ HGVNIKMLK+GM I+ARHV
Sbjct  458  SAVTSAPFCSMWFIGLEFERSENLNVDLTESIQNFTEHVMMHGVNIKMLKEGMTIDARHV  517

Query  538  KRKSLSQYLDTDFLKRERKSMEQHNNFNNAILANRKRLSTELSTQKE-------------  584
            KRK LS YLD+DFLKRERKSME HNNFNN +LANRKRLSTEL+  ++             
Sbjct  518  KRKQLSLYLDSDFLKRERKSMESHNNFNNTLLANRKRLSTELAQSQDPLPPGQQPSSGNR  577

Query  585  --GGSTKKARLSESQTEENSNASSDTGGITPTTQPT---SAPNFTPDAKSSTNNGGAGSG  639
                  K  RLS+S TEENSNASSD G  TPTT  T   SAP+F    KSS  NG     
Sbjct  578  GRDSGAKIQRLSDSLTEENSNASSDMGAGTPTTPTTAQLSAPSF----KSSGKNGSEIDV  633

Query  640  SGSGSNSPRNSNGNGGSNSVNNQNTNSNSNSTTTTAATAAATAEVACS  687
                   P N             N N++SN+TTT         EVACS
Sbjct  634  VEQEPTQPHN-------------NGNASSNTTTT---------EVACS  659


>Q8MZ09_DROME unnamed protein product
Length=659

 Score = 1016 bits (2626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 521/708 (74%), Positives = 564/708 (80%), Gaps = 70/708 (10%)

Query  1    MWNSDSRSQNGVSISSTGSPSYGGYNSSNGNGRNGSPHHQQQHQQQQVKQLGMTSAISLA  60
            MWNS+              P++  ++  NGN  +G P           KQLGMTSAISLA
Sbjct  1    MWNSE--------------PTHRQHHQHNGNSTSGGP---------PAKQLGMTSAISLA  37

Query  61   EPRTEDLQKTEELRKALEPFKVFETQDELNHRMEILAKLNTLVKQWVKDVSMSKNMPEVA  120
            EPR EDLQ+T+ELR +LEP+ VFE+QDELNHRMEILAKLNTLVKQWVK++S+SKNMPE A
Sbjct  38   EPRPEDLQRTDELRGSLEPYNVFESQDELNHRMEILAKLNTLVKQWVKEISVSKNMPESA  97

Query  121  AEKLGGKIYTFGSYRLGVHHKGADIDALCVAPRNIERTDYFTSFFDLLKKQSEVTECRSV  180
            AEKLGGKIYTFGSYRLGVHHKGADIDALCVAPRNIERTDYF SFF++LKKQ EVTECRSV
Sbjct  98   AEKLGGKIYTFGSYRLGVHHKGADIDALCVAPRNIERTDYFQSFFEVLKKQPEVTECRSV  157

Query  181  EEAFVPVIKMNFDGIEIDLLFARLSLKEIPDDFDLRDDNLLKNLDPRSVRSLNGCRVTDE  240
            EEAFVPVIKMNFDGIEIDLLFARLSLKEIPDDFDLRDDNLL+NLD RSVRSLNGCRVTDE
Sbjct  158  EEAFVPVIKMNFDGIEIDLLFARLSLKEIPDDFDLRDDNLLRNLDHRSVRSLNGCRVTDE  217

Query  241  ILALVPNIENFRLALRSIKLWAKKHGIYSNSLGYFGGVTWAMLVARTCQLYPNATASTLV  300
            ILALVPNIENFRLALR+IKLWAKKHGIYSNSLGYFGGVTWAMLVARTCQLYPNA A+TLV
Sbjct  218  ILALVPNIENFRLALRTIKLWAKKHGIYSNSLGYFGGVTWAMLVARTCQLYPNAAAATLV  277

Query  301  HKFFLVFSRWKWPNPVLLKHPDNVNLRFPVWDPRVNASDRYHLMPIITPAYPQQNSTFNV  360
            HKFFLVFSRWKWPNPVLLKHPDNVNLRF VWDPRVNASDRYHLMPIITPAYPQQNSTFNV
Sbjct  278  HKFFLVFSRWKWPNPVLLKHPDNVNLRFQVWDPRVNASDRYHLMPIITPAYPQQNSTFNV  337

Query  361  SESTKKVILNEFNRGMITTDEIMLGRATWDRLFEAPSFFYKYRHFIVLLVTSQTGDDQLE  420
            SESTKKVIL EFNRGM  TDEIMLGR  W+RLFEAPSFFY+YRHFIVLLV SQT DD LE
Sbjct  338  SESTKKVILTEFNRGMNITDEIMLGRIPWERLFEAPSFFYRYRHFIVLLVNSQTADDHLE  397

Query  421  WCGLVESKIRLLVGNLERNQHISLAHVNPTCFDYKK--IAVNTQVNSGNEDDKTQSGGNP  478
            WCGLVESK+RLL+ NLERN HI+LAHVNP CF++KK   A N+Q NSGNEDD  QS GN 
Sbjct  398  WCGLVESKVRLLISNLERNPHIALAHVNPKCFEFKKGQSANNSQNNSGNEDDLKQSQGNQ  457

Query  479  T-VSPTPFCSMWFIGLEFERTENLNVDLTESIQNFTEHVIQHGVNIKMLKDGMHIEARHV  537
            + V+  PFCSMWFIGLEFER+ENLNVDLTESIQNFTEHV+ HGVNIKMLK+GM I+ARHV
Sbjct  458  SAVTSAPFCSMWFIGLEFERSENLNVDLTESIQNFTEHVMMHGVNIKMLKEGMTIDARHV  517

Query  538  KRKSLSQYLDTDFLKRERKSMEQHNNFNNAILANRKRLSTELSTQKE-------------  584
            KRK LS YLD+DFLKRERKSME HNNFNN +LANRKRLSTEL+  ++             
Sbjct  518  KRKQLSLYLDSDFLKRERKSMESHNNFNNTLLANRKRLSTELAQSQDPLPPGQQPSSGNR  577

Query  585  --GGSTKKARLSESQTEENSNASSDTGGITPTTQPT---SAPNFTPDAKSSTNNGGAGSG  639
                  K  RLS+S TEENSNASSD G  TPTT  T   SAP+F    KSS  NG     
Sbjct  578  GRDSGAKIQRLSDSLTEENSNASSDMGAGTPTTPTTAQLSAPSF----KSSGKNGSEIDV  633

Query  640  SGSGSNSPRNSNGNGGSNSVNNQNTNSNSNSTTTTAATAAATAEVACS  687
                   P N             N N++SN+TTT         EVACS
Sbjct  634  VEQEPTQPHN-------------NGNASSNTTTT---------EVACS  659



Lambda      K        H
   0.314    0.128    0.382 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 14120244890


Query= XP_014085248.1 PREDICTED: probable serine/threonine-protein kinase
DDB_G0282963 [Bactrocera oleae]

Length=220
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ELL_DROME  unnamed protein product                                    27.7    8.9  


>ELL_DROME unnamed protein product
Length=1059

 Score = 27.7 bits (60),  Expect = 8.9, Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 29/55 (53%), Gaps = 1/55 (2%)

Query  50   ATSIPGHTSNTAAMAFKQGLPTASSIYQRNNNSRRLQHHMSASAGMLGVLGGSGG  104
            A+ +P  TS +A+   KQ +P   S Y  + NS   QH  S S   +G +G SGG
Sbjct  682  ASFVPAATSGSASGTSKQRMPPQQSDYN-SYNSNNAQHVASNSKKRMGSVGPSGG  735



Lambda      K        H
   0.314    0.128    0.382 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 14120244890


Query= XP_014085249.1 PREDICTED: calmodulin isoform X1 [Bactrocera oleae]

Length=149
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CALM_DROME  unnamed protein product                                   297     1e-105
CALM_CAEEL  unnamed protein product                                   296     5e-105
CALM_TRYBB  unnamed protein product                                   279     3e-98 


>CALM_DROME unnamed protein product
Length=149

 Score = 297 bits (761),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%), Gaps = 0/149 (0%)

Query  1    MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60
            MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  61   NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE  120
            NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE  120

Query  121  EVDEMIREADIDGDGQVNYEEFVTMMTSK  149
            EVDEMIREADIDGDGQVNYEEFVTMMTSK
Sbjct  121  EVDEMIREADIDGDGQVNYEEFVTMMTSK  149


>CALM_CAEEL unnamed protein product
Length=149

 Score = 296 bits (758),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 148/149 (99%), Positives = 149/149 (100%), Gaps = 0/149 (0%)

Query  1    MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60
            MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  61   NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE  120
            NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE  120

Query  121  EVDEMIREADIDGDGQVNYEEFVTMMTSK  149
            EVDEMIREADIDGDGQVNYEEFVTMMT+K
Sbjct  121  EVDEMIREADIDGDGQVNYEEFVTMMTTK  149


>CALM_TRYBB unnamed protein product
Length=149

 Score = 279 bits (713),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 135/149 (91%), Positives = 145/149 (97%), Gaps = 0/149 (0%)

Query  1    MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60
            MADQL+ EQI+EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVD DG
Sbjct  1    MADQLSNEQISEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDQDG  60

Query  61   NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE  120
            +GTIDFPEFLT+MARKM+D+DSEEEI+EAFRVFDKDGNGFISAAELRH+MTNLGEKLTDE
Sbjct  61   SGTIDFPEFLTLMARKMQDSDSEEEIKEAFRVFDKDGNGFISAAELRHIMTNLGEKLTDE  120

Query  121  EVDEMIREADIDGDGQVNYEEFVTMMTSK  149
            EVDEMIREAD+DGDGQ+NYEEFV MM SK
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKMMMSK  149



Lambda      K        H
   0.314    0.128    0.382 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 14120244890


Query= XP_014085250.1 PREDICTED: calmodulin isoform X1 [Bactrocera oleae]

Length=149
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CALM_DROME  unnamed protein product                                   297     1e-105
CALM_CAEEL  unnamed protein product                                   296     5e-105
CALM_TRYBB  unnamed protein product                                   279     3e-98 


>CALM_DROME unnamed protein product
Length=149

 Score = 297 bits (761),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%), Gaps = 0/149 (0%)

Query  1    MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60
            MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  61   NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE  120
            NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE  120

Query  121  EVDEMIREADIDGDGQVNYEEFVTMMTSK  149
            EVDEMIREADIDGDGQVNYEEFVTMMTSK
Sbjct  121  EVDEMIREADIDGDGQVNYEEFVTMMTSK  149


>CALM_CAEEL unnamed protein product
Length=149

 Score = 296 bits (758),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 148/149 (99%), Positives = 149/149 (100%), Gaps = 0/149 (0%)

Query  1    MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60
            MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  61   NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE  120
            NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE  120

Query  121  EVDEMIREADIDGDGQVNYEEFVTMMTSK  149
            EVDEMIREADIDGDGQVNYEEFVTMMT+K
Sbjct  121  EVDEMIREADIDGDGQVNYEEFVTMMTTK  149


>CALM_TRYBB unnamed protein product
Length=149

 Score = 279 bits (713),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 135/149 (91%), Positives = 145/149 (97%), Gaps = 0/149 (0%)

Query  1    MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60
            MADQL+ EQI+EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVD DG
Sbjct  1    MADQLSNEQISEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDQDG  60

Query  61   NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE  120
            +GTIDFPEFLT+MARKM+D+DSEEEI+EAFRVFDKDGNGFISAAELRH+MTNLGEKLTDE
Sbjct  61   SGTIDFPEFLTLMARKMQDSDSEEEIKEAFRVFDKDGNGFISAAELRHIMTNLGEKLTDE  120

Query  121  EVDEMIREADIDGDGQVNYEEFVTMMTSK  149
            EVDEMIREAD+DGDGQ+NYEEFV MM SK
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKMMMSK  149



Lambda      K        H
   0.314    0.128    0.382 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 14120244890


Query= XP_014085251.1 PREDICTED: mucin-5AC isoform X1 [Bactrocera oleae]

Length=1477
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A1Z6W9_DROME  unnamed protein product                                 1569    0.0  
A0A0B4KEW8_DROME  unnamed protein product                             1513    0.0  
LIN12_CAEEL  unnamed protein product                                  53.9    1e-06


>A1Z6W9_DROME unnamed protein product
Length=1363

 Score = 1569 bits (4063),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 897/1406 (64%), Positives = 1029/1406 (73%), Gaps = 148/1406 (11%)

Query  103   SISQISPKSSSHMMSGVPLLLHTSPKLVLESTITDTNTRNVAAGLLTRDGDIDRDDNETR  162
             S+SQISPKSSSH          +  +  +EST+ D+    +A G   +   +D +DNETR
Sbjct  75    SVSQISPKSSSH---------RSPDRQRIESTMADS-VNGLAEG---QSSPLDVNDNETR  121

Query  163   QHIRMKRSAQPILNENYPKSGPNDVHFPSDTEKEASAGHYFQYNIKPTSTLNDGTSETPE  222
                R++RSA PIL++  P  GPNDVHFP D EK+ SAG YF YNIKPT T  D   E PE
Sbjct  122   AE-RVERSASPILHDRQPI-GPNDVHFPEDLEKDVSAGRYFHYNIKPTGTF-DNQDEQPE  178

Query  223   RT-QGARVGKTLKPSFNGIASTLLPATTLVSESFLAKGGLRPFTSGSPINPTRSTAISTA  281
             RT QG R GKTL               +   +SFL +G LRP  SGSPI P+ S   ++A
Sbjct  179   RTHQGIRAGKTLSQG-----------GSSSEQSFLGRGDLRPLVSGSPIRPSPSNTATSA  227

Query  282   ATATA--LPHNPRQNSNPDIQDIITGIVKLLNGNVNVHANTQGLRRPSASRINNRGPPRI  339
               A+A   PH+PRQN NPDIQDIITGIVKLLNGNVNVHANTQG+RRPSASRINNRGPPRI
Sbjct  228   TAASATQAPHSPRQNGNPDIQDIITGIVKLLNGNVNVHANTQGIRRPSASRINNRGPPRI  287

Query  340   SDVQTLPIDYDTQKKPLGSSIRPPPYTGPFDRPERPFITGVPIPEQIVPLRPGFISQRPP  399
             S+ Q LPIDY+ QK   G+S+RPPPY  PFDRPERPFITGVPIPEQIVP+RPGF+S RPP
Sbjct  288   SEAQNLPIDYEAQKP--GTSMRPPPY--PFDRPERPFITGVPIPEQIVPVRPGFVSNRPP  343

Query  400   WHRQKPRPPITTAIGG-RRPIPQYKPMPNTQLSPPVAEESAAPVKDMPEMTSSQHSGEME  458
             W+R KPRPPI T++GG RRP+PQYKP+P   +  P+  +   P+    E    Q+  E  
Sbjct  344   WYRNKPRPPIATSVGGNRRPLPQYKPLPAPPVQAPLQPQD--PLDRKNEQEKEQNHQEQ-  400

Query  459   ISVPPDYNDANGDVPKPTDATYDSEFSNEDTNSQYIEVSDQDSNETADQGPMTVEKDEFE  518
                 P   D   DV  PTD TYDSEFSNED N+QYIEVSDQD++ T  +      +DE +
Sbjct  401   ----PQPTD---DVVLPTDTTYDSEFSNEDANAQYIEVSDQDTDATGGE-----VEDELQ  448

Query  519   EEETAPMPPSPPPAKKDEQSSKKKPSKHKGADKKK---HTPED--FAAIIETNSAVHT--  571
                  P   + PP      S KK      G++KKK    +P+D  F+ IIET+S VHT  
Sbjct  449   PPPPPPSTTNNPPTTPTNPSKKKH-KPKPGSEKKKLPEESPQDEGFSTIIETSSVVHTVM  507

Query  572   -ESSTYAPMPMEISEGAIIDPSTEEVIFMTPSKTPTLEISSELDDTSSSTEIITQNSIIT  630
               SSTY PM M+ S          E + + PS    + +      T++ T  +  +   +
Sbjct  508   GMSSTYVPMSMDSS----------ESLGLDPSTEEVIFM------TANRTPTLEPSVTSS  551

Query  631   TALPNTIQSPVMLSPSSSTELLATIPPASTNTTPKPLSTTTTARLSTTTSSTFTSVAPPV  690
                 ++      + P+SS E   T    +T T+    +TT+T    +T S +      P 
Sbjct  552   LGTSSSSNPASAIQPTSSKEHTKTTTTTTTTTSSSTSTTTSTTTPPSTESVS------PN  605

Query  691   TTPTNTLPTPMPQPPSDYQPRPGIVLDDPEFKPGGRPRPPRPIQSRPGDVQQQPPY-NIQ  749
             ++  NT  TP    P+ Y PRPGIVLDDPEFKPGGRPR       +    QQ  P   +Q
Sbjct  606   SSNANTNATP----PAPYHPRPGIVLDDPEFKPGGRPR----PPVQRPPAQQTLPLPAVQ  657

Query  750   PTRQHLPPGYGEIFDVTLSAIQGPGSVG-GSQQTINIKPYGTYGNSGGQQGDIILSAAGD  808
             PTRQHLPPGYGEIFDVTLSAIQGPG  G GSQQTINIKPYG+Y  +GG QGDII+SA+GD
Sbjct  658   PTRQHLPPGYGEIFDVTLSAIQGPGPKGSGSQQTINIKPYGSYA-AGGGQGDIIVSASGD  716

Query  809   DGFVSIDGKRTYINLFGEPTDPPVGVPTTPATAVPQLPGSGVTVGSGAGNGNGIDGSGNV  868
             DGFVSIDGKRTYINLFG+PTDPP G  TTPAT +PQLPGSG   GSG+G G+G   +  V
Sbjct  717   DGFVSIDGKRTYINLFGDPTDPPAGA-TTPATRLPQLPGSGSGSGSGSGTGSGGASTPGV  775

Query  869   G---------------SGAGNAVTQNNLPSLGSGYGIPETEVVDLEPTKPNNAKPQ--SS  911
             G               +   NAVTQ++      GY +PETEVVDL+     ++KPQ  + 
Sbjct  776   GVSSGGGGGSGSSISPAAPANAVTQSS-----GGYVVPETEVVDLQ----GHSKPQGGAP  826

Query  912   TTNSGPTRPHYRSRPTQPPVRIDTCIVGDDSTCDQAQHERCKTENGVSSCHCRPGYSRRK  971
             TTN+GPTRPHYR RPTQPPVRIDTCIVGDDSTCDQAQHERCKT+NGVSSCHCRPGYSRRK
Sbjct  827   TTNAGPTRPHYRQRPTQPPVRIDTCIVGDDSTCDQAQHERCKTDNGVSSCHCRPGYSRRK  886

Query  972   HREPCRKVISFYLGMRVDRIYEHRIVWDNKLLDKHSEPYGQLSYESIRAIDSAMSMTPYS  1031
             HREPCR+VISF+LGMRVDRIYEHRIVWD KL+DKHSEP+GQLSYESIRA+DSAMSMTPYS
Sbjct  887   HREPCRRVISFHLGMRVDRIYEHRIVWDTKLMDKHSEPFGQLSYESIRALDSAMSMTPYS  946

Query  1032  DEFMDARVNNIYRGDPNLGGSAVFVNMTIKLDESVETLRPNLRADVQKHLLGVLHRRNNN  1091
             DEFM+A+VNNIYRGDPNLGGS V+VNMTIKLDESVETLRPNLR+DVQKHLLGVLHRRNNN
Sbjct  947   DEFMEAKVNNIYRGDPNLGGSGVYVNMTIKLDESVETLRPNLRSDVQKHLLGVLHRRNNN  1006

Query  1092  IGNSVLYVSSPEGSITALHDLDECQSRELNDCHASALCSNSWGSFRCACEVGLRDPWADQ  1151
             IGNSVLYVSSPEG+++AL DLDECQS ELNDCH+ A CSN+WGSFRCACE GLRDPWADQ
Sbjct  1007  IGNSVLYVSSPEGAVSALQDLDECQSPELNDCHSGASCSNTWGSFRCACEAGLRDPWADQ  1066

Query  1152  PQRAGRDCQSCPDSYCNNRGTCSYNEEGNQVCACDSSHYGAQCEIDGEVLGVAIGASLAA  1211
             P R+GR+CQ+C DS CNN GTCSY E+G Q+C CDSSHYGAQCEIDGEVLGVAIGAS+AA
Sbjct  1067  PARSGRECQACADSVCNNHGTCSYAEDGAQLCTCDSSHYGAQCEIDGEVLGVAIGASVAA  1126

Query  1212  VVIIVLTLVCLIMWSRRWQREQKNAIGSPVFGYMNTAPMKSAGLPGQPGYQVTLEDRMRW  1271
             ++IIVLTLVCLIMWSRRWQREQKNA+GSPVFGYMNTAP+KSAGLP Q GYQVTLEDRMRW
Sbjct  1127  IIIIVLTLVCLIMWSRRWQREQKNAMGSPVFGYMNTAPLKSAGLP-QAGYQVTLEDRMRW  1185

Query  1272  AQIADVMAQTNHYGVSPIAEPVGPTRPSSAMFAYPNLQSMGMGTMGGMSMQGTMQMHQAG  1331
             AQIADVMAQTNHYG    AEP+GPTRPSSAMFAYPNL +MGMGT+GGMS+Q TMQMH + 
Sbjct  1186  AQIADVMAQTNHYG----AEPIGPTRPSSAMFAYPNLGAMGMGTLGGMSLQSTMQMHPSA  1241

Query  1332  SMAPPVPLPRYECVYPSDNSSNTNKKRLGLSARSNGMRTLENSSSSEEEDRADLLGRNFQ  1391
             ++APPVPLP                 RLGL  RSNGMRTLENSSSSEEEDRADLLGRNFQ
Sbjct  1242  TLAPPVPLP-----------------RLGLGPRSNGMRTLENSSSSEEEDRADLLGRNFQ  1284

Query  1392  VPRPKSRSNGSIANQSGIYYDVDYEPSGNGIGNTSVDHLYGSQNQSSSHSHTHSHSHSGN  1451
             VPRPKSRSNGSIANQSGIYYDVDYEPSGNGIGN+SVDHLYGSQNQS +HS       SG+
Sbjct  1285  VPRPKSRSNGSIANQSGIYYDVDYEPSGNGIGNSSVDHLYGSQNQSVTHS-------SGH  1337

Query  1452  NHIPGPQGIPMSTYTSGRAPSSYYMK  1477
             +HIPGPQGIPMSTYTSGRAPSSYYMK
Sbjct  1338  SHIPGPQGIPMSTYTSGRAPSSYYMK  1363


>A0A0B4KEW8_DROME unnamed protein product
Length=1343

 Score = 1513 bits (3917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 879/1406 (63%), Positives = 1009/1406 (72%), Gaps = 168/1406 (12%)

Query  103   SISQISPKSSSHMMSGVPLLLHTSPKLVLESTITDTNTRNVAAGLLTRDGDIDRDDNETR  162
             S+SQISPKSSSH          +  +  +EST+ D+    +A G   +   +D +DNETR
Sbjct  75    SVSQISPKSSSH---------RSPDRQRIESTMADS-VNGLAEG---QSSPLDVNDNETR  121

Query  163   QHIRMKRSAQPILNENYPKSGPNDVHFPSDTEKEASAGHYFQYNIKPTSTLNDGTSETPE  222
                R++RSA PIL++  P  GPNDVHFP D EK+ SAG YF YNIKPT T  D   E PE
Sbjct  122   AE-RVERSASPILHDRQPI-GPNDVHFPEDLEKDVSAGRYFHYNIKPTGTF-DNQDEQPE  178

Query  223   RT-QGARVGKTLKPSFNGIASTLLPATTLVSESFLAKGGLRPFTSGSPINPTRSTAISTA  281
             RT QG R GKTL               +   +SFL +G LRP  SGSPI P+ S   ++A
Sbjct  179   RTHQGIRAGKTLSQ-----------GGSSSEQSFLGRGDLRPLVSGSPIRPSPSNTATSA  227

Query  282   ATATA--LPHNPRQNSNPDIQDIITGIVKLLNGNVNVHANTQGLRRPSASRINNRGPPRI  339
               A+A   PH+PRQN NPDIQDIITGIVKLLNGNVNVHANTQG+RRPSASRINNRGPPRI
Sbjct  228   TAASATQAPHSPRQNGNPDIQDIITGIVKLLNGNVNVHANTQGIRRPSASRINNRGPPRI  287

Query  340   SDVQTLPIDYDTQKKPLGSSIRPPPYTGPFDRPERPFITGVPIPEQIVPLRPGFISQRPP  399
             S+ Q LPIDY+ QK   G+S+RPPPY  PFDRPERPFITGVPIPEQIVP+RPGF+S RPP
Sbjct  288   SEAQNLPIDYEAQKP--GTSMRPPPY--PFDRPERPFITGVPIPEQIVPVRPGFVSNRPP  343

Query  400   WHRQKPRPPITTAIGG-RRPIPQYKPMPNTQLSPPVAEESAAPVKDMPEMTSSQHSGEME  458
             W+R KPRPPI T++GG RRP+PQYKP+P   +  P+  +   P+    E    Q+  E  
Sbjct  344   WYRNKPRPPIATSVGGNRRPLPQYKPLPAPPVQAPLQPQD--PLDRKNEQEKEQNHQEQ-  400

Query  459   ISVPPDYNDANGDVPKPTDATYDSEFSNEDTNSQYIEVSDQDSNETADQGPMTVEKDEFE  518
                 P   D   DV  PTD TYDSEFSNED N+QYIEVSDQD++ T  +    VE DE +
Sbjct  401   ----PQPTD---DVVLPTDTTYDSEFSNEDANAQYIEVSDQDTDATGGE----VE-DELQ  448

Query  519   EEETAPMPPSPPPAKKDEQSSKKKPSKHKGADKKK---HTPED--FAAIIETNSAVHT--  571
                  P   + PP      S KK      G++KKK    +P+D  F+ IIET+S VHT  
Sbjct  449   PPPPPPSTTNNPPTTPTNPSKKKH-KPKPGSEKKKLPEESPQDEGFSTIIETSSVVHTVM  507

Query  572   -ESSTYAPMPMEISEGAIIDPSTEEVIFMTPSKTPTLEISSELDDTSSSTEIITQNSIIT  630
               SSTY PM M+ S          E + + PS    + +      T++ T  +  +   +
Sbjct  508   GMSSTYVPMSMDSS----------ESLGLDPSTEEVIFM------TANRTPTLEPSVTSS  551

Query  631   TALPNTIQSPVMLSPSSSTELLATIPPASTNTTPKPLSTTTTARLSTTTSSTFTSVAPPV  690
                 ++      + P+SS E   T    +T T+    +TT+T    +T S +      P 
Sbjct  552   LGTSSSSNPASAIQPTSSKEHTKTTTTTTTTTSSSTSTTTSTTTPPSTESVS------PN  605

Query  691   TTPTNTLPTPMPQPPSDYQPRPGIVLDDPEFKPGGRPRPPRPIQSRPGDVQQQPPY-NIQ  749
             ++  NT  TP    P+ Y PRPGIVLDDPEFKPGGRPR       +    QQ  P   +Q
Sbjct  606   SSNANTNATP----PAPYHPRPGIVLDDPEFKPGGRPR----PPVQRPPAQQTLPLPAVQ  657

Query  750   PTRQHLPPGYGEIFDVTLSAIQGPGSVG-GSQQTINIKPYGTYGNSGGQQGDIILSAAGD  808
             PTRQHLPPGYGEIFDVTLSAIQGPG  G GSQQTINIKPYG+Y  +GG QGDII+SA   
Sbjct  658   PTRQHLPPGYGEIFDVTLSAIQGPGPKGSGSQQTINIKPYGSYA-AGGGQGDIIVSA---  713

Query  809   DGFVSIDGKRTYINLFGEPTDPPVGVPTTPATAVPQLPGSGVTVGSGAGNGNGIDGSGNV  868
                                +DPP G  TTPAT +PQLPGSG   GSG+G G+G   +  V
Sbjct  714   -------------------SDPPAGA-TTPATRLPQLPGSGSGSGSGSGTGSGGASTPGV  753

Query  869   G---------------SGAGNAVTQNNLPSLGSGYGIPETEVVDLEPTKPNNAKPQ--SS  911
             G               +   NAVTQ++      GY +PETEVVDL+     ++KPQ  + 
Sbjct  754   GVSSGGGGGSGSSISPAAPANAVTQSS-----GGYVVPETEVVDLQ----GHSKPQGGAP  804

Query  912   TTNSGPTRPHYRSRPTQPPVRIDTCIVGDDSTCDQAQHERCKTENGVSSCHCRPGYSRRK  971
             TTN+GPTRPHYR RPTQPPVRIDTCIVGDDSTCDQAQHERCKT+NGVSSCHCRPGYSRRK
Sbjct  805   TTNAGPTRPHYRQRPTQPPVRIDTCIVGDDSTCDQAQHERCKTDNGVSSCHCRPGYSRRK  864

Query  972   HREPCRKVISFYLGMRVDRIYEHRIVWDNKLLDKHSEPYGQLSYESIRAIDSAMSMTPYS  1031
             HREPCR+VISF+LGMRVDRIYEHRIVWD KL+DKHSEP+GQLSYESIRA+DSAMSMTPYS
Sbjct  865   HREPCRRVISFHLGMRVDRIYEHRIVWDTKLMDKHSEPFGQLSYESIRALDSAMSMTPYS  924

Query  1032  DEFMDARVNNIYRGDPNLGGSAVFVNMTIKLDESVETLRPNLRADVQKHLLGVLHRRNNN  1091
             DEFM+A+VNNIYRGDPNLGGS V+VNMTIKLDESVETLRPNLR+DVQKHLLGVLHRRNNN
Sbjct  925   DEFMEAKVNNIYRGDPNLGGSGVYVNMTIKLDESVETLRPNLRSDVQKHLLGVLHRRNNN  984

Query  1092  IGNSVLYVSSPEGSITALHDLDECQSRELNDCHASALCSNSWGSFRCACEVGLRDPWADQ  1151
             IGNSVLYVSSPEG+++AL DLDECQS ELNDCH+ A CSN+WGSFRCACE GLRDPWADQ
Sbjct  985   IGNSVLYVSSPEGAVSALQDLDECQSPELNDCHSGASCSNTWGSFRCACEAGLRDPWADQ  1044

Query  1152  PQRAGRDCQSCPDSYCNNRGTCSYNEEGNQVCACDSSHYGAQCEIDGEVLGVAIGASLAA  1211
             P R+GR+CQ+C DS CNN GTCSY E+G Q+C CDSSHYGAQCEIDGEVLGVAIGAS+AA
Sbjct  1045  PARSGRECQACADSVCNNHGTCSYAEDGAQLCTCDSSHYGAQCEIDGEVLGVAIGASVAA  1104

Query  1212  VVIIVLTLVCLIMWSRRWQREQKNAIGSPVFGYMNTAPMKSAGLPGQPGYQVTLEDRMRW  1271
             ++IIVLTLVCLIMWSRRWQREQKNA+GSPVFGYMNTAP+KSAGLP Q GYQVTLEDRMRW
Sbjct  1105  IIIIVLTLVCLIMWSRRWQREQKNAMGSPVFGYMNTAPLKSAGLP-QAGYQVTLEDRMRW  1163

Query  1272  AQIADVMAQTNHYGVSPIAEPVGPTRPSSAMFAYPNLQSMGMGTMGGMSMQGTMQMHQAG  1331
             AQIADVMAQTNHYG    AEP+GPTRPSSAMFAYPNL +MGMGT+GGMS+Q TMQMH + 
Sbjct  1164  AQIADVMAQTNHYGQ---AEPIGPTRPSSAMFAYPNLGAMGMGTLGGMSLQSTMQMHPSA  1220

Query  1332  SMAPPVPLPRYECVYPSDNSSNTNKKRLGLSARSNGMRTLENSSSSEEEDRADLLGRNFQ  1391
             ++APPVPLPR                RLGL  RSNGMRTLENSSSSEEEDRADLLGRNFQ
Sbjct  1221  TLAPPVPLPR----------------RLGLGPRSNGMRTLENSSSSEEEDRADLLGRNFQ  1264

Query  1392  VPRPKSRSNGSIANQSGIYYDVDYEPSGNGIGNTSVDHLYGSQNQSSSHSHTHSHSHSGN  1451
             VPRPKSRSNGSIANQSGIYYDVDYEPSGNGIGN+SVDHLYGSQNQS +HS       SG+
Sbjct  1265  VPRPKSRSNGSIANQSGIYYDVDYEPSGNGIGNSSVDHLYGSQNQSVTHS-------SGH  1317

Query  1452  NHIPGPQGIPMSTYTSGRAPSSYYMK  1477
             +HIPGPQGIPMSTYTSGRAPSSYYMK
Sbjct  1318  SHIPGPQGIPMSTYTSGRAPSSYYMK  1343


>LIN12_CAEEL unnamed protein product
Length=1429

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 41/90 (46%), Gaps = 8/90 (9%)

Query  1106  ITALHDLDECQSRELNDCHASALCSNSWGSFRCACEVGLRDPWADQPQRAGRDCQSCPDS  1165
             I    D +EC S   N C  +  C N  GSFRC C  G    W D+P         C D 
Sbjct  360   ILCEQDKNECLSE--NMCLNNGTCVNLPGSFRCDCARGFGGKWCDEPLNM------CQDF  411

Query  1166  YCNNRGTCSYNEEGNQVCACDSSHYGAQCE  1195
             +C N GTC +  + + VC C +   G +CE
Sbjct  412   HCENDGTCMHTSDHSPVCQCKNGFIGKRCE  441


 Score = 35.8 bits (81),  Expect = 0.36, Method: Compositional matrix adjust.
 Identities = 31/105 (30%), Positives = 39/105 (37%), Gaps = 9/105 (9%)

Query  1091  NIGNSVLYVSSPEGSITALHDLDECQSRELNDCHASALCSNSWGSFRCACEVGLRDPWAD  1150
             +IG + +     EG I   H  D C     N C    +C     SF C C  G      +
Sbjct  524   HIGYACICKQGFEGDICERHK-DLCLE---NPCSNGGVCHQHRESFSCDCPPGFYGNGCE  579

Query  1151  QPQRAGRDCQSCPDSYCNNRGTCSYNEEGNQVCACDSSHYGAQCE  1195
             Q +        C  S C N G C   EE  + C C     GA+CE
Sbjct  580   QEKMF-----RCLKSTCQNGGVCINEEEKGRKCECSYGFSGARCE  619



Lambda      K        H
   0.314    0.128    0.382 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 14120244890


Query= XP_014085252.1 PREDICTED: calmodulin isoform X2 [Bactrocera oleae]

Length=149
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CALM_DROME  unnamed protein product                                   297     1e-105
CALM_CAEEL  unnamed protein product                                   296     5e-105
CALM_TRYBB  unnamed protein product                                   279     3e-98 


>CALM_DROME unnamed protein product
Length=149

 Score = 297 bits (761),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%), Gaps = 0/149 (0%)

Query  1    MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60
            MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  61   NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE  120
            NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE  120

Query  121  EVDEMIREADIDGDGQVNYEEFVTMMTSK  149
            EVDEMIREADIDGDGQVNYEEFVTMMTSK
Sbjct  121  EVDEMIREADIDGDGQVNYEEFVTMMTSK  149


>CALM_CAEEL unnamed protein product
Length=149

 Score = 296 bits (758),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 148/149 (99%), Positives = 149/149 (100%), Gaps = 0/149 (0%)

Query  1    MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60
            MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG
Sbjct  1    MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60

Query  61   NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE  120
            NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE
Sbjct  61   NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE  120

Query  121  EVDEMIREADIDGDGQVNYEEFVTMMTSK  149
            EVDEMIREADIDGDGQVNYEEFVTMMT+K
Sbjct  121  EVDEMIREADIDGDGQVNYEEFVTMMTTK  149


>CALM_TRYBB unnamed protein product
Length=149

 Score = 279 bits (713),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 135/149 (91%), Positives = 145/149 (97%), Gaps = 0/149 (0%)

Query  1    MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG  60
            MADQL+ EQI+EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVD DG
Sbjct  1    MADQLSNEQISEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDQDG  60

Query  61   NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE  120
            +GTIDFPEFLT+MARKM+D+DSEEEI+EAFRVFDKDGNGFISAAELRH+MTNLGEKLTDE
Sbjct  61   SGTIDFPEFLTLMARKMQDSDSEEEIKEAFRVFDKDGNGFISAAELRHIMTNLGEKLTDE  120

Query  121  EVDEMIREADIDGDGQVNYEEFVTMMTSK  149
            EVDEMIREAD+DGDGQ+NYEEFV MM SK
Sbjct  121  EVDEMIREADVDGDGQINYEEFVKMMMSK  149



Lambda      K        H
   0.314    0.128    0.382 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 14120244890


Query= XP_014085253.1 PREDICTED: H/ACA ribonucleoprotein complex subunit 4
isoform X1 [Bactrocera oleae]

Length=514
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DKC1_DROME  unnamed protein product                                   831     0.0  
DKC1_DICDI  unnamed protein product                                   572     0.0  
Q38CM1_TRYB2  unnamed protein product                                 523     0.0  


>DKC1_DROME unnamed protein product
Length=508

 Score = 831 bits (2147),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/464 (89%), Positives = 431/464 (93%), Gaps = 6/464 (1%)

Query  1    MADIEIKKEKKKKKIKEEPIDVDDLGTLQKTGDFSVKPSEKSVKLDASQWPLLLKNFDKL  60
            MAD+E++KEKKKKKIKEEP+D DD+GTLQK G+F +KPS K  +LD SQWPLLLKNFDKL
Sbjct  1    MADVEVRKEKKKKKIKEEPLDGDDIGTLQKQGNFQIKPSSKIAELDTSQWPLLLKNFDKL  60

Query  61   NVRTNHYTPLPHGSSPLNRDIQEYMKSGFINLDKPSNPSSHEVVAWIKKILKVEKTGHSG  120
            N+R+NHYTPL HGSSPLNRDI+EYMK+GFINLDKPSNPSSHEVVAWIKKILKVEKTGHSG
Sbjct  61   NIRSNHYTPLAHGSSPLNRDIKEYMKTGFINLDKPSNPSSHEVVAWIKKILKVEKTGHSG  120

Query  121  TLDPKVTGCLIVCIDRATRLVKSQQSAGKEYVAIFKLHSPVESVAKVRQGLEKLRGALFQ  180
            TLDPKVTGCLIVCIDRATRLVKSQQSAGKEYVAIFKLH  VESVAKVRQGLEKLRGALFQ
Sbjct  121  TLDPKVTGCLIVCIDRATRLVKSQQSAGKEYVAIFKLHGAVESVAKVRQGLEKLRGALFQ  180

Query  181  RPPLISAVKRQLRVRTVYDSKLLDYDEARNMGVFWVSCEAGSYIRTMCVHLGLVLGVGGQ  240
            RPPLISAVKRQLRVRTVYDSKLLDYDE RNMGVFWVSCEAGSYIRTMCVHLGLVLGVGGQ
Sbjct  181  RPPLISAVKRQLRVRTVYDSKLLDYDETRNMGVFWVSCEAGSYIRTMCVHLGLVLGVGGQ  240

Query  241  MLELRRVRSGIQSERDGMVTMHDVLDAMYLYENHKDESMLRRVIKPLEGLLVNHKRIIMK  300
            MLELRRVRSGIQSERDGMVTMHDVLDAM+LYENHKDESMLRRVIKPLEGLLVNHKRIIMK
Sbjct  241  MLELRRVRSGIQSERDGMVTMHDVLDAMWLYENHKDESMLRRVIKPLEGLLVNHKRIIMK  300

Query  301  DSSVNAVCYGAKIMLPGVLRYEDGIEIDKEIVIVTTKGEAICLAIAQMTTATMASCDHGV  360
            DSSVNAVCYGAKI LPGVLRYEDGIEID+EIVI TTKGEAICLAIA MTTATMASCDHGV
Sbjct  301  DSSVNAVCYGAKITLPGVLRYEDGIEIDQEIVICTTKGEAICLAIALMTTATMASCDHGV  360

Query  361  VAKIKRVIMERDTYPRKWGLGPKASAKKALIAAGKLDKYGRPNENTPKEWLTGFVDYNAK  420
            VAKIKRVIMERDTYPRKWGLGPKASAKKALIAAGKLDK+GRPNENTPKEWLTG+VDYNAK
Sbjct  361  VAKIKRVIMERDTYPRKWGLGPKASAKKALIAAGKLDKFGRPNENTPKEWLTGYVDYNAK  420

Query  421  KPAAAVAPQNTTPTNGGSTEEGKKRKLSASSQDGNALTVVQDDT  464
            KPAA    Q  +PTNG S  E  KRKLS SS +  A   V ++T
Sbjct  421  KPAA----QEVSPTNGSS--EPSKRKLSTSSVEETAAAAVSEET  458


>DKC1_DICDI unnamed protein product
Length=540

 Score = 572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/385 (67%), Positives = 321/385 (83%), Gaps = 1/385 (0%)

Query  36   VKPSEKSVKLDASQWPLLLKNFDKLNVRTNHYTPLPHGSSPLNRDIQEYMKSGFINLDKP  95
            +KP EK+  LD S+WPLLLKN+D+L+VRT HYTP+P+G SPL R I+EY+K G INLDKP
Sbjct  23   IKP-EKTPILDTSKWPLLLKNYDQLSVRTGHYTPIPNGHSPLKRPIKEYVKYGIINLDKP  81

Query  96   SNPSSHEVVAWIKKILKVEKTGHSGTLDPKVTGCLIVCIDRATRLVKSQQSAGKEYVAIF  155
            SNPSSHEVVAWI+ IL+V KTGHSGTLDPKVTGCLIVCI+RATRLVKSQQ AGKEY+ I 
Sbjct  82   SNPSSHEVVAWIRTILRVTKTGHSGTLDPKVTGCLIVCIERATRLVKSQQGAGKEYIGIV  141

Query  156  KLHSPVESVAKVRQGLEKLRGALFQRPPLISAVKRQLRVRTVYDSKLLDYDEARNMGVFW  215
            +LH  +E   ++ + ++ L GALFQRPP  SAVK++LRVRT+++SKLL++D  RN+G+ W
Sbjct  142  RLHGAIEGTTELSKAVDTLTGALFQRPPQKSAVKKRLRVRTIHNSKLLEFDPERNLGLIW  201

Query  216  VSCEAGSYIRTMCVHLGLVLGVGGQMLELRRVRSGIQSERDGMVTMHDVLDAMYLYENHK  275
            V CEAG+YIRT+CVH+GL++GVGG M ELRRVRSGI SE+ G VTMHDV DA Y Y+N K
Sbjct  202  VDCEAGTYIRTLCVHIGLLMGVGGHMQELRRVRSGIMSEKKGQVTMHDVKDAQYEYDNSK  261

Query  276  DESMLRRVIKPLEGLLVNHKRIIMKDSSVNAVCYGAKIMLPGVLRYEDGIEIDKEIVIVT  335
            DES LRRVI+PLE +L N+KRI++KDS++NA+CYGAK+M+PG+LRYE  IE ++E+V++T
Sbjct  262  DESYLRRVIQPLEAILTNYKRIVVKDSAINAICYGAKLMIPGLLRYEQDIESNEEVVLIT  321

Query  336  TKGEAICLAIAQMTTATMASCDHGVVAKIKRVIMERDTYPRKWGLGPKASAKKALIAAGK  395
            TKGEAI + IAQMTTA+MA+CDHGVVA IKRVIM+RD YP +WGLGPKA  KK +I  GK
Sbjct  322  TKGEAIAIGIAQMTTASMATCDHGVVATIKRVIMDRDVYPVRWGLGPKAKVKKEMIKDGK  381

Query  396  LDKYGRPNENTPKEWLTGFVDYNAK  420
            LDK+G+PNE TP +W   +  Y  +
Sbjct  382  LDKFGKPNEKTPSDWTNTYTYYTGQ  406


>Q38CM1_TRYB2 unnamed protein product
Length=427

 Score = 523 bits (1347),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/415 (60%), Positives = 314/415 (76%), Gaps = 5/415 (1%)

Query  25   LGTLQKTGDFSV--KPSEKSVKLDASQWPLLLKNFDKLNVRTNHYTPLPHGSSPLNRDIQ  82
            LG  Q+  DF +  +       L   +WPLLLKN+D+LNVR++H+T L  G SPL R + 
Sbjct  6    LGEAQRKEDFCIPLEGQHTDCALSPEEWPLLLKNYDRLNVRSSHFTVLDCGWSPLRRPLS  65

Query  83   EYMKSGFINLDKPSNPSSHEVVAWIKKILKVEKTGHSGTLDPKVTGCLIVCIDRATRLVK  142
            +Y+K G INLDKPSNPSSHEVV+WIK+ILK EKTGH+GTLDPKVTG LI+CIDRATRLVK
Sbjct  66   QYVKYGMINLDKPSNPSSHEVVSWIKRILKCEKTGHAGTLDPKVTGALIICIDRATRLVK  125

Query  143  SQQSAGKEYVAIFKLHSPVESVAKVRQGLEKLRGALFQRPPLISAVKRQLRVRTVYDSKL  202
            SQQ+AGK Y+ + +LH  V S  KV   L++L G  FQRPPLI+AVKRQLR+R +Y ++L
Sbjct  126  SQQNAGKTYIGVLRLHDTV-SEKKVVASLQRLTGPCFQRPPLIAAVKRQLRIRNIYSNQL  184

Query  203  LDYDEARNMGVFWVSCEAGSYIRTMCVHLGLVLGVGGQMLELRRVRSGIQSERDGMVTMH  262
            ++YD+ R++ VF   CEAG+YIRT+CVHLGL+LGVGG M ELRR+R+G+ SE D + TMH
Sbjct  185  IEYDKHRHLAVFETHCEAGTYIRTLCVHLGLILGVGGHMEELRRIRTGVISEDDHISTMH  244

Query  263  DVLDAMYLYENHKDESMLRRVIKPLEGLLVNHKRIIMKDSSVNAVCYGAKIMLPGVLRYE  322
            DVLDA +LY+N KDE+ LRRVI P E LL N+KR+++KDS+VNAVCYGAK+M+PG+ R++
Sbjct  245  DVLDAQWLYDNEKDETYLRRVILPCEYLLTNYKRVVVKDSAVNAVCYGAKLMIPGLARFD  304

Query  323  DGIEIDKEIVIVTTKGEAICLAIAQMTTATMASCDHGVVAKIKRVIMERDTYPRKWGLGP  382
            +GIE D  IV++TTKGEAI LA A+M+T+ MAS DHG+VA+ KRVIM+RDTYPR+WGLGP
Sbjct  305  NGIERDDVIVLMTTKGEAIALAYAEMSTSQMASVDHGIVARSKRVIMDRDTYPRRWGLGP  364

Query  383  KASAKKALIAAGKLDKYGRPNENTPKEWLTGFVDYNAKKPAAAVAPQNTTPTNGG  437
             A  K+ ++  G LDKYGRP  NTP +W   +VDY      A        P   G
Sbjct  365  VAVKKRTMMKDGLLDKYGRPQANTPSDWF--YVDYGGVSTNAEGVQYGEAPRKNG  417



Lambda      K        H
   0.314    0.128    0.382 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 14120244890


Query= XP_014085254.1 PREDICTED: H/ACA ribonucleoprotein complex subunit 4
isoform X2 [Bactrocera oleae]

Length=227
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DKC1_DROME  unnamed protein product                                   377     2e-130
DKC1_DICDI  unnamed protein product                                   260     3e-84 
Q38CM1_TRYB2  unnamed protein product                                 237     9e-77 


>DKC1_DROME unnamed protein product
Length=508

 Score = 377 bits (968),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 191/222 (86%), Positives = 204/222 (92%), Gaps = 4/222 (2%)

Query  1    MADIEIKKEKKKKKIKEEPIDVDDLGTLQKTGDFSVKPSEKSVKLDASQWPLLLKNFDKL  60
            MAD+E++KEKKKKKIKEEP+D DD+GTLQK G+F +KPS K  +LD SQWPLLLKNFDKL
Sbjct  1    MADVEVRKEKKKKKIKEEPLDGDDIGTLQKQGNFQIKPSSKIAELDTSQWPLLLKNFDKL  60

Query  61   NVRTNHYTPLPHGSSPLNRDIQEYMKSGFINLDKPSNPSSHEVVAWIKKILKVEKTGHSG  120
            N+R+NHYTPL HGSSPLNRDI+EYMK+GFINLDKPSNPSSHEVVAWIKKILKVEKTGHSG
Sbjct  61   NIRSNHYTPLAHGSSPLNRDIKEYMKTGFINLDKPSNPSSHEVVAWIKKILKVEKTGHSG  120

Query  121  TLDPKVTGCLIVCIDRATRLVKSQQSAGKEYVAIFKLHSPVESVAKVRQGLEKLRGALFQ  180
            TLDPKVTGCLIVCIDRATRLVKSQQSAGKEYVAIFKLH  VESVAKVRQGLEKLRGALFQ
Sbjct  121  TLDPKVTGCLIVCIDRATRLVKSQQSAGKEYVAIFKLHGAVESVAKVRQGLEKLRGALFQ  180

Query  181  RPPLISAVKRQLRVRTVYDSKLLDYDEARNMAVRRVRIFVPC  222
            RPPLISAVKRQLRVRTVYDSKLLDYDE RNM V     +V C
Sbjct  181  RPPLISAVKRQLRVRTVYDSKLLDYDETRNMGV----FWVSC  218


>DKC1_DICDI unnamed protein product
Length=540

 Score = 260 bits (664),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 153/187 (82%), Gaps = 5/187 (3%)

Query  36   VKPSEKSVKLDASQWPLLLKNFDKLNVRTNHYTPLPHGSSPLNRDIQEYMKSGFINLDKP  95
            +KP EK+  LD S+WPLLLKN+D+L+VRT HYTP+P+G SPL R I+EY+K G INLDKP
Sbjct  23   IKP-EKTPILDTSKWPLLLKNYDQLSVRTGHYTPIPNGHSPLKRPIKEYVKYGIINLDKP  81

Query  96   SNPSSHEVVAWIKKILKVEKTGHSGTLDPKVTGCLIVCIDRATRLVKSQQSAGKEYVAIF  155
            SNPSSHEVVAWI+ IL+V KTGHSGTLDPKVTGCLIVCI+RATRLVKSQQ AGKEY+ I 
Sbjct  82   SNPSSHEVVAWIRTILRVTKTGHSGTLDPKVTGCLIVCIERATRLVKSQQGAGKEYIGIV  141

Query  156  KLHSPVESVAKVRQGLEKLRGALFQRPPLISAVKRQLRVRTVYDSKLLDYDEARNMAVRR  215
            +LH  +E   ++ + ++ L GALFQRPP  SAVK++LRVRT+++SKLL++D  RN+ +  
Sbjct  142  RLHGAIEGTTELSKAVDTLTGALFQRPPQKSAVKKRLRVRTIHNSKLLEFDPERNLGL--  199

Query  216  VRIFVPC  222
              I+V C
Sbjct  200  --IWVDC  204


>Q38CM1_TRYB2 unnamed protein product
Length=427

 Score = 237 bits (605),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 114/191 (60%), Positives = 146/191 (76%), Gaps = 3/191 (2%)

Query  25   LGTLQKTGDFSV--KPSEKSVKLDASQWPLLLKNFDKLNVRTNHYTPLPHGSSPLNRDIQ  82
            LG  Q+  DF +  +       L   +WPLLLKN+D+LNVR++H+T L  G SPL R + 
Sbjct  6    LGEAQRKEDFCIPLEGQHTDCALSPEEWPLLLKNYDRLNVRSSHFTVLDCGWSPLRRPLS  65

Query  83   EYMKSGFINLDKPSNPSSHEVVAWIKKILKVEKTGHSGTLDPKVTGCLIVCIDRATRLVK  142
            +Y+K G INLDKPSNPSSHEVV+WIK+ILK EKTGH+GTLDPKVTG LI+CIDRATRLVK
Sbjct  66   QYVKYGMINLDKPSNPSSHEVVSWIKRILKCEKTGHAGTLDPKVTGALIICIDRATRLVK  125

Query  143  SQQSAGKEYVAIFKLHSPVESVAKVRQGLEKLRGALFQRPPLISAVKRQLRVRTVYDSKL  202
            SQQ+AGK Y+ + +LH  V S  KV   L++L G  FQRPPLI+AVKRQLR+R +Y ++L
Sbjct  126  SQQNAGKTYIGVLRLHDTV-SEKKVVASLQRLTGPCFQRPPLIAAVKRQLRIRNIYSNQL  184

Query  203  LDYDEARNMAV  213
            ++YD+ R++AV
Sbjct  185  IEYDKHRHLAV  195



Lambda      K        H
   0.314    0.128    0.382 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 14120244890


Query= XP_014085255.1 PREDICTED: borealin-like [Bactrocera oleae]

Length=317
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

BOREA_DROME  unnamed protein product                                  193     1e-59
Q9VLD7_DROME  unnamed protein product                                 101     2e-25
SIBA_DICDI  unnamed protein product                                   32.7    0.45 


>BOREA_DROME unnamed protein product
Length=315

 Score = 193 bits (491),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 144/320 (45%), Positives = 203/320 (63%), Gaps = 20/320 (6%)

Query  1    MPRTKVSKSTKRFRETSSCEEKLREFEASFDGYLHALELKGKAQIKSIEDKFYMLLMGTD  60
            MPRTK+ K++KR RE ++ EEK+R +E   D  L +++      + +++ +   LL    
Sbjct  1    MPRTKIPKNSKRNREVANREEKVRLYELKMDSRLISIDSLETKFLSAVDHQVKTLLGQVQ  60

Query  61   SNVLDLLMGDVLSL--NLTKPEDYK-----KHLNTLAGSNSAGVKQTSGKQLNPNDEGYL  113
              + +L M +VL L   L +  D+K     + L +++ S SA          + NDE   
Sbjct  61   KELANLKMPEVLRLFEELDRFSDFKASDQTQLLASMSMSGSAIEGHAPSATGSRNDE---  117

Query  114  TEDSTNGGSSVGVSTSILSAYSRASIKQQQQRGRTPGPLSSARARRPRRSRSACDDLVQV  173
             EDS+ G S      SIL+A++  S+ +  +  RTPGPL SARARR RRSRSAC DL  +
Sbjct  118  -EDSSIGASG----GSILAAHT-GSLLRSTKAMRTPGPLHSARARRARRSRSACGDLNIL  171

Query  174  STIKSSTSSSTVMDTRISRSKMRTPTATRSKALSADRSSQVCGQQFSMTMSASSPAAAFL  233
             + K  + SS+   +R SRSK+RTP A+R+KA SADR+     Q+   + S ++P  AFL
Sbjct  172  HSAKPPSISSSSSSSRNSRSKLRTPMASRAKAFSADRTP--LKQKQMRSGSPTTPPMAFL  229

Query  234  RWPKPGEVVLSKCGSPVVAHVMPDKFANVNIPTKNGVFSLRPKKL--DELKSDIIDAIDA  291
            R+PKPGEV LSK GSP+VA VMPDKFANVNIP +NGV SLRPKKL  DE++S++++ +D 
Sbjct  230  RYPKPGEVALSKYGSPMVAQVMPDKFANVNIPIRNGVLSLRPKKLDADEVESNLLENLDE  289

Query  292  DTLSQIKTLHDNLNLIMKMA  311
            DTL+QIKTLH+NL +I+  A
Sbjct  290  DTLNQIKTLHENLQMIVNKA  309


>Q9VLD7_DROME unnamed protein product
Length=216

 Score = 101 bits (251),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/144 (40%), Positives = 90/144 (63%), Gaps = 20/144 (14%)

Query  172  QVSTIKSSTSSSTVMDTRISRSKMRTPT---ATRSKALSADRSSQVCGQQFSMTMSASSP  228
            Q + IK  T+ S      ISR + RTP      R +A S DR+  + G     TMS    
Sbjct  83   QRAAIKPPTTRSLS----ISRGRTRTPQNALPPRLQAHSVDRA--LSGD----TMS----  128

Query  229  AAAFLRWPKPGEVVLSKCGSPVVAHVMPDKFANVNIPTKNGVFSLRPKKLDELKSDIIDA  288
               F+RWP+ GE+VLSK GSP+   + PD++A+V+IPT+ GV +++P K++ +K +++  
Sbjct  129  ---FVRWPRAGEMVLSKAGSPLAVQMRPDRYADVHIPTRGGVITVKPHKINTVKREVLMQ  185

Query  289  IDADTLSQIKTLHDNLNLIMKMAD  312
            +D +TL+Q+KTL+ NL LI+ MA+
Sbjct  186  LDENTLNQVKTLNANLGLIVDMAN  209


 Score = 35.4 bits (80),  Expect = 0.033, Method: Compositional matrix adjust.
 Identities = 19/84 (23%), Positives = 43/84 (51%), Gaps = 0/84 (0%)

Query  1   MPRTKVSKSTKRFRETSSCEEKLREFEASFDGYLHALELKGKAQIKSIEDKFYMLLMGTD  60
           MPRTK++   +  R+ +  EEK+R  +   D  L  ++   K   + ++++  ++   TD
Sbjct  1   MPRTKITARRQAQRQKADREEKVRLSQIKMDSALEKIDEMSKRYKQEVDNQIKVIRGRTD  60

Query  61  SNVLDLLMGDVLSLNLTKPEDYKK  84
             +L + M + L+L      ++++
Sbjct  61  KQLLQMKMPEFLALGFKTFAEFQR  84


>SIBA_DICDI unnamed protein product
Length=1927

 Score = 32.7 bits (73),  Expect = 0.45, Method: Compositional matrix adjust.
 Identities = 19/92 (21%), Positives = 42/92 (46%), Gaps = 0/92 (0%)

Query  150   GPLSSARARRPRRSRSACDDLVQVSTIKSSTSSSTVMDTRISRSKMRTPTATRSKALSAD  209
             GP++      P ++ S+ + L Q S++  S  ++ + D    R+ +R+  A  +  + + 
Sbjct  1324  GPITFRYINVPPKAESSDETLNQDSSVSFSVKATDLEDNSNVRAVIRSLPAKGTLTIKST  1383

Query  210   RSSQVCGQQFSMTMSASSPAAAFLRWPKPGEV  241
               +      +++     +P A +  W KPG V
Sbjct  1384  GKAAEISSTYAIDDFVYTPVAGYSNWDKPGHV  1415



Lambda      K        H
   0.314    0.128    0.382 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 14120244890


Query= XP_014085256.1 PREDICTED: Golgi-specific brefeldin A-resistance
guanine nucleotide exchange factor 1 [Bactrocera oleae]

Length=2168
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A1Z8W8_DROME  unnamed protein product                                 2430    0.0  
A1Z8W9_DROME  unnamed protein product                                 2419    0.0  
A0A0B4K7N0_DROME  unnamed protein product                             2417    0.0  


>A1Z8W8_DROME unnamed protein product
Length=1983

 Score = 2430 bits (6297),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1268/1965 (65%), Positives = 1465/1965 (75%), Gaps = 156/1965 (8%)

Query  1     MTLPGNGIFVVREQMSTLMTAMRRGTRWNSAAYVDEEKDGLMKMFVNLKEMLKNVEDLRL  60
             M LPGNGI+VVR +M+TLMTAMRRGTRWN+ AYVD+E D L+K+F++LK  L  +EDLR 
Sbjct  1     MALPGNGIYVVRGEMATLMTAMRRGTRWNATAYVDDENDSLLKLFIDLKHELNRIEDLRQ  60

Query  61    IEPNIFLAPFLEVIRTDETTGAVTSLALEAINEFLSSGLIDPTSTNLAVTVENIVDAVTH  120
             IEP +FLAPFLEVIRT + TG +TSLAL ++N+ LS GLIDPTS NLA  VE I DAVTH
Sbjct  61    IEPQVFLAPFLEVIRTADATGPLTSLALASVNKLLSYGLIDPTSPNLADIVERIADAVTH  120

Query  121   ARFMGTDQSSDGVTLFCVVEVLHTLMRSPEGSVLSNEAVCEVMLSCFKICFEPRLNELLR  180
             ARFMGTDQSSDGVT   V+EVLHTL+RSPEG+ +SN ++CEVMLSCFKI FEPRL+ELLR
Sbjct  121   ARFMGTDQSSDGVTFMRVIEVLHTLIRSPEGAAVSNVSMCEVMLSCFKISFEPRLSELLR  180

Query  181   RYAKKALKDMVYLLFMRLPQFSEDRNAANVLRKFQMIATSMDQNKSKQRKKILKSGQTST  240
             R A+K+LKDMV L FMRLPQF+E+R+   + ++F +   +    + K ++K +   QT+ 
Sbjct  181   RSAEKSLKDMVLLFFMRLPQFAEERSDTMLQKRFTIGDAASGATQEKLKRKTVAQAQTAP  240

Query  241   ATNTLSRSSSDNAKPELERKLSVTTVIDPQTPHLQVP-HTKALPLATTPATPAGNILDMQ  299
                   +SS+    P+            PQ+ +L VP H KA  LATTPA+PAGNILDMQ
Sbjct  241   -----RKSSAVEEPPQ-----------TPQSANLTVPGHLKAPILATTPASPAGNILDMQ  284

Query  300   GKITQTPTTTQGIVDADGTTTTESSINVQQCEEH--VDGVEGAAPTQPLICAEQQATDAG  357
             GKITQTPTTT    + + T      I V+  E    +DG  G A                
Sbjct  285   GKITQTPTTTASTGEDETTVPETPVIQVESTESEPLLDGETGEA----------------  328

Query  358   ANNLTTTTTTLVEAEENGLQSNSGGSSEYINSVGVRFTQQNSLDGSEGAASLLPYGLPCI  417
                    T+TL EA           SSEYINSVGVRFTQQ++        SL PYGLP I
Sbjct  329   -------TSTLAEA----------NSSEYINSVGVRFTQQST---DHDVTSLSPYGLPFI  368

Query  418   QELFRFLILLCNPLDKQNTDTMIHMGLSLLTVAFKVGADNIGKYDTLLELVKDDLCRNLF  477
             QELFRFLI+LCNPLDKQN+D+M+H GLSLLTVAF+V ADNIGKY+ LLELVKDDLCRNL 
Sbjct  369   QELFRFLIILCNPLDKQNSDSMMHTGLSLLTVAFEVAADNIGKYEGLLELVKDDLCRNLI  428

Query  478   ALMNSERLTIFAADLQLCFLLFESLRGHLKFQLEAYLKKLSEIVASDSPKTPYEMRELAL  537
             +L++SERL+IFAADLQLCFLLFESLRGHLKFQLEAYL+KLSEI+ASD+PKTPYEMRELAL
Sbjct  429   SLLSSERLSIFAADLQLCFLLFESLRGHLKFQLEAYLRKLSEIIASDNPKTPYEMRELAL  488

Query  538   DNLLQLWRIPGFVSELYINYDCDLYCTDLFEGLVNLLSKYTLSATNAVYSTHIISLDTLS  597
             DNLLQLWRIPGFV+ELYINYDCDLYCTD+FE L NLLSKYTLSATNAVYSTHIIS+DTL 
Sbjct  489   DNLLQLWRIPGFVTELYINYDCDLYCTDMFESLTNLLSKYTLSATNAVYSTHIISMDTLL  548

Query  598   SVIENIEQNCIASK-LVNNENGSTGASTVTTTGRHSRHNSELEAIIID-GNNEDNKSVVE  655
             SVI++IE+NC ASK   NN      A+  T   RHSRHNS LE I+ID GN+   +  VE
Sbjct  549   SVIDSIERNCAASKNSSNNRESLPEAAPATGGSRHSRHNSGLEGIVIDSGNSVAAEEKVE  608

Query  656   NISKFINSSS-RLRLGAGGIANAGLTREYLTNVKQKKRVLSQGTELFNQRPDKGIQYLQE  714
             NI+ FIN+SS RLRL +GG    G+T E L  VKQKKR+LSQGTE FNQRP+KGIQYLQE
Sbjct  609   NIASFINASSHRLRLQSGG-EGVGITSEQLAKVKQKKRLLSQGTERFNQRPEKGIQYLQE  667

Query  715   HGILSAQLDPMQVALFLRENPGLDKKMIGEYISKKKNVDSKILMNFVDSFDFAGLRVDQA  774
             HGIL+A+LDPMQVALFLRENPGLDKKMIGEYISKKKNVDSKIL+NFVDSFDF GLRVDQA
Sbjct  668   HGILNAELDPMQVALFLRENPGLDKKMIGEYISKKKNVDSKILINFVDSFDFTGLRVDQA  727

Query  775   LRLYLETFRLPGEAPLIFLVLEHFADHWHKQNNAPFANTDAAFSLAYAIIMLNMDQHNSN  834
             LRLYLETFRLPGEAPLIFLVLEHF+DHWHKQN  PFAN DAAF LAYAIIMLNMDQHNSN
Sbjct  728   LRLYLETFRLPGEAPLIFLVLEHFSDHWHKQNQDPFANVDAAFRLAYAIIMLNMDQHNSN  787

Query  835   AKRLNVPMTQEDFLKNLRGLNGGVDFDQEMLSNVFNAIKNEEIVMPAEQTGLVRENYLWK  894
             AKRLNVPMT EDF KNLRGLNGG DFDQEML+ VFNAIKNEEIVMPAEQTGLVRENY WK
Sbjct  788   AKRLNVPMTLEDFTKNLRGLNGGEDFDQEMLAQVFNAIKNEEIVMPAEQTGLVRENYQWK  847

Query  895   VLLRRGVGLDSVYKYVQDAAYDLEVFNLLWGASLSALSFMFDKSSESGYQRILSGFTKCA  954
             VLLRRG   D  + YV DA+YD+E+FN++WGASLSALSFMFDKS+E+GYQR L+GF+K A
Sbjct  848   VLLRRGDTHDGHFHYVHDASYDVEIFNIVWGASLSALSFMFDKSTETGYQRTLAGFSKSA  907

Query  955   GIAAHYNLHANFDALILTLCKFTTLSNLSQPEATTVANNELTQSVGFGFNAKAQAAMRTV  1014
              I+AHYNLH++FDAL+LTLCKFTTL +  +      ANNE  Q+V FG N KAQAAMRTV
Sbjct  908   AISAHYNLHSDFDALVLTLCKFTTLLSSVEQHEPAPANNETQQAVNFGLNGKAQAAMRTV  967

Query  1015  FALVHDYGDCLREGWKHILELFLQLFRLKLLPKSLIEVEDFCEESGKTQLKLEKPSQKQE  1074
             F LVHDYGDCLRE WKHIL+L+LQLFRLKLLPKSLIEVEDFCE +GK  L LEKP +KQE
Sbjct  968   FLLVHDYGDCLRESWKHILDLYLQLFRLKLLPKSLIEVEDFCEANGKAMLILEKPREKQE  1027

Query  1075  AGLFSSLYSYLSSEGQREPTYEEQEFIKLGKKCIKECQLDQMIQESKFVQLESLQELLRN  1134
             +GLFSSLYS++SSEGQREPTYEEQ+FIKLG+KCIKECQLDQM+QESKFVQLESLQELL+ 
Sbjct  1028  SGLFSSLYSFISSEGQREPTYEEQDFIKLGRKCIKECQLDQMLQESKFVQLESLQELLKC  1087

Query  1135  ILALIKPPTAAKYDDGTPYAEDVVVFWMELLVKIVIQNRDRMVHLWPDVRDRIYLLLIGA  1194
             +LAL+K P   K   G PYAED  VFWME LVKIV+ NRDRM+ LWP VRD++YLLL+G+
Sbjct  1088  VLALLKAPQGHK-SIGLPYAEDQTVFWMEFLVKIVVHNRDRMIPLWPAVRDQMYLLLMGS  1146

Query  1195  TTYNYEYLLNRSIVAVLKLAIYLMRNEELCPIVLQSLKMLLTLKSAVILRISRQISTGVY  1254
              +  Y+YLLNR IVAVLKLAIYLMRNEELCPIVLQSLKMLL LK A++LRIS+QIS G+Y
Sbjct  1147  ASCGYDYLLNRCIVAVLKLAIYLMRNEELCPIVLQSLKMLLMLKPALLLRISKQISIGIY  1206

Query  1255  ELLKTSAQNIHSEQDWQIIFTILECVGAGAVPPEYVDIILPQLPLELGGGANSEGTLSSE  1314
             ELLKTSAQNIHSEQDWQIIF +LECVGAGAVPP Y D    QLPL   G A S+G +S E
Sbjct  1207  ELLKTSAQNIHSEQDWQIIFNLLECVGAGAVPPNYDDA---QLPLPPNGSAKSDGAISGE  1263

Query  1315  ED-SGLPDRGYLSDTDASIKSQQQPAQQ