BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_050572977.1 glucose transporter type 1 isoform X9 [Bombus
affinis]

Length=847
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GTR1_DROME  unnamed protein product                                   865     0.0   
FGT1_CAEEL  unnamed protein product                                   375     5e-121
Q7KJP2_DROME  unnamed protein product                                 201     3e-56 


>GTR1_DROME unnamed protein product
Length=1440

 Score = 865 bits (2235),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/488 (88%), Positives = 452/488 (93%), Gaps = 7/488 (1%)

Query  339  LLEQGLTLFLSYAILAAVLGMLQFGYNTGVINAPEVNIENFMKDVYKDRYGEDISDDSVK  398
            L   GLT FL+Y+I +AVLGMLQFGYNTGVINAPE NIENFMKDVYKDRYGEDIS++ ++
Sbjct  4    LCAPGLTFFLTYSIFSAVLGMLQFGYNTGVINAPEKNIENFMKDVYKDRYGEDISEEFIQ  63

Query  399  KLYSVAVSIFAIGGMLGGFSGGIIANRFGRKGGLLLNNVLGIVGACLMGCTKIAHSYEML  458
            +LYSVAVSIFAIGGMLGGFSGG +ANRFGRKGGLLLNNVLGI GACLMG TK++HSYEML
Sbjct  64   QLYSVAVSIFAIGGMLGGFSGGWMANRFGRKGGLLLNNVLGIAGACLMGFTKVSHSYEML  123

Query  459  FFGRFIIGVNCGLNTSLVPMYISEIAPLNLRGGLGTVNQLAVTVGLLVSQVLGIEQILGT  518
            F GRFIIGVNCGLNTSLVPMYISEIAPLNLRGGLGTVNQLAVTVGLL+SQVLGIEQILGT
Sbjct  124  FLGRFIIGVNCGLNTSLVPMYISEIAPLNLRGGLGTVNQLAVTVGLLLSQVLGIEQILGT  183

Query  519  NEGWPVLLGLAICPAILQLLLLPVCPESPRYLLITKQWEEEARKALRRLRASNQVEEDIE  578
            NEGWP+LLGLAICPAILQL+LLPVCPESPRYLLITKQWEEEARKALRRLRAS  VEEDIE
Sbjct  184  NEGWPILLGLAICPAILQLILLPVCPESPRYLLITKQWEEEARKALRRLRASGSVEEDIE  243

Query  579  EMRAEERAQQAESRISMTELICSPTLRAPLVIGVVMQLSQQLSGINAVFYYSTNLFTSSG  638
            EMRAEERAQQ+ES IS  ELICSPTLR PL+IG+VMQLSQQ SGINAVFYYST+LF SSG
Sbjct  244  EMRAEERAQQSESHISTMELICSPTLRPPLIIGIVMQLSQQFSGINAVFYYSTSLFMSSG  303

Query  639  LTEESAKFATIGIGAIMVLMTLGSIPLMDRTGRRTLHLYGLGGMFIFSIFITISFLIKEF  698
            LTEESAKFATIGIGAIMV+MTL SIPLMDRTGRRTLHLYGLGGMFIFSIFITISFLIK  
Sbjct  304  LTEESAKFATIGIGAIMVVMTLVSIPLMDRTGRRTLHLYGLGGMFIFSIFITISFLIK--  361

Query  699  FGYVQEMIDWMSYLSVVSTLSFVVFFAVGPGSIPWMITAELFSQGPRPAAMSIAVLVNWM  758
                 EMIDWMSYLSVV+TL FVVFFAVGPGSIPWMITAELFSQGPRP+AM+IAVLVNWM
Sbjct  362  -----EMIDWMSYLSVVATLGFVVFFAVGPGSIPWMITAELFSQGPRPSAMAIAVLVNWM  416

Query  759  ANFLVGIGFPSMKTSLENYTFLPFSAFLAIFWIFTYKKVPETKNKTFEEILALFRHGNDR  818
            ANF+VGIGFPSMKT+LENYTFLPFS FLAIFWIFTYKKVPETKNKTFEEILALFRH N R
Sbjct  417  ANFVVGIGFPSMKTALENYTFLPFSVFLAIFWIFTYKKVPETKNKTFEEILALFRHNNGR  476

Query  819  EEELATNS  826
                 TNS
Sbjct  477  SMLNCTNS  484


>FGT1_CAEEL unnamed protein product
Length=510

 Score = 375 bits (963),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 202/480 (42%), Positives = 302/480 (63%), Gaps = 8/480 (2%)

Query  335  RKLRLLEQGLTLFLSYAILAAVLGMLQFGYNTGVINAPEVNIENFMKDVYKDRYGEDISD  394
            +K+   +  LT  L+++     L   QFGY+ G +NAP   I  ++   +KD + +++S 
Sbjct  33   QKIIFPDGKLTKCLAFSAFVITLASFQFGYHIGCVNAPGGLITEWIIGSHKDLFDKELSR  92

Query  395  DSVKKLYSVAVSIFAIGGMLGGFSGGIIANRFGRKGGLLLNNVLGIVGACLMGCTKIAHS  454
            ++    +SVAVS+FA+GGM+GG S G +A++ GR+G L  NN+L +  A LMG  K   +
Sbjct  93   ENADLAWSVAVSVFAVGGMIGGLSSGWLADKVGRRGALFYNNLLALAAAALMGLAKSVGA  152

Query  455  YEMLFFGRFIIGVNCGLNTSLVPMYISEIAPLNLRGGLGTVNQLAVTVGLLVSQVLGIEQ  514
            Y M+  GR IIG+NCG +++LVPM+++EI+P NLRG LG+++QL VT+ +LVSQ+ G+  
Sbjct  153  YPMVILGRLIIGLNCGFSSALVPMFLTEISPNNLRGMLGSLHQLLVTIAILVSQIFGLPH  212

Query  515  ILGTNEGWPVLLGLAICPAILQLLLLPVCPESPRYLLITKQWEEEARKALRRLRASNQVE  574
            +LGT + WP++    + PA+LQL LL +CPESP+Y +  +    EA  AL++LR +  V 
Sbjct  213  LLGTGDRWPLIFAFTVVPAVLQLALLMLCPESPKYTMAVRGQRNEAESALKKLRDTEDVS  272

Query  575  EDIEEMRAEERAQQAESRISMTELICSPTLRAPLVIGVVMQLSQQLSGINAVFYYSTNLF  634
             +IE M+ E  A   + +  M ++     L  P+ I ++M L+QQLSGIN   +YST +F
Sbjct  273  TEIEAMQEEATAAGVQEKPKMGDMF-KGALLWPMSIAIMMMLAQQLSGINVAMFYSTVIF  331

Query  635  TSSGLTEESAKFATIGIGAIMVLMTLGSIPLMD--RTGRRTLHLYGLGGMFIFSIFITIS  692
              +GLT     +ATIG+GA+ V+MTL S+ L+D  + GRR+L L GL GMF+ ++ +  +
Sbjct  332  RGAGLTGNEPFYATIGMGAVNVIMTLISVWLVDHPKFGRRSLLLAGLTGMFVSTLLLVGA  391

Query  693  FLIKEFFGYVQEMIDWMSYLSVVSTLSFVVFFAVGPGSIPWMITAELFSQGPRPAAMSIA  752
              I+   G       W SY ++   L FV+ FA GPG+IPW   +E+F    R  A SIA
Sbjct  392  LTIQNSGGD-----KWASYSAIGFVLLFVISFATGPGAIPWFFVSEIFDSSARGNANSIA  446

Query  753  VLVNWMANFLVGIGFPSMKTSLENYTFLPFSAFLAIFWIFTYKKVPETKNKTFEEILALF  812
            V+VNW AN LVG+ F  +   ++ Y+F  FS FLA F  +T+K VPETK K+ E+I A F
Sbjct  447  VMVNWAANLLVGLTFLPINNLMQQYSFFIFSGFLAFFIFYTWKFVPETKGKSIEQIQAEF  506


>Q7KJP2_DROME unnamed protein product
Length=476

 Score = 201 bits (511),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 148/485 (31%), Positives = 249/485 (51%), Gaps = 29/485 (6%)

Query  341  EQGLTLFLSYAILAAVLG-MLQFGYNTGVINAPEVNIENFMKDVYKDRYGEDISDDSVKK  399
            +QG T  L    +   +G ++  GY  GV+NAP   I +++ +   +RY   + D  +  
Sbjct  5    KQGWTCLLVLICVCITVGTVIPVGYAFGVMNAPSAFIRSWIMESVLERYSSRLGDSQMTI  64

Query  400  LYSVAVSIFAIGGMLGGFSGGIIANRFGRKGGLLLNNVLGIVGA-CLMGCTKIAHSYEML  458
            + S  VSIF IGGMLG     I + R GR+G L L+ +L +V   C + C ++A+S EML
Sbjct  65   IMSTVVSIFLIGGMLGAPFAPIFSARLGRRGILTLSGLLLLVSCICQLFC-RMANSIEML  123

Query  459  FFGRFIIGVNCGLNTSLVPMYISEIAPLNLRGGLGTVNQLAVTVGLLVSQVLGIEQILGT  518
              GR I G+   L  +  PMY+ E+AP  L G +G    + +T G+++ QV   + +LGT
Sbjct  124  LLGRLIGGLAAALIYATQPMYLVELAPAELSGSVGVFTCIGLTGGIVLGQVFSFDFLLGT  183

Query  519  NEGWPVLLGLAICPAILQLLLLPVCPESPRYLLITKQWEEEARKALRRLRAS-NQVEEDI  577
             + WP  L  +    ++ L  +   PESPR+L+ ++   E+AR  L RLR    +V  ++
Sbjct  184  EKLWPYALSGSAIFVLIGLAPIFWFPESPRFLM-SQGRREKARVTLMRLRRDEGRVNAEM  242

Query  578  EEMRAEERAQQAESRISMTELICSPTLRAPLVIGVVMQLSQQLSGINAVFYYSTNLFTSS  637
             E    E +   E +++M +++C+  L+ PL I       QQ+SGI+A+++YS  +FT S
Sbjct  243  AEF---EVSSTDEGQVTMKQVLCNSKLKLPLFIVCSFHFVQQMSGISAIWFYSIEIFTQS  299

Query  638  GLTEESAKFATIGIGAIMVLMTLGSIPLMDRTGRRTLHLYGLGGMFIFSIFITISFLIKE  697
            G T   A +    +G +  +  L    LM    RR +              +TIS L   
Sbjct  300  GFTAAVAMWLNFALGLLNFISALMGPWLMRSFNRRLM--------------MTISCLCSA  345

Query  698  FF-------GYVQEMIDWMSYLSVVSTLSFVVFFAVGPGSIPWMITAELFSQGPRPAAMS  750
             F         +   I   S+  +     +++ F +G G  P+ I +E+F    RP+AM+
Sbjct  346  IFLVLLVVGLELMSTIHEFSFTCIAFLSLYIITFNMGLGPTPYFIGSEIFETASRPSAMA  405

Query  751  IAVLVNWMANFLVGIGFPSMKTSLENYTFLPFSAFLAIFWIFTYKKVPETKNKTFEEILA  810
            +    NW+ANF++ + FP++ ++   + FL    F A  ++ TY+ +PET+N+  +++  
Sbjct  406  LGSFFNWLANFVLNMIFPTLNSATGPFVFLLCVVFCAYGFLLTYRYLPETRNRDAKDVAQ  465

Query  811  LFRHG  815
            L  +G
Sbjct  466  LMENG  470



Lambda      K        H
   0.317    0.133    0.383 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10587853120


Query= XP_050572978.1 uridine phosphorylase 1 isoform X1 [Bombus affinis]

Length=369
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VBA0_DROME  unnamed protein product                                 509     0.0  
Q8IMQ8_DROME  unnamed protein product                                 508     0.0  
UTPP_CAEEL  unnamed protein product                                   225     2e-71


>Q9VBA0_DROME unnamed protein product
Length=368

 Score = 509 bits (1312),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 244/332 (73%), Positives = 285/332 (86%), Gaps = 4/332 (1%)

Query  40   VRYTDGSVRLRNPNIELMDQDILYHLALGSGSHDLVEMFGDVKFVCMGGTPKRMEDFAHF  99
             RY+DG+V+LRN NIELMDQDILYHLALGS SHDL EMFGDVKFVCMGGTPKRME+FAHF
Sbjct  39   TRYSDGTVKLRNSNIELMDQDILYHLALGSESHDLQEMFGDVKFVCMGGTPKRMENFAHF  98

Query  100  IMKEIGHKLPAGTTLLDISQYSYRYSMYKVGPVLSISHGMGMPSVGILLHEMIKLMYHAK  159
            IM EIG+KLPAGT L DIS YSYRYSMYKVGPVL +SHGMG PSV IL+HEMIKLMYHAK
Sbjct  99   IMNEIGYKLPAGTQLQDISAYSYRYSMYKVGPVLCVSHGMGTPSVSILMHEMIKLMYHAK  158

Query  160  VKDPIFFRIGTCGGIGLEGGTVVISEEAVDGMLKSYLEVPVLGKMVRRPAKLDRQLARDL  219
             KDP+F RIGTCGGIG++GGTV+I+E+A+DG L++  E  +LGK + RPAKLD++LAR+L
Sbjct  159  CKDPVFIRIGTCGGIGVDGGTVIITEDALDGQLRNSHEFTILGKTIHRPAKLDKKLAREL  218

Query  220  KALAHRDDPYDTVIGKTMCTDDFYEGQGRMDGAFCEFTENDKMDYLNKLHKAGVVNIEME  279
            K+LA  DDPYDT+IGKT+CT+DFYEGQGR+DGAFC+F+EN+KM YL KL + GVVNIEME
Sbjct  219  KSLASPDDPYDTIIGKTLCTNDFYEGQGRLDGAFCDFSENEKMAYLEKLRENGVVNIEME  278

Query  280  SLSFGALTHLAGIKSAVVCVTLLDRFKGDQVLAPKEVLNEWQIRPQQLVARYITRYLQRK  339
            S  F ALTH AGIK+AVVCV LL+R  GDQV APKEV+NEWQ RPQ LV+RYI + L   
Sbjct  279  STIFAALTHHAGIKAAVVCVALLNRLNGDQVNAPKEVMNEWQARPQILVSRYIRKVLTHN  338

Query  340  GRL-SLDGH-GSVYVKSPRRFKLVQQESENYD  369
            G+L +L GH GS  +KSPRRFKLVQQES+ ++
Sbjct  339  GQLKALFGHQGS--IKSPRRFKLVQQESQAHE  368


>Q8IMQ8_DROME unnamed protein product
Length=347

 Score = 508 bits (1309),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 243/330 (74%), Positives = 284/330 (86%), Gaps = 4/330 (1%)

Query  42   YTDGSVRLRNPNIELMDQDILYHLALGSGSHDLVEMFGDVKFVCMGGTPKRMEDFAHFIM  101
            Y+DG+V+LRN NIELMDQDILYHLALGS SHDL EMFGDVKFVCMGGTPKRME+FAHFIM
Sbjct  20   YSDGTVKLRNSNIELMDQDILYHLALGSESHDLQEMFGDVKFVCMGGTPKRMENFAHFIM  79

Query  102  KEIGHKLPAGTTLLDISQYSYRYSMYKVGPVLSISHGMGMPSVGILLHEMIKLMYHAKVK  161
             EIG+KLPAGT L DIS YSYRYSMYKVGPVL +SHGMG PSV IL+HEMIKLMYHAK K
Sbjct  80   NEIGYKLPAGTQLQDISAYSYRYSMYKVGPVLCVSHGMGTPSVSILMHEMIKLMYHAKCK  139

Query  162  DPIFFRIGTCGGIGLEGGTVVISEEAVDGMLKSYLEVPVLGKMVRRPAKLDRQLARDLKA  221
            DP+F RIGTCGGIG++GGTV+I+E+A+DG L++  E  +LGK + RPAKLD++LAR+LK+
Sbjct  140  DPVFIRIGTCGGIGVDGGTVIITEDALDGQLRNSHEFTILGKTIHRPAKLDKKLARELKS  199

Query  222  LAHRDDPYDTVIGKTMCTDDFYEGQGRMDGAFCEFTENDKMDYLNKLHKAGVVNIEMESL  281
            LA  DDPYDT+IGKT+CT+DFYEGQGR+DGAFC+F+EN+KM YL KL + GVVNIEMES 
Sbjct  200  LASPDDPYDTIIGKTLCTNDFYEGQGRLDGAFCDFSENEKMAYLEKLRENGVVNIEMEST  259

Query  282  SFGALTHLAGIKSAVVCVTLLDRFKGDQVLAPKEVLNEWQIRPQQLVARYITRYLQRKGR  341
             F ALTH AGIK+AVVCV LL+R  GDQV APKEV+NEWQ RPQ LV+RYI + L   G+
Sbjct  260  IFAALTHHAGIKAAVVCVALLNRLNGDQVNAPKEVMNEWQARPQILVSRYIRKVLTHNGQ  319

Query  342  L-SLDGH-GSVYVKSPRRFKLVQQESENYD  369
            L +L GH GS  +KSPRRFKLVQQES+ ++
Sbjct  320  LKALFGHQGS--IKSPRRFKLVQQESQAHE  347


>UTPP_CAEEL unnamed protein product
Length=295

 Score = 225 bits (573),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 134/294 (46%), Positives = 183/294 (62%), Gaps = 12/294 (4%)

Query  44   DGSVRLRNPNIELMDQ-DILYHLALGSGSHDLVEMFGDVKFVCMGGTPKRMEDFAHFIMK  102
            +G+V   N   ++ D+ D LYH   G  + D+  +FGD KFVC GG+P R + +A +  K
Sbjct  7    NGNVEKPNKYFDIKDKRDFLYHFGFGVDTLDIPAVFGDTKFVCTGGSPGRFKLYAEWFAK  66

Query  103  EIGHKLPAGTTLLDISQYSYRYSMYKVGPVLSISHGMGMPSVGILLHEMIKLMYHAKVKD  162
            E    +P    L      S R+ +YK GPV  I+HGMG PS+ I+L E  KLM+HA VK+
Sbjct  67   EA--NIPCSENL----SRSDRFVIYKTGPVCWINHGMGTPSLSIMLVESFKLMHHAGVKN  120

Query  163  PIFFRIGTCGGIGLEGGTVVISEEAVDGML-KSYLEVPVLGKMVRRPAKLDRQLARDLKA  221
            P F R+GT GG+G+  GTVV+S EA++  L  +Y+++ + GK + RP +LD  L   L  
Sbjct  121  PTFIRLGTSGGVGVPPGTVVVSTEAMNAELGDTYVQI-IAGKRIERPTQLDAALREALCE  179

Query  222  LA-HRDDPYDTVIGKTMCTDDFYEGQGRMDGAFCEFTENDKMDYLNKLHKAGVVNIEMES  280
            +   +  P +T  GKTMC DDFYEGQ R+DG FC++ E DK  +L KL+  GV NIEMES
Sbjct  180  VGKEKSIPVET--GKTMCADDFYEGQMRLDGYFCDYEEEDKYAFLRKLNALGVRNIEMES  237

Query  281  LSFGALTHLAGIKSAVVCVTLLDRFKGDQVLAPKEVLNEWQIRPQQLVARYITR  334
              F + T  AG +SA+VCVTLL+R  GDQV   KE   E++ RP +LV  YI +
Sbjct  238  TCFASFTCRAGFQSAIVCVTLLNRMDGDQVQIAKEQYIEYEERPFRLVTAYIRK  291



Lambda      K        H
   0.317    0.133    0.383 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10587853120


Query= XP_050572979.1 uridine phosphorylase 1 isoform X2 [Bombus affinis]

Length=340
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8IMQ8_DROME  unnamed protein product                                 525     0.0  
Q9VBA0_DROME  unnamed protein product                                 510     0.0  
UTPP_CAEEL  unnamed protein product                                   226     2e-72


>Q8IMQ8_DROME unnamed protein product
Length=347

 Score = 525 bits (1351),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/341 (74%), Positives = 292/341 (86%), Gaps = 4/341 (1%)

Query  2    SLLLEEEELDEYTDGSVRLRNPNIELMDQDILYHLALGSGSHDLVEMFGDVKFVCMGGTP  61
            S  L EEELDEY+DG+V+LRN NIELMDQDILYHLALGS SHDL EMFGDVKFVCMGGTP
Sbjct  9    SASLSEEELDEYSDGTVKLRNSNIELMDQDILYHLALGSESHDLQEMFGDVKFVCMGGTP  68

Query  62   KRMEDFAHFIMKEIGHKLPAGTTLLDISQYSYRYSMYKVGPVLSISHGMGMPSVGILLHE  121
            KRME+FAHFIM EIG+KLPAGT L DIS YSYRYSMYKVGPVL +SHGMG PSV IL+HE
Sbjct  69   KRMENFAHFIMNEIGYKLPAGTQLQDISAYSYRYSMYKVGPVLCVSHGMGTPSVSILMHE  128

Query  122  MIKLMYHAKVKDPIFFRIGTCGGIGLEGGTVVISEEAVDGMLKSYLEVPVLGKMVRRPAK  181
            MIKLMYHAK KDP+F RIGTCGGIG++GGTV+I+E+A+DG L++  E  +LGK + RPAK
Sbjct  129  MIKLMYHAKCKDPVFIRIGTCGGIGVDGGTVIITEDALDGQLRNSHEFTILGKTIHRPAK  188

Query  182  LDRQLARDLKALAHRDDPYDTVIGKTMCTDDFYEGQGRMDGAFCEFTENDKMDYLNKLHK  241
            LD++LAR+LK+LA  DDPYDT+IGKT+CT+DFYEGQGR+DGAFC+F+EN+KM YL KL +
Sbjct  189  LDKKLARELKSLASPDDPYDTIIGKTLCTNDFYEGQGRLDGAFCDFSENEKMAYLEKLRE  248

Query  242  AGVVNIEMESLSFGALTHLAGIKSAVVCVTLLDRFKGDQVLAPKEVLNEWQIRPQQLVAR  301
             GVVNIEMES  F ALTH AGIK+AVVCV LL+R  GDQV APKEV+NEWQ RPQ LV+R
Sbjct  249  NGVVNIEMESTIFAALTHHAGIKAAVVCVALLNRLNGDQVNAPKEVMNEWQARPQILVSR  308

Query  302  YITRYLQRKGRL-SLDGH-GSVYVKSPRRFKLVQQESENYD  340
            YI + L   G+L +L GH GS  +KSPRRFKLVQQES+ ++
Sbjct  309  YIRKVLTHNGQLKALFGHQGS--IKSPRRFKLVQQESQAHE  347


>Q9VBA0_DROME unnamed protein product
Length=368

 Score = 510 bits (1313),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/346 (71%), Positives = 291/346 (84%), Gaps = 12/346 (3%)

Query  5    LEEEELDE--------YTDGSVRLRNPNIELMDQDILYHLALGSGSHDLVEMFGDVKFVC  56
            L+++E D+        Y+DG+V+LRN NIELMDQDILYHLALGS SHDL EMFGDVKFVC
Sbjct  25   LQDDETDDAYVKRITRYSDGTVKLRNSNIELMDQDILYHLALGSESHDLQEMFGDVKFVC  84

Query  57   MGGTPKRMEDFAHFIMKEIGHKLPAGTTLLDISQYSYRYSMYKVGPVLSISHGMGMPSVG  116
            MGGTPKRME+FAHFIM EIG+KLPAGT L DIS YSYRYSMYKVGPVL +SHGMG PSV 
Sbjct  85   MGGTPKRMENFAHFIMNEIGYKLPAGTQLQDISAYSYRYSMYKVGPVLCVSHGMGTPSVS  144

Query  117  ILLHEMIKLMYHAKVKDPIFFRIGTCGGIGLEGGTVVISEEAVDGMLKSYLEVPVLGKMV  176
            IL+HEMIKLMYHAK KDP+F RIGTCGGIG++GGTV+I+E+A+DG L++  E  +LGK +
Sbjct  145  ILMHEMIKLMYHAKCKDPVFIRIGTCGGIGVDGGTVIITEDALDGQLRNSHEFTILGKTI  204

Query  177  RRPAKLDRQLARDLKALAHRDDPYDTVIGKTMCTDDFYEGQGRMDGAFCEFTENDKMDYL  236
             RPAKLD++LAR+LK+LA  DDPYDT+IGKT+CT+DFYEGQGR+DGAFC+F+EN+KM YL
Sbjct  205  HRPAKLDKKLARELKSLASPDDPYDTIIGKTLCTNDFYEGQGRLDGAFCDFSENEKMAYL  264

Query  237  NKLHKAGVVNIEMESLSFGALTHLAGIKSAVVCVTLLDRFKGDQVLAPKEVLNEWQIRPQ  296
             KL + GVVNIEMES  F ALTH AGIK+AVVCV LL+R  GDQV APKEV+NEWQ RPQ
Sbjct  265  EKLRENGVVNIEMESTIFAALTHHAGIKAAVVCVALLNRLNGDQVNAPKEVMNEWQARPQ  324

Query  297  QLVARYITRYLQRKGRL-SLDGH-GSVYVKSPRRFKLVQQESENYD  340
             LV+RYI + L   G+L +L GH GS  +KSPRRFKLVQQES+ ++
Sbjct  325  ILVSRYIRKVLTHNGQLKALFGHQGS--IKSPRRFKLVQQESQAHE  368


>UTPP_CAEEL unnamed protein product
Length=295

 Score = 226 bits (577),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 134/294 (46%), Positives = 183/294 (62%), Gaps = 12/294 (4%)

Query  15   DGSVRLRNPNIELMDQ-DILYHLALGSGSHDLVEMFGDVKFVCMGGTPKRMEDFAHFIMK  73
            +G+V   N   ++ D+ D LYH   G  + D+  +FGD KFVC GG+P R + +A +  K
Sbjct  7    NGNVEKPNKYFDIKDKRDFLYHFGFGVDTLDIPAVFGDTKFVCTGGSPGRFKLYAEWFAK  66

Query  74   EIGHKLPAGTTLLDISQYSYRYSMYKVGPVLSISHGMGMPSVGILLHEMIKLMYHAKVKD  133
            E    +P    L      S R+ +YK GPV  I+HGMG PS+ I+L E  KLM+HA VK+
Sbjct  67   EA--NIPCSENL----SRSDRFVIYKTGPVCWINHGMGTPSLSIMLVESFKLMHHAGVKN  120

Query  134  PIFFRIGTCGGIGLEGGTVVISEEAVDGML-KSYLEVPVLGKMVRRPAKLDRQLARDLKA  192
            P F R+GT GG+G+  GTVV+S EA++  L  +Y+++ + GK + RP +LD  L   L  
Sbjct  121  PTFIRLGTSGGVGVPPGTVVVSTEAMNAELGDTYVQI-IAGKRIERPTQLDAALREALCE  179

Query  193  LA-HRDDPYDTVIGKTMCTDDFYEGQGRMDGAFCEFTENDKMDYLNKLHKAGVVNIEMES  251
            +   +  P +T  GKTMC DDFYEGQ R+DG FC++ E DK  +L KL+  GV NIEMES
Sbjct  180  VGKEKSIPVET--GKTMCADDFYEGQMRLDGYFCDYEEEDKYAFLRKLNALGVRNIEMES  237

Query  252  LSFGALTHLAGIKSAVVCVTLLDRFKGDQVLAPKEVLNEWQIRPQQLVARYITR  305
              F + T  AG +SA+VCVTLL+R  GDQV   KE   E++ RP +LV  YI +
Sbjct  238  TCFASFTCRAGFQSAIVCVTLLNRMDGDQVQIAKEQYIEYEERPFRLVTAYIRK  291



Lambda      K        H
   0.317    0.133    0.383 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10587853120


Query= XP_050572980.1 phosphatidylserine lipase ABHD16A [Bombus affinis]

Length=567
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VZF1_DROME  unnamed protein product                                 380     3e-126
AHO3_CAEEL  unnamed protein product                                   35.8    0.088 
Q9VBX8_DROME  unnamed protein product                                 35.4    0.11  


>Q9VZF1_DROME unnamed protein product
Length=524

 Score = 380 bits (977),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 214/544 (39%), Positives = 312/544 (57%), Gaps = 36/544 (7%)

Query  1    MSFIRTLWKCNFGPRLFKVYEITWIGRLVEKSYEPNSLERWGDQIVICFAAIWSISLYTI  60
            MSF+  +    FGP L+  Y    +     K YE  ++E++G+QI+   + +WS+  YT 
Sbjct  1    MSFLNYV----FGPNLYMEYR--GVPEPQRKMYEAGAVEKFGEQILSTLSVMWSVGYYTS  54

Query  61   PLVAIFFYQHSNSITENISFLCKLAASASAIFIASLAARGYSRASNPIYLKFLKTLNEVN  120
            PL+  F Y+    +T++I  L K+  S   I I SL  RG  R  +  Y   +K L    
Sbjct  55   PLLVTFLYRRGYLVTDSIPTLAKITTSVGLIVILSLVMRGLGRKQSRSYSNMIKALVRAK  114

Query  121  AHYTV-ETKQELDKYEFEFWARPVDFDIRNIKKVTAKGKLTLENIAAFSGHIKRQTGKEF  179
            +     +   EL +++ EF A PVDFD++ +   T K  +T            R+     
Sbjct  115  SSKAPGDANSELRRFDIEFNAWPVDFDVKALTGDTKKPVVT-----------ARRREPIQ  163

Query  180  ICTLPCKFLSYIVAHTFAIKMIYPGSATVLNWAFRSTLLKGRIHLIKR-GGERYKLLTAD  238
            + TLPC+ ++Y+  +TF + MIYPGS  +L    R  L+ GR  LI+   G RYK+ T D
Sbjct  164  LATLPCEAIAYLAINTFGLSMIYPGSVKLLQKLMRPMLISGRAKLIEDDNGIRYKVKTID  223

Query  239  NNEIDAIFVDRR-NKKTNGNMLVITCEGNCGFYESGIISTPMSKGYSILGWNHPGFGSST  297
            +NEID +F+D R N   NG  LVI  EGN GFYE GI++TP++  YS+LGWNHPGF  ST
Sbjct  224  SNEIDTLFIDNRPNNVGNGKTLVICSEGNAGFYEVGIMATPVALKYSVLGWNHPGFAGST  283

Query  298  GAPYPLQEENAIDCVMRFAIDHLKFPEEQIIVYGWSIGGYTATWAAMNYPSIQSLVLDAT  357
            G P+P Q++NAID V++FAI++L+FP E II+YGWSIGG++  +AA  YP ++ +VLDAT
Sbjct  284  GTPHPHQDKNAIDAVVQFAINNLRFPVEDIILYGWSIGGFSTLYAASVYPDVKGVVLDAT  343

Query  358  FDDVLPLAIMTMPSSLEGLVRNIIRDYFNLNIAEQLNRYNGTVLLIRRTEDEVVCTPSGN  417
            FDDVL LA+  MP++L G+V+  IR+Y NLN AE  N +NG +  IRRTEDE++     N
Sbjct  344  FDDVLYLAVPRMPAALAGIVKVAIRNYCNLNNAELANEFNGPISFIRRTEDEIIA--EDN  401

Query  418  NLSGNRGNMLLTKLLIRRYPHIF--AETSGCATLLVRFLSADISTRKSIIETVGVDEKQC  475
            ++  NRGN L+  +L  RYP+IF  ++ +    LL + L                DEK C
Sbjct  402  HIDTNRGNFLVLSVLKHRYPNIFGASQLNKAKGLLSKPLEP--------YSIPVADEKLC  453

Query  476  L-KLIGADIKKNDDIVLYPSTLGEDCDSTTKQQLIVFLATMYMKDQPSSHCTPLTVDLFQ  534
            + +LI      +D+   +P  +G D     +  + VFL   +++D  S+HCT L  + F 
Sbjct  454  MSRLI---TYASDEGKSFPMNIGADYSEEVRNLMAVFLLRKHLRDYNSTHCTQLPGEFFT  510

Query  535  PGWN  538
              W+
Sbjct  511  MPWD  514


>AHO3_CAEEL unnamed protein product
Length=332

 Score = 35.8 bits (81),  Expect = 0.088, Method: Compositional matrix adjust.
 Identities = 34/127 (27%), Positives = 54/127 (43%), Gaps = 10/127 (8%)

Query  285  ILGWNHPGFGSSTGAPYPLQEENAIDCVMRFAIDHLKFPEEQIIVYGWSIGGYTATWAAM  344
            +  +++ G+G STG P        I             P+E+II+YG SIG   +   A 
Sbjct  143  VFSYDYSGYGCSTGKPSEKNLYADITAAFELLKSEFGVPKEKIILYGQSIGTVPSVDLA-  201

Query  345  NYPSIQSLVLDATFDDVLPLAIMTMPSSLEGLVRNIIRDYFNLNIAEQLNRYNGTVLLIR  404
            +   + +LVL +      PL +  M  +  G       D F     E++ R     L+I 
Sbjct  202  SREDLAALVLHS------PL-MSGMRVAFPGTTTTWCCDAF--PSIEKVPRVKCPTLVIH  252

Query  405  RTEDEVV  411
             T+DEV+
Sbjct  253  GTDDEVI  259


>Q9VBX8_DROME unnamed protein product
Length=286

 Score = 35.4 bits (80),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 56/130 (43%), Gaps = 14/130 (11%)

Query  284  SILGWNHPGFGSSTGAPYPLQEENAIDCVMRFAIDHLKFPEEQIIVYGWSIGGYTATWAA  343
            +I G+++ G+G S G P        I+   +          E II+YG SIG       A
Sbjct  120  NIFGYDYSGYGMSGGKPSEKNLYADIEAAWQAMRTRFNISPETIILYGQSIGTVPTVDLA  179

Query  344  MNYPSIQSLVLDATFDDVLPLAIMTMPSSLEGLVRNIIRDYF--NLNIAEQLNRYNGTVL  401
              +  + +++L +      PL      S L  + RN  R +F       +++ +    VL
Sbjct  180  SRH-EVGAVILHS------PLM-----SGLRVVFRNTKRTWFFDAFPSIDKVAKVKAPVL  227

Query  402  LIRRTEDEVV  411
            +I  T+DEV+
Sbjct  228  VIHGTDDEVI  237



Lambda      K        H
   0.317    0.133    0.383 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10587853120


Query= XP_050572981.1 RNA-binding protein squid isoform X1 [Bombus affinis]

Length=362
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SQD_DROME  unnamed protein product                                    286     5e-95
G5EFS2_CAEEL  unnamed protein product                                 142     3e-39
RB27C_DROME  unnamed protein product                                  139     2e-37


>SQD_DROME unnamed protein product
Length=344

 Score = 286 bits (733),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 143/209 (68%), Positives = 171/209 (82%), Gaps = 7/209 (3%)

Query  7    KDFSEDI-ADQNFEQNGEAENGGGDATENGQESQEDRSTGGNQDSLNDRKLFVGGLSWET  65
            +DF++D+ AD    +NG+A   G   + NG    +  ++G   D   DRKLFVGGLSWET
Sbjct  14   EDFTKDVTADGPGSENGDA---GAAGSTNGSSDNQSAASGQRDD---DRKLFVGGLSWET  67

Query  66   TDKELRDHFGTYGDIESINVKTDPNTGRSRGFAFIVFAKAESLDKIMAAGDHIINNKKVD  125
            T+KELRDHFG YG+IESINVKTDP TGRSRGFAFIVF   E++DK+ AA +HIIN+KKVD
Sbjct  68   TEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHIINSKKVD  127

Query  126  PKKAKARHGKVFVGGLSTELSDDDIKHFFSQFGTIVEVEMPFDKTKNQRKGFCFITFESE  185
            PKKAKARHGK+FVGGL+TE+SD++IK +F QFG IVEVEMPFDK K+QRKGFCFITF+SE
Sbjct  128  PKKAKARHGKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSE  187

Query  186  QVVNELLKTPKQTINGKEVDVKKATPKPD  214
            QVV +LLKTPKQ I GKEVDVK+ATPKP+
Sbjct  188  QVVTDLLKTPKQKIAGKEVDVKRATPKPE  216


>G5EFS2_CAEEL unnamed protein product
Length=320

 Score = 142 bits (357),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/229 (33%), Positives = 119/229 (52%), Gaps = 14/229 (6%)

Query  55   KLFVGGLSWETTDKELRDHFGTYGDIESINVKTDPNTGRSRGFAFIVFAKAESLDKIMAA  114
            K+F+GGLSW+TT + LRD+FG +G++    V  DP T R+RGF FI F    S+DK++  
Sbjct  46   KMFIGGLSWQTTAENLRDYFGRFGEVNECMVMRDPATKRARGFGFITFVDPSSVDKVLNN  105

Query  115  GDHIINNKKVDPK---------KAKARHGKVFVGGLSTELSDDDIKHFFSQFGTIVEVEM  165
             +H ++ KK+DPK         K   +  KVF+GGLS   + +D+K +F  +G + +  +
Sbjct  106  REHELDGKKIDPKVAFPKRTQAKLVTKTKKVFIGGLSATSTLEDMKQYFETYGKVEDAML  165

Query  166  PFDKTKNQRKGFCFITFESEQVVNELLKTPKQTINGKEVDVKKATPKPDGMGGMRGGAGG  225
             FDK   + +GF F+TF+S++V +++ +     INGK V+ KKA PK   +      +  
Sbjct  166  MFDKATQRHRGFGFVTFDSDEVADKVCEIHFHEINGKMVECKKAQPKEVMLPVQLNKSRA  225

Query  226  RGGRGGRGGRGRGFGGQGGWGQGGYGGGYGGGYGQGGYGGGYDGYGGGY  274
               R        G   +       Y   +GG      +   ++   GGY
Sbjct  226  AAARN-----LYGMPPETLLAYAQYLPRFGGNLMYPNFTNVFNNMPGGY  269


>RB27C_DROME unnamed protein product
Length=421

 Score = 139 bits (350),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/189 (37%), Positives = 110/189 (58%), Gaps = 10/189 (5%)

Query  55   KLFVGGLSWETTDKELRDHFGTYGDIESINVKTDPNTGRSRGFAFIVFAKAESLDKIMAA  114
            KLFVGGLSWETT + L  +F  +GDI    V  +  +GRSRGF F+ FA   +++ ++  
Sbjct  8    KLFVGGLSWETTQENLSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTNVNHVLQN  67

Query  115  GDHIINNKKVDPKKAKARHG---------KVFVGGLSTELSDDDIKHFFSQFGTIVEVEM  165
            G H ++ + +DPK    R           KVF+GGL + +++ D++ FF+++G + EV +
Sbjct  68   GPHTLDGRTIDPKPCNPRTLQKPKKGGGYKVFLGGLPSNVTETDLRTFFNRYGKVTEVVI  127

Query  166  PFDKTKNQRKGFCFITFESEQVVNELLKTPKQTINGKEVDVKKATPKPDGMGGMRGGAGG  225
             +D+ K + +GF F++FE E  V  +       +NGK+V++KKA P+ DG GG       
Sbjct  128  MYDQEKKKSRGFGFLSFEEESSVEHVTNERYINLNGKQVEIKKAEPR-DGSGGQNSNNST  186

Query  226  RGGRGGRGG  234
             GG  G+ G
Sbjct  187  VGGAYGKLG  195


 Score = 62.8 bits (151),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 47/79 (59%), Gaps = 0/79 (0%)

Query  134  GKVFVGGLSTELSDDDIKHFFSQFGTIVEVEMPFDKTKNQRKGFCFITFESEQVVNELLK  193
            GK+FVGGLS E + +++  +F +FG I++  +  +    + +GF F+TF     VN +L+
Sbjct  7    GKLFVGGLSWETTQENLSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTNVNHVLQ  66

Query  194  TPKQTINGKEVDVKKATPK  212
                T++G+ +D K   P+
Sbjct  67   NGPHTLDGRTIDPKPCNPR  85



Lambda      K        H
   0.317    0.133    0.383 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10587853120


Query= XP_050572982.1 RNA-binding protein squid isoform X2 [Bombus affinis]

Length=348
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SQD_DROME  unnamed protein product                                    286     4e-95
G5EFS2_CAEEL  unnamed protein product                                 142     2e-39
RB27C_DROME  unnamed protein product                                  138     3e-37


>SQD_DROME unnamed protein product
Length=344

 Score = 286 bits (733),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 143/209 (68%), Positives = 171/209 (82%), Gaps = 7/209 (3%)

Query  7    KDFSEDI-ADQNFEQNGEAENGGGDATENGQESQEDRSTGGNQDSLNDRKLFVGGLSWET  65
            +DF++D+ AD    +NG+A   G   + NG    +  ++G   D   DRKLFVGGLSWET
Sbjct  14   EDFTKDVTADGPGSENGDA---GAAGSTNGSSDNQSAASGQRDD---DRKLFVGGLSWET  67

Query  66   TDKELRDHFGTYGDIESINVKTDPNTGRSRGFAFIVFAKAESLDKIMAAGDHIINNKKVD  125
            T+KELRDHFG YG+IESINVKTDP TGRSRGFAFIVF   E++DK+ AA +HIIN+KKVD
Sbjct  68   TEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHIINSKKVD  127

Query  126  PKKAKARHGKVFVGGLSTELSDDDIKHFFSQFGTIVEVEMPFDKTKNQRKGFCFITFESE  185
            PKKAKARHGK+FVGGL+TE+SD++IK +F QFG IVEVEMPFDK K+QRKGFCFITF+SE
Sbjct  128  PKKAKARHGKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSE  187

Query  186  QVVNELLKTPKQTINGKEVDVKKATPKPD  214
            QVV +LLKTPKQ I GKEVDVK+ATPKP+
Sbjct  188  QVVTDLLKTPKQKIAGKEVDVKRATPKPE  216


>G5EFS2_CAEEL unnamed protein product
Length=320

 Score = 142 bits (357),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/229 (33%), Positives = 119/229 (52%), Gaps = 14/229 (6%)

Query  55   KLFVGGLSWETTDKELRDHFGTYGDIESINVKTDPNTGRSRGFAFIVFAKAESLDKIMAA  114
            K+F+GGLSW+TT + LRD+FG +G++    V  DP T R+RGF FI F    S+DK++  
Sbjct  46   KMFIGGLSWQTTAENLRDYFGRFGEVNECMVMRDPATKRARGFGFITFVDPSSVDKVLNN  105

Query  115  GDHIINNKKVDPK---------KAKARHGKVFVGGLSTELSDDDIKHFFSQFGTIVEVEM  165
             +H ++ KK+DPK         K   +  KVF+GGLS   + +D+K +F  +G + +  +
Sbjct  106  REHELDGKKIDPKVAFPKRTQAKLVTKTKKVFIGGLSATSTLEDMKQYFETYGKVEDAML  165

Query  166  PFDKTKNQRKGFCFITFESEQVVNELLKTPKQTINGKEVDVKKATPKPDGMGGMRGGAGG  225
             FDK   + +GF F+TF+S++V +++ +     INGK V+ KKA PK   +      +  
Sbjct  166  MFDKATQRHRGFGFVTFDSDEVADKVCEIHFHEINGKMVECKKAQPKEVMLPVQLNKSRA  225

Query  226  RGGRGGRGGRGRGFGGQGGWGQGGYGGGYGGGYGQGGYGGGYDGYGGGY  274
               R        G   +       Y   +GG      +   ++   GGY
Sbjct  226  AAARN-----LYGMPPETLLAYAQYLPRFGGNLMYPNFTNVFNNMPGGY  269


>RB27C_DROME unnamed protein product
Length=421

 Score = 138 bits (348),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/189 (37%), Positives = 110/189 (58%), Gaps = 10/189 (5%)

Query  55   KLFVGGLSWETTDKELRDHFGTYGDIESINVKTDPNTGRSRGFAFIVFAKAESLDKIMAA  114
            KLFVGGLSWETT + L  +F  +GDI    V  +  +GRSRGF F+ FA   +++ ++  
Sbjct  8    KLFVGGLSWETTQENLSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTNVNHVLQN  67

Query  115  GDHIINNKKVDPKKAKARHG---------KVFVGGLSTELSDDDIKHFFSQFGTIVEVEM  165
            G H ++ + +DPK    R           KVF+GGL + +++ D++ FF+++G + EV +
Sbjct  68   GPHTLDGRTIDPKPCNPRTLQKPKKGGGYKVFLGGLPSNVTETDLRTFFNRYGKVTEVVI  127

Query  166  PFDKTKNQRKGFCFITFESEQVVNELLKTPKQTINGKEVDVKKATPKPDGMGGMRGGAGG  225
             +D+ K + +GF F++FE E  V  +       +NGK+V++KKA P+ DG GG       
Sbjct  128  MYDQEKKKSRGFGFLSFEEESSVEHVTNERYINLNGKQVEIKKAEPR-DGSGGQNSNNST  186

Query  226  RGGRGGRGG  234
             GG  G+ G
Sbjct  187  VGGAYGKLG  195


 Score = 62.8 bits (151),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 47/79 (59%), Gaps = 0/79 (0%)

Query  134  GKVFVGGLSTELSDDDIKHFFSQFGTIVEVEMPFDKTKNQRKGFCFITFESEQVVNELLK  193
            GK+FVGGLS E + +++  +F +FG I++  +  +    + +GF F+TF     VN +L+
Sbjct  7    GKLFVGGLSWETTQENLSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTNVNHVLQ  66

Query  194  TPKQTINGKEVDVKKATPK  212
                T++G+ +D K   P+
Sbjct  67   NGPHTLDGRTIDPKPCNPR  85



Lambda      K        H
   0.317    0.133    0.383 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10587853120


Query= XP_050572983.1 RNA-binding protein squid isoform X3 [Bombus affinis]

Length=338
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SQD_DROME  unnamed protein product                                    287     1e-95
G5EFS2_CAEEL  unnamed protein product                                 142     9e-40
RB27C_DROME  unnamed protein product                                  140     6e-38


>SQD_DROME unnamed protein product
Length=344

 Score = 287 bits (735),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 143/210 (68%), Positives = 171/210 (81%), Gaps = 7/210 (3%)

Query  7    KDFSEDI-ADQNFEQNGEAENGGGDATENGQESQEDRSTGGNQDSLNDRKLFVGGLSWET  65
            +DF++D+ AD    +NG+A   G   + NG    +  ++G   D   DRKLFVGGLSWET
Sbjct  14   EDFTKDVTADGPGSENGDA---GAAGSTNGSSDNQSAASGQRDD---DRKLFVGGLSWET  67

Query  66   TDKELRDHFGTYGDIESINVKTDPNTGRSRGFAFIVFAKAESLDKIMAAGDHIINNKKVD  125
            T+KELRDHFG YG+IESINVKTDP TGRSRGFAFIVF   E++DK+ AA +HIIN+KKVD
Sbjct  68   TEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHIINSKKVD  127

Query  126  PKKAKARHGKVFVGGLSTELSDDDIKHFFSQFGTIVEVEMPFDKTKNQRKGFCFITFESE  185
            PKKAKARHGK+FVGGL+TE+SD++IK +F QFG IVEVEMPFDK K+QRKGFCFITF+SE
Sbjct  128  PKKAKARHGKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSE  187

Query  186  QVVNELLKTPKQTINGKEVDVKKATPKPDG  215
            QVV +LLKTPKQ I GKEVDVK+ATPKP+ 
Sbjct  188  QVVTDLLKTPKQKIAGKEVDVKRATPKPEN  217


>G5EFS2_CAEEL unnamed protein product
Length=320

 Score = 142 bits (359),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 75/229 (33%), Positives = 119/229 (52%), Gaps = 14/229 (6%)

Query  55   KLFVGGLSWETTDKELRDHFGTYGDIESINVKTDPNTGRSRGFAFIVFAKAESLDKIMAA  114
            K+F+GGLSW+TT + LRD+FG +G++    V  DP T R+RGF FI F    S+DK++  
Sbjct  46   KMFIGGLSWQTTAENLRDYFGRFGEVNECMVMRDPATKRARGFGFITFVDPSSVDKVLNN  105

Query  115  GDHIINNKKVDPK---------KAKARHGKVFVGGLSTELSDDDIKHFFSQFGTIVEVEM  165
             +H ++ KK+DPK         K   +  KVF+GGLS   + +D+K +F  +G + +  +
Sbjct  106  REHELDGKKIDPKVAFPKRTQAKLVTKTKKVFIGGLSATSTLEDMKQYFETYGKVEDAML  165

Query  166  PFDKTKNQRKGFCFITFESEQVVNELLKTPKQTINGKEVDVKKATPKPDGMGGMRGGAGG  225
             FDK   + +GF F+TF+S++V +++ +     INGK V+ KKA PK   +      +  
Sbjct  166  MFDKATQRHRGFGFVTFDSDEVADKVCEIHFHEINGKMVECKKAQPKEVMLPVQLNKSRA  225

Query  226  RGGRGGRGGRGRGFGGQGGWGQGGYGGGYGGGYGQGGYGGGYDGYGGGY  274
               R        G   +       Y   +GG      +   ++   GGY
Sbjct  226  AAARN-----LYGMPPETLLAYAQYLPRFGGNLMYPNFTNVFNNMPGGY  269


>RB27C_DROME unnamed protein product
Length=421

 Score = 140 bits (353),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 70/189 (37%), Positives = 110/189 (58%), Gaps = 10/189 (5%)

Query  55   KLFVGGLSWETTDKELRDHFGTYGDIESINVKTDPNTGRSRGFAFIVFAKAESLDKIMAA  114
            KLFVGGLSWETT + L  +F  +GDI    V  +  +GRSRGF F+ FA   +++ ++  
Sbjct  8    KLFVGGLSWETTQENLSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTNVNHVLQN  67

Query  115  GDHIINNKKVDPKKAKARHG---------KVFVGGLSTELSDDDIKHFFSQFGTIVEVEM  165
            G H ++ + +DPK    R           KVF+GGL + +++ D++ FF+++G + EV +
Sbjct  68   GPHTLDGRTIDPKPCNPRTLQKPKKGGGYKVFLGGLPSNVTETDLRTFFNRYGKVTEVVI  127

Query  166  PFDKTKNQRKGFCFITFESEQVVNELLKTPKQTINGKEVDVKKATPKPDGMGGMRGGAGG  225
             +D+ K + +GF F++FE E  V  +       +NGK+V++KKA P+ DG GG       
Sbjct  128  MYDQEKKKSRGFGFLSFEEESSVEHVTNERYINLNGKQVEIKKAEPR-DGSGGQNSNNST  186

Query  226  RGGRGGRGG  234
             GG  G+ G
Sbjct  187  VGGAYGKLG  195


 Score = 62.8 bits (151),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 47/79 (59%), Gaps = 0/79 (0%)

Query  134  GKVFVGGLSTELSDDDIKHFFSQFGTIVEVEMPFDKTKNQRKGFCFITFESEQVVNELLK  193
            GK+FVGGLS E + +++  +F +FG I++  +  +    + +GF F+TF     VN +L+
Sbjct  7    GKLFVGGLSWETTQENLSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTNVNHVLQ  66

Query  194  TPKQTINGKEVDVKKATPK  212
                T++G+ +D K   P+
Sbjct  67   NGPHTLDGRTIDPKPCNPR  85



Lambda      K        H
   0.317    0.133    0.383 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10587853120


Query= XP_050572984.1 RNA-binding protein squid isoform X4 [Bombus affinis]

Length=338
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SQD_DROME  unnamed protein product                                    286     3e-95
G5EFS2_CAEEL  unnamed protein product                                 141     3e-39
RB27C_DROME  unnamed protein product                                  138     3e-37


>SQD_DROME unnamed protein product
Length=344

 Score = 286 bits (733),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 143/209 (68%), Positives = 171/209 (82%), Gaps = 7/209 (3%)

Query  7    KDFSEDI-ADQNFEQNGEAENGGGDATENGQESQEDRSTGGNQDSLNDRKLFVGGLSWET  65
            +DF++D+ AD    +NG+A   G   + NG    +  ++G   D   DRKLFVGGLSWET
Sbjct  14   EDFTKDVTADGPGSENGDA---GAAGSTNGSSDNQSAASGQRDD---DRKLFVGGLSWET  67

Query  66   TDKELRDHFGTYGDIESINVKTDPNTGRSRGFAFIVFAKAESLDKIMAAGDHIINNKKVD  125
            T+KELRDHFG YG+IESINVKTDP TGRSRGFAFIVF   E++DK+ AA +HIIN+KKVD
Sbjct  68   TEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHIINSKKVD  127

Query  126  PKKAKARHGKVFVGGLSTELSDDDIKHFFSQFGTIVEVEMPFDKTKNQRKGFCFITFESE  185
            PKKAKARHGK+FVGGL+TE+SD++IK +F QFG IVEVEMPFDK K+QRKGFCFITF+SE
Sbjct  128  PKKAKARHGKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSE  187

Query  186  QVVNELLKTPKQTINGKEVDVKKATPKPD  214
            QVV +LLKTPKQ I GKEVDVK+ATPKP+
Sbjct  188  QVVTDLLKTPKQKIAGKEVDVKRATPKPE  216


>G5EFS2_CAEEL unnamed protein product
Length=320

 Score = 141 bits (356),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/229 (33%), Positives = 119/229 (52%), Gaps = 14/229 (6%)

Query  55   KLFVGGLSWETTDKELRDHFGTYGDIESINVKTDPNTGRSRGFAFIVFAKAESLDKIMAA  114
            K+F+GGLSW+TT + LRD+FG +G++    V  DP T R+RGF FI F    S+DK++  
Sbjct  46   KMFIGGLSWQTTAENLRDYFGRFGEVNECMVMRDPATKRARGFGFITFVDPSSVDKVLNN  105

Query  115  GDHIINNKKVDPK---------KAKARHGKVFVGGLSTELSDDDIKHFFSQFGTIVEVEM  165
             +H ++ KK+DPK         K   +  KVF+GGLS   + +D+K +F  +G + +  +
Sbjct  106  REHELDGKKIDPKVAFPKRTQAKLVTKTKKVFIGGLSATSTLEDMKQYFETYGKVEDAML  165

Query  166  PFDKTKNQRKGFCFITFESEQVVNELLKTPKQTINGKEVDVKKATPKPDGMGGMRGGAGG  225
             FDK   + +GF F+TF+S++V +++ +     INGK V+ KKA PK   +      +  
Sbjct  166  MFDKATQRHRGFGFVTFDSDEVADKVCEIHFHEINGKMVECKKAQPKEVMLPVQLNKSRA  225

Query  226  RGGRGGRGGRGRGFGGQGGWGQGGYGGGYGGGYGQGGYGGGYDGYGGGY  274
               R        G   +       Y   +GG      +   ++   GGY
Sbjct  226  AAARN-----LYGMPPETLLAYAQYLPRFGGNLMYPNFTNVFNNMPGGY  269


>RB27C_DROME unnamed protein product
Length=421

 Score = 138 bits (347),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/189 (37%), Positives = 110/189 (58%), Gaps = 10/189 (5%)

Query  55   KLFVGGLSWETTDKELRDHFGTYGDIESINVKTDPNTGRSRGFAFIVFAKAESLDKIMAA  114
            KLFVGGLSWETT + L  +F  +GDI    V  +  +GRSRGF F+ FA   +++ ++  
Sbjct  8    KLFVGGLSWETTQENLSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTNVNHVLQN  67

Query  115  GDHIINNKKVDPKKAKARHG---------KVFVGGLSTELSDDDIKHFFSQFGTIVEVEM  165
            G H ++ + +DPK    R           KVF+GGL + +++ D++ FF+++G + EV +
Sbjct  68   GPHTLDGRTIDPKPCNPRTLQKPKKGGGYKVFLGGLPSNVTETDLRTFFNRYGKVTEVVI  127

Query  166  PFDKTKNQRKGFCFITFESEQVVNELLKTPKQTINGKEVDVKKATPKPDGMGGMRGGAGG  225
             +D+ K + +GF F++FE E  V  +       +NGK+V++KKA P+ DG GG       
Sbjct  128  MYDQEKKKSRGFGFLSFEEESSVEHVTNERYINLNGKQVEIKKAEPR-DGSGGQNSNNST  186

Query  226  RGGRGGRGG  234
             GG  G+ G
Sbjct  187  VGGAYGKLG  195


 Score = 62.8 bits (151),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 47/79 (59%), Gaps = 0/79 (0%)

Query  134  GKVFVGGLSTELSDDDIKHFFSQFGTIVEVEMPFDKTKNQRKGFCFITFESEQVVNELLK  193
            GK+FVGGLS E + +++  +F +FG I++  +  +    + +GF F+TF     VN +L+
Sbjct  7    GKLFVGGLSWETTQENLSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTNVNHVLQ  66

Query  194  TPKQTINGKEVDVKKATPK  212
                T++G+ +D K   P+
Sbjct  67   NGPHTLDGRTIDPKPCNPR  85



Lambda      K        H
   0.317    0.133    0.383 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10587853120


Query= XP_050572985.1 RNA-binding protein squid isoform X5 [Bombus affinis]

Length=324
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SQD_DROME  unnamed protein product                                    286     1e-95
G5EFS2_CAEEL  unnamed protein product                                 142     6e-40
RB27C_DROME  unnamed protein product                                  139     7e-38


>SQD_DROME unnamed protein product
Length=344

 Score = 286 bits (733),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 143/209 (68%), Positives = 171/209 (82%), Gaps = 7/209 (3%)

Query  7    KDFSEDI-ADQNFEQNGEAENGGGDATENGQESQEDRSTGGNQDSLNDRKLFVGGLSWET  65
            +DF++D+ AD    +NG+A   G   + NG    +  ++G   D   DRKLFVGGLSWET
Sbjct  14   EDFTKDVTADGPGSENGDA---GAAGSTNGSSDNQSAASGQRDD---DRKLFVGGLSWET  67

Query  66   TDKELRDHFGTYGDIESINVKTDPNTGRSRGFAFIVFAKAESLDKIMAAGDHIINNKKVD  125
            T+KELRDHFG YG+IESINVKTDP TGRSRGFAFIVF   E++DK+ AA +HIIN+KKVD
Sbjct  68   TEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHIINSKKVD  127

Query  126  PKKAKARHGKVFVGGLSTELSDDDIKHFFSQFGTIVEVEMPFDKTKNQRKGFCFITFESE  185
            PKKAKARHGK+FVGGL+TE+SD++IK +F QFG IVEVEMPFDK K+QRKGFCFITF+SE
Sbjct  128  PKKAKARHGKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSE  187

Query  186  QVVNELLKTPKQTINGKEVDVKKATPKPD  214
            QVV +LLKTPKQ I GKEVDVK+ATPKP+
Sbjct  188  QVVTDLLKTPKQKIAGKEVDVKRATPKPE  216


>G5EFS2_CAEEL unnamed protein product
Length=320

 Score = 142 bits (359),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 75/229 (33%), Positives = 119/229 (52%), Gaps = 14/229 (6%)

Query  55   KLFVGGLSWETTDKELRDHFGTYGDIESINVKTDPNTGRSRGFAFIVFAKAESLDKIMAA  114
            K+F+GGLSW+TT + LRD+FG +G++    V  DP T R+RGF FI F    S+DK++  
Sbjct  46   KMFIGGLSWQTTAENLRDYFGRFGEVNECMVMRDPATKRARGFGFITFVDPSSVDKVLNN  105

Query  115  GDHIINNKKVDPK---------KAKARHGKVFVGGLSTELSDDDIKHFFSQFGTIVEVEM  165
             +H ++ KK+DPK         K   +  KVF+GGLS   + +D+K +F  +G + +  +
Sbjct  106  REHELDGKKIDPKVAFPKRTQAKLVTKTKKVFIGGLSATSTLEDMKQYFETYGKVEDAML  165

Query  166  PFDKTKNQRKGFCFITFESEQVVNELLKTPKQTINGKEVDVKKATPKPDGMGGMRGGAGG  225
             FDK   + +GF F+TF+S++V +++ +     INGK V+ KKA PK   +      +  
Sbjct  166  MFDKATQRHRGFGFVTFDSDEVADKVCEIHFHEINGKMVECKKAQPKEVMLPVQLNKSRA  225

Query  226  RGGRGGRGGRGRGFGGQGGWGQGGYGGGYGGGYGQGGYGGGYDGYGGGY  274
               R        G   +       Y   +GG      +   ++   GGY
Sbjct  226  AAARN-----LYGMPPETLLAYAQYLPRFGGNLMYPNFTNVFNNMPGGY  269


>RB27C_DROME unnamed protein product
Length=421

 Score = 139 bits (351),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 70/189 (37%), Positives = 110/189 (58%), Gaps = 10/189 (5%)

Query  55   KLFVGGLSWETTDKELRDHFGTYGDIESINVKTDPNTGRSRGFAFIVFAKAESLDKIMAA  114
            KLFVGGLSWETT + L  +F  +GDI    V  +  +GRSRGF F+ FA   +++ ++  
Sbjct  8    KLFVGGLSWETTQENLSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTNVNHVLQN  67

Query  115  GDHIINNKKVDPKKAKARHG---------KVFVGGLSTELSDDDIKHFFSQFGTIVEVEM  165
            G H ++ + +DPK    R           KVF+GGL + +++ D++ FF+++G + EV +
Sbjct  68   GPHTLDGRTIDPKPCNPRTLQKPKKGGGYKVFLGGLPSNVTETDLRTFFNRYGKVTEVVI  127

Query  166  PFDKTKNQRKGFCFITFESEQVVNELLKTPKQTINGKEVDVKKATPKPDGMGGMRGGAGG  225
             +D+ K + +GF F++FE E  V  +       +NGK+V++KKA P+ DG GG       
Sbjct  128  MYDQEKKKSRGFGFLSFEEESSVEHVTNERYINLNGKQVEIKKAEPR-DGSGGQNSNNST  186

Query  226  RGGRGGRGG  234
             GG  G+ G
Sbjct  187  VGGAYGKLG  195


 Score = 62.4 bits (150),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 47/79 (59%), Gaps = 0/79 (0%)

Query  134  GKVFVGGLSTELSDDDIKHFFSQFGTIVEVEMPFDKTKNQRKGFCFITFESEQVVNELLK  193
            GK+FVGGLS E + +++  +F +FG I++  +  +    + +GF F+TF     VN +L+
Sbjct  7    GKLFVGGLSWETTQENLSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTNVNHVLQ  66

Query  194  TPKQTINGKEVDVKKATPK  212
                T++G+ +D K   P+
Sbjct  67   NGPHTLDGRTIDPKPCNPR  85



Lambda      K        H
   0.317    0.133    0.383 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10587853120


Query= XP_050572986.1 RNA-binding protein squid isoform X6 [Bombus affinis]

Length=324
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SQD_DROME  unnamed protein product                                    286     3e-95
G5EFS2_CAEEL  unnamed protein product                                 140     3e-39
RB27C_DROME  unnamed protein product                                  138     3e-37


>SQD_DROME unnamed protein product
Length=344

 Score = 286 bits (731),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 143/209 (68%), Positives = 171/209 (82%), Gaps = 7/209 (3%)

Query  7    KDFSEDI-ADQNFEQNGEAENGGGDATENGQESQEDRSTGGNQDSLNDRKLFVGGLSWET  65
            +DF++D+ AD    +NG+A   G   + NG    +  ++G   D   DRKLFVGGLSWET
Sbjct  14   EDFTKDVTADGPGSENGDA---GAAGSTNGSSDNQSAASGQRDD---DRKLFVGGLSWET  67

Query  66   TDKELRDHFGTYGDIESINVKTDPNTGRSRGFAFIVFAKAESLDKIMAAGDHIINNKKVD  125
            T+KELRDHFG YG+IESINVKTDP TGRSRGFAFIVF   E++DK+ AA +HIIN+KKVD
Sbjct  68   TEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHIINSKKVD  127

Query  126  PKKAKARHGKVFVGGLSTELSDDDIKHFFSQFGTIVEVEMPFDKTKNQRKGFCFITFESE  185
            PKKAKARHGK+FVGGL+TE+SD++IK +F QFG IVEVEMPFDK K+QRKGFCFITF+SE
Sbjct  128  PKKAKARHGKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSE  187

Query  186  QVVNELLKTPKQTINGKEVDVKKATPKPD  214
            QVV +LLKTPKQ I GKEVDVK+ATPKP+
Sbjct  188  QVVTDLLKTPKQKIAGKEVDVKRATPKPE  216


>G5EFS2_CAEEL unnamed protein product
Length=320

 Score = 140 bits (354),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/229 (33%), Positives = 119/229 (52%), Gaps = 14/229 (6%)

Query  55   KLFVGGLSWETTDKELRDHFGTYGDIESINVKTDPNTGRSRGFAFIVFAKAESLDKIMAA  114
            K+F+GGLSW+TT + LRD+FG +G++    V  DP T R+RGF FI F    S+DK++  
Sbjct  46   KMFIGGLSWQTTAENLRDYFGRFGEVNECMVMRDPATKRARGFGFITFVDPSSVDKVLNN  105

Query  115  GDHIINNKKVDPK---------KAKARHGKVFVGGLSTELSDDDIKHFFSQFGTIVEVEM  165
             +H ++ KK+DPK         K   +  KVF+GGLS   + +D+K +F  +G + +  +
Sbjct  106  REHELDGKKIDPKVAFPKRTQAKLVTKTKKVFIGGLSATSTLEDMKQYFETYGKVEDAML  165

Query  166  PFDKTKNQRKGFCFITFESEQVVNELLKTPKQTINGKEVDVKKATPKPDGMGGMRGGAGG  225
             FDK   + +GF F+TF+S++V +++ +     INGK V+ KKA PK   +      +  
Sbjct  166  MFDKATQRHRGFGFVTFDSDEVADKVCEIHFHEINGKMVECKKAQPKEVMLPVQLNKSRA  225

Query  226  RGGRGGRGGRGRGFGGQGGWGQGGYGGGYGGGYGQGGYGGGYDGYGGGY  274
               R        G   +       Y   +GG      +   ++   GGY
Sbjct  226  AAARN-----LYGMPPETLLAYAQYLPRFGGNLMYPNFTNVFNNMPGGY  269


>RB27C_DROME unnamed protein product
Length=421

 Score = 138 bits (347),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/189 (37%), Positives = 110/189 (58%), Gaps = 10/189 (5%)

Query  55   KLFVGGLSWETTDKELRDHFGTYGDIESINVKTDPNTGRSRGFAFIVFAKAESLDKIMAA  114
            KLFVGGLSWETT + L  +F  +GDI    V  +  +GRSRGF F+ FA   +++ ++  
Sbjct  8    KLFVGGLSWETTQENLSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTNVNHVLQN  67

Query  115  GDHIINNKKVDPKKAKARH---------GKVFVGGLSTELSDDDIKHFFSQFGTIVEVEM  165
            G H ++ + +DPK    R           KVF+GGL + +++ D++ FF+++G + EV +
Sbjct  68   GPHTLDGRTIDPKPCNPRTLQKPKKGGGYKVFLGGLPSNVTETDLRTFFNRYGKVTEVVI  127

Query  166  PFDKTKNQRKGFCFITFESEQVVNELLKTPKQTINGKEVDVKKATPKPDGMGGMRGGAGG  225
             +D+ K + +GF F++FE E  V  +       +NGK+V++KKA P+ DG GG       
Sbjct  128  MYDQEKKKSRGFGFLSFEEESSVEHVTNERYINLNGKQVEIKKAEPR-DGSGGQNSNNST  186

Query  226  RGGRGGRGG  234
             GG  G+ G
Sbjct  187  VGGAYGKLG  195


 Score = 62.8 bits (151),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 47/79 (59%), Gaps = 0/79 (0%)

Query  134  GKVFVGGLSTELSDDDIKHFFSQFGTIVEVEMPFDKTKNQRKGFCFITFESEQVVNELLK  193
            GK+FVGGLS E + +++  +F +FG I++  +  +    + +GF F+TF     VN +L+
Sbjct  7    GKLFVGGLSWETTQENLSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTNVNHVLQ  66

Query  194  TPKQTINGKEVDVKKATPK  212
                T++G+ +D K   P+
Sbjct  67   NGPHTLDGRTIDPKPCNPR  85



Lambda      K        H
   0.317    0.133    0.383 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10587853120


Query= XP_050572987.1 RNA-binding protein squid isoform X7 [Bombus affinis]

Length=314
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SQD_DROME  unnamed protein product                                    286     1e-95
G5EFS2_CAEEL  unnamed protein product                                 142     7e-40
A0A0B4KGY9_DROME  unnamed protein product                             139     4e-37


>SQD_DROME unnamed protein product
Length=344

 Score = 286 bits (733),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 143/209 (68%), Positives = 171/209 (82%), Gaps = 7/209 (3%)

Query  7    KDFSEDI-ADQNFEQNGEAENGGGDATENGQESQEDRSTGGNQDSLNDRKLFVGGLSWET  65
            +DF++D+ AD    +NG+A   G   + NG    +  ++G   D   DRKLFVGGLSWET
Sbjct  14   EDFTKDVTADGPGSENGDA---GAAGSTNGSSDNQSAASGQRDD---DRKLFVGGLSWET  67

Query  66   TDKELRDHFGTYGDIESINVKTDPNTGRSRGFAFIVFAKAESLDKIMAAGDHIINNKKVD  125
            T+KELRDHFG YG+IESINVKTDP TGRSRGFAFIVF   E++DK+ AA +HIIN+KKVD
Sbjct  68   TEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHIINSKKVD  127

Query  126  PKKAKARHGKVFVGGLSTELSDDDIKHFFSQFGTIVEVEMPFDKTKNQRKGFCFITFESE  185
            PKKAKARHGK+FVGGL+TE+SD++IK +F QFG IVEVEMPFDK K+QRKGFCFITF+SE
Sbjct  128  PKKAKARHGKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSE  187

Query  186  QVVNELLKTPKQTINGKEVDVKKATPKPD  214
            QVV +LLKTPKQ I GKEVDVK+ATPKP+
Sbjct  188  QVVTDLLKTPKQKIAGKEVDVKRATPKPE  216


>G5EFS2_CAEEL unnamed protein product
Length=320

 Score = 142 bits (358),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 75/229 (33%), Positives = 119/229 (52%), Gaps = 14/229 (6%)

Query  55   KLFVGGLSWETTDKELRDHFGTYGDIESINVKTDPNTGRSRGFAFIVFAKAESLDKIMAA  114
            K+F+GGLSW+TT + LRD+FG +G++    V  DP T R+RGF FI F    S+DK++  
Sbjct  46   KMFIGGLSWQTTAENLRDYFGRFGEVNECMVMRDPATKRARGFGFITFVDPSSVDKVLNN  105

Query  115  GDHIINNKKVDPK---------KAKARHGKVFVGGLSTELSDDDIKHFFSQFGTIVEVEM  165
             +H ++ KK+DPK         K   +  KVF+GGLS   + +D+K +F  +G + +  +
Sbjct  106  REHELDGKKIDPKVAFPKRTQAKLVTKTKKVFIGGLSATSTLEDMKQYFETYGKVEDAML  165

Query  166  PFDKTKNQRKGFCFITFESEQVVNELLKTPKQTINGKEVDVKKATPKPDGMGGMRGGAGG  225
             FDK   + +GF F+TF+S++V +++ +     INGK V+ KKA PK   +      +  
Sbjct  166  MFDKATQRHRGFGFVTFDSDEVADKVCEIHFHEINGKMVECKKAQPKEVMLPVQLNKSRA  225

Query  226  RGGRGGRGGRGRGFGGQGGWGQGGYGGGYGGGYGQGGYGGGYDGYGGGY  274
               R        G   +       Y   +GG      +   ++   GGY
Sbjct  226  AAARN-----LYGMPPETLLAYAQYLPRFGGNLMYPNFTNVFNNMPGGY  269


>A0A0B4KGY9_DROME unnamed protein product
Length=567

 Score = 139 bits (350),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 66/166 (40%), Positives = 105/166 (63%), Gaps = 8/166 (5%)

Query  55   KLFVGGLSWETTDKELRDHFGTYGDIESINVKTDPNTGRSRGFAFIVFAKAESLDKIMAA  114
            KLFVGGLSW+T+  +L+++F  +G +  + +  DP T RSRGF FI F +  +++K++  
Sbjct  137  KLFVGGLSWQTSSDKLKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEPCTVEKVLKV  196

Query  115  GDHIINNKKVDPKKAKARH--------GKVFVGGLSTELSDDDIKHFFSQFGTIVEVEMP  166
              H ++ KK+DPK A  ++         K+FVGG+S + S +++K +FSQFG + E  M 
Sbjct  197  PIHTLDGKKIDPKHATPKNRPRQANKTKKIFVGGVSQDTSAEEVKAYFSQFGPVEETVML  256

Query  167  FDKTKNQRKGFCFITFESEQVVNELLKTPKQTINGKEVDVKKATPK  212
             D+   + +GF F+TFE+E VV+ + +    TI  K+V+ KKA PK
Sbjct  257  MDQQTKRHRGFGFVTFENEDVVDRVCEIHFHTIKNKKVECKKAQPK  302



Lambda      K        H
   0.317    0.133    0.383 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10587853120


Query= XP_050572988.1 RNA-binding protein squid isoform X8 [Bombus affinis]

Length=300
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

G5EFS2_CAEEL  unnamed protein product                                 142     6e-40
A0A0B4KGY9_DROME  unnamed protein product                             139     4e-37
Q9VBQ1_DROME  unnamed protein product                                 139     5e-37


>G5EFS2_CAEEL unnamed protein product
Length=320

 Score = 142 bits (357),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 75/229 (33%), Positives = 119/229 (52%), Gaps = 14/229 (6%)

Query  55   KLFVGGLSWETTDKELRDHFGTYGDIESINVKTDPNTGRSRGFAFIVFAKAESLDKIMAA  114
            K+F+GGLSW+TT + LRD+FG +G++    V  DP T R+RGF FI F    S+DK++  
Sbjct  46   KMFIGGLSWQTTAENLRDYFGRFGEVNECMVMRDPATKRARGFGFITFVDPSSVDKVLNN  105

Query  115  GDHIINNKKVDPK---------KAKARHGKVFVGGLSTELSDDDIKHFFSQFGTIVEVEM  165
             +H ++ KK+DPK         K   +  KVF+GGLS   + +D+K +F  +G + +  +
Sbjct  106  REHELDGKKIDPKVAFPKRTQAKLVTKTKKVFIGGLSATSTLEDMKQYFETYGKVEDAML  165

Query  166  PFDKTKNQRKGFCFITFESEQVVNELLKTPKQTINGKEVDVKKATPKPDGMGGMRGGAGG  225
             FDK   + +GF F+TF+S++V +++ +     INGK V+ KKA PK   +      +  
Sbjct  166  MFDKATQRHRGFGFVTFDSDEVADKVCEIHFHEINGKMVECKKAQPKEVMLPVQLNKSRA  225

Query  226  RGGRGGRGGRGRGFGGQGGWGQGGYGGGYGGGYGQGGYGGGYDGYGGGY  274
               R        G   +       Y   +GG      +   ++   GGY
Sbjct  226  AAARN-----LYGMPPETLLAYAQYLPRFGGNLMYPNFTNVFNNMPGGY  269


>A0A0B4KGY9_DROME unnamed protein product
Length=567

 Score = 139 bits (350),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 66/166 (40%), Positives = 105/166 (63%), Gaps = 8/166 (5%)

Query  55   KLFVGGLSWETTDKELRDHFGTYGDIESINVKTDPNTGRSRGFAFIVFAKAESLDKIMAA  114
            KLFVGGLSW+T+  +L+++F  +G +  + +  DP T RSRGF FI F +  +++K++  
Sbjct  137  KLFVGGLSWQTSSDKLKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEPCTVEKVLKV  196

Query  115  GDHIINNKKVDPKKAKARH--------GKVFVGGLSTELSDDDIKHFFSQFGTIVEVEMP  166
              H ++ KK+DPK A  ++         K+FVGG+S + S +++K +FSQFG + E  M 
Sbjct  197  PIHTLDGKKIDPKHATPKNRPRQANKTKKIFVGGVSQDTSAEEVKAYFSQFGPVEETVML  256

Query  167  FDKTKNQRKGFCFITFESEQVVNELLKTPKQTINGKEVDVKKATPK  212
             D+   + +GF F+TFE+E VV+ + +    TI  K+V+ KKA PK
Sbjct  257  MDQQTKRHRGFGFVTFENEDVVDRVCEIHFHTIKNKKVECKKAQPK  302


>Q9VBQ1_DROME unnamed protein product
Length=606

 Score = 139 bits (350),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 66/166 (40%), Positives = 105/166 (63%), Gaps = 8/166 (5%)

Query  55   KLFVGGLSWETTDKELRDHFGTYGDIESINVKTDPNTGRSRGFAFIVFAKAESLDKIMAA  114
            KLFVGGLSW+T+  +L+++F  +G +  + +  DP T RSRGF FI F +  +++K++  
Sbjct  176  KLFVGGLSWQTSSDKLKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEPCTVEKVLKV  235

Query  115  GDHIINNKKVDPKKAKARH--------GKVFVGGLSTELSDDDIKHFFSQFGTIVEVEMP  166
              H ++ KK+DPK A  ++         K+FVGG+S + S +++K +FSQFG + E  M 
Sbjct  236  PIHTLDGKKIDPKHATPKNRPRQANKTKKIFVGGVSQDTSAEEVKAYFSQFGPVEETVML  295

Query  167  FDKTKNQRKGFCFITFESEQVVNELLKTPKQTINGKEVDVKKATPK  212
             D+   + +GF F+TFE+E VV+ + +    TI  K+V+ KKA PK
Sbjct  296  MDQQTKRHRGFGFVTFENEDVVDRVCEIHFHTIKNKKVECKKAQPK  341



Lambda      K        H
   0.317    0.133    0.383 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10587853120


Query= XP_050572989.1 guanine nucleotide-binding protein G(q) subunit alpha
isoform X1 [Bombus affinis]

Length=353
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

G5EGU1_CAEEL  unnamed protein product                                 608     0.0  
GNAQ_DROME  unnamed protein product                                   595     0.0  
Q8T3G5_CAEEL  unnamed protein product                                 510     0.0  


>G5EGU1_CAEEL unnamed protein product
Length=355

 Score = 608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/355 (82%), Positives = 322/355 (91%), Gaps = 2/355 (1%)

Query  1    MACCLSEEAREQKRINQEIERQLRKDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSG  60
            MACCLSEEAREQKRINQEIE+QL++DKR+ARRELKLLLLGTGESGKSTFIKQMRIIHG G
Sbjct  1    MACCLSEEAREQKRINQEIEKQLQRDKRNARRELKLLLLGTGESGKSTFIKQMRIIHGQG  60

Query  61   YSDDDKRGFIKLVYQNIFMAMQSMIRAMDLLKIQYASSAN--IEKAELVRSVDFETVTTF  118
            YS++DKR  I+LVYQN+FMA+QSMIRAMD L I++ + +    EKA +VR VDFE+VT+F
Sbjct  61   YSEEDKRAHIRLVYQNVFMAIQSMIRAMDTLDIKFGNESEELQEKAAVVREVDFESVTSF  120

Query  119  ESPYVEAIKDLWADSGIQECYDRRREYQLTDSAKYYLLEIDRVAARGYLPTEQDILRVRV  178
            E PYV  IK+LW DSGIQECYDRRREYQLTDSAKYYL ++ R+A   YLPTEQDILRVRV
Sbjct  121  EEPYVSYIKELWEDSGIQECYDRRREYQLTDSAKYYLSDLRRLAVPDYLPTEQDILRVRV  180

Query  179  PTTGIIEYPFDLEEIRFRMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFESEN  238
            PTTGIIEYPFDLE+I FRMVDVGGQRSERRKWIHCFENVTSI+FLVALSEYDQ+L E +N
Sbjct  181  PTTGIIEYPFDLEQIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVECDN  240

Query  239  ENRMEESKALFKTIITYPWFQQSSVILFLNKKDLLEEKIMYSHLVDYFPEYNGPQRDAIP  298
            ENRMEESKALF+TIITYPWF  SSVILFLNKKDLLEEKI+YSHL DYFPEY+GP RD I 
Sbjct  241  ENRMEESKALFRTIITYPWFTNSSVILFLNKKDLLEEKILYSHLADYFPEYDGPPRDPIA  300

Query  299  AREFILQMFVELNPDIEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV  353
            AREFIL+MFV+LNPD +KIIYSHFTCATDTENIRFVFAAVKDTILQ NLKEYNLV
Sbjct  301  AREFILKMFVDLNPDADKIIYSHFTCATDTENIRFVFAAVKDTILQHNLKEYNLV  355


>GNAQ_DROME unnamed protein product
Length=353

 Score = 595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/352 (80%), Positives = 315/352 (89%), Gaps = 0/352 (0%)

Query  1    MACCLSEEAREQKRINQEIERQLRKDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSG  60
            M CCLSEEA+EQKRINQEIE+QLR+DKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSG
Sbjct  1    MECCLSEEAKEQKRINQEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSG  60

Query  61   YSDDDKRGFIKLVYQNIFMAMQSMIRAMDLLKIQYASSANIEKAELVRSVDFETVTTFES  120
            YSD+DKRG+IKLV+QNIFMAMQSMI+AMD+LKI Y    + E A+LV S+D+ETVTTFE 
Sbjct  61   YSDEDKRGYIKLVFQNIFMAMQSMIKAMDMLKISYGQGEHSELADLVMSIDYETVTTFED  120

Query  121  PYVEAIKDLWADSGIQECYDRRREYQLTDSAKYYLLEIDRVAARGYLPTEQDILRVRVPT  180
            PY+ AIK LW D+GIQECYDRRREYQLTDSAKYYL ++ R+    YLPTEQDILR RVPT
Sbjct  121  PYLNAIKTLWDDAGIQECYDRRREYQLTDSAKYYLSDLARIEQADYLPTEQDILRARVPT  180

Query  181  TGIIEYPFDLEEIRFRMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFESENEN  240
            TGI+EYPFDL+ I FRMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFES+NEN
Sbjct  181  TGILEYPFDLDGIVFRMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFESDNEN  240

Query  241  RMEESKALFKTIITYPWFQQSSVILFLNKKDLLEEKIMYSHLVDYFPEYNGPQRDAIPAR  300
            RMEESKALF+TIITYPWFQ SSVILFLNKKDLLEEKIMYSHLVDYFPEY+GP++D   A+
Sbjct  241  RMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPKQDHAAAK  300

Query  301  EFILQMFVELNPDIEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNL  352
            +F+L+ ++  NPD E+  YSHFT ATDTENI+ VF AVKDTI+Q  LKE+NL
Sbjct  301  QFVLKKYLACNPDPERQCYSHFTTATDTENIKLVFCAVKDTIMQNALKEFNL  352


>Q8T3G5_CAEEL unnamed protein product
Length=303

 Score = 510 bits (1313),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 244/303 (81%), Positives = 270/303 (89%), Gaps = 2/303 (1%)

Query  53   MRIIHGSGYSDDDKRGFIKLVYQNIFMAMQSMIRAMDLLKIQYASSAN--IEKAELVRSV  110
            MRIIHG GYS++DKR  I+LVYQN+FMA+QSMIRAMD L I++ + +    EKA +VR V
Sbjct  1    MRIIHGQGYSEEDKRAHIRLVYQNVFMAIQSMIRAMDTLDIKFGNESEELQEKAAVVREV  60

Query  111  DFETVTTFESPYVEAIKDLWADSGIQECYDRRREYQLTDSAKYYLLEIDRVAARGYLPTE  170
            DFE+VT+FE PYV  IK+LW DSGIQECYDRRREYQLTDSAKYYL ++ R+A   YLPTE
Sbjct  61   DFESVTSFEEPYVSYIKELWEDSGIQECYDRRREYQLTDSAKYYLSDLRRLAVPDYLPTE  120

Query  171  QDILRVRVPTTGIIEYPFDLEEIRFRMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYD  230
            QDILRVRVPTTGIIEYPFDLE+I FRMVDVGGQRSERRKWIHCFENVTSI+FLVALSEYD
Sbjct  121  QDILRVRVPTTGIIEYPFDLEQIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYD  180

Query  231  QILFESENENRMEESKALFKTIITYPWFQQSSVILFLNKKDLLEEKIMYSHLVDYFPEYN  290
            Q+L E +NENRMEESKALF+TIITYPWF  SSVILFLNKKDLLEEKI+YSHL DYFPEY+
Sbjct  181  QVLVECDNENRMEESKALFRTIITYPWFTNSSVILFLNKKDLLEEKILYSHLADYFPEYD  240

Query  291  GPQRDAIPAREFILQMFVELNPDIEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEY  350
            GP RD I AREFIL+MFV+LNPD +KIIYSHFTCATDTENIRFVFAAVKDTILQ NLKEY
Sbjct  241  GPPRDPIAAREFILKMFVDLNPDADKIIYSHFTCATDTENIRFVFAAVKDTILQHNLKEY  300

Query  351  NLV  353
            NLV
Sbjct  301  NLV  303



Lambda      K        H
   0.317    0.133    0.383 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10587853120


Query= XP_050572990.1 guanine nucleotide-binding protein G(q) subunit alpha
isoform X2 [Bombus affinis]

Length=353
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

G5EGU1_CAEEL  unnamed protein product                                 615     0.0  
GNAQ_DROME  unnamed protein product                                   610     0.0  
Q8T3G5_CAEEL  unnamed protein product                                 515     0.0  


>G5EGU1_CAEEL unnamed protein product
Length=355

 Score = 615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/355 (83%), Positives = 322/355 (91%), Gaps = 2/355 (1%)

Query  1    MACCLSEEAREQKRINQEIERQLRKDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSG  60
            MACCLSEEAREQKRINQEIE+QL++DKR+ARRELKLLLLGTGESGKSTFIKQMRIIHG G
Sbjct  1    MACCLSEEAREQKRINQEIEKQLQRDKRNARRELKLLLLGTGESGKSTFIKQMRIIHGQG  60

Query  61   YSDDDKRGFIKLVYQNIFMAMQSMIRAMDLLKIQYASSAN--IEKAELVRSVDFETVTTF  118
            YS++DKR  I+LVYQN+FMA+QSMIRAMD L I++ + +    EKA +VR VDFE+VT+F
Sbjct  61   YSEEDKRAHIRLVYQNVFMAIQSMIRAMDTLDIKFGNESEELQEKAAVVREVDFESVTSF  120

Query  119  ESPYVEAIKDLWADSGIQECYDRRREYQLTDSAKYYLSDLERIEKPDFLPTEQDILRARA  178
            E PYV  IK+LW DSGIQECYDRRREYQLTDSAKYYLSDL R+  PD+LPTEQDILR R 
Sbjct  121  EEPYVSYIKELWEDSGIQECYDRRREYQLTDSAKYYLSDLRRLAVPDYLPTEQDILRVRV  180

Query  179  PTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFESEN  238
            PTTGIIEYPFDL+ IIFRMVDVGGQRSERRKWIHCFENVTSI+FLVALSEYDQ+L E +N
Sbjct  181  PTTGIIEYPFDLEQIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVECDN  240

Query  239  ENRMEESKALFKTIITYPWFQQSSVILFLNKKDLLEEKIMYSHLVDYFPEYNGPQRDAIP  298
            ENRMEESKALF+TIITYPWF  SSVILFLNKKDLLEEKI+YSHL DYFPEY+GP RD I 
Sbjct  241  ENRMEESKALFRTIITYPWFTNSSVILFLNKKDLLEEKILYSHLADYFPEYDGPPRDPIA  300

Query  299  AREFILQMFVELNPDIEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV  353
            AREFIL+MFV+LNPD +KIIYSHFTCATDTENIRFVFAAVKDTILQ NLKEYNLV
Sbjct  301  AREFILKMFVDLNPDADKIIYSHFTCATDTENIRFVFAAVKDTILQHNLKEYNLV  355


>GNAQ_DROME unnamed protein product
Length=353

 Score = 610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/352 (82%), Positives = 320/352 (91%), Gaps = 0/352 (0%)

Query  1    MACCLSEEAREQKRINQEIERQLRKDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSG  60
            M CCLSEEA+EQKRINQEIE+QLR+DKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSG
Sbjct  1    MECCLSEEAKEQKRINQEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSG  60

Query  61   YSDDDKRGFIKLVYQNIFMAMQSMIRAMDLLKIQYASSANIEKAELVRSVDFETVTTFES  120
            YSD+DKRG+IKLV+QNIFMAMQSMI+AMD+LKI Y    + E A+LV S+D+ETVTTFE 
Sbjct  61   YSDEDKRGYIKLVFQNIFMAMQSMIKAMDMLKISYGQGEHSELADLVMSIDYETVTTFED  120

Query  121  PYVEAIKDLWADSGIQECYDRRREYQLTDSAKYYLSDLERIEKPDFLPTEQDILRARAPT  180
            PY+ AIK LW D+GIQECYDRRREYQLTDSAKYYLSDL RIE+ D+LPTEQDILRAR PT
Sbjct  121  PYLNAIKTLWDDAGIQECYDRRREYQLTDSAKYYLSDLARIEQADYLPTEQDILRARVPT  180

Query  181  TGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFESENEN  240
            TGI+EYPFDLD I+FRMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFES+NEN
Sbjct  181  TGILEYPFDLDGIVFRMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFESDNEN  240

Query  241  RMEESKALFKTIITYPWFQQSSVILFLNKKDLLEEKIMYSHLVDYFPEYNGPQRDAIPAR  300
            RMEESKALF+TIITYPWFQ SSVILFLNKKDLLEEKIMYSHLVDYFPEY+GP++D   A+
Sbjct  241  RMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPKQDHAAAK  300

Query  301  EFILQMFVELNPDIEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNL  352
            +F+L+ ++  NPD E+  YSHFT ATDTENI+ VF AVKDTI+Q  LKE+NL
Sbjct  301  QFVLKKYLACNPDPERQCYSHFTTATDTENIKLVFCAVKDTIMQNALKEFNL  352


>Q8T3G5_CAEEL unnamed protein product
Length=303

 Score = 515 bits (1327),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/303 (81%), Positives = 270/303 (89%), Gaps = 2/303 (1%)

Query  53   MRIIHGSGYSDDDKRGFIKLVYQNIFMAMQSMIRAMDLLKIQYASSAN--IEKAELVRSV  110
            MRIIHG GYS++DKR  I+LVYQN+FMA+QSMIRAMD L I++ + +    EKA +VR V
Sbjct  1    MRIIHGQGYSEEDKRAHIRLVYQNVFMAIQSMIRAMDTLDIKFGNESEELQEKAAVVREV  60

Query  111  DFETVTTFESPYVEAIKDLWADSGIQECYDRRREYQLTDSAKYYLSDLERIEKPDFLPTE  170
            DFE+VT+FE PYV  IK+LW DSGIQECYDRRREYQLTDSAKYYLSDL R+  PD+LPTE
Sbjct  61   DFESVTSFEEPYVSYIKELWEDSGIQECYDRRREYQLTDSAKYYLSDLRRLAVPDYLPTE  120

Query  171  QDILRARAPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYD  230
            QDILR R PTTGIIEYPFDL+ IIFRMVDVGGQRSERRKWIHCFENVTSI+FLVALSEYD
Sbjct  121  QDILRVRVPTTGIIEYPFDLEQIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYD  180

Query  231  QILFESENENRMEESKALFKTIITYPWFQQSSVILFLNKKDLLEEKIMYSHLVDYFPEYN  290
            Q+L E +NENRMEESKALF+TIITYPWF  SSVILFLNKKDLLEEKI+YSHL DYFPEY+
Sbjct  181  QVLVECDNENRMEESKALFRTIITYPWFTNSSVILFLNKKDLLEEKILYSHLADYFPEYD  240

Query  291  GPQRDAIPAREFILQMFVELNPDIEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEY  350
            GP RD I AREFIL+MFV+LNPD +KIIYSHFTCATDTENIRFVFAAVKDTILQ NLKEY
Sbjct  241  GPPRDPIAAREFILKMFVDLNPDADKIIYSHFTCATDTENIRFVFAAVKDTILQHNLKEY  300

Query  351  NLV  353
            NLV
Sbjct  301  NLV  303



Lambda      K        H
   0.317    0.133    0.383 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10587853120


Query= XP_050572991.1 guanine nucleotide-binding protein G(q) subunit alpha
isoform X3 [Bombus affinis]

Length=353
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GNAQ_DROME  unnamed protein product                                   620     0.0   
G5EGU1_CAEEL  unnamed protein product                                 584     0.0   
Q8T3G5_CAEEL  unnamed protein product                                 486     3e-174


>GNAQ_DROME unnamed protein product
Length=353

 Score = 620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/353 (83%), Positives = 319/353 (90%), Gaps = 0/353 (0%)

Query  1    MACCLSEEAREQKRINQEIERQLRKDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSG  60
            M CCLSEEA+EQKRINQEIE+QLR+DKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSG
Sbjct  1    MECCLSEEAKEQKRINQEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSG  60

Query  61   YSDDDKRGFIKLVYQNIFMAMQSMIRAMDLLKIQYASSANIEKAELVRSVDFETVTTFES  120
            YSD+DKRG+IKLV+QNIFMAMQSMI+AMD+LKI Y    + E A+LV S+D+ETVTTFE 
Sbjct  61   YSDEDKRGYIKLVFQNIFMAMQSMIKAMDMLKISYGQGEHSELADLVMSIDYETVTTFED  120

Query  121  PYVEAIKDLWADSGIQECYDRRREYQLTDSAKYYLLEIDRVAARGYLPTEQDILRVRVPT  180
            PY+ AIK LW D+GIQECYDRRREYQLTDSAKYYL ++ R+    YLPTEQDILR RVPT
Sbjct  121  PYLNAIKTLWDDAGIQECYDRRREYQLTDSAKYYLSDLARIEQADYLPTEQDILRARVPT  180

Query  181  TGIIEYPFDLEEIRFRMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFESENEN  240
            TGI+EYPFDL+ I FRMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFES+NEN
Sbjct  181  TGILEYPFDLDGIVFRMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFESDNEN  240

Query  241  RMEESKALFKTIITYPWFQQSSVILFLNKKDLLEEKIMYSHLVDYFPEYNGPKQQDVPAR  300
            RMEESKALF+TIITYPWFQ SSVILFLNKKDLLEEKIMYSHLVDYFPEY+GPKQ    A+
Sbjct  241  RMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPKQDHAAAK  300

Query  301  EFILKVYLNTNPDPDRMCYSHFTCATDTENIKLVFCAVKDTIMQTALKEFNLA  353
            +F+LK YL  NPDP+R CYSHFT ATDTENIKLVFCAVKDTIMQ ALKEFNL 
Sbjct  301  QFVLKKYLACNPDPERQCYSHFTTATDTENIKLVFCAVKDTIMQNALKEFNLG  353


>G5EGU1_CAEEL unnamed protein product
Length=355

 Score = 584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/355 (78%), Positives = 315/355 (89%), Gaps = 2/355 (1%)

Query  1    MACCLSEEAREQKRINQEIERQLRKDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSG  60
            MACCLSEEAREQKRINQEIE+QL++DKR+ARRELKLLLLGTGESGKSTFIKQMRIIHG G
Sbjct  1    MACCLSEEAREQKRINQEIEKQLQRDKRNARRELKLLLLGTGESGKSTFIKQMRIIHGQG  60

Query  61   YSDDDKRGFIKLVYQNIFMAMQSMIRAMDLLKIQYASSAN--IEKAELVRSVDFETVTTF  118
            YS++DKR  I+LVYQN+FMA+QSMIRAMD L I++ + +    EKA +VR VDFE+VT+F
Sbjct  61   YSEEDKRAHIRLVYQNVFMAIQSMIRAMDTLDIKFGNESEELQEKAAVVREVDFESVTSF  120

Query  119  ESPYVEAIKDLWADSGIQECYDRRREYQLTDSAKYYLLEIDRVAARGYLPTEQDILRVRV  178
            E PYV  IK+LW DSGIQECYDRRREYQLTDSAKYYL ++ R+A   YLPTEQDILRVRV
Sbjct  121  EEPYVSYIKELWEDSGIQECYDRRREYQLTDSAKYYLSDLRRLAVPDYLPTEQDILRVRV  180

Query  179  PTTGIIEYPFDLEEIRFRMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFESEN  238
            PTTGIIEYPFDLE+I FRMVDVGGQRSERRKWIHCFENVTSI+FLVALSEYDQ+L E +N
Sbjct  181  PTTGIIEYPFDLEQIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVECDN  240

Query  239  ENRMEESKALFKTIITYPWFQQSSVILFLNKKDLLEEKIMYSHLVDYFPEYNGPKQQDVP  298
            ENRMEESKALF+TIITYPWF  SSVILFLNKKDLLEEKI+YSHL DYFPEY+GP +  + 
Sbjct  241  ENRMEESKALFRTIITYPWFTNSSVILFLNKKDLLEEKILYSHLADYFPEYDGPPRDPIA  300

Query  299  AREFILKVYLNTNPDPDRMCYSHFTCATDTENIKLVFCAVKDTIMQTALKEFNLA  353
            AREFILK++++ NPD D++ YSHFTCATDTENI+ VF AVKDTI+Q  LKE+NL 
Sbjct  301  AREFILKMFVDLNPDADKIIYSHFTCATDTENIRFVFAAVKDTILQHNLKEYNLV  355


>Q8T3G5_CAEEL unnamed protein product
Length=303

 Score = 486 bits (1251),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 229/303 (76%), Positives = 263/303 (87%), Gaps = 2/303 (1%)

Query  53   MRIIHGSGYSDDDKRGFIKLVYQNIFMAMQSMIRAMDLLKIQYASSAN--IEKAELVRSV  110
            MRIIHG GYS++DKR  I+LVYQN+FMA+QSMIRAMD L I++ + +    EKA +VR V
Sbjct  1    MRIIHGQGYSEEDKRAHIRLVYQNVFMAIQSMIRAMDTLDIKFGNESEELQEKAAVVREV  60

Query  111  DFETVTTFESPYVEAIKDLWADSGIQECYDRRREYQLTDSAKYYLLEIDRVAARGYLPTE  170
            DFE+VT+FE PYV  IK+LW DSGIQECYDRRREYQLTDSAKYYL ++ R+A   YLPTE
Sbjct  61   DFESVTSFEEPYVSYIKELWEDSGIQECYDRRREYQLTDSAKYYLSDLRRLAVPDYLPTE  120

Query  171  QDILRVRVPTTGIIEYPFDLEEIRFRMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYD  230
            QDILRVRVPTTGIIEYPFDLE+I FRMVDVGGQRSERRKWIHCFENVTSI+FLVALSEYD
Sbjct  121  QDILRVRVPTTGIIEYPFDLEQIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYD  180

Query  231  QILFESENENRMEESKALFKTIITYPWFQQSSVILFLNKKDLLEEKIMYSHLVDYFPEYN  290
            Q+L E +NENRMEESKALF+TIITYPWF  SSVILFLNKKDLLEEKI+YSHL DYFPEY+
Sbjct  181  QVLVECDNENRMEESKALFRTIITYPWFTNSSVILFLNKKDLLEEKILYSHLADYFPEYD  240

Query  291  GPKQQDVPAREFILKVYLNTNPDPDRMCYSHFTCATDTENIKLVFCAVKDTIMQTALKEF  350
            GP +  + AREFILK++++ NPD D++ YSHFTCATDTENI+ VF AVKDTI+Q  LKE+
Sbjct  241  GPPRDPIAAREFILKMFVDLNPDADKIIYSHFTCATDTENIRFVFAAVKDTILQHNLKEY  300

Query  351  NLA  353
            NL 
Sbjct  301  NLV  303



Lambda      K        H
   0.317    0.133    0.383 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10587853120


Query= XP_050572992.1 G protein alpha q subunit isoform X4 [Bombus affinis]

Length=353
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GNAQ_DROME  unnamed protein product                                   635     0.0   
G5EGU1_CAEEL  unnamed protein product                                 590     0.0   
Q8T3G5_CAEEL  unnamed protein product                                 492     1e-176


>GNAQ_DROME unnamed protein product
Length=353

 Score = 635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/353 (85%), Positives = 324/353 (92%), Gaps = 0/353 (0%)

Query  1    MACCLSEEAREQKRINQEIERQLRKDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSG  60
            M CCLSEEA+EQKRINQEIE+QLR+DKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSG
Sbjct  1    MECCLSEEAKEQKRINQEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSG  60

Query  61   YSDDDKRGFIKLVYQNIFMAMQSMIRAMDLLKIQYASSANIEKAELVRSVDFETVTTFES  120
            YSD+DKRG+IKLV+QNIFMAMQSMI+AMD+LKI Y    + E A+LV S+D+ETVTTFE 
Sbjct  61   YSDEDKRGYIKLVFQNIFMAMQSMIKAMDMLKISYGQGEHSELADLVMSIDYETVTTFED  120

Query  121  PYVEAIKDLWADSGIQECYDRRREYQLTDSAKYYLSDLERIEKPDFLPTEQDILRARAPT  180
            PY+ AIK LW D+GIQECYDRRREYQLTDSAKYYLSDL RIE+ D+LPTEQDILRAR PT
Sbjct  121  PYLNAIKTLWDDAGIQECYDRRREYQLTDSAKYYLSDLARIEQADYLPTEQDILRARVPT  180

Query  181  TGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFESENEN  240
            TGI+EYPFDLD I+FRMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFES+NEN
Sbjct  181  TGILEYPFDLDGIVFRMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFESDNEN  240

Query  241  RMEESKALFKTIITYPWFQQSSVILFLNKKDLLEEKIMYSHLVDYFPEYNGPKQQDVPAR  300
            RMEESKALF+TIITYPWFQ SSVILFLNKKDLLEEKIMYSHLVDYFPEY+GPKQ    A+
Sbjct  241  RMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPKQDHAAAK  300

Query  301  EFILKVYLNTNPDPDRMCYSHFTCATDTENIKLVFCAVKDTIMQTALKEFNLA  353
            +F+LK YL  NPDP+R CYSHFT ATDTENIKLVFCAVKDTIMQ ALKEFNL 
Sbjct  301  QFVLKKYLACNPDPERQCYSHFTTATDTENIKLVFCAVKDTIMQNALKEFNLG  353


>G5EGU1_CAEEL unnamed protein product
Length=355

 Score = 590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/355 (78%), Positives = 315/355 (89%), Gaps = 2/355 (1%)

Query  1    MACCLSEEAREQKRINQEIERQLRKDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSG  60
            MACCLSEEAREQKRINQEIE+QL++DKR+ARRELKLLLLGTGESGKSTFIKQMRIIHG G
Sbjct  1    MACCLSEEAREQKRINQEIEKQLQRDKRNARRELKLLLLGTGESGKSTFIKQMRIIHGQG  60

Query  61   YSDDDKRGFIKLVYQNIFMAMQSMIRAMDLLKIQYASSAN--IEKAELVRSVDFETVTTF  118
            YS++DKR  I+LVYQN+FMA+QSMIRAMD L I++ + +    EKA +VR VDFE+VT+F
Sbjct  61   YSEEDKRAHIRLVYQNVFMAIQSMIRAMDTLDIKFGNESEELQEKAAVVREVDFESVTSF  120

Query  119  ESPYVEAIKDLWADSGIQECYDRRREYQLTDSAKYYLSDLERIEKPDFLPTEQDILRARA  178
            E PYV  IK+LW DSGIQECYDRRREYQLTDSAKYYLSDL R+  PD+LPTEQDILR R 
Sbjct  121  EEPYVSYIKELWEDSGIQECYDRRREYQLTDSAKYYLSDLRRLAVPDYLPTEQDILRVRV  180

Query  179  PTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFESEN  238
            PTTGIIEYPFDL+ IIFRMVDVGGQRSERRKWIHCFENVTSI+FLVALSEYDQ+L E +N
Sbjct  181  PTTGIIEYPFDLEQIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVECDN  240

Query  239  ENRMEESKALFKTIITYPWFQQSSVILFLNKKDLLEEKIMYSHLVDYFPEYNGPKQQDVP  298
            ENRMEESKALF+TIITYPWF  SSVILFLNKKDLLEEKI+YSHL DYFPEY+GP +  + 
Sbjct  241  ENRMEESKALFRTIITYPWFTNSSVILFLNKKDLLEEKILYSHLADYFPEYDGPPRDPIA  300

Query  299  AREFILKVYLNTNPDPDRMCYSHFTCATDTENIKLVFCAVKDTIMQTALKEFNLA  353
            AREFILK++++ NPD D++ YSHFTCATDTENI+ VF AVKDTI+Q  LKE+NL 
Sbjct  301  AREFILKMFVDLNPDADKIIYSHFTCATDTENIRFVFAAVKDTILQHNLKEYNLV  355


>Q8T3G5_CAEEL unnamed protein product
Length=303

 Score = 492 bits (1266),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 230/303 (76%), Positives = 263/303 (87%), Gaps = 2/303 (1%)

Query  53   MRIIHGSGYSDDDKRGFIKLVYQNIFMAMQSMIRAMDLLKIQYASSAN--IEKAELVRSV  110
            MRIIHG GYS++DKR  I+LVYQN+FMA+QSMIRAMD L I++ + +    EKA +VR V
Sbjct  1    MRIIHGQGYSEEDKRAHIRLVYQNVFMAIQSMIRAMDTLDIKFGNESEELQEKAAVVREV  60

Query  111  DFETVTTFESPYVEAIKDLWADSGIQECYDRRREYQLTDSAKYYLSDLERIEKPDFLPTE  170
            DFE+VT+FE PYV  IK+LW DSGIQECYDRRREYQLTDSAKYYLSDL R+  PD+LPTE
Sbjct  61   DFESVTSFEEPYVSYIKELWEDSGIQECYDRRREYQLTDSAKYYLSDLRRLAVPDYLPTE  120

Query  171  QDILRARAPTTGIIEYPFDLDSIIFRMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYD  230
            QDILR R PTTGIIEYPFDL+ IIFRMVDVGGQRSERRKWIHCFENVTSI+FLVALSEYD
Sbjct  121  QDILRVRVPTTGIIEYPFDLEQIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYD  180

Query  231  QILFESENENRMEESKALFKTIITYPWFQQSSVILFLNKKDLLEEKIMYSHLVDYFPEYN  290
            Q+L E +NENRMEESKALF+TIITYPWF  SSVILFLNKKDLLEEKI+YSHL DYFPEY+
Sbjct  181  QVLVECDNENRMEESKALFRTIITYPWFTNSSVILFLNKKDLLEEKILYSHLADYFPEYD  240

Query  291  GPKQQDVPAREFILKVYLNTNPDPDRMCYSHFTCATDTENIKLVFCAVKDTIMQTALKEF  350
            GP +  + AREFILK++++ NPD D++ YSHFTCATDTENI+ VF AVKDTI+Q  LKE+
Sbjct  241  GPPRDPIAAREFILKMFVDLNPDADKIIYSHFTCATDTENIRFVFAAVKDTILQHNLKEY  300

Query  351  NLA  353
            NL 
Sbjct  301  NLV  303



Lambda      K        H
   0.317    0.133    0.383 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10587853120


Query= XP_050572993.1 guanine nucleotide-binding protein G(q) subunit alpha
isoform X1 [Bombus affinis]

Length=353
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

G5EGU1_CAEEL  unnamed protein product                                 608     0.0  
GNAQ_DROME  unnamed protein product                                   595     0.0  
Q8T3G5_CAEEL  unnamed protein product                                 510     0.0  


>G5EGU1_CAEEL unnamed protein product
Length=355

 Score = 608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/355 (82%), Positives = 322/355 (91%), Gaps = 2/355 (1%)

Query  1    MACCLSEEAREQKRINQEIERQLRKDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSG  60
            MACCLSEEAREQKRINQEIE+QL++DKR+ARRELKLLLLGTGESGKSTFIKQMRIIHG G
Sbjct  1    MACCLSEEAREQKRINQEIEKQLQRDKRNARRELKLLLLGTGESGKSTFIKQMRIIHGQG  60

Query  61   YSDDDKRGFIKLVYQNIFMAMQSMIRAMDLLKIQYASSAN--IEKAELVRSVDFETVTTF  118
            YS++DKR  I+LVYQN+FMA+QSMIRAMD L I++ + +    EKA +VR VDFE+VT+F
Sbjct  61   YSEEDKRAHIRLVYQNVFMAIQSMIRAMDTLDIKFGNESEELQEKAAVVREVDFESVTSF  120

Query  119  ESPYVEAIKDLWADSGIQECYDRRREYQLTDSAKYYLLEIDRVAARGYLPTEQDILRVRV  178
            E PYV  IK+LW DSGIQECYDRRREYQLTDSAKYYL ++ R+A   YLPTEQDILRVRV
Sbjct  121  EEPYVSYIKELWEDSGIQECYDRRREYQLTDSAKYYLSDLRRLAVPDYLPTEQDILRVRV  180

Query  179  PTTGIIEYPFDLEEIRFRMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFESEN  238
            PTTGIIEYPFDLE+I FRMVDVGGQRSERRKWIHCFENVTSI+FLVALSEYDQ+L E +N
Sbjct  181  PTTGIIEYPFDLEQIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVECDN  240

Query  239  ENRMEESKALFKTIITYPWFQQSSVILFLNKKDLLEEKIMYSHLVDYFPEYNGPQRDAIP  298
            ENRMEESKALF+TIITYPWF  SSVILFLNKKDLLEEKI+YSHL DYFPEY+GP RD I 
Sbjct  241  ENRMEESKALFRTIITYPWFTNSSVILFLNKKDLLEEKILYSHLADYFPEYDGPPRDPIA  300

Query  299  AREFILQMFVELNPDIEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV  353
            AREFIL+MFV+LNPD +KIIYSHFTCATDTENIRFVFAAVKDTILQ NLKEYNLV
Sbjct  301  AREFILKMFVDLNPDADKIIYSHFTCATDTENIRFVFAAVKDTILQHNLKEYNLV  355


>GNAQ_DROME unnamed protein product
Length=353

 Score = 595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/352 (80%), Positives = 315/352 (89%), Gaps = 0/352 (0%)

Query  1    MACCLSEEAREQKRINQEIERQLRKDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSG  60
            M CCLSEEA+EQKRINQEIE+QLR+DKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSG
Sbjct  1    MECCLSEEAKEQKRINQEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSG  60

Query  61   YSDDDKRGFIKLVYQNIFMAMQSMIRAMDLLKIQYASSANIEKAELVRSVDFETVTTFES  120
            YSD+DKRG+IKLV+QNIFMAMQSMI+AMD+LKI Y    + E A+LV S+D+ETVTTFE 
Sbjct  61   YSDEDKRGYIKLVFQNIFMAMQSMIKAMDMLKISYGQGEHSELADLVMSIDYETVTTFED  120

Query  121  PYVEAIKDLWADSGIQECYDRRREYQLTDSAKYYLLEIDRVAARGYLPTEQDILRVRVPT  180
            PY+ AIK LW D+GIQECYDRRREYQLTDSAKYYL ++ R+    YLPTEQDILR RVPT
Sbjct  121  PYLNAIKTLWDDAGIQECYDRRREYQLTDSAKYYLSDLARIEQADYLPTEQDILRARVPT  180

Query  181  TGIIEYPFDLEEIRFRMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFESENEN  240
            TGI+EYPFDL+ I FRMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFES+NEN
Sbjct  181  TGILEYPFDLDGIVFRMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFESDNEN  240

Query  241  RMEESKALFKTIITYPWFQQSSVILFLNKKDLLEEKIMYSHLVDYFPEYNGPQRDAIPAR  300
            RMEESKALF+TIITYPWFQ SSVILFLNKKDLLEEKIMYSHLVDYFPEY+GP++D   A+
Sbjct  241  RMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPKQDHAAAK  300

Query  301  EFILQMFVELNPDIEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNL  352
            +F+L+ ++  NPD E+  YSHFT ATDTENI+ VF AVKDTI+Q  LKE+NL
Sbjct  301  QFVLKKYLACNPDPERQCYSHFTTATDTENIKLVFCAVKDTIMQNALKEFNL  352


>Q8T3G5_CAEEL unnamed protein product
Length=303

 Score = 510 bits (1313),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 244/303 (81%), Positives = 270/303 (89%), Gaps = 2/303 (1%)

Query  53   MRIIHGSGYSDDDKRGFIKLVYQNIFMAMQSMIRAMDLLKIQYASSAN--IEKAELVRSV  110
            MRIIHG GYS++DKR  I+LVYQN+FMA+QSMIRAMD L I++ + +    EKA +VR V
Sbjct  1    MRIIHGQGYSEEDKRAHIRLVYQNVFMAIQSMIRAMDTLDIKFGNESEELQEKAAVVREV  60

Query  111  DFETVTTFESPYVEAIKDLWADSGIQECYDRRREYQLTDSAKYYLLEIDRVAARGYLPTE  170
            DFE+VT+FE PYV  IK+LW DSGIQECYDRRREYQLTDSAKYYL ++ R+A   YLPTE
Sbjct  61   DFESVTSFEEPYVSYIKELWEDSGIQECYDRRREYQLTDSAKYYLSDLRRLAVPDYLPTE  120

Query  171  QDILRVRVPTTGIIEYPFDLEEIRFRMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYD  230
            QDILRVRVPTTGIIEYPFDLE+I FRMVDVGGQRSERRKWIHCFENVTSI+FLVALSEYD
Sbjct  121  QDILRVRVPTTGIIEYPFDLEQIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYD  180

Query  231  QILFESENENRMEESKALFKTIITYPWFQQSSVILFLNKKDLLEEKIMYSHLVDYFPEYN  290
            Q+L E +NENRMEESKALF+TIITYPWF  SSVILFLNKKDLLEEKI+YSHL DYFPEY+
Sbjct  181  QVLVECDNENRMEESKALFRTIITYPWFTNSSVILFLNKKDLLEEKILYSHLADYFPEYD  240

Query  291  GPQRDAIPAREFILQMFVELNPDIEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEY  350
            GP RD I AREFIL+MFV+LNPD +KIIYSHFTCATDTENIRFVFAAVKDTILQ NLKEY
Sbjct  241  GPPRDPIAAREFILKMFVDLNPDADKIIYSHFTCATDTENIRFVFAAVKDTILQHNLKEY  300

Query  351  NLV  353
            NLV
Sbjct  301  NLV  303



Lambda      K        H
   0.317    0.133    0.383 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10587853120


Query= XP_050572994.1 guanine nucleotide-binding protein G(q) subunit alpha
isoform X5 [Bombus affinis]

Length=396
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

G5EGU1_CAEEL  unnamed protein product                                 593     0.0   
GNAQ_DROME  unnamed protein product                                   589     0.0   
Q8T3G5_CAEEL  unnamed protein product                                 494     1e-176


>G5EGU1_CAEEL unnamed protein product
Length=355

 Score = 593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/398 (74%), Positives = 322/398 (81%), Gaps = 45/398 (11%)

Query  1    MACCLSEEAREQKRINQEIERQLRKDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSG  60
            MACCLSEEAREQKRINQEIE+QL++DKR+ARRELKLLLLGTGESGKSTFIKQMRIIHG G
Sbjct  1    MACCLSEEAREQKRINQEIEKQLQRDKRNARRELKLLLLGTGESGKSTFIKQMRIIHGQG  60

Query  61   YSDDDKRGFIKLVYQNIFMAMQSMIRAMDLLKIQYASSAN--IEKAELVRSVDFETVTTF  118
            YS++DKR  I+LVYQN+FMA+QSMIRAMD L I++ + +    EKA +VR VDFE+VT+F
Sbjct  61   YSEEDKRAHIRLVYQNVFMAIQSMIRAMDTLDIKFGNESEELQEKAAVVREVDFESVTSF  120

Query  119  ESPYVEAIKDLWADSGIQECYDRRREYQLTDSAKYYLLEIDRVAARGYLPTEQDILRVRV  178
            E PYV  IK+LW DSGIQECYDRRREYQLTDSAKYYL                       
Sbjct  121  EEPYVSYIKELWEDSGIQECYDRRREYQLTDSAKYYL-----------------------  157

Query  179  PTTGIIEYPFDLEEIRFSYLSDLERIEKPDFLPTEQDILRARAPTTGIIEYPFDLDSIIF  238
                                SDL R+  PD+LPTEQDILR R PTTGIIEYPFDL+ IIF
Sbjct  158  --------------------SDLRRLAVPDYLPTEQDILRVRVPTTGIIEYPFDLEQIIF  197

Query  239  RMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFESENENRMEESKALFKTIITY  298
            RMVDVGGQRSERRKWIHCFENVTSI+FLVALSEYDQ+L E +NENRMEESKALF+TIITY
Sbjct  198  RMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVECDNENRMEESKALFRTIITY  257

Query  299  PWFQQSSVILFLNKKDLLEEKIMYSHLVDYFPEYNGPQRDAIPAREFILQMFVELNPDIE  358
            PWF  SSVILFLNKKDLLEEKI+YSHL DYFPEY+GP RD I AREFIL+MFV+LNPD +
Sbjct  258  PWFTNSSVILFLNKKDLLEEKILYSHLADYFPEYDGPPRDPIAAREFILKMFVDLNPDAD  317

Query  359  KIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV  396
            KIIYSHFTCATDTENIRFVFAAVKDTILQ NLKEYNLV
Sbjct  318  KIIYSHFTCATDTENIRFVFAAVKDTILQHNLKEYNLV  355


>GNAQ_DROME unnamed protein product
Length=353

 Score = 589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/395 (73%), Positives = 320/395 (81%), Gaps = 43/395 (11%)

Query  1    MACCLSEEAREQKRINQEIERQLRKDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSG  60
            M CCLSEEA+EQKRINQEIE+QLR+DKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSG
Sbjct  1    MECCLSEEAKEQKRINQEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSG  60

Query  61   YSDDDKRGFIKLVYQNIFMAMQSMIRAMDLLKIQYASSANIEKAELVRSVDFETVTTFES  120
            YSD+DKRG+IKLV+QNIFMAMQSMI+AMD+LKI Y    + E A+LV S+D+ETVTTFE 
Sbjct  61   YSDEDKRGYIKLVFQNIFMAMQSMIKAMDMLKISYGQGEHSELADLVMSIDYETVTTFED  120

Query  121  PYVEAIKDLWADSGIQECYDRRREYQLTDSAKYYLLEIDRVAARGYLPTEQDILRVRVPT  180
            PY+ AIK LW D+GIQECYDRRREYQLTDSAKYYL                         
Sbjct  121  PYLNAIKTLWDDAGIQECYDRRREYQLTDSAKYYL-------------------------  155

Query  181  TGIIEYPFDLEEIRFSYLSDLERIEKPDFLPTEQDILRARAPTTGIIEYPFDLDSIIFRM  240
                              SDL RIE+ D+LPTEQDILRAR PTTGI+EYPFDLD I+FRM
Sbjct  156  ------------------SDLARIEQADYLPTEQDILRARVPTTGILEYPFDLDGIVFRM  197

Query  241  VDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFESENENRMEESKALFKTIITYPW  300
            VDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFES+NENRMEESKALF+TIITYPW
Sbjct  198  VDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFESDNENRMEESKALFRTIITYPW  257

Query  301  FQQSSVILFLNKKDLLEEKIMYSHLVDYFPEYNGPQRDAIPAREFILQMFVELNPDIEKI  360
            FQ SSVILFLNKKDLLEEKIMYSHLVDYFPEY+GP++D   A++F+L+ ++  NPD E+ 
Sbjct  258  FQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPKQDHAAAKQFVLKKYLACNPDPERQ  317

Query  361  IYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNL  395
             YSHFT ATDTENI+ VF AVKDTI+Q  LKE+NL
Sbjct  318  CYSHFTTATDTENIKLVFCAVKDTIMQNALKEFNL  352


>Q8T3G5_CAEEL unnamed protein product
Length=303

 Score = 494 bits (1271),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 245/346 (71%), Positives = 270/346 (78%), Gaps = 45/346 (13%)

Query  53   MRIIHGSGYSDDDKRGFIKLVYQNIFMAMQSMIRAMDLLKIQYASSAN--IEKAELVRSV  110
            MRIIHG GYS++DKR  I+LVYQN+FMA+QSMIRAMD L I++ + +    EKA +VR V
Sbjct  1    MRIIHGQGYSEEDKRAHIRLVYQNVFMAIQSMIRAMDTLDIKFGNESEELQEKAAVVREV  60

Query  111  DFETVTTFESPYVEAIKDLWADSGIQECYDRRREYQLTDSAKYYLLEIDRVAARGYLPTE  170
            DFE+VT+FE PYV  IK+LW DSGIQECYDRRREYQLTDSAKYYL               
Sbjct  61   DFESVTSFEEPYVSYIKELWEDSGIQECYDRRREYQLTDSAKYYL---------------  105

Query  171  QDILRVRVPTTGIIEYPFDLEEIRFSYLSDLERIEKPDFLPTEQDILRARAPTTGIIEYP  230
                                        SDL R+  PD+LPTEQDILR R PTTGIIEYP
Sbjct  106  ----------------------------SDLRRLAVPDYLPTEQDILRVRVPTTGIIEYP  137

Query  231  FDLDSIIFRMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFESENENRMEESKA  290
            FDL+ IIFRMVDVGGQRSERRKWIHCFENVTSI+FLVALSEYDQ+L E +NENRMEESKA
Sbjct  138  FDLEQIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVECDNENRMEESKA  197

Query  291  LFKTIITYPWFQQSSVILFLNKKDLLEEKIMYSHLVDYFPEYNGPQRDAIPAREFILQMF  350
            LF+TIITYPWF  SSVILFLNKKDLLEEKI+YSHL DYFPEY+GP RD I AREFIL+MF
Sbjct  198  LFRTIITYPWFTNSSVILFLNKKDLLEEKILYSHLADYFPEYDGPPRDPIAAREFILKMF  257

Query  351  VELNPDIEKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV  396
            V+LNPD +KIIYSHFTCATDTENIRFVFAAVKDTILQ NLKEYNLV
Sbjct  258  VDLNPDADKIIYSHFTCATDTENIRFVFAAVKDTILQHNLKEYNLV  303



Lambda      K        H
   0.317    0.133    0.383 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10587853120


Query= XP_050572995.1 protein SCAI isoform X1 [Bombus affinis]

Length=567
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A8Y5B7_DROME  unnamed protein product                                 29.6    8.6  
Q9GPN7_DROME  unnamed protein product                                 29.6    8.9  
Q9VJD7_DROME  unnamed protein product                                 29.3    9.4  


>A8Y5B7_DROME unnamed protein product
Length=4593

 Score = 29.6 bits (65),  Expect = 8.6, Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 21/36 (58%), Gaps = 0/36 (0%)

Query  214   GPQTSPPVERTPPMCLSLQEILIVGNCADQVKFSEL  249
             GP  +   E T  M  +L ++++V NC+DQ+ F  L
Sbjct  1952  GPAGTGKTETTKDMGRALGKLVVVFNCSDQMDFRGL  1987


>Q9GPN7_DROME unnamed protein product
Length=4350

 Score = 29.6 bits (65),  Expect = 8.9, Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 21/36 (58%), Gaps = 0/36 (0%)

Query  214   GPQTSPPVERTPPMCLSLQEILIVGNCADQVKFSEL  249
             GP  +   E T  M  +L ++++V NC+DQ+ F  L
Sbjct  1709  GPAGTGKTETTKDMGRALGKLVVVFNCSDQMDFRGL  1744


>Q9VJD7_DROME unnamed protein product
Length=494

 Score = 29.3 bits (64),  Expect = 9.4, Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 17/38 (45%), Gaps = 0/38 (0%)

Query  261  EREPRDDPNHLHDASPAGRMPFRPGAYPGAENGAPRRD  298
            ER P  +PN+    +P G  P   G YP    G P  +
Sbjct  115  ERNPATEPNNGGYTTPNGGYPVNNGGYPVNNGGYPSNN  152



Lambda      K        H
   0.317    0.133    0.383 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10587853120


Query= XP_050572996.1 guanine nucleotide-binding protein G(q) subunit alpha
isoform X6 [Bombus affinis]

Length=396
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GNAQ_DROME  unnamed protein product                                   601     0.0   
G5EGU1_CAEEL  unnamed protein product                                 582     0.0   
Q8T3G5_CAEEL  unnamed protein product                                 483     3e-172


>GNAQ_DROME unnamed protein product
Length=353

 Score = 601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/396 (74%), Positives = 323/396 (82%), Gaps = 43/396 (11%)

Query  1    MACCLSEEAREQKRINQEIERQLRKDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSG  60
            M CCLSEEA+EQKRINQEIE+QLR+DKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSG
Sbjct  1    MECCLSEEAKEQKRINQEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSG  60

Query  61   YSDDDKRGFIKLVYQNIFMAMQSMIRAMDLLKIQYASSANIEKAELVRSVDFETVTTFES  120
            YSD+DKRG+IKLV+QNIFMAMQSMI+AMD+LKI Y    + E A+LV S+D+ETVTTFE 
Sbjct  61   YSDEDKRGYIKLVFQNIFMAMQSMIKAMDMLKISYGQGEHSELADLVMSIDYETVTTFED  120

Query  121  PYVEAIKDLWADSGIQECYDRRREYQLTDSAKYYLLEIDRVAARGYLPTEQDILRVRVPT  180
            PY+ AIK LW D+GIQECYDRRREYQLTDSAKYYL                         
Sbjct  121  PYLNAIKTLWDDAGIQECYDRRREYQLTDSAKYYL-------------------------  155

Query  181  TGIIEYPFDLEEIRFSYLSDLERIEKPDFLPTEQDILRARAPTTGIIEYPFDLDSIIFRM  240
                              SDL RIE+ D+LPTEQDILRAR PTTGI+EYPFDLD I+FRM
Sbjct  156  ------------------SDLARIEQADYLPTEQDILRARVPTTGILEYPFDLDGIVFRM  197

Query  241  VDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFESENENRMEESKALFKTIITYPW  300
            VDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFES+NENRMEESKALF+TIITYPW
Sbjct  198  VDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFESDNENRMEESKALFRTIITYPW  257

Query  301  FQQSSVILFLNKKDLLEEKIMYSHLVDYFPEYNGPQRDAIPAREFILQMFVELNPDIEKI  360
            FQ SSVILFLNKKDLLEEKIMYSHLVDYFPEY+GP++D   A++F+L+ ++  NPD E+ 
Sbjct  258  FQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPKQDHAAAKQFVLKKYLACNPDPERQ  317

Query  361  IYSHFTCATDTENIKLVFCAVKDTIMQTALKEFNLA  396
             YSHFT ATDTENIKLVFCAVKDTIMQ ALKEFNL 
Sbjct  318  CYSHFTTATDTENIKLVFCAVKDTIMQNALKEFNLG  353


>G5EGU1_CAEEL unnamed protein product
Length=355

 Score = 582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/398 (72%), Positives = 318/398 (80%), Gaps = 45/398 (11%)

Query  1    MACCLSEEAREQKRINQEIERQLRKDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSG  60
            MACCLSEEAREQKRINQEIE+QL++DKR+ARRELKLLLLGTGESGKSTFIKQMRIIHG G
Sbjct  1    MACCLSEEAREQKRINQEIEKQLQRDKRNARRELKLLLLGTGESGKSTFIKQMRIIHGQG  60

Query  61   YSDDDKRGFIKLVYQNIFMAMQSMIRAMDLLKIQYASSAN--IEKAELVRSVDFETVTTF  118
            YS++DKR  I+LVYQN+FMA+QSMIRAMD L I++ + +    EKA +VR VDFE+VT+F
Sbjct  61   YSEEDKRAHIRLVYQNVFMAIQSMIRAMDTLDIKFGNESEELQEKAAVVREVDFESVTSF  120

Query  119  ESPYVEAIKDLWADSGIQECYDRRREYQLTDSAKYYLLEIDRVAARGYLPTEQDILRVRV  178
            E PYV  IK+LW DSGIQECYDRRREYQLTDSAKYYL                       
Sbjct  121  EEPYVSYIKELWEDSGIQECYDRRREYQLTDSAKYYL-----------------------  157

Query  179  PTTGIIEYPFDLEEIRFSYLSDLERIEKPDFLPTEQDILRARAPTTGIIEYPFDLDSIIF  238
                                SDL R+  PD+LPTEQDILR R PTTGIIEYPFDL+ IIF
Sbjct  158  --------------------SDLRRLAVPDYLPTEQDILRVRVPTTGIIEYPFDLEQIIF  197

Query  239  RMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFESENENRMEESKALFKTIITY  298
            RMVDVGGQRSERRKWIHCFENVTSI+FLVALSEYDQ+L E +NENRMEESKALF+TIITY
Sbjct  198  RMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVECDNENRMEESKALFRTIITY  257

Query  299  PWFQQSSVILFLNKKDLLEEKIMYSHLVDYFPEYNGPQRDAIPAREFILQMFVELNPDIE  358
            PWF  SSVILFLNKKDLLEEKI+YSHL DYFPEY+GP RD I AREFIL+MFV+LNPD +
Sbjct  258  PWFTNSSVILFLNKKDLLEEKILYSHLADYFPEYDGPPRDPIAAREFILKMFVDLNPDAD  317

Query  359  KIIYSHFTCATDTENIKLVFCAVKDTIMQTALKEFNLA  396
            KIIYSHFTCATDTENI+ VF AVKDTI+Q  LKE+NL 
Sbjct  318  KIIYSHFTCATDTENIRFVFAAVKDTILQHNLKEYNLV  355


>Q8T3G5_CAEEL unnamed protein product
Length=303

 Score = 483 bits (1242),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 238/346 (69%), Positives = 266/346 (77%), Gaps = 45/346 (13%)

Query  53   MRIIHGSGYSDDDKRGFIKLVYQNIFMAMQSMIRAMDLLKIQYASSAN--IEKAELVRSV  110
            MRIIHG GYS++DKR  I+LVYQN+FMA+QSMIRAMD L I++ + +    EKA +VR V
Sbjct  1    MRIIHGQGYSEEDKRAHIRLVYQNVFMAIQSMIRAMDTLDIKFGNESEELQEKAAVVREV  60

Query  111  DFETVTTFESPYVEAIKDLWADSGIQECYDRRREYQLTDSAKYYLLEIDRVAARGYLPTE  170
            DFE+VT+FE PYV  IK+LW DSGIQECYDRRREYQLTDSAKYYL               
Sbjct  61   DFESVTSFEEPYVSYIKELWEDSGIQECYDRRREYQLTDSAKYYL---------------  105

Query  171  QDILRVRVPTTGIIEYPFDLEEIRFSYLSDLERIEKPDFLPTEQDILRARAPTTGIIEYP  230
                                        SDL R+  PD+LPTEQDILR R PTTGIIEYP
Sbjct  106  ----------------------------SDLRRLAVPDYLPTEQDILRVRVPTTGIIEYP  137

Query  231  FDLDSIIFRMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFESENENRMEESKA  290
            FDL+ IIFRMVDVGGQRSERRKWIHCFENVTSI+FLVALSEYDQ+L E +NENRMEESKA
Sbjct  138  FDLEQIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVECDNENRMEESKA  197

Query  291  LFKTIITYPWFQQSSVILFLNKKDLLEEKIMYSHLVDYFPEYNGPQRDAIPAREFILQMF  350
            LF+TIITYPWF  SSVILFLNKKDLLEEKI+YSHL DYFPEY+GP RD I AREFIL+MF
Sbjct  198  LFRTIITYPWFTNSSVILFLNKKDLLEEKILYSHLADYFPEYDGPPRDPIAAREFILKMF  257

Query  351  VELNPDIEKIIYSHFTCATDTENIKLVFCAVKDTIMQTALKEFNLA  396
            V+LNPD +KIIYSHFTCATDTENI+ VF AVKDTI+Q  LKE+NL 
Sbjct  258  VDLNPDADKIIYSHFTCATDTENIRFVFAAVKDTILQHNLKEYNLV  303



Lambda      K        H
   0.317    0.133    0.383 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10587853120


Query= XP_050572997.1 loricrin-like [Bombus affinis]

Length=345
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RESIL_DROME  unnamed protein product                                  62.0    2e-10


>RESIL_DROME unnamed protein product
Length=620

 Score = 62.0 bits (149),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 80/165 (48%), Positives = 89/165 (54%), Gaps = 29/165 (18%)

Query  6    TWAPLAATVLATALLL-QPIYAEAPISGSYLPPSTSYGTPNLGGGGPSSTYGAPSGGGGG  64
             +  L  T+L   ++L +P   E P++ SYLPPS SYG P   G G     G PS   G 
Sbjct  1    MFKLLGLTLLMAMVVLGRP---EPPVN-SYLPPSDSYGAPGQSGPG-----GRPSDSYGA  51

Query  65   GGGGGGGRPSSSYGAPSSSY----------GAPSSTYGAP-----SGGRPSSTY-GAPSN  108
             GGG GGRPS SYGAP              G PS TYGAP     +GGRPSS+Y      
Sbjct  52   PGGGNGGRPSDSYGAPGQGQGQGQGQGGYAGKPSDTYGAPGGGNGNGGRPSSSYGAPGGG  111

Query  109  GGGRPSSTY--GAPSGGGRPSSTYGAPGGGSGFGGGL-SSSYGAP  150
             GGRPS TY       GGRPS TYGAPGGG    GG  SSSYGAP
Sbjct  112  NGGRPSDTYGAPGGGNGGRPSDTYGAPGGGGNGNGGRPSSSYGAP  156



Lambda      K        H
   0.317    0.133    0.383 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10587853120


Query= XP_050572998.1 PDZ and LIM domain protein Zasp-like isoform X1
[Bombus affinis]

Length=326
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q86LF6_DROME  unnamed protein product                                 114     2e-30
Q8IGH4_DROME  unnamed protein product                                 115     2e-29
Q7KUD8_DROME  unnamed protein product                                 115     2e-29


>Q86LF6_DROME unnamed protein product
Length=206

 Score = 114 bits (285),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 67/102 (66%), Gaps = 0/102 (0%)

Query  219  APPSTITLRPEPPISQAPAPVYQAQPAATKAPVSGNMRGDLKWPPASVRAQTEAENRARM  278
            A P  ITLR E P+SQ PAPVY +QPAA        +RGDLKWPP   +     EN  R 
Sbjct  103  ASPGIITLRKEAPVSQKPAPVYTSQPAAVSYQGGSKLRGDLKWPPPEYKEAAARENEERR  162

Query  279  ELAKGPAVRPRRVHKDYSGFFAQHALNSTYPGYRAPPGTQYF  320
            +LA GP  RPRRV++DY+ FFA+H LN+ YP Y+ PPGTQ+ 
Sbjct  163  QLALGPVCRPRRVNRDYTPFFAKHQLNNGYPSYKVPPGTQHI  204


>Q8IGH4_DROME unnamed protein product
Length=315

 Score = 115 bits (287),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 67/102 (66%), Gaps = 0/102 (0%)

Query  219  APPSTITLRPEPPISQAPAPVYQAQPAATKAPVSGNMRGDLKWPPASVRAQTEAENRARM  278
            A P  ITLR E P+SQ PAPVY +QPAA        +RGDLKWPP   +     EN  R 
Sbjct  212  ASPGIITLRKEAPVSQKPAPVYTSQPAAVSYQGGSKLRGDLKWPPPEYKEAAARENEERR  271

Query  279  ELAKGPAVRPRRVHKDYSGFFAQHALNSTYPGYRAPPGTQYF  320
            +LA GP  RPRRV++DY+ FFA+H LN+ YP Y+ PPGTQ+ 
Sbjct  272  QLALGPVCRPRRVNRDYTPFFAKHQLNNGYPSYKVPPGTQHI  313


>Q7KUD8_DROME unnamed protein product
Length=354

 Score = 115 bits (288),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 67/102 (66%), Gaps = 0/102 (0%)

Query  219  APPSTITLRPEPPISQAPAPVYQAQPAATKAPVSGNMRGDLKWPPASVRAQTEAENRARM  278
            A P  ITLR E P+SQ PAPVY +QPAA        +RGDLKWPP   +     EN  R 
Sbjct  251  ASPGIITLRKEAPVSQKPAPVYTSQPAAVSYQGGSKLRGDLKWPPPEYKEAAARENEERR  310

Query  279  ELAKGPAVRPRRVHKDYSGFFAQHALNSTYPGYRAPPGTQYF  320
            +LA GP  RPRRV++DY+ FFA+H LN+ YP Y+ PPGTQ+ 
Sbjct  311  QLALGPVCRPRRVNRDYTPFFAKHQLNNGYPSYKVPPGTQHI  352



Lambda      K        H
   0.317    0.133    0.383 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10587853120


Query= XP_050572999.1 PDZ and LIM domain protein Zasp-like isoform X1
[Bombus affinis]

Length=326
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q86LF6_DROME  unnamed protein product                                 114     2e-30
Q8IGH4_DROME  unnamed protein product                                 115     2e-29
Q7KUD8_DROME  unnamed protein product                                 115     2e-29


>Q86LF6_DROME unnamed protein product
Length=206

 Score = 114 bits (285),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 67/102 (66%), Gaps = 0/102 (0%)

Query  219  APPSTITLRPEPPISQAPAPVYQAQPAATKAPVSGNMRGDLKWPPASVRAQTEAENRARM  278
            A P  ITLR E P+SQ PAPVY +QPAA        +RGDLKWPP   +     EN  R 
Sbjct  103  ASPGIITLRKEAPVSQKPAPVYTSQPAAVSYQGGSKLRGDLKWPPPEYKEAAARENEERR  162

Query  279  ELAKGPAVRPRRVHKDYSGFFAQHALNSTYPGYRAPPGTQYF  320
            +LA GP  RPRRV++DY+ FFA+H LN+ YP Y+ PPGTQ+ 
Sbjct  163  QLALGPVCRPRRVNRDYTPFFAKHQLNNGYPSYKVPPGTQHI  204


>Q8IGH4_DROME unnamed protein product
Length=315

 Score = 115 bits (287),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 67/102 (66%), Gaps = 0/102 (0%)

Query  219  APPSTITLRPEPPISQAPAPVYQAQPAATKAPVSGNMRGDLKWPPASVRAQTEAENRARM  278
            A P  ITLR E P+SQ PAPVY +QPAA        +RGDLKWPP   +     EN  R 
Sbjct  212  ASPGIITLRKEAPVSQKPAPVYTSQPAAVSYQGGSKLRGDLKWPPPEYKEAAARENEERR  271

Query  279  ELAKGPAVRPRRVHKDYSGFFAQHALNSTYPGYRAPPGTQYF  320
            +LA GP  RPRRV++DY+ FFA+H LN+ YP Y+ PPGTQ+ 
Sbjct  272  QLALGPVCRPRRVNRDYTPFFAKHQLNNGYPSYKVPPGTQHI  313


>Q7KUD8_DROME unnamed protein product
Length=354

 Score = 115 bits (288),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 67/102 (66%), Gaps = 0/102 (0%)

Query  219  APPSTITLRPEPPISQAPAPVYQAQPAATKAPVSGNMRGDLKWPPASVRAQTEAENRARM  278
            A P  ITLR E P+SQ PAPVY +QPAA        +RGDLKWPP   +     EN  R 
Sbjct  251  ASPGIITLRKEAPVSQKPAPVYTSQPAAVSYQGGSKLRGDLKWPPPEYKEAAARENEERR  310

Query  279  ELAKGPAVRPRRVHKDYSGFFAQHALNSTYPGYRAPPGTQYF  320
            +LA GP  RPRRV++DY+ FFA+H LN+ YP Y+ PPGTQ+ 
Sbjct  311  QLALGPVCRPRRVNRDYTPFFAKHQLNNGYPSYKVPPGTQHI  352



Lambda      K        H
   0.317    0.133    0.383 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10587853120


Query= XP_050573000.1 PDZ and LIM domain protein Zasp-like isoform X1
[Bombus affinis]

Length=326
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q86LF6_DROME  unnamed protein product                                 114     2e-30
Q8IGH4_DROME  unnamed protein product                                 115     2e-29
Q7KUD8_DROME  unnamed protein product                                 115     2e-29


>Q86LF6_DROME unnamed protein product
Length=206

 Score = 114 bits (285),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 67/102 (66%), Gaps = 0/102 (0%)

Query  219  APPSTITLRPEPPISQAPAPVYQAQPAATKAPVSGNMRGDLKWPPASVRAQTEAENRARM  278
            A P  ITLR E P+SQ PAPVY +QPAA        +RGDLKWPP   +     EN  R 
Sbjct  103  ASPGIITLRKEAPVSQKPAPVYTSQPAAVSYQGGSKLRGDLKWPPPEYKEAAARENEERR  162

Query  279  ELAKGPAVRPRRVHKDYSGFFAQHALNSTYPGYRAPPGTQYF  320
            +LA GP  RPRRV++DY+ FFA+H LN+ YP Y+ PPGTQ+ 
Sbjct  163  QLALGPVCRPRRVNRDYTPFFAKHQLNNGYPSYKVPPGTQHI  204


>Q8IGH4_DROME unnamed protein product
Length=315

 Score = 115 bits (287),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 67/102 (66%), Gaps = 0/102 (0%)

Query  219  APPSTITLRPEPPISQAPAPVYQAQPAATKAPVSGNMRGDLKWPPASVRAQTEAENRARM  278
            A P  ITLR E P+SQ PAPVY +QPAA        +RGDLKWPP   +     EN  R 
Sbjct  212  ASPGIITLRKEAPVSQKPAPVYTSQPAAVSYQGGSKLRGDLKWPPPEYKEAAARENEERR  271

Query  279  ELAKGPAVRPRRVHKDYSGFFAQHALNSTYPGYRAPPGTQYF  320
            +LA GP  RPRRV++DY+ FFA+H LN+ YP Y+ PPGTQ+ 
Sbjct  272  QLALGPVCRPRRVNRDYTPFFAKHQLNNGYPSYKVPPGTQHI  313


>Q7KUD8_DROME unnamed protein product
Length=354

 Score = 115 bits (288),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 67/102 (66%), Gaps = 0/102 (0%)

Query  219  APPSTITLRPEPPISQAPAPVYQAQPAATKAPVSGNMRGDLKWPPASVRAQTEAENRARM  278
            A P  ITLR E P+SQ PAPVY +QPAA        +RGDLKWPP   +     EN  R 
Sbjct  251  ASPGIITLRKEAPVSQKPAPVYTSQPAAVSYQGGSKLRGDLKWPPPEYKEAAARENEERR  310

Query  279  ELAKGPAVRPRRVHKDYSGFFAQHALNSTYPGYRAPPGTQYF  320
            +LA GP  RPRRV++DY+ FFA+H LN+ YP Y+ PPGTQ+ 
Sbjct  311  QLALGPVCRPRRVNRDYTPFFAKHQLNNGYPSYKVPPGTQHI  352



Lambda      K        H
   0.317    0.133    0.383 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10587853120


Query= XP_050573001.1 protein SCAI isoform X2 [Bombus affinis]

Length=509
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A8Y5B7_DROME  unnamed protein product                                 29.6    9.1  
Q9GPN7_DROME  unnamed protein product                                 29.6    9.2  
Q9VJD7_DROME  unnamed protein product                                 29.3    9.7  


>A8Y5B7_DROME unnamed protein product
Length=4593

 Score = 29.6 bits (65),  Expect = 9.1, Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 21/36 (58%), Gaps = 0/36 (0%)

Query  214   GPQTSPPVERTPPMCLSLQEILIVGNCADQVKFSEL  249
             GP  +   E T  M  +L ++++V NC+DQ+ F  L
Sbjct  1952  GPAGTGKTETTKDMGRALGKLVVVFNCSDQMDFRGL  1987


>Q9GPN7_DROME unnamed protein product
Length=4350

 Score = 29.6 bits (65),  Expect = 9.2, Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 21/36 (58%), Gaps = 0/36 (0%)

Query  214   GPQTSPPVERTPPMCLSLQEILIVGNCADQVKFSEL  249
             GP  +   E T  M  +L ++++V NC+DQ+ F  L
Sbjct  1709  GPAGTGKTETTKDMGRALGKLVVVFNCSDQMDFRGL  1744


>Q9VJD7_DROME unnamed protein product
Length=494

 Score = 29.3 bits (64),  Expect = 9.7, Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 17/38 (45%), Gaps = 0/38 (0%)

Query  261  EREPRDDPNHLHDASPAGRMPFRPGAYPGAENGAPRRD  298
            ER P  +PN+    +P G  P   G YP    G P  +
Sbjct  115  ERNPATEPNNGGYTTPNGGYPVNNGGYPVNNGGYPSNN  152



Lambda      K        H
   0.317    0.133    0.383 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10587853120


Query= XP_050573002.1 PDZ and LIM domain protein Zasp-like isoform X1
[Bombus affinis]

Length=326
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q86LF6_DROME  unnamed protein product                                 114     2e-30
Q8IGH4_DROME  unnamed protein product                                 115     2e-29
Q7KUD8_DROME  unnamed protein product                                 115     2e-29


>Q86LF6_DROME unnamed protein product
Length=206

 Score = 114 bits (285),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 67/102 (66%), Gaps = 0/102 (0%)

Query  219  APPSTITLRPEPPISQAPAPVYQAQPAATKAPVSGNMRGDLKWPPASVRAQTEAENRARM  278
            A P  ITLR E P+SQ PAPVY +QPAA        +RGDLKWPP   +     EN  R 
Sbjct  103  ASPGIITLRKEAPVSQKPAPVYTSQPAAVSYQGGSKLRGDLKWPPPEYKEAAARENEERR  162

Query  279  ELAKGPAVRPRRVHKDYSGFFAQHALNSTYPGYRAPPGTQYF  320
            +LA GP  RPRRV++DY+ FFA+H LN+ YP Y+ PPGTQ+ 
Sbjct  163  QLALGPVCRPRRVNRDYTPFFAKHQLNNGYPSYKVPPGTQHI  204


>Q8IGH4_DROME unnamed protein product
Length=315

 Score = 115 bits (287),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 67/102 (66%), Gaps = 0/102 (0%)

Query  219  APPSTITLRPEPPISQAPAPVYQAQPAATKAPVSGNMRGDLKWPPASVRAQTEAENRARM  278
            A P  ITLR E P+SQ PAPVY +QPAA        +RGDLKWPP   +     EN  R 
Sbjct  212  ASPGIITLRKEAPVSQKPAPVYTSQPAAVSYQGGSKLRGDLKWPPPEYKEAAARENEERR  271

Query  279  ELAKGPAVRPRRVHKDYSGFFAQHALNSTYPGYRAPPGTQYF  320
            +LA GP  RPRRV++DY+ FFA+H LN+ YP Y+ PPGTQ+ 
Sbjct  272  QLALGPVCRPRRVNRDYTPFFAKHQLNNGYPSYKVPPGTQHI  313


>Q7KUD8_DROME unnamed protein product
Length=354

 Score = 115 bits (288),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 67/102 (66%), Gaps = 0/102 (0%)

Query  219  APPSTITLRPEPPISQAPAPVYQAQPAATKAPVSGNMRGDLKWPPASVRAQTEAENRARM  278
            A P  ITLR E P+SQ PAPVY +QPAA        +RGDLKWPP   +     EN  R 
Sbjct  251  ASPGIITLRKEAPVSQKPAPVYTSQPAAVSYQGGSKLRGDLKWPPPEYKEAAARENEERR  310

Query  279  ELAKGPAVRPRRVHKDYSGFFAQHALNSTYPGYRAPPGTQYF  320
            +LA GP  RPRRV++DY+ FFA+H LN+ YP Y+ PPGTQ+ 
Sbjct  311  QLALGPVCRPRRVNRDYTPFFAKHQLNNGYPSYKVPPGTQHI  352



Lambda      K        H
   0.317    0.133    0.383 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10587853120


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Nov 7, 2022  4:57 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_050573003.1 PDZ and LIM domain protein Zasp-like isoform X1
[Bombus affinis]

Length=326
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q86LF6_DROME  unnamed protein product                                 114     2e-30
Q8IGH4_DROME  unnamed protein product                                 115     2e-29
Q7KUD8_DROME  unnamed protein product                                 115     2e-29


>Q86LF6_DROME unnamed protein product
Length=206

 Score = 114 bits (285),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 67/102 (66%), Gaps = 0/102 (0%)

Query  219  APPSTITLRPEPPISQAPAPVYQAQPAATKAPVSGNMRGDLKWPPASVRAQTEAENRARM  278
            A P  ITLR E P+SQ PAPVY +QPAA        +RGDLKWPP   +     EN  R 
Sbjct  103  ASPGIITLRKEAPVSQKPAPVYTSQPAAVSYQGGSKLRGDLKWPPPEYKEAAARENEERR  162

Query  279  ELAKGPAVRPRRVHKDYSGFFAQHALNSTYPGYRAPPGTQYF  320
            +LA GP  RPRRV++DY+ FFA+H LN+ YP Y+ PPGTQ+ 
Sbjct  163  QLALGPVCRPRRVNRDYTPFFAKHQLNNGYPSYKVPPGTQHI  204


>Q8IGH4_DROME unnamed protein product
Length=315

 Score = 115 bits (287),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 67/102 (66%), Gaps = 0/102 (0%)

Query  219  APPSTITLRPEPPISQAPAPVYQAQPAATKAPVSGNMRGDLKWPPASVRAQTEAENRARM  278
            A P  ITLR E P+SQ PAPVY +QPAA        +RGDLKWPP   +     EN  R 
Sbjct  212  ASPGIITLRKEAPVSQKPAPVYTSQPAAVSYQGGSKLRGDLKWPPPEYKEAAARENEERR  271

Query  279  ELAKGPAVRPRRVHKDYSGFFAQHALNSTYPGYRAPPGTQYF  320
            +LA GP  RPRRV++DY+ FFA+H LN+ YP Y+ PPGTQ+ 
Sbjct  272  QLALGPVCRPRRVNRDYTPFFAKHQLNNGYPSYKVPPGTQHI  313


>Q7KUD8_DROME unnamed protein product
Length=354

 Score = 115 bits (288),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 67/102 (66%), Gaps = 0/102 (0%)

Query  219  APPSTITLRPEPPISQAPAPVYQAQPAATKAPVSGNMRGDLKWPPASVRAQTEAENRARM  278
            A P  ITLR E P+SQ PAPVY +QPAA        +RGDLKWPP   +     EN  R 
Sbjct  251  ASPGIITLRKEAPVSQKPAPVYTSQPAAVSYQGGSKLRGDLKWPPPEYKEAAARENEERR  310

Query  279  ELAKGPAVRPRRVHKDYSGFFAQHALNSTYPGYRAPPGTQYF  320
            +LA GP  RPRRV++DY+ FFA+H LN+ YP Y+ PPGTQ+ 
Sbjct  311  QLALGPVCRPRRVNRDYTPFFAKHQLNNGYPSYKVPPGTQHI  352



Lambda      K        H
   0.311    0.127    0.380 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3252957642


Query= XP_050573004.1 PDZ and LIM domain protein Zasp-like isoform X1
[Bombus affinis]

Length=326
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q86LF6_DROME  unnamed protein product                                 114     2e-30
Q8IGH4_DROME  unnamed protein product                                 115     2e-29
Q7KUD8_DROME  unnamed protein product                                 115     2e-29


>Q86LF6_DROME unnamed protein product
Length=206

 Score = 114 bits (285),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 67/102 (66%), Gaps = 0/102 (0%)

Query  219  APPSTITLRPEPPISQAPAPVYQAQPAATKAPVSGNMRGDLKWPPASVRAQTEAENRARM  278
            A P  ITLR E P+SQ PAPVY +QPAA        +RGDLKWPP   +     EN  R 
Sbjct  103  ASPGIITLRKEAPVSQKPAPVYTSQPAAVSYQGGSKLRGDLKWPPPEYKEAAARENEERR  162

Query  279  ELAKGPAVRPRRVHKDYSGFFAQHALNSTYPGYRAPPGTQYF  320
            +LA GP  RPRRV++DY+ FFA+H LN+ YP Y+ PPGTQ+ 
Sbjct  163  QLALGPVCRPRRVNRDYTPFFAKHQLNNGYPSYKVPPGTQHI  204


>Q8IGH4_DROME unnamed protein product
Length=315

 Score = 115 bits (287),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 67/102 (66%), Gaps = 0/102 (0%)

Query  219  APPSTITLRPEPPISQAPAPVYQAQPAATKAPVSGNMRGDLKWPPASVRAQTEAENRARM  278
            A P  ITLR E P+SQ PAPVY +QPAA        +RGDLKWPP   +     EN  R 
Sbjct  212  ASPGIITLRKEAPVSQKPAPVYTSQPAAVSYQGGSKLRGDLKWPPPEYKEAAARENEERR  271

Query  279  ELAKGPAVRPRRVHKDYSGFFAQHALNSTYPGYRAPPGTQYF  320
            +LA GP  RPRRV++DY+ FFA+H LN+ YP Y+ PPGTQ+ 
Sbjct  272  QLALGPVCRPRRVNRDYTPFFAKHQLNNGYPSYKVPPGTQHI  313


>Q7KUD8_DROME unnamed protein product
Length=354

 Score = 115 bits (288),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 67/102 (66%), Gaps = 0/102 (0%)

Query  219  APPSTITLRPEPPISQAPAPVYQAQPAATKAPVSGNMRGDLKWPPASVRAQTEAENRARM  278
            A P  ITLR E P+SQ PAPVY +QPAA        +RGDLKWPP   +     EN  R 
Sbjct  251  ASPGIITLRKEAPVSQKPAPVYTSQPAAVSYQGGSKLRGDLKWPPPEYKEAAARENEERR  310

Query  279  ELAKGPAVRPRRVHKDYSGFFAQHALNSTYPGYRAPPGTQYF  320
            +LA GP  RPRRV++DY+ FFA+H LN+ YP Y+ PPGTQ+ 
Sbjct  311  QLALGPVCRPRRVNRDYTPFFAKHQLNNGYPSYKVPPGTQHI  352



Lambda      K        H
   0.311    0.127    0.380 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3252957642


Query= XP_050573005.1 PDZ and LIM domain protein Zasp-like isoform X2
[Bombus affinis]

Length=325
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q86LF6_DROME  unnamed protein product                                 114     3e-30
Q8IGH4_DROME  unnamed protein product                                 114     2e-29
Q7KUD8_DROME  unnamed protein product                                 115     2e-29


>Q86LF6_DROME unnamed protein product
Length=206

 Score = 114 bits (285),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 67/102 (66%), Gaps = 0/102 (0%)

Query  218  APPSTITLRPEPPISQAPAPVYQAQPAATKAPVSGNMRGDLKWPPASVRAQTEAENRARM  277
            A P  ITLR E P+SQ PAPVY +QPAA        +RGDLKWPP   +     EN  R 
Sbjct  103  ASPGIITLRKEAPVSQKPAPVYTSQPAAVSYQGGSKLRGDLKWPPPEYKEAAARENEERR  162

Query  278  ELAKGPAVRPRRVHKDYSGFFAQHALNSTYPGYRAPPGTQYF  319
            +LA GP  RPRRV++DY+ FFA+H LN+ YP Y+ PPGTQ+ 
Sbjct  163  QLALGPVCRPRRVNRDYTPFFAKHQLNNGYPSYKVPPGTQHI  204


>Q8IGH4_DROME unnamed protein product
Length=315

 Score = 114 bits (286),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 67/102 (66%), Gaps = 0/102 (0%)

Query  218  APPSTITLRPEPPISQAPAPVYQAQPAATKAPVSGNMRGDLKWPPASVRAQTEAENRARM  277
            A P  ITLR E P+SQ PAPVY +QPAA        +RGDLKWPP   +     EN  R 
Sbjct  212  ASPGIITLRKEAPVSQKPAPVYTSQPAAVSYQGGSKLRGDLKWPPPEYKEAAARENEERR  271

Query  278  ELAKGPAVRPRRVHKDYSGFFAQHALNSTYPGYRAPPGTQYF  319
            +LA GP  RPRRV++DY+ FFA+H LN+ YP Y+ PPGTQ+ 
Sbjct  272  QLALGPVCRPRRVNRDYTPFFAKHQLNNGYPSYKVPPGTQHI  313


>Q7KUD8_DROME unnamed protein product
Length=354

 Score = 115 bits (288),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 67/102 (66%), Gaps = 0/102 (0%)

Query  218  APPSTITLRPEPPISQAPAPVYQAQPAATKAPVSGNMRGDLKWPPASVRAQTEAENRARM  277
            A P  ITLR E P+SQ PAPVY +QPAA        +RGDLKWPP   +     EN  R 
Sbjct  251  ASPGIITLRKEAPVSQKPAPVYTSQPAAVSYQGGSKLRGDLKWPPPEYKEAAARENEERR  310

Query  278  ELAKGPAVRPRRVHKDYSGFFAQHALNSTYPGYRAPPGTQYF  319
            +LA GP  RPRRV++DY+ FFA+H LN+ YP Y+ PPGTQ+ 
Sbjct  311  QLALGPVCRPRRVNRDYTPFFAKHQLNNGYPSYKVPPGTQHI  352



Lambda      K        H
   0.311    0.127    0.380 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3252957642


Query= XP_050573006.1 probable serine/threonine-protein kinase samkC
isoform X3 [Bombus affinis]

Length=295
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q86LF6_DROME  unnamed protein product                                 114     2e-30
Q8IGH4_DROME  unnamed protein product                                 114     1e-29
Q7KUD8_DROME  unnamed protein product                                 115     1e-29


>Q86LF6_DROME unnamed protein product
Length=206

 Score = 114 bits (285),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 67/102 (66%), Gaps = 0/102 (0%)

Query  188  APPSTITLRPEPPISQAPAPVYQAQPAATKAPVSGNMRGDLKWPPASVRAQTEAENRARM  247
            A P  ITLR E P+SQ PAPVY +QPAA        +RGDLKWPP   +     EN  R 
Sbjct  103  ASPGIITLRKEAPVSQKPAPVYTSQPAAVSYQGGSKLRGDLKWPPPEYKEAAARENEERR  162

Query  248  ELAKGPAVRPRRVHKDYSGFFAQHALNSTYPGYRAPPGTQYF  289
            +LA GP  RPRRV++DY+ FFA+H LN+ YP Y+ PPGTQ+ 
Sbjct  163  QLALGPVCRPRRVNRDYTPFFAKHQLNNGYPSYKVPPGTQHI  204


>Q8IGH4_DROME unnamed protein product
Length=315

 Score = 114 bits (286),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 67/102 (66%), Gaps = 0/102 (0%)

Query  188  APPSTITLRPEPPISQAPAPVYQAQPAATKAPVSGNMRGDLKWPPASVRAQTEAENRARM  247
            A P  ITLR E P+SQ PAPVY +QPAA        +RGDLKWPP   +     EN  R 
Sbjct  212  ASPGIITLRKEAPVSQKPAPVYTSQPAAVSYQGGSKLRGDLKWPPPEYKEAAARENEERR  271

Query  248  ELAKGPAVRPRRVHKDYSGFFAQHALNSTYPGYRAPPGTQYF  289
            +LA GP  RPRRV++DY+ FFA+H LN+ YP Y+ PPGTQ+ 
Sbjct  272  QLALGPVCRPRRVNRDYTPFFAKHQLNNGYPSYKVPPGTQHI  313


>Q7KUD8_DROME unnamed protein product
Length=354

 Score = 115 bits (288),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 67/102 (66%), Gaps = 0/102 (0%)

Query  188  APPSTITLRPEPPISQAPAPVYQAQPAATKAPVSGNMRGDLKWPPASVRAQTEAENRARM  247
            A P  ITLR E P+SQ PAPVY +QPAA        +RGDLKWPP   +     EN  R 
Sbjct  251  ASPGIITLRKEAPVSQKPAPVYTSQPAAVSYQGGSKLRGDLKWPPPEYKEAAARENEERR  310

Query  248  ELAKGPAVRPRRVHKDYSGFFAQHALNSTYPGYRAPPGTQYF  289
            +LA GP  RPRRV++DY+ FFA+H LN+ YP Y+ PPGTQ+ 
Sbjct  311  QLALGPVCRPRRVNRDYTPFFAKHQLNNGYPSYKVPPGTQHI  352



Lambda      K        H
   0.311    0.127    0.380 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3252957642


Query= XP_050573007.1 probable serine/threonine-protein kinase samkC
isoform X4 [Bombus affinis]

Length=290
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q86LF6_DROME  unnamed protein product                                 114     1e-30
Q8IGH4_DROME  unnamed protein product                                 114     1e-29
Q7KUD8_DROME  unnamed protein product                                 115     1e-29


>Q86LF6_DROME unnamed protein product
Length=206

 Score = 114 bits (284),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 67/102 (66%), Gaps = 0/102 (0%)

Query  183  APPSTITLRPEPPISQAPAPVYQAQPAATKAPVSGNMRGDLKWPPASVRAQTEAENRARM  242
            A P  ITLR E P+SQ PAPVY +QPAA        +RGDLKWPP   +     EN  R 
Sbjct  103  ASPGIITLRKEAPVSQKPAPVYTSQPAAVSYQGGSKLRGDLKWPPPEYKEAAARENEERR  162

Query  243  ELAKGPAVRPRRVHKDYSGFFAQHALNSTYPGYRAPPGTQYF  284
            +LA GP  RPRRV++DY+ FFA+H LN+ YP Y+ PPGTQ+ 
Sbjct  163  QLALGPVCRPRRVNRDYTPFFAKHQLNNGYPSYKVPPGTQHI  204


>Q8IGH4_DROME unnamed protein product
Length=315

 Score = 114 bits (286),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 67/102 (66%), Gaps = 0/102 (0%)

Query  183  APPSTITLRPEPPISQAPAPVYQAQPAATKAPVSGNMRGDLKWPPASVRAQTEAENRARM  242
            A P  ITLR E P+SQ PAPVY +QPAA        +RGDLKWPP   +     EN  R 
Sbjct  212  ASPGIITLRKEAPVSQKPAPVYTSQPAAVSYQGGSKLRGDLKWPPPEYKEAAARENEERR  271

Query  243  ELAKGPAVRPRRVHKDYSGFFAQHALNSTYPGYRAPPGTQYF  284
            +LA GP  RPRRV++DY+ FFA+H LN+ YP Y+ PPGTQ+ 
Sbjct  272  QLALGPVCRPRRVNRDYTPFFAKHQLNNGYPSYKVPPGTQHI  313


>Q7KUD8_DROME unnamed protein product
Length=354

 Score = 115 bits (287),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 67/102 (66%), Gaps = 0/102 (0%)

Query  183  APPSTITLRPEPPISQAPAPVYQAQPAATKAPVSGNMRGDLKWPPASVRAQTEAENRARM  242
            A P  ITLR E P+SQ PAPVY +QPAA        +RGDLKWPP   +     EN  R 
Sbjct  251  ASPGIITLRKEAPVSQKPAPVYTSQPAAVSYQGGSKLRGDLKWPPPEYKEAAARENEERR  310

Query  243  ELAKGPAVRPRRVHKDYSGFFAQHALNSTYPGYRAPPGTQYF  284
            +LA GP  RPRRV++DY+ FFA+H LN+ YP Y+ PPGTQ+ 
Sbjct  311  QLALGPVCRPRRVNRDYTPFFAKHQLNNGYPSYKVPPGTQHI  352



Lambda      K        H
   0.311    0.127    0.380 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3252957642


Query= XP_050573008.1 probable serine/threonine-protein kinase samkC
isoform X5 [Bombus affinis]

Length=265
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q86LF6_DROME  unnamed protein product                                 114     8e-31
Q8IGH4_DROME  unnamed protein product                                 114     6e-30
Q7KUD8_DROME  unnamed protein product                                 115     8e-30


>Q86LF6_DROME unnamed protein product
Length=206

 Score = 114 bits (284),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 67/102 (66%), Gaps = 0/102 (0%)

Query  158  APPSTITLRPEPPISQAPAPVYQAQPAATKAPVSGNMRGDLKWPPASVRAQTEAENRARM  217
            A P  ITLR E P+SQ PAPVY +QPAA        +RGDLKWPP   +     EN  R 
Sbjct  103  ASPGIITLRKEAPVSQKPAPVYTSQPAAVSYQGGSKLRGDLKWPPPEYKEAAARENEERR  162

Query  218  ELAKGPAVRPRRVHKDYSGFFAQHALNSTYPGYRAPPGTQYF  259
            +LA GP  RPRRV++DY+ FFA+H LN+ YP Y+ PPGTQ+ 
Sbjct  163  QLALGPVCRPRRVNRDYTPFFAKHQLNNGYPSYKVPPGTQHI  204


>Q8IGH4_DROME unnamed protein product
Length=315

 Score = 114 bits (286),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 67/102 (66%), Gaps = 0/102 (0%)

Query  158  APPSTITLRPEPPISQAPAPVYQAQPAATKAPVSGNMRGDLKWPPASVRAQTEAENRARM  217
            A P  ITLR E P+SQ PAPVY +QPAA        +RGDLKWPP   +     EN  R 
Sbjct  212  ASPGIITLRKEAPVSQKPAPVYTSQPAAVSYQGGSKLRGDLKWPPPEYKEAAARENEERR  271

Query  218  ELAKGPAVRPRRVHKDYSGFFAQHALNSTYPGYRAPPGTQYF  259
            +LA GP  RPRRV++DY+ FFA+H LN+ YP Y+ PPGTQ+ 
Sbjct  272  QLALGPVCRPRRVNRDYTPFFAKHQLNNGYPSYKVPPGTQHI  313


>Q7KUD8_DROME unnamed protein product
Length=354

 Score = 115 bits (287),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 67/102 (66%), Gaps = 0/102 (0%)

Query  158  APPSTITLRPEPPISQAPAPVYQAQPAATKAPVSGNMRGDLKWPPASVRAQTEAENRARM  217
            A P  ITLR E P+SQ PAPVY +QPAA        +RGDLKWPP   +     EN  R 
Sbjct  251  ASPGIITLRKEAPVSQKPAPVYTSQPAAVSYQGGSKLRGDLKWPPPEYKEAAARENEERR  310

Query  218  ELAKGPAVRPRRVHKDYSGFFAQHALNSTYPGYRAPPGTQYF  259
            +LA GP  RPRRV++DY+ FFA+H LN+ YP Y+ PPGTQ+ 
Sbjct  311  QLALGPVCRPRRVNRDYTPFFAKHQLNNGYPSYKVPPGTQHI  352



Lambda      K        H
   0.311    0.127    0.380 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3252957642


Query= XP_050573009.1 probable serine/threonine-protein kinase samkC
isoform X6 [Bombus affinis]

Length=264
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q86LF6_DROME  unnamed protein product                                 114     6e-31
Q8IGH4_DROME  unnamed protein product                                 115     4e-30
M9PC30_DROME  unnamed protein product                                 114     6e-30


>Q86LF6_DROME unnamed protein product
Length=206

 Score = 114 bits (285),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 67/102 (66%), Gaps = 0/102 (0%)

Query  157  APPSTITLRPEPPISQAPAPVYQAQPAATKAPVSGNMRGDLKWPPASVRAQTEAENRARM  216
            A P  ITLR E P+SQ PAPVY +QPAA        +RGDLKWPP   +     EN  R 
Sbjct  103  ASPGIITLRKEAPVSQKPAPVYTSQPAAVSYQGGSKLRGDLKWPPPEYKEAAARENEERR  162

Query  217  ELAKGPAVRPRRVHKDYSGFFAQHALNSTYPGYRAPPGTQYF  258
            +LA GP  RPRRV++DY+ FFA+H LN+ YP Y+ PPGTQ+ 
Sbjct  163  QLALGPVCRPRRVNRDYTPFFAKHQLNNGYPSYKVPPGTQHI  204


>Q8IGH4_DROME unnamed protein product
Length=315

 Score = 115 bits (287),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 67/102 (66%), Gaps = 0/102 (0%)

Query  157  APPSTITLRPEPPISQAPAPVYQAQPAATKAPVSGNMRGDLKWPPASVRAQTEAENRARM  216
            A P  ITLR E P+SQ PAPVY +QPAA        +RGDLKWPP   +     EN  R 
Sbjct  212  ASPGIITLRKEAPVSQKPAPVYTSQPAAVSYQGGSKLRGDLKWPPPEYKEAAARENEERR  271

Query  217  ELAKGPAVRPRRVHKDYSGFFAQHALNSTYPGYRAPPGTQYF  258
            +LA GP  RPRRV++DY+ FFA+H LN+ YP Y+ PPGTQ+ 
Sbjct  272  QLALGPVCRPRRVNRDYTPFFAKHQLNNGYPSYKVPPGTQHI  313


>M9PC30_DROME unnamed protein product
Length=299

 Score = 114 bits (285),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 67/102 (66%), Gaps = 0/102 (0%)

Query  157  APPSTITLRPEPPISQAPAPVYQAQPAATKAPVSGNMRGDLKWPPASVRAQTEAENRARM  216
            A P  ITLR E P+SQ PAPVY +QPAA        +RGDLKWPP   +     EN  R 
Sbjct  196  ASPGIITLRKEAPVSQKPAPVYTSQPAAVSYQGGSKLRGDLKWPPPEYKEAAARENEERR  255

Query  217  ELAKGPAVRPRRVHKDYSGFFAQHALNSTYPGYRAPPGTQYF  258
            +LA GP  RPRRV++DY+ FFA+H LN+ YP Y+ PPGTQ+ 
Sbjct  256  QLALGPVCRPRRVNRDYTPFFAKHQLNNGYPSYKVPPGTQHI  297



Lambda      K        H
   0.311    0.127    0.380 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3252957642


Query= XP_050573010.1 uncharacterized protein LOC126913791 isoform X7
[Bombus affinis]

Length=231
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q86LF6_DROME  unnamed protein product                                 114     3e-31
Q7KUD8_DROME  unnamed protein product                                 115     2e-30
Q867T3_DROME  unnamed protein product                                 115     2e-30


>Q86LF6_DROME unnamed protein product
Length=206

 Score = 114 bits (285),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 67/102 (66%), Gaps = 0/102 (0%)

Query  124  APPSTITLRPEPPISQAPAPVYQAQPAATKAPVSGNMRGDLKWPPASVRAQTEAENRARM  183
            A P  ITLR E P+SQ PAPVY +QPAA        +RGDLKWPP   +     EN  R 
Sbjct  103  ASPGIITLRKEAPVSQKPAPVYTSQPAAVSYQGGSKLRGDLKWPPPEYKEAAARENEERR  162

Query  184  ELAKGPAVRPRRVHKDYSGFFAQHALNSTYPGYRAPPGTQYF  225
            +LA GP  RPRRV++DY+ FFA+H LN+ YP Y+ PPGTQ+ 
Sbjct  163  QLALGPVCRPRRVNRDYTPFFAKHQLNNGYPSYKVPPGTQHI  204


>Q7KUD8_DROME unnamed protein product
Length=354

 Score = 115 bits (288),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 67/102 (66%), Gaps = 0/102 (0%)

Query  124  APPSTITLRPEPPISQAPAPVYQAQPAATKAPVSGNMRGDLKWPPASVRAQTEAENRARM  183
            A P  ITLR E P+SQ PAPVY +QPAA        +RGDLKWPP   +     EN  R 
Sbjct  251  ASPGIITLRKEAPVSQKPAPVYTSQPAAVSYQGGSKLRGDLKWPPPEYKEAAARENEERR  310

Query  184  ELAKGPAVRPRRVHKDYSGFFAQHALNSTYPGYRAPPGTQYF  225
            +LA GP  RPRRV++DY+ FFA+H LN+ YP Y+ PPGTQ+ 
Sbjct  311  QLALGPVCRPRRVNRDYTPFFAKHQLNNGYPSYKVPPGTQHI  352


 Score = 79.7 bits (195),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 60/91 (66%), Gaps = 4/91 (4%)

Query  1   MSAQKAMFVNKQFNSPINLYSPQAIQETLDRQTQVLANGAVGIDFNQLAKPANLQNSAVL  60
           M+A +   V+KQFNSP+ LYS + ++ TL+R+ +      + +D +Q+ KP NL NSAVL
Sbjct  1   MAALQRKLVHKQFNSPMGLYSQENVKATLNRELKAFGGEGIEVD-DQITKPLNLANSAVL  59

Query  61  RMLEEEEARQRGGQPRLKRVAWPPPPEDQDL  91
           R +EEEE + + G    KRVAWPP  E++ +
Sbjct  60  RAVEEEEQQAKCG---YKRVAWPPASEERII  87


>Q867T3_DROME unnamed protein product
Length=355

 Score = 115 bits (288),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 67/102 (66%), Gaps = 0/102 (0%)

Query  124  APPSTITLRPEPPISQAPAPVYQAQPAATKAPVSGNMRGDLKWPPASVRAQTEAENRARM  183
            A P  ITLR E P+SQ PAPVY +QPAA        +RGDLKWPP   +     EN  R 
Sbjct  252  ASPGIITLRKEAPVSQKPAPVYTSQPAAVSYQGGSKLRGDLKWPPPEYKEAAARENEERR  311

Query  184  ELAKGPAVRPRRVHKDYSGFFAQHALNSTYPGYRAPPGTQYF  225
            +LA GP  RPRRV++DY+ FFA+H LN+ YP Y+ PPGTQ+ 
Sbjct  312  QLALGPVCRPRRVNRDYTPFFAKHQLNNGYPSYKVPPGTQHI  353


 Score = 79.7 bits (195),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 60/91 (66%), Gaps = 4/91 (4%)

Query  1   MSAQKAMFVNKQFNSPINLYSPQAIQETLDRQTQVLANGAVGIDFNQLAKPANLQNSAVL  60
           M+A +   V+KQFNSP+ LYS + ++ TL+R+ +      + +D +Q+ KP NL NSAVL
Sbjct  1   MAALQRKLVHKQFNSPMGLYSQENVKATLNRELKAFGGEGIEVD-DQITKPLNLANSAVL  59

Query  61  RMLEEEEARQRGGQPRLKRVAWPPPPEDQDL  91
           R +EEEE + + G    KRVAWPP  E++ +
Sbjct  60  RAVEEEEQQAKCG---YKRVAWPPASEERII  87



Lambda      K        H
   0.311    0.127    0.380 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3252957642


Query= XP_050573011.1 protein SCAI isoform X3 [Bombus affinis]

Length=491
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VJD7_DROME  unnamed protein product                                 29.3    8.9  
A8Y5B7_DROME  unnamed protein product                                 29.3    9.7  
Q9GPN7_DROME  unnamed protein product                                 29.3    9.9  


>Q9VJD7_DROME unnamed protein product
Length=494

 Score = 29.3 bits (64),  Expect = 8.9, Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 17/38 (45%), Gaps = 0/38 (0%)

Query  185  EREPRDDPNHLHDASPAGRMPFRPGAYPGAENGAPRRD  222
            ER P  +PN+    +P G  P   G YP    G P  +
Sbjct  115  ERNPATEPNNGGYTTPNGGYPVNNGGYPVNNGGYPSNN  152


>A8Y5B7_DROME unnamed protein product
Length=4593

 Score = 29.3 bits (64),  Expect = 9.7, Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 21/36 (58%), Gaps = 0/36 (0%)

Query  138   GPQTSPPVERTPPMCLSLQEILIVGNCADQVKFSEL  173
             GP  +   E T  M  +L ++++V NC+DQ+ F  L
Sbjct  1952  GPAGTGKTETTKDMGRALGKLVVVFNCSDQMDFRGL  1987


>Q9GPN7_DROME unnamed protein product
Length=4350

 Score = 29.3 bits (64),  Expect = 9.9, Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 21/36 (58%), Gaps = 0/36 (0%)

Query  138   GPQTSPPVERTPPMCLSLQEILIVGNCADQVKFSEL  173
             GP  +   E T  M  +L ++++V NC+DQ+ F  L
Sbjct  1709  GPAGTGKTETTKDMGRALGKLVVVFNCSDQMDFRGL  1744



Lambda      K        H
   0.311    0.127    0.380 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3252957642


Query= XP_050573012.1 omega-amidase NIT2-like isoform X1 [Bombus affinis]

Length=290
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

NFT1_DROME  unnamed protein product                                   159     4e-45
NFT1_CAEEL  unnamed protein product                                   152     6e-43
Q19437_CAEEL  unnamed protein product                                 65.1    9e-12


>NFT1_DROME unnamed protein product
Length=460

 Score = 159 bits (401),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 93/292 (32%), Positives = 152/292 (52%), Gaps = 13/292 (4%)

Query  2    ILTNIVKQVVRMMSTFR------LALVQLQVNEVKSKNVERAVSYISSAKEHNADIIALP  55
            I+  I +Q+ RM    R      +A+ Q++    K+ N+ + +  +  AK  NA ++ LP
Sbjct  12   IVIAIHQQLRRMSVQKRKDQSATIAVGQMRSTSDKAANLSQVIELVDRAKSQNACMLFLP  71

Query  56   EC--FNSPYGIQYFPKYAESIPDGETSVALSKAAKENSIYVVGGTIPEIEGDKLYNTCTI  113
            EC  F      Q   + +E + DGE      + AK N I++  G + E    K++N   +
Sbjct  72   ECCDFVGESRTQTI-ELSEGL-DGELMAQYRELAKCNKIWISLGGVHERNDQKIFNAHVL  129

Query  114  WGPDGTLIAKHRKVHLFDIDIPNKITFRESDSLSPGNSLTM-FDVKGCKIGIGICYDIRF  172
                G L A +RK+H+FD+    ++  RESD+++PG  L         +IG+ ICYD+RF
Sbjct  130  LNEKGELAAVYRKLHMFDV-TTKEVRLRESDTVTPGYCLERPVSTPVGQIGLQICYDLRF  188

Query  173  EEMARIYRNKGCQMLIYPAAFNMTTGPLHWSLLQRSRANDNQLYVACISPARVPSASYVA  232
             E A + R  G  +L YP+AF   TG  HW +L R+RA + Q +V   +     +    +
Sbjct  189  AEPAVLLRKLGANLLTYPSAFTYATGKAHWEILLRARAIETQCFVVAAAQIGWHNQKRQS  248

Query  233  WGHTQLTNPWGKILYDLETQE-NMVVTDIDLKVVEEVRAQIPTFSQRRTDLY  283
            WGH+ + +PWG +L D   QE ++   ++DL V++ +   +P F  RR D+Y
Sbjct  249  WGHSMIVSPWGNVLADCSEQELDIGTAEVDLSVLQSLYQTMPCFEHRRNDIY  300


>NFT1_CAEEL unnamed protein product
Length=440

 Score = 152 bits (384),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 89/279 (32%), Positives = 150/279 (54%), Gaps = 8/279 (3%)

Query  12   RMMSTFR--LALVQLQVNEVKSKNVERAVSYISSAKEHNADIIALPECFNSPYGIQYFPK  69
            R M+T R  +A+ Q+  +    KN + A + I  A E   +++ LPECF+   G+    +
Sbjct  8    RTMATGRHFIAVCQMTSDNDLEKNFQAAKNMIERAGEKKCEMVFLPECFDF-IGLNKNEQ  66

Query  70   YAESIP-DGETSVALSKAAKENSIYV-VGGTIPEIEGDKLY--NTCTIWGPDGTLIAKHR  125
               ++  D E      + A++++I++ +GG   +   D  +  NT  I   DG   A++ 
Sbjct  67   IDLAMATDCEYMEKYRELARKHNIWLSLGGLHHKDPSDAAHPWNTHLIIDSDGVTRAEYN  126

Query  126  KVHLFDIDIPNKITFRESDSLSPGNSLTM-FDVKGCKIGIGICYDIRFEEMARIYRNKGC  184
            K+HLFD++IP K+   ES+    G  +    D    ++G+ ICYD+RF E++   R +G 
Sbjct  127  KLHLFDLEIPGKVRLMESEFSKAGTEMIPPVDTPIGRLGLSICYDVRFPELSLWNRKRGA  186

Query  185  QMLIYPAAFNMTTGPLHWSLLQRSRANDNQLYVACISPARVPSASYVAWGHTQLTNPWGK  244
            Q+L +P+AF + TG  HW  L R+RA +NQ YV   +     +    ++GH+ + +PWG 
Sbjct  187  QLLSFPSAFTLNTGLAHWETLLRARAIENQCYVVAAAQTGAHNPKRQSYGHSMVVDPWGA  246

Query  245  ILYDLETQENMVVTDIDLKVVEEVRAQIPTFSQRRTDLY  283
            ++     + +M   +IDL  V+ +R   P FS RR+DLY
Sbjct  247  VVAQCSERVDMCFAEIDLSYVDTLREMQPVFSHRRSDLY  285


>Q19437_CAEEL unnamed protein product
Length=387

 Score = 65.1 bits (157),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 57/232 (25%), Positives = 107/232 (46%), Gaps = 25/232 (11%)

Query  8    KQVVRMMSTFRLALVQLQVNEVKSKNV--------ERAVSYISSAKEHNADIIALPECFN  59
            K+  R     R+A +Q +++   + +V        +R  + I +A    A++I L E + 
Sbjct  65   KEQTRAPRLVRVAAIQNKIHRPTTDSVVEQRDAIHQRVGAMIEAAASAGANVIGLQEAWT  124

Query  60   SPYGI---QYFP--KYAESIPDGETSVALSKAAKENSIYVVGGTIP--EIEGDKLYNTCT  112
             P+     +  P  ++AES+  G T+  LSK A ++ I ++   +   E + D ++NT  
Sbjct  125  MPFAFCTRERLPWTEFAESVYTGPTTQFLSKLAVKHDIVIISPILERDEEKDDVIWNTAV  184

Query  113  IWGPDGTLIAKHRKVHLFDIDIPNKITFRESDSLSPGNSLTMFDVKGCKIGIGICYDIRF  172
            +    G +I + RK H+  +   N+ T+    +L       +F+ K  +IGI ICY    
Sbjct  185  VISHTGRVIGRSRKNHIPRVGDFNESTYYMESTLG----HPVFETKYGRIGINICYGRHH  240

Query  173  EEMARIYRNKGCQMLIYPAAFNMTTGPLH---WSLLQRSRANDNQLYVACIS  221
             +   +Y   G +++  P+A   T G L    W +  R+ A  N ++   I+
Sbjct  241  PQNWMMYALNGAEIIFNPSA---TVGALSEPLWGIEARNAAIANHVFTVGIN  289



Lambda      K        H
   0.311    0.127    0.380 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3252957642


Query= XP_050573013.1 omega-amidase NIT2-like isoform X2 [Bombus affinis]

Length=278
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

NFT1_DROME  unnamed protein product                                   143     2e-39
NFT1_CAEEL  unnamed protein product                                   127     2e-33
Q19437_CAEEL  unnamed protein product                                 64.7    1e-11


>NFT1_DROME unnamed protein product
Length=460

 Score = 143 bits (360),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 88/281 (31%), Positives = 144/281 (51%), Gaps = 16/281 (6%)

Query  2    ILTNIVKQVVRMMSTFR------LALVQLQVNEVKSKNVERAVSYISSAKEHNADIIALP  55
            I+  I +Q+ RM    R      +A+ Q++    K+ N+ + +  +  AK  NA ++ LP
Sbjct  12   IVIAIHQQLRRMSVQKRKDQSATIAVGQMRSTSDKAANLSQVIELVDRAKSQNACMLFLP  71

Query  56   EC--FNSPYGIQYFPKYAESIPDGETSVALSKAAKENSIYVVGGTIPEIEGDKLYNTCTI  113
            EC  F      Q   + +E + DGE      + AK N I++  G + E    K++N   +
Sbjct  72   ECCDFVGESRTQTI-ELSEGL-DGELMAQYRELAKCNKIWISLGGVHERNDQKIFNAHVL  129

Query  114  WGPDGTLIAKHRKVHLFDIDIPNKITFRESDSLSPGNSLTM-FDVKGCKIGIGICYDIRF  172
                G L A +RK+H+FD+    ++  RESD+++PG  L         +IG+ ICYD+RF
Sbjct  130  LNEKGELAAVYRKLHMFDV-TTKEVRLRESDTVTPGYCLERPVSTPVGQIGLQICYDLRF  188

Query  173  EEMARIYRNKGCQMLIYPAAFNMTTGPLHWSLLQRSRANDNQLYVACISPARVPSASYVA  232
             E A + R  G  +L YP+AF   TG  HW +L R+RA + Q +V   +     +    +
Sbjct  189  AEPAVLLRKLGANLLTYPSAFTYATGKAHWEILLRARAIETQCFVVAAAQIGWHNQKRQS  248

Query  233  WGHTQLTNPWGKILYDLETQENMVVTDIGNFQLNIKSEKSM  273
            WGH+ + +PWG +L D   QE     DIG  ++++   +S+
Sbjct  249  WGHSMIVSPWGNVLADCSEQE----LDIGTAEVDLSVLQSL  285


>NFT1_CAEEL unnamed protein product
Length=440

 Score = 127 bits (318),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 79/271 (29%), Positives = 140/271 (52%), Gaps = 8/271 (3%)

Query  12   RMMSTFR--LALVQLQVNEVKSKNVERAVSYISSAKEHNADIIALPECFNSPYGIQYFPK  69
            R M+T R  +A+ Q+  +    KN + A + I  A E   +++ LPECF+   G+    +
Sbjct  8    RTMATGRHFIAVCQMTSDNDLEKNFQAAKNMIERAGEKKCEMVFLPECFDF-IGLNKNEQ  66

Query  70   YAESIP-DGETSVALSKAAKENSIYV-VGGTIPEIEGDKLY--NTCTIWGPDGTLIAKHR  125
               ++  D E      + A++++I++ +GG   +   D  +  NT  I   DG   A++ 
Sbjct  67   IDLAMATDCEYMEKYRELARKHNIWLSLGGLHHKDPSDAAHPWNTHLIIDSDGVTRAEYN  126

Query  126  KVHLFDIDIPNKITFRESDSLSPGNSLTM-FDVKGCKIGIGICYDIRFEEMARIYRNKGC  184
            K+HLFD++IP K+   ES+    G  +    D    ++G+ ICYD+RF E++   R +G 
Sbjct  127  KLHLFDLEIPGKVRLMESEFSKAGTEMIPPVDTPIGRLGLSICYDVRFPELSLWNRKRGA  186

Query  185  QMLIYPAAFNMTTGPLHWSLLQRSRANDNQLYVACISPARVPSASYVAWGHTQLTNPWGK  244
            Q+L +P+AF + TG  HW  L R+RA +NQ YV   +     +    ++GH+ + +PWG 
Sbjct  187  QLLSFPSAFTLNTGLAHWETLLRARAIENQCYVVAAAQTGAHNPKRQSYGHSMVVDPWGA  246

Query  245  ILYDLETQENMVVTDIGNFQLNIKSEKSMIF  275
            ++     + +M   +I    ++   E   +F
Sbjct  247  VVAQCSERVDMCFAEIDLSYVDTLREMQPVF  277


>Q19437_CAEEL unnamed protein product
Length=387

 Score = 64.7 bits (156),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 57/232 (25%), Positives = 107/232 (46%), Gaps = 25/232 (11%)

Query  8    KQVVRMMSTFRLALVQLQVNEVKSKNV--------ERAVSYISSAKEHNADIIALPECFN  59
            K+  R     R+A +Q +++   + +V        +R  + I +A    A++I L E + 
Sbjct  65   KEQTRAPRLVRVAAIQNKIHRPTTDSVVEQRDAIHQRVGAMIEAAASAGANVIGLQEAWT  124

Query  60   SPYGI---QYFP--KYAESIPDGETSVALSKAAKENSIYVVGGTIP--EIEGDKLYNTCT  112
             P+     +  P  ++AES+  G T+  LSK A ++ I ++   +   E + D ++NT  
Sbjct  125  MPFAFCTRERLPWTEFAESVYTGPTTQFLSKLAVKHDIVIISPILERDEEKDDVIWNTAV  184

Query  113  IWGPDGTLIAKHRKVHLFDIDIPNKITFRESDSLSPGNSLTMFDVKGCKIGIGICYDIRF  172
            +    G +I + RK H+  +   N+ T+    +L       +F+ K  +IGI ICY    
Sbjct  185  VISHTGRVIGRSRKNHIPRVGDFNESTYYMESTLG----HPVFETKYGRIGINICYGRHH  240

Query  173  EEMARIYRNKGCQMLIYPAAFNMTTGPLH---WSLLQRSRANDNQLYVACIS  221
             +   +Y   G +++  P+A   T G L    W +  R+ A  N ++   I+
Sbjct  241  PQNWMMYALNGAEIIFNPSA---TVGALSEPLWGIEARNAAIANHVFTVGIN  289



Lambda      K        H
   0.311    0.127    0.380 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3252957642


Query= XP_050573014.1 omega-amidase NIT2-like isoform X3 [Bombus affinis]

Length=270
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

NFT1_DROME  unnamed protein product                                   140     1e-38
NFT1_CAEEL  unnamed protein product                                   127     7e-34
Q19437_CAEEL  unnamed protein product                                 64.3    1e-11


>NFT1_DROME unnamed protein product
Length=460

 Score = 140 bits (353),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 87/269 (32%), Positives = 137/269 (51%), Gaps = 16/269 (6%)

Query  2    ILTNIVKQVVRMMSTFR------LALVQLQVNEVKSKNVERAVSYISSAKEHNADIIALP  55
            I+  I +Q+ RM    R      +A+ Q++    K+ N+ + +  +  AK  NA ++ LP
Sbjct  12   IVIAIHQQLRRMSVQKRKDQSATIAVGQMRSTSDKAANLSQVIELVDRAKSQNACMLFLP  71

Query  56   EC--FNSPYGIQYFPKYAESIPDGETSVALSKAAKENSIYVVGGTIPEIEGDKLYNTCTI  113
            EC  F      Q   + +E + DGE      + AK N I++  G + E    K++N   +
Sbjct  72   ECCDFVGESRTQTI-ELSEGL-DGELMAQYRELAKCNKIWISLGGVHERNDQKIFNAHVL  129

Query  114  WGPDGTLIAKHRKVHLFDIDIPNKITFRESDSLSPGNSLTM-FDVKGCKIGIGICYDIRF  172
                G L A +RK+H+FD+    ++  RESD+++PG  L         +IG+ ICYD+RF
Sbjct  130  LNEKGELAAVYRKLHMFDV-TTKEVRLRESDTVTPGYCLERPVSTPVGQIGLQICYDLRF  188

Query  173  EEMARIYRNKGCQMLIYPAAFNMTTGPLHWSLLQRSRANDNQLYVACISPARVPSASYVA  232
             E A + R  G  +L YP+AF   TG  HW +L R+RA + Q +V   +     +    +
Sbjct  189  AEPAVLLRKLGANLLTYPSAFTYATGKAHWEILLRARAIETQCFVVAAAQIGWHNQKRQS  248

Query  233  WGHTQLTNPWGKILYDLETQENMVVTDIG  261
            WGH+ + +PWG +L D   QE     DIG
Sbjct  249  WGHSMIVSPWGNVLADCSEQE----LDIG  273


>NFT1_CAEEL unnamed protein product
Length=440

 Score = 127 bits (319),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 77/259 (30%), Positives = 137/259 (53%), Gaps = 8/259 (3%)

Query  12   RMMSTFR--LALVQLQVNEVKSKNVERAVSYISSAKEHNADIIALPECFNSPYGIQYFPK  69
            R M+T R  +A+ Q+  +    KN + A + I  A E   +++ LPECF+   G+    +
Sbjct  8    RTMATGRHFIAVCQMTSDNDLEKNFQAAKNMIERAGEKKCEMVFLPECFDF-IGLNKNEQ  66

Query  70   YAESIP-DGETSVALSKAAKENSIYV-VGGTIPEIEGDKLY--NTCTIWGPDGTLIAKHR  125
               ++  D E      + A++++I++ +GG   +   D  +  NT  I   DG   A++ 
Sbjct  67   IDLAMATDCEYMEKYRELARKHNIWLSLGGLHHKDPSDAAHPWNTHLIIDSDGVTRAEYN  126

Query  126  KVHLFDIDIPNKITFRESDSLSPGNSLTM-FDVKGCKIGIGICYDIRFEEMARIYRNKGC  184
            K+HLFD++IP K+   ES+    G  +    D    ++G+ ICYD+RF E++   R +G 
Sbjct  127  KLHLFDLEIPGKVRLMESEFSKAGTEMIPPVDTPIGRLGLSICYDVRFPELSLWNRKRGA  186

Query  185  QMLIYPAAFNMTTGPLHWSLLQRSRANDNQLYVACISPARVPSASYVAWGHTQLTNPWGK  244
            Q+L +P+AF + TG  HW  L R+RA +NQ YV   +     +    ++GH+ + +PWG 
Sbjct  187  QLLSFPSAFTLNTGLAHWETLLRARAIENQCYVVAAAQTGAHNPKRQSYGHSMVVDPWGA  246

Query  245  ILYDLETQENMVVTDIGVT  263
            ++     + +M   +I ++
Sbjct  247  VVAQCSERVDMCFAEIDLS  265


>Q19437_CAEEL unnamed protein product
Length=387

 Score = 64.3 bits (155),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 57/232 (25%), Positives = 107/232 (46%), Gaps = 25/232 (11%)

Query  8    KQVVRMMSTFRLALVQLQVNEVKSKNV--------ERAVSYISSAKEHNADIIALPECFN  59
            K+  R     R+A +Q +++   + +V        +R  + I +A    A++I L E + 
Sbjct  65   KEQTRAPRLVRVAAIQNKIHRPTTDSVVEQRDAIHQRVGAMIEAAASAGANVIGLQEAWT  124

Query  60   SPYGI---QYFP--KYAESIPDGETSVALSKAAKENSIYVVGGTIP--EIEGDKLYNTCT  112
             P+     +  P  ++AES+  G T+  LSK A ++ I ++   +   E + D ++NT  
Sbjct  125  MPFAFCTRERLPWTEFAESVYTGPTTQFLSKLAVKHDIVIISPILERDEEKDDVIWNTAV  184

Query  113  IWGPDGTLIAKHRKVHLFDIDIPNKITFRESDSLSPGNSLTMFDVKGCKIGIGICYDIRF  172
            +    G +I + RK H+  +   N+ T+    +L       +F+ K  +IGI ICY    
Sbjct  185  VISHTGRVIGRSRKNHIPRVGDFNESTYYMESTLG----HPVFETKYGRIGINICYGRHH  240

Query  173  EEMARIYRNKGCQMLIYPAAFNMTTGPLH---WSLLQRSRANDNQLYVACIS  221
             +   +Y   G +++  P+A   T G L    W +  R+ A  N ++   I+
Sbjct  241  PQNWMMYALNGAEIIFNPSA---TVGALSEPLWGIEARNAAIANHVFTVGIN  289



Lambda      K        H
   0.311    0.127    0.380 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3252957642


Query= XP_050573015.1 G-patch domain and KOW motifs-containing protein
homolog 1-like [Bombus affinis]

Length=265
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GPKOW_CAEEL  unnamed protein product                                  68.2    8e-13
Q385Z7_TRYB2  unnamed protein product                                 30.0    2.0  


>GPKOW_CAEEL unnamed protein product
Length=462

 Score = 68.2 bits (165),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 64/105 (61%), Gaps = 5/105 (5%)

Query  1    MGLGA---DKVALQKKNTDSKKEEEE--VKIEKGTFVKIIAGKQGNNYGQIEGFDDDAGR  55
            +GLGA   + V   K   +S K EEE   +I+ G+F+K++ G+    YG++EG DDD+  
Sbjct  192  LGLGATPKNPVGKNKNTGESSKAEEEKLEEIKVGSFIKVVDGRNKGVYGKVEGRDDDSNS  251

Query  56   LIINLALGGNIISVNEFMVQPVTKSEYSKNSKVLNTKKYEEYKDK  100
            L I  A+GG  + V++ +   V+  EY ++SK LN  +Y++ KD+
Sbjct  252  LFIRTAIGGKTMKVSQIVAVAVSAKEYERDSKCLNKSEYDKEKDR  296


>Q385Z7_TRYB2 unnamed protein product
Length=545

 Score = 30.0 bits (66),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 40/85 (47%), Gaps = 3/85 (4%)

Query  141  NKNKYDKVGDKKSERRKRRSESNDDSDS---DSEKKRRRERSNSNSNDSYKLKRLKKSKK  197
            N +K+ + G +  E  ++  E  +D       S   RR+ RS     +++K KR  +SKK
Sbjct  382  NADKHHEEGKRDEEEHQQAEEREEDKQEGRRQSPNPRRKHRSEDQEEENHKGKRTSESKK  441

Query  198  RKKYDCSSERSSKKRDDEKDQDLDH  222
            R     + E+     D+E+  +L H
Sbjct  442  RSAESTNDEKEVSGTDEEEAAELRH  466



Lambda      K        H
   0.311    0.127    0.380 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3252957642


Query= XP_050573016.1 G-patch domain and KOW motifs-containing protein
homolog 1-like [Bombus affinis]

Length=265
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GPKOW_CAEEL  unnamed protein product                                  68.2    8e-13
Q385Z7_TRYB2  unnamed protein product                                 30.0    2.0  


>GPKOW_CAEEL unnamed protein product
Length=462

 Score = 68.2 bits (165),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 64/105 (61%), Gaps = 5/105 (5%)

Query  1    MGLGA---DKVALQKKNTDSKKEEEE--VKIEKGTFVKIIAGKQGNNYGQIEGFDDDAGR  55
            +GLGA   + V   K   +S K EEE   +I+ G+F+K++ G+    YG++EG DDD+  
Sbjct  192  LGLGATPKNPVGKNKNTGESSKAEEEKLEEIKVGSFIKVVDGRNKGVYGKVEGRDDDSNS  251

Query  56   LIINLALGGNIISVNEFMVQPVTKSEYSKNSKVLNTKKYEEYKDK  100
            L I  A+GG  + V++ +   V+  EY ++SK LN  +Y++ KD+
Sbjct  252  LFIRTAIGGKTMKVSQIVAVAVSAKEYERDSKCLNKSEYDKEKDR  296


>Q385Z7_TRYB2 unnamed protein product
Length=545

 Score = 30.0 bits (66),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 40/85 (47%), Gaps = 3/85 (4%)

Query  141  NKNKYDKVGDKKSERRKRRSESNDDSDS---DSEKKRRRERSNSNSNDSYKLKRLKKSKK  197
            N +K+ + G +  E  ++  E  +D       S   RR+ RS     +++K KR  +SKK
Sbjct  382  NADKHHEEGKRDEEEHQQAEEREEDKQEGRRQSPNPRRKHRSEDQEEENHKGKRTSESKK  441

Query  198  RKKYDCSSERSSKKRDDEKDQDLDH  222
            R     + E+     D+E+  +L H
Sbjct  442  RSAESTNDEKEVSGTDEEEAAELRH  466



Lambda      K        H
   0.311    0.127    0.380 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3252957642


Query= XP_050573017.1 G-patch domain and KOW motifs-containing protein
homolog 1-like [Bombus affinis]

Length=265
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GPKOW_CAEEL  unnamed protein product                                  68.2    8e-13
Q385Z7_TRYB2  unnamed protein product                                 30.0    2.0  


>GPKOW_CAEEL unnamed protein product
Length=462

 Score = 68.2 bits (165),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 64/105 (61%), Gaps = 5/105 (5%)

Query  1    MGLGA---DKVALQKKNTDSKKEEEE--VKIEKGTFVKIIAGKQGNNYGQIEGFDDDAGR  55
            +GLGA   + V   K   +S K EEE   +I+ G+F+K++ G+    YG++EG DDD+  
Sbjct  192  LGLGATPKNPVGKNKNTGESSKAEEEKLEEIKVGSFIKVVDGRNKGVYGKVEGRDDDSNS  251

Query  56   LIINLALGGNIISVNEFMVQPVTKSEYSKNSKVLNTKKYEEYKDK  100
            L I  A+GG  + V++ +   V+  EY ++SK LN  +Y++ KD+
Sbjct  252  LFIRTAIGGKTMKVSQIVAVAVSAKEYERDSKCLNKSEYDKEKDR  296


>Q385Z7_TRYB2 unnamed protein product
Length=545

 Score = 30.0 bits (66),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 40/85 (47%), Gaps = 3/85 (4%)

Query  141  NKNKYDKVGDKKSERRKRRSESNDDSDS---DSEKKRRRERSNSNSNDSYKLKRLKKSKK  197
            N +K+ + G +  E  ++  E  +D       S   RR+ RS     +++K KR  +SKK
Sbjct  382  NADKHHEEGKRDEEEHQQAEEREEDKQEGRRQSPNPRRKHRSEDQEEENHKGKRTSESKK  441

Query  198  RKKYDCSSERSSKKRDDEKDQDLDH  222
            R     + E+     D+E+  +L H
Sbjct  442  RSAESTNDEKEVSGTDEEEAAELRH  466



Lambda      K        H
   0.311    0.127    0.380 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3252957642


Query= XP_050573018.1 G-patch domain and KOW motifs-containing protein
homolog 1-like [Bombus affinis]

Length=265
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GPKOW_CAEEL  unnamed protein product                                  68.2    8e-13
Q385Z7_TRYB2  unnamed protein product                                 30.0    2.0  


>GPKOW_CAEEL unnamed protein product
Length=462

 Score = 68.2 bits (165),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 64/105 (61%), Gaps = 5/105 (5%)

Query  1    MGLGA---DKVALQKKNTDSKKEEEE--VKIEKGTFVKIIAGKQGNNYGQIEGFDDDAGR  55
            +GLGA   + V   K   +S K EEE   +I+ G+F+K++ G+    YG++EG DDD+  
Sbjct  192  LGLGATPKNPVGKNKNTGESSKAEEEKLEEIKVGSFIKVVDGRNKGVYGKVEGRDDDSNS  251

Query  56   LIINLALGGNIISVNEFMVQPVTKSEYSKNSKVLNTKKYEEYKDK  100
            L I  A+GG  + V++ +   V+  EY ++SK LN  +Y++ KD+
Sbjct  252  LFIRTAIGGKTMKVSQIVAVAVSAKEYERDSKCLNKSEYDKEKDR  296


>Q385Z7_TRYB2 unnamed protein product
Length=545

 Score = 30.0 bits (66),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 40/85 (47%), Gaps = 3/85 (4%)

Query  141  NKNKYDKVGDKKSERRKRRSESNDDSDS---DSEKKRRRERSNSNSNDSYKLKRLKKSKK  197
            N +K+ + G +  E  ++  E  +D       S   RR+ RS     +++K KR  +SKK
Sbjct  382  NADKHHEEGKRDEEEHQQAEEREEDKQEGRRQSPNPRRKHRSEDQEEENHKGKRTSESKK  441

Query  198  RKKYDCSSERSSKKRDDEKDQDLDH  222
            R     + E+     D+E+  +L H
Sbjct  442  RSAESTNDEKEVSGTDEEEAAELRH  466



Lambda      K        H
   0.311    0.127    0.380 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3252957642


Query= XP_050573019.1 G-patch domain and KOW motifs-containing protein
homolog 1-like [Bombus affinis]

Length=265
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GPKOW_CAEEL  unnamed protein product                                  68.2    8e-13
Q385Z7_TRYB2  unnamed protein product                                 30.0    2.0  


>GPKOW_CAEEL unnamed protein product
Length=462

 Score = 68.2 bits (165),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 64/105 (61%), Gaps = 5/105 (5%)

Query  1    MGLGA---DKVALQKKNTDSKKEEEE--VKIEKGTFVKIIAGKQGNNYGQIEGFDDDAGR  55
            +GLGA   + V   K   +S K EEE   +I+ G+F+K++ G+    YG++EG DDD+  
Sbjct  192  LGLGATPKNPVGKNKNTGESSKAEEEKLEEIKVGSFIKVVDGRNKGVYGKVEGRDDDSNS  251

Query  56   LIINLALGGNIISVNEFMVQPVTKSEYSKNSKVLNTKKYEEYKDK  100
            L I  A+GG  + V++ +   V+  EY ++SK LN  +Y++ KD+
Sbjct  252  LFIRTAIGGKTMKVSQIVAVAVSAKEYERDSKCLNKSEYDKEKDR  296


>Q385Z7_TRYB2 unnamed protein product
Length=545

 Score = 30.0 bits (66),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 40/85 (47%), Gaps = 3/85 (4%)

Query  141  NKNKYDKVGDKKSERRKRRSESNDDSDS---DSEKKRRRERSNSNSNDSYKLKRLKKSKK  197
            N +K+ + G +  E  ++  E  +D       S   RR+ RS     +++K KR  +SKK
Sbjct  382  NADKHHEEGKRDEEEHQQAEEREEDKQEGRRQSPNPRRKHRSEDQEEENHKGKRTSESKK  441

Query  198  RKKYDCSSERSSKKRDDEKDQDLDH  222
            R     + E+     D+E+  +L H
Sbjct  442  RSAESTNDEKEVSGTDEEEAAELRH  466



Lambda      K        H
   0.311    0.127    0.380 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3252957642


Query= XP_050573020.1 G-patch domain and KOW motifs-containing protein
homolog 1-like [Bombus affinis]

Length=265
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GPKOW_CAEEL  unnamed protein product                                  68.2    8e-13
Q385Z7_TRYB2  unnamed protein product                                 30.0    2.0  


>GPKOW_CAEEL unnamed protein product
Length=462

 Score = 68.2 bits (165),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 64/105 (61%), Gaps = 5/105 (5%)

Query  1    MGLGA---DKVALQKKNTDSKKEEEE--VKIEKGTFVKIIAGKQGNNYGQIEGFDDDAGR  55
            +GLGA   + V   K   +S K EEE   +I+ G+F+K++ G+    YG++EG DDD+  
Sbjct  192  LGLGATPKNPVGKNKNTGESSKAEEEKLEEIKVGSFIKVVDGRNKGVYGKVEGRDDDSNS  251

Query  56   LIINLALGGNIISVNEFMVQPVTKSEYSKNSKVLNTKKYEEYKDK  100
            L I  A+GG  + V++ +   V+  EY ++SK LN  +Y++ KD+
Sbjct  252  LFIRTAIGGKTMKVSQIVAVAVSAKEYERDSKCLNKSEYDKEKDR  296


>Q385Z7_TRYB2 unnamed protein product
Length=545

 Score = 30.0 bits (66),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 40/85 (47%), Gaps = 3/85 (4%)

Query  141  NKNKYDKVGDKKSERRKRRSESNDDSDS---DSEKKRRRERSNSNSNDSYKLKRLKKSKK  197
            N +K+ + G +  E  ++  E  +D       S   RR+ RS     +++K KR  +SKK
Sbjct  382  NADKHHEEGKRDEEEHQQAEEREEDKQEGRRQSPNPRRKHRSEDQEEENHKGKRTSESKK  441

Query  198  RKKYDCSSERSSKKRDDEKDQDLDH  222
            R     + E+     D+E+  +L H
Sbjct  442  RSAESTNDEKEVSGTDEEEAAELRH  466



Lambda      K        H
   0.311    0.127    0.380 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3252957642


Query= XP_050573021.1 G-patch domain and KOW motifs-containing protein
homolog 1-like [Bombus affinis]

Length=265
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GPKOW_CAEEL  unnamed protein product                                  68.2    8e-13
Q385Z7_TRYB2  unnamed protein product                                 30.0    2.0  


>GPKOW_CAEEL unnamed protein product
Length=462

 Score = 68.2 bits (165),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 64/105 (61%), Gaps = 5/105 (5%)

Query  1    MGLGA---DKVALQKKNTDSKKEEEE--VKIEKGTFVKIIAGKQGNNYGQIEGFDDDAGR  55
            +GLGA   + V   K   +S K EEE   +I+ G+F+K++ G+    YG++EG DDD+  
Sbjct  192  LGLGATPKNPVGKNKNTGESSKAEEEKLEEIKVGSFIKVVDGRNKGVYGKVEGRDDDSNS  251

Query  56   LIINLALGGNIISVNEFMVQPVTKSEYSKNSKVLNTKKYEEYKDK  100
            L I  A+GG  + V++ +   V+  EY ++SK LN  +Y++ KD+
Sbjct  252  LFIRTAIGGKTMKVSQIVAVAVSAKEYERDSKCLNKSEYDKEKDR  296


>Q385Z7_TRYB2 unnamed protein product
Length=545

 Score = 30.0 bits (66),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 40/85 (47%), Gaps = 3/85 (4%)

Query  141  NKNKYDKVGDKKSERRKRRSESNDDSDS---DSEKKRRRERSNSNSNDSYKLKRLKKSKK  197
            N +K+ + G +  E  ++  E  +D       S   RR+ RS     +++K KR  +SKK
Sbjct  382  NADKHHEEGKRDEEEHQQAEEREEDKQEGRRQSPNPRRKHRSEDQEEENHKGKRTSESKK  441

Query  198  RKKYDCSSERSSKKRDDEKDQDLDH  222
            R     + E+     D+E+  +L H
Sbjct  442  RSAESTNDEKEVSGTDEEEAAELRH  466



Lambda      K        H
   0.311    0.127    0.380 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3252957642


Query= XP_050573022.1 G-patch domain and KOW motifs-containing protein
homolog 1-like [Bombus affinis]

Length=265
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GPKOW_CAEEL  unnamed protein product                                  68.2    8e-13
Q385Z7_TRYB2  unnamed protein product                                 30.0    2.0  


>GPKOW_CAEEL unnamed protein product
Length=462

 Score = 68.2 bits (165),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 64/105 (61%), Gaps = 5/105 (5%)

Query  1    MGLGA---DKVALQKKNTDSKKEEEE--VKIEKGTFVKIIAGKQGNNYGQIEGFDDDAGR  55
            +GLGA   + V   K   +S K EEE   +I+ G+F+K++ G+    YG++EG DDD+  
Sbjct  192  LGLGATPKNPVGKNKNTGESSKAEEEKLEEIKVGSFIKVVDGRNKGVYGKVEGRDDDSNS  251

Query  56   LIINLALGGNIISVNEFMVQPVTKSEYSKNSKVLNTKKYEEYKDK  100
            L I  A+GG  + V++ +   V+  EY ++SK LN  +Y++ KD+
Sbjct  252  LFIRTAIGGKTMKVSQIVAVAVSAKEYERDSKCLNKSEYDKEKDR  296


>Q385Z7_TRYB2 unnamed protein product
Length=545

 Score = 30.0 bits (66),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 40/85 (47%), Gaps = 3/85 (4%)

Query  141  NKNKYDKVGDKKSERRKRRSESNDDSDS---DSEKKRRRERSNSNSNDSYKLKRLKKSKK  197
            N +K+ + G +  E  ++  E  +D       S   RR+ RS     +++K KR  +SKK
Sbjct  382  NADKHHEEGKRDEEEHQQAEEREEDKQEGRRQSPNPRRKHRSEDQEEENHKGKRTSESKK  441

Query  198  RKKYDCSSERSSKKRDDEKDQDLDH  222
            R     + E+     D+E+  +L H
Sbjct  442  RSAESTNDEKEVSGTDEEEAAELRH  466



Lambda      K        H
   0.311    0.127    0.380 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3252957642


Query= XP_050573023.1 one cut domain family member 3-like isoform X1
[Bombus affinis]

Length=555
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

H8ESG1_CAEEL  unnamed protein product                                 54.3    2e-07
G5EBN5_CAEEL  unnamed protein product                                 54.3    2e-07
RESIL_DROME  unnamed protein product                                  47.0    3e-05


>H8ESG1_CAEEL unnamed protein product
Length=1494

 Score = 54.3 bits (129),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 97/310 (31%), Positives = 123/310 (40%), Gaps = 65/310 (21%)

Query  19    DPIRTKKEAPLSPPPSQYGPPATSYGVPNVGSSYNAPSDSYGAPPPPSSSYGAPSSSYGA  78
             D  R +K+AP +  P   GPP+     P   S  + P  S       S  +GA   + GA
Sbjct  798   DSYRARKQAPQAQIPEDQGPPS-----PTPSSICDFPVQSQR-----SQRFGAFEGAQGA  847

Query  79    PSGPSSSYNAPSSS-------------YGAPSGPSSSYGAPSSSYGVPSGPSSSYGAPSS  125
             P G    Y  P S              +GAP G    YGAP     + + P + YG   S
Sbjct  848   P-GAQRGYQGPHSPVPGALTGSQASGPFGAPPGAPHGYGAP-----LQAPPQAPYGYDPS  901

Query  126   SYGVPAGPSSSYGAP------SSSYGAPAGP----SSSYGAPSDH-GADHGSFGGDQGYS  174
              Y  P    S+Y AP      S++Y     P    + SY  P    GA +G+  G     
Sbjct  902   RYQDP----STYPAPPPILPGSAAYEHAIRPYPGDTGSYQVPRIVPGAQYGAQAG-----  952

Query  175   SGGSFGDDHGNGGGHGS-FGGDHGSFG--GGHGSFGGGHGSFGGGHGSFGGDQGSFGGDH  231
             SG  FG   G  G  G+ FG     FG  G  G+  G  G+ G   G+ G     FG   
Sbjct  953   SGAYFGAQFGAQGAQGAHFGAQGVQFGAQGAQGAHFGAQGAQGAQFGAQGAQGEQFGA--  1010

Query  232   HGGGGGGGGGGGGGGDHHGGGGSGGLSTSYGA------PAQSYG---PPAQSYGPPAQSY  282
              G  G   G  G  G H G  G+ G  T +GA      P  SYG   PP  SYGP   ++
Sbjct  1011  QGAQGAHFGAQGAQGAHFGAQGAQG--TQFGAQGAQGPPPASYGAPTPPQASYGPAPGAH  1068

Query  283   GPPAQSYGPP  292
             G    + GPP
Sbjct  1069  GYQNGAQGPP  1078


 Score = 43.9 bits (102),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 58/113 (51%), Gaps = 13/113 (12%)

Query  55    PSDSYGAPPPPSSSYGAPSSSYGAPSGPSSSYNAPSSSYGAPSGPSSSYGAPSSSYGVPS  114
             P  SYGAP PP +SYG    ++G  +G   +   P +  GA   P + +GA    +G  +
Sbjct  1047  PPASYGAPTPPQASYGPAPGAHGYQNG---AQGPPGAEVGAQGPPGAHFGA----HGASA  1099

Query  115   GPSSSYGAPS------SSYGVPAGPSSSYGAPSSSYGAPAGPSSSYGAPSDHG  161
              P +SYGAP+      +SYG   G     G    ++GA A P +S+GAP+  G
Sbjct  1100  PPPTSYGAPTPQRPPQASYGAAPGAQGPPGGQFEAHGAAALPPTSHGAPTPQG  1152


 Score = 40.0 bits (92),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 62/212 (29%), Positives = 79/212 (37%), Gaps = 36/212 (17%)

Query  89    PSSSYGAPSGPSSSYGAPSSSYGVPSGPSSSYGAPSSSYGVPAGPSSSYGAPSSSYGAPA  148
             P +SYGAP+ P +SYG    ++G  +G   + G P +  G    P + +GA    +GA A
Sbjct  1047  PPASYGAPTPPQASYGPAPGAHGYQNG---AQGPPGAEVGAQGPPGAHFGA----HGASA  1099

Query  149   GPSSSYGAPSDHGADHGSFGGDQGYSS--GGSFG---------DDHGNGGGHGSFGGDHG  197
              P +SYGAP+       S+G   G     GG F            HG     G FG   G
Sbjct  1100  PPPTSYGAPTPQRPPQASYGAAPGAQGPPGGQFEAHGAAALPPTSHGAPTPQGPFGAAPG  1159

Query  198   SFGGGHGSFGGGHGSFGG----GHGSFGG------DQGSFGGDH-----HGGGGGGGGGG  242
             +  G  G +G     +      G   FG        QGSFG             G   G 
Sbjct  1160  AQFGAQGPYGQQGARYEAQKSPGAAIFGAPGAPPQHQGSFGAQFGVPPPQNSAPGAQFGA  1219

Query  243   GGGGDHHGGGGSGGLSTSYGAPAQSYGPPAQS  274
                   H          SY APA    PPA S
Sbjct  1220  KPEASSHAPTPPPQPHPSYQAPA---PPPALS  1248


 Score = 38.9 bits (89),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 78/262 (30%), Positives = 104/262 (40%), Gaps = 36/262 (14%)

Query  37    GPPATSYGVPNVGSSYNAPSDSYGAPPPPSSSYGAPSSSYGAPSGPSSSYNAPS----SS  92
              PP   YG     S Y  PS +Y APPP      A   +     G + SY  P     + 
Sbjct  890   APPQAPYGYD--PSRYQDPS-TYPAPPPILPGSAAYEHAIRPYPGDTGSYQVPRIVPGAQ  946

Query  93    YGAPSGPSSSYGAPSSSYGVPSGPSSSYGAPSSSYGVPAGPSSSYGAPSSSYGAPAGPSS  152
             YGA +G  + +GA    +G      + +GA    +G       + GA  + +GA     +
Sbjct  947   YGAQAGSGAYFGA---QFGAQGAQGAHFGAQGVQFG-------AQGAQGAHFGAQGAQGA  996

Query  153   SYGAPSDHGADHGSFGGDQG--YSSGGSFGDDHGNGGGHGSFGGDHGSFGGGHGSFG---  207
              +GA    G   G+ G  QG  + + G+ G   G  G  G+  G  G+ G    S+G   
Sbjct  997   QFGAQGAQGEQFGAQGA-QGAHFGAQGAQGAHFGAQGAQGTQFGAQGAQGPPPASYGAPT  1055

Query  208   ---GGHGSFGGGHGSFGGDQGSFGGDHHGGGGGGGGGGGGGGDHHGG-GGSGGLSTSYGA  263
                  +G   G HG   G QG  G +         G  G  G H G  G S    TSYGA
Sbjct  1056  PPQASYGPAPGAHGYQNGAQGPPGAE--------VGAQGPPGAHFGAHGASAPPPTSYGA  1107

Query  264   PAQSYGPPAQSYGPPAQSYGPP  285
             P     PP  SYG    + GPP
Sbjct  1108  PTPQR-PPQASYGAAPGAQGPP  1128


 Score = 30.8 bits (68),  Expect = 4.0, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 62/132 (47%), Gaps = 26/132 (20%)

Query  30    SPPPSQYG------PPATSYGV-PNVGSSYNAPSDSYGAPPPPSSSYGAPSSSYGAPSGP  82
             +PPP+ YG      PP  SYG  P          +++GA   P +S+GAP+     P GP
Sbjct  1099  APPPTSYGAPTPQRPPQASYGAAPGAQGPPGGQFEAHGAAALPPTSHGAPT-----PQGP  1153

Query  83    SSSYNAPSSSYGAPSGPSSSYGAP--------SSSYGVPSGPSSSYGAPSSSYGVPAGPS  134
               +  AP + +GA  GP    GA         ++ +G P  P    G+  + +GVP  P 
Sbjct  1154  FGA--APGAQFGA-QGPYGQQGARYEAQKSPGAAIFGAPGAPPQHQGSFGAQFGVPP-PQ  1209

Query  135   SSYGAPSSSYGA  146
             +S  AP + +GA
Sbjct  1210  NS--APGAQFGA  1219


>G5EBN5_CAEEL unnamed protein product
Length=1492

 Score = 54.3 bits (129),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 97/310 (31%), Positives = 123/310 (40%), Gaps = 65/310 (21%)

Query  19    DPIRTKKEAPLSPPPSQYGPPATSYGVPNVGSSYNAPSDSYGAPPPPSSSYGAPSSSYGA  78
             D  R +K+AP +  P   GPP+     P   S  + P  S       S  +GA   + GA
Sbjct  798   DSYRARKQAPQAQIPEDQGPPS-----PTPSSICDFPVQSQR-----SQRFGAFEGAQGA  847

Query  79    PSGPSSSYNAPSSS-------------YGAPSGPSSSYGAPSSSYGVPSGPSSSYGAPSS  125
             P G    Y  P S              +GAP G    YGAP     + + P + YG   S
Sbjct  848   P-GAQRGYQGPHSPVPGALTGSQASGPFGAPPGAPHGYGAP-----LQAPPQAPYGYDPS  901

Query  126   SYGVPAGPSSSYGAP------SSSYGAPAGP----SSSYGAPSDH-GADHGSFGGDQGYS  174
              Y  P    S+Y AP      S++Y     P    + SY  P    GA +G+  G     
Sbjct  902   RYQDP----STYPAPPPILPGSAAYEHAIRPYPGDTGSYQVPRIVPGAQYGAQAG-----  952

Query  175   SGGSFGDDHGNGGGHGS-FGGDHGSFG--GGHGSFGGGHGSFGGGHGSFGGDQGSFGGDH  231
             SG  FG   G  G  G+ FG     FG  G  G+  G  G+ G   G+ G     FG   
Sbjct  953   SGAYFGAQFGAQGAQGAHFGAQGVQFGAQGAQGAHFGAQGAQGAQFGAQGAQGEQFGA--  1010

Query  232   HGGGGGGGGGGGGGGDHHGGGGSGGLSTSYGA------PAQSYG---PPAQSYGPPAQSY  282
              G  G   G  G  G H G  G+ G  T +GA      P  SYG   PP  SYGP   ++
Sbjct  1011  QGAQGAHFGAQGAQGAHFGAQGAQG--TQFGAQGAQGPPPASYGAPTPPQASYGPAPGAH  1068

Query  283   GPPAQSYGPP  292
             G    + GPP
Sbjct  1069  GYQNGAQGPP  1078


 Score = 43.9 bits (102),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 58/113 (51%), Gaps = 13/113 (12%)

Query  55    PSDSYGAPPPPSSSYGAPSSSYGAPSGPSSSYNAPSSSYGAPSGPSSSYGAPSSSYGVPS  114
             P  SYGAP PP +SYG    ++G  +G   +   P +  GA   P + +GA    +G  +
Sbjct  1047  PPASYGAPTPPQASYGPAPGAHGYQNG---AQGPPGAEVGAQGPPGAHFGA----HGASA  1099

Query  115   GPSSSYGAPS------SSYGVPAGPSSSYGAPSSSYGAPAGPSSSYGAPSDHG  161
              P +SYGAP+      +SYG   G     G    ++GA A P +S+GAP+  G
Sbjct  1100  PPPTSYGAPTPQRPPQASYGAAPGAQGPPGGQFEAHGAAALPPTSHGAPTPQG  1152


 Score = 40.4 bits (93),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 62/212 (29%), Positives = 79/212 (37%), Gaps = 36/212 (17%)

Query  89    PSSSYGAPSGPSSSYGAPSSSYGVPSGPSSSYGAPSSSYGVPAGPSSSYGAPSSSYGAPA  148
             P +SYGAP+ P +SYG    ++G  +G   + G P +  G    P + +GA    +GA A
Sbjct  1047  PPASYGAPTPPQASYGPAPGAHGYQNG---AQGPPGAEVGAQGPPGAHFGA----HGASA  1099

Query  149   GPSSSYGAPSDHGADHGSFGGDQGYSS--GGSFG---------DDHGNGGGHGSFGGDHG  197
              P +SYGAP+       S+G   G     GG F            HG     G FG   G
Sbjct  1100  PPPTSYGAPTPQRPPQASYGAAPGAQGPPGGQFEAHGAAALPPTSHGAPTPQGPFGAAPG  1159

Query  198   SFGGGHGSFGGGHGSFGG----GHGSFGG------DQGSFGGDH-----HGGGGGGGGGG  242
             +  G  G +G     +      G   FG        QGSFG             G   G 
Sbjct  1160  AQFGAQGPYGQQGARYEAQKSPGAAIFGAPGAPPQHQGSFGAQFGVPPPQNSAPGAQFGA  1219

Query  243   GGGGDHHGGGGSGGLSTSYGAPAQSYGPPAQS  274
                   H          SY APA    PPA S
Sbjct  1220  KPEASSHAPTPPPQPHPSYQAPA---PPPALS  1248


 Score = 38.9 bits (89),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 78/262 (30%), Positives = 104/262 (40%), Gaps = 36/262 (14%)

Query  37    GPPATSYGVPNVGSSYNAPSDSYGAPPPPSSSYGAPSSSYGAPSGPSSSYNAPS----SS  92
              PP   YG     S Y  PS +Y APPP      A   +     G + SY  P     + 
Sbjct  890   APPQAPYGYD--PSRYQDPS-TYPAPPPILPGSAAYEHAIRPYPGDTGSYQVPRIVPGAQ  946

Query  93    YGAPSGPSSSYGAPSSSYGVPSGPSSSYGAPSSSYGVPAGPSSSYGAPSSSYGAPAGPSS  152
             YGA +G  + +GA    +G      + +GA    +G       + GA  + +GA     +
Sbjct  947   YGAQAGSGAYFGA---QFGAQGAQGAHFGAQGVQFG-------AQGAQGAHFGAQGAQGA  996

Query  153   SYGAPSDHGADHGSFGGDQG--YSSGGSFGDDHGNGGGHGSFGGDHGSFGGGHGSFG---  207
              +GA    G   G+ G  QG  + + G+ G   G  G  G+  G  G+ G    S+G   
Sbjct  997   QFGAQGAQGEQFGAQGA-QGAHFGAQGAQGAHFGAQGAQGTQFGAQGAQGPPPASYGAPT  1055

Query  208   ---GGHGSFGGGHGSFGGDQGSFGGDHHGGGGGGGGGGGGGGDHHGG-GGSGGLSTSYGA  263
                  +G   G HG   G QG  G +         G  G  G H G  G S    TSYGA
Sbjct  1056  PPQASYGPAPGAHGYQNGAQGPPGAE--------VGAQGPPGAHFGAHGASAPPPTSYGA  1107

Query  264   PAQSYGPPAQSYGPPAQSYGPP  285
             P     PP  SYG    + GPP
Sbjct  1108  PTPQR-PPQASYGAAPGAQGPP  1128


 Score = 30.8 bits (68),  Expect = 4.2, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 62/132 (47%), Gaps = 26/132 (20%)

Query  30    SPPPSQYG------PPATSYGV-PNVGSSYNAPSDSYGAPPPPSSSYGAPSSSYGAPSGP  82
             +PPP+ YG      PP  SYG  P          +++GA   P +S+GAP+     P GP
Sbjct  1099  APPPTSYGAPTPQRPPQASYGAAPGAQGPPGGQFEAHGAAALPPTSHGAPT-----PQGP  1153

Query  83    SSSYNAPSSSYGAPSGPSSSYGAP--------SSSYGVPSGPSSSYGAPSSSYGVPAGPS  134
               +  AP + +GA  GP    GA         ++ +G P  P    G+  + +GVP  P 
Sbjct  1154  FGA--APGAQFGA-QGPYGQQGARYEAQKSPGAAIFGAPGAPPQHQGSFGAQFGVPP-PQ  1209

Query  135   SSYGAPSSSYGA  146
             +S  AP + +GA
Sbjct  1210  NS--APGAQFGA  1219


>RESIL_DROME unnamed protein product
Length=620

 Score = 47.0 bits (110),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 77/173 (45%), Positives = 81/173 (47%), Gaps = 70/173 (40%)

Query  55   PSDSYGAPPP--------PSSSYGAP------------SSSYGAPSG-----PSSSYNA-  88
            PSD+YGAP          PSSSYGAP            SSSYGAP G     PS +Y A 
Sbjct  131  PSDTYGAPGGGGNGNGGRPSSSYGAPGQGQGNGNGGRSSSSYGAPGGGNGGRPSDTYGAP  190

Query  89   -------PSSSYGAPSG------PSSSYGA--------PSSSYGVPSG---------PSS  118
                   PS +YGAP G      PSSSYGA        PS +YG P G         PSS
Sbjct  191  GGGNGGRPSDTYGAPGGGNNGGRPSSSYGAPGGGNGGRPSDTYGAPGGGNGNGSGGRPSS  250

Query  119  SYGA-----------PSSSYGVPA---GPSSSYGAPSSSYGAPAGPSSSYGAP  157
            SYGA           PS SYG P     PS SYGAP S  G    PSSSYGAP
Sbjct  251  SYGAPGQGQGGFGGRPSDSYGAPGQNQKPSDSYGAPGSGNGNGGRPSSSYGAP  303


 Score = 43.9 bits (102),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 68/130 (52%), Gaps = 39/130 (30%)

Query  55   PSDSYGAPPP------PSSSYGA--------PSSSYGAPSGPSSSYNA--PSSSYGAPSG  98
            PSD+YGAP        PSSSYGA        PS +YGAP G + + +   PSSSYGAP  
Sbjct  198  PSDTYGAPGGGNNGGRPSSSYGAPGGGNGGRPSDTYGAPGGGNGNGSGGRPSSSYGAPGQ  257

Query  99   --------PSSSYGAPSSSYGVPSGPSSSYGAPSSSYGVPAGPSSSYGAPSSSYGAP-AG  149
                    PS SYGAP    G    PS SYGAP S  G       + G PSSSYGAP +G
Sbjct  258  GQGGFGGRPSDSYGAP----GQNQKPSDSYGAPGSGNG-------NGGRPSSSYGAPGSG  306

Query  150  PSSSYGAPSD  159
            P    G PSD
Sbjct  307  PG---GRPSD  313


 Score = 43.1 bits (100),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 80/166 (48%), Gaps = 26/166 (16%)

Query  5    LLFLCCFLFVSALGDPIRTKKEAPLSPPPSQYGPPATSYGVPNVGSSYNAPSDSYGAPPP  64
            LL L   + +  LG P          PP + Y PP+ SYG P        PSDSYGAP  
Sbjct  4    LLGLTLLMAMVVLGRP---------EPPVNSYLPPSDSYGAPGQSGPGGRPSDSYGAPGG  54

Query  65   -----PSSSYGAPSSSYGAPSGPSSSYNAPSSSYGAPSGPSSSYGAPSSSYGVPSGPSSS  119
                 PS SYGAP    G   G       PS +YGAP G + + G PSSSYG P     +
Sbjct  55   GNGGRPSDSYGAPGQGQGQGQGQGGYAGKPSDTYGAPGGGNGNGGRPSSSYGAPG--GGN  112

Query  120  YGAPSSSYGVPAGPSSSYGAPSSSYGAPAG--------PSSSYGAP  157
             G PS +YG P     + G PS +YGAP G        PSSSYGAP
Sbjct  113  GGRPSDTYGAPG--GGNGGRPSDTYGAPGGGGNGNGGRPSSSYGAP  156



Lambda      K        H
   0.311    0.127    0.380 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3252957642


Query= XP_050573024.1 acidic leucine-rich nuclear phosphoprotein 32 family
member A isoform X1 [Bombus affinis]

Length=260
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

AN32A_DROME  unnamed protein product                                  223     1e-72
RU2A_CAEEL  unnamed protein product                                   55.1    9e-09
RU2A_DROME  unnamed protein product                                   53.1    4e-08


>AN32A_DROME unnamed protein product
Length=261

 Score = 223 bits (567),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 138/253 (55%), Positives = 166/253 (66%), Gaps = 21/253 (8%)

Query  19   CHQLTRIKELVLDNCRSTHIVGLTDEFVALESLSLINVGLTSLKGFPKLSSLKKLELSDN  78
              ++ +I EL LDNCRST IVGLTDE+ ALESLSLINVGLT+LKGFPKL +LKKLELSDN
Sbjct  11   ARKVNQITELNLDNCRSTSIVGLTDEYTALESLSLINVGLTTLKGFPKLPNLKKLELSDN  70

Query  79   RISGGLNLLQSSPKLTHLNLSGNKIKDLDTLQPLKEFKNLKNLDLFNNEVTNLDNYREKV  138
            RIS GLN L +SPKL +LNLSGNKIKDL+TL+PL+EFKNL  LDLFNN+ T +DNYREK+
Sbjct  71   RISSGLNYLTTSPKLQYLNLSGNKIKDLETLKPLEEFKNLVVLDLFNNDATQVDNYREKI  130

Query  139  FSLIPSLRCLDGFDTDDCEVDDSEGEDDEVNGNEDGDGDANEEDSEEVSDEEEFVFEEGD  198
            F ++PSL  LDGFD +D EV     +DDEVNGN   D D      E+   ++      G+
Sbjct  131  FKMLPSLNFLDGFDCNDEEVQSDGDDDDEVNGN---DSDEVGVSDEDDDSDDSDEEANGE  187

Query  199  VGLEAVYKDGL-EDESD-----------------EDDFLCDEEEEEEDDDNEDDEQEEEE  240
            V L  VY D L ED SD                  DD   D  E     + +D + E+E 
Sbjct  188  VSLSEVYNDDLEEDNSDWEGEDEAGEEDEEEDSDIDDADGDANESAASVNAKDKDGEKEA  247

Query  241  ESSPARGKKRKHE  253
            + S  RGKKRKH+
Sbjct  248  DESQVRGKKRKHD  260


>RU2A_CAEEL unnamed protein product
Length=253

 Score = 55.1 bits (131),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 49/93 (53%), Gaps = 1/93 (1%)

Query  58   LTSLKGFPKLSSLKKLELSDNRISG-GLNLLQSSPKLTHLNLSGNKIKDLDTLQPLKEFK  116
            +  L  FP  S L  L L +NRI+    ++    P L  L L+ N I +L  ++PL E K
Sbjct  54   IRKLDNFPTFSRLNTLYLHNNRINYIAPDIATKLPNLKTLALTNNNICELGDIEPLAECK  113

Query  117  NLKNLDLFNNEVTNLDNYREKVFSLIPSLRCLD  149
             L+ +    N +T+ DNYR  +   +P++R +D
Sbjct  114  KLEYVTFIGNPITHKDNYRMYMIYKLPTVRVID  146


>RU2A_DROME unnamed protein product
Length=265

 Score = 53.1 bits (126),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 51/95 (54%), Gaps = 5/95 (5%)

Query  58   LTSLKGFPKLSSLKKLELSDNRI---SGGLNLLQSSPKLTHLNLSGNKIKDLDTLQPLKE  114
            L  L   P L  LK L L++NRI   S GL   ++ P L  + L+GN +++L  L+PL  
Sbjct  54   LRKLDNLPHLPRLKCLLLNNNRILRISEGLE--EAVPNLGSIILTGNNLQELSDLEPLVG  111

Query  115  FKNLKNLDLFNNEVTNLDNYREKVFSLIPSLRCLD  149
            F  L+ + L  N V+   NYRE +    P LR LD
Sbjct  112  FTKLETICLLINPVSTKPNYREYMAYKFPQLRLLD  146



Lambda      K        H
   0.311    0.127    0.380 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3252957642


Query= XP_050573025.1 acidic leucine-rich nuclear phosphoprotein 32 family
member A isoform X2 [Bombus affinis]

Length=252
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

AN32A_DROME  unnamed protein product                                  242     3e-80
RU2A_CAEEL  unnamed protein product                                   55.8    5e-09
RU2A_DROME  unnamed protein product                                   54.7    1e-08


>AN32A_DROME unnamed protein product
Length=261

 Score = 242 bits (617),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 148/263 (56%), Positives = 175/263 (67%), Gaps = 21/263 (8%)

Query  1    MEKRIELEKRGRNPGEIKELVLDNCRSTHIVGLTDEFVALESLSLINVGLTSLKGFPKLS  60
            MEKRIELE+R R   +I EL LDNCRST IVGLTDE+ ALESLSLINVGLT+LKGFPKL 
Sbjct  1    MEKRIELERRARKVNQITELNLDNCRSTSIVGLTDEYTALESLSLINVGLTTLKGFPKLP  60

Query  61   SLKKLELSDNRISGGLNLLQSSPKLTHLNLSGNKIKDLDTLQPLKEFKNLKNLDLFNNEV  120
            +LKKLELSDNRIS GLN L +SPKL +LNLSGNKIKDL+TL+PL+EFKNL  LDLFNN+ 
Sbjct  61   NLKKLELSDNRISSGLNYLTTSPKLQYLNLSGNKIKDLETLKPLEEFKNLVVLDLFNNDA  120

Query  121  TNLDNYREKVFSLIPSLRCLDGFDTDDCEVDDSEGEDDEVNGNEDGDGDANEEDSEEVSD  180
            T +DNYREK+F ++PSL  LDGFD +D EV     +DDEVNGN   D D      E+   
Sbjct  121  TQVDNYREKIFKMLPSLNFLDGFDCNDEEVQSDGDDDDEVNGN---DSDEVGVSDEDDDS  177

Query  181  EEEFVFEEGDVGLEAVYKDGL-EDESD-----------------EDDFLCDEEEEEEDDD  222
            ++      G+V L  VY D L ED SD                  DD   D  E     +
Sbjct  178  DDSDEEANGEVSLSEVYNDDLEEDNSDWEGEDEAGEEDEEEDSDIDDADGDANESAASVN  237

Query  223  NEDDEQEEEEESSPARGKKRKHE  245
             +D + E+E + S  RGKKRKH+
Sbjct  238  AKDKDGEKEADESQVRGKKRKHD  260


>RU2A_CAEEL unnamed protein product
Length=253

 Score = 55.8 bits (133),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 49/93 (53%), Gaps = 1/93 (1%)

Query  50   LTSLKGFPKLSSLKKLELSDNRISG-GLNLLQSSPKLTHLNLSGNKIKDLDTLQPLKEFK  108
            +  L  FP  S L  L L +NRI+    ++    P L  L L+ N I +L  ++PL E K
Sbjct  54   IRKLDNFPTFSRLNTLYLHNNRINYIAPDIATKLPNLKTLALTNNNICELGDIEPLAECK  113

Query  109  NLKNLDLFNNEVTNLDNYREKVFSLIPSLRCLD  141
             L+ +    N +T+ DNYR  +   +P++R +D
Sbjct  114  KLEYVTFIGNPITHKDNYRMYMIYKLPTVRVID  146


>RU2A_DROME unnamed protein product
Length=265

 Score = 54.7 bits (130),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 65/132 (49%), Gaps = 5/132 (4%)

Query  13   NPGEIKELVLDNCRSTHIVGLTDEFVALESLSLINVGLTSLKGFPKLSSLKKLELSDNRI  72
            NP   +EL L   +   I  L       +++ L +  L  L   P L  LK L L++NRI
Sbjct  17   NPCRERELDLRGYKIPQIENLGATLDQFDTIDLSDNDLRKLDNLPHLPRLKCLLLNNNRI  76

Query  73   ---SGGLNLLQSSPKLTHLNLSGNKIKDLDTLQPLKEFKNLKNLDLFNNEVTNLDNYREK  129
               S GL   ++ P L  + L+GN +++L  L+PL  F  L+ + L  N V+   NYRE 
Sbjct  77   LRISEGLE--EAVPNLGSIILTGNNLQELSDLEPLVGFTKLETICLLINPVSTKPNYREY  134

Query  130  VFSLIPSLRCLD  141
            +    P LR LD
Sbjct  135  MAYKFPQLRLLD  146



Lambda      K        H
   0.311    0.127    0.380 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3252957642


Query= XP_050573026.1 DNA-directed RNA polymerase III subunit RPC7-like
isoform X1 [Bombus affinis]

Length=216
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8II80_PLAF7  unnamed protein product                                 39.7    0.001
FEN1_PLAF7  unnamed protein product                                   29.6    2.5  


>Q8II80_PLAF7 unnamed protein product
Length=1570

 Score = 39.7 bits (91),  Expect = 0.001, Method: Composition-based stats.
 Identities = 28/99 (28%), Positives = 50/99 (51%), Gaps = 7/99 (7%)

Query  121  KRKGQKCKNSQTKRKNVDIESKLQELEKKENLQQSDAEEEEKEEEEAEGKDDEQ--AEDE  178
            K   +K K+ + K KN +     Q+ EK E  +Q + +++EK +E+ + K D++   E +
Sbjct  253  KITNEKIKSQELKEKNKEETKCKQDGEKNEKEEQQNEQDDEKNKEQQKCKQDDEKNKEQQ  312

Query  179  EEELDEEMDE-----GTDYVNNYFDNGEGYDDEDDNLDD  212
             E+ D+E ++       D   N     E  DDE  N++D
Sbjct  313  NEQRDDEQNKEQQKCKQDDEQNKEQQNEQRDDEQINMED  351


 Score = 35.4 bits (80),  Expect = 0.035, Method: Composition-based stats.
 Identities = 21/87 (24%), Positives = 45/87 (52%), Gaps = 0/87 (0%)

Query  121  KRKGQKCKNSQTKRKNVDIESKLQELEKKENLQQSDAEEEEKEEEEAEGKDDEQAEDEEE  180
            K + ++ +N Q   KN + +   Q+ EK +  Q    ++E+ +E++   +DDEQ ++++ 
Sbjct  280  KNEKEEQQNEQDDEKNKEQQKCKQDDEKNKEQQNEQRDDEQNKEQQKCKQDDEQNKEQQN  339

Query  181  ELDEEMDEGTDYVNNYFDNGEGYDDED  207
            E  ++     +  NN  +  + Y  ED
Sbjct  340  EQRDDEQINMEDNNNICEILKNYVQED  366


>FEN1_PLAF7 unnamed protein product
Length=672

 Score = 29.6 bits (65),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 44/78 (56%), Gaps = 6/78 (8%)

Query  144  QELEKKENLQQSDAEEEEKEEEEAEGKDDEQAEDEEEELDEEMDEGTDYVNNYFD-----  198
            + L+ ++NL     +++EK +++ + KDDE+ +D+E+  D+E     ++ +N FD     
Sbjct  448  KNLDDEKNLDDEKNKDDEKNKDDEKNKDDEKNKDDEKNKDDEKKSLDNFSSNLFDSDKES  507

Query  199  -NGEGYDDEDDNLDDGPI  215
             +G    +E  N+DD  I
Sbjct  508  ESGNIIKNEKQNMDDEKI  525



Lambda      K        H
   0.311    0.127    0.380 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3252957642


Query= XP_050573027.1 DNA-directed RNA polymerase III subunit RPC7-like
isoform X1 [Bombus affinis]

Length=216
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8II80_PLAF7  unnamed protein product                                 39.7    0.001
FEN1_PLAF7  unnamed protein product                                   29.6    2.5  


>Q8II80_PLAF7 unnamed protein product
Length=1570

 Score = 39.7 bits (91),  Expect = 0.001, Method: Composition-based stats.
 Identities = 28/99 (28%), Positives = 50/99 (51%), Gaps = 7/99 (7%)

Query  121  KRKGQKCKNSQTKRKNVDIESKLQELEKKENLQQSDAEEEEKEEEEAEGKDDEQ--AEDE  178
            K   +K K+ + K KN +     Q+ EK E  +Q + +++EK +E+ + K D++   E +
Sbjct  253  KITNEKIKSQELKEKNKEETKCKQDGEKNEKEEQQNEQDDEKNKEQQKCKQDDEKNKEQQ  312

Query  179  EEELDEEMDE-----GTDYVNNYFDNGEGYDDEDDNLDD  212
             E+ D+E ++       D   N     E  DDE  N++D
Sbjct  313  NEQRDDEQNKEQQKCKQDDEQNKEQQNEQRDDEQINMED  351


 Score = 35.4 bits (80),  Expect = 0.035, Method: Composition-based stats.
 Identities = 21/87 (24%), Positives = 45/87 (52%), Gaps = 0/87 (0%)

Query  121  KRKGQKCKNSQTKRKNVDIESKLQELEKKENLQQSDAEEEEKEEEEAEGKDDEQAEDEEE  180
            K + ++ +N Q   KN + +   Q+ EK +  Q    ++E+ +E++   +DDEQ ++++ 
Sbjct  280  KNEKEEQQNEQDDEKNKEQQKCKQDDEKNKEQQNEQRDDEQNKEQQKCKQDDEQNKEQQN  339

Query  181  ELDEEMDEGTDYVNNYFDNGEGYDDED  207
            E  ++     +  NN  +  + Y  ED
Sbjct  340  EQRDDEQINMEDNNNICEILKNYVQED  366


>FEN1_PLAF7 unnamed protein product
Length=672

 Score = 29.6 bits (65),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 44/78 (56%), Gaps = 6/78 (8%)

Query  144  QELEKKENLQQSDAEEEEKEEEEAEGKDDEQAEDEEEELDEEMDEGTDYVNNYFD-----  198
            + L+ ++NL     +++EK +++ + KDDE+ +D+E+  D+E     ++ +N FD     
Sbjct  448  KNLDDEKNLDDEKNKDDEKNKDDEKNKDDEKNKDDEKNKDDEKKSLDNFSSNLFDSDKES  507

Query  199  -NGEGYDDEDDNLDDGPI  215
             +G    +E  N+DD  I
Sbjct  508  ESGNIIKNEKQNMDDEKI  525



Lambda      K        H
   0.311    0.127    0.380 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3252957642


Query= XP_050573028.1 DNA-directed RNA polymerase III subunit RPC7-like
isoform X2 [Bombus affinis]

Length=204
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

FEN1_PLAF7  unnamed protein product                                   28.5    4.2  


>FEN1_PLAF7 unnamed protein product
Length=672

 Score = 28.5 bits (62),  Expect = 4.2, Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 44/78 (56%), Gaps = 6/78 (8%)

Query  132  QELEKKENLQQSDAEEEEKEEEEAEGKDDEQAEDEEEELDEEMDEGTDYVNNYFD-----  186
            + L+ ++NL     +++EK +++ + KDDE+ +D+E+  D+E     ++ +N FD     
Sbjct  448  KNLDDEKNLDDEKNKDDEKNKDDEKNKDDEKNKDDEKNKDDEKKSLDNFSSNLFDSDKES  507

Query  187  -NGEGYDDEDDNLDDGPI  203
             +G    +E  N+DD  I
Sbjct  508  ESGNIIKNEKQNMDDEKI  525



Lambda      K        H
   0.311    0.127    0.380 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3252957642


Query= XP_050573029.1 DNA-directed RNA polymerase III subunit RPC7-like
isoform X2 [Bombus affinis]

Length=204
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

FEN1_PLAF7  unnamed protein product                                   28.5    4.2  


>FEN1_PLAF7 unnamed protein product
Length=672

 Score = 28.5 bits (62),  Expect = 4.2, Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 44/78 (56%), Gaps = 6/78 (8%)

Query  132  QELEKKENLQQSDAEEEEKEEEEAEGKDDEQAEDEEEELDEEMDEGTDYVNNYFD-----  186
            + L+ ++NL     +++EK +++ + KDDE+ +D+E+  D+E     ++ +N FD     
Sbjct  448  KNLDDEKNLDDEKNKDDEKNKDDEKNKDDEKNKDDEKNKDDEKKSLDNFSSNLFDSDKES  507

Query  187  -NGEGYDDEDDNLDDGPI  203
             +G    +E  N+DD  I
Sbjct  508  ESGNIIKNEKQNMDDEKI  525



Lambda      K        H
   0.311    0.127    0.380 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3252957642


Query= XP_050573030.1 DNA-directed RNA polymerase III subunit RPC7-like
[Bombus affinis]

Length=216
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

FEN1_PLAF7  unnamed protein product                                   29.6    2.3  


>FEN1_PLAF7 unnamed protein product
Length=672

 Score = 29.6 bits (65),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 44/78 (56%), Gaps = 6/78 (8%)

Query  144  QELEKKENLQQSDAEEEEKEEEEAEGKDDEQAEDEEEELDEEMDEGTDYVNNYFD-----  198
            + L+ ++NL     +++EK +++ + KDDE+ +D+E+  D+E     ++ +N FD     
Sbjct  448  KNLDDEKNLDDEKNKDDEKNKDDEKNKDDEKNKDDEKNKDDEKKSLDNFSSNLFDSDKES  507

Query  199  -NGEGYDDEDDNLDDGPI  215
             +G    +E  N+DD  I
Sbjct  508  ESGNIIKNEKQNMDDEKI  525



Lambda      K        H
   0.311    0.127    0.380 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3252957642


Query= XP_050573031.1 uncharacterized protein LOC126913798 [Bombus affinis]

Length=193
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q388X1_TRYB2  unnamed protein product                                 29.6    1.8  


>Q388X1_TRYB2 unnamed protein product
Length=902

 Score = 29.6 bits (65),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 22/98 (22%), Positives = 48/98 (49%), Gaps = 10/98 (10%)

Query  71   EGSI-HMEEFLQETKAQYESLKEQCDNLETVFEEYGYHYDE-NNVLEESNANSTRSPDQN  128
            EGS+  +EE L   + Q+ +++ +CD L+T+ +E  +  +     L++     T   DQ+
Sbjct  151  EGSVKRLEEHLVHERQQHANVRGECDRLKTMLQETQWEVERARRELQQERERPT--VDQS  208

Query  129  SVEETENLKVEFTPNLSWKCKVKENGLSSACKDNYKSY  166
             V+   N +  + P    + ++ E       +D +K++
Sbjct  209  EVQRLLNDRTRYIPTGEVQQRIDE------IRDTHKAF  240



Lambda      K        H
   0.311    0.127    0.380 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3252957642


Query= XP_050573032.1 one cut domain family member 3-like isoform X2
[Bombus affinis]

Length=538
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

G5EBN5_CAEEL  unnamed protein product                                 51.2    2e-06
H8ESG1_CAEEL  unnamed protein product                                 51.2    2e-06
RESIL_DROME  unnamed protein product                                  47.0    3e-05


>G5EBN5_CAEEL unnamed protein product
Length=1492

 Score = 51.2 bits (121),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 92/306 (30%), Positives = 115/306 (38%), Gaps = 74/306 (24%)

Query  19    DPIRTKKEAPLSPPPSQYGPPATSYGVPNVGSSYNAPSDSYGAPPPPSSSYGAPSSSYGA  78
             D  R +K+AP +  P   GPP+     P   S  + P  S       S  +GA   + GA
Sbjct  798   DSYRARKQAPQAQIPEDQGPPS-----PTPSSICDFPVQSQR-----SQRFGAFEGAQGA  847

Query  79    PSGPSSSYNAPSSS-------------YGAPSGPSSSYGAPSSSYGVPAGPSSSYGAPSS  125
             P G    Y  P S              +GAP G    YGAP     + A P + YG   S
Sbjct  848   P-GAQRGYQGPHSPVPGALTGSQASGPFGAPPGAPHGYGAP-----LQAPPQAPYGYDPS  901

Query  126   SYGAPA-----------------------GPSSSYGAPSDH-GADHGSFGGDQGYSSGGS  161
              Y  P+                       G + SY  P    GA +G+  G     SG  
Sbjct  902   RYQDPSTYPAPPPILPGSAAYEHAIRPYPGDTGSYQVPRIVPGAQYGAQAG-----SGAY  956

Query  162   FGDDHGNGGGHGS-FGGDHGSFG--GGHGSFGGGHGSFGGGHGSFGGDQGSFGGDHHGGG  218
             FG   G  G  G+ FG     FG  G  G+  G  G+ G   G+ G     FG    G  
Sbjct  957   FGAQFGAQGAQGAHFGAQGVQFGAQGAQGAHFGAQGAQGAQFGAQGAQGEQFGA--QGAQ  1014

Query  219   GGGGGGGGGGGDHHGGGGSGGLSTSYGA------PAQSYG---PPAQSYGPPAQSYGPPA  269
             G   G  G  G H G  G+ G  T +GA      P  SYG   PP  SYGP   ++G   
Sbjct  1015  GAHFGAQGAQGAHFGAQGAQG--TQFGAQGAQGPPPASYGAPTPPQASYGPAPGAHGYQN  1072

Query  270   QSYGPP  275
              + GPP
Sbjct  1073  GAQGPP  1078


 Score = 40.0 bits (92),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 52/110 (47%), Gaps = 24/110 (22%)

Query  55    PSDSYGAPPPPSSSYGA--------------PSSSYGAPSGPSSSYNAPSSSYGAPSGPS  100
             P  SYGAP PP +SYG               P +  GA   P + + A    +GA + P 
Sbjct  1047  PPASYGAPTPPQASYGPAPGAHGYQNGAQGPPGAEVGAQGPPGAHFGA----HGASAPPP  1102

Query  101   SSYGAPS------SSYGVPAGPSSSYGAPSSSYGAPAGPSSSYGAPSDHG  144
             +SYGAP+      +SYG   G     G    ++GA A P +S+GAP+  G
Sbjct  1103  TSYGAPTPQRPPQASYGAAPGAQGPPGGQFEAHGAAALPPTSHGAPTPQG  1152


 Score = 38.9 bits (89),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 62/214 (29%), Positives = 79/214 (37%), Gaps = 36/214 (17%)

Query  70    GAPSSSYGAPSGPSSSYNAPSSSYGAPSGPSSSYGAPSSSYGVPAGPSSSYGAPSSSYGA  129
             G P +SYGAP+ P +SY     ++G  +G   + G P +  G    P + +GA    +GA
Sbjct  1045  GPPPASYGAPTPPQASYGPAPGAHGYQNG---AQGPPGAEVGAQGPPGAHFGA----HGA  1097

Query  130   PAGPSSSYGAPSDHGADHGSFGGDQGYSS--GGSFG---------DDHGNGGGHGSFGGD  178
              A P +SYGAP+       S+G   G     GG F            HG     G FG  
Sbjct  1098  SAPPPTSYGAPTPQRPPQASYGAAPGAQGPPGGQFEAHGAAALPPTSHGAPTPQGPFGAA  1157

Query  179   HGSFGGGHGSFGGGHGSFGG----GHGSFGG------DQGSFGGDH-----HGGGGGGGG  223
              G+  G  G +G     +      G   FG        QGSFG             G   
Sbjct  1158  PGAQFGAQGPYGQQGARYEAQKSPGAAIFGAPGAPPQHQGSFGAQFGVPPPQNSAPGAQF  1217

Query  224   GGGGGGDHHGGGGSGGLSTSYGAPAQSYGPPAQS  257
             G       H          SY APA    PPA S
Sbjct  1218  GAKPEASSHAPTPPPQPHPSYQAPA---PPPALS  1248


 Score = 36.2 bits (82),  Expect = 0.082, Method: Compositional matrix adjust.
 Identities = 75/264 (28%), Positives = 106/264 (40%), Gaps = 33/264 (13%)

Query  18    GDPIRTKKEAPLSPPPSQYGPPATSYGVPNVGSSYNAPSDSYGAPPPPSSSYGAPS----  73
             G P++   +AP    PS+Y  P+T    P +     A   +    P  + SY  P     
Sbjct  885   GAPLQAPPQAPYGYDPSRYQDPSTYPAPPPILPGSAAYEHAIRPYPGDTGSYQVPRIVPG  944

Query  74    SSYGAPSGPSSSYNAPSSSYGAPSGPSSSYGAPSSSYGVPAGPSSSYGAPSSSYGAPAGP  133
             + YGA +G  + + A    +GA     + +GA    +G       + GA  + +GA    
Sbjct  945   AQYGAQAGSGAYFGA---QFGAQGAQGAHFGAQGVQFG-------AQGAQGAHFGAQGAQ  994

Query  134   SSSYGAPSDHGADHGSFGGDQG--YSSGGSFGDDHGNGGGHGSFGGDHGSFGGGHGSFG-  190
              + +GA    G   G+ G  QG  + + G+ G   G  G  G+  G  G+ G    S+G 
Sbjct  995   GAQFGAQGAQGEQFGAQGA-QGAHFGAQGAQGAHFGAQGAQGTQFGAQGAQGPPPASYGA  1053

Query  191   -----GGHGSFGGGHGSFGGDQGSFGGDHHGGGGGGGGGGGGGGDHHGG-GGSGGLSTSY  244
                    +G   G HG   G QG  G +         G  G  G H G  G S    TSY
Sbjct  1054  PTPPQASYGPAPGAHGYQNGAQGPPGAE--------VGAQGPPGAHFGAHGASAPPPTSY  1105

Query  245   GAPAQSYGPPAQSYGPPAQSYGPP  268
             GAP     PP  SYG    + GPP
Sbjct  1106  GAPTPQR-PPQASYGAAPGAQGPP  1128


>H8ESG1_CAEEL unnamed protein product
Length=1494

 Score = 51.2 bits (121),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 92/306 (30%), Positives = 115/306 (38%), Gaps = 74/306 (24%)

Query  19    DPIRTKKEAPLSPPPSQYGPPATSYGVPNVGSSYNAPSDSYGAPPPPSSSYGAPSSSYGA  78
             D  R +K+AP +  P   GPP+     P   S  + P  S       S  +GA   + GA
Sbjct  798   DSYRARKQAPQAQIPEDQGPPS-----PTPSSICDFPVQSQR-----SQRFGAFEGAQGA  847

Query  79    PSGPSSSYNAPSSS-------------YGAPSGPSSSYGAPSSSYGVPAGPSSSYGAPSS  125
             P G    Y  P S              +GAP G    YGAP     + A P + YG   S
Sbjct  848   P-GAQRGYQGPHSPVPGALTGSQASGPFGAPPGAPHGYGAP-----LQAPPQAPYGYDPS  901

Query  126   SYGAPA-----------------------GPSSSYGAPSDH-GADHGSFGGDQGYSSGGS  161
              Y  P+                       G + SY  P    GA +G+  G     SG  
Sbjct  902   RYQDPSTYPAPPPILPGSAAYEHAIRPYPGDTGSYQVPRIVPGAQYGAQAG-----SGAY  956

Query  162   FGDDHGNGGGHGS-FGGDHGSFG--GGHGSFGGGHGSFGGGHGSFGGDQGSFGGDHHGGG  218
             FG   G  G  G+ FG     FG  G  G+  G  G+ G   G+ G     FG    G  
Sbjct  957   FGAQFGAQGAQGAHFGAQGVQFGAQGAQGAHFGAQGAQGAQFGAQGAQGEQFGA--QGAQ  1014

Query  219   GGGGGGGGGGGDHHGGGGSGGLSTSYGA------PAQSYG---PPAQSYGPPAQSYGPPA  269
             G   G  G  G H G  G+ G  T +GA      P  SYG   PP  SYGP   ++G   
Sbjct  1015  GAHFGAQGAQGAHFGAQGAQG--TQFGAQGAQGPPPASYGAPTPPQASYGPAPGAHGYQN  1072

Query  270   QSYGPP  275
              + GPP
Sbjct  1073  GAQGPP  1078


 Score = 40.0 bits (92),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 52/110 (47%), Gaps = 24/110 (22%)

Query  55    PSDSYGAPPPPSSSYGA--------------PSSSYGAPSGPSSSYNAPSSSYGAPSGPS  100
             P  SYGAP PP +SYG               P +  GA   P + + A    +GA + P 
Sbjct  1047  PPASYGAPTPPQASYGPAPGAHGYQNGAQGPPGAEVGAQGPPGAHFGA----HGASAPPP  1102

Query  101   SSYGAPS------SSYGVPAGPSSSYGAPSSSYGAPAGPSSSYGAPSDHG  144
             +SYGAP+      +SYG   G     G    ++GA A P +S+GAP+  G
Sbjct  1103  TSYGAPTPQRPPQASYGAAPGAQGPPGGQFEAHGAAALPPTSHGAPTPQG  1152


 Score = 38.9 bits (89),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 62/214 (29%), Positives = 79/214 (37%), Gaps = 36/214 (17%)

Query  70    GAPSSSYGAPSGPSSSYNAPSSSYGAPSGPSSSYGAPSSSYGVPAGPSSSYGAPSSSYGA  129
             G P +SYGAP+ P +SY     ++G  +G   + G P +  G    P + +GA    +GA
Sbjct  1045  GPPPASYGAPTPPQASYGPAPGAHGYQNG---AQGPPGAEVGAQGPPGAHFGA----HGA  1097

Query  130   PAGPSSSYGAPSDHGADHGSFGGDQGYSS--GGSFG---------DDHGNGGGHGSFGGD  178
              A P +SYGAP+       S+G   G     GG F            HG     G FG  
Sbjct  1098  SAPPPTSYGAPTPQRPPQASYGAAPGAQGPPGGQFEAHGAAALPPTSHGAPTPQGPFGAA  1157

Query  179   HGSFGGGHGSFGGGHGSFGG----GHGSFGG------DQGSFGGDH-----HGGGGGGGG  223
              G+  G  G +G     +      G   FG        QGSFG             G   
Sbjct  1158  PGAQFGAQGPYGQQGARYEAQKSPGAAIFGAPGAPPQHQGSFGAQFGVPPPQNSAPGAQF  1217

Query  224   GGGGGGDHHGGGGSGGLSTSYGAPAQSYGPPAQS  257
             G       H          SY APA    PPA S
Sbjct  1218  GAKPEASSHAPTPPPQPHPSYQAPA---PPPALS  1248


 Score = 36.2 bits (82),  Expect = 0.082, Method: Compositional matrix adjust.
 Identities = 75/264 (28%), Positives = 106/264 (40%), Gaps = 33/264 (13%)

Query  18    GDPIRTKKEAPLSPPPSQYGPPATSYGVPNVGSSYNAPSDSYGAPPPPSSSYGAPS----  73
             G P++   +AP    PS+Y  P+T    P +     A   +    P  + SY  P     
Sbjct  885   GAPLQAPPQAPYGYDPSRYQDPSTYPAPPPILPGSAAYEHAIRPYPGDTGSYQVPRIVPG  944

Query  74    SSYGAPSGPSSSYNAPSSSYGAPSGPSSSYGAPSSSYGVPAGPSSSYGAPSSSYGAPAGP  133
             + YGA +G  + + A    +GA     + +GA    +G       + GA  + +GA    
Sbjct  945   AQYGAQAGSGAYFGA---QFGAQGAQGAHFGAQGVQFG-------AQGAQGAHFGAQGAQ  994

Query  134   SSSYGAPSDHGADHGSFGGDQG--YSSGGSFGDDHGNGGGHGSFGGDHGSFGGGHGSFG-  190
              + +GA    G   G+ G  QG  + + G+ G   G  G  G+  G  G+ G    S+G 
Sbjct  995   GAQFGAQGAQGEQFGAQGA-QGAHFGAQGAQGAHFGAQGAQGTQFGAQGAQGPPPASYGA  1053

Query  191   -----GGHGSFGGGHGSFGGDQGSFGGDHHGGGGGGGGGGGGGGDHHGG-GGSGGLSTSY  244
                    +G   G HG   G QG  G +         G  G  G H G  G S    TSY
Sbjct  1054  PTPPQASYGPAPGAHGYQNGAQGPPGAE--------VGAQGPPGAHFGAHGASAPPPTSY  1105

Query  245   GAPAQSYGPPAQSYGPPAQSYGPP  268
             GAP     PP  SYG    + GPP
Sbjct  1106  GAPTPQR-PPQASYGAAPGAQGPP  1128


>RESIL_DROME unnamed protein product
Length=620

 Score = 47.0 bits (110),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 59/110 (54%), Gaps = 28/110 (25%)

Query  55   PSDSYGAPPP------PSSSYGA--------PSSSYGAPSGPSSSYNA--PSSSYGAPSG  98
            PSD+YGAP        PSSSYGA        PS +YGAP G + + +   PSSSYGAP  
Sbjct  198  PSDTYGAPGGGNNGGRPSSSYGAPGGGNGGRPSDTYGAPGGGNGNGSGGRPSSSYGAPGQ  257

Query  99   --------PSSSYGAPSSSYGVPAGPSSSYGAPSSSYGAPAGPSSSYGAP  140
                    PS SYGAP    G    PS SYGAP S  G    PSSSYGAP
Sbjct  258  GQGGFGGRPSDSYGAP----GQNQKPSDSYGAPGSGNGNGGRPSSSYGAP  303


 Score = 45.1 bits (105),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 68/162 (42%), Positives = 77/162 (48%), Gaps = 35/162 (22%)

Query  5    LLFLCCFLFVSALGDPIRTKKEAPLSPPPSQYGPPATSYGVPNVGSSYNAPSDSYGAPPP  64
            LL L   + +  LG P          PP + Y PP+ SYG P        PSDSYGAP  
Sbjct  4    LLGLTLLMAMVVLGRP---------EPPVNSYLPPSDSYGAPGQSGPGGRPSDSYGAPGG  54

Query  65   -----PSSSYGAPSSSYGAPSGPSSSYNAPSSSYGAPSGPSSSYGAPSSSYGVPAG----  115
                 PS SYGAP    G   G       PS +YGAP G + + G PSSSYG P G    
Sbjct  55   GNGGRPSDSYGAPGQGQGQGQGQGGYAGKPSDTYGAPGGGNGNGGRPSSSYGAPGGGNGG  114

Query  116  -PSSSYGA--------PSSSYGAPAG--------PSSSYGAP  140
             PS +YGA        PS +YGAP G        PSSSYGAP
Sbjct  115  RPSDTYGAPGGGNGGRPSDTYGAPGGGGNGNGGRPSSSYGAP  156


 Score = 32.7 bits (73),  Expect = 0.76, Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 68/143 (48%), Gaps = 57/143 (40%)

Query  55   PSDSYGAPPP--------PSSSYGAP------------SSSYGAPSG-----PSSSYNA-  88
            PSD+YGAP          PSSSYGAP            SSSYGAP G     PS +Y A 
Sbjct  131  PSDTYGAPGGGGNGNGGRPSSSYGAPGQGQGNGNGGRSSSSYGAPGGGNGGRPSDTYGAP  190

Query  89   -------PSSSYGAPSG------PSSSYGA--------PSSSYGVPAGPSSSYGA--PSS  125
                   PS +YGAP G      PSSSYGA        PS +YG P G + +     PSS
Sbjct  191  GGGNGGRPSDTYGAPGGGNNGGRPSSSYGAPGGGNGGRPSDTYGAPGGGNGNGSGGRPSS  250

Query  126  SYGAPAG--------PSSSYGAP  140
            SYGAP          PS SYGAP
Sbjct  251  SYGAPGQGQGGFGGRPSDSYGAP  273



Lambda      K        H
   0.311    0.127    0.380 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3252957642


Query= XP_050573033.1 uncharacterized protein LOC126913799 [Bombus affinis]

Length=170
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ERO1_CAEEL  unnamed protein product                                   28.9    2.2  
Q9VPL9_DROME  unnamed protein product                                 28.9    3.0  
M9NCY5_DROME  unnamed protein product                                 28.9    3.0  


>ERO1_CAEEL unnamed protein product
Length=478

 Score = 28.9 bits (63),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 37/86 (43%), Gaps = 16/86 (19%)

Query  79   QGGDAKCDPEQAEKWKERRECLEM----LKRE----LSKIRDGGDNSQDWDYLLEDDEKK  130
            Q G A CD E     + RR  + M    +K E      K  D G+N    D  L DDEK+
Sbjct  92   QCGIAFCDDEVPAGLR-RRNAVNMEAAAVKEEEDDDAEKCADAGNNIDPMDRTLHDDEKR  150

Query  131  EASITEIQDD-------EISKDESNG  149
            +    +  DD       EI  DES+G
Sbjct  151  QLDAMDHHDDGLEDKFCEIEDDESDG  176


>Q9VPL9_DROME unnamed protein product
Length=5322

 Score = 28.9 bits (63),  Expect = 3.0, Method: Composition-based stats.
 Identities = 28/125 (22%), Positives = 52/125 (42%), Gaps = 23/125 (18%)

Query  41    PRHLKRQNNVQRMLQDKMEGYEKYILECERKEKIEQEMQGGDAKCDPEQAEKWKERRECL  100
             P+  + ++ +     DK EG EK+  E             G++K D   +E+ K     +
Sbjct  1672  PKQDEEKSELDEATTDKPEGDEKFKTE-------------GESKKDLTDSEETKLESSAM  1718

Query  101   EMLKRELSKIRDGGDNSQDWDYLLEDDEKKEASITEIQDDEISKDESNGKINASTNVIKQ  160
             E+  +E S+  D   + +D     +D +K E       DDE+ K +   K    +  +K 
Sbjct  1719  EVDSKEESEPDDSKKSDED----NKDKDKMEV------DDEVGKSDKESKPEEQSETVKT  1768

Query  161   VADSE  165
               +S+
Sbjct  1769  EENSK  1773


>M9NCY5_DROME unnamed protein product
Length=5343

 Score = 28.9 bits (63),  Expect = 3.0, Method: Composition-based stats.
 Identities = 28/125 (22%), Positives = 52/125 (42%), Gaps = 23/125 (18%)

Query  41    PRHLKRQNNVQRMLQDKMEGYEKYILECERKEKIEQEMQGGDAKCDPEQAEKWKERRECL  100
             P+  + ++ +     DK EG EK+  E             G++K D   +E+ K     +
Sbjct  1672  PKQDEEKSELDEATTDKPEGDEKFKTE-------------GESKKDLTDSEETKLESSAM  1718

Query  101   EMLKRELSKIRDGGDNSQDWDYLLEDDEKKEASITEIQDDEISKDESNGKINASTNVIKQ  160
             E+  +E S+  D   + +D     +D +K E       DDE+ K +   K    +  +K 
Sbjct  1719  EVDSKEESEPDDSKKSDED----NKDKDKMEV------DDEVGKSDKESKPEEQSETVKT  1768

Query  161   VADSE  165
               +S+
Sbjct  1769  EENSK  1773



Lambda      K        H
   0.311    0.127    0.380 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3252957642


Query= XP_050573034.1 U1 small nuclear ribonucleoprotein C [Bombus affinis]

Length=170
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RU1C_DROME  unnamed protein product                                   132     6e-40
BRM_DROME  unnamed protein product                                    32.0    0.22 
O61707_CAEEL  unnamed protein product                                 27.3    7.3  


>RU1C_DROME unnamed protein product
Length=145

 Score = 132 bits (332),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 92/135 (68%), Gaps = 16/135 (12%)

Query  1    MPKYYCDYCDTYLTHDSPSVRKTHCQGRKHKDNVKYFYQKWMEEQAQHLIDATTAAFKAG  60
            MPKYYCDYCDTYLTHDSPSVRKTHC GRKH+DNVK++YQKWMEEQAQHLIDATTAAFKAG
Sbjct  1    MPKYYCDYCDTYLTHDSPSVRKTHCTGRKHRDNVKFYYQKWMEEQAQHLIDATTAAFKAG  60

Query  61   KIASNPFAANKGAAIPPPPNLGPRPGVPPQGPPGMMPPPGMHPGGPMGPGGPMMMGPHGP  120
            KI +NPFA   G A P P  +              +PPP M      G  G   M P   
Sbjct  61   KITNNPFAGGPGGAPPKPAGVS-------------IPPPNMGAPPRPGMPGMPYMPP--L  105

Query  121  MPPMMGMRPP-MMGP  134
            M PMMGMRPP +M P
Sbjct  106  MNPMMGMRPPPIMNP  120


>BRM_DROME unnamed protein product
Length=1638

 Score = 32.0 bits (71),  Expect = 0.22, Method: Composition-based stats.
 Identities = 20/59 (34%), Positives = 24/59 (41%), Gaps = 0/59 (0%)

Query  87   VPPQGPPGMMPPPGMHPGGPMGPGGPMMMGPHGPMPPMMGMRPPMMGPMGPMGPMMGPM  145
            +P  G P  M P G  P  P  P  P + G    MPP   +  P  GP   + P   PM
Sbjct  329  LPNGGKPLSMGPSGGQPLIPSSPMQPQVRGTLPGMPPGSQVPQPGGGPQRQVPPAGMPM  387


 Score = 30.0 bits (66),  Expect = 1.1, Method: Composition-based stats.
 Identities = 31/124 (25%), Positives = 36/124 (29%), Gaps = 52/124 (42%)

Query  92   PPGMMPPPGMHPGGPMGPGGPMMMGPHGPMPPMM--------------------------  125
            PP    PP  +P GP  PG  M + P  P P M                           
Sbjct  255  PPQCSTPPASNPYGPPVPGQKMQVAP--PPPHMQQGQPLPPQPPQVGGPPPIQQQQPPQQ  312

Query  126  -------------------GMRPPMMGPMG-----PMGPMMGPMGPMGPMRPPMNGPPPP  161
                               G +P  MGP G     P  PM   +    P  PP +  P P
Sbjct  313  QQQQSQPPPPEPHQHQLPNGGKPLSMGPSGGQPLIPSSPMQPQVRGTLPGMPPGSQVPQP  372

Query  162  MGGP  165
             GGP
Sbjct  373  GGGP  376


>O61707_CAEEL unnamed protein product
Length=523

 Score = 27.3 bits (59),  Expect = 7.3, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 27/49 (55%), Gaps = 11/49 (22%)

Query  107  MGPGGPMMMGPHGPMPPMMGMRPPMMGPMGPMGPMMGPMGPMGPMRPPM  155
            M  GGP M+         +G RP M+ PMGP GP   PMG  GP+R PM
Sbjct  237  MVQGGPHMVS--------VGARP-MIRPMGPGGP--SPMGLQGPVRGPM  274



Lambda      K        H
   0.311    0.127    0.380 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3252957642


Query= XP_050573035.1 CCR4-NOT transcription complex subunit 6-like [Bombus
affinis]

Length=163
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VCB6_DROME  unnamed protein product                                 219     1e-69
Q7K112_DROME  unnamed protein product                                 219     2e-69
Q8IMX1_DROME  unnamed protein product                                 219     2e-69


>Q9VCB6_DROME unnamed protein product
Length=545

 Score = 219 bits (559),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 131/160 (82%), Gaps = 2/160 (1%)

Query  1    MSRNHKDKYENSNPRRTHTFMSTEDANSGKKSYWPELEITGSIRNLSPNLWQLTHLTALY  60
            MSRN KDKY+++N RR   F+S ED  +GKK+ W  LEITG +RN+SP+LW+  HLTALY
Sbjct  1    MSRN-KDKYDSAN-RRQQIFLSQEDIAAGKKTNWSGLEITGCVRNISPSLWEFEHLTALY  58

Query  61   LNDNSLQRIPSEIGRLVNLRALDLSSNKLRSLPAELGDLIYLRELLLNQNYLRVLPYELG  120
            LNDN L R+P+++G L +LR LDLSSNKLRSLPAELG+LI LRELLLN N+LRVLPYE+G
Sbjct  59   LNDNQLLRLPADVGMLTSLRTLDLSSNKLRSLPAELGELIQLRELLLNNNFLRVLPYEIG  118

Query  121  KLFQLQVLGLQGNPLSKEIMALYGEPSGTHKLLSYMLDNL  160
            KLF L +LGL GNPL KE M +Y EP+GT KLL+YMLDNL
Sbjct  119  KLFHLVILGLMGNPLQKEFMNIYNEPNGTQKLLTYMLDNL  158


>Q7K112_DROME unnamed protein product
Length=552

 Score = 219 bits (559),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 131/160 (82%), Gaps = 2/160 (1%)

Query  1    MSRNHKDKYENSNPRRTHTFMSTEDANSGKKSYWPELEITGSIRNLSPNLWQLTHLTALY  60
            MSRN KDKY+++N RR   F+S ED  +GKK+ W  LEITG +RN+SP+LW+  HLTALY
Sbjct  8    MSRN-KDKYDSAN-RRQQIFLSQEDIAAGKKTNWSGLEITGCVRNISPSLWEFEHLTALY  65

Query  61   LNDNSLQRIPSEIGRLVNLRALDLSSNKLRSLPAELGDLIYLRELLLNQNYLRVLPYELG  120
            LNDN L R+P+++G L +LR LDLSSNKLRSLPAELG+LI LRELLLN N+LRVLPYE+G
Sbjct  66   LNDNQLLRLPADVGMLTSLRTLDLSSNKLRSLPAELGELIQLRELLLNNNFLRVLPYEIG  125

Query  121  KLFQLQVLGLQGNPLSKEIMALYGEPSGTHKLLSYMLDNL  160
            KLF L +LGL GNPL KE M +Y EP+GT KLL+YMLDNL
Sbjct  126  KLFHLVILGLMGNPLQKEFMNIYNEPNGTQKLLTYMLDNL  165


>Q8IMX1_DROME unnamed protein product
Length=567

 Score = 219 bits (559),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 131/160 (82%), Gaps = 2/160 (1%)

Query  1    MSRNHKDKYENSNPRRTHTFMSTEDANSGKKSYWPELEITGSIRNLSPNLWQLTHLTALY  60
            MSRN KDKY+++N RR   F+S ED  +GKK+ W  LEITG +RN+SP+LW+  HLTALY
Sbjct  23   MSRN-KDKYDSAN-RRQQIFLSQEDIAAGKKTNWSGLEITGCVRNISPSLWEFEHLTALY  80

Query  61   LNDNSLQRIPSEIGRLVNLRALDLSSNKLRSLPAELGDLIYLRELLLNQNYLRVLPYELG  120
            LNDN L R+P+++G L +LR LDLSSNKLRSLPAELG+LI LRELLLN N+LRVLPYE+G
Sbjct  81   LNDNQLLRLPADVGMLTSLRTLDLSSNKLRSLPAELGELIQLRELLLNNNFLRVLPYEIG  140

Query  121  KLFQLQVLGLQGNPLSKEIMALYGEPSGTHKLLSYMLDNL  160
            KLF L +LGL GNPL KE M +Y EP+GT KLL+YMLDNL
Sbjct  141  KLFHLVILGLMGNPLQKEFMNIYNEPNGTQKLLTYMLDNL  180



Lambda      K        H
   0.311    0.127    0.380 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3252957642


Query= XP_050573036.1 CCR4-NOT transcription complex subunit 6-like [Bombus
affinis]

Length=163
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VCB6_DROME  unnamed protein product                                 219     1e-69
Q7K112_DROME  unnamed protein product                                 219     2e-69
Q8IMX1_DROME  unnamed protein product                                 219     2e-69


>Q9VCB6_DROME unnamed protein product
Length=545

 Score = 219 bits (559),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 131/160 (82%), Gaps = 2/160 (1%)

Query  1    MSRNHKDKYENSNPRRTHTFMSTEDANSGKKSYWPELEITGSIRNLSPNLWQLTHLTALY  60
            MSRN KDKY+++N RR   F+S ED  +GKK+ W  LEITG +RN+SP+LW+  HLTALY
Sbjct  1    MSRN-KDKYDSAN-RRQQIFLSQEDIAAGKKTNWSGLEITGCVRNISPSLWEFEHLTALY  58

Query  61   LNDNSLQRIPSEIGRLVNLRALDLSSNKLRSLPAELGDLIYLRELLLNQNYLRVLPYELG  120
            LNDN L R+P+++G L +LR LDLSSNKLRSLPAELG+LI LRELLLN N+LRVLPYE+G
Sbjct  59   LNDNQLLRLPADVGMLTSLRTLDLSSNKLRSLPAELGELIQLRELLLNNNFLRVLPYEIG  118

Query  121  KLFQLQVLGLQGNPLSKEIMALYGEPSGTHKLLSYMLDNL  160
            KLF L +LGL GNPL KE M +Y EP+GT KLL+YMLDNL
Sbjct  119  KLFHLVILGLMGNPLQKEFMNIYNEPNGTQKLLTYMLDNL  158


>Q7K112_DROME unnamed protein product
Length=552

 Score = 219 bits (559),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 131/160 (82%), Gaps = 2/160 (1%)

Query  1    MSRNHKDKYENSNPRRTHTFMSTEDANSGKKSYWPELEITGSIRNLSPNLWQLTHLTALY  60
            MSRN KDKY+++N RR   F+S ED  +GKK+ W  LEITG +RN+SP+LW+  HLTALY
Sbjct  8    MSRN-KDKYDSAN-RRQQIFLSQEDIAAGKKTNWSGLEITGCVRNISPSLWEFEHLTALY  65

Query  61   LNDNSLQRIPSEIGRLVNLRALDLSSNKLRSLPAELGDLIYLRELLLNQNYLRVLPYELG  120
            LNDN L R+P+++G L +LR LDLSSNKLRSLPAELG+LI LRELLLN N+LRVLPYE+G
Sbjct  66   LNDNQLLRLPADVGMLTSLRTLDLSSNKLRSLPAELGELIQLRELLLNNNFLRVLPYEIG  125

Query  121  KLFQLQVLGLQGNPLSKEIMALYGEPSGTHKLLSYMLDNL  160
            KLF L +LGL GNPL KE M +Y EP+GT KLL+YMLDNL
Sbjct  126  KLFHLVILGLMGNPLQKEFMNIYNEPNGTQKLLTYMLDNL  165


>Q8IMX1_DROME unnamed protein product
Length=567

 Score = 219 bits (559),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 131/160 (82%), Gaps = 2/160 (1%)

Query  1    MSRNHKDKYENSNPRRTHTFMSTEDANSGKKSYWPELEITGSIRNLSPNLWQLTHLTALY  60
            MSRN KDKY+++N RR   F+S ED  +GKK+ W  LEITG +RN+SP+LW+  HLTALY
Sbjct  23   MSRN-KDKYDSAN-RRQQIFLSQEDIAAGKKTNWSGLEITGCVRNISPSLWEFEHLTALY  80

Query  61   LNDNSLQRIPSEIGRLVNLRALDLSSNKLRSLPAELGDLIYLRELLLNQNYLRVLPYELG  120
            LNDN L R+P+++G L +LR LDLSSNKLRSLPAELG+LI LRELLLN N+LRVLPYE+G
Sbjct  81   LNDNQLLRLPADVGMLTSLRTLDLSSNKLRSLPAELGELIQLRELLLNNNFLRVLPYEIG  140

Query  121  KLFQLQVLGLQGNPLSKEIMALYGEPSGTHKLLSYMLDNL  160
            KLF L +LGL GNPL KE M +Y EP+GT KLL+YMLDNL
Sbjct  141  KLFHLVILGLMGNPLQKEFMNIYNEPNGTQKLLTYMLDNL  180



Lambda      K        H
   0.311    0.127    0.380 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3252957642


Query= XP_050573037.1 uncharacterized protein LOC126913802 isoform X1
[Bombus affinis]

Length=151
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VZ85_DROME  unnamed protein product                                 28.9    2.0  
Q8WQM0_DROME  unnamed protein product                                 28.9    2.0  


>Q9VZ85_DROME unnamed protein product
Length=1984

 Score = 28.9 bits (63),  Expect = 2.0, Method: Composition-based stats.
 Identities = 13/41 (32%), Positives = 25/41 (61%), Gaps = 0/41 (0%)

Query  67    SPLIPGETARVRLVSKPVKSVKWTCLTCLSVKRYPTKKGYK  107
             +PL+P ET  ++++  PV++VK   +  +   R PT++  K
Sbjct  1156  NPLVPHETELLKILRNPVEAVKLNLVPHVCGLRAPTRESGK  1196


>Q8WQM0_DROME unnamed protein product
Length=1984

 Score = 28.9 bits (63),  Expect = 2.0, Method: Composition-based stats.
 Identities = 13/41 (32%), Positives = 25/41 (61%), Gaps = 0/41 (0%)

Query  67    SPLIPGETARVRLVSKPVKSVKWTCLTCLSVKRYPTKKGYK  107
             +PL+P ET  ++++  PV++VK   +  +   R PT++  K
Sbjct  1156  NPLVPHETELLKILRNPVEAVKLNLVPHVCGLRAPTRESGK  1196



Lambda      K        H
   0.311    0.127    0.380 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3252957642


Query= XP_050573038.1 uncharacterized protein LOC126913802 isoform X2
[Bombus affinis]

Length=135
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VZ85_DROME  unnamed protein product                                 28.9    1.5  
Q8WQM0_DROME  unnamed protein product                                 28.9    1.5  
O62178_CAEEL  unnamed protein product                                 26.6    8.2  


>Q9VZ85_DROME unnamed protein product
Length=1984

 Score = 28.9 bits (63),  Expect = 1.5, Method: Composition-based stats.
 Identities = 13/41 (32%), Positives = 25/41 (61%), Gaps = 0/41 (0%)

Query  51    SPLIPGETARVRLVSKPVKSVKWTCLTCLSVKRYPTKKGYK  91
             +PL+P ET  ++++  PV++VK   +  +   R PT++  K
Sbjct  1156  NPLVPHETELLKILRNPVEAVKLNLVPHVCGLRAPTRESGK  1196


>Q8WQM0_DROME unnamed protein product
Length=1984

 Score = 28.9 bits (63),  Expect = 1.5, Method: Composition-based stats.
 Identities = 13/41 (32%), Positives = 25/41 (61%), Gaps = 0/41 (0%)

Query  51    SPLIPGETARVRLVSKPVKSVKWTCLTCLSVKRYPTKKGYK  91
             +PL+P ET  ++++  PV++VK   +  +   R PT++  K
Sbjct  1156  NPLVPHETELLKILRNPVEAVKLNLVPHVCGLRAPTRESGK  1196


>O62178_CAEEL unnamed protein product
Length=2271

 Score = 26.6 bits (57),  Expect = 8.2, Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 27/53 (51%), Gaps = 2/53 (4%)

Query  61   VRLVSKPVKSVKWTCLTCLSVKRYPTKKGYKLWIEQPNSVVQIFNYAPKSLDN  113
            VR++S   +S+  + +  L    YP    Y+L IEQ N   Q    +PK ++N
Sbjct  466  VRVLSWKSESIDHSTVEALCALMYPMHDQYELRIEQLNK--QSLMSSPKFVEN  516



Lambda      K        H
   0.311    0.127    0.380 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3252957642


Query= XP_050573039.1 uncharacterized protein LOC126913804 isoform X1
[Bombus affinis]

Length=138
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q38DY0_TRYB2  unnamed protein product                                 28.5    1.7  
G5EEK5_CAEEL  unnamed protein product                                 27.7    4.0  
Q57XS3_TRYB2  unnamed protein product                                 27.3    5.3  


>Q38DY0_TRYB2 unnamed protein product
Length=191

 Score = 28.5 bits (62),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 12/39 (31%), Positives = 19/39 (49%), Gaps = 1/39 (3%)

Query  18  FLQYCLHNKILLKRDKCGAFEVSGTSNNIRT-LSNCLYI  55
           ++ +C   + L  R+ CGA E +  SNN       C Y+
Sbjct  14  YIVWCEQVRALFTREPCGAVEDAADSNNDDAYFPECFYM  52


>G5EEK5_CAEEL unnamed protein product
Length=843

 Score = 27.7 bits (60),  Expect = 4.0, Method: Composition-based stats.
 Identities = 21/72 (29%), Positives = 39/72 (54%), Gaps = 2/72 (3%)

Query  42   TSNNIRTLSNCLYIIDNIKSETNKKLKKLQKEALAADYSPSSGNNNGTLYIIYSTIWNSI  101
            +SN+   L + L  ++  +SE  K L+K QK+ +AA     S  +   L ++ +T W ++
Sbjct  2    SSNSALELKSALSQLNRERSEMVKDLEKAQKDYVAARNMHKSTGSQNHLEVV-NTCWKNV  60

Query  102  QRKFKKGIRSKI  113
            Q   +K  +SK+
Sbjct  61   QAA-QKAHQSKV  71


>Q57XS3_TRYB2 unnamed protein product
Length=651

 Score = 27.3 bits (59),  Expect = 5.3, Method: Composition-based stats.
 Identities = 10/30 (33%), Positives = 16/30 (53%), Gaps = 0/30 (0%)

Query  97   IWNSIQRKFKKGIRSKILQPDTKYNEWKLL  126
            I N ++  FK+  R+ I+ PD     W +L
Sbjct  105  IANVVEEDFKRATRAGIITPDQARQLWAML  134



Lambda      K        H
   0.311    0.127    0.380 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3252957642


Query= XP_050573040.1 uncharacterized protein LOC126913804 isoform X2
[Bombus affinis]

Length=106
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q38DY0_TRYB2  unnamed protein product                                 29.3    0.44 
Q54TS2_DICDI  unnamed protein product                                 26.9    4.1  
Q8IP51_DROME  unnamed protein product                                 26.2    6.6  


>Q38DY0_TRYB2 unnamed protein product
Length=191

 Score = 29.3 bits (64),  Expect = 0.44, Method: Compositional matrix adjust.
 Identities = 12/39 (31%), Positives = 19/39 (49%), Gaps = 1/39 (3%)

Query  18  FLQYCLHNKILLKRDKCGAFEVSGTSNNIRT-LSNCLYI  55
           ++ +C   + L  R+ CGA E +  SNN       C Y+
Sbjct  14  YIVWCEQVRALFTREPCGAVEDAADSNNDDAYFPECFYM  52


>Q54TS2_DICDI unnamed protein product
Length=1706

 Score = 26.9 bits (58),  Expect = 4.1, Method: Compositional matrix adjust.
 Identities = 15/35 (43%), Positives = 22/35 (63%), Gaps = 1/35 (3%)

Query  69    KLQKEALAADYSPYSALIKARTKTNK-SKVKNIFK  102
             ++Q E  +ADY P  AL + +   NK S++KNI K
Sbjct  1028  EIQNELWSADYGPDFALRELKKLKNKYSEIKNIIK  1062


>Q8IP51_DROME unnamed protein product
Length=3375

 Score = 26.2 bits (56),  Expect = 6.6, Method: Composition-based stats.
 Identities = 19/66 (29%), Positives = 27/66 (41%), Gaps = 1/66 (2%)

Query  21    YCLHNKILLKRDKCGAFEVSGTSNNIRTLSNC-LYIIDNIKSETNKKLKKLQKEALAADY  79
             YC      LK DKC A       N  +   NC L ++D ++   NK  + +    L    
Sbjct  1793  YCREGVTGLKCDKCQAERHHLVDNGCKICDNCTLLLLDYMELVGNKLRRGMHNMDLTGIP  1852

Query  80    SPYSAL  85
             +PY  L
Sbjct  1853  APYRKL  1858



Lambda      K        H
   0.311    0.127    0.380 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3252957642


Query= XP_050573041.1 uncharacterized protein LOC126913803 isoform X1
[Bombus affinis]

Length=542
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GLH2_CAEEL  unnamed protein product                                   33.9    0.42 


>GLH2_CAEEL unnamed protein product
Length=974

 Score = 33.9 bits (76),  Expect = 0.42, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 47/109 (43%), Gaps = 27/109 (25%)

Query  55   GHGGGLATGYGGDLGGHGGDLSVHGGDAGDGFGHSGGGGF--------------------  94
            G+G    TG+G    G  G  S + G  G G G++GG GF                    
Sbjct  69   GNGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGGGNAGGTGF  128

Query  95   --GHSGGGDIG----GGFGHSGGDIGGS-FGHSSGGDVGGGFGHSGGGG  136
              G++GG  +G    GG G   G+ GG+ FG  + G  G G G +GG G
Sbjct  129  GSGNAGGTGLGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGKAGGTG  177


 Score = 30.8 bits (68),  Expect = 4.0, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 28/55 (51%), Gaps = 5/55 (9%)

Query  76   SVHGGDAGDGFGHSGGGGFGHSGGGDIGGGFGHSGGDIGGSFGHSSGGDVGGGFG  130
            S + G  G G G++GG GFG    G  G G G++GG      G  SG   G GFG
Sbjct  130  SGNAGGTGLGSGNAGGTGFGSGNAGGTGFGSGNAGGT-----GFGSGKAGGTGFG  179



Lambda      K        H
   0.311    0.127    0.380 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3252957642


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Nov 7, 2022  4:57 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_050573042.1 histone H2A.V [Bombus affinis]

Length=128
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

H2AV_DROME  unnamed protein product                                   238     2e-82
H2AV_CAEEL  unnamed protein product                                   216     1e-73
O97320_PLAF7  unnamed protein product                                 184     7e-61


>H2AV_DROME unnamed protein product
Length=141

 Score = 238 bits (606),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/122 (99%), Positives = 122/122 (100%), Gaps = 0/122 (0%)

Query  1    MAGGKAGKDSGKAKAKAVSRSARAGLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILE  60
            MAGGKAGKDSGKAKAKAVSRSARAGLQFPVGRIHRHLK+RTTSHGRVGATAAVYSAAILE
Sbjct  1    MAGGKAGKDSGKAKAKAVSRSARAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILE  60

Query  61   YLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIG  120
            YLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIG
Sbjct  61   YLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIG  120

Query  121  KK  122
            KK
Sbjct  121  KK  122


>H2AV_CAEEL unnamed protein product
Length=140

 Score = 216 bits (549),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 118/129 (91%), Gaps = 2/129 (2%)

Query  1    MAGGK--AGKDSGKAKAKAVSRSARAGLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAI  58
            MAGGK  AGKDSGK+K+K VSRSARAGLQFPVGRIHR LK RTTS GRVGATAAVYSAAI
Sbjct  1    MAGGKGKAGKDSGKSKSKVVSRSARAGLQFPVGRIHRFLKQRTTSSGRVGATAAVYSAAI  60

Query  59   LEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSL  118
            LEYLTAEVLELAGNASKDLKVKRITPRHL LAIRGDEELD+LIKATIAGGGVIPHIH+ L
Sbjct  61   LEYLTAEVLELAGNASKDLKVKRITPRHLHLAIRGDEELDTLIKATIAGGGVIPHIHRYL  120

Query  119  IGKKGSQKP  127
            + KKG+  P
Sbjct  121  MNKKGAPVP  129


>O97320_PLAF7 unnamed protein product
Length=158

 Score = 184 bits (466),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 100/104 (96%), Gaps = 0/104 (0%)

Query  18   VSRSARAGLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDL  77
            +SR++RAGLQFPVGR+HR LK+R +S GRVG+TAAVY+AAILEYLTAEVLELAGNA+KDL
Sbjct  41   LSRASRAGLQFPVGRVHRMLKSRISSDGRVGSTAAVYAAAILEYLTAEVLELAGNATKDL  100

Query  78   KVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGK  121
            KVKRITPRHLQLAIRGDEELD+LIKATIAGGGVIPHIHK+L+ K
Sbjct  101  KVKRITPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKALMNK  144



Lambda      K        H
   0.315    0.131    0.361 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 566763464


Query= XP_050573043.1 methyl farnesoate epoxidase-like isoform X2 [Bombus
affinis]

Length=504
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

C15A1_DIPPU  unnamed protein product                                  478     9e-166
C15C1_BOMMO  unnamed protein product                                  331     4e-108
CP303_DROME  unnamed protein product                                  298     2e-95 


>C15A1_DIPPU unnamed protein product
Length=493

 Score = 478 bits (1230),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 233/493 (47%), Positives = 328/493 (67%), Gaps = 4/493 (1%)

Query  5    TISLLLILLFMFGVYDCIKPHNFPPGPKWLPVIGCFFTFRRLKLKRKYSYLALQDLTKTY  64
             I+L++I++F+  + D IKP  +PPGP WLPV+G +  FRR K +  Y +L    L+  Y
Sbjct  2    VIALIVIIIFLVCL-DVIKPRGYPPGPVWLPVVGSYLWFRREKSRVGYYHLVWSSLSSRY  60

Query  65   GPILGLKLGNQKAVVISTYDLVKKVLLQEEFNGRPDGFFFRVRAFGKRKGILFTEGPKWS  124
            GP+ G++LG    VV   YD ++ +LL++EF+GRPDG+FFR+R FGKR G++FT+GP W 
Sbjct  61   GPVTGMRLGTDYIVVACGYDAIRDILLRDEFDGRPDGYFFRLRTFGKRMGVVFTDGPVWQ  120

Query  125  QCRRFTMRHLRTFGLGQAIMEQQLIVEADNLVNYLLRASAKG--PVPMHTAFDIAVLNSL  182
            + RRF M+HLR  GLG   ME  +  EA +LV  L R S  G   +PMH  FDI VLNSL
Sbjct  121  EQRRFCMQHLRKLGLGSRSMEAHIEEEARDLVASLHRRSNGGLTAIPMHDVFDICVLNSL  180

Query  183  WFMFAGHRFDYENEKLVEILETVHDAFRLMDTMGGIVSQMPFLRFIIPELSGYNDLMRIL  242
            W M AGHRFD ++++LV++L+ VH  FR++D  GG+++QMP LRFI P  SGY +LM  L
Sbjct  181  WAMLAGHRFDLDDQRLVDLLDIVHKCFRMIDPSGGLLNQMPPLRFIAPRHSGYTNLMTHL  240

Query  243  HKLWNFLDEEINIHERRLPGNQPQDLIDAFLLEISSKNTEQDDSIFDRENLLVLCLDLFL  302
            +++WNFL E I+ H +    +  +DLID FL E+ +    Q++S F+   L+ LCLDLF+
Sbjct  241  NRIWNFLRETIDDHRKSFNADNMRDLIDLFLREMETSKC-QNNSSFEDLQLVSLCLDLFM  299

Query  303  AGSKTTTDTLATTFLFLSLHSEWIKILQEELDTVVGRLRSPTLEDYSSLPMMESFLAEVQ  362
            AGS+TT++TL    L++ L+ +  + +Q+ELD  VG  R PTL+D  SL  +E+ L E+Q
Sbjct  300  AGSETTSNTLGFAVLYMLLYPQVQRRVQDELDRCVGTDRQPTLQDRRSLRYLEAVLMEIQ  359

Query  363  RYLILAPLGVPHKTMKDVTFGGYSIPKDTIILLDFHSALNDPAYWDHPEEFRPQRFLDAN  422
            R+  +AP G+PHK +K+    G++IPK T +L+   S   D  +W  PE FRP+RF+  N
Sbjct  360  RHATIAPSGIPHKALKNTVLMGHTIPKGTTVLVSMWSLHRDVQHWGDPEVFRPERFISGN  419

Query  423  GRFCQNNASIPFGLGKRRCPGEMLARTSLFLFFAYVIHNFDIEISPEHGEPDPNGYDGFT  482
            G   Q++  +PFG+GKRRC GE LA+ SLFLFF+ ++HNF I  S E   P   GYDG T
Sbjct  420  GNIKQDDWFMPFGIGKRRCIGETLAKASLFLFFSTLLHNFSILPSSESPLPSLEGYDGVT  479

Query  483  ISPKSYYLKLTAR  495
            +SPK +  KL  R
Sbjct  480  LSPKPFSAKLIPR  492


>C15C1_BOMMO unnamed protein product
Length=493

 Score = 331 bits (848),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 176/491 (36%), Positives = 277/491 (56%), Gaps = 9/491 (2%)

Query  9    LLILLFMFGVYDCIKPHN---FPPGPKWLPVIGCFFTFRRLKLKRKYSYLALQDLTKTYG  65
            L++L F+   Y   + H    +PPGP  LP++G   +      K K  +L  Q  ++ YG
Sbjct  4    LIVLCFILFFYIISRRHRGLCYPPGPTPLPIVGNLLSVLWESRKFKCHHLIWQSWSQKYG  63

Query  66   PILGLKLGNQKAVVISTYDLVKKVLLQEEFNGRPDGFFFRVRAFGKRKGILFTEGPKWSQ  125
             +LGL+LG+   VV++  +L+++V  +E F GRPDGFF+ +R+FGK+ G++F++GP W +
Sbjct  64   NLLGLRLGSINVVVVTGIELIREVSNREVFEGRPDGFFYTMRSFGKKLGLVFSDGPTWHR  123

Query  126  CRRFTMRHLRTFGLGQAIMEQQLIVEADNLVNYLLRASAKGPVPMHTAFDIAVLNSLWFM  185
             RRF +++L+ FG     M   +  E + LV   L A A  P+ ++  F I ++N LW +
Sbjct  124  TRRFVLKYLKNFGYNSRFMNVYIGDECEALVQLRL-ADAGEPILVNQMFHITIVNILWRL  182

Query  186  FAGHRFDYENEKLVEILETVHDAFRLMDTMGGIVSQMPFLRFIIPELSGYNDLMRILHKL  245
             AG R+D E+++L E+   V   F+L+D  GG ++ +PFLR  +P L G+ +L  I + L
Sbjct  183  VAGKRYDLEDQRLKELCSLVMRLFKLVDMSGGFLNFLPFLRHFVPRLIGFTELQEIHNAL  242

Query  246  WNFLDEEINIHERRLPGNQPQDLIDAFLLEISSKNTEQDDSIFDRENLLVLCLDLFLAGS  305
              +L E I  H+  L    P+D+IDAFL+++     E  D     ++L V+CLDL  AG 
Sbjct  243  HQYLREIIKEHQENLQLGAPKDVIDAFLIDM----LESQDDKPTLDDLQVVCLDLLEAGM  298

Query  306  KTTTDTLATTFLFLSLHSEWIKILQEELDTVVGRLRSPTLEDYSSLPMMESFLAEVQRYL  365
            +T T+T     L +  + +  + L +E+D ++GR R+P L+D   +   E+ + E  R  
Sbjct  299  ETVTNTAVFMLLHVVRNEDVQRKLHQEIDDIIGRDRNPLLDDRIRMVYTEAVILETLRIS  358

Query  366  ILAPLGVPHKTMKDVTFGGYSIPKDTIILLDFHSALNDPAYWDHPEEFRPQRFLDANGRF  425
             +A +G+PH  + D   G Y IPK T ILL  +   + P +W  PE FRP+RFL   G  
Sbjct  359  TVASMGIPHMALNDAKLGNYIIPKGTFILLSLYELHHGP-HWKDPETFRPERFLTKEGNI  417

Query  426  CQNNASIPFGLGKRRCPGEMLARTSLFLFFAYVIHNFDIEISPEHGEPDPNGYDGFTISP  485
             Q+   IPFG+GKRRC GE LAR+ LF+F  +++  F + I      P     DG ++S 
Sbjct  418  LQDEWLIPFGIGKRRCIGEGLARSELFMFLTHILQKFHLRIPKNEPLPSTEPIDGLSLSA  477

Query  486  KSYYLKLTARS  496
            K + +    R 
Sbjct  478  KQFRIIFEPRK  488


>CP303_DROME unnamed protein product
Length=503

 Score = 298 bits (763),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 171/506 (34%), Positives = 265/506 (52%), Gaps = 14/506 (3%)

Query  1    MLYATISLLLILLFMFGVYDCIKPHNFPPGPKWLPVIGCFFTFRRLKLKRKYSYLALQDL  60
            M Y  I +    L         KP  FPPGP W P++G      +L+ +       +   
Sbjct  1    MFYTVIWIFCATLLAILFGGVRKPKRFPPGPAWYPIVGSALQVSQLRCRLGMFCKVIDVF  60

Query  61   TKTY-GP--ILGLKLGNQKAVVISTYDLVKKVLLQEEFNGRPDGFFFRVRAFGKRKGILF  117
             + Y  P    GLK+G  K V+  T D + +++  E+ +GRPDG F+R+R F  R G+L 
Sbjct  61   ARQYVNPYGFYGLKIGKDKVVIAYTNDAISEMMTNEDIDGRPDGIFYRLRTFNSRLGVLL  120

Query  118  TEGPKWSQCRRFTMRHLRTFGLGQAIMEQQLIVEA----DNLVNYLLRASAKGP-VPMHT  172
            T+G  W + RRF +RHL+ FG  ++ M   +  EA     +L + +L++  K   + MH 
Sbjct  121  TDGEMWVEQRRFILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHD  180

Query  173  AFDIAVLNSLWFMFAGHRFDYENEKLVEILETVHDAFRLMDTMGGIVSQMPFLRFIIPEL  232
               + VLN+LW M +G R++  + ++ ++LET  + F+ +D +G + S  P LRFI P  
Sbjct  181  LTSVYVLNTLWCMLSGRRYEPGSPEITQLLETFFELFKNIDMVGALFSHFPLLRFIAPNF  240

Query  233  SGYNDLMRILHKLWNFLDEEINIHERRLPG-NQPQDLIDAFLLEISSKNTEQDDSIFDRE  291
            SGYN  +     L+ F+ +EI +H       ++P+DL+D++L      N E+   +F  +
Sbjct  241  SGYNGFVESHRSLYTFMSKEIELHRLTYKNYDEPRDLMDSYLRAQDEGNDEK--GMFSDQ  298

Query  292  NLLVLCLDLFLAGSKTTTDTLATTFLFLSLHSEWIKILQEELDTVVGRLRSPTLE-DYSS  350
            +LL +CLD+FLAGS+TT  +L   F+ L L  E  +   +E+  VVG  R P    D + 
Sbjct  299  SLLAICLDMFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEWSRDRTK  358

Query  351  LPMMESFLAEVQRYLILAPLGVPHKTMKDVTFGGYSIPKDTIILLDFHSALNDPAYWDHP  410
            LP  E+   E  R  +L   G+PH+ + D    GY IPKDT+++  F   L +P  +  P
Sbjct  359  LPYCEAITLEAVRMFMLHTFGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPDP  418

Query  411  EEFRPQRFLDANGRFCQNNASIPFGLGKRRCPGEMLARTSLFLFFAYVIHNFDIEISPEH  470
            E F P R+L  +G      A  PFG G+ RC G++L R +LF+F   V+ NF +   P  
Sbjct  419  ESFNPDRYL-FDGHLKLPEAFNPFGFGRHRCMGDLLGRQNLFMFTTTVLQNFKMVAIPGQ  477

Query  471  GEPDPNGYDGFTISPKSYYLKLTARS  496
              P+    +G T + K Y + L AR 
Sbjct  478  -VPEEVPLEGATAAVKPYDIMLVARE  502



Lambda      K        H
   0.315    0.131    0.361 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 566763464


Query= XP_050573044.1 glucose transporter type 1 isoform X10 [Bombus
affinis]

Length=841
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GTR1_DROME  unnamed protein product                                   862     0.0   
FGT1_CAEEL  unnamed protein product                                   375     5e-121
Q7KJP2_DROME  unnamed protein product                                 202     2e-56 


>GTR1_DROME unnamed protein product
Length=1440

 Score = 862 bits (2228),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/483 (88%), Positives = 451/483 (93%), Gaps = 7/483 (1%)

Query  339  LLEQGLTLFLSYAILAAVLGMLQFGYNTGVINAPEVNIENFMKDVYKDRYGEDISDDSVK  398
            L   GLT FL+Y+I +AVLGMLQFGYNTGVINAPE NIENFMKDVYKDRYGEDIS++ ++
Sbjct  4    LCAPGLTFFLTYSIFSAVLGMLQFGYNTGVINAPEKNIENFMKDVYKDRYGEDISEEFIQ  63

Query  399  KLYSVAVSIFAIGGMLGGFSGGIIANRFGRKGGLLLNNVLGIVGACLMGCTKIAHSYEML  458
            +LYSVAVSIFAIGGMLGGFSGG +ANRFGRKGGLLLNNVLGI GACLMG TK++HSYEML
Sbjct  64   QLYSVAVSIFAIGGMLGGFSGGWMANRFGRKGGLLLNNVLGIAGACLMGFTKVSHSYEML  123

Query  459  FFGRFIIGVNCGLNTSLVPMYISEIAPLNLRGGLGTVNQLAVTVGLLVSQVLGIEQILGT  518
            F GRFIIGVNCGLNTSLVPMYISEIAPLNLRGGLGTVNQLAVTVGLL+SQVLGIEQILGT
Sbjct  124  FLGRFIIGVNCGLNTSLVPMYISEIAPLNLRGGLGTVNQLAVTVGLLLSQVLGIEQILGT  183

Query  519  NEGWPVLLGLAICPAILQLLLLPVCPESPRYLLITKQWEEEARKALRRLRASNQVEEDIE  578
            NEGWP+LLGLAICPAILQL+LLPVCPESPRYLLITKQWEEEARKALRRLRAS  VEEDIE
Sbjct  184  NEGWPILLGLAICPAILQLILLPVCPESPRYLLITKQWEEEARKALRRLRASGSVEEDIE  243

Query  579  EMRAEERAQQAESRISMTELICSPTLRAPLVIGVVMQLSQQLSGINAVFYYSTNLFTSSG  638
            EMRAEERAQQ+ES IS  ELICSPTLR PL+IG+VMQLSQQ SGINAVFYYST+LF SSG
Sbjct  244  EMRAEERAQQSESHISTMELICSPTLRPPLIIGIVMQLSQQFSGINAVFYYSTSLFMSSG  303

Query  639  LTEESAKFATIGIGAIMVLMTLGSIPLMDRTGRRTLHLYGLGGMFIFSIFITISFLIKEF  698
            LTEESAKFATIGIGAIMV+MTL SIPLMDRTGRRTLHLYGLGGMFIFSIFITISFLIK  
Sbjct  304  LTEESAKFATIGIGAIMVVMTLVSIPLMDRTGRRTLHLYGLGGMFIFSIFITISFLIK--  361

Query  699  FGYVQEMIDWMSYLSVVSTLSFVVFFAVGPGSIPWMITAELFSQGPRPAAMSIAVLVNWM  758
                 EMIDWMSYLSVV+TL FVVFFAVGPGSIPWMITAELFSQGPRP+AM+IAVLVNWM
Sbjct  362  -----EMIDWMSYLSVVATLGFVVFFAVGPGSIPWMITAELFSQGPRPSAMAIAVLVNWM  416

Query  759  ANFLVGIGFPSMKTSLENYTFLPFSAFLAIFWIFTYKKVPETKNKTFEEILALFRHGNDR  818
            ANF+VGIGFPSMKT+LENYTFLPFS FLAIFWIFTYKKVPETKNKTFEEILALFRH N R
Sbjct  417  ANFVVGIGFPSMKTALENYTFLPFSVFLAIFWIFTYKKVPETKNKTFEEILALFRHNNGR  476

Query  819  SSL  821
            S L
Sbjct  477  SML  479


>FGT1_CAEEL unnamed protein product
Length=510

 Score = 375 bits (963),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 202/480 (42%), Positives = 302/480 (63%), Gaps = 8/480 (2%)

Query  335  RKLRLLEQGLTLFLSYAILAAVLGMLQFGYNTGVINAPEVNIENFMKDVYKDRYGEDISD  394
            +K+   +  LT  L+++     L   QFGY+ G +NAP   I  ++   +KD + +++S 
Sbjct  33   QKIIFPDGKLTKCLAFSAFVITLASFQFGYHIGCVNAPGGLITEWIIGSHKDLFDKELSR  92

Query  395  DSVKKLYSVAVSIFAIGGMLGGFSGGIIANRFGRKGGLLLNNVLGIVGACLMGCTKIAHS  454
            ++    +SVAVS+FA+GGM+GG S G +A++ GR+G L  NN+L +  A LMG  K   +
Sbjct  93   ENADLAWSVAVSVFAVGGMIGGLSSGWLADKVGRRGALFYNNLLALAAAALMGLAKSVGA  152

Query  455  YEMLFFGRFIIGVNCGLNTSLVPMYISEIAPLNLRGGLGTVNQLAVTVGLLVSQVLGIEQ  514
            Y M+  GR IIG+NCG +++LVPM+++EI+P NLRG LG+++QL VT+ +LVSQ+ G+  
Sbjct  153  YPMVILGRLIIGLNCGFSSALVPMFLTEISPNNLRGMLGSLHQLLVTIAILVSQIFGLPH  212

Query  515  ILGTNEGWPVLLGLAICPAILQLLLLPVCPESPRYLLITKQWEEEARKALRRLRASNQVE  574
            +LGT + WP++    + PA+LQL LL +CPESP+Y +  +    EA  AL++LR +  V 
Sbjct  213  LLGTGDRWPLIFAFTVVPAVLQLALLMLCPESPKYTMAVRGQRNEAESALKKLRDTEDVS  272

Query  575  EDIEEMRAEERAQQAESRISMTELICSPTLRAPLVIGVVMQLSQQLSGINAVFYYSTNLF  634
             +IE M+ E  A   + +  M ++     L  P+ I ++M L+QQLSGIN   +YST +F
Sbjct  273  TEIEAMQEEATAAGVQEKPKMGDMF-KGALLWPMSIAIMMMLAQQLSGINVAMFYSTVIF  331

Query  635  TSSGLTEESAKFATIGIGAIMVLMTLGSIPLMD--RTGRRTLHLYGLGGMFIFSIFITIS  692
              +GLT     +ATIG+GA+ V+MTL S+ L+D  + GRR+L L GL GMF+ ++ +  +
Sbjct  332  RGAGLTGNEPFYATIGMGAVNVIMTLISVWLVDHPKFGRRSLLLAGLTGMFVSTLLLVGA  391

Query  693  FLIKEFFGYVQEMIDWMSYLSVVSTLSFVVFFAVGPGSIPWMITAELFSQGPRPAAMSIA  752
              I+   G       W SY ++   L FV+ FA GPG+IPW   +E+F    R  A SIA
Sbjct  392  LTIQNSGGD-----KWASYSAIGFVLLFVISFATGPGAIPWFFVSEIFDSSARGNANSIA  446

Query  753  VLVNWMANFLVGIGFPSMKTSLENYTFLPFSAFLAIFWIFTYKKVPETKNKTFEEILALF  812
            V+VNW AN LVG+ F  +   ++ Y+F  FS FLA F  +T+K VPETK K+ E+I A F
Sbjct  447  VMVNWAANLLVGLTFLPINNLMQQYSFFIFSGFLAFFIFYTWKFVPETKGKSIEQIQAEF  506


>Q7KJP2_DROME unnamed protein product
Length=476

 Score = 202 bits (513),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 148/485 (31%), Positives = 249/485 (51%), Gaps = 29/485 (6%)

Query  341  EQGLTLFLSYAILAAVLG-MLQFGYNTGVINAPEVNIENFMKDVYKDRYGEDISDDSVKK  399
            +QG T  L    +   +G ++  GY  GV+NAP   I +++ +   +RY   + D  +  
Sbjct  5    KQGWTCLLVLICVCITVGTVIPVGYAFGVMNAPSAFIRSWIMESVLERYSSRLGDSQMTI  64

Query  400  LYSVAVSIFAIGGMLGGFSGGIIANRFGRKGGLLLNNVLGIVGA-CLMGCTKIAHSYEML  458
            + S  VSIF IGGMLG     I + R GR+G L L+ +L +V   C + C ++A+S EML
Sbjct  65   IMSTVVSIFLIGGMLGAPFAPIFSARLGRRGILTLSGLLLLVSCICQLFC-RMANSIEML  123

Query  459  FFGRFIIGVNCGLNTSLVPMYISEIAPLNLRGGLGTVNQLAVTVGLLVSQVLGIEQILGT  518
              GR I G+   L  +  PMY+ E+AP  L G +G    + +T G+++ QV   + +LGT
Sbjct  124  LLGRLIGGLAAALIYATQPMYLVELAPAELSGSVGVFTCIGLTGGIVLGQVFSFDFLLGT  183

Query  519  NEGWPVLLGLAICPAILQLLLLPVCPESPRYLLITKQWEEEARKALRRLRAS-NQVEEDI  577
             + WP  L  +    ++ L  +   PESPR+L+ ++   E+AR  L RLR    +V  ++
Sbjct  184  EKLWPYALSGSAIFVLIGLAPIFWFPESPRFLM-SQGRREKARVTLMRLRRDEGRVNAEM  242

Query  578  EEMRAEERAQQAESRISMTELICSPTLRAPLVIGVVMQLSQQLSGINAVFYYSTNLFTSS  637
             E    E +   E +++M +++C+  L+ PL I       QQ+SGI+A+++YS  +FT S
Sbjct  243  AEF---EVSSTDEGQVTMKQVLCNSKLKLPLFIVCSFHFVQQMSGISAIWFYSIEIFTQS  299

Query  638  GLTEESAKFATIGIGAIMVLMTLGSIPLMDRTGRRTLHLYGLGGMFIFSIFITISFLIKE  697
            G T   A +    +G +  +  L    LM    RR +              +TIS L   
Sbjct  300  GFTAAVAMWLNFALGLLNFISALMGPWLMRSFNRRLM--------------MTISCLCSA  345

Query  698  FF-------GYVQEMIDWMSYLSVVSTLSFVVFFAVGPGSIPWMITAELFSQGPRPAAMS  750
             F         +   I   S+  +     +++ F +G G  P+ I +E+F    RP+AM+
Sbjct  346  IFLVLLVVGLELMSTIHEFSFTCIAFLSLYIITFNMGLGPTPYFIGSEIFETASRPSAMA  405

Query  751  IAVLVNWMANFLVGIGFPSMKTSLENYTFLPFSAFLAIFWIFTYKKVPETKNKTFEEILA  810
            +    NW+ANF++ + FP++ ++   + FL    F A  ++ TY+ +PET+N+  +++  
Sbjct  406  LGSFFNWLANFVLNMIFPTLNSATGPFVFLLCVVFCAYGFLLTYRYLPETRNRDAKDVAQ  465

Query  811  LFRHG  815
            L  +G
Sbjct  466  LMENG  470



Lambda      K        H
   0.315    0.131    0.361 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 566763464


Query= XP_050573045.1 probable cytochrome P450 305a1 [Bombus affinis]

Length=490
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

C15A1_DIPPU  unnamed protein product                                  305     3e-98
C15C1_BOMMO  unnamed protein product                                  270     9e-85
CP303_DROME  unnamed protein product                                  258     6e-80


>C15A1_DIPPU unnamed protein product
Length=493

 Score = 305 bits (780),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 172/492 (35%), Positives = 276/492 (56%), Gaps = 11/492 (2%)

Query  9    IVTLILLIIYLVVGQ--HTRKTPPGPFSWPIFGNHFLMKRLIREFGGQHEAFLELSKRYA  66
            ++ LI++II+LV       R  PPGP   P+ G++   +R     G  H  +  LS RY 
Sbjct  2    VIALIVIIIFLVCLDVIKPRGYPPGPVWLPVVGSYLWFRREKSRVGYYHLVWSSLSSRYG  61

Query  67   SDVISVTIGNEKVLIVSGSKLCETVLKNEEFDGRPWNEFIKLRNMGKKQGITMNDGGEWK  126
              V  + +G + +++  G      +L  +EFDGRP   F +LR  GK+ G+   DG  W+
Sbjct  62   P-VTGMRLGTDYIVVACGYDAIRDILLRDEFDGRPDGYFFRLRTFGKRMGVVFTDGPVWQ  120

Query  127  ELRSWMLRTMRVFGFGKREMAQMIRKE---LTLFLNEMNTEGPQI--LKPLITPTVINVL  181
            E R + ++ +R  G G R M   I +E   L   L+  +  G     +  +    V+N L
Sbjct  121  EQRRFCMQHLRKLGLGSRSMEAHIEEEARDLVASLHRRSNGGLTAIPMHDVFDICVLNSL  180

Query  182  WFLTTGESFS-RGERIDSFIKLMETRAKVFDMMGGLISAFPWIRYIAPEFSGYNLLCTLN  240
            W +  G  F    +R+   + ++    ++ D  GGL++  P +R+IAP  SGY  L T  
Sbjct  181  WAMLAGHRFDLDDQRLVDLLDIVHKCFRMIDPSGGLLNQMPPLRFIAPRHSGYTNLMTHL  240

Query  241  KQLKDFLMETIIEHKKKYKPGSEADVIDMFLHEMK-NHGESSPIFTDDQLVILLIDLFLA  299
             ++ +FL ETI +H+K +   +  D+ID+FL EM+ +  +++  F D QLV L +DLF+A
Sbjct  241  NRIWNFLRETIDDHRKSFNADNMRDLIDLFLREMETSKCQNNSSFEDLQLVSLCLDLFMA  300

Query  300  GFTTTSLTLDFLLLTMTVYQDVQHKVQKEIDSVISRDRLPEVEDKAKLPYVEAVISEVQR  359
            G  TTS TL F +L M +Y  VQ +VQ E+D  +  DR P ++D+  L Y+EAV+ E+QR
Sbjct  301  GSETTSNTLGFAVLYMLLYPQVQRRVQDELDRCVGTDRQPTLQDRRSLRYLEAVLMEIQR  360

Query  360  MWPVFPIIGPRRVLHDTILDKYTVPRDTTILVNMYSINKDPNIYPEPDKFMPERFIK-ND  418
               + P   P + L +T+L  +T+P+ TT+LV+M+S+++D   + +P+ F PERFI  N 
Sbjct  361  HATIAPSGIPHKALKNTVLMGHTIPKGTTVLVSMWSLHRDVQHWGDPEVFRPERFISGNG  420

Query  419  VFEPDTYSLQFGKGRRRCPGEVLAKSALFILFTGIMQKYNLRPVPGKGPNSVEIIYGLTS  478
              + D + + FG G+RRC GE LAK++LF+ F+ ++  +++ P       S+E   G+T 
Sbjct  421  NIKQDDWFMPFGIGKRRCIGETLAKASLFLFFSTLLHNFSILPSSESPLPSLEGYDGVTL  480

Query  479  SPKPYEVLVTPR  490
            SPKP+   + PR
Sbjct  481  SPKPFSAKLIPR  492


>C15C1_BOMMO unnamed protein product
Length=493

 Score = 270 bits (689),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 163/492 (33%), Positives = 267/492 (54%), Gaps = 12/492 (2%)

Query  6    LLAIVTLILLIIYLVVGQHTRKT--PPGPFSWPIFGNHFLMKRLIREFGGQHEAFLELSK  63
            +LA++ L  ++ + ++ +  R    PPGP   PI GN   +    R+F   H  +   S+
Sbjct  1    MLALIVLCFILFFYIISRRHRGLCYPPGPTPLPIVGNLLSVLWESRKFKCHHLIWQSWSQ  60

Query  64   RYASDVISVTIGNEKVLIVSGSKLCETVLKNEEFDGRPWNEFIKLRNMGKKQGITMNDGG  123
            +Y  +++ + +G+  V++V+G +L   V   E F+GRP   F  +R+ GKK G+  +DG 
Sbjct  61   KYG-NLLGLRLGSINVVVVTGIELIREVSNREVFEGRPDGFFYTMRSFGKKLGLVFSDGP  119

Query  124  EWKELRSWMLRTMRVFGFGKREMAQMIRKELTLF--LNEMNTEGPQILKPLITPTVINVL  181
             W   R ++L+ ++ FG+  R M   I  E      L   +   P ++  +   T++N+L
Sbjct  120  TWHRTRRFVLKYLKNFGYNSRFMNVYIGDECEALVQLRLADAGEPILVNQMFHITIVNIL  179

Query  182  WFLTTGESFS-RGERIDSFIKLMETRAKVFDMMGGLISAFPWIRYIAPEFSGYNLLCTLN  240
            W L  G+ +    +R+     L+    K+ DM GG ++  P++R+  P   G+  L  ++
Sbjct  180  WRLVAGKRYDLEDQRLKELCSLVMRLFKLVDMSGGFLNFLPFLRHFVPRLIGFTELQEIH  239

Query  241  KQLKDFLMETIIEHKKKYKPGSEADVIDMFLHEMKNHGESSPIFTDDQLVILLIDLFLAG  300
              L  +L E I EH++  + G+  DVID FL +M    +  P   D Q+V L  DL  AG
Sbjct  240  NALHQYLREIIKEHQENLQLGAPKDVIDAFLIDMLESQDDKPTLDDLQVVCL--DLLEAG  297

Query  301  FTTTSLTLDFLLLTMTVYQDVQHKVQKEIDSVISRDRLPEVEDKAKLPYVEAVISEVQRM  360
              T + T  F+LL +   +DVQ K+ +EID +I RDR P ++D+ ++ Y EAVI E  R+
Sbjct  298  METVTNTAVFMLLHVVRNEDVQRKLHQEIDDIIGRDRNPLLDDRIRMVYTEAVILETLRI  357

Query  361  WPVFPIIGPRRVLHDTILDKYTVPRDTTILVNMYSINKDPNIYPEPDKFMPERFI-KNDV  419
              V  +  P   L+D  L  Y +P+ T IL+++Y ++  P+ + +P+ F PERF+ K   
Sbjct  358  STVASMGIPHMALNDAKLGNYIIPKGTFILLSLYELHHGPH-WKDPETFRPERFLTKEGN  416

Query  420  FEPDTYSLQFGKGRRRCPGEVLAKSALFILFTGIMQKYNLRPVPGKGP-NSVEIIYGLTS  478
               D + + FG G+RRC GE LA+S LF+  T I+QK++LR +P   P  S E I GL+ 
Sbjct  417  ILQDEWLIPFGIGKRRCIGEGLARSELFMFLTHILQKFHLR-IPKNEPLPSTEPIDGLSL  475

Query  479  SPKPYEVLVTPR  490
            S K + ++  PR
Sbjct  476  SAKQFRIIFEPR  487


>CP303_DROME unnamed protein product
Length=503

 Score = 258 bits (658),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 152/506 (30%), Positives = 268/506 (53%), Gaps = 21/506 (4%)

Query  1    MFATVLLAIVTLILLIIYLVVGQHTRKTPPGPFSWPIFGNHFLMKRLIREFGGQHEAFLE  60
            MF TV+      +L I++  V +  ++ PPGP  +PI G+   + +L    G   +    
Sbjct  1    MFYTVIWIFCATLLAILFGGV-RKPKRFPPGPAWYPIVGSALQVSQLRCRLGMFCKVIDV  59

Query  61   LSKRYAS--DVISVTIGNEKVLIVSGSKLCETVLKNEEFDGRPWNEFIKLRNMGKKQGIT  118
             +++Y +      + IG +KV+I   +     ++ NE+ DGRP   F +LR    + G+ 
Sbjct  60   FARQYVNPYGFYGLKIGKDKVVIAYTNDAISEMMTNEDIDGRPDGIFYRLRTFNSRLGVL  119

Query  119  MNDGGEWKELRSWMLRTMRVFGFGKREMAQMIRKELTLFLNE-----MNTEGPQI---LK  170
            + DG  W E R ++LR ++ FGF +  M  ++  E T  L +     + + G Q    + 
Sbjct  120  LTDGEMWVEQRRFILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMH  179

Query  171  PLITPTVINVLWFLTTGESFSRGERIDSFIKLMETRAKVF---DMMGGLISAFPWIRYIA  227
             L +  V+N LW + +G  +  G       +L+ET  ++F   DM+G L S FP +R+IA
Sbjct  180  DLTSVYVLNTLWCMLSGRRYEPGS--PEITQLLETFFELFKNIDMVGALFSHFPLLRFIA  237

Query  228  PEFSGYNLLCTLNKQLKDFLMETIIEHKKKYKPGSEA-DVIDMFLHEMKNHGESSPIFTD  286
            P FSGYN     ++ L  F+ + I  H+  YK   E  D++D +L       +   +F+D
Sbjct  238  PNFSGYNGFVESHRSLYTFMSKEIELHRLTYKNYDEPRDLMDSYLRAQDEGNDEKGMFSD  297

Query  287  DQLVILLIDLFLAGFTTTSLTLDFLLLTMTVYQDVQHKVQKEIDSVISRDRLPE-VEDKA  345
              L+ + +D+FLAG  TT+ +L F  + + +  ++Q +  +EI  V+  +R+PE   D+ 
Sbjct  298  QSLLAICLDMFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEWSRDRT  357

Query  346  KLPYVEAVISEVQRMWPVFPIIGPRRVLHDTILDKYTVPRDTTILVNMYSINKDPNIYPE  405
            KLPY EA+  E  RM+ +     P R + DT L  Y +P+DT ++     +  +P  +P+
Sbjct  358  KLPYCEAITLEAVRMFMLHTFGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPD  417

Query  406  PDKFMPERFIKNDVFE-PDTYSLQFGKGRRRCPGEVLAKSALFILFTGIMQKYNLRPVPG  464
            P+ F P+R++ +   + P+ ++  FG GR RC G++L +  LF+  T ++Q + +  +PG
Sbjct  418  PESFNPDRYLFDGHLKLPEAFN-PFGFGRHRCMGDLLGRQNLFMFTTTVLQNFKMVAIPG  476

Query  465  KGPNSVEIIYGLTSSPKPYEVLVTPR  490
            + P  V  + G T++ KPY++++  R
Sbjct  477  QVPEEVP-LEGATAAVKPYDIMLVAR  501



Lambda      K        H
   0.315    0.131    0.361 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 566763464


Query= XP_050573046.1 retinoid-inducible serine carboxypeptidase-like
[Bombus affinis]

Length=434
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VDT5_DROME  unnamed protein product                                 150     2e-40
Q38CD6_TRYB2  unnamed protein product                                 114     1e-27
Q38CD5_TRYB2  unnamed protein product                                 112     6e-27


>Q9VDT5_DROME unnamed protein product
Length=482

 Score = 150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 119/421 (28%), Positives = 196/421 (47%), Gaps = 50/421 (12%)

Query  32   GYVKVRP--TSHMFWWLYYTTADVSSYYEKPLIIWLQGGPGASSTSYGNFEELGPLDVN-  88
            GY+ V P   S+MF+W Y+       Y   P+++WLQGGPGASS  +G F E GPL+++ 
Sbjct  89   GYLTVDPGFKSNMFFW-YFPAEQEPEY--APVVLWLQGGPGASSL-FGLFTENGPLELDG  144

Query  89   ---LKPRNFTWVKDYNVLFIDNPVGTGFSYTTTLGGYTTTNAEIAHDLLECIKGFLKQLP  145
               L+ RN+TW K +N+++IDNPVGTGFS+T    GY T   ++  +L E +   L +L 
Sbjct  145  HGKLQKRNYTWSKTHNLIYIDNPVGTGFSFTENDAGYATNEKDVGRNLHEAVMQ-LYELF  203

Query  146  EFADVPTY-ITTESYGGKMGAEFALSWYKAQQ--QEKIKSNLKGVALGDAWISPIDSVMT  202
            E+++   + +T ESY GK     A   +K Q   + ++   LKGVA+G+    P+   + 
Sbjct  204  EWSNSSGFWVTGESYAGKYVPALAYHIHKVQNAIETRVYVPLKGVAIGNGLSDPLHQ-LK  262

Query  203  WAPFLLATGMVDTDGYEKINKAALRTKEAVDSKRWTNATKLW------SYTEG-VIDEVT  255
            +  +L   G++D  G +  + A  +  E + S     A  ++        T G +   +T
Sbjct  263  YGDYLYQLGLIDEHGLQSFHDAEAKGAECIKSHDMECAFDVFDSLINGDLTNGSLFSNLT  322

Query  256  NNIDFYNILTKIEPDTNQLTPMQRLVSEPTFAQEYSVFSQESLSKLMNGPVKESLNLPS-  314
                +YN L   + D   L                          L  G  + ++++ + 
Sbjct  323  GYNWYYNYLKTHDDDGANLGEF-----------------------LQAGATRRAIHVGNK  359

Query  315  --NHGTQSNLVFSKLGGDFMKPVIHIVESLLNETKLKVVVISGHMDLIVDTPGTLRWVEK  372
              +   + N V   L  D M  V   +  LL      V + SG +D+IV  P T  ++ +
Sbjct  360  TFHDLDKENKVELHLKKDIMDSVAPWIAELL--AHYTVCIYSGQLDIIVAYPLTRNYLNQ  417

Query  373  MQWKDANSWHRSDRAPLVVENIIEGYVKSYGNFSMYWVNRAGHMVPKDNPAAMAWILKEF  432
            +++  ++ +  + R    V   + GYVK  G+     V  AGHM P D P  +  ++   
Sbjct  418  LKFPGSDKYKVAPREVWRVGKEVAGYVKHAGHLVEIMVRNAGHMAPHDQPKWLYMMIDHL  477

Query  433  T  433
            T
Sbjct  478  T  478


>Q38CD6_TRYB2 unnamed protein product
Length=464

 Score = 114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 104/439 (24%), Positives = 184/439 (42%), Gaps = 52/439 (12%)

Query  26   PGEQEW-GYVKV---RPTSHMFWWLYYTTADVSSYYEKPLIIWLQGGPGASSTSYGNFEE  81
            PG  +W GY  +   +   H F+W +            P+++W+ GGPG SS  +    E
Sbjct  43   PGVNQWSGYFDIPGEQSDKHYFYWAF---GPRDGNPNAPVLLWMTGGPGCSSM-FALLAE  98

Query  82   LGPLDVN-----LKPRNFTWVKDYNVLFIDNPVGTGFSYTTTLGGYTTTNAEIAHDLLEC  136
             GP  +N     +    ++W     V++ID P G GFSY      Y    AE++ D+   
Sbjct  99   NGPCLMNETTGDIYNNTYSWNNHAYVIYIDQPAGVGFSYADK-ADYDKNEAEVSEDMYNF  157

Query  137  IKGFLKQLPEFADVPTYITTESYGGKMGAEFALSWYKAQQQ-EKIKSNLKGVALGDAWIS  195
            ++ F  +  +  +   ++  ESYGG      A    +  ++ E I   L G+A+G+    
Sbjct  158  LQAFFGEHEDLRENDFFVVGESYGGHFAPATAYRINQGNKKGEGIYIPLAGLAVGNGLTD  217

Query  196  PIDSVMT-------WAPFLLATGMVDTDGYEKINKAALRTKEAVDSKRWTNATKLWSYTE  248
            P     +       W   +L    +  + Y+ +N      +  + +    N++   SY E
Sbjct  218  PYTQYASYPRLAWDWCKEVLGYSCISRETYDSMNSMVPACQSNISACDADNSSSADSYCE  277

Query  249  GVIDEVTNNI-DFYNILTKIEPDTNQLTPMQRLVSEPTFAQEYSVFSQESLSKLMNGP-V  306
                  +  + DF  +LT I      +  +++    P        ++   +   MN   V
Sbjct  278  MAGAACSGFVSDF--LLTGI-----NVYDIRKTCDGPL------CYNTTGIDNFMNREDV  324

Query  307  KESLNLP----SNHGTQSNLVFSKLGGDFMKPVIHIVESLLNETKLKVVVISGHMDLIVD  362
            + SL +          + NL+F     D+ K   + +  LL E  ++V++ +G MD I +
Sbjct  325  QRSLGVDPMTWQACNMEVNLMFDI---DWFKNFNYTISGLL-EDGVRVMIYAGDMDFICN  380

Query  363  TPGTLRWVEKMQWKDANSWHRSDRAPL-VVENIIEGYVKSYG------NFSMYWVNRAGH  415
              G   W   +QW  +  + ++   P   ++    G V+S        +FS   V RAGH
Sbjct  381  WIGNKEWTLALQWSGSEEFVKAPDTPFSSIDGSAAGLVRSVSSNTSSMHFSFVQVYRAGH  440

Query  416  MVPKDNPAAMAWILKEFTK  434
            MVP D PAA + I+++F +
Sbjct  441  MVPMDQPAAASTIIEKFMR  459


>Q38CD5_TRYB2 unnamed protein product
Length=466

 Score = 112 bits (281),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 111/452 (25%), Positives = 190/452 (42%), Gaps = 54/452 (12%)

Query  16   SEALAKKGFG-----PGEQEW-GYVKV---RPTSHMFWWLYYTTADVSSYYEKPLIIWLQ  66
            S AL   G G     PG  +W GY  +   +   H F+W +            P+++W+ 
Sbjct  31   SLALRTTGSGWEPCDPGVNQWSGYFDIPGEQSDKHYFYWAF---GPRDGNPNAPVLLWMT  87

Query  67   GGPGASSTSYGNFEELGPLDVN-----LKPRNFTWVKDYNVLFIDNPVGTGFSYTTTLGG  121
            GGPG SS  +    E GP  +N     +    ++W     V++ID P G GFSY      
Sbjct  88   GGPGCSSM-FALLAENGPCLMNETTGDIYNNTYSWNNHAYVIYIDQPAGVGFSYADK-AD  145

Query  122  YTTTNAEIAHDLLECIKGFLKQLPEFADVPTYITTESYGGKMGAEFALSWYKAQQQ-EKI  180
            Y    AE++ D+   ++ F  +  +  +   ++  ESYGG      A    +  ++ E I
Sbjct  146  YDKNEAEVSEDMYNFLQAFFGEHEDLRENDFFVVGESYGGHFAPATAYRINQGNKKGEGI  205

Query  181  KSNLKGVALGDAWISPIDSVMT-------WAPFLLATGMVDTDGYEKINKAALRTKEAVD  233
               L G+A+G+    P     +       W   +L +  V  + Y+ +N      ++ ++
Sbjct  206  YIPLAGLAVGNGLTDPYTQYASYPRLAWDWCKEVLGSPCVSRETYDSMNSMVPACQKVIN  265

Query  234  SKR--WTNATKLWSYTEGVIDEVTNNIDFYNILTKIEPDTNQLTPMQRLVSEPTFAQEYS  291
            +     +++  L   +    D VTN       LTKI       T   R     T   ++ 
Sbjct  266  ACNAGASSSQYLCKLSRVTCDPVTNLF----TLTKIS------TYDIRRKCNATLCYKF-  314

Query  292  VFSQESLSKLMNGP-VKESLNLPSNHGTQSNLVFSKLGG-DFMKPVIHIVESLLNETKLK  349
                +++   MN   V++SL +            SK+   D+ K   + +  LL E  ++
Sbjct  315  ----DAIPAFMNRENVQKSLGVRPTVWKSCVFDASKMFNIDWSKNFNYTISGLL-EDGVR  369

Query  350  VVVISGHMDLIVDTPGTLRWVEKMQWKDANSWHRSDRAPL-VVENIIEGYVKSYG-----  403
            V++ +G MD I +  G   W   +QW  +  + ++   P   ++    G V+S       
Sbjct  370  VMIYAGDMDFICNWIGNKEWTLALQWSGSEEFVKAPDTPFSSIDGSAAGLVRSVSSNTSS  429

Query  404  -NFSMYWVNRAGHMVPKDNPAAMAWILKEFTK  434
             +FS   V RAGHMVP D PAA + I+++F +
Sbjct  430  MHFSFVQVYRAGHMVPMDQPAAASTIIEKFMR  461



Lambda      K        H
   0.315    0.131    0.361 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 566763464


Query= XP_050573047.1 flotillin-1 [Bombus affinis]

Length=426
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

FLOT1_DROME  unnamed protein product                                  714     0.0   
FLOT2_DROME  unnamed protein product                                  376     1e-127
H2FLJ1_CAEEL  unnamed protein product                                 35.4    0.065 


>FLOT1_DROME unnamed protein product
Length=426

 Score = 714 bits (1843),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/426 (85%), Positives = 402/426 (94%), Gaps = 0/426 (0%)

Query  1    MSCGFVTCGPNEALVVSGCCYSKPLLVPGGRVFVWPIVQQVQKISLNTMTLQVESPTVYT  60
            M+ GFVTCGPNEALVVSGCCY KPLLVPGGR FVWP+ QQVQ+ISLNTMTLQVESP VYT
Sbjct  1    MTWGFVTCGPNEALVVSGCCYMKPLLVPGGRAFVWPVGQQVQRISLNTMTLQVESPCVYT  60

Query  61   CQGVPISVTGIAQVKIQGQNEEMLSTACEQFLGKTEEEIHNIALVTLEGHQRAIMGSMTV  120
             QGVPISVTGIAQVK+QGQNE+ML TACEQFLGK+E EI++IALVTLEGHQRAIMGSMTV
Sbjct  61   SQGVPISVTGIAQVKVQGQNEDMLLTACEQFLGKSEAEINHIALVTLEGHQRAIMGSMTV  120

Query  121  EEIYKDRKKFSKEVFEVASSDLVNMGITVVSYTLKDIRDEEGYLKALGMARTAEVKRDAR  180
            EEIYKDRKKFSK+VFEVASSDL NMGITVVSYT+KD+RDEEGYL++LGMARTAEVKRDAR
Sbjct  121  EEIYKDRKKFSKQVFEVASSDLANMGITVVSYTIKDLRDEEGYLRSLGMARTAEVKRDAR  180

Query  181  IGEAEARRDAQIREAIAEEQRMAARFLNDTEIAKAQRDFELKKAAYDVEVQTKKAEAEMA  240
            IGEAEAR +A I+EAIAEEQRMAARFLNDT+IAKAQRDFELKKAAYDVEVQTKKAEAEMA
Sbjct  181  IGEAEARAEAHIKEAIAEEQRMAARFLNDTDIAKAQRDFELKKAAYDVEVQTKKAEAEMA  240

Query  241  FELQAAKTKQRIMEEQMQIKVVERGQEIAVQEQEMMRRERELDATVRRPADAEKYRLEKM  300
            +ELQAAKTKQRI EEQMQ+KV+ER QEIAVQEQE+MRREREL+AT+RRPA+AEK+R+EK+
Sbjct  241  YELQAAKTKQRIKEEQMQVKVIERTQEIAVQEQEIMRRERELEATIRRPAEAEKFRMEKL  300

Query  301  AEANKLRLIMEAEAEAKAIKIRGEAEAFAIDAKAKAEAEQMAMKAAAWNEYKSAAMIDMM  360
            AEANK R++MEAEAEA++I+IRGEAEAFAI AKAKAEAEQMAMKA A+ EY+ AAM++M+
Sbjct  301  AEANKQRVVMEAEAEAESIRIRGEAEAFAIAAKAKAEAEQMAMKAEAYREYREAAMVEML  360

Query  361  LDTLPKVAAEVAAPLSQAKKITMVSSGSGTIGAEKLTEEVFNIVTRVPDLVKNLTGVDIA  420
            LDTLPKVAAEVAAPLSQAKKITMVSSG+G IGA KLT EV +IV +VP+LVKN+TGVDIA
Sbjct  361  LDTLPKVAAEVAAPLSQAKKITMVSSGTGDIGAAKLTGEVLSIVNKVPELVKNITGVDIA  420

Query  421  KSVHAA  426
            +SVHA 
Sbjct  421  RSVHAG  426


>FLOT2_DROME unnamed protein product
Length=438

 Score = 376 bits (965),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 203/429 (47%), Positives = 293/429 (68%), Gaps = 20/429 (5%)

Query  7    TCGPNEALVVSG-CCYS-KPLLVPGGRVFVWPIVQQVQKISLNTMTLQVESPTVYTCQGV  64
            T GPNEAL+VSG CC S K   + GG  + W +V  VQ++SLN MTL      V T QGV
Sbjct  6    TTGPNEALIVSGGCCGSTKKRTIVGGWAWAWWLVTDVQRLSLNVMTLNPMCENVETSQGV  65

Query  65   PISVTGIAQVKI------------QGQNEEMLSTACEQFLGKTEEEIHNIALVTLEGHQR  112
            P++VTG+AQ KI              + +E+L TA EQFLGK+ +EI    L TLEGH R
Sbjct  66   PLTVTGVAQCKIMKSSSYKQTDYHNDEADELLGTASEQFLGKSVKEIKQTILQTLEGHLR  125

Query  113  AIMGSMTVEEIYKDRKKFSKEVFEVASSDLVNMGITVVSYTLKDIRDEEGYLKALGMART  172
            AI+G++TVEE+YKDR +F+  V EVA+ D+  MGI ++S+T+KD+ D+  YL +LG A+T
Sbjct  126  AILGTLTVEEVYKDRDQFAALVREVAAPDVGRMGIEILSFTIKDVYDDVQYLASLGKAQT  185

Query  173  AEVKRDARIGEAEARRDAQIREAIAEEQRMAARFLNDTEIAKAQRDFELKKAAYDVEVQT  232
            A VKRDA  G AEA RDA IREA  E+  M  ++  DT+I    R ++L+KA +D E+ T
Sbjct  186  AVVKRDADAGVAEANRDAGIREAECEKSAMDVKYSTDTKIEDNTRMYKLQKANFDQEINT  245

Query  233  KKAEAEMAFELQAAKTKQRIMEEQMQIKVVERGQEIAVQEQEMMRRERELDATVRRPADA  292
             KAE+++A+ELQAAK +QRI  E++QI+VVER ++I ++ QE+ R++REL  TV+ PA+A
Sbjct  246  AKAESQLAYELQAAKIRQRIRNEEIQIEVVERRKQIEIESQEVQRKDRELTGTVKLPAEA  305

Query  293  EKYRLEKMAEANKLRLIMEAEAEAKAIKIRGEAEAFAIDAKAKAEAEQMAMKAAAWNEYK  352
            E +RL+ +A+A + + I  A AEA+ I+  G AEA AI+   KAEAE+M MKA  + +Y 
Sbjct  306  EAFRLQTLAQAKQCQTIEGARAEAERIRKIGSAEAHAIELVGKAEAERMRMKAHVYKQYG  365

Query  353  SAAMIDMMLDTLPKVAAEVAAPLSQAKKITMVSSGSGTIGAEKLTEEVFNIVTRVPDLVK  412
             AA+++++L++LPK+AAEVAAPL++  +I ++       G + +T +V  +V ++P  + 
Sbjct  366  DAAIMNIVLESLPKIAAEVAAPLAKTDEIVLIG------GNDNITNDVTRLVAQLPPSIN  419

Query  413  NLTGVDIAK  421
             LTGVD++K
Sbjct  420  ALTGVDLSK  428


>H2FLJ1_CAEEL unnamed protein product
Length=324

 Score = 35.4 bits (80),  Expect = 0.065, Method: Compositional matrix adjust.
 Identities = 38/185 (21%), Positives = 84/185 (45%), Gaps = 12/185 (6%)

Query  12   EALVVSGCCYSKPLLVPGGRVFVWPIVQQVQKI-SLNTMTLQVESPTVYTCQGVPISVTG  70
            EA VV        +L PG   F+ PI+ +++ + +L  + +++      T   V + + G
Sbjct  45   EAWVVERMGKFYKILEPGLN-FLLPIIDKIKFVQNLREIAIEIPEQGAITIDNVQLRLDG  103

Query  71   IAQVKIQGQNEEMLSTACEQFLGKTEEEIHNIALVTLEGHQRAIMGSMTVEEIYKDRKKF  130
            +  +++    +        +F       +  +A  T+    R+ +G + ++ ++K+R+  
Sbjct  104  VLYLRVFDPYKASYGVDDPEF------AVTQLAQTTM----RSEVGKINLDTVFKERELL  153

Query  131  SKEVFEVASSDLVNMGITVVSYTLKDIRDEEGYLKALGMARTAEVKRDARIGEAEARRDA  190
            ++ +    +      GI  + Y ++D++      +A+ M   AE K+ A I E+E  R+A
Sbjct  154  NENIVFAINKASAPWGIQCMRYEIRDMQMPSKIQEAMQMQVEAERKKRAAILESEGIREA  213

Query  191  QIREA  195
             I  A
Sbjct  214  AINRA  218



Lambda      K        H
   0.315    0.131    0.361 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 566763464


Query= XP_050573048.1 GDP-mannose 4,6 dehydratase isoform X1 [Bombus
affinis]

Length=365
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GMDS_DROME  unnamed protein product                                   556     0.0   
GMD1_CAEEL  unnamed protein product                                   494     8e-176
GMD2_CAEEL  unnamed protein product                                   489     3e-174


>GMDS_DROME unnamed protein product
Length=395

 Score = 556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/332 (76%), Positives = 294/332 (89%), Gaps = 0/332 (0%)

Query  4    DGRRRVALITGITGQDGSYLAEFLLEKGYDVHGIIRRASSFNTARIQHLYADPKCHRQGR  63
            D R +VALITGITGQDGSYLAEFLL+K Y+VHGIIRRAS+FNT RI+HLYADPK H+ GR
Sbjct  43   DSRDKVALITGITGQDGSYLAEFLLKKDYEVHGIIRRASTFNTTRIEHLYADPKAHKGGR  102

Query  64   MKLHYGDMTDSSSLVKVISSVQPTEIYNLAAQSHVMVSFEVSEYTAEVDAVGTVRLLDAI  123
            MKLHYGDMTDSSSLVK+I+ V+PTEIYNLAAQSHV VSF++SEYTAEVDAVGT+R+LDAI
Sbjct  103  MKLHYGDMTDSSSLVKIINMVKPTEIYNLAAQSHVKVSFDLSEYTAEVDAVGTLRILDAI  162

Query  124  RTCGLEKSVKFYHASTSELYGRVTQVPQNEKTPFYPRSPYACAKLYSFWIVVNYREAYNM  183
            RTCG+EK+V+FY ASTSELYG+V + PQNE+TPFYPRSPYACAK+Y FWIV+NYREAYNM
Sbjct  163  RTCGMEKNVRFYQASTSELYGKVVETPQNEQTPFYPRSPYACAKMYGFWIVINYREAYNM  222

Query  184  FACNGILFNHESPRRGENFVTRKVTRSIAKIQLGLQDVLELGNLDAKRDWGHAKDYVEAM  243
            +ACNGILFNHESPRRGENFVTRK+TRS+AKI     +  ELGNLD+KRDWGHA DYVEAM
Sbjct  223  YACNGILFNHESPRRGENFVTRKITRSVAKIYHKQMEYFELGNLDSKRDWGHASDYVEAM  282

Query  244  WLMLQQPIPDDYVIATGETHSVREFVEAAFLYVGRTIKWEGEGINEIGQDAQTGQVLVKV  303
            W+MLQ+  P DYVIATGETHSVREFVEAAF ++ R I W+G+G++E+G +  TG V V++
Sbjct  283  WMMLQRESPSDYVIATGETHSVREFVEAAFKHIDREITWKGKGVDEVGVENGTGIVRVRI  342

Query  304  NPKYFRPTEVDVLLGDANKAKEKIGWKPTVTF  335
            NPKYFRPTEVD+L GDA+KA  ++ W P VTF
Sbjct  343  NPKYFRPTEVDLLQGDASKANRELNWTPKVTF  374


>GMD1_CAEEL unnamed protein product
Length=399

 Score = 494 bits (1272),  Expect = 8e-176, Method: Compositional matrix adjust.
 Identities = 227/329 (69%), Positives = 276/329 (84%), Gaps = 2/329 (1%)

Query  7    RRVALITGITGQDGSYLAEFLLEKGYDVHGIIRRASSFNTARIQHLYADPKCHR-QGRMK  65
            R+VALITGI+GQDGSYLAE LL KGY VHGIIRR+SSFNTARI+HLY++P  H       
Sbjct  50   RKVALITGISGQDGSYLAELLLSKGYKVHGIIRRSSSFNTARIEHLYSNPITHHGDSSFS  109

Query  66   LHYGDMTDSSSLVKVISSVQPTEIYNLAAQSHVMVSFEVSEYTAEVDAVGTVRLLDAIRT  125
            LHYGDMTDSS L+K+IS+++PTE+Y+LAAQSHV VSF++ EYTAEVDAVGT+RLLDAI  
Sbjct  110  LHYGDMTDSSCLIKLISTIEPTEVYHLAAQSHVKVSFDLPEYTAEVDAVGTLRLLDAIHA  169

Query  126  CGLEKSVKFYHASTSELYGRVTQVPQNEKTPFYPRSPYACAKLYSFWIVVNYREAYNMFA  185
            C L + V+FY ASTSELYG+V ++PQ+EKTPFYPRSPYA AK+Y +WIVVNYREAYNMFA
Sbjct  170  CRLTEKVRFYQASTSELYGKVQEIPQSEKTPFYPRSPYAVAKMYGYWIVVNYREAYNMFA  229

Query  186  CNGILFNHESPRRGENFVTRKVTRSIAKIQLGLQDVLELGNLDAKRDWGHAKDYVEAMWL  245
            CNGILFNHESPRRGE FVTRK+TRS+AKI LG Q+ +ELGNL A RDWGHA++YVEAMW 
Sbjct  230  CNGILFNHESPRRGETFVTRKITRSVAKISLGQQESIELGNLSALRDWGHAREYVEAMWR  289

Query  246  MLQQPIPDDYVIATGETHSVREFVEAAFLYVGRTIKWEGEGINEIGQDAQTGQVLVKVNP  305
            +LQ   PDD+VIATG+  SVREF   AF  +G  ++WEGEG+ E+G++ + G + VKV+P
Sbjct  290  ILQHDSPDDFVIATGKQFSVREFCNLAFAEIGEVLQWEGEGVEEVGKN-KDGVIRVKVSP  348

Query  306  KYFRPTEVDVLLGDANKAKEKIGWKPTVT  334
            KY+RPTEV+ LLG+A KAK+ +GW+  VT
Sbjct  349  KYYRPTEVETLLGNAEKAKKTLGWEAKVT  377


>GMD2_CAEEL unnamed protein product
Length=382

 Score = 489 bits (1260),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 228/329 (69%), Positives = 273/329 (83%), Gaps = 2/329 (1%)

Query  7    RRVALITGITGQDGSYLAEFLLEKGYDVHGIIRRASSFNTARIQHLYADPKCHR-QGRMK  65
            R+VALITGITGQDGSYLAE LL KGY VHGIIRR+SSFNTARI+HLY +P  H       
Sbjct  33   RKVALITGITGQDGSYLAELLLSKGYKVHGIIRRSSSFNTARIEHLYGNPVTHNGSASFS  92

Query  66   LHYGDMTDSSSLVKVISSVQPTEIYNLAAQSHVMVSFEVSEYTAEVDAVGTVRLLDAIRT  125
            LHYGDMTDSS L+K+IS+++PTEIY+LAAQSHV VSF++ EYTAEVDAVGT+RLLDAI  
Sbjct  93   LHYGDMTDSSCLIKLISTIEPTEIYHLAAQSHVKVSFDLPEYTAEVDAVGTLRLLDAIHA  152

Query  126  CGLEKSVKFYHASTSELYGRVTQVPQNEKTPFYPRSPYACAKLYSFWIVVNYREAYNMFA  185
            C L + V+FY ASTSELYG+V ++PQ+E TPFYPRSPYA AK+Y +WIVVNYREAY MFA
Sbjct  153  CRLTEKVRFYQASTSELYGKVQEIPQSELTPFYPRSPYAVAKMYGYWIVVNYREAYKMFA  212

Query  186  CNGILFNHESPRRGENFVTRKVTRSIAKIQLGLQDVLELGNLDAKRDWGHAKDYVEAMWL  245
            CNGILFNHESPRRGE FVTRK+TRS+AKI L  Q+ +ELGNL A RDWGHAK+YVEAMW 
Sbjct  213  CNGILFNHESPRRGETFVTRKITRSVAKISLRQQEHIELGNLSALRDWGHAKEYVEAMWR  272

Query  246  MLQQPIPDDYVIATGETHSVREFVEAAFLYVGRTIKWEGEGINEIGQDAQTGQVLVKVNP  305
            +LQQ  PDD+VIATG+  SVREF   AF  +G  + WEGEG++E+G++ Q G V VKV+P
Sbjct  273  ILQQDTPDDFVIATGKQFSVREFCNLAFAEIGEQLVWEGEGVDEVGKN-QDGVVRVKVSP  331

Query  306  KYFRPTEVDVLLGDANKAKEKIGWKPTVT  334
            KY+RPTEV+ LLG+  KA++ +GW+P +T
Sbjct  332  KYYRPTEVETLLGNPAKARKTLGWEPKIT  360



Lambda      K        H
   0.315    0.131    0.361 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 566763464


Query= XP_050573049.1 uncharacterized protein LOC126913868 [Bombus affinis]

Length=147
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9W2M4_DROME  unnamed protein product                                 109     7e-30
Q8MR08_DROME  unnamed protein product                                 109     9e-30
Q7K1R6_DROME  unnamed protein product                                 87.0    2e-21


>Q9W2M4_DROME unnamed protein product
Length=296

 Score = 109 bits (273),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 73/116 (63%), Gaps = 0/116 (0%)

Query  32   NLVVGRALHHGDMLPAKVKPEHGVAYVCHNGNEHMKHDFEILMPAEFHWIHASNGHVPPN  91
             L + RA H GD++P K+ P HGV YV   G EH   ++E+L      W+    G++PPN
Sbjct  181  QLYIARARHEGDLIPGKLHPSHGVTYVAWGGGEHGHAEYEVLCAGGGQWLPVDAGNIPPN  240

Query  92   AVESGKTVEGEMLYVGRAFQNGIPCVGKVHRTHGVLYVPYEGREIPFRDYEVLVLS  147
            A+ +G+T EGE L++GRA  +G   VGKV  +HG  Y+PY G E+ ++++E+ V +
Sbjct  241  ALPAGETAEGEPLFIGRATHDGTITVGKVQPSHGCCYIPYGGEELAYKEFEIYVTN  296


 Score = 54.7 bits (130),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 39/65 (60%), Gaps = 1/65 (2%)

Query  80   WIHASNGHVPPNAVESGKTVEGEMLYVGRAFQNGIPCVGKVHRTHGVLYVPYEGREIPFR  139
            W+ A+NG VPPNA+E G     E LY+ RA   G    GK+H +HGV YV + G E    
Sbjct  159  WVPAANGEVPPNALEGGFD-SSEQLYIARARHEGDLIPGKLHPSHGVTYVAWGGGEHGHA  217

Query  140  DYEVL  144
            +YEVL
Sbjct  218  EYEVL  222


 Score = 43.9 bits (102),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 30/56 (54%), Gaps = 0/56 (0%)

Query  19   PGMICVGKDLDGLNLVVGRALHHGDMLPAKVKPEHGVAYVCHNGNEHMKHDFEILM  74
            P  +  G+  +G  L +GRA H G +   KV+P HG  Y+ + G E    +FEI +
Sbjct  239  PNALPAGETAEGEPLFIGRATHDGTITVGKVQPSHGCCYIPYGGEELAYKEFEIYV  294


>Q8MR08_DROME unnamed protein product
Length=308

 Score = 109 bits (273),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 73/116 (63%), Gaps = 0/116 (0%)

Query  32   NLVVGRALHHGDMLPAKVKPEHGVAYVCHNGNEHMKHDFEILMPAEFHWIHASNGHVPPN  91
             L + RA H GD++P K+ P HGV YV   G EH   ++E+L      W+    G++PPN
Sbjct  193  QLYIARARHEGDLIPGKLHPSHGVTYVAWGGGEHGHAEYEVLCAGGGQWLPVDAGNIPPN  252

Query  92   AVESGKTVEGEMLYVGRAFQNGIPCVGKVHRTHGVLYVPYEGREIPFRDYEVLVLS  147
            A+ +G+T EGE L++GRA  +G   VGKV  +HG  Y+PY G E+ ++++E+ V +
Sbjct  253  ALPAGETAEGEPLFIGRATHDGTITVGKVQPSHGCCYIPYGGEELAYKEFEIYVTN  308


 Score = 54.7 bits (130),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 39/65 (60%), Gaps = 1/65 (2%)

Query  80   WIHASNGHVPPNAVESGKTVEGEMLYVGRAFQNGIPCVGKVHRTHGVLYVPYEGREIPFR  139
            W+ A+NG VPPNA+E G     E LY+ RA   G    GK+H +HGV YV + G E    
Sbjct  171  WVPAANGEVPPNALEGGFD-SSEQLYIARARHEGDLIPGKLHPSHGVTYVAWGGGEHGHA  229

Query  140  DYEVL  144
            +YEVL
Sbjct  230  EYEVL  234


 Score = 43.9 bits (102),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 30/56 (54%), Gaps = 0/56 (0%)

Query  19   PGMICVGKDLDGLNLVVGRALHHGDMLPAKVKPEHGVAYVCHNGNEHMKHDFEILM  74
            P  +  G+  +G  L +GRA H G +   KV+P HG  Y+ + G E    +FEI +
Sbjct  251  PNALPAGETAEGEPLFIGRATHDGTITVGKVQPSHGCCYIPYGGEELAYKEFEIYV  306


>Q7K1R6_DROME unnamed protein product
Length=263

 Score = 87.0 bits (214),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/151 (34%), Positives = 79/151 (52%), Gaps = 10/151 (7%)

Query  7    KWVRFTGARYFVP-------GMICVGKDLDGLNLVVGRALHHGDMLPAKVKPEHGVAYVC  59
             WV     R  +P       G +  G + DGL   V R  +H D+LPA   PE   A+  
Sbjct  106  DWVPIDLDRDSLPDAHLPPEGAVQCGTNEDGLPTYVARGYYHDDLLPAPYVPEKKAAFGS  165

Query  60   HNGNEH-MKHDFEILM--PAEFHWIHASNGHVPPNAVESGKTVEGEMLYVGRAFQNGIPC  116
            H+ +   +  D EIL+    ++ W+   +G  P +A+ +G +  GE+ Y GR    GI  
Sbjct  166  HSCSARTLTDDVEILVLNDCDYKWVPGQHGTYPRDALNTGYSELGEVTYTGRGLYQGILR  225

Query  117  VGKVHRTHGVLYVPYEGREIPFRDYEVLVLS  147
            +GKVH +H V+Y+P+ G+E+    YEVLV++
Sbjct  226  LGKVHPSHKVMYIPHHGQEVSVNTYEVLVVT  256



Lambda      K        H
   0.315    0.131    0.361 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 566763464


Query= XP_050573050.1 tRNA-uridine aminocarboxypropyltransferase 1 [Bombus
affinis]

Length=300
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q38CZ6_TRYB2  unnamed protein product                                 123     3e-33
CADN_DROME  unnamed protein product                                   30.0    3.0  
Q387E1_TRYB2  unnamed protein product                                 29.6    4.3  


>Q38CZ6_TRYB2 unnamed protein product
Length=280

 Score = 123 bits (309),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/223 (32%), Positives = 117/223 (52%), Gaps = 28/223 (13%)

Query  47   RKICERCNKSRKFFCYSCYLPVISKEYFPTIKLPIKIDIIKHAREIDGKSTAIHAAILAP  106
            R++C +C + R+++CY C + V  +   P +KLP+ + +I H  E  GKST++ A+ ++P
Sbjct  41   RRLCPKCGRRRQYYCYDCLIVVHPESQPPPLKLPLNVYVILHPGETRGKSTSLAASTISP  100

Query  107  EDVRIFTYPNFPEILNKEETVLIFPSPTGIPVDSLFIKKVEEDNKIITNIIKNAFPIKKA  166
             D+ I  YP+ P  L  + T+L++PS     ++SL                +N    K  
Sbjct  101  -DLHIIDYPHVPTDLEPKATLLLYPSTDSTELESL----------------ENLDSCKNV  143

Query  167  IFIDSTWHQTQAIYKDQRLRDLHCVILKSRISQFWRHQKKSPRWYLATIEAIHQFLVEL-  225
            +FID TW Q++A+ +D+RL     V +K++ S FWR Q   P  YLAT+EAI+ FL E  
Sbjct  144  VFIDGTWQQSKAMARDERLSKFRHVRIKAQTSLFWRFQNNDPT-YLATVEAIYYFLREFI  202

Query  226  ---HTCAFGAIQGYANIKHTEENSTNNIVYQNVNELPEIDQRY  265
               +    G    Y N         ++I+Y  +N+   + QRY
Sbjct  203  SQNNKRRAGCQPPYYN------GDVDDILYYYINQYIAVQQRY  239


>CADN_DROME unnamed protein product
Length=3097

 Score = 30.0 bits (66),  Expect = 3.0, Method: Composition-based stats.
 Identities = 13/28 (46%), Positives = 17/28 (61%), Gaps = 0/28 (0%)

Query  252   YQNVNELPEIDQRYRGQYDDLLYFFKYM  279
             Y NVN   ++   YR Q+D  LYF+ YM
Sbjct  2523  YLNVNAPLQVGGLYREQFDQSLYFWHYM  2550


>Q387E1_TRYB2 unnamed protein product
Length=5795

 Score = 29.6 bits (65),  Expect = 4.3, Method: Composition-based stats.
 Identities = 27/91 (30%), Positives = 45/91 (49%), Gaps = 11/91 (12%)

Query  74    FPTIKLPIKIDIIKHAREIDGKSTAIHAAILAPEDVRIFTYPNF-----PEILNK-EETV  127
             FP  +LP+  D + H+ E++     +    LA ++ RI    N       E+++K +E +
Sbjct  1403  FPVAQLPLDEDDVFHSLEVERLQLRLRQDSLASKE-RIAELENMMNCRTTELIDKMKEEI  1461

Query  128   LIF--PSPTGIPVDSLFIKKVEEDNKIITNI  156
               F  P+P GIP++ L  K  E DN +   I
Sbjct  1462  RKFLDPTPLGIPLEEL--KLDEHDNYVAKEI  1490



Lambda      K        H
   0.315    0.131    0.361 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 566763464


Query= XP_050573051.1 nucleoprotein TPR [Bombus affinis]

Length=2380
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TPR_DROME  unnamed protein product                                    786     0.0  
Q382P4_TRYB2  unnamed protein product                                 35.4    0.68 
M9PEK6_DROME  unnamed protein product                                 33.9    2.3  


>TPR_DROME unnamed protein product
Length=2346

 Score = 786 bits (2029),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 770/2528 (30%), Positives = 1236/2528 (49%), Gaps = 395/2528 (16%)

Query  11    VLGEVLTEEELTQVPDALAKKLNAYFNEKFEQYITAKAVFETNRKNFDQTLDKLQKDLTE  70
              L  +L  +EL  VP+ + KKL+ Y N   ++Y   +A    NR             L E
Sbjct  8     TLNNILQPDELKLVPEDVQKKLSEYINNFSDEYCKNRAA--ANR-------------LAE  52

Query  71    EKSDSEECKGKLE-LAEKYTT------ELQTSLDQTKGEIQKLQETVKRLEKENGDLRRH  123
              +   EE + K+E    K+T+      EL+T LDQ   E   L +T+ + E+    LR+ 
Sbjct  53    AEQKKEELENKMEDYLVKFTSFELNVNELRTHLDQMSSERVNLMDTIAKGEQTISQLRKE  112

Query  124   RDTVVDERDALQLQVERRDREIERMHTELSSLGTQLRNAIAAKCQALAETEEIRSLDMTL  183
             + +VV+ERD++   +ER+  E+ER+  +L +   QL +AIAAKC+A+A  +EI+S ++ L
Sbjct  113   KASVVEERDSMMKVIERQQAELERLKQDLHTYQQQLSSAIAAKCEAIARVDEIQSKEVAL  172

Query  184   EFKEKRLEQERTLLSQQMASLEEELAKRISELQSTRAEASARALLTDTRLAQRDEELRIA  243
             E KE R+E ER +L +++  +  +L K  +ELQ+ R E +   +   + L ++ E L++ 
Sbjct  173   ELKENRMESERDMLHKEILLISGDLNKSNAELQNIRREHTINTMQLQSCLKEKTESLKL-  231

Query  244   NEATAQLRELYTSLQRRCDELSQKLEEQRTHEIAMHASYREEIG-------AQTRLADLY  296
                   ++E Y    +   EL+ K+E Q       + +  E +G       A+ +L +++
Sbjct  232   ------MQEQYEQAVKTIGELTSKIEMQNDTAFKQNQATEEYVGKLKKELDAKEKLFEIF  285

Query  297   KGMADEANAKAEEFSNAVKELQELLEHATEQYGTLETTHNQLQLQHKQELVEKEQKIDEL  356
             K    +   + EE    + E++ LLE A EQ   L      ++ +H  EL E+ +KI  +
Sbjct  286   KSTESDHLIQREELLQGISEIKRLLEEAEEQCAQLTEQMETMKQKHSAELDEQNKKIQAM  345

Query  357   LKELNHANELLKNIKQERLDQAVEQLAPTAAIASRVLRKGLSLTQIYTQLVDVTNELTSE  416
              +EL  AN+LLK  ++  L+ A+ QLAP+AA+ASR++R  LSLT++Y+     + EL   
Sbjct  346   EQELASANDLLKQARESNLESAICQLAPSAAVASRLIRSDLSLTELYSMYAKSSEELEMR  405

Query  417   REENGRLKSQMDIILRELEEKAPVLQQQREDYETAMANIGTLTSRLDELLVENHRLQETS  476
               E  +LK Q+  I+ E+ E AP+L++Q  DY+        L    DELL     L+   
Sbjct  406   NCEIEQLKLQLKSIIAEISESAPILEKQNSDYQKMKETNSELLREHDELLQNKLCLEREL  465

Query  477   DEANRIAKHHTKENQRLKTEVSDLARQVCFLLKEVQESRISAAVDTSEFSMDMDNLASSE  536
             + A     H+  EN++LK   +DL+RQVC LL E+  + I A V             S  
Sbjct  466   ERALSTLNHNQNENKKLKQTHTDLSRQVCMLLDEL--NCIRAGVKHVRIQPTRQLPTSES  523

Query  537   IISKKLVTFKDIEELQENNQKLLSIVRTLSSRQEEIERATDEI---NSGEMKEKLDRYLE  593
             +IS  LVTF  IEEL + N  LL++ R L+   E  E+  D++    S     KLD    
Sbjct  524   LISDNLVTFSSIEELVDRNTYLLNMSRELTELLEASEKNQDKMLLEQSKNHIRKLDARFA  583

Query  594   QLEDMQAAQDRQTKMLEGLLRQRDMYKNMY---QQCLKQGNVTEKKELSMTQEEEEGREI  650
             +LED+     ++   +  LL + D YK +Y   Q+ L Q  V                + 
Sbjct  584   ELEDLLT---QKNNTVTTLLSKCDRYKKLYFAAQKKLGQNTV--------------DLDD  626

Query  651   NGVKPVKDEVATITQDDVN---------REKELQKQLTETETKLKQITDDYETYKKERAA  701
             + ++P    + T  Q   N         R ++L++QL     K   + ++Y+ Y  E+  
Sbjct  627   SNLEPNDSALDTSEQPAANFEESRKLEKRVRQLEQQLEGEVKKYASLKENYDYYTSEKRK  686

Query  702   HERMLGEEVERLRKEAEAHSDRCCRLKAQLDSANDRFNLLQPNVASYKSQIKVLEEKCLN  761
             ++ +  E+ + +RKE    +   C+L    +   ++  LL  N+ +YK Q+  LEE+  N
Sbjct  687   NDALAQEQFDSMRKEVRELTSSNCKLMNTTEFQKEQIELLHKNIGTYKQQVTTLEERTKN  746

Query  762   YNVTIGKHEQSLMILKDEALAAQTRLSRAEVQLENLRRSLSILSDSESRLMKERETYQRE  821
             Y  TI KHEQ++ +LKDE +AA  + + A+ + ++LR+   IL D+ SRL  E+ETY RE
Sbjct  747   YEKTIIKHEQTVHLLKDEMMAAHRKHAAADAEAQSLRQENRILRDTSSRLQIEKETYHRE  806

Query  822   RQTQALLRADVESIKASLERVQAEGQLRAEQRLDDATRECAALRRRLQEEQDRFRELSAH  881
             +Q+Q+LL   +E IK +LER + EG+ R EQRLDD  RE AA RR  QEE+++FRE    
Sbjct  807   QQSQSLLLNSLEFIKTNLERSEMEGRQRLEQRLDDTVRELAAQRRHFQEEEEKFRESINE  866

Query  882   LERQLTTAQERLTEERNVTEQIRIELEQVRQSDSQNAQRIEELNTKLRQAATHSIS-KPF  940
              +RQ  TA +   EE+ + ++ + EL  VR+  ++   ++ EL+ KL++  T +++  P 
Sbjct  867   FKRQAETAIKLKDEEKQLADKWQAELTSVREELAEKVNKVNELSKKLQEVLTPTLNDNPI  926

Query  941   TGDEYPVKRLKELEMQLATIQAEAKSLSEQLKSSRQQSQQYCDIAESAEAQLREVTVQHN  1000
             T      KR +E E++L     E +SL+++L  +R+  +Q+  +++SAE++++ +   H 
Sbjct  927   TAAN---KRAREFELKLDQATVEIESLTKELAKTREHGEQFYKMSQSAESEIKRLHELHG  983

Query  1001  KCKEELETALKEARVEIISLQKKVQELVEELAKVSNGQQETDS-----ELREKLADAERK  1055
             +   + E  +K+ R     L+ ++ +L  E A +SN  +++ +     +L+    D +  
Sbjct  984   ELVAKQEEEIKKLRSSEAELKTRISDLEAE-AMLSNVTEQSKTVNQSGQLKSAQDDLKSL  1042

Query  1056  LEELDEVKGELEIVKGDLHNASVSVKEAEEKYAREMVLHSTDLQILAKLKEDAQTVEQKI  1115
             LE+L E    +  ++ +  +   S+  AE KYA  M+ HS D+Q L + K +      ++
Sbjct  1043  LEKLTEANCTIRTLRSENTSLVESLNAAEVKYANGMIQHSADIQELTRYKAEFFKANDEL  1102

Query  1116  ASLTQEKNAATEALNLEREACQEREKRLHEEIQEMQQRISDLDAQNAILHTQIQELSDKT  1175
               L   + +   A +    +  E +K L +E +E ++R++DL A N+ LH QI+ L+ K 
Sbjct  1103  NQLKSGRESLQAAYDELLRSNAEAQKLLDKEREESEKRVADLHALNSNLHDQIEALASKL  1162

Query  1176  AIMHSQQSKIAEQGSPDTSL--------EAMNRSFSGLEDDSKSAEQLLRVMKYLRREKD  1227
             A++ SQ        +P++SL        +++N S     ++ ++ EQLL+++K+LR+EKD
Sbjct  1163  AVLASQSQ------NPNSSLNESAMDGDQSLNASGLTAAEEGRNNEQLLKIIKFLRKEKD  1216

Query  1228  LAVAKFDVLRAENLRLKSQVEVMEKRLKETEAALNSEREKSEIDVVTTSKHAELLRKVET  1287
             L  AK D+L+AEN RL S+  + +K++ E    LN ER KS+ DVV+ +KH E+LRK+ET
Sbjct  1217  LFAAKLDILKAENARLISEHAIQQKKVDELNGYLNQERAKSQTDVVSANKHEEVLRKIET  1276

Query  1288  LNAITDSNRILREERDSLSAKVSELTAKVAALSEEVVPLRATSRDLQAKTEALLQENTSL  1347
             LNAITDSNRILREER++L+ +V+ELT +++++ +E+ PL+ ++++L +K E +  ENTSL
Sbjct  1277  LNAITDSNRILREERNALTLRVAELTDRISSVEKELFPLQCSNKELTSKIEEINVENTSL  1336

Query  1348  KGEATRWRQRANILVERANKTSPEDWRRLQTERENLSKLLTSERETHAKRAEELNQLK--  1405
             + EA +WRQRAN LVE++N+ +PE+++RLQ ERE+L+KLLT+E+E + K+++EL  LK  
Sbjct  1337  RTEAIKWRQRANALVEKSNR-NPEEFKRLQAEREHLAKLLTAEKELNKKQSDELTVLKQR  1395

Query  1406  --TEKGVLEEQLSILQKQVQTQGEEIQKASEEARKLGQDLNEALADSSLKAKDLVTLRKE  1463
               TE  +L +Q+ IL +  + Q +E     +   +  QD+ E       K ++L+   +E
Sbjct  1396  MNTEIPMLNKQMQILDEARKKQVDEFTNLKQNNTRQTQDIMELKNRLLQKEEELLKANEE  1455

Query  1464  LGDKEVVLNDIKNKEIQIRKIAKKYKTQFEELAKTVEEEKSKSEESRMSAGTSGNEDVGR  1523
             L  K+  + D + KE+Q+RK+AK+YK  +  L                S G  G E    
Sbjct  1456  LETKDKTIADKETKELQLRKLAKRYKDFYIGL---------------QSQG-GGTESAAE  1499

Query  1524  VSQEREDQLREEGRQELRQANLELTSKLDELSRQMIVVQNEAESLKKEIDTMNRTRVEKE  1583
             + + R                    S+L+E++ Q+  +++E E + KE D + + R E E
Sbjct  1500  LEKVR--------------------SELEEVNNQLRALKDEHEKITKECDEVKK-RTEPE  1538

Query  1584  ERVRRALTTARTELMRLRESKKICEKELIDLKAKVEAGATESDTAEHDARLVALKSQMES  1643
                        T  +R +E K   +K ++DL          +D    +      KS  + 
Sbjct  1539  ---------TDTSAIR-QEYKAKLDKLVVDLT------VARTDLVNQETTFAGTKSSYDE  1582

Query  1644  RISRLEHEKSE-----------IQAEKETLVQRVTQLQRQ-------------VAGVSGI  1679
              I+RLE E  E           +  E E+L  R+ QL RQ             VA    I
Sbjct  1583  TIARLEKELQENIAANKDINQRLTRENESLHMRINQLTRQLGSQQSTKPSTSSVAEKGNI  1642

Query  1680  SATTEPPTANIKPMSARA--------------ETPLASIRPMSVVVQSRTAAVLPTTASA  1725
             S ++ P TAN+KPMS  A              ETPLASIRP+S V  SRTAA+LPT+   
Sbjct  1643  SESS-PRTANVKPMSGSATVQQSATVTPWRGGETPLASIRPIS-VQNSRTAAILPTSQQP  1700

Query  1726  PVMVAPHQQQQ-------------------------PQQQVVHTTETSS--------PTS  1752
             P   +                               P QQ VHTT +++        PTS
Sbjct  1701  PAGSSTSTSSSSSSSSTSTTSAAGGGSSAVAQTALVPPQQQVHTTGSAALESMASSSPTS  1760

Query  1753  SLPDFQPASTSSSSSQTAPNTLRQLVVQPQ-LSESAESTQREDPESAETLSVQQQQCQQQ  1811
             S  D+ P+++S+S +  A        + P   S +AES+Q    E+      QQ   Q  
Sbjct  1761  SHTDYMPSTSSASVAVAA--------IPPMGASSAAESSQ----EAESIQHPQQNDSQLF  1808

Query  1812  QQQQQQQTVALVSPRVEQQQQQQQA---------AVSDQQQTVA----------------  1846
                 QQQ VALVSPRVE       +         ++ D                      
Sbjct  1809  VGGAQQQVVALVSPRVEGSSSSSSSTSVPTATAPSIQDGGSQSQQPSTSGSSSSSSTVVS  1868

Query  1847  -----SSSTQSVSTSQA---STGHKRPRALDSTASGSGIVEGVDHSRQEQVLSPKSKRSR  1898
                  + S+ +V+T+QA   S G KRPR ++  +S +G  EGV      + +S  +KR R
Sbjct  1869  SHSRHTPSSSNVTTTQAGCSSQGIKRPRDIEGDSS-TGTEEGV-----AEKMSKITKRLR  1922

Query  1899  QEMSST------ASASASEVEYQVPTSSQRDQDEEV-------EEGCVVVVDCDEG--EG  1943
               M S          S  +V+ Q+PTSSQRDQ++++       EE   V+ D D+G  +G
Sbjct  1923  GPMHSGELSAGHIGDSGMDVD-QMPTSSQRDQEDDIQVVDSDDEED--VLADADDGPIDG  1979

Query  1944  GGNHQTQEEEEFDNDPYEEMEEEEEIPYEVEVEVE-RDNNEVEIIMGEDSTSVEVPRQAQ  2002
             G   Q   E+ ++ D   EM++ E    + ++ V+ +DNNEV+I         EVP Q  
Sbjct  1980  GEAEQEGYEDSYEQD--NEMDDNEGGDDDNDIAVDAQDNNEVDI---------EVPEQ-H  2027

Query  2003  VTVPTNQQQQQSEAISSAEP-TGEPPTSFGTRSSRGIAPMPRQQQQQHLLLPQQGYEDGG  2061
             +      Q   ++AI++A   T E   S    S  G +  P       + LPQ    +  
Sbjct  2028  MQAQEESQSLDNQAIATASASTQENNQSQAITSGSGESSNP-------VTLPQA---EAS  2077

Query  2062  DDSIVPSTPTLFVPRRGDGFGEAVSSPQVPQGRFTFGDSSAPTTASSTPSLSTPSGSATR  2121
             +     ++ +    RR +   E VSSPQV      F +  A   ++     +  +G A  
Sbjct  2078  NWKQAAASTSTAAARRNESSVEIVSSPQVS----NFCEQPARLESAEVDGTAEVAGGAPH  2133

Query  2122  TIFGSSSSGVA-----QVIQESMDDTRMDLAQLEDGGTGRSVPTTPLQVSPAADLPPSTS  2176
                G S +G A     Q   E+ + +  D  +  D G   +  T   + +  A    + +
Sbjct  2134  ESAGPSDTGAASASSPQKQSEAGESSGSDALKAADDGGDHADGTDNAREADEAFAEETMA  2193

Query  2177  SGPTEEQETPVSVTPVSVTGTTDVSEEPTIPSIRVLGVDDQQHNQTEMITESISTTPTE-  2235
             +G  E+ +   +  P   T  ++VS                 HNQ  +        PTE 
Sbjct  2194  TGQGEDSQPLGNDNPNVGTSQSEVS-----------------HNQANL----GEGNPTED  2232

Query  2236  -----GMSSEGEKRTDETGPLISGDDDAVDTGEGTEEPVCDIVEDEVEESREAEA-SPSS  2289
                  G+SSEGEK+             AV    G E           EE REAEA SPS 
Sbjct  2233  SEGADGVSSEGEKQ-------------AV----GVE-----------EEGREAEATSPSE  2264

Query  2290  NTRQRAMAAANAAAAANGARGATARRSARSQDRFRTRGSRPTPIVWE-SQQPGGRGQNVM  2348
             NTR R +      +A    RG  A R      +     +RP  IVW+    PG   QN M
Sbjct  2265  NTRFRTL-----RSAVPTRRGHRAMRGGSPNSQ-----NRPQRIVWQRDTSPGNIQQNQM  2314

Query  2349  RGHATRGA  2356
               +  R A
Sbjct  2315  SANNNRFA  2322


>Q382P4_TRYB2 unnamed protein product
Length=1299

 Score = 35.4 bits (80),  Expect = 0.68, Method: Compositional matrix adjust.
 Identities = 84/308 (27%), Positives = 147/308 (48%), Gaps = 55/308 (18%)

Query  788   SRAEVQLENLRRSLSILSDSESRLMKERETYQRERQTQALLR---ADVESIKASLERVQA  844
             S  E +L+ LR+ LS ++DS+S L KE             LR   +DV   K+SLE+   
Sbjct  687   SSLEKELKELRKQLSDVADSKSSLEKE-------------LRKQLSDVAGSKSSLEKELK  733

Query  845   EGQLRAEQRLDDATRECAALRRRLQEEQDRFRELS---AHLERQLTTAQERLTE----ER  897
             E  LR +    D     ++L + L+E + +  +++   + LE++L   +++L++    + 
Sbjct  734   E--LRKQP--SDVADSKSSLEKELKELRKQPSDVTGSKSSLEKELKELRKQLSDVADSKS  789

Query  898   NVTEQIRIELEQVRQSDSQNAQRIEELNTKLRQAATHSISKPFTGDEYPVKRLKELEMQL  957
             ++ +++R +L  V  S S   +  +EL  +L   A         G +  ++  KEL  QL
Sbjct  790   SLEKELRKQLSDVAGSKSSLEKEPDELKKQLSDVA---------GSKSSLE--KELRKQL  838

Query  958   ATIQAEAKSLSEQLKSSRQQSQQYCDIAESAEAQLREVTVQHNKCKEELETALKEARVEI  1017
             + +     SL ++LK  R+Q         S E +LR+        K  LE  LKE R ++
Sbjct  839   SDVAGSKSSLEKELKELRKQLSDVAGSKSSLEKELRKQLSDVAGSKSSLEKELKELRKQL  898

Query  1018  -------ISLQKKVQELVEELAKVSNGQQETDSELRE------KLADAERKLE-ELDEVK  1063
                     SL+K   EL ++L+ V+  +   + EL+E       +AD++  LE EL E++
Sbjct  899   SDVADSKSSLEK---ELRKQLSDVAGSKSSLEKELKELRKQLSDVADSKSSLEKELKELR  955

Query  1064  GELEIVKG  1071
              +L  V G
Sbjct  956   KQLSDVAG  963


>M9PEK6_DROME unnamed protein product
Length=2501

 Score = 33.9 bits (76),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 49/216 (23%), Positives = 108/216 (50%), Gaps = 21/216 (10%)

Query  56    NFDQTLDKLQKDLTEEKSD-------SEECKGKLELAEKYTTELQTSLDQTKGEIQKLQE  108
             N    LDK +K+L + KS        S++ + + E A++    L+  LD+ + E+ K++ 
Sbjct  1353  NLKVELDKERKELAQVKSVIEAQTKLSDDLQRQKESAQQLVDNLKVELDKERKELAKVKS  1412

Query  109   TVKRLEKENGDLRRHRDTVVDERDALQLQVERRDREIERMHTELSSLGTQLRNAIAAKCQ  168
              ++   K + DL+R +++     D L++++++  +E+ ++    S++G Q + +   +CQ
Sbjct  1413  VIEAQTKLSDDLQRQKESAQQLVDNLKMELDKERKELAQVK---SAIGAQTKLSDDLECQ  1469

Query  169   ALAETEEIRSLDMTLEFKEKRLEQERTLLSQQMASLEEELAKRISELQSTRAEASARALL  228
                  E ++ L   L+ +   LE+ER  L++  ++ E +  K   +L+  + +A     L
Sbjct  1470  K----ESVQQLVDNLKVE---LEKERKELAKVNSAFEAQ-TKLSDDLKLQKEDAQREVFL  1521

Query  229   TDTRLAQRDEELRIANEATAQLRELYTSLQRRCDEL  264
                RL +   E  +     A L ++  +L+ RC ++
Sbjct  1522  VKERLVKEKREFEV---KLATLEDIIETLEMRCTQM  1554



Lambda      K        H
   0.315    0.131    0.361 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 566763464


Query= XP_050573052.1 supervillin isoform X1 [Bombus affinis]

Length=2294
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

VILD_DICDI  unnamed protein product                                   183     6e-46
VILB_DICDI  unnamed protein product                                   162     5e-40
GELS_DROME  unnamed protein product                                   114     6e-25


>VILD_DICDI unnamed protein product
Length=1704

 Score = 183 bits (465),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 201/817 (25%), Positives = 348/817 (43%), Gaps = 148/817 (18%)

Query  1506  SSNRLQPYKDL---------MLLLIKGRRHVQVRLVEPVAESINSGDNFVLVTKSEVYNY  1556
             S++ L  Y DL         +L+ +KG+R ++VR+V+    S+N  ++F+L     ++ +
Sbjct  1008  SADDLTRYLDLTAIKNGKQKILIQVKGKRKIRVRMVKLSTSSLNCHNSFILDAGPRIFVW  1067

Query  1557  IGKYCNVIEKARGAEIALSIQQNKDLGCQTFQVITINEDKLTCTKSQLQKFWSYLGAENE  1616
              G   + + KA+  + A  I+  +  G  T   +    D+      Q   FW  LG  N 
Sbjct  1068  AGSKTSRVNKAKALDFANRIRTKERGGKSTLIQLDQGRDE------QSFDFWEILGG-NS  1120

Query  1617  NVDVIEGGHPDEDELYETFMIDTNMVYEIKDEELVPLEKYWGT---IPKIEMLDPNKVLV  1673
             +  +     P+E +          +  ++K   L     + GT   +P  E+L+   V V
Sbjct  1121  SDPIATTPTPEEQDTESIKTTIYRVGLDVKKNSLRARLAWEGTDWKLPNKEILNTKFVYV  1180

Query  1674  FDFGSEMYIWSGKGASTDKKKLATHLATEMWQEGYDYSECTVCPISAASMIGRRTMSKID  1733
              D  +E+++W GK +S+ ++K+AT +A                               + 
Sbjct  1181  VDCVTEIFVWVGKESSSIQRKMATKVA-------------------------------LV  1209

Query  1734  LKSAKVRPKWCLLAKLTQHVETILFREKFLDWPNVSRIIRIRGTKSKENVDGTVTIEVCN  1793
             L++ K R  W  + +LT+  E  LF+EKF ++P +  I   R  + K +V  T  +E   
Sbjct  1210  LQAQKDRVDWTKITRLTEFGENNLFKEKFANYPGMLPISTTR-QEIKSHV-ATSKVE-HK  1266

Query  1794  INNLLEENTIPVDLILEGTHLGRGTGWYDDEQMKQFIVTTMG-IKVWHIDEFSHSLLDDS  1852
             I  L    T P               + D+E +    +   G +KVW I+++        
Sbjct  1267  IETLASRMTTP---------------FIDNEALFTIPIDEGGRVKVWKIEDYEKIDHPQH  1311

Query  1853  SVGQFHSADSYIVYWMYSVTVTGRELSGLPSKHSAKGRDRSVYFIWQGQNASLNEQGAAA  1912
                QF S+DSYIV + Y                    ++  V + + G+++S+NE+G +A
Sbjct  1312  LYSQFFSSDSYIVLYTYM----------------QNNKEAHVIYYYLGRDSSINEKGTSA  1355

Query  1913  LLTIELDND---QAPQIRVVQGYEPAAFLNLFSGGMIVHSGKKTNVKCDKRWRLYICRGT  1969
              LT++L+        Q RVV   E   FLNLF   M++H GK  N    K+  LY  +G 
Sbjct  1356  YLTVDLNESLVGACVQTRVVANKECKNFLNLFKTKMVIHKGKYNNYD-PKKPSLYQVKGL  1414

Query  1970  LESEVSLIEIPCSTRQLRSRGSLILLDTKNNKIYVWHGSNSLPHIKQHAVNAAAKLEKNR  2029
              + ++  +++  S+  L +    IL   +  KIY+WHG  SL   +  A++ A       
Sbjct  1415  DKIDIRAVQVEFSSSMLNTLHVSILRTPE--KIYIWHGKFSLDAEQNSALSIAENFN---  1469

Query  2030  PQETGLTSEGDIEIFEIDEGMEPEEFINAL-------GQMNKKLYVSLEKDQLQEHTPRL  2082
                   ++   IEI +  EG E  EF +A           N  +  S        + PR 
Sbjct  1470  ------STSAPIEILK--EGSESNEFWSAFESTGGRQKYFNDIMIQSSSIPTSFTYKPRF  1521

Query  2083  FHLSSISKEFKSVEMLCPHRASLPTPFPFLQEDLYQVHQPALFLLDNKNELWIWQGWWPN  2142
             F  S+ S   +  E             PF Q+DL      ++ +LD ++ +++W      
Sbjct  1522  FVCSNASGIVEVTE-----------ESPFSQDDL---DIGSVCILDVQSHIYLW------  1561

Query  2143  TGAEDQSGSKAVRWQAERRAAMTMAMQYWQ--RIHPETNKYPIYLVWAGLEPLQFINLFP  2200
                    GS+A      +RA+M + + + +  ++        + +     EP+ F + F 
Sbjct  1562  ------IGSRAT--HRTKRASMEVVLNFIETSKLGHSKEHTKVLIATPFEEPIGFKSYFR  1613

Query  2201  TWT---YRDDIAELNIEDGRNPGEVLTVESELVRLTQSTYPPAQLLQRPLPEGVDPTHLE  2257
              W    Y  +   L  +DG      + VE  L    +  Y   +LL  PLP GVD T L+
Sbjct  1614  AWCTSKYPKNKLPLVEKDG------IPVEQVLKDYLKEIYTYEELLADPLPAGVDSTKLD  1667

Query  2258  LYLSQQHFQEILGMTKEEFQELPVWKQVNLKKEIGLF  2294
              YL+ + F+++  MT+ E+ ++P WK+  +KKE+ LF
Sbjct  1668  TYLNDEDFEKVFKMTRTEWLKIPAWKREGIKKELFLF  1704


>VILB_DICDI unnamed protein product
Length=959

 Score = 162 bits (411),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 179/727 (25%), Positives = 295/727 (41%), Gaps = 160/727 (22%)

Query  1514  KDLMLLLIKGRRHVQVRLVEPVAESINSGDNFVLVTKSEVYNYIGKYCNVIEKARGAEIA  1573
             K   L  +KGRR+++V+ V+  ++S+NSGD FVL  +  +Y + G   + +EK +G ++ 
Sbjct  191   KQYKLFHLKGRRNIRVKQVDISSKSLNSGDVFVLDCEDFIYQWNGSESSRLEKGKGLDLT  250

Query  1574  LSIQQNKDLGCQTFQVITINEDKLTCTKSQLQKFWSYLGAENENVDVIEGGHPDEDELYE  1633
             + ++  K       ++I ++E+    T     +FW  LG   ++V   E G   +D  YE
Sbjct  251   IRLRDEKSAKA---KIIVMDEND---TDKDHPEFWKRLGGCKDDVQKAEQG--GDDFAYE  302

Query  1634  TFMIDT-------NMVYEIKDEELVPLEKYWGTIPKIEMLDPNKVLVFDFGSEMYIWSGK  1686
                ++        N+ YE+    + P+    G +     L+     + D  +E+Y+W GK
Sbjct  303   KKSVEQIKLYQVENLNYEVHLHLIDPI----GDVYSTTQLNAEFCYILDCETELYVWLGK  358

Query  1687  GASTDKKKLATHLATEMWQEGYDYSECTVCPISAASMIGRRTMSKIDLKSAKVRPKWCLL  1746
              ++ D++ +A  +A  M                             DL     RP W  +
Sbjct  359   ASANDQRTVA--MANAM-----------------------------DLLHEDNRPSWTPI  387

Query  1747  AKLTQHVETILFREKFL--DW-----------PNVSRIIRIRGTKSKENVDGTVTIEVCN  1793
              K+TQ  E  LF++KF    W           P   + +  +  + K NVD     E   
Sbjct  388   IKMTQGSENTLFKDKFKKGSWGEYVNDNFEKKPITGKGVAAKAVQEKINVDALHNPEKYQ  447

Query  1794  INNLLEENTIPVDLILEGTHLGRGTGWYDDEQMKQFIVTTMGIKVWHIDEFSHSLLDDSS  1853
             ++    ++TIP    ++  H G                    +K+WH+   +   +  S 
Sbjct  448   LSKEERKSTIPTLHHVDDKHRGE-------------------LKIWHVRNRNKFEISQSE  488

Query  1854  VGQFHSADSYIVYWMYSVTVTGRELSGLPSKHSAKGRDRSVYFIWQGQNASLNEQGAAAL  1913
              G F++   Y+V               L +  +A G + S+ + WQG+ +S  ++GAAAL
Sbjct  489   FGLFYNQSCYLV---------------LFTLFAADGSNNSILYYWQGRFSSSEDKGAAAL  533

Query  1914  LTIELDND---QAPQIRVVQGYEPAAFLNLFSGGMIVHSGKKTNVKCDKRWR--------  1962
             L  ++  +       +R VQ  EP  FL  F G M+V  G + N   +            
Sbjct  534   LAKDVGKELHRSCIHVRTVQNKEPNHFLEHFQGRMVVFKGSRPNATTEVSLENLSSSLQG  593

Query  1963  LYICRGTLESEVSLIEIPCSTRQLRSRGSLILLDTKNNKIYVWHGSNSLPHIKQHAVNAA  2022
             LY  RGT    +  I++  +   L S  S IL++ KN   Y+W G        +++    
Sbjct  594   LYHVRGTEPINIHSIQVEKAISSLDSNDSFILVNFKNTISYIWVG--------KYSDEKE  645

Query  2023  AKLEKNRPQETGLTSEGDIEIFEIDEGMEPEEFINALGQMNKKLYVSLEKD---QL----  2075
             A L+ +    TG   +       IDEG E  EF  +L + N  L  SL KD   QL    
Sbjct  646   AALQISSNVFTGYNFQ------LIDEGDETSEFWESL-ETNSSL--SLLKDYYTQLRTVE  696

Query  2076  QEHTPRLFHLSSISKEFKSVEMLCPHRASLPTPFPFLQEDLYQVHQPALFLLDNKNELWI  2135
             QE   RLF  S+ S  FK  E+             F Q+DL       + +LDN+ ++++
Sbjct  697   QEKKTRLFQCSNNSGVFKVFEI-----------HDFSQDDL---DSDDVMILDNQKQIFV  742

Query  2136  WQGWWPNTGAEDQSGSKAVRWQAERRAAMTMAMQYWQRIHPETNKYPIYLVWAGLEPLQF  2195
             W       G E            E+  A   A++Y           PI+ +  G EP +F
Sbjct  743   W------VGKESSD--------TEKLMANETALEYIMNAPTHRRDDPIFTIQDGFEPHEF  788

Query  2196  INLFPTW  2202
                F  W
Sbjct  789   TFNFHAW  795


 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 34/59 (58%), Gaps = 1/59 (2%)

Query  2237  YPPAQLLQRP-LPEGVDPTHLELYLSQQHFQEILGMTKEEFQELPVWKQVNLKKEIGLF  2294
             YP + L Q+  LP  +D + L LYLS + F     MTKE FQ+ P WK   L+ + GLF
Sbjct  901   YPLSVLKQKTNLPNDIDKSCLHLYLSDEEFLSTFKMTKEIFQKTPAWKTKQLRVDNGLF  959


>GELS_DROME unnamed protein product
Length=798

 Score = 114 bits (284),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 162/698 (23%), Positives = 267/698 (38%), Gaps = 131/698 (19%)

Query  1518  LLLIKGRRHVQVRLVEPVAESINSGDNFVLVTKSEVYNYIGKYCNVIEKARGAEIALSIQ  1577
             L  +KG+R+V+VR V     S+N+GD F+L   S++Y Y+G     +EK +    A  I+
Sbjct  194   LFQVKGKRNVRVRQVNLSVSSMNTGDCFILDAGSDIYVYVGSQAKRVEKLKAISAANQIR  253

Query  1578  QNKDLGCQTFQVITINEDKLTCTKSQLQKFWSYLGAENENVDVIEGGHPDEDELYETFMI  1637
                  G    Q++    D  + T +  Q F+  LG+ + +  V +    DED  +E    
Sbjct  254   DQDHNGRARVQIV----DDFS-TDADKQHFFDVLGSGSAD-QVPDESTADEDSAFERTDA  307

Query  1638  DTNMVYEIKDEELVPLEKYWGTIPKIE-MLDPNKVLVFDFGSEMYIWSGKGASTDKKKLA  1696
                 +Y++ D          G  P  + MLD  +  + D GS +++W GKGA+  +K  A
Sbjct  308   AAVSLYKVSDASGKLKVDIIGQKPLTQAMLDTRECFILDTGSGIFVWVGKGATQKEKTDA  367

Query  1697  THLATEMWQEGYDYSECTVCPISAASMIGRRTMSKIDLKSAKVRPKWCLLAKLTQHVETI  1756
                A E                               L++ K  P W  + ++ +  E+ 
Sbjct  368   MAKAQEF------------------------------LRTKKY-PAWTQIHRIVEGSESA  396

Query  1757  LFREKFLDWPNVSRIIRIRGTKSKENVDGTVTIEVCNINNLLEENTIPVDLILEGTHLGR  1816
              F++ F  W       R  G      +   + I    + N  E +++   L   G   GR
Sbjct  397   PFKQYFDTW-------RDAGMSHSRLIRSALGIGSDELLNDDEIDSVVTQLKKSG---GR  446

Query  1817  GTGWYDDEQMKQFIVTTMGIKVWHIDEFSHSLLDDSSVGQFHSADSYIVYWMYSVTVTGR  1876
               G+  D         T  +     DE   S +            SY++ + Y       
Sbjct  447   AFGFMPDHGQNVIETITQYVAKPGSDEIVVSTVPFDEKLPLLGFASYVLTYNYEAN----  502

Query  1877  ELSGLPSKHSAKGRDRSVYFIWQG------QNASLNEQGAAALLTIELDNDQAPQIRVVQ  1930
                         G   S+ ++W G            E+G          +     ++  Q
Sbjct  503   -----------NGDTGSLTYVWHGVKASAAARKRAFEEGLVG-------SKDGLLVQTNQ  544

Query  1931  GYEPAAFLNLFSGGMIVHSGKKTNVKCDKRWRLYICRGTLESEVSLIEIPCSTRQLRSRG  1990
             G+EP  F  +F G ++  S     V      +L+  RGT+ES+V   E+   +  L S  
Sbjct  545   GHEPRHFYKIFKGKLLT-SFTALPVTA----QLFRIRGTVESDVHASEVAADSSSLASSD  599

Query  1991  SLILLDTKNNKIYVWHGSNSLPHIKQHAVNAAAKLEKNRPQETGLTSEGDIEIFEIDEGM  2050
             + +L   K++KIY+W+G  +    KQ AV+  +                D+E+ +++EG 
Sbjct  600   AFVLHSGKSHKIYIWNGLGASAFEKQAAVDRFSDYWD------------DVELEQVEEGA  647

Query  2051  EPEEF---INALGQMNKKLYVSLEKDQLQEHTPRLFHLSSISKEFKSVEMLCPHRASLPT  2107
             EP+EF   +N  GQ ++    SL  D       RLFH    S  F  VE +  +      
Sbjct  648   EPDEFWEELNGEGQYDR----SLGDDGAPLLESRLFHCHLSSGGFLKVEEVAQYE-----  698

Query  2108  PFPFLQEDLYQVHQPALFLLDNKNELWIWQGWWPNTGAEDQSGSKAVRWQAERRAAMTMA  2167
                  QEDL       + LLD  +E+++W G+    G  ++   K           +  A
Sbjct  699   -----QEDL---DSDDIMLLDAGDEIYLWVGY----GVSEEENGK----------LLDTA  736

Query  2168  MQYWQRIHPETNKY---PIYLVWAGLEPLQFINLFPTW  2202
               Y+  + P    +    I  V  G EP  F  +FP W
Sbjct  737   KLYFN-LEPTARSFDTVSIIRVPQGKEPRVFKRMFPNW  773


 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 99/391 (25%), Positives = 163/391 (42%), Gaps = 75/391 (19%)

Query  1833  TMGIKVWHIDEFSHSLLDDSSVGQFHSADSYIVYWMYSVTVTGRELSGLPSKHSAKGRDR  1892
             T G+++W I+ F   +   ++ G+F++ DS+IV            L+ + +K   K    
Sbjct  69    TPGLEIWRIENFEPVIYPKTNYGKFYTGDSFIV------------LNTIENKKDKK-LSW  115

Query  1893  SVYFIWQGQNASLNEQGAAALLTIELD---NDQAPQIRVVQGYEPAAFLNLFSGGMIVHS  1949
              V+F W G   S +E GAAA+LT++LD   N    Q R VQ +E   FL+ F  G+    
Sbjct  116   DVHF-WLGLETSTDEAGAAAILTVQLDDLLNGGPVQHREVQDHESQLFLSYFKNGIRYEQ  174

Query  1950  G------KKTNVKCDKRWRLYICRGTLESEVSLIEIPCSTRQLRSRGSLILLDTKNNKIY  2003
             G      K          RL+  +G     V  + +  S+    + G   +LD  ++ IY
Sbjct  175   GGVGTGFKHVETNAQGETRLFQVKGKRNVRVRQVNLSVSS---MNTGDCFILDAGSD-IY  230

Query  2004  VWHGSNSLPHIKQHAVNAAAKLEKNRPQE-TGLTSEGDIEIFEIDEGMEPEEFINALGQM  2062
             V+ GS +    K  A++AA ++   R Q+  G      ++ F  D   + + F + LG  
Sbjct  231   VYVGSQAKRVEKLKAISAANQI---RDQDHNGRARVQIVDDFSTD--ADKQHFFDVLGSG  285

Query  2063  NKKLY---VSLEKDQLQEHTP----RLFHLSSISKEFKSVEMLCPHRASLPTPFPFLQED  2115
             +        + ++D   E T      L+ +S  S + K V+++           P  Q  
Sbjct  286   SADQVPDESTADEDSAFERTDAAAVSLYKVSDASGKLK-VDIIGQK--------PLTQAM  336

Query  2116  LYQVHQPALFLLDNKNELWIWQGWWPNTGAEDQSGSKAVRWQAERRAAMTMAMQYWQRIH  2175
             L        F+LD  + +++W G     GA           Q E+  AM  A ++ +   
Sbjct  337   L---DTRECFILDTGSGIFVWVG----KGAT----------QKEKTDAMAKAQEFLR---  376

Query  2176  PETNKYP----IYLVWAGLEPLQFINLFPTW  2202
               T KYP    I+ +  G E   F   F TW
Sbjct  377   --TKKYPAWTQIHRIVEGSESAPFKQYFDTW  405



Lambda      K        H
   0.315    0.131    0.361 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 566763464


Query= XP_050573053.1 supervillin isoform X1 [Bombus affinis]

Length=2294
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

VILD_DICDI  unnamed protein product                                   183     6e-46
VILB_DICDI  unnamed protein product                                   162     5e-40
GELS_DROME  unnamed protein product                                   114     6e-25


>VILD_DICDI unnamed protein product
Length=1704

 Score = 183 bits (465),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 201/817 (25%), Positives = 348/817 (43%), Gaps = 148/817 (18%)

Query  1506  SSNRLQPYKDL---------MLLLIKGRRHVQVRLVEPVAESINSGDNFVLVTKSEVYNY  1556
             S++ L  Y DL         +L+ +KG+R ++VR+V+    S+N  ++F+L     ++ +
Sbjct  1008  SADDLTRYLDLTAIKNGKQKILIQVKGKRKIRVRMVKLSTSSLNCHNSFILDAGPRIFVW  1067

Query  1557  IGKYCNVIEKARGAEIALSIQQNKDLGCQTFQVITINEDKLTCTKSQLQKFWSYLGAENE  1616
              G   + + KA+  + A  I+  +  G  T   +    D+      Q   FW  LG  N 
Sbjct  1068  AGSKTSRVNKAKALDFANRIRTKERGGKSTLIQLDQGRDE------QSFDFWEILGG-NS  1120

Query  1617  NVDVIEGGHPDEDELYETFMIDTNMVYEIKDEELVPLEKYWGT---IPKIEMLDPNKVLV  1673
             +  +     P+E +          +  ++K   L     + GT   +P  E+L+   V V
Sbjct  1121  SDPIATTPTPEEQDTESIKTTIYRVGLDVKKNSLRARLAWEGTDWKLPNKEILNTKFVYV  1180

Query  1674  FDFGSEMYIWSGKGASTDKKKLATHLATEMWQEGYDYSECTVCPISAASMIGRRTMSKID  1733
              D  +E+++W GK +S+ ++K+AT +A                               + 
Sbjct  1181  VDCVTEIFVWVGKESSSIQRKMATKVA-------------------------------LV  1209

Query  1734  LKSAKVRPKWCLLAKLTQHVETILFREKFLDWPNVSRIIRIRGTKSKENVDGTVTIEVCN  1793
             L++ K R  W  + +LT+  E  LF+EKF ++P +  I   R  + K +V  T  +E   
Sbjct  1210  LQAQKDRVDWTKITRLTEFGENNLFKEKFANYPGMLPISTTR-QEIKSHV-ATSKVE-HK  1266

Query  1794  INNLLEENTIPVDLILEGTHLGRGTGWYDDEQMKQFIVTTMG-IKVWHIDEFSHSLLDDS  1852
             I  L    T P               + D+E +    +   G +KVW I+++        
Sbjct  1267  IETLASRMTTP---------------FIDNEALFTIPIDEGGRVKVWKIEDYEKIDHPQH  1311

Query  1853  SVGQFHSADSYIVYWMYSVTVTGRELSGLPSKHSAKGRDRSVYFIWQGQNASLNEQGAAA  1912
                QF S+DSYIV + Y                    ++  V + + G+++S+NE+G +A
Sbjct  1312  LYSQFFSSDSYIVLYTYM----------------QNNKEAHVIYYYLGRDSSINEKGTSA  1355

Query  1913  LLTIELDND---QAPQIRVVQGYEPAAFLNLFSGGMIVHSGKKTNVKCDKRWRLYICRGT  1969
              LT++L+        Q RVV   E   FLNLF   M++H GK  N    K+  LY  +G 
Sbjct  1356  YLTVDLNESLVGACVQTRVVANKECKNFLNLFKTKMVIHKGKYNNYD-PKKPSLYQVKGL  1414

Query  1970  LESEVSLIEIPCSTRQLRSRGSLILLDTKNNKIYVWHGSNSLPHIKQHAVNAAAKLEKNR  2029
              + ++  +++  S+  L +    IL   +  KIY+WHG  SL   +  A++ A       
Sbjct  1415  DKIDIRAVQVEFSSSMLNTLHVSILRTPE--KIYIWHGKFSLDAEQNSALSIAENFN---  1469

Query  2030  PQETGLTSEGDIEIFEIDEGMEPEEFINAL-------GQMNKKLYVSLEKDQLQEHTPRL  2082
                   ++   IEI +  EG E  EF +A           N  +  S        + PR 
Sbjct  1470  ------STSAPIEILK--EGSESNEFWSAFESTGGRQKYFNDIMIQSSSIPTSFTYKPRF  1521

Query  2083  FHLSSISKEFKSVEMLCPHRASLPTPFPFLQEDLYQVHQPALFLLDNKNELWIWQGWWPN  2142
             F  S+ S   +  E             PF Q+DL      ++ +LD ++ +++W      
Sbjct  1522  FVCSNASGIVEVTE-----------ESPFSQDDL---DIGSVCILDVQSHIYLW------  1561

Query  2143  TGAEDQSGSKAVRWQAERRAAMTMAMQYWQ--RIHPETNKYPIYLVWAGLEPLQFINLFP  2200
                    GS+A      +RA+M + + + +  ++        + +     EP+ F + F 
Sbjct  1562  ------IGSRAT--HRTKRASMEVVLNFIETSKLGHSKEHTKVLIATPFEEPIGFKSYFR  1613

Query  2201  TWT---YRDDIAELNIEDGRNPGEVLTVESELVRLTQSTYPPAQLLQRPLPEGVDPTHLE  2257
              W    Y  +   L  +DG      + VE  L    +  Y   +LL  PLP GVD T L+
Sbjct  1614  AWCTSKYPKNKLPLVEKDG------IPVEQVLKDYLKEIYTYEELLADPLPAGVDSTKLD  1667

Query  2258  LYLSQQHFQEILGMTKEEFQELPVWKQVNLKKEIGLF  2294
              YL+ + F+++  MT+ E+ ++P WK+  +KKE+ LF
Sbjct  1668  TYLNDEDFEKVFKMTRTEWLKIPAWKREGIKKELFLF  1704


>VILB_DICDI unnamed protein product
Length=959

 Score = 162 bits (411),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 179/727 (25%), Positives = 295/727 (41%), Gaps = 160/727 (22%)

Query  1514  KDLMLLLIKGRRHVQVRLVEPVAESINSGDNFVLVTKSEVYNYIGKYCNVIEKARGAEIA  1573
             K   L  +KGRR+++V+ V+  ++S+NSGD FVL  +  +Y + G   + +EK +G ++ 
Sbjct  191   KQYKLFHLKGRRNIRVKQVDISSKSLNSGDVFVLDCEDFIYQWNGSESSRLEKGKGLDLT  250

Query  1574  LSIQQNKDLGCQTFQVITINEDKLTCTKSQLQKFWSYLGAENENVDVIEGGHPDEDELYE  1633
             + ++  K       ++I ++E+    T     +FW  LG   ++V   E G   +D  YE
Sbjct  251   IRLRDEKSAKA---KIIVMDEND---TDKDHPEFWKRLGGCKDDVQKAEQG--GDDFAYE  302

Query  1634  TFMIDT-------NMVYEIKDEELVPLEKYWGTIPKIEMLDPNKVLVFDFGSEMYIWSGK  1686
                ++        N+ YE+    + P+    G +     L+     + D  +E+Y+W GK
Sbjct  303   KKSVEQIKLYQVENLNYEVHLHLIDPI----GDVYSTTQLNAEFCYILDCETELYVWLGK  358

Query  1687  GASTDKKKLATHLATEMWQEGYDYSECTVCPISAASMIGRRTMSKIDLKSAKVRPKWCLL  1746
              ++ D++ +A  +A  M                             DL     RP W  +
Sbjct  359   ASANDQRTVA--MANAM-----------------------------DLLHEDNRPSWTPI  387

Query  1747  AKLTQHVETILFREKFL--DW-----------PNVSRIIRIRGTKSKENVDGTVTIEVCN  1793
              K+TQ  E  LF++KF    W           P   + +  +  + K NVD     E   
Sbjct  388   IKMTQGSENTLFKDKFKKGSWGEYVNDNFEKKPITGKGVAAKAVQEKINVDALHNPEKYQ  447

Query  1794  INNLLEENTIPVDLILEGTHLGRGTGWYDDEQMKQFIVTTMGIKVWHIDEFSHSLLDDSS  1853
             ++    ++TIP    ++  H G                    +K+WH+   +   +  S 
Sbjct  448   LSKEERKSTIPTLHHVDDKHRGE-------------------LKIWHVRNRNKFEISQSE  488

Query  1854  VGQFHSADSYIVYWMYSVTVTGRELSGLPSKHSAKGRDRSVYFIWQGQNASLNEQGAAAL  1913
              G F++   Y+V               L +  +A G + S+ + WQG+ +S  ++GAAAL
Sbjct  489   FGLFYNQSCYLV---------------LFTLFAADGSNNSILYYWQGRFSSSEDKGAAAL  533

Query  1914  LTIELDND---QAPQIRVVQGYEPAAFLNLFSGGMIVHSGKKTNVKCDKRWR--------  1962
             L  ++  +       +R VQ  EP  FL  F G M+V  G + N   +            
Sbjct  534   LAKDVGKELHRSCIHVRTVQNKEPNHFLEHFQGRMVVFKGSRPNATTEVSLENLSSSLQG  593

Query  1963  LYICRGTLESEVSLIEIPCSTRQLRSRGSLILLDTKNNKIYVWHGSNSLPHIKQHAVNAA  2022
             LY  RGT    +  I++  +   L S  S IL++ KN   Y+W G        +++    
Sbjct  594   LYHVRGTEPINIHSIQVEKAISSLDSNDSFILVNFKNTISYIWVG--------KYSDEKE  645

Query  2023  AKLEKNRPQETGLTSEGDIEIFEIDEGMEPEEFINALGQMNKKLYVSLEKD---QL----  2075
             A L+ +    TG   +       IDEG E  EF  +L + N  L  SL KD   QL    
Sbjct  646   AALQISSNVFTGYNFQ------LIDEGDETSEFWESL-ETNSSL--SLLKDYYTQLRTVE  696

Query  2076  QEHTPRLFHLSSISKEFKSVEMLCPHRASLPTPFPFLQEDLYQVHQPALFLLDNKNELWI  2135
             QE   RLF  S+ S  FK  E+             F Q+DL       + +LDN+ ++++
Sbjct  697   QEKKTRLFQCSNNSGVFKVFEI-----------HDFSQDDL---DSDDVMILDNQKQIFV  742

Query  2136  WQGWWPNTGAEDQSGSKAVRWQAERRAAMTMAMQYWQRIHPETNKYPIYLVWAGLEPLQF  2195
             W       G E            E+  A   A++Y           PI+ +  G EP +F
Sbjct  743   W------VGKESSD--------TEKLMANETALEYIMNAPTHRRDDPIFTIQDGFEPHEF  788

Query  2196  INLFPTW  2202
                F  W
Sbjct  789   TFNFHAW  795


 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 34/59 (58%), Gaps = 1/59 (2%)

Query  2237  YPPAQLLQRP-LPEGVDPTHLELYLSQQHFQEILGMTKEEFQELPVWKQVNLKKEIGLF  2294
             YP + L Q+  LP  +D + L LYLS + F     MTKE FQ+ P WK   L+ + GLF
Sbjct  901   YPLSVLKQKTNLPNDIDKSCLHLYLSDEEFLSTFKMTKEIFQKTPAWKTKQLRVDNGLF  959


>GELS_DROME unnamed protein product
Length=798

 Score = 114 bits (284),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 162/698 (23%), Positives = 267/698 (38%), Gaps = 131/698 (19%)

Query  1518  LLLIKGRRHVQVRLVEPVAESINSGDNFVLVTKSEVYNYIGKYCNVIEKARGAEIALSIQ  1577
             L  +KG+R+V+VR V     S+N+GD F+L   S++Y Y+G     +EK +    A  I+
Sbjct  194   LFQVKGKRNVRVRQVNLSVSSMNTGDCFILDAGSDIYVYVGSQAKRVEKLKAISAANQIR  253

Query  1578  QNKDLGCQTFQVITINEDKLTCTKSQLQKFWSYLGAENENVDVIEGGHPDEDELYETFMI  1637
                  G    Q++    D  + T +  Q F+  LG+ + +  V +    DED  +E    
Sbjct  254   DQDHNGRARVQIV----DDFS-TDADKQHFFDVLGSGSAD-QVPDESTADEDSAFERTDA  307

Query  1638  DTNMVYEIKDEELVPLEKYWGTIPKIE-MLDPNKVLVFDFGSEMYIWSGKGASTDKKKLA  1696
                 +Y++ D          G  P  + MLD  +  + D GS +++W GKGA+  +K  A
Sbjct  308   AAVSLYKVSDASGKLKVDIIGQKPLTQAMLDTRECFILDTGSGIFVWVGKGATQKEKTDA  367

Query  1697  THLATEMWQEGYDYSECTVCPISAASMIGRRTMSKIDLKSAKVRPKWCLLAKLTQHVETI  1756
                A E                               L++ K  P W  + ++ +  E+ 
Sbjct  368   MAKAQEF------------------------------LRTKKY-PAWTQIHRIVEGSESA  396

Query  1757  LFREKFLDWPNVSRIIRIRGTKSKENVDGTVTIEVCNINNLLEENTIPVDLILEGTHLGR  1816
              F++ F  W       R  G      +   + I    + N  E +++   L   G   GR
Sbjct  397   PFKQYFDTW-------RDAGMSHSRLIRSALGIGSDELLNDDEIDSVVTQLKKSG---GR  446

Query  1817  GTGWYDDEQMKQFIVTTMGIKVWHIDEFSHSLLDDSSVGQFHSADSYIVYWMYSVTVTGR  1876
               G+  D         T  +     DE   S +            SY++ + Y       
Sbjct  447   AFGFMPDHGQNVIETITQYVAKPGSDEIVVSTVPFDEKLPLLGFASYVLTYNYEAN----  502

Query  1877  ELSGLPSKHSAKGRDRSVYFIWQG------QNASLNEQGAAALLTIELDNDQAPQIRVVQ  1930
                         G   S+ ++W G            E+G          +     ++  Q
Sbjct  503   -----------NGDTGSLTYVWHGVKASAAARKRAFEEGLVG-------SKDGLLVQTNQ  544

Query  1931  GYEPAAFLNLFSGGMIVHSGKKTNVKCDKRWRLYICRGTLESEVSLIEIPCSTRQLRSRG  1990
             G+EP  F  +F G ++  S     V      +L+  RGT+ES+V   E+   +  L S  
Sbjct  545   GHEPRHFYKIFKGKLLT-SFTALPVTA----QLFRIRGTVESDVHASEVAADSSSLASSD  599

Query  1991  SLILLDTKNNKIYVWHGSNSLPHIKQHAVNAAAKLEKNRPQETGLTSEGDIEIFEIDEGM  2050
             + +L   K++KIY+W+G  +    KQ AV+  +                D+E+ +++EG 
Sbjct  600   AFVLHSGKSHKIYIWNGLGASAFEKQAAVDRFSDYWD------------DVELEQVEEGA  647

Query  2051  EPEEF---INALGQMNKKLYVSLEKDQLQEHTPRLFHLSSISKEFKSVEMLCPHRASLPT  2107
             EP+EF   +N  GQ ++    SL  D       RLFH    S  F  VE +  +      
Sbjct  648   EPDEFWEELNGEGQYDR----SLGDDGAPLLESRLFHCHLSSGGFLKVEEVAQYE-----  698

Query  2108  PFPFLQEDLYQVHQPALFLLDNKNELWIWQGWWPNTGAEDQSGSKAVRWQAERRAAMTMA  2167
                  QEDL       + LLD  +E+++W G+    G  ++   K           +  A
Sbjct  699   -----QEDL---DSDDIMLLDAGDEIYLWVGY----GVSEEENGK----------LLDTA  736

Query  2168  MQYWQRIHPETNKY---PIYLVWAGLEPLQFINLFPTW  2202
               Y+  + P    +    I  V  G EP  F  +FP W
Sbjct  737   KLYFN-LEPTARSFDTVSIIRVPQGKEPRVFKRMFPNW  773


 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 99/391 (25%), Positives = 163/391 (42%), Gaps = 75/391 (19%)

Query  1833  TMGIKVWHIDEFSHSLLDDSSVGQFHSADSYIVYWMYSVTVTGRELSGLPSKHSAKGRDR  1892
             T G+++W I+ F   +   ++ G+F++ DS+IV            L+ + +K   K    
Sbjct  69    TPGLEIWRIENFEPVIYPKTNYGKFYTGDSFIV------------LNTIENKKDKK-LSW  115

Query  1893  SVYFIWQGQNASLNEQGAAALLTIELD---NDQAPQIRVVQGYEPAAFLNLFSGGMIVHS  1949
              V+F W G   S +E GAAA+LT++LD   N    Q R VQ +E   FL+ F  G+    
Sbjct  116   DVHF-WLGLETSTDEAGAAAILTVQLDDLLNGGPVQHREVQDHESQLFLSYFKNGIRYEQ  174

Query  1950  G------KKTNVKCDKRWRLYICRGTLESEVSLIEIPCSTRQLRSRGSLILLDTKNNKIY  2003
             G      K          RL+  +G     V  + +  S+    + G   +LD  ++ IY
Sbjct  175   GGVGTGFKHVETNAQGETRLFQVKGKRNVRVRQVNLSVSS---MNTGDCFILDAGSD-IY  230

Query  2004  VWHGSNSLPHIKQHAVNAAAKLEKNRPQE-TGLTSEGDIEIFEIDEGMEPEEFINALGQM  2062
             V+ GS +    K  A++AA ++   R Q+  G      ++ F  D   + + F + LG  
Sbjct  231   VYVGSQAKRVEKLKAISAANQI---RDQDHNGRARVQIVDDFSTD--ADKQHFFDVLGSG  285

Query  2063  NKKLY---VSLEKDQLQEHTP----RLFHLSSISKEFKSVEMLCPHRASLPTPFPFLQED  2115
             +        + ++D   E T      L+ +S  S + K V+++           P  Q  
Sbjct  286   SADQVPDESTADEDSAFERTDAAAVSLYKVSDASGKLK-VDIIGQK--------PLTQAM  336

Query  2116  LYQVHQPALFLLDNKNELWIWQGWWPNTGAEDQSGSKAVRWQAERRAAMTMAMQYWQRIH  2175
             L        F+LD  + +++W G     GA           Q E+  AM  A ++ +   
Sbjct  337   L---DTRECFILDTGSGIFVWVG----KGAT----------QKEKTDAMAKAQEFLR---  376

Query  2176  PETNKYP----IYLVWAGLEPLQFINLFPTW  2202
               T KYP    I+ +  G E   F   F TW
Sbjct  377   --TKKYPAWTQIHRIVEGSESAPFKQYFDTW  405



Lambda      K        H
   0.315    0.131    0.361 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 566763464


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Nov 7, 2022  4:57 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_050573054.1 supervillin isoform X2 [Bombus affinis]

Length=2293
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

VILD_DICDI  unnamed protein product                                   183     7e-46
VILB_DICDI  unnamed protein product                                   162     6e-40
GELS_DROME  unnamed protein product                                   114     6e-25


>VILD_DICDI unnamed protein product
Length=1704

 Score = 183 bits (465),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 201/817 (25%), Positives = 348/817 (43%), Gaps = 148/817 (18%)

Query  1505  SSNRLQPYKDL---------MLLLIKGRRHVQVRLVEPVAESINSGDNFVLVTKSEVYNY  1555
             S++ L  Y DL         +L+ +KG+R ++VR+V+    S+N  ++F+L     ++ +
Sbjct  1008  SADDLTRYLDLTAIKNGKQKILIQVKGKRKIRVRMVKLSTSSLNCHNSFILDAGPRIFVW  1067

Query  1556  IGKYCNVIEKARGAEIALSIQQNKDLGCQTFQVITINEDKLTCTKSQLQKFWSYLGAENE  1615
              G   + + KA+  + A  I+  +  G  T   +    D+      Q   FW  LG  N 
Sbjct  1068  AGSKTSRVNKAKALDFANRIRTKERGGKSTLIQLDQGRDE------QSFDFWEILGG-NS  1120

Query  1616  NVDVIEGGHPDEDELYETFMIDTNMVYEIKDEELVPLEKYWGT---IPKIEMLDPNKVLV  1672
             +  +     P+E +          +  ++K   L     + GT   +P  E+L+   V V
Sbjct  1121  SDPIATTPTPEEQDTESIKTTIYRVGLDVKKNSLRARLAWEGTDWKLPNKEILNTKFVYV  1180

Query  1673  FDFGSEMYIWSGKGASTDKKKLATHLATEMWQEGYDYSECTVCPISAASMIGRRTMSKID  1732
              D  +E+++W GK +S+ ++K+AT +A                               + 
Sbjct  1181  VDCVTEIFVWVGKESSSIQRKMATKVA-------------------------------LV  1209

Query  1733  LKSAKVRPKWCLLAKLTQHVETILFREKFLDWPNVSRIIRIRGTKSKENVDGTVTIEVCN  1792
             L++ K R  W  + +LT+  E  LF+EKF ++P +  I   R  + K +V  T  +E   
Sbjct  1210  LQAQKDRVDWTKITRLTEFGENNLFKEKFANYPGMLPISTTR-QEIKSHV-ATSKVE-HK  1266

Query  1793  INNLLEENTIPVDLILEGTHLGRGTGWYDDEQMKQFIVTTMG-IKVWHIDEFSHSLLDDS  1851
             I  L    T P               + D+E +    +   G +KVW I+++        
Sbjct  1267  IETLASRMTTP---------------FIDNEALFTIPIDEGGRVKVWKIEDYEKIDHPQH  1311

Query  1852  SVGQFHSADSYIVYWMYSVTVTGRELSGLPSKHSAKGRDRSVYFIWQGQNASLNEQGAAA  1911
                QF S+DSYIV + Y                    ++  V + + G+++S+NE+G +A
Sbjct  1312  LYSQFFSSDSYIVLYTYM----------------QNNKEAHVIYYYLGRDSSINEKGTSA  1355

Query  1912  LLTIELDND---QAPQIRVVQGYEPAAFLNLFSGGMIVHSGKKTNVKCDKRWRLYICRGT  1968
              LT++L+        Q RVV   E   FLNLF   M++H GK  N    K+  LY  +G 
Sbjct  1356  YLTVDLNESLVGACVQTRVVANKECKNFLNLFKTKMVIHKGKYNNYD-PKKPSLYQVKGL  1414

Query  1969  LESEVSLIEIPCSTRQLRSRGSLILLDTKNNKIYVWHGSNSLPHIKQHAVNAAAKLEKNR  2028
              + ++  +++  S+  L +    IL   +  KIY+WHG  SL   +  A++ A       
Sbjct  1415  DKIDIRAVQVEFSSSMLNTLHVSILRTPE--KIYIWHGKFSLDAEQNSALSIAENFN---  1469

Query  2029  PQETGLTSEGDIEIFEIDEGMEPEEFINAL-------GQMNKKLYVSLEKDQLQEHTPRL  2081
                   ++   IEI +  EG E  EF +A           N  +  S        + PR 
Sbjct  1470  ------STSAPIEILK--EGSESNEFWSAFESTGGRQKYFNDIMIQSSSIPTSFTYKPRF  1521

Query  2082  FHLSSISKEFKSVEMLCPHRASLPTPFPFLQEDLYQVHQPALFLLDNKNELWIWQGWWPN  2141
             F  S+ S   +  E             PF Q+DL      ++ +LD ++ +++W      
Sbjct  1522  FVCSNASGIVEVTE-----------ESPFSQDDL---DIGSVCILDVQSHIYLW------  1561

Query  2142  TGAEDQSGSKAVRWQAERRAAMTMAMQYWQ--RIHPETNKYPIYLVWAGLEPLQFINLFP  2199
                    GS+A      +RA+M + + + +  ++        + +     EP+ F + F 
Sbjct  1562  ------IGSRAT--HRTKRASMEVVLNFIETSKLGHSKEHTKVLIATPFEEPIGFKSYFR  1613

Query  2200  TWT---YRDDIAELNIEDGRNPGEVLTVESELVRLTQSTYPPAQLLQRPLPEGVDPTHLE  2256
              W    Y  +   L  +DG      + VE  L    +  Y   +LL  PLP GVD T L+
Sbjct  1614  AWCTSKYPKNKLPLVEKDG------IPVEQVLKDYLKEIYTYEELLADPLPAGVDSTKLD  1667

Query  2257  LYLSQQHFQEILGMTKEEFQELPVWKQVNLKKEIGLF  2293
              YL+ + F+++  MT+ E+ ++P WK+  +KKE+ LF
Sbjct  1668  TYLNDEDFEKVFKMTRTEWLKIPAWKREGIKKELFLF  1704


>VILB_DICDI unnamed protein product
Length=959

 Score = 162 bits (411),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 179/727 (25%), Positives = 295/727 (41%), Gaps = 160/727 (22%)

Query  1513  KDLMLLLIKGRRHVQVRLVEPVAESINSGDNFVLVTKSEVYNYIGKYCNVIEKARGAEIA  1572
             K   L  +KGRR+++V+ V+  ++S+NSGD FVL  +  +Y + G   + +EK +G ++ 
Sbjct  191   KQYKLFHLKGRRNIRVKQVDISSKSLNSGDVFVLDCEDFIYQWNGSESSRLEKGKGLDLT  250

Query  1573  LSIQQNKDLGCQTFQVITINEDKLTCTKSQLQKFWSYLGAENENVDVIEGGHPDEDELYE  1632
             + ++  K       ++I ++E+    T     +FW  LG   ++V   E G   +D  YE
Sbjct  251   IRLRDEKSAKA---KIIVMDEND---TDKDHPEFWKRLGGCKDDVQKAEQG--GDDFAYE  302

Query  1633  TFMIDT-------NMVYEIKDEELVPLEKYWGTIPKIEMLDPNKVLVFDFGSEMYIWSGK  1685
                ++        N+ YE+    + P+    G +     L+     + D  +E+Y+W GK
Sbjct  303   KKSVEQIKLYQVENLNYEVHLHLIDPI----GDVYSTTQLNAEFCYILDCETELYVWLGK  358

Query  1686  GASTDKKKLATHLATEMWQEGYDYSECTVCPISAASMIGRRTMSKIDLKSAKVRPKWCLL  1745
              ++ D++ +A  +A  M                             DL     RP W  +
Sbjct  359   ASANDQRTVA--MANAM-----------------------------DLLHEDNRPSWTPI  387

Query  1746  AKLTQHVETILFREKFL--DW-----------PNVSRIIRIRGTKSKENVDGTVTIEVCN  1792
              K+TQ  E  LF++KF    W           P   + +  +  + K NVD     E   
Sbjct  388   IKMTQGSENTLFKDKFKKGSWGEYVNDNFEKKPITGKGVAAKAVQEKINVDALHNPEKYQ  447

Query  1793  INNLLEENTIPVDLILEGTHLGRGTGWYDDEQMKQFIVTTMGIKVWHIDEFSHSLLDDSS  1852
             ++    ++TIP    ++  H G                    +K+WH+   +   +  S 
Sbjct  448   LSKEERKSTIPTLHHVDDKHRGE-------------------LKIWHVRNRNKFEISQSE  488

Query  1853  VGQFHSADSYIVYWMYSVTVTGRELSGLPSKHSAKGRDRSVYFIWQGQNASLNEQGAAAL  1912
              G F++   Y+V               L +  +A G + S+ + WQG+ +S  ++GAAAL
Sbjct  489   FGLFYNQSCYLV---------------LFTLFAADGSNNSILYYWQGRFSSSEDKGAAAL  533

Query  1913  LTIELDND---QAPQIRVVQGYEPAAFLNLFSGGMIVHSGKKTNVKCDKRWR--------  1961
             L  ++  +       +R VQ  EP  FL  F G M+V  G + N   +            
Sbjct  534   LAKDVGKELHRSCIHVRTVQNKEPNHFLEHFQGRMVVFKGSRPNATTEVSLENLSSSLQG  593

Query  1962  LYICRGTLESEVSLIEIPCSTRQLRSRGSLILLDTKNNKIYVWHGSNSLPHIKQHAVNAA  2021
             LY  RGT    +  I++  +   L S  S IL++ KN   Y+W G        +++    
Sbjct  594   LYHVRGTEPINIHSIQVEKAISSLDSNDSFILVNFKNTISYIWVG--------KYSDEKE  645

Query  2022  AKLEKNRPQETGLTSEGDIEIFEIDEGMEPEEFINALGQMNKKLYVSLEKD---QL----  2074
             A L+ +    TG   +       IDEG E  EF  +L + N  L  SL KD   QL    
Sbjct  646   AALQISSNVFTGYNFQ------LIDEGDETSEFWESL-ETNSSL--SLLKDYYTQLRTVE  696

Query  2075  QEHTPRLFHLSSISKEFKSVEMLCPHRASLPTPFPFLQEDLYQVHQPALFLLDNKNELWI  2134
             QE   RLF  S+ S  FK  E+             F Q+DL       + +LDN+ ++++
Sbjct  697   QEKKTRLFQCSNNSGVFKVFEI-----------HDFSQDDL---DSDDVMILDNQKQIFV  742

Query  2135  WQGWWPNTGAEDQSGSKAVRWQAERRAAMTMAMQYWQRIHPETNKYPIYLVWAGLEPLQF  2194
             W       G E            E+  A   A++Y           PI+ +  G EP +F
Sbjct  743   W------VGKESSD--------TEKLMANETALEYIMNAPTHRRDDPIFTIQDGFEPHEF  788

Query  2195  INLFPTW  2201
                F  W
Sbjct  789   TFNFHAW  795


 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 34/59 (58%), Gaps = 1/59 (2%)

Query  2236  YPPAQLLQRP-LPEGVDPTHLELYLSQQHFQEILGMTKEEFQELPVWKQVNLKKEIGLF  2293
             YP + L Q+  LP  +D + L LYLS + F     MTKE FQ+ P WK   L+ + GLF
Sbjct  901   YPLSVLKQKTNLPNDIDKSCLHLYLSDEEFLSTFKMTKEIFQKTPAWKTKQLRVDNGLF  959


>GELS_DROME unnamed protein product
Length=798

 Score = 114 bits (284),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 162/698 (23%), Positives = 267/698 (38%), Gaps = 131/698 (19%)

Query  1517  LLLIKGRRHVQVRLVEPVAESINSGDNFVLVTKSEVYNYIGKYCNVIEKARGAEIALSIQ  1576
             L  +KG+R+V+VR V     S+N+GD F+L   S++Y Y+G     +EK +    A  I+
Sbjct  194   LFQVKGKRNVRVRQVNLSVSSMNTGDCFILDAGSDIYVYVGSQAKRVEKLKAISAANQIR  253

Query  1577  QNKDLGCQTFQVITINEDKLTCTKSQLQKFWSYLGAENENVDVIEGGHPDEDELYETFMI  1636
                  G    Q++    D  + T +  Q F+  LG+ + +  V +    DED  +E    
Sbjct  254   DQDHNGRARVQIV----DDFS-TDADKQHFFDVLGSGSAD-QVPDESTADEDSAFERTDA  307

Query  1637  DTNMVYEIKDEELVPLEKYWGTIPKIE-MLDPNKVLVFDFGSEMYIWSGKGASTDKKKLA  1695
                 +Y++ D          G  P  + MLD  +  + D GS +++W GKGA+  +K  A
Sbjct  308   AAVSLYKVSDASGKLKVDIIGQKPLTQAMLDTRECFILDTGSGIFVWVGKGATQKEKTDA  367

Query  1696  THLATEMWQEGYDYSECTVCPISAASMIGRRTMSKIDLKSAKVRPKWCLLAKLTQHVETI  1755
                A E                               L++ K  P W  + ++ +  E+ 
Sbjct  368   MAKAQEF------------------------------LRTKKY-PAWTQIHRIVEGSESA  396

Query  1756  LFREKFLDWPNVSRIIRIRGTKSKENVDGTVTIEVCNINNLLEENTIPVDLILEGTHLGR  1815
              F++ F  W       R  G      +   + I    + N  E +++   L   G   GR
Sbjct  397   PFKQYFDTW-------RDAGMSHSRLIRSALGIGSDELLNDDEIDSVVTQLKKSG---GR  446

Query  1816  GTGWYDDEQMKQFIVTTMGIKVWHIDEFSHSLLDDSSVGQFHSADSYIVYWMYSVTVTGR  1875
               G+  D         T  +     DE   S +            SY++ + Y       
Sbjct  447   AFGFMPDHGQNVIETITQYVAKPGSDEIVVSTVPFDEKLPLLGFASYVLTYNYEAN----  502

Query  1876  ELSGLPSKHSAKGRDRSVYFIWQG------QNASLNEQGAAALLTIELDNDQAPQIRVVQ  1929
                         G   S+ ++W G            E+G          +     ++  Q
Sbjct  503   -----------NGDTGSLTYVWHGVKASAAARKRAFEEGLVG-------SKDGLLVQTNQ  544

Query  1930  GYEPAAFLNLFSGGMIVHSGKKTNVKCDKRWRLYICRGTLESEVSLIEIPCSTRQLRSRG  1989
             G+EP  F  +F G ++  S     V      +L+  RGT+ES+V   E+   +  L S  
Sbjct  545   GHEPRHFYKIFKGKLLT-SFTALPVTA----QLFRIRGTVESDVHASEVAADSSSLASSD  599

Query  1990  SLILLDTKNNKIYVWHGSNSLPHIKQHAVNAAAKLEKNRPQETGLTSEGDIEIFEIDEGM  2049
             + +L   K++KIY+W+G  +    KQ AV+  +                D+E+ +++EG 
Sbjct  600   AFVLHSGKSHKIYIWNGLGASAFEKQAAVDRFSDYWD------------DVELEQVEEGA  647

Query  2050  EPEEF---INALGQMNKKLYVSLEKDQLQEHTPRLFHLSSISKEFKSVEMLCPHRASLPT  2106
             EP+EF   +N  GQ ++    SL  D       RLFH    S  F  VE +  +      
Sbjct  648   EPDEFWEELNGEGQYDR----SLGDDGAPLLESRLFHCHLSSGGFLKVEEVAQYE-----  698

Query  2107  PFPFLQEDLYQVHQPALFLLDNKNELWIWQGWWPNTGAEDQSGSKAVRWQAERRAAMTMA  2166
                  QEDL       + LLD  +E+++W G+    G  ++   K           +  A
Sbjct  699   -----QEDL---DSDDIMLLDAGDEIYLWVGY----GVSEEENGK----------LLDTA  736

Query  2167  MQYWQRIHPETNKY---PIYLVWAGLEPLQFINLFPTW  2201
               Y+  + P    +    I  V  G EP  F  +FP W
Sbjct  737   KLYFN-LEPTARSFDTVSIIRVPQGKEPRVFKRMFPNW  773


 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 99/391 (25%), Positives = 163/391 (42%), Gaps = 75/391 (19%)

Query  1832  TMGIKVWHIDEFSHSLLDDSSVGQFHSADSYIVYWMYSVTVTGRELSGLPSKHSAKGRDR  1891
             T G+++W I+ F   +   ++ G+F++ DS+IV            L+ + +K   K    
Sbjct  69    TPGLEIWRIENFEPVIYPKTNYGKFYTGDSFIV------------LNTIENKKDKK-LSW  115

Query  1892  SVYFIWQGQNASLNEQGAAALLTIELD---NDQAPQIRVVQGYEPAAFLNLFSGGMIVHS  1948
              V+F W G   S +E GAAA+LT++LD   N    Q R VQ +E   FL+ F  G+    
Sbjct  116   DVHF-WLGLETSTDEAGAAAILTVQLDDLLNGGPVQHREVQDHESQLFLSYFKNGIRYEQ  174

Query  1949  G------KKTNVKCDKRWRLYICRGTLESEVSLIEIPCSTRQLRSRGSLILLDTKNNKIY  2002
             G      K          RL+  +G     V  + +  S+    + G   +LD  ++ IY
Sbjct  175   GGVGTGFKHVETNAQGETRLFQVKGKRNVRVRQVNLSVSS---MNTGDCFILDAGSD-IY  230

Query  2003  VWHGSNSLPHIKQHAVNAAAKLEKNRPQE-TGLTSEGDIEIFEIDEGMEPEEFINALGQM  2061
             V+ GS +    K  A++AA ++   R Q+  G      ++ F  D   + + F + LG  
Sbjct  231   VYVGSQAKRVEKLKAISAANQI---RDQDHNGRARVQIVDDFSTD--ADKQHFFDVLGSG  285

Query  2062  NKKLY---VSLEKDQLQEHTPR----LFHLSSISKEFKSVEMLCPHRASLPTPFPFLQED  2114
             +        + ++D   E T      L+ +S  S + K V+++           P  Q  
Sbjct  286   SADQVPDESTADEDSAFERTDAAAVSLYKVSDASGKLK-VDIIGQK--------PLTQAM  336

Query  2115  LYQVHQPALFLLDNKNELWIWQGWWPNTGAEDQSGSKAVRWQAERRAAMTMAMQYWQRIH  2174
             L        F+LD  + +++W G     GA           Q E+  AM  A ++ +   
Sbjct  337   L---DTRECFILDTGSGIFVWVG----KGAT----------QKEKTDAMAKAQEFLR---  376

Query  2175  PETNKYP----IYLVWAGLEPLQFINLFPTW  2201
               T KYP    I+ +  G E   F   F TW
Sbjct  377   --TKKYPAWTQIHRIVEGSESAPFKQYFDTW  405



Lambda      K        H
   0.311    0.127    0.359 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 30836202964


Query= XP_050573055.1 supervillin isoform X3 [Bombus affinis]

Length=2259
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

VILD_DICDI  unnamed protein product                                   184     5e-46
VILB_DICDI  unnamed protein product                                   163     4e-40
GELS_DROME  unnamed protein product                                   114     5e-25


>VILD_DICDI unnamed protein product
Length=1704

 Score = 184 bits (466),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 201/817 (25%), Positives = 348/817 (43%), Gaps = 148/817 (18%)

Query  1471  SSNRLQPYKDL---------MLLLIKGRRHVQVRLVEPVAESINSGDNFVLVTKSEVYNY  1521
             S++ L  Y DL         +L+ +KG+R ++VR+V+    S+N  ++F+L     ++ +
Sbjct  1008  SADDLTRYLDLTAIKNGKQKILIQVKGKRKIRVRMVKLSTSSLNCHNSFILDAGPRIFVW  1067

Query  1522  IGKYCNVIEKARGAEIALSIQQNKDLGCQTFQVITINEDKLTCTKSQLQKFWSYLGAENE  1581
              G   + + KA+  + A  I+  +  G  T   +    D+      Q   FW  LG  N 
Sbjct  1068  AGSKTSRVNKAKALDFANRIRTKERGGKSTLIQLDQGRDE------QSFDFWEILGG-NS  1120

Query  1582  NVDVIEGGHPDEDELYETFMIDTNMVYEIKDEELVPLEKYWGT---IPKIEMLDPNKVLV  1638
             +  +     P+E +          +  ++K   L     + GT   +P  E+L+   V V
Sbjct  1121  SDPIATTPTPEEQDTESIKTTIYRVGLDVKKNSLRARLAWEGTDWKLPNKEILNTKFVYV  1180

Query  1639  FDFGSEMYIWSGKGASTDKKKLATHLATEMWQEGYDYSECTVCPISAASMIGRRTMSKID  1698
              D  +E+++W GK +S+ ++K+AT +A                               + 
Sbjct  1181  VDCVTEIFVWVGKESSSIQRKMATKVA-------------------------------LV  1209

Query  1699  LKSAKVRPKWCLLAKLTQHVETILFREKFLDWPNVSRIIRIRGTKSKENVDGTVTIEVCN  1758
             L++ K R  W  + +LT+  E  LF+EKF ++P +  I   R  + K +V  T  +E   
Sbjct  1210  LQAQKDRVDWTKITRLTEFGENNLFKEKFANYPGMLPISTTR-QEIKSHV-ATSKVE-HK  1266

Query  1759  INNLLEENTIPVDLILEGTHLGRGTGWYDDEQMKQFIVTTMG-IKVWHIDEFSHSLLDDS  1817
             I  L    T P               + D+E +    +   G +KVW I+++        
Sbjct  1267  IETLASRMTTP---------------FIDNEALFTIPIDEGGRVKVWKIEDYEKIDHPQH  1311

Query  1818  SVGQFHSADSYIVYWMYSVTVTGRELSGLPSKHSAKGRDRSVYFIWQGQNASLNEQGAAA  1877
                QF S+DSYIV + Y                    ++  V + + G+++S+NE+G +A
Sbjct  1312  LYSQFFSSDSYIVLYTYM----------------QNNKEAHVIYYYLGRDSSINEKGTSA  1355

Query  1878  LLTIELDND---QAPQIRVVQGYEPAAFLNLFSGGMIVHSGKKTNVKCDKRWRLYICRGT  1934
              LT++L+        Q RVV   E   FLNLF   M++H GK  N    K+  LY  +G 
Sbjct  1356  YLTVDLNESLVGACVQTRVVANKECKNFLNLFKTKMVIHKGKYNNYD-PKKPSLYQVKGL  1414

Query  1935  LESEVSLIEIPCSTRQLRSRGSLILLDTKNNKIYVWHGSNSLPHIKQHAVNAAAKLEKNR  1994
              + ++  +++  S+  L +    IL   +  KIY+WHG  SL   +  A++ A       
Sbjct  1415  DKIDIRAVQVEFSSSMLNTLHVSILRTPE--KIYIWHGKFSLDAEQNSALSIAENFN---  1469

Query  1995  PQETGLTSEGDIEIFEIDEGMEPEEFINAL-------GQMNKKLYVSLEKDQLQEHTPRL  2047
                   ++   IEI +  EG E  EF +A           N  +  S        + PR 
Sbjct  1470  ------STSAPIEILK--EGSESNEFWSAFESTGGRQKYFNDIMIQSSSIPTSFTYKPRF  1521

Query  2048  FHLSSISKEFKSVEMLCPHRASLPTPFPFLQEDLYQVHQPALFLLDNKNELWIWQGWWPN  2107
             F  S+ S   +  E             PF Q+DL      ++ +LD ++ +++W      
Sbjct  1522  FVCSNASGIVEVTE-----------ESPFSQDDL---DIGSVCILDVQSHIYLW------  1561

Query  2108  TGAEDQSGSKAVRWQAERRAAMTMAMQYWQ--RIHPETNKYPIYLVWAGLEPLQFINLFP  2165
                    GS+A      +RA+M + + + +  ++        + +     EP+ F + F 
Sbjct  1562  ------IGSRAT--HRTKRASMEVVLNFIETSKLGHSKEHTKVLIATPFEEPIGFKSYFR  1613

Query  2166  TWT---YRDDIAELNIEDGRNPGEVLTVESELVRLTQSTYPPAQLLQRPLPEGVDPTHLE  2222
              W    Y  +   L  +DG      + VE  L    +  Y   +LL  PLP GVD T L+
Sbjct  1614  AWCTSKYPKNKLPLVEKDG------IPVEQVLKDYLKEIYTYEELLADPLPAGVDSTKLD  1667

Query  2223  LYLSQQHFQEILGMTKEEFQELPVWKQVNLKKEIGLF  2259
              YL+ + F+++  MT+ E+ ++P WK+  +KKE+ LF
Sbjct  1668  TYLNDEDFEKVFKMTRTEWLKIPAWKREGIKKELFLF  1704


>VILB_DICDI unnamed protein product
Length=959

 Score = 163 bits (412),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 179/727 (25%), Positives = 295/727 (41%), Gaps = 160/727 (22%)

Query  1479  KDLMLLLIKGRRHVQVRLVEPVAESINSGDNFVLVTKSEVYNYIGKYCNVIEKARGAEIA  1538
             K   L  +KGRR+++V+ V+  ++S+NSGD FVL  +  +Y + G   + +EK +G ++ 
Sbjct  191   KQYKLFHLKGRRNIRVKQVDISSKSLNSGDVFVLDCEDFIYQWNGSESSRLEKGKGLDLT  250

Query  1539  LSIQQNKDLGCQTFQVITINEDKLTCTKSQLQKFWSYLGAENENVDVIEGGHPDEDELYE  1598
             + ++  K       ++I ++E+    T     +FW  LG   ++V   E G   +D  YE
Sbjct  251   IRLRDEKSAKA---KIIVMDEND---TDKDHPEFWKRLGGCKDDVQKAEQG--GDDFAYE  302

Query  1599  TFMIDT-------NMVYEIKDEELVPLEKYWGTIPKIEMLDPNKVLVFDFGSEMYIWSGK  1651
                ++        N+ YE+    + P+    G +     L+     + D  +E+Y+W GK
Sbjct  303   KKSVEQIKLYQVENLNYEVHLHLIDPI----GDVYSTTQLNAEFCYILDCETELYVWLGK  358

Query  1652  GASTDKKKLATHLATEMWQEGYDYSECTVCPISAASMIGRRTMSKIDLKSAKVRPKWCLL  1711
              ++ D++ +A  +A  M                             DL     RP W  +
Sbjct  359   ASANDQRTVA--MANAM-----------------------------DLLHEDNRPSWTPI  387

Query  1712  AKLTQHVETILFREKFL--DW-----------PNVSRIIRIRGTKSKENVDGTVTIEVCN  1758
              K+TQ  E  LF++KF    W           P   + +  +  + K NVD     E   
Sbjct  388   IKMTQGSENTLFKDKFKKGSWGEYVNDNFEKKPITGKGVAAKAVQEKINVDALHNPEKYQ  447

Query  1759  INNLLEENTIPVDLILEGTHLGRGTGWYDDEQMKQFIVTTMGIKVWHIDEFSHSLLDDSS  1818
             ++    ++TIP    ++  H G                    +K+WH+   +   +  S 
Sbjct  448   LSKEERKSTIPTLHHVDDKHRGE-------------------LKIWHVRNRNKFEISQSE  488

Query  1819  VGQFHSADSYIVYWMYSVTVTGRELSGLPSKHSAKGRDRSVYFIWQGQNASLNEQGAAAL  1878
              G F++   Y+V               L +  +A G + S+ + WQG+ +S  ++GAAAL
Sbjct  489   FGLFYNQSCYLV---------------LFTLFAADGSNNSILYYWQGRFSSSEDKGAAAL  533

Query  1879  LTIELDND---QAPQIRVVQGYEPAAFLNLFSGGMIVHSGKKTNVKCDKRWR--------  1927
             L  ++  +       +R VQ  EP  FL  F G M+V  G + N   +            
Sbjct  534   LAKDVGKELHRSCIHVRTVQNKEPNHFLEHFQGRMVVFKGSRPNATTEVSLENLSSSLQG  593

Query  1928  LYICRGTLESEVSLIEIPCSTRQLRSRGSLILLDTKNNKIYVWHGSNSLPHIKQHAVNAA  1987
             LY  RGT    +  I++  +   L S  S IL++ KN   Y+W G        +++    
Sbjct  594   LYHVRGTEPINIHSIQVEKAISSLDSNDSFILVNFKNTISYIWVG--------KYSDEKE  645

Query  1988  AKLEKNRPQETGLTSEGDIEIFEIDEGMEPEEFINALGQMNKKLYVSLEKD---QL----  2040
             A L+ +    TG   +       IDEG E  EF  +L + N  L  SL KD   QL    
Sbjct  646   AALQISSNVFTGYNFQ------LIDEGDETSEFWESL-ETNSSL--SLLKDYYTQLRTVE  696

Query  2041  QEHTPRLFHLSSISKEFKSVEMLCPHRASLPTPFPFLQEDLYQVHQPALFLLDNKNELWI  2100
             QE   RLF  S+ S  FK  E+             F Q+DL       + +LDN+ ++++
Sbjct  697   QEKKTRLFQCSNNSGVFKVFEI-----------HDFSQDDL---DSDDVMILDNQKQIFV  742

Query  2101  WQGWWPNTGAEDQSGSKAVRWQAERRAAMTMAMQYWQRIHPETNKYPIYLVWAGLEPLQF  2160
             W       G E            E+  A   A++Y           PI+ +  G EP +F
Sbjct  743   W------VGKESSD--------TEKLMANETALEYIMNAPTHRRDDPIFTIQDGFEPHEF  788

Query  2161  INLFPTW  2167
                F  W
Sbjct  789   TFNFHAW  795


 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 34/59 (58%), Gaps = 1/59 (2%)

Query  2202  YPPAQLLQRP-LPEGVDPTHLELYLSQQHFQEILGMTKEEFQELPVWKQVNLKKEIGLF  2259
             YP + L Q+  LP  +D + L LYLS + F     MTKE FQ+ P WK   L+ + GLF
Sbjct  901   YPLSVLKQKTNLPNDIDKSCLHLYLSDEEFLSTFKMTKEIFQKTPAWKTKQLRVDNGLF  959


>GELS_DROME unnamed protein product
Length=798

 Score = 114 bits (284),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 162/698 (23%), Positives = 267/698 (38%), Gaps = 131/698 (19%)

Query  1483  LLLIKGRRHVQVRLVEPVAESINSGDNFVLVTKSEVYNYIGKYCNVIEKARGAEIALSIQ  1542
             L  +KG+R+V+VR V     S+N+GD F+L   S++Y Y+G     +EK +    A  I+
Sbjct  194   LFQVKGKRNVRVRQVNLSVSSMNTGDCFILDAGSDIYVYVGSQAKRVEKLKAISAANQIR  253

Query  1543  QNKDLGCQTFQVITINEDKLTCTKSQLQKFWSYLGAENENVDVIEGGHPDEDELYETFMI  1602
                  G    Q++    D  + T +  Q F+  LG+ + +  V +    DED  +E    
Sbjct  254   DQDHNGRARVQIV----DDFS-TDADKQHFFDVLGSGSAD-QVPDESTADEDSAFERTDA  307

Query  1603  DTNMVYEIKDEELVPLEKYWGTIPKIE-MLDPNKVLVFDFGSEMYIWSGKGASTDKKKLA  1661
                 +Y++ D          G  P  + MLD  +  + D GS +++W GKGA+  +K  A
Sbjct  308   AAVSLYKVSDASGKLKVDIIGQKPLTQAMLDTRECFILDTGSGIFVWVGKGATQKEKTDA  367

Query  1662  THLATEMWQEGYDYSECTVCPISAASMIGRRTMSKIDLKSAKVRPKWCLLAKLTQHVETI  1721
                A E                               L++ K  P W  + ++ +  E+ 
Sbjct  368   MAKAQEF------------------------------LRTKKY-PAWTQIHRIVEGSESA  396

Query  1722  LFREKFLDWPNVSRIIRIRGTKSKENVDGTVTIEVCNINNLLEENTIPVDLILEGTHLGR  1781
              F++ F  W       R  G      +   + I    + N  E +++   L   G   GR
Sbjct  397   PFKQYFDTW-------RDAGMSHSRLIRSALGIGSDELLNDDEIDSVVTQLKKSG---GR  446

Query  1782  GTGWYDDEQMKQFIVTTMGIKVWHIDEFSHSLLDDSSVGQFHSADSYIVYWMYSVTVTGR  1841
               G+  D         T  +     DE   S +            SY++ + Y       
Sbjct  447   AFGFMPDHGQNVIETITQYVAKPGSDEIVVSTVPFDEKLPLLGFASYVLTYNYEAN----  502

Query  1842  ELSGLPSKHSAKGRDRSVYFIWQG------QNASLNEQGAAALLTIELDNDQAPQIRVVQ  1895
                         G   S+ ++W G            E+G          +     ++  Q
Sbjct  503   -----------NGDTGSLTYVWHGVKASAAARKRAFEEGLVG-------SKDGLLVQTNQ  544

Query  1896  GYEPAAFLNLFSGGMIVHSGKKTNVKCDKRWRLYICRGTLESEVSLIEIPCSTRQLRSRG  1955
             G+EP  F  +F G ++  S     V      +L+  RGT+ES+V   E+   +  L S  
Sbjct  545   GHEPRHFYKIFKGKLLT-SFTALPVTA----QLFRIRGTVESDVHASEVAADSSSLASSD  599

Query  1956  SLILLDTKNNKIYVWHGSNSLPHIKQHAVNAAAKLEKNRPQETGLTSEGDIEIFEIDEGM  2015
             + +L   K++KIY+W+G  +    KQ AV+  +                D+E+ +++EG 
Sbjct  600   AFVLHSGKSHKIYIWNGLGASAFEKQAAVDRFSDYWD------------DVELEQVEEGA  647

Query  2016  EPEEF---INALGQMNKKLYVSLEKDQLQEHTPRLFHLSSISKEFKSVEMLCPHRASLPT  2072
             EP+EF   +N  GQ ++    SL  D       RLFH    S  F  VE +  +      
Sbjct  648   EPDEFWEELNGEGQYDR----SLGDDGAPLLESRLFHCHLSSGGFLKVEEVAQYE-----  698

Query  2073  PFPFLQEDLYQVHQPALFLLDNKNELWIWQGWWPNTGAEDQSGSKAVRWQAERRAAMTMA  2132
                  QEDL       + LLD  +E+++W G+    G  ++   K           +  A
Sbjct  699   -----QEDL---DSDDIMLLDAGDEIYLWVGY----GVSEEENGK----------LLDTA  736

Query  2133  MQYWQRIHPETNKY---PIYLVWAGLEPLQFINLFPTW  2167
               Y+  + P    +    I  V  G EP  F  +FP W
Sbjct  737   KLYFN-LEPTARSFDTVSIIRVPQGKEPRVFKRMFPNW  773


 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 99/391 (25%), Positives = 163/391 (42%), Gaps = 75/391 (19%)

Query  1798  TMGIKVWHIDEFSHSLLDDSSVGQFHSADSYIVYWMYSVTVTGRELSGLPSKHSAKGRDR  1857
             T G+++W I+ F   +   ++ G+F++ DS+IV            L+ + +K   K    
Sbjct  69    TPGLEIWRIENFEPVIYPKTNYGKFYTGDSFIV------------LNTIENKKDKK-LSW  115

Query  1858  SVYFIWQGQNASLNEQGAAALLTIELD---NDQAPQIRVVQGYEPAAFLNLFSGGMIVHS  1914
              V+F W G   S +E GAAA+LT++LD   N    Q R VQ +E   FL+ F  G+    
Sbjct  116   DVHF-WLGLETSTDEAGAAAILTVQLDDLLNGGPVQHREVQDHESQLFLSYFKNGIRYEQ  174

Query  1915  G------KKTNVKCDKRWRLYICRGTLESEVSLIEIPCSTRQLRSRGSLILLDTKNNKIY  1968
             G      K          RL+  +G     V  + +  S+    + G   +LD  ++ IY
Sbjct  175   GGVGTGFKHVETNAQGETRLFQVKGKRNVRVRQVNLSVSS---MNTGDCFILDAGSD-IY  230

Query  1969  VWHGSNSLPHIKQHAVNAAAKLEKNRPQE-TGLTSEGDIEIFEIDEGMEPEEFINALGQM  2027
             V+ GS +    K  A++AA ++   R Q+  G      ++ F  D   + + F + LG  
Sbjct  231   VYVGSQAKRVEKLKAISAANQI---RDQDHNGRARVQIVDDFSTD--ADKQHFFDVLGSG  285

Query  2028  NKKLY---VSLEKDQLQEHTPR----LFHLSSISKEFKSVEMLCPHRASLPTPFPFLQED  2080
             +        + ++D   E T      L+ +S  S + K V+++           P  Q  
Sbjct  286   SADQVPDESTADEDSAFERTDAAAVSLYKVSDASGKLK-VDIIGQK--------PLTQAM  336

Query  2081  LYQVHQPALFLLDNKNELWIWQGWWPNTGAEDQSGSKAVRWQAERRAAMTMAMQYWQRIH  2140
             L        F+LD  + +++W G     GA           Q E+  AM  A ++ +   
Sbjct  337   L---DTRECFILDTGSGIFVWVG----KGAT----------QKEKTDAMAKAQEFLR---  376

Query  2141  PETNKYP----IYLVWAGLEPLQFINLFPTW  2167
               T KYP    I+ +  G E   F   F TW
Sbjct  377   --TKKYPAWTQIHRIVEGSESAPFKQYFDTW  405



Lambda      K        H
   0.311    0.127    0.359 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 30836202964


Query= XP_050573056.1 uncharacterized protein LOC126913872 isoform X1
[Bombus affinis]

Length=2047
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9GQA3_DROME  unnamed protein product                                 575     2e-176
M9NFI9_DROME  unnamed protein product                                 579     8e-172
M9NEY3_DROME  unnamed protein product                                 578     1e-171


>Q9GQA3_DROME unnamed protein product
Length=1330

 Score = 575 bits (1482),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 353/692 (51%), Positives = 421/692 (61%), Gaps = 111/692 (16%)

Query  1094  DNTPDWLSDVLSAPDTSLINSTI----------------NDYSLSHRSRSDLTI------  1131
             D+ P+WL DVL AP  SL N  I                N Y L H   SDL        
Sbjct  233   DDEPEWLRDVLEAPKRSLENLLITSATSSRAPGQREELENGYDL-HEKHSDLNQTYITGG  291

Query  1132  DSLTESQVGSVTGSESGLLGSVNSLND---------TYEINDD-------------TETE  1169
             +SL ES V   +      L    +++D         TY + D              TE +
Sbjct  292   ESLHESIVSVESTQSDATLNQTTTIDDSIISSKHNSTYSLADAEQATSSTVLSTGVTELD  351

Query  1170  HQDEYVP---PTPGKVVLVENGVHYFEDGHFWMEVAGIPESDDEKDDYPTNIPIKKMSKV  1226
                 Y+P   P   K VLVE GVHYFEDG+FWMEV G+ + DD+   YP  I ++K  KV
Sbjct  352   DSQYYIPEYPPVRSKEVLVEAGVHYFEDGNFWMEVPGLLDFDDDDCSYPP-ITVRKNPKV  410

Query  1227  SFDTKPMRVYSTHSVNEYDRRNEDVDPVAASAEYELEKRVEKMEVFPVELMKGPEGLGLS  1286
              F + P+ V ST SVN+YDRRNEDVDPVAASAEYELEKRVEKM VFPVELMKGPEGLGLS
Sbjct  411   RFSSGPIHVCSTFSVNDYDRRNEDVDPVAASAEYELEKRVEKMHVFPVELMKGPEGLGLS  470

Query  1287  IIGMGVGADAGLEKLGIFVKTITEKGAAAREGRIQVNDQIVEVDGKSLVGVTQAYAASVL  1346
             IIGMGVGADAGLEKLGIFVKTIT+ GAAAR+GRIQVNDQI+EVDGKSLVGVTQAYAASVL
Sbjct  471   IIGMGVGADAGLEKLGIFVKTITDNGAAARDGRIQVNDQIIEVDGKSLVGVTQAYAASVL  530

Query  1347  RNTSGLVRFVIGRERDP-NSEVAMLIRQSLQADKE------REQQANSARKLNFSDASPD  1399
             RNTSGLV+F IGRERDP NSEVA LIR SLQAD+E      R+Q+    R L++S+ S  
Sbjct  531   RNTSGLVKFQIGRERDPENSEVAQLIRLSLQADREKEERLKRQQEEYLRRTLDYSEDST-  589

Query  1400  SQRGSEDISVGGMGGIPGSPAMSSCSEGEPPQSPIENYLSSSGRSRSPIISSSMPPHTSA  1459
                                P  ++ S  E P SP++                  P    A
Sbjct  590   ------------------QPVSANSSVCEGPSSPVQ---------------VEHPMEVEA  616

Query  1460  TTQNDVDSLRLLLQESQYKLALADGEVEKLKAKLVDLENSGAGSEEYAAKLRESGLRLHE  1519
             T   +V+SL+ LLQES+    + +  ++ LK KLV LE +G  +E  + +LR       +
Sbjct  617   THSQEVESLKRLLQESEMGCLVKEEIIQNLKRKLVKLETTGNENELLSERLR-------Q  669

Query  1520  SERALGTARQDLIAAREMLSQATAQNAALQQKYARARRAARELR---TDIAARDEFYQQL  1576
             SER LG  R++    + ML Q+  Q  AL +KY +A+R  RE +    D+  R+EFYQQL
Sbjct  670   SERELGNIRKEAANLQNMLQQSQGQYMALDKKYNKAKRLVREYQQRELDMCHREEFYQQL  729

Query  1577  LQEKDTEYNALVKSLKDRVITLEVELTETQRRFGLPVRLPYDGTTARIVTPQLSRRQLPP  1636
             LQEKDTEYNALVK LKDRVI LE EL ETQR+ G PV LPYD  T ++ TPQ+ R+  PP
Sbjct  730   LQEKDTEYNALVKKLKDRVINLEHELQETQRKAGFPVGLPYDSATLKL-TPQMMRKT-PP  787

Query  1637  PP--SSTSCQLSDTETSDLSSPDDGDKTATVERKLPLPLPVKEELDRAVPAHRLLDNSAG  1694
              P       +LSDTE SDLS   DG KTATVERK    +PVK+ELD AVP H LLDNS  
Sbjct  788   KPLFHKLETELSDTEISDLSPDGDGVKTATVERK----VPVKDELDAAVPQHELLDNSIN  843

Query  1695  KSKAELASRGGLANRQLPKRSGGLSNSSSDYG  1726
             K+K +LASRGGLANRQLP  +G   NSS+  G
Sbjct  844   KTKIDLASRGGLANRQLPSANG---NSSTSNG  872


 Score = 146 bits (368),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 92/219 (42%), Positives = 129/219 (59%), Gaps = 19/219 (9%)

Query  1815  PPASFAEQLKQVLAERERRLGGNDMSSSRESSGDFSDLNNPHSSDPALVTHHLVEEIRQA  1874
             P +SF +QL Q L++RERRLG     SSR SS D++++N   S+  A+    L+ EIRQA
Sbjct  1104  PGSSFTDQLNQALSDRERRLGD---GSSRHSSDDYTEINKSQSA-AAINCKTLINEIRQA  1159

Query  1875  VSEANQRVKKATIPSSNLIGSGSTPWHHPGSSPSSLSSGGSVSPPAVDPSPSKTDTSEVW  1934
             V+EA  +   A         +   P HH  +SP+S+SSG S SP     SPS+T      
Sbjct  1160  VNEAQPKGALAAAAPPANPAAAVRP-HHRSASPTSMSSGCS-SPGY---SPSRT------  1208

Query  1935  LPPHPSDFGLGDKKS----HFWQNAPVTDWSKEQVCQWLSGIGLERYAPRFLETGINGGN  1990
             L    S     D+K+    + ++  PV +W+K+QV  WL GI LERY P F E  + GG 
Sbjct  1209  LDLSGSSSSFSDRKAMAAGYTYKGGPVHEWTKDQVGHWLMGIELERYIPVFKENNVEGGA  1268

Query  1991  LLRLESRDLKAFGICGDEKSHLKRKLKELRAQADRERKE  2029
             LL L+S+D K  GICGD+K  LK++LK+L+A  ++ERK+
Sbjct  1269  LLTLDSKDFKTLGICGDDKHRLKKRLKDLKANIEKERKD  1307


 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 1/41 (2%)

Query  1023  PDTMTADEAENLLSSRILEKKIRQGSALLSDEEAQEIARLL  1063
             PD MTA EAE LLSS ILE KIRQ S LLSDE+A+E+ ++L
Sbjct  55    PDDMTAAEAERLLSSSILENKIRQQS-LLSDEQAKEVEQIL  94


>M9NFI9_DROME unnamed protein product
Length=2148

 Score = 579 bits (1493),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 357/692 (52%), Positives = 426/692 (62%), Gaps = 111/692 (16%)

Query  1094  DNTPDWLSDVLSAPDTSLINSTI----------------NDYSLSHRSRSDLTI------  1131
             D+ P+WL DVL AP  SL N  I                N Y L H   SDL        
Sbjct  1037  DDEPEWLRDVLEAPKRSLENLLITSATSSRAPGQREELENGYDL-HEKHSDLNQTYITGG  1095

Query  1132  DSLTESQVGSVTGSESGLLGSVNSLND---------TYEINDD-------------TETE  1169
             +SL ES V   +      L    +++D         TY + D              TE +
Sbjct  1096  ESLHESIVSVESTQSDATLNQTTTIDDSIISSKHNSTYSLADAEQATSSTVLSTGVTELD  1155

Query  1170  HQDEYVP---PTPGKVVLVENGVHYFEDGHFWMEVAGIPESDDEKDDYPTNIPIKKMSKV  1226
                 Y+P   P   K VLVE GVHYFEDG+FWMEV G+ + DD+   YP  I ++K  KV
Sbjct  1156  DSQYYIPEYPPVRSKEVLVEAGVHYFEDGNFWMEVPGLLDFDDDDCSYPP-ITVRKNPKV  1214

Query  1227  SFDTKPMRVYSTHSVNEYDRRNEDVDPVAASAEYELEKRVEKMEVFPVELMKGPEGLGLS  1286
              F + P+ VYST SVN+YDRRNEDVDPVAASAEYELEKRVEKM VFPVELMKGPEGLGLS
Sbjct  1215  RFSSGPIHVYSTFSVNDYDRRNEDVDPVAASAEYELEKRVEKMHVFPVELMKGPEGLGLS  1274

Query  1287  IIGMGVGADAGLEKLGIFVKTITEKGAAAREGRIQVNDQIVEVDGKSLVGVTQAYAASVL  1346
             IIGMGVGADAGLEKLGIFVKTIT+ GAAAR+GRIQVNDQI+EVDGKSLVGVTQAYAASVL
Sbjct  1275  IIGMGVGADAGLEKLGIFVKTITDNGAAARDGRIQVNDQIIEVDGKSLVGVTQAYAASVL  1334

Query  1347  RNTSGLVRFVIGRERDP-NSEVAMLIRQSLQADKE------REQQANSARKLNFSDASPD  1399
             RNTSGLV+F IGRERDP NSEVA LIR SLQAD+E      R+Q+    R L++S+ S  
Sbjct  1335  RNTSGLVKFQIGRERDPENSEVAQLIRLSLQADREKEERLKRQQEEYLRRTLDYSEDS--  1392

Query  1400  SQRGSEDISVGGMGGIPGSPAMSSCSEGEPPQSPIENYLSSSGRSRSPIISSSMPPHTSA  1459
                 ++ +S           A SS  EG  P SP++                  P    A
Sbjct  1393  ----TQPVS-----------ANSSVCEG--PSSPVQ---------------VEHPMEVEA  1420

Query  1460  TTQNDVDSLRLLLQESQYKLALADGEVEKLKAKLVDLENSGAGSEEYAAKLRESGLRLHE  1519
             T   +V+SL+ LLQES+    + +  ++ LK KLV LE +G  +E  + +LR       +
Sbjct  1421  THSQEVESLKRLLQESEMGCLVKEEIIQNLKRKLVKLETTGNENELLSERLR-------Q  1473

Query  1520  SERALGTARQDLIAAREMLSQATAQNAALQQKYARARRAARELR---TDIAARDEFYQQL  1576
             SER LG  R++    + ML Q+  Q  AL +KY +A+R  RE +    D+  R+EFYQQL
Sbjct  1474  SERELGNIRKEAANLQNMLQQSQGQYMALDKKYNKAKRLVREYQQRELDMCHREEFYQQL  1533

Query  1577  LQEKDTEYNALVKSLKDRVITLEVELTETQRRFGLPVRLPYDGTTARIVTPQLSRRQLPP  1636
             LQEKDTEYNALVK LKDRVI LE EL ETQR+ G PV LPYD  T ++ TPQ+ R+  PP
Sbjct  1534  LQEKDTEYNALVKKLKDRVINLEHELQETQRKAGFPVGLPYDSATLKL-TPQMMRKT-PP  1591

Query  1637  PP--SSTSCQLSDTETSDLSSPDDGDKTATVERKLPLPLPVKEELDRAVPAHRLLDNSAG  1694
              P       +LSDTE SDLS   DG KTATVERK    +PVK+ELD AVP H LLDNS  
Sbjct  1592  KPLFHKLETELSDTEISDLSPDGDGVKTATVERK----VPVKDELDAAVPQHELLDNSIN  1647

Query  1695  KSKAELASRGGLANRQLPKRSGGLSNSSSDYG  1726
             K+K +LASRGGLANRQLP  +G   NSS+  G
Sbjct  1648  KTKIDLASRGGLANRQLPSANG---NSSTSNG  1676


 Score = 148 bits (373),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 97/234 (41%), Positives = 135/234 (58%), Gaps = 35/234 (15%)

Query  1815  PPASFAEQLKQVLAERERRLGGNDMSSSRESSGDFSDLNNPHSSDPALVTHHLVEEIRQA  1874
             P +SF +QL Q L++RERRLG     SSR SS D++++N   S+  A+    L+ EIRQA
Sbjct  1908  PGSSFTDQLNQALSDRERRLGDG---SSRHSSDDYTEINKSQSA-AAINCKTLINEIRQA  1963

Query  1875  VSEANQRVKKATIPSSNLIGSGSTPW--------------HHPGS-SPSSLSSGGSVSPP  1919
             V+EA  +VK+  +P S L   G+ PW              H  G  SP+S+SSG   S P
Sbjct  1964  VNEAQPKVKQ-VVPQS-LSPPGTVPWQQQHHQQIQQQPSAHTTGPPSPTSMSSG--CSSP  2019

Query  1920  AVDPSPSKTDTSEVWLPPHPSDFGLGDKKS----HFWQNAPVTDWSKEQVCQWLSGIGLE  1975
                 SPS+T      L    S     D+K+    + ++  PV +W+K+QV  WL GI LE
Sbjct  2020  GY--SPSRT------LDLSGSSSSFSDRKAMAAGYTYKGGPVHEWTKDQVGHWLMGIELE  2071

Query  1976  RYAPRFLETGINGGNLLRLESRDLKAFGICGDEKSHLKRKLKELRAQADRERKE  2029
             RY P F E  + GG LL L+S+D K  GICGD+K  LK++LK+L+A  ++ERK+
Sbjct  2072  RYIPVFKENNVEGGALLTLDSKDFKTLGICGDDKHRLKKRLKDLKANIEKERKD  2125


 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 82/247 (33%), Positives = 108/247 (44%), Gaps = 41/247 (17%)

Query  14   KVSAIANIFQSKP-------QLDNLIHRTNNILSDGFKEPAVPLKESPTQVTVVRTESHV  66
            KVS IANIFQ KP       QL  +        +         ++ +P     VRTESH 
Sbjct  14   KVSQIANIFQRKPIEIQPVEQLSAVAAAHAAAAAAAAAAHHAHVQGAPA----VRTESHS  69

Query  67   ARFNNARALFEKLGEENKPNKPVDRITKPSNLHGLRSRSSSANSGSGCTSPARSPRPRSP  126
            ARFNNARALFEKLG E+  N    R+ +  +        S  +S          P+ R+P
Sbjct  70   ARFNNARALFEKLGVESNSNV-SSRLLRSGSREDNLCDGSDRSSSRSSDRSQSPPKRRTP  128

Query  127  SPPGTRDHLSNWSASVPALNA---ERHFENG--------------------HNHG-LDNI  162
             P G     +N +A++ A N    E+   N                     HN   L + 
Sbjct  129  FPSGVSLVHNNNNAAIVAQNGVPPEQRLSNSKFIVEPAAQVVPTSVVKYPQHNISRLKSE  188

Query  163  PDKHKSRAGFGKFDKNYGKENRLDDRPEKPEKPERRLNSKELIEKQKNWTSHFSKTRPSR  222
                      G     +       D+P   EKPER+ NS+ELIEKQK WTSHF+KT+ +R
Sbjct  189  EPSPVPPPASGSVSALFASSG--GDKP---EKPERKFNSRELIEKQKKWTSHFTKTKTTR  243

Query  223  YNSDPNR  229
             +SD NR
Sbjct  244  THSDLNR  250


 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 1/41 (2%)

Query  1023  PDTMTADEAENLLSSRILEKKIRQGSALLSDEEAQEIARLL  1063
             PD MTA EAE LLSS ILE KIRQ S LLSDE+A+E+ ++L
Sbjct  859   PDDMTAAEAERLLSSSILENKIRQQS-LLSDEQAKEVEQIL  898


 Score = 37.7 bits (86),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 15/24 (63%), Positives = 21/24 (88%), Gaps = 0/24 (0%)

Query  652  RRSHVRVDLQAAGLGQRPPSVISS  675
            +RS + V++ AAGLGQRPPS+IS+
Sbjct  537  KRSSITVNMPAAGLGQRPPSIIST  560


>M9NEY3_DROME unnamed protein product
Length=2134

 Score = 578 bits (1491),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 357/692 (52%), Positives = 426/692 (62%), Gaps = 111/692 (16%)

Query  1094  DNTPDWLSDVLSAPDTSLINSTI----------------NDYSLSHRSRSDLTI------  1131
             D+ P+WL DVL AP  SL N  I                N Y L H   SDL        
Sbjct  1037  DDEPEWLRDVLEAPKRSLENLLITSATSSRAPGQREELENGYDL-HEKHSDLNQTYITGG  1095

Query  1132  DSLTESQVGSVTGSESGLLGSVNSLND---------TYEINDD-------------TETE  1169
             +SL ES V   +      L    +++D         TY + D              TE +
Sbjct  1096  ESLHESIVSVESTQSDATLNQTTTIDDSIISSKHNSTYSLADAEQATSSTVLSTGVTELD  1155

Query  1170  HQDEYVP---PTPGKVVLVENGVHYFEDGHFWMEVAGIPESDDEKDDYPTNIPIKKMSKV  1226
                 Y+P   P   K VLVE GVHYFEDG+FWMEV G+ + DD+   YP  I ++K  KV
Sbjct  1156  DSQYYIPEYPPVRSKEVLVEAGVHYFEDGNFWMEVPGLLDFDDDDCSYPP-ITVRKNPKV  1214

Query  1227  SFDTKPMRVYSTHSVNEYDRRNEDVDPVAASAEYELEKRVEKMEVFPVELMKGPEGLGLS  1286
              F + P+ VYST SVN+YDRRNEDVDPVAASAEYELEKRVEKM VFPVELMKGPEGLGLS
Sbjct  1215  RFSSGPIHVYSTFSVNDYDRRNEDVDPVAASAEYELEKRVEKMHVFPVELMKGPEGLGLS  1274

Query  1287  IIGMGVGADAGLEKLGIFVKTITEKGAAAREGRIQVNDQIVEVDGKSLVGVTQAYAASVL  1346
             IIGMGVGADAGLEKLGIFVKTIT+ GAAAR+GRIQVNDQI+EVDGKSLVGVTQAYAASVL
Sbjct  1275  IIGMGVGADAGLEKLGIFVKTITDNGAAARDGRIQVNDQIIEVDGKSLVGVTQAYAASVL  1334

Query  1347  RNTSGLVRFVIGRERDP-NSEVAMLIRQSLQADKE------REQQANSARKLNFSDASPD  1399
             RNTSGLV+F IGRERDP NSEVA LIR SLQAD+E      R+Q+    R L++S+ S  
Sbjct  1335  RNTSGLVKFQIGRERDPENSEVAQLIRLSLQADREKEERLKRQQEEYLRRTLDYSEDS--  1392

Query  1400  SQRGSEDISVGGMGGIPGSPAMSSCSEGEPPQSPIENYLSSSGRSRSPIISSSMPPHTSA  1459
                 ++ +S           A SS  EG  P SP++                  P    A
Sbjct  1393  ----TQPVS-----------ANSSVCEG--PSSPVQ---------------VEHPMEVEA  1420

Query  1460  TTQNDVDSLRLLLQESQYKLALADGEVEKLKAKLVDLENSGAGSEEYAAKLRESGLRLHE  1519
             T   +V+SL+ LLQES+    + +  ++ LK KLV LE +G  +E  + +LR       +
Sbjct  1421  THSQEVESLKRLLQESEMGCLVKEEIIQNLKRKLVKLETTGNENELLSERLR-------Q  1473

Query  1520  SERALGTARQDLIAAREMLSQATAQNAALQQKYARARRAARELR---TDIAARDEFYQQL  1576
             SER LG  R++    + ML Q+  Q  AL +KY +A+R  RE +    D+  R+EFYQQL
Sbjct  1474  SERELGNIRKEAANLQNMLQQSQGQYMALDKKYNKAKRLVREYQQRELDMCHREEFYQQL  1533

Query  1577  LQEKDTEYNALVKSLKDRVITLEVELTETQRRFGLPVRLPYDGTTARIVTPQLSRRQLPP  1636
             LQEKDTEYNALVK LKDRVI LE EL ETQR+ G PV LPYD  T ++ TPQ+ R+  PP
Sbjct  1534  LQEKDTEYNALVKKLKDRVINLEHELQETQRKAGFPVGLPYDSATLKL-TPQMMRKT-PP  1591

Query  1637  PP--SSTSCQLSDTETSDLSSPDDGDKTATVERKLPLPLPVKEELDRAVPAHRLLDNSAG  1694
              P       +LSDTE SDLS   DG KTATVERK    +PVK+ELD AVP H LLDNS  
Sbjct  1592  KPLFHKLETELSDTEISDLSPDGDGVKTATVERK----VPVKDELDAAVPQHELLDNSIN  1647

Query  1695  KSKAELASRGGLANRQLPKRSGGLSNSSSDYG  1726
             K+K +LASRGGLANRQLP  +G   NSS+  G
Sbjct  1648  KTKIDLASRGGLANRQLPSANG---NSSTSNG  1676


 Score = 139 bits (351),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 91/227 (40%), Positives = 129/227 (57%), Gaps = 35/227 (15%)

Query  1815  PPASFAEQLKQVLAERERRLGGNDMSSSRESSGDFSDLNNPHSSDPALVTHHLVEEIRQA  1874
             P +SF +QL Q L++RERRLG     SSR SS D++++N   S+  A+    L+ EIRQA
Sbjct  1908  PGSSFTDQLNQALSDRERRLGDG---SSRHSSDDYTEINKSQSA-AAINCKTLINEIRQA  1963

Query  1875  VSEANQRV--------KKATIPSSNLIGSGSTPWHHPGSSPSSLSSGGSVSPPAVDPSPS  1926
             V+EA  +V        +    PS++  G           SP+S+SSG   S P    SPS
Sbjct  1964  VNEAQPKVPWQQQHHQQIQQQPSAHTTGP---------PSPTSMSSG--CSSPGY--SPS  2010

Query  1927  KTDTSEVWLPPHPSDFGLGDKKS----HFWQNAPVTDWSKEQVCQWLSGIGLERYAPRFL  1982
             +T      L    S     D+K+    + ++  PV +W+K+QV  WL GI LERY P F 
Sbjct  2011  RT------LDLSGSSSSFSDRKAMAAGYTYKGGPVHEWTKDQVGHWLMGIELERYIPVFK  2064

Query  1983  ETGINGGNLLRLESRDLKAFGICGDEKSHLKRKLKELRAQADRERKE  2029
             E  + GG LL L+S+D K  GICGD+K  LK++LK+L+A  ++ERK+
Sbjct  2065  ENNVEGGALLTLDSKDFKTLGICGDDKHRLKKRLKDLKANIEKERKD  2111


 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 82/247 (33%), Positives = 108/247 (44%), Gaps = 41/247 (17%)

Query  14   KVSAIANIFQSKP-------QLDNLIHRTNNILSDGFKEPAVPLKESPTQVTVVRTESHV  66
            KVS IANIFQ KP       QL  +        +         ++ +P     VRTESH 
Sbjct  14   KVSQIANIFQRKPIEIQPVEQLSAVAAAHAAAAAAAAAAHHAHVQGAPA----VRTESHS  69

Query  67   ARFNNARALFEKLGEENKPNKPVDRITKPSNLHGLRSRSSSANSGSGCTSPARSPRPRSP  126
            ARFNNARALFEKLG E+  N    R+ +  +        S  +S          P+ R+P
Sbjct  70   ARFNNARALFEKLGVESNSNVS-SRLLRSGSREDNLCDGSDRSSSRSSDRSQSPPKRRTP  128

Query  127  SPPGTRDHLSNWSASVPALNA---ERHFENG--------------------HNHG-LDNI  162
             P G     +N +A++ A N    E+   N                     HN   L + 
Sbjct  129  FPSGVSLVHNNNNAAIVAQNGVPPEQRLSNSKFIVEPAAQVVPTSVVKYPQHNISRLKSE  188

Query  163  PDKHKSRAGFGKFDKNYGKENRLDDRPEKPEKPERRLNSKELIEKQKNWTSHFSKTRPSR  222
                      G     +       D+P   EKPER+ NS+ELIEKQK WTSHF+KT+ +R
Sbjct  189  EPSPVPPPASGSVSALFASSG--GDKP---EKPERKFNSRELIEKQKKWTSHFTKTKTTR  243

Query  223  YNSDPNR  229
             +SD NR
Sbjct  244  THSDLNR  250


 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 1/41 (2%)

Query  1023  PDTMTADEAENLLSSRILEKKIRQGSALLSDEEAQEIARLL  1063
             PD MTA EAE LLSS ILE KIRQ S LLSDE+A+E+ ++L
Sbjct  859   PDDMTAAEAERLLSSSILENKIRQQS-LLSDEQAKEVEQIL  898


 Score = 37.7 bits (86),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 15/24 (63%), Positives = 21/24 (88%), Gaps = 0/24 (0%)

Query  652  RRSHVRVDLQAAGLGQRPPSVISS  675
            +RS + V++ AAGLGQRPPS+IS+
Sbjct  537  KRSSITVNMPAAGLGQRPPSIIST  560



Lambda      K        H
   0.311    0.127    0.359 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 30836202964


Query= XP_050573057.1 uncharacterized protein LOC126913872 isoform X1
[Bombus affinis]

Length=2047
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9GQA3_DROME  unnamed protein product                                 575     2e-176
M9NFI9_DROME  unnamed protein product                                 579     8e-172
M9NEY3_DROME  unnamed protein product                                 578     1e-171


>Q9GQA3_DROME unnamed protein product
Length=1330

 Score = 575 bits (1482),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 353/692 (51%), Positives = 421/692 (61%), Gaps = 111/692 (16%)

Query  1094  DNTPDWLSDVLSAPDTSLINSTI----------------NDYSLSHRSRSDLTI------  1131
             D+ P+WL DVL AP  SL N  I                N Y L H   SDL        
Sbjct  233   DDEPEWLRDVLEAPKRSLENLLITSATSSRAPGQREELENGYDL-HEKHSDLNQTYITGG  291

Query  1132  DSLTESQVGSVTGSESGLLGSVNSLND---------TYEINDD-------------TETE  1169
             +SL ES V   +      L    +++D         TY + D              TE +
Sbjct  292   ESLHESIVSVESTQSDATLNQTTTIDDSIISSKHNSTYSLADAEQATSSTVLSTGVTELD  351

Query  1170  HQDEYVP---PTPGKVVLVENGVHYFEDGHFWMEVAGIPESDDEKDDYPTNIPIKKMSKV  1226
                 Y+P   P   K VLVE GVHYFEDG+FWMEV G+ + DD+   YP  I ++K  KV
Sbjct  352   DSQYYIPEYPPVRSKEVLVEAGVHYFEDGNFWMEVPGLLDFDDDDCSYPP-ITVRKNPKV  410

Query  1227  SFDTKPMRVYSTHSVNEYDRRNEDVDPVAASAEYELEKRVEKMEVFPVELMKGPEGLGLS  1286
              F + P+ V ST SVN+YDRRNEDVDPVAASAEYELEKRVEKM VFPVELMKGPEGLGLS
Sbjct  411   RFSSGPIHVCSTFSVNDYDRRNEDVDPVAASAEYELEKRVEKMHVFPVELMKGPEGLGLS  470

Query  1287  IIGMGVGADAGLEKLGIFVKTITEKGAAAREGRIQVNDQIVEVDGKSLVGVTQAYAASVL  1346
             IIGMGVGADAGLEKLGIFVKTIT+ GAAAR+GRIQVNDQI+EVDGKSLVGVTQAYAASVL
Sbjct  471   IIGMGVGADAGLEKLGIFVKTITDNGAAARDGRIQVNDQIIEVDGKSLVGVTQAYAASVL  530

Query  1347  RNTSGLVRFVIGRERDP-NSEVAMLIRQSLQADKE------REQQANSARKLNFSDASPD  1399
             RNTSGLV+F IGRERDP NSEVA LIR SLQAD+E      R+Q+    R L++S+ S  
Sbjct  531   RNTSGLVKFQIGRERDPENSEVAQLIRLSLQADREKEERLKRQQEEYLRRTLDYSEDST-  589

Query  1400  SQRGSEDISVGGMGGIPGSPAMSSCSEGEPPQSPIENYLSSSGRSRSPIISSSMPPHTSA  1459
                                P  ++ S  E P SP++                  P    A
Sbjct  590   ------------------QPVSANSSVCEGPSSPVQ---------------VEHPMEVEA  616

Query  1460  TTQNDVDSLRLLLQESQYKLALADGEVEKLKAKLVDLENSGAGSEEYAAKLRESGLRLHE  1519
             T   +V+SL+ LLQES+    + +  ++ LK KLV LE +G  +E  + +LR       +
Sbjct  617   THSQEVESLKRLLQESEMGCLVKEEIIQNLKRKLVKLETTGNENELLSERLR-------Q  669

Query  1520  SERALGTARQDLIAAREMLSQATAQNAALQQKYARARRAARELR---TDIAARDEFYQQL  1576
             SER LG  R++    + ML Q+  Q  AL +KY +A+R  RE +    D+  R+EFYQQL
Sbjct  670   SERELGNIRKEAANLQNMLQQSQGQYMALDKKYNKAKRLVREYQQRELDMCHREEFYQQL  729

Query  1577  LQEKDTEYNALVKSLKDRVITLEVELTETQRRFGLPVRLPYDGTTARIVTPQLSRRQLPP  1636
             LQEKDTEYNALVK LKDRVI LE EL ETQR+ G PV LPYD  T ++ TPQ+ R+  PP
Sbjct  730   LQEKDTEYNALVKKLKDRVINLEHELQETQRKAGFPVGLPYDSATLKL-TPQMMRKT-PP  787

Query  1637  PP--SSTSCQLSDTETSDLSSPDDGDKTATVERKLPLPLPVKEELDRAVPAHRLLDNSAG  1694
              P       +LSDTE SDLS   DG KTATVERK    +PVK+ELD AVP H LLDNS  
Sbjct  788   KPLFHKLETELSDTEISDLSPDGDGVKTATVERK----VPVKDELDAAVPQHELLDNSIN  843

Query  1695  KSKAELASRGGLANRQLPKRSGGLSNSSSDYG  1726
             K+K +LASRGGLANRQLP  +G   NSS+  G
Sbjct  844   KTKIDLASRGGLANRQLPSANG---NSSTSNG  872


 Score = 146 bits (368),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 92/219 (42%), Positives = 129/219 (59%), Gaps = 19/219 (9%)

Query  1815  PPASFAEQLKQVLAERERRLGGNDMSSSRESSGDFSDLNNPHSSDPALVTHHLVEEIRQA  1874
             P +SF +QL Q L++RERRLG     SSR SS D++++N   S+  A+    L+ EIRQA
Sbjct  1104  PGSSFTDQLNQALSDRERRLGD---GSSRHSSDDYTEINKSQSA-AAINCKTLINEIRQA  1159

Query  1875  VSEANQRVKKATIPSSNLIGSGSTPWHHPGSSPSSLSSGGSVSPPAVDPSPSKTDTSEVW  1934
             V+EA  +   A         +   P HH  +SP+S+SSG S SP     SPS+T      
Sbjct  1160  VNEAQPKGALAAAAPPANPAAAVRP-HHRSASPTSMSSGCS-SPGY---SPSRT------  1208

Query  1935  LPPHPSDFGLGDKKS----HFWQNAPVTDWSKEQVCQWLSGIGLERYAPRFLETGINGGN  1990
             L    S     D+K+    + ++  PV +W+K+QV  WL GI LERY P F E  + GG 
Sbjct  1209  LDLSGSSSSFSDRKAMAAGYTYKGGPVHEWTKDQVGHWLMGIELERYIPVFKENNVEGGA  1268

Query  1991  LLRLESRDLKAFGICGDEKSHLKRKLKELRAQADRERKE  2029
             LL L+S+D K  GICGD+K  LK++LK+L+A  ++ERK+
Sbjct  1269  LLTLDSKDFKTLGICGDDKHRLKKRLKDLKANIEKERKD  1307


 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 1/41 (2%)

Query  1023  PDTMTADEAENLLSSRILEKKIRQGSALLSDEEAQEIARLL  1063
             PD MTA EAE LLSS ILE KIRQ S LLSDE+A+E+ ++L
Sbjct  55    PDDMTAAEAERLLSSSILENKIRQQS-LLSDEQAKEVEQIL  94


>M9NFI9_DROME unnamed protein product
Length=2148

 Score = 579 bits (1493),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 357/692 (52%), Positives = 426/692 (62%), Gaps = 111/692 (16%)

Query  1094  DNTPDWLSDVLSAPDTSLINSTI----------------NDYSLSHRSRSDLTI------  1131
             D+ P+WL DVL AP  SL N  I                N Y L H   SDL        
Sbjct  1037  DDEPEWLRDVLEAPKRSLENLLITSATSSRAPGQREELENGYDL-HEKHSDLNQTYITGG  1095

Query  1132  DSLTESQVGSVTGSESGLLGSVNSLND---------TYEINDD-------------TETE  1169
             +SL ES V   +      L    +++D         TY + D              TE +
Sbjct  1096  ESLHESIVSVESTQSDATLNQTTTIDDSIISSKHNSTYSLADAEQATSSTVLSTGVTELD  1155

Query  1170  HQDEYVP---PTPGKVVLVENGVHYFEDGHFWMEVAGIPESDDEKDDYPTNIPIKKMSKV  1226
                 Y+P   P   K VLVE GVHYFEDG+FWMEV G+ + DD+   YP  I ++K  KV
Sbjct  1156  DSQYYIPEYPPVRSKEVLVEAGVHYFEDGNFWMEVPGLLDFDDDDCSYPP-ITVRKNPKV  1214

Query  1227  SFDTKPMRVYSTHSVNEYDRRNEDVDPVAASAEYELEKRVEKMEVFPVELMKGPEGLGLS  1286
              F + P+ VYST SVN+YDRRNEDVDPVAASAEYELEKRVEKM VFPVELMKGPEGLGLS
Sbjct  1215  RFSSGPIHVYSTFSVNDYDRRNEDVDPVAASAEYELEKRVEKMHVFPVELMKGPEGLGLS  1274

Query  1287  IIGMGVGADAGLEKLGIFVKTITEKGAAAREGRIQVNDQIVEVDGKSLVGVTQAYAASVL  1346
             IIGMGVGADAGLEKLGIFVKTIT+ GAAAR+GRIQVNDQI+EVDGKSLVGVTQAYAASVL
Sbjct  1275  IIGMGVGADAGLEKLGIFVKTITDNGAAARDGRIQVNDQIIEVDGKSLVGVTQAYAASVL  1334

Query  1347  RNTSGLVRFVIGRERDP-NSEVAMLIRQSLQADKE------REQQANSARKLNFSDASPD  1399
             RNTSGLV+F IGRERDP NSEVA LIR SLQAD+E      R+Q+    R L++S+ S  
Sbjct  1335  RNTSGLVKFQIGRERDPENSEVAQLIRLSLQADREKEERLKRQQEEYLRRTLDYSEDS--  1392

Query  1400  SQRGSEDISVGGMGGIPGSPAMSSCSEGEPPQSPIENYLSSSGRSRSPIISSSMPPHTSA  1459
                 ++ +S           A SS  EG  P SP++                  P    A
Sbjct  1393  ----TQPVS-----------ANSSVCEG--PSSPVQ---------------VEHPMEVEA  1420

Query  1460  TTQNDVDSLRLLLQESQYKLALADGEVEKLKAKLVDLENSGAGSEEYAAKLRESGLRLHE  1519
             T   +V+SL+ LLQES+    + +  ++ LK KLV LE +G  +E  + +LR       +
Sbjct  1421  THSQEVESLKRLLQESEMGCLVKEEIIQNLKRKLVKLETTGNENELLSERLR-------Q  1473

Query  1520  SERALGTARQDLIAAREMLSQATAQNAALQQKYARARRAARELR---TDIAARDEFYQQL  1576
             SER LG  R++    + ML Q+  Q  AL +KY +A+R  RE +    D+  R+EFYQQL
Sbjct  1474  SERELGNIRKEAANLQNMLQQSQGQYMALDKKYNKAKRLVREYQQRELDMCHREEFYQQL  1533

Query  1577  LQEKDTEYNALVKSLKDRVITLEVELTETQRRFGLPVRLPYDGTTARIVTPQLSRRQLPP  1636
             LQEKDTEYNALVK LKDRVI LE EL ETQR+ G PV LPYD  T ++ TPQ+ R+  PP
Sbjct  1534  LQEKDTEYNALVKKLKDRVINLEHELQETQRKAGFPVGLPYDSATLKL-TPQMMRKT-PP  1591

Query  1637  PP--SSTSCQLSDTETSDLSSPDDGDKTATVERKLPLPLPVKEELDRAVPAHRLLDNSAG  1694
              P       +LSDTE SDLS   DG KTATVERK    +PVK+ELD AVP H LLDNS  
Sbjct  1592  KPLFHKLETELSDTEISDLSPDGDGVKTATVERK----VPVKDELDAAVPQHELLDNSIN  1647

Query  1695  KSKAELASRGGLANRQLPKRSGGLSNSSSDYG  1726
             K+K +LASRGGLANRQLP  +G   NSS+  G
Sbjct  1648  KTKIDLASRGGLANRQLPSANG---NSSTSNG  1676


 Score = 148 bits (373),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 97/234 (41%), Positives = 135/234 (58%), Gaps = 35/234 (15%)

Query  1815  PPASFAEQLKQVLAERERRLGGNDMSSSRESSGDFSDLNNPHSSDPALVTHHLVEEIRQA  1874
             P +SF +QL Q L++RERRLG     SSR SS D++++N   S+  A+    L+ EIRQA
Sbjct  1908  PGSSFTDQLNQALSDRERRLGDG---SSRHSSDDYTEINKSQSA-AAINCKTLINEIRQA  1963

Query  1875  VSEANQRVKKATIPSSNLIGSGSTPW--------------HHPGS-SPSSLSSGGSVSPP  1919
             V+EA  +VK+  +P S L   G+ PW              H  G  SP+S+SSG   S P
Sbjct  1964  VNEAQPKVKQ-VVPQS-LSPPGTVPWQQQHHQQIQQQPSAHTTGPPSPTSMSSG--CSSP  2019

Query  1920  AVDPSPSKTDTSEVWLPPHPSDFGLGDKKS----HFWQNAPVTDWSKEQVCQWLSGIGLE  1975
                 SPS+T      L    S     D+K+    + ++  PV +W+K+QV  WL GI LE
Sbjct  2020  GY--SPSRT------LDLSGSSSSFSDRKAMAAGYTYKGGPVHEWTKDQVGHWLMGIELE  2071

Query  1976  RYAPRFLETGINGGNLLRLESRDLKAFGICGDEKSHLKRKLKELRAQADRERKE  2029
             RY P F E  + GG LL L+S+D K  GICGD+K  LK++LK+L+A  ++ERK+
Sbjct  2072  RYIPVFKENNVEGGALLTLDSKDFKTLGICGDDKHRLKKRLKDLKANIEKERKD  2125


 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 82/247 (33%), Positives = 108/247 (44%), Gaps = 41/247 (17%)

Query  14   KVSAIANIFQSKP-------QLDNLIHRTNNILSDGFKEPAVPLKESPTQVTVVRTESHV  66
            KVS IANIFQ KP       QL  +        +         ++ +P     VRTESH 
Sbjct  14   KVSQIANIFQRKPIEIQPVEQLSAVAAAHAAAAAAAAAAHHAHVQGAPA----VRTESHS  69

Query  67   ARFNNARALFEKLGEENKPNKPVDRITKPSNLHGLRSRSSSANSGSGCTSPARSPRPRSP  126
            ARFNNARALFEKLG E+  N    R+ +  +        S  +S          P+ R+P
Sbjct  70   ARFNNARALFEKLGVESNSNV-SSRLLRSGSREDNLCDGSDRSSSRSSDRSQSPPKRRTP  128

Query  127  SPPGTRDHLSNWSASVPALNA---ERHFENG--------------------HNHG-LDNI  162
             P G     +N +A++ A N    E+   N                     HN   L + 
Sbjct  129  FPSGVSLVHNNNNAAIVAQNGVPPEQRLSNSKFIVEPAAQVVPTSVVKYPQHNISRLKSE  188

Query  163  PDKHKSRAGFGKFDKNYGKENRLDDRPEKPEKPERRLNSKELIEKQKNWTSHFSKTRPSR  222
                      G     +       D+P   EKPER+ NS+ELIEKQK WTSHF+KT+ +R
Sbjct  189  EPSPVPPPASGSVSALFASSG--GDKP---EKPERKFNSRELIEKQKKWTSHFTKTKTTR  243

Query  223  YNSDPNR  229
             +SD NR
Sbjct  244  THSDLNR  250


 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 1/41 (2%)

Query  1023  PDTMTADEAENLLSSRILEKKIRQGSALLSDEEAQEIARLL  1063
             PD MTA EAE LLSS ILE KIRQ S LLSDE+A+E+ ++L
Sbjct  859   PDDMTAAEAERLLSSSILENKIRQQS-LLSDEQAKEVEQIL  898


 Score = 37.7 bits (86),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 15/24 (63%), Positives = 21/24 (88%), Gaps = 0/24 (0%)

Query  652  RRSHVRVDLQAAGLGQRPPSVISS  675
            +RS + V++ AAGLGQRPPS+IS+
Sbjct  537  KRSSITVNMPAAGLGQRPPSIIST  560


>M9NEY3_DROME unnamed protein product
Length=2134

 Score = 578 bits (1491),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 357/692 (52%), Positives = 426/692 (62%), Gaps = 111/692 (16%)

Query  1094  DNTPDWLSDVLSAPDTSLINSTI----------------NDYSLSHRSRSDLTI------  1131
             D+ P+WL DVL AP  SL N  I                N Y L H   SDL        
Sbjct  1037  DDEPEWLRDVLEAPKRSLENLLITSATSSRAPGQREELENGYDL-HEKHSDLNQTYITGG  1095

Query  1132  DSLTESQVGSVTGSESGLLGSVNSLND---------TYEINDD-------------TETE  1169
             +SL ES V   +      L    +++D         TY + D              TE +
Sbjct  1096  ESLHESIVSVESTQSDATLNQTTTIDDSIISSKHNSTYSLADAEQATSSTVLSTGVTELD  1155

Query  1170  HQDEYVP---PTPGKVVLVENGVHYFEDGHFWMEVAGIPESDDEKDDYPTNIPIKKMSKV  1226
                 Y+P   P   K VLVE GVHYFEDG+FWMEV G+ + DD+   YP  I ++K  KV
Sbjct  1156  DSQYYIPEYPPVRSKEVLVEAGVHYFEDGNFWMEVPGLLDFDDDDCSYPP-ITVRKNPKV  1214

Query  1227  SFDTKPMRVYSTHSVNEYDRRNEDVDPVAASAEYELEKRVEKMEVFPVELMKGPEGLGLS  1286
              F + P+ VYST SVN+YDRRNEDVDPVAASAEYELEKRVEKM VFPVELMKGPEGLGLS
Sbjct  1215  RFSSGPIHVYSTFSVNDYDRRNEDVDPVAASAEYELEKRVEKMHVFPVELMKGPEGLGLS  1274

Query  1287  IIGMGVGADAGLEKLGIFVKTITEKGAAAREGRIQVNDQIVEVDGKSLVGVTQAYAASVL  1346
             IIGMGVGADAGLEKLGIFVKTIT+ GAAAR+GRIQVNDQI+EVDGKSLVGVTQAYAASVL
Sbjct  1275  IIGMGVGADAGLEKLGIFVKTITDNGAAARDGRIQVNDQIIEVDGKSLVGVTQAYAASVL  1334

Query  1347  RNTSGLVRFVIGRERDP-NSEVAMLIRQSLQADKE------REQQANSARKLNFSDASPD  1399
             RNTSGLV+F IGRERDP NSEVA LIR SLQAD+E      R+Q+    R L++S+ S  
Sbjct  1335  RNTSGLVKFQIGRERDPENSEVAQLIRLSLQADREKEERLKRQQEEYLRRTLDYSEDS--  1392

Query  1400  SQRGSEDISVGGMGGIPGSPAMSSCSEGEPPQSPIENYLSSSGRSRSPIISSSMPPHTSA  1459
                 ++ +S           A SS  EG  P SP++                  P    A
Sbjct  1393  ----TQPVS-----------ANSSVCEG--PSSPVQ---------------VEHPMEVEA  1420

Query  1460  TTQNDVDSLRLLLQESQYKLALADGEVEKLKAKLVDLENSGAGSEEYAAKLRESGLRLHE  1519
             T   +V+SL+ LLQES+    + +  ++ LK KLV LE +G  +E  + +LR       +
Sbjct  1421  THSQEVESLKRLLQESEMGCLVKEEIIQNLKRKLVKLETTGNENELLSERLR-------Q  1473

Query  1520  SERALGTARQDLIAAREMLSQATAQNAALQQKYARARRAARELR---TDIAARDEFYQQL  1576
             SER LG  R++    + ML Q+  Q  AL +KY +A+R  RE +    D+  R+EFYQQL
Sbjct  1474  SERELGNIRKEAANLQNMLQQSQGQYMALDKKYNKAKRLVREYQQRELDMCHREEFYQQL  1533

Query  1577  LQEKDTEYNALVKSLKDRVITLEVELTETQRRFGLPVRLPYDGTTARIVTPQLSRRQLPP  1636
             LQEKDTEYNALVK LKDRVI LE EL ETQR+ G PV LPYD  T ++ TPQ+ R+  PP
Sbjct  1534  LQEKDTEYNALVKKLKDRVINLEHELQETQRKAGFPVGLPYDSATLKL-TPQMMRKT-PP  1591

Query  1637  PP--SSTSCQLSDTETSDLSSPDDGDKTATVERKLPLPLPVKEELDRAVPAHRLLDNSAG  1694
              P       +LSDTE SDLS   DG KTATVERK    +PVK+ELD AVP H LLDNS  
Sbjct  1592  KPLFHKLETELSDTEISDLSPDGDGVKTATVERK----VPVKDELDAAVPQHELLDNSIN  1647

Query  1695  KSKAELASRGGLANRQLPKRSGGLSNSSSDYG  1726
             K+K +LASRGGLANRQLP  +G   NSS+  G
Sbjct  1648  KTKIDLASRGGLANRQLPSANG---NSSTSNG  1676


 Score = 139 bits (351),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 91/227 (40%), Positives = 129/227 (57%), Gaps = 35/227 (15%)

Query  1815  PPASFAEQLKQVLAERERRLGGNDMSSSRESSGDFSDLNNPHSSDPALVTHHLVEEIRQA  1874
             P +SF +QL Q L++RERRLG     SSR SS D++++N   S+  A+    L+ EIRQA
Sbjct  1908  PGSSFTDQLNQALSDRERRLGDG---SSRHSSDDYTEINKSQSA-AAINCKTLINEIRQA  1963

Query  1875  VSEANQRV--------KKATIPSSNLIGSGSTPWHHPGSSPSSLSSGGSVSPPAVDPSPS  1926
             V+EA  +V        +    PS++  G           SP+S+SSG   S P    SPS
Sbjct  1964  VNEAQPKVPWQQQHHQQIQQQPSAHTTGP---------PSPTSMSSG--CSSPGY--SPS  2010

Query  1927  KTDTSEVWLPPHPSDFGLGDKKS----HFWQNAPVTDWSKEQVCQWLSGIGLERYAPRFL  1982
             +T      L    S     D+K+    + ++  PV +W+K+QV  WL GI LERY P F 
Sbjct  2011  RT------LDLSGSSSSFSDRKAMAAGYTYKGGPVHEWTKDQVGHWLMGIELERYIPVFK  2064

Query  1983  ETGINGGNLLRLESRDLKAFGICGDEKSHLKRKLKELRAQADRERKE  2029
             E  + GG LL L+S+D K  GICGD+K  LK++LK+L+A  ++ERK+
Sbjct  2065  ENNVEGGALLTLDSKDFKTLGICGDDKHRLKKRLKDLKANIEKERKD  2111


 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 82/247 (33%), Positives = 108/247 (44%), Gaps = 41/247 (17%)

Query  14   KVSAIANIFQSKP-------QLDNLIHRTNNILSDGFKEPAVPLKESPTQVTVVRTESHV  66
            KVS IANIFQ KP       QL  +        +         ++ +P     VRTESH 
Sbjct  14   KVSQIANIFQRKPIEIQPVEQLSAVAAAHAAAAAAAAAAHHAHVQGAPA----VRTESHS  69

Query  67   ARFNNARALFEKLGEENKPNKPVDRITKPSNLHGLRSRSSSANSGSGCTSPARSPRPRSP  126
            ARFNNARALFEKLG E+  N    R+ +  +        S  +S          P+ R+P
Sbjct  70   ARFNNARALFEKLGVESNSNVS-SRLLRSGSREDNLCDGSDRSSSRSSDRSQSPPKRRTP  128

Query  127  SPPGTRDHLSNWSASVPALNA---ERHFENG--------------------HNHG-LDNI  162
             P G     +N +A++ A N    E+   N                     HN   L + 
Sbjct  129  FPSGVSLVHNNNNAAIVAQNGVPPEQRLSNSKFIVEPAAQVVPTSVVKYPQHNISRLKSE  188

Query  163  PDKHKSRAGFGKFDKNYGKENRLDDRPEKPEKPERRLNSKELIEKQKNWTSHFSKTRPSR  222
                      G     +       D+P   EKPER+ NS+ELIEKQK WTSHF+KT+ +R
Sbjct  189  EPSPVPPPASGSVSALFASSG--GDKP---EKPERKFNSRELIEKQKKWTSHFTKTKTTR  243

Query  223  YNSDPNR  229
             +SD NR
Sbjct  244  THSDLNR  250


 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 1/41 (2%)

Query  1023  PDTMTADEAENLLSSRILEKKIRQGSALLSDEEAQEIARLL  1063
             PD MTA EAE LLSS ILE KIRQ S LLSDE+A+E+ ++L
Sbjct  859   PDDMTAAEAERLLSSSILENKIRQQS-LLSDEQAKEVEQIL  898


 Score = 37.7 bits (86),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 15/24 (63%), Positives = 21/24 (88%), Gaps = 0/24 (0%)

Query  652  RRSHVRVDLQAAGLGQRPPSVISS  675
            +RS + V++ AAGLGQRPPS+IS+
Sbjct  537  KRSSITVNMPAAGLGQRPPSIIST  560



Lambda      K        H
   0.311    0.127    0.359 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 30836202964


Query= XP_050573058.1 uncharacterized protein LOC126913872 isoform X1
[Bombus affinis]

Length=2047
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9GQA3_DROME  unnamed protein product                                 575     2e-176
M9NFI9_DROME  unnamed protein product                                 579     8e-172
M9NEY3_DROME  unnamed protein product                                 578     1e-171


>Q9GQA3_DROME unnamed protein product
Length=1330

 Score = 575 bits (1482),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 353/692 (51%), Positives = 421/692 (61%), Gaps = 111/692 (16%)

Query  1094  DNTPDWLSDVLSAPDTSLINSTI----------------NDYSLSHRSRSDLTI------  1131
             D+ P+WL DVL AP  SL N  I                N Y L H   SDL        
Sbjct  233   DDEPEWLRDVLEAPKRSLENLLITSATSSRAPGQREELENGYDL-HEKHSDLNQTYITGG  291

Query  1132  DSLTESQVGSVTGSESGLLGSVNSLND---------TYEINDD-------------TETE  1169
             +SL ES V   +      L    +++D         TY + D              TE +
Sbjct  292   ESLHESIVSVESTQSDATLNQTTTIDDSIISSKHNSTYSLADAEQATSSTVLSTGVTELD  351

Query  1170  HQDEYVP---PTPGKVVLVENGVHYFEDGHFWMEVAGIPESDDEKDDYPTNIPIKKMSKV  1226
                 Y+P   P   K VLVE GVHYFEDG+FWMEV G+ + DD+   YP  I ++K  KV
Sbjct  352   DSQYYIPEYPPVRSKEVLVEAGVHYFEDGNFWMEVPGLLDFDDDDCSYPP-ITVRKNPKV  410

Query  1227  SFDTKPMRVYSTHSVNEYDRRNEDVDPVAASAEYELEKRVEKMEVFPVELMKGPEGLGLS  1286
              F + P+ V ST SVN+YDRRNEDVDPVAASAEYELEKRVEKM VFPVELMKGPEGLGLS
Sbjct  411   RFSSGPIHVCSTFSVNDYDRRNEDVDPVAASAEYELEKRVEKMHVFPVELMKGPEGLGLS  470

Query  1287  IIGMGVGADAGLEKLGIFVKTITEKGAAAREGRIQVNDQIVEVDGKSLVGVTQAYAASVL  1346
             IIGMGVGADAGLEKLGIFVKTIT+ GAAAR+GRIQVNDQI+EVDGKSLVGVTQAYAASVL
Sbjct  471   IIGMGVGADAGLEKLGIFVKTITDNGAAARDGRIQVNDQIIEVDGKSLVGVTQAYAASVL  530

Query  1347  RNTSGLVRFVIGRERDP-NSEVAMLIRQSLQADKE------REQQANSARKLNFSDASPD  1399
             RNTSGLV+F IGRERDP NSEVA LIR SLQAD+E      R+Q+    R L++S+ S  
Sbjct  531   RNTSGLVKFQIGRERDPENSEVAQLIRLSLQADREKEERLKRQQEEYLRRTLDYSEDST-  589

Query  1400  SQRGSEDISVGGMGGIPGSPAMSSCSEGEPPQSPIENYLSSSGRSRSPIISSSMPPHTSA  1459
                                P  ++ S  E P SP++                  P    A
Sbjct  590   ------------------QPVSANSSVCEGPSSPVQ---------------VEHPMEVEA  616

Query  1460  TTQNDVDSLRLLLQESQYKLALADGEVEKLKAKLVDLENSGAGSEEYAAKLRESGLRLHE  1519
             T   +V+SL+ LLQES+    + +  ++ LK KLV LE +G  +E  + +LR       +
Sbjct  617   THSQEVESLKRLLQESEMGCLVKEEIIQNLKRKLVKLETTGNENELLSERLR-------Q  669

Query  1520  SERALGTARQDLIAAREMLSQATAQNAALQQKYARARRAARELR---TDIAARDEFYQQL  1576
             SER LG  R++    + ML Q+  Q  AL +KY +A+R  RE +    D+  R+EFYQQL
Sbjct  670   SERELGNIRKEAANLQNMLQQSQGQYMALDKKYNKAKRLVREYQQRELDMCHREEFYQQL  729

Query  1577  LQEKDTEYNALVKSLKDRVITLEVELTETQRRFGLPVRLPYDGTTARIVTPQLSRRQLPP  1636
             LQEKDTEYNALVK LKDRVI LE EL ETQR+ G PV LPYD  T ++ TPQ+ R+  PP
Sbjct  730   LQEKDTEYNALVKKLKDRVINLEHELQETQRKAGFPVGLPYDSATLKL-TPQMMRKT-PP  787

Query  1637  PP--SSTSCQLSDTETSDLSSPDDGDKTATVERKLPLPLPVKEELDRAVPAHRLLDNSAG  1694
              P       +LSDTE SDLS   DG KTATVERK    +PVK+ELD AVP H LLDNS  
Sbjct  788   KPLFHKLETELSDTEISDLSPDGDGVKTATVERK----VPVKDELDAAVPQHELLDNSIN  843

Query  1695  KSKAELASRGGLANRQLPKRSGGLSNSSSDYG  1726
             K+K +LASRGGLANRQLP  +G   NSS+  G
Sbjct  844   KTKIDLASRGGLANRQLPSANG---NSSTSNG  872


 Score = 146 bits (368),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 92/219 (42%), Positives = 129/219 (59%), Gaps = 19/219 (9%)

Query  1815  PPASFAEQLKQVLAERERRLGGNDMSSSRESSGDFSDLNNPHSSDPALVTHHLVEEIRQA  1874
             P +SF +QL Q L++RERRLG     SSR SS D++++N   S+  A+    L+ EIRQA
Sbjct  1104  PGSSFTDQLNQALSDRERRLGD---GSSRHSSDDYTEINKSQSA-AAINCKTLINEIRQA  1159

Query  1875  VSEANQRVKKATIPSSNLIGSGSTPWHHPGSSPSSLSSGGSVSPPAVDPSPSKTDTSEVW  1934
             V+EA  +   A         +   P HH  +SP+S+SSG S SP     SPS+T      
Sbjct  1160  VNEAQPKGALAAAAPPANPAAAVRP-HHRSASPTSMSSGCS-SPGY---SPSRT------  1208

Query  1935  LPPHPSDFGLGDKKS----HFWQNAPVTDWSKEQVCQWLSGIGLERYAPRFLETGINGGN  1990
             L    S     D+K+    + ++  PV +W+K+QV  WL GI LERY P F E  + GG 
Sbjct  1209  LDLSGSSSSFSDRKAMAAGYTYKGGPVHEWTKDQVGHWLMGIELERYIPVFKENNVEGGA  1268

Query  1991  LLRLESRDLKAFGICGDEKSHLKRKLKELRAQADRERKE  2029
             LL L+S+D K  GICGD+K  LK++LK+L+A  ++ERK+
Sbjct  1269  LLTLDSKDFKTLGICGDDKHRLKKRLKDLKANIEKERKD  1307


 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 1/41 (2%)

Query  1023  PDTMTADEAENLLSSRILEKKIRQGSALLSDEEAQEIARLL  1063
             PD MTA EAE LLSS ILE KIRQ S LLSDE+A+E+ ++L
Sbjct  55    PDDMTAAEAERLLSSSILENKIRQQS-LLSDEQAKEVEQIL  94


>M9NFI9_DROME unnamed protein product
Length=2148

 Score = 579 bits (1493),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 357/692 (52%), Positives = 426/692 (62%), Gaps = 111/692 (16%)

Query  1094  DNTPDWLSDVLSAPDTSLINSTI----------------NDYSLSHRSRSDLTI------  1131
             D+ P+WL DVL AP  SL N  I                N Y L H   SDL        
Sbjct  1037  DDEPEWLRDVLEAPKRSLENLLITSATSSRAPGQREELENGYDL-HEKHSDLNQTYITGG  1095

Query  1132  DSLTESQVGSVTGSESGLLGSVNSLND---------TYEINDD-------------TETE  1169
             +SL ES V   +      L    +++D         TY + D              TE +
Sbjct  1096  ESLHESIVSVESTQSDATLNQTTTIDDSIISSKHNSTYSLADAEQATSSTVLSTGVTELD  1155

Query  1170  HQDEYVP---PTPGKVVLVENGVHYFEDGHFWMEVAGIPESDDEKDDYPTNIPIKKMSKV  1226
                 Y+P   P   K VLVE GVHYFEDG+FWMEV G+ + DD+   YP  I ++K  KV
Sbjct  1156  DSQYYIPEYPPVRSKEVLVEAGVHYFEDGNFWMEVPGLLDFDDDDCSYPP-ITVRKNPKV  1214

Query  1227  SFDTKPMRVYSTHSVNEYDRRNEDVDPVAASAEYELEKRVEKMEVFPVELMKGPEGLGLS  1286
              F + P+ VYST SVN+YDRRNEDVDPVAASAEYELEKRVEKM VFPVELMKGPEGLGLS
Sbjct  1215  RFSSGPIHVYSTFSVNDYDRRNEDVDPVAASAEYELEKRVEKMHVFPVELMKGPEGLGLS  1274

Query  1287  IIGMGVGADAGLEKLGIFVKTITEKGAAAREGRIQVNDQIVEVDGKSLVGVTQAYAASVL  1346
             IIGMGVGADAGLEKLGIFVKTIT+ GAAAR+GRIQVNDQI+EVDGKSLVGVTQAYAASVL
Sbjct  1275  IIGMGVGADAGLEKLGIFVKTITDNGAAARDGRIQVNDQIIEVDGKSLVGVTQAYAASVL  1334

Query  1347  RNTSGLVRFVIGRERDP-NSEVAMLIRQSLQADKE------REQQANSARKLNFSDASPD  1399
             RNTSGLV+F IGRERDP NSEVA LIR SLQAD+E      R+Q+    R L++S+ S  
Sbjct  1335  RNTSGLVKFQIGRERDPENSEVAQLIRLSLQADREKEERLKRQQEEYLRRTLDYSEDS--  1392

Query  1400  SQRGSEDISVGGMGGIPGSPAMSSCSEGEPPQSPIENYLSSSGRSRSPIISSSMPPHTSA  1459
                 ++ +S           A SS  EG  P SP++                  P    A
Sbjct  1393  ----TQPVS-----------ANSSVCEG--PSSPVQ---------------VEHPMEVEA  1420

Query  1460  TTQNDVDSLRLLLQESQYKLALADGEVEKLKAKLVDLENSGAGSEEYAAKLRESGLRLHE  1519
             T   +V+SL+ LLQES+    + +  ++ LK KLV LE +G  +E  + +LR       +
Sbjct  1421  THSQEVESLKRLLQESEMGCLVKEEIIQNLKRKLVKLETTGNENELLSERLR-------Q  1473

Query  1520  SERALGTARQDLIAAREMLSQATAQNAALQQKYARARRAARELR---TDIAARDEFYQQL  1576
             SER LG  R++    + ML Q+  Q  AL +KY +A+R  RE +    D+  R+EFYQQL
Sbjct  1474  SERELGNIRKEAANLQNMLQQSQGQYMALDKKYNKAKRLVREYQQRELDMCHREEFYQQL  1533

Query  1577  LQEKDTEYNALVKSLKDRVITLEVELTETQRRFGLPVRLPYDGTTARIVTPQLSRRQLPP  1636
             LQEKDTEYNALVK LKDRVI LE EL ETQR+ G PV LPYD  T ++ TPQ+ R+  PP
Sbjct  1534  LQEKDTEYNALVKKLKDRVINLEHELQETQRKAGFPVGLPYDSATLKL-TPQMMRKT-PP  1591

Query  1637  PP--SSTSCQLSDTETSDLSSPDDGDKTATVERKLPLPLPVKEELDRAVPAHRLLDNSAG  1694
              P       +LSDTE SDLS   DG KTATVERK    +PVK+ELD AVP H LLDNS  
Sbjct  1592  KPLFHKLETELSDTEISDLSPDGDGVKTATVERK----VPVKDELDAAVPQHELLDNSIN  1647

Query  1695  KSKAELASRGGLANRQLPKRSGGLSNSSSDYG  1726
             K+K +LASRGGLANRQLP  +G   NSS+  G
Sbjct  1648  KTKIDLASRGGLANRQLPSANG---NSSTSNG  1676


 Score = 148 bits (373),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 97/234 (41%), Positives = 135/234 (58%), Gaps = 35/234 (15%)

Query  1815  PPASFAEQLKQVLAERERRLGGNDMSSSRESSGDFSDLNNPHSSDPALVTHHLVEEIRQA  1874
             P +SF +QL Q L++RERRLG     SSR SS D++++N   S+  A+    L+ EIRQA
Sbjct  1908  PGSSFTDQLNQALSDRERRLGDG---SSRHSSDDYTEINKSQSA-AAINCKTLINEIRQA  1963

Query  1875  VSEANQRVKKATIPSSNLIGSGSTPW--------------HHPGS-SPSSLSSGGSVSPP  1919
             V+EA  +VK+  +P S L   G+ PW              H  G  SP+S+SSG   S P
Sbjct  1964  VNEAQPKVKQ-VVPQS-LSPPGTVPWQQQHHQQIQQQPSAHTTGPPSPTSMSSG--CSSP  2019

Query  1920  AVDPSPSKTDTSEVWLPPHPSDFGLGDKKS----HFWQNAPVTDWSKEQVCQWLSGIGLE  1975
                 SPS+T      L    S     D+K+    + ++  PV +W+K+QV  WL GI LE
Sbjct  2020  GY--SPSRT------LDLSGSSSSFSDRKAMAAGYTYKGGPVHEWTKDQVGHWLMGIELE  2071

Query  1976  RYAPRFLETGINGGNLLRLESRDLKAFGICGDEKSHLKRKLKELRAQADRERKE  2029
             RY P F E  + GG LL L+S+D K  GICGD+K  LK++LK+L+A  ++ERK+
Sbjct  2072  RYIPVFKENNVEGGALLTLDSKDFKTLGICGDDKHRLKKRLKDLKANIEKERKD  2125


 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 82/247 (33%), Positives = 108/247 (44%), Gaps = 41/247 (17%)

Query  14   KVSAIANIFQSKP-------QLDNLIHRTNNILSDGFKEPAVPLKESPTQVTVVRTESHV  66
            KVS IANIFQ KP       QL  +        +         ++ +P     VRTESH 
Sbjct  14   KVSQIANIFQRKPIEIQPVEQLSAVAAAHAAAAAAAAAAHHAHVQGAPA----VRTESHS  69

Query  67   ARFNNARALFEKLGEENKPNKPVDRITKPSNLHGLRSRSSSANSGSGCTSPARSPRPRSP  126
            ARFNNARALFEKLG E+  N    R+ +  +        S  +S          P+ R+P
Sbjct  70   ARFNNARALFEKLGVESNSNV-SSRLLRSGSREDNLCDGSDRSSSRSSDRSQSPPKRRTP  128

Query  127  SPPGTRDHLSNWSASVPALNA---ERHFENG--------------------HNHG-LDNI  162
             P G     +N +A++ A N    E+   N                     HN   L + 
Sbjct  129  FPSGVSLVHNNNNAAIVAQNGVPPEQRLSNSKFIVEPAAQVVPTSVVKYPQHNISRLKSE  188

Query  163  PDKHKSRAGFGKFDKNYGKENRLDDRPEKPEKPERRLNSKELIEKQKNWTSHFSKTRPSR  222
                      G     +       D+P   EKPER+ NS+ELIEKQK WTSHF+KT+ +R
Sbjct  189  EPSPVPPPASGSVSALFASSG--GDKP---EKPERKFNSRELIEKQKKWTSHFTKTKTTR  243

Query  223  YNSDPNR  229
             +SD NR
Sbjct  244  THSDLNR  250


 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 1/41 (2%)

Query  1023  PDTMTADEAENLLSSRILEKKIRQGSALLSDEEAQEIARLL  1063
             PD MTA EAE LLSS ILE KIRQ S LLSDE+A+E+ ++L
Sbjct  859   PDDMTAAEAERLLSSSILENKIRQQS-LLSDEQAKEVEQIL  898


 Score = 37.7 bits (86),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 15/24 (63%), Positives = 21/24 (88%), Gaps = 0/24 (0%)

Query  652  RRSHVRVDLQAAGLGQRPPSVISS  675
            +RS + V++ AAGLGQRPPS+IS+
Sbjct  537  KRSSITVNMPAAGLGQRPPSIIST  560


>M9NEY3_DROME unnamed protein product
Length=2134

 Score = 578 bits (1491),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 357/692 (52%), Positives = 426/692 (62%), Gaps = 111/692 (16%)

Query  1094  DNTPDWLSDVLSAPDTSLINSTI----------------NDYSLSHRSRSDLTI------  1131
             D+ P+WL DVL AP  SL N  I                N Y L H   SDL        
Sbjct  1037  DDEPEWLRDVLEAPKRSLENLLITSATSSRAPGQREELENGYDL-HEKHSDLNQTYITGG  1095

Query  1132  DSLTESQVGSVTGSESGLLGSVNSLND---------TYEINDD-------------TETE  1169
             +SL ES V   +      L    +++D         TY + D              TE +
Sbjct  1096  ESLHESIVSVESTQSDATLNQTTTIDDSIISSKHNSTYSLADAEQATSSTVLSTGVTELD  1155

Query  1170  HQDEYVP---PTPGKVVLVENGVHYFEDGHFWMEVAGIPESDDEKDDYPTNIPIKKMSKV  1226
                 Y+P   P   K VLVE GVHYFEDG+FWMEV G+ + DD+   YP  I ++K  KV
Sbjct  1156  DSQYYIPEYPPVRSKEVLVEAGVHYFEDGNFWMEVPGLLDFDDDDCSYPP-ITVRKNPKV  1214

Query  1227  SFDTKPMRVYSTHSVNEYDRRNEDVDPVAASAEYELEKRVEKMEVFPVELMKGPEGLGLS  1286
              F + P+ VYST SVN+YDRRNEDVDPVAASAEYELEKRVEKM VFPVELMKGPEGLGLS
Sbjct  1215  RFSSGPIHVYSTFSVNDYDRRNEDVDPVAASAEYELEKRVEKMHVFPVELMKGPEGLGLS  1274

Query  1287  IIGMGVGADAGLEKLGIFVKTITEKGAAAREGRIQVNDQIVEVDGKSLVGVTQAYAASVL  1346
             IIGMGVGADAGLEKLGIFVKTIT+ GAAAR+GRIQVNDQI+EVDGKSLVGVTQAYAASVL
Sbjct  1275  IIGMGVGADAGLEKLGIFVKTITDNGAAARDGRIQVNDQIIEVDGKSLVGVTQAYAASVL  1334

Query  1347  RNTSGLVRFVIGRERDP-NSEVAMLIRQSLQADKE------REQQANSARKLNFSDASPD  1399
             RNTSGLV+F IGRERDP NSEVA LIR SLQAD+E      R+Q+    R L++S+ S  
Sbjct  1335  RNTSGLVKFQIGRERDPENSEVAQLIRLSLQADREKEERLKRQQEEYLRRTLDYSEDS--  1392

Query  1400  SQRGSEDISVGGMGGIPGSPAMSSCSEGEPPQSPIENYLSSSGRSRSPIISSSMPPHTSA  1459
                 ++ +S           A SS  EG  P SP++                  P    A
Sbjct  1393  ----TQPVS-----------ANSSVCEG--PSSPVQ---------------VEHPMEVEA  1420

Query  1460  TTQNDVDSLRLLLQESQYKLALADGEVEKLKAKLVDLENSGAGSEEYAAKLRESGLRLHE  1519
             T   +V+SL+ LLQES+    + +  ++ LK KLV LE +G  +E  + +LR       +
Sbjct  1421  THSQEVESLKRLLQESEMGCLVKEEIIQNLKRKLVKLETTGNENELLSERLR-------Q  1473

Query  1520  SERALGTARQDLIAAREMLSQATAQNAALQQKYARARRAARELR---TDIAARDEFYQQL  1576
             SER LG  R++    + ML Q+  Q  AL +KY +A+R  RE +    D+  R+EFYQQL
Sbjct  1474  SERELGNIRKEAANLQNMLQQSQGQYMALDKKYNKAKRLVREYQQRELDMCHREEFYQQL  1533

Query  1577  LQEKDTEYNALVKSLKDRVITLEVELTETQRRFGLPVRLPYDGTTARIVTPQLSRRQLPP  1636
             LQEKDTEYNALVK LKDRVI LE EL ETQR+ G PV LPYD  T ++ TPQ+ R+  PP
Sbjct  1534  LQEKDTEYNALVKKLKDRVINLEHELQETQRKAGFPVGLPYDSATLKL-TPQMMRKT-PP  1591

Query  1637  PP--SSTSCQLSDTETSDLSSPDDGDKTATVERKLPLPLPVKEELDRAVPAHRLLDNSAG  1694
              P       +LSDTE SDLS   DG KTATVERK    +PVK+ELD AVP H LLDNS  
Sbjct  1592  KPLFHKLETELSDTEISDLSPDGDGVKTATVERK----VPVKDELDAAVPQHELLDNSIN  1647

Query  1695  KSKAELASRGGLANRQLPKRSGGLSNSSSDYG  1726
             K+K +LASRGGLANRQLP  +G   NSS+  G
Sbjct  1648  KTKIDLASRGGLANRQLPSANG---NSSTSNG  1676


 Score = 139 bits (351),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 91/227 (40%), Positives = 129/227 (57%), Gaps = 35/227 (15%)

Query  1815  PPASFAEQLKQVLAERERRLGGNDMSSSRESSGDFSDLNNPHSSDPALVTHHLVEEIRQA  1874
             P +SF +QL Q L++RERRLG     SSR SS D++++N   S+  A+    L+ EIRQA
Sbjct  1908  PGSSFTDQLNQALSDRERRLGDG---SSRHSSDDYTEINKSQSA-AAINCKTLINEIRQA  1963

Query  1875  VSEANQRV--------KKATIPSSNLIGSGSTPWHHPGSSPSSLSSGGSVSPPAVDPSPS  1926
             V+EA  +V        +    PS++  G           SP+S+SSG   S P    SPS
Sbjct  1964  VNEAQPKVPWQQQHHQQIQQQPSAHTTGP---------PSPTSMSSG--CSSPGY--SPS  2010

Query  1927  KTDTSEVWLPPHPSDFGLGDKKS----HFWQNAPVTDWSKEQVCQWLSGIGLERYAPRFL  1982
             +T      L    S     D+K+    + ++  PV +W+K+QV  WL GI LERY P F 
Sbjct  2011  RT------LDLSGSSSSFSDRKAMAAGYTYKGGPVHEWTKDQVGHWLMGIELERYIPVFK  2064

Query  1983  ETGINGGNLLRLESRDLKAFGICGDEKSHLKRKLKELRAQADRERKE  2029
             E  + GG LL L+S+D K  GICGD+K  LK++LK+L+A  ++ERK+
Sbjct  2065  ENNVEGGALLTLDSKDFKTLGICGDDKHRLKKRLKDLKANIEKERKD  2111


 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 82/247 (33%), Positives = 108/247 (44%), Gaps = 41/247 (17%)

Query  14   KVSAIANIFQSKP-------QLDNLIHRTNNILSDGFKEPAVPLKESPTQVTVVRTESHV  66
            KVS IANIFQ KP       QL  +        +         ++ +P     VRTESH 
Sbjct  14   KVSQIANIFQRKPIEIQPVEQLSAVAAAHAAAAAAAAAAHHAHVQGAPA----VRTESHS  69

Query  67   ARFNNARALFEKLGEENKPNKPVDRITKPSNLHGLRSRSSSANSGSGCTSPARSPRPRSP  126
            ARFNNARALFEKLG E+  N    R+ +  +        S  +S          P+ R+P
Sbjct  70   ARFNNARALFEKLGVESNSNVS-SRLLRSGSREDNLCDGSDRSSSRSSDRSQSPPKRRTP  128

Query  127  SPPGTRDHLSNWSASVPALNA---ERHFENG--------------------HNHG-LDNI  162
             P G     +N +A++ A N    E+   N                     HN   L + 
Sbjct  129  FPSGVSLVHNNNNAAIVAQNGVPPEQRLSNSKFIVEPAAQVVPTSVVKYPQHNISRLKSE  188

Query  163  PDKHKSRAGFGKFDKNYGKENRLDDRPEKPEKPERRLNSKELIEKQKNWTSHFSKTRPSR  222
                      G     +       D+P   EKPER+ NS+ELIEKQK WTSHF+KT+ +R
Sbjct  189  EPSPVPPPASGSVSALFASSG--GDKP---EKPERKFNSRELIEKQKKWTSHFTKTKTTR  243

Query  223  YNSDPNR  229
             +SD NR
Sbjct  244  THSDLNR  250


 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 1/41 (2%)

Query  1023  PDTMTADEAENLLSSRILEKKIRQGSALLSDEEAQEIARLL  1063
             PD MTA EAE LLSS ILE KIRQ S LLSDE+A+E+ ++L
Sbjct  859   PDDMTAAEAERLLSSSILENKIRQQS-LLSDEQAKEVEQIL  898


 Score = 37.7 bits (86),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 15/24 (63%), Positives = 21/24 (88%), Gaps = 0/24 (0%)

Query  652  RRSHVRVDLQAAGLGQRPPSVISS  675
            +RS + V++ AAGLGQRPPS+IS+
Sbjct  537  KRSSITVNMPAAGLGQRPPSIIST  560



Lambda      K        H
   0.311    0.127    0.359 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 30836202964


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Nov 7, 2022  4:57 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_050573059.1 uncharacterized protein LOC126913872 isoform X1
[Bombus affinis]

Length=2047
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9GQA3_DROME  unnamed protein product                                 575     2e-176
M9NFI9_DROME  unnamed protein product                                 579     8e-172
M9NEY3_DROME  unnamed protein product                                 578     1e-171


>Q9GQA3_DROME unnamed protein product
Length=1330

 Score = 575 bits (1482),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 353/692 (51%), Positives = 421/692 (61%), Gaps = 111/692 (16%)

Query  1094  DNTPDWLSDVLSAPDTSLINSTI----------------NDYSLSHRSRSDLTI------  1131
             D+ P+WL DVL AP  SL N  I                N Y L H   SDL        
Sbjct  233   DDEPEWLRDVLEAPKRSLENLLITSATSSRAPGQREELENGYDL-HEKHSDLNQTYITGG  291

Query  1132  DSLTESQVGSVTGSESGLLGSVNSLND---------TYEINDD-------------TETE  1169
             +SL ES V   +      L    +++D         TY + D              TE +
Sbjct  292   ESLHESIVSVESTQSDATLNQTTTIDDSIISSKHNSTYSLADAEQATSSTVLSTGVTELD  351

Query  1170  HQDEYVP---PTPGKVVLVENGVHYFEDGHFWMEVAGIPESDDEKDDYPTNIPIKKMSKV  1226
                 Y+P   P   K VLVE GVHYFEDG+FWMEV G+ + DD+   YP  I ++K  KV
Sbjct  352   DSQYYIPEYPPVRSKEVLVEAGVHYFEDGNFWMEVPGLLDFDDDDCSYPP-ITVRKNPKV  410

Query  1227  SFDTKPMRVYSTHSVNEYDRRNEDVDPVAASAEYELEKRVEKMEVFPVELMKGPEGLGLS  1286
              F + P+ V ST SVN+YDRRNEDVDPVAASAEYELEKRVEKM VFPVELMKGPEGLGLS
Sbjct  411   RFSSGPIHVCSTFSVNDYDRRNEDVDPVAASAEYELEKRVEKMHVFPVELMKGPEGLGLS  470

Query  1287  IIGMGVGADAGLEKLGIFVKTITEKGAAAREGRIQVNDQIVEVDGKSLVGVTQAYAASVL  1346
             IIGMGVGADAGLEKLGIFVKTIT+ GAAAR+GRIQVNDQI+EVDGKSLVGVTQAYAASVL
Sbjct  471   IIGMGVGADAGLEKLGIFVKTITDNGAAARDGRIQVNDQIIEVDGKSLVGVTQAYAASVL  530

Query  1347  RNTSGLVRFVIGRERDP-NSEVAMLIRQSLQADKE------REQQANSARKLNFSDASPD  1399
             RNTSGLV+F IGRERDP NSEVA LIR SLQAD+E      R+Q+    R L++S+ S  
Sbjct  531   RNTSGLVKFQIGRERDPENSEVAQLIRLSLQADREKEERLKRQQEEYLRRTLDYSEDST-  589

Query  1400  SQRGSEDISVGGMGGIPGSPAMSSCSEGEPPQSPIENYLSSSGRSRSPIISSSMPPHTSA  1459
                                P  ++ S  E P SP++                  P    A
Sbjct  590   ------------------QPVSANSSVCEGPSSPVQ---------------VEHPMEVEA  616

Query  1460  TTQNDVDSLRLLLQESQYKLALADGEVEKLKAKLVDLENSGAGSEEYAAKLRESGLRLHE  1519
             T   +V+SL+ LLQES+    + +  ++ LK KLV LE +G  +E  + +LR       +
Sbjct  617   THSQEVESLKRLLQESEMGCLVKEEIIQNLKRKLVKLETTGNENELLSERLR-------Q  669

Query  1520  SERALGTARQDLIAAREMLSQATAQNAALQQKYARARRAARELR---TDIAARDEFYQQL  1576
             SER LG  R++    + ML Q+  Q  AL +KY +A+R  RE +    D+  R+EFYQQL
Sbjct  670   SERELGNIRKEAANLQNMLQQSQGQYMALDKKYNKAKRLVREYQQRELDMCHREEFYQQL  729

Query  1577  LQEKDTEYNALVKSLKDRVITLEVELTETQRRFGLPVRLPYDGTTARIVTPQLSRRQLPP  1636
             LQEKDTEYNALVK LKDRVI LE EL ETQR+ G PV LPYD  T ++ TPQ+ R+  PP
Sbjct  730   LQEKDTEYNALVKKLKDRVINLEHELQETQRKAGFPVGLPYDSATLKL-TPQMMRKT-PP  787

Query  1637  PP--SSTSCQLSDTETSDLSSPDDGDKTATVERKLPLPLPVKEELDRAVPAHRLLDNSAG  1694
              P       +LSDTE SDLS   DG KTATVERK    +PVK+ELD AVP H LLDNS  
Sbjct  788   KPLFHKLETELSDTEISDLSPDGDGVKTATVERK----VPVKDELDAAVPQHELLDNSIN  843

Query  1695  KSKAELASRGGLANRQLPKRSGGLSNSSSDYG  1726
             K+K +LASRGGLANRQLP  +G   NSS+  G
Sbjct  844   KTKIDLASRGGLANRQLPSANG---NSSTSNG  872


 Score = 146 bits (368),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 92/219 (42%), Positives = 129/219 (59%), Gaps = 19/219 (9%)

Query  1815  PPASFAEQLKQVLAERERRLGGNDMSSSRESSGDFSDLNNPHSSDPALVTHHLVEEIRQA  1874
             P +SF +QL Q L++RERRLG     SSR SS D++++N   S+  A+    L+ EIRQA
Sbjct  1104  PGSSFTDQLNQALSDRERRLGD---GSSRHSSDDYTEINKSQSA-AAINCKTLINEIRQA  1159

Query  1875  VSEANQRVKKATIPSSNLIGSGSTPWHHPGSSPSSLSSGGSVSPPAVDPSPSKTDTSEVW  1934
             V+EA  +   A         +   P HH  +SP+S+SSG S SP     SPS+T      
Sbjct  1160  VNEAQPKGALAAAAPPANPAAAVRP-HHRSASPTSMSSGCS-SPGY---SPSRT------  1208

Query  1935  LPPHPSDFGLGDKKS----HFWQNAPVTDWSKEQVCQWLSGIGLERYAPRFLETGINGGN  1990
             L    S     D+K+    + ++  PV +W+K+QV  WL GI LERY P F E  + GG 
Sbjct  1209  LDLSGSSSSFSDRKAMAAGYTYKGGPVHEWTKDQVGHWLMGIELERYIPVFKENNVEGGA  1268

Query  1991  LLRLESRDLKAFGICGDEKSHLKRKLKELRAQADRERKE  2029
             LL L+S+D K  GICGD+K  LK++LK+L+A  ++ERK+
Sbjct  1269  LLTLDSKDFKTLGICGDDKHRLKKRLKDLKANIEKERKD  1307


 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 1/41 (2%)

Query  1023  PDTMTADEAENLLSSRILEKKIRQGSALLSDEEAQEIARLL  1063
             PD MTA EAE LLSS ILE KIRQ S LLSDE+A+E+ ++L
Sbjct  55    PDDMTAAEAERLLSSSILENKIRQQS-LLSDEQAKEVEQIL  94


>M9NFI9_DROME unnamed protein product
Length=2148

 Score = 579 bits (1493),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 357/692 (52%), Positives = 426/692 (62%), Gaps = 111/692 (16%)

Query  1094  DNTPDWLSDVLSAPDTSLINSTI----------------NDYSLSHRSRSDLTI------  1131
             D+ P+WL DVL AP  SL N  I                N Y L H   SDL        
Sbjct  1037  DDEPEWLRDVLEAPKRSLENLLITSATSSRAPGQREELENGYDL-HEKHSDLNQTYITGG  1095

Query  1132  DSLTESQVGSVTGSESGLLGSVNSLND---------TYEINDD-------------TETE  1169
             +SL ES V   +      L    +++D         TY + D              TE +
Sbjct  1096  ESLHESIVSVESTQSDATLNQTTTIDDSIISSKHNSTYSLADAEQATSSTVLSTGVTELD  1155

Query  1170  HQDEYVP---PTPGKVVLVENGVHYFEDGHFWMEVAGIPESDDEKDDYPTNIPIKKMSKV  1226
                 Y+P   P   K VLVE GVHYFEDG+FWMEV G+ + DD+   YP  I ++K  KV
Sbjct  1156  DSQYYIPEYPPVRSKEVLVEAGVHYFEDGNFWMEVPGLLDFDDDDCSYPP-ITVRKNPKV  1214

Query  1227  SFDTKPMRVYSTHSVNEYDRRNEDVDPVAASAEYELEKRVEKMEVFPVELMKGPEGLGLS  1286
              F + P+ VYST SVN+YDRRNEDVDPVAASAEYELEKRVEKM VFPVELMKGPEGLGLS
Sbjct  1215  RFSSGPIHVYSTFSVNDYDRRNEDVDPVAASAEYELEKRVEKMHVFPVELMKGPEGLGLS  1274

Query  1287  IIGMGVGADAGLEKLGIFVKTITEKGAAAREGRIQVNDQIVEVDGKSLVGVTQAYAASVL  1346
             IIGMGVGADAGLEKLGIFVKTIT+ GAAAR+GRIQVNDQI+EVDGKSLVGVTQAYAASVL
Sbjct  1275  IIGMGVGADAGLEKLGIFVKTITDNGAAARDGRIQVNDQIIEVDGKSLVGVTQAYAASVL  1334

Query  1347  RNTSGLVRFVIGRERDP-NSEVAMLIRQSLQADKE------REQQANSARKLNFSDASPD  1399
             RNTSGLV+F IGRERDP NSEVA LIR SLQAD+E      R+Q+    R L++S+ S  
Sbjct  1335  RNTSGLVKFQIGRERDPENSEVAQLIRLSLQADREKEERLKRQQEEYLRRTLDYSEDS--  1392

Query  1400  SQRGSEDISVGGMGGIPGSPAMSSCSEGEPPQSPIENYLSSSGRSRSPIISSSMPPHTSA  1459
                 ++ +S           A SS  EG  P SP++                  P    A
Sbjct  1393  ----TQPVS-----------ANSSVCEG--PSSPVQ---------------VEHPMEVEA  1420

Query  1460  TTQNDVDSLRLLLQESQYKLALADGEVEKLKAKLVDLENSGAGSEEYAAKLRESGLRLHE  1519
             T   +V+SL+ LLQES+    + +  ++ LK KLV LE +G  +E  + +LR       +
Sbjct  1421  THSQEVESLKRLLQESEMGCLVKEEIIQNLKRKLVKLETTGNENELLSERLR-------Q  1473

Query  1520  SERALGTARQDLIAAREMLSQATAQNAALQQKYARARRAARELR---TDIAARDEFYQQL  1576
             SER LG  R++    + ML Q+  Q  AL +KY +A+R  RE +    D+  R+EFYQQL
Sbjct  1474  SERELGNIRKEAANLQNMLQQSQGQYMALDKKYNKAKRLVREYQQRELDMCHREEFYQQL  1533

Query  1577  LQEKDTEYNALVKSLKDRVITLEVELTETQRRFGLPVRLPYDGTTARIVTPQLSRRQLPP  1636
             LQEKDTEYNALVK LKDRVI LE EL ETQR+ G PV LPYD  T ++ TPQ+ R+  PP
Sbjct  1534  LQEKDTEYNALVKKLKDRVINLEHELQETQRKAGFPVGLPYDSATLKL-TPQMMRKT-PP  1591

Query  1637  PP--SSTSCQLSDTETSDLSSPDDGDKTATVERKLPLPLPVKEELDRAVPAHRLLDNSAG  1694
              P       +LSDTE SDLS   DG KTATVERK    +PVK+ELD AVP H LLDNS  
Sbjct  1592  KPLFHKLETELSDTEISDLSPDGDGVKTATVERK----VPVKDELDAAVPQHELLDNSIN  1647

Query  1695  KSKAELASRGGLANRQLPKRSGGLSNSSSDYG  1726
             K+K +LASRGGLANRQLP  +G   NSS+  G
Sbjct  1648  KTKIDLASRGGLANRQLPSANG---NSSTSNG  1676


 Score = 148 bits (373),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 97/234 (41%), Positives = 135/234 (58%), Gaps = 35/234 (15%)

Query  1815  PPASFAEQLKQVLAERERRLGGNDMSSSRESSGDFSDLNNPHSSDPALVTHHLVEEIRQA  1874
             P +SF +QL Q L++RERRLG     SSR SS D++++N   S+  A+    L+ EIRQA
Sbjct  1908  PGSSFTDQLNQALSDRERRLGDG---SSRHSSDDYTEINKSQSA-AAINCKTLINEIRQA  1963

Query  1875  VSEANQRVKKATIPSSNLIGSGSTPW--------------HHPGS-SPSSLSSGGSVSPP  1919
             V+EA  +VK+  +P S L   G+ PW              H  G  SP+S+SSG   S P
Sbjct  1964  VNEAQPKVKQ-VVPQS-LSPPGTVPWQQQHHQQIQQQPSAHTTGPPSPTSMSSG--CSSP  2019

Query  1920  AVDPSPSKTDTSEVWLPPHPSDFGLGDKKS----HFWQNAPVTDWSKEQVCQWLSGIGLE  1975
                 SPS+T      L    S     D+K+    + ++  PV +W+K+QV  WL GI LE
Sbjct  2020  GY--SPSRT------LDLSGSSSSFSDRKAMAAGYTYKGGPVHEWTKDQVGHWLMGIELE  2071

Query  1976  RYAPRFLETGINGGNLLRLESRDLKAFGICGDEKSHLKRKLKELRAQADRERKE  2029
             RY P F E  + GG LL L+S+D K  GICGD+K  LK++LK+L+A  ++ERK+
Sbjct  2072  RYIPVFKENNVEGGALLTLDSKDFKTLGICGDDKHRLKKRLKDLKANIEKERKD  2125


 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 82/247 (33%), Positives = 108/247 (44%), Gaps = 41/247 (17%)

Query  14   KVSAIANIFQSKP-------QLDNLIHRTNNILSDGFKEPAVPLKESPTQVTVVRTESHV  66
            KVS IANIFQ KP       QL  +        +         ++ +P     VRTESH 
Sbjct  14   KVSQIANIFQRKPIEIQPVEQLSAVAAAHAAAAAAAAAAHHAHVQGAPA----VRTESHS  69

Query  67   ARFNNARALFEKLGEENKPNKPVDRITKPSNLHGLRSRSSSANSGSGCTSPARSPRPRSP  126
            ARFNNARALFEKLG E+  N    R+ +  +        S  +S          P+ R+P
Sbjct  70   ARFNNARALFEKLGVESNSNV-SSRLLRSGSREDNLCDGSDRSSSRSSDRSQSPPKRRTP  128

Query  127  SPPGTRDHLSNWSASVPALNA---ERHFENG--------------------HNHG-LDNI  162
             P G     +N +A++ A N    E+   N                     HN   L + 
Sbjct  129  FPSGVSLVHNNNNAAIVAQNGVPPEQRLSNSKFIVEPAAQVVPTSVVKYPQHNISRLKSE  188

Query  163  PDKHKSRAGFGKFDKNYGKENRLDDRPEKPEKPERRLNSKELIEKQKNWTSHFSKTRPSR  222
                      G     +       D+P   EKPER+ NS+ELIEKQK WTSHF+KT+ +R
Sbjct  189  EPSPVPPPASGSVSALFASSG--GDKP---EKPERKFNSRELIEKQKKWTSHFTKTKTTR  243

Query  223  YNSDPNR  229
             +SD NR
Sbjct  244  THSDLNR  250


 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 1/41 (2%)

Query  1023  PDTMTADEAENLLSSRILEKKIRQGSALLSDEEAQEIARLL  1063
             PD MTA EAE LLSS ILE KIRQ S LLSDE+A+E+ ++L
Sbjct  859   PDDMTAAEAERLLSSSILENKIRQQS-LLSDEQAKEVEQIL  898


 Score = 37.7 bits (86),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 15/24 (63%), Positives = 21/24 (88%), Gaps = 0/24 (0%)

Query  652  RRSHVRVDLQAAGLGQRPPSVISS  675
            +RS + V++ AAGLGQRPPS+IS+
Sbjct  537  KRSSITVNMPAAGLGQRPPSIIST  560


>M9NEY3_DROME unnamed protein product
Length=2134

 Score = 578 bits (1491),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 357/692 (52%), Positives = 426/692 (62%), Gaps = 111/692 (16%)

Query  1094  DNTPDWLSDVLSAPDTSLINSTI----------------NDYSLSHRSRSDLTI------  1131
             D+ P+WL DVL AP  SL N  I                N Y L H   SDL        
Sbjct  1037  DDEPEWLRDVLEAPKRSLENLLITSATSSRAPGQREELENGYDL-HEKHSDLNQTYITGG  1095

Query  1132  DSLTESQVGSVTGSESGLLGSVNSLND---------TYEINDD-------------TETE  1169
             +SL ES V   +      L    +++D         TY + D              TE +
Sbjct  1096  ESLHESIVSVESTQSDATLNQTTTIDDSIISSKHNSTYSLADAEQATSSTVLSTGVTELD  1155

Query  1170  HQDEYVP---PTPGKVVLVENGVHYFEDGHFWMEVAGIPESDDEKDDYPTNIPIKKMSKV  1226
                 Y+P   P   K VLVE GVHYFEDG+FWMEV G+ + DD+   YP  I ++K  KV
Sbjct  1156  DSQYYIPEYPPVRSKEVLVEAGVHYFEDGNFWMEVPGLLDFDDDDCSYPP-ITVRKNPKV  1214

Query  1227  SFDTKPMRVYSTHSVNEYDRRNEDVDPVAASAEYELEKRVEKMEVFPVELMKGPEGLGLS  1286
              F + P+ VYST SVN+YDRRNEDVDPVAASAEYELEKRVEKM VFPVELMKGPEGLGLS
Sbjct  1215  RFSSGPIHVYSTFSVNDYDRRNEDVDPVAASAEYELEKRVEKMHVFPVELMKGPEGLGLS  1274

Query  1287  IIGMGVGADAGLEKLGIFVKTITEKGAAAREGRIQVNDQIVEVDGKSLVGVTQAYAASVL  1346
             IIGMGVGADAGLEKLGIFVKTIT+ GAAAR+GRIQVNDQI+EVDGKSLVGVTQAYAASVL
Sbjct  1275  IIGMGVGADAGLEKLGIFVKTITDNGAAARDGRIQVNDQIIEVDGKSLVGVTQAYAASVL  1334

Query  1347  RNTSGLVRFVIGRERDP-NSEVAMLIRQSLQADKE------REQQANSARKLNFSDASPD  1399
             RNTSGLV+F IGRERDP NSEVA LIR SLQAD+E      R+Q+    R L++S+ S  
Sbjct  1335  RNTSGLVKFQIGRERDPENSEVAQLIRLSLQADREKEERLKRQQEEYLRRTLDYSEDS--  1392

Query  1400  SQRGSEDISVGGMGGIPGSPAMSSCSEGEPPQSPIENYLSSSGRSRSPIISSSMPPHTSA  1459
                 ++ +S           A SS  EG  P SP++                  P    A
Sbjct  1393  ----TQPVS-----------ANSSVCEG--PSSPVQ---------------VEHPMEVEA  1420

Query  1460  TTQNDVDSLRLLLQESQYKLALADGEVEKLKAKLVDLENSGAGSEEYAAKLRESGLRLHE  1519
             T   +V+SL+ LLQES+    + +  ++ LK KLV LE +G  +E  + +LR       +
Sbjct  1421  THSQEVESLKRLLQESEMGCLVKEEIIQNLKRKLVKLETTGNENELLSERLR-------Q  1473

Query  1520  SERALGTARQDLIAAREMLSQATAQNAALQQKYARARRAARELR---TDIAARDEFYQQL  1576
             SER LG  R++    + ML Q+  Q  AL +KY +A+R  RE +    D+  R+EFYQQL
Sbjct  1474  SERELGNIRKEAANLQNMLQQSQGQYMALDKKYNKAKRLVREYQQRELDMCHREEFYQQL  1533

Query  1577  LQEKDTEYNALVKSLKDRVITLEVELTETQRRFGLPVRLPYDGTTARIVTPQLSRRQLPP  1636
             LQEKDTEYNALVK LKDRVI LE EL ETQR+ G PV LPYD  T ++ TPQ+ R+  PP
Sbjct  1534  LQEKDTEYNALVKKLKDRVINLEHELQETQRKAGFPVGLPYDSATLKL-TPQMMRKT-PP  1591

Query  1637  PP--SSTSCQLSDTETSDLSSPDDGDKTATVERKLPLPLPVKEELDRAVPAHRLLDNSAG  1694
              P       +LSDTE SDLS   DG KTATVERK    +PVK+ELD AVP H LLDNS  
Sbjct  1592  KPLFHKLETELSDTEISDLSPDGDGVKTATVERK----VPVKDELDAAVPQHELLDNSIN  1647

Query  1695  KSKAELASRGGLANRQLPKRSGGLSNSSSDYG  1726
             K+K +LASRGGLANRQLP  +G   NSS+  G
Sbjct  1648  KTKIDLASRGGLANRQLPSANG---NSSTSNG  1676


 Score = 139 bits (351),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 91/227 (40%), Positives = 129/227 (57%), Gaps = 35/227 (15%)

Query  1815  PPASFAEQLKQVLAERERRLGGNDMSSSRESSGDFSDLNNPHSSDPALVTHHLVEEIRQA  1874
             P +SF +QL Q L++RERRLG     SSR SS D++++N   S+  A+    L+ EIRQA
Sbjct  1908  PGSSFTDQLNQALSDRERRLGDG---SSRHSSDDYTEINKSQSA-AAINCKTLINEIRQA  1963

Query  1875  VSEANQRV--------KKATIPSSNLIGSGSTPWHHPGSSPSSLSSGGSVSPPAVDPSPS  1926
             V+EA  +V        +    PS++  G           SP+S+SSG   S P    SPS
Sbjct  1964  VNEAQPKVPWQQQHHQQIQQQPSAHTTGP---------PSPTSMSSG--CSSPGY--SPS  2010

Query  1927  KTDTSEVWLPPHPSDFGLGDKKS----HFWQNAPVTDWSKEQVCQWLSGIGLERYAPRFL  1982
             +T      L    S     D+K+    + ++  PV +W+K+QV  WL GI LERY P F 
Sbjct  2011  RT------LDLSGSSSSFSDRKAMAAGYTYKGGPVHEWTKDQVGHWLMGIELERYIPVFK  2064

Query  1983  ETGINGGNLLRLESRDLKAFGICGDEKSHLKRKLKELRAQADRERKE  2029
             E  + GG LL L+S+D K  GICGD+K  LK++LK+L+A  ++ERK+
Sbjct  2065  ENNVEGGALLTLDSKDFKTLGICGDDKHRLKKRLKDLKANIEKERKD  2111


 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 82/247 (33%), Positives = 108/247 (44%), Gaps = 41/247 (17%)

Query  14   KVSAIANIFQSKP-------QLDNLIHRTNNILSDGFKEPAVPLKESPTQVTVVRTESHV  66
            KVS IANIFQ KP       QL  +        +         ++ +P     VRTESH 
Sbjct  14   KVSQIANIFQRKPIEIQPVEQLSAVAAAHAAAAAAAAAAHHAHVQGAPA----VRTESHS  69

Query  67   ARFNNARALFEKLGEENKPNKPVDRITKPSNLHGLRSRSSSANSGSGCTSPARSPRPRSP  126
            ARFNNARALFEKLG E+  N    R+ +  +        S  +S          P+ R+P
Sbjct  70   ARFNNARALFEKLGVESNSNVS-SRLLRSGSREDNLCDGSDRSSSRSSDRSQSPPKRRTP  128

Query  127  SPPGTRDHLSNWSASVPALNA---ERHFENG--------------------HNHG-LDNI  162
             P G     +N +A++ A N    E+   N                     HN   L + 
Sbjct  129  FPSGVSLVHNNNNAAIVAQNGVPPEQRLSNSKFIVEPAAQVVPTSVVKYPQHNISRLKSE  188

Query  163  PDKHKSRAGFGKFDKNYGKENRLDDRPEKPEKPERRLNSKELIEKQKNWTSHFSKTRPSR  222
                      G     +       D+P   EKPER+ NS+ELIEKQK WTSHF+KT+ +R
Sbjct  189  EPSPVPPPASGSVSALFASSG--GDKP---EKPERKFNSRELIEKQKKWTSHFTKTKTTR  243

Query  223  YNSDPNR  229
             +SD NR
Sbjct  244  THSDLNR  250


 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 1/41 (2%)

Query  1023  PDTMTADEAENLLSSRILEKKIRQGSALLSDEEAQEIARLL  1063
             PD MTA EAE LLSS ILE KIRQ S LLSDE+A+E+ ++L
Sbjct  859   PDDMTAAEAERLLSSSILENKIRQQS-LLSDEQAKEVEQIL  898


 Score = 37.7 bits (86),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 15/24 (63%), Positives = 21/24 (88%), Gaps = 0/24 (0%)

Query  652  RRSHVRVDLQAAGLGQRPPSVISS  675
            +RS + V++ AAGLGQRPPS+IS+
Sbjct  537  KRSSITVNMPAAGLGQRPPSIIST  560



Lambda      K        H
   0.306    0.123    0.336 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 27409708836


Query= XP_050573060.1 uncharacterized protein LOC126913872 isoform X2
[Bombus affinis]

Length=2036
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9GQA3_DROME  unnamed protein product                                 574     3e-176
M9NFI9_DROME  unnamed protein product                                 578     2e-171
M9NEY3_DROME  unnamed protein product                                 577     3e-171


>Q9GQA3_DROME unnamed protein product
Length=1330

 Score = 574 bits (1480),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 351/678 (52%), Positives = 419/678 (62%), Gaps = 94/678 (14%)

Query  1094  DNTPDWLSDVLSAPDTSLINSTI----------------NDYSLSHRSRSDLTI------  1131
             D+ P+WL DVL AP  SL N  I                N Y L H   SDL        
Sbjct  233   DDEPEWLRDVLEAPKRSLENLLITSATSSRAPGQREELENGYDL-HEKHSDLNQTYITGG  291

Query  1132  DSLTESQVGSVTGSESGLLGSVNSLND---------TYEINDD-------------TETE  1169
             +SL ES V   +      L    +++D         TY + D              TE +
Sbjct  292   ESLHESIVSVESTQSDATLNQTTTIDDSIISSKHNSTYSLADAEQATSSTVLSTGVTELD  351

Query  1170  HQDEYVP---PTPGKVVLVENGVHYFEDGHFWMEVAGIPESDDEKDDYPTNIPIKKMSKV  1226
                 Y+P   P   K VLVE GVHYFEDG+FWMEV G+ + DD+   YP  I ++K  KV
Sbjct  352   DSQYYIPEYPPVRSKEVLVEAGVHYFEDGNFWMEVPGLLDFDDDDCSYPP-ITVRKNPKV  410

Query  1227  SFDTKPMRVYSTHSVNEYDRRNEDVDPVAASAEYELEKRVEKMEVFPVELMKGPEGLGLS  1286
              F + P+ V ST SVN+YDRRNEDVDPVAASAEYELEKRVEKM VFPVELMKGPEGLGLS
Sbjct  411   RFSSGPIHVCSTFSVNDYDRRNEDVDPVAASAEYELEKRVEKMHVFPVELMKGPEGLGLS  470

Query  1287  IIGMGVGADAGLEKLGIFVKTITEKGAAAREGRIQVNDQIVEVDGKSLVGVTQAYAASVL  1346
             IIGMGVGADAGLEKLGIFVKTIT+ GAAAR+GRIQVNDQI+EVDGKSLVGVTQAYAASVL
Sbjct  471   IIGMGVGADAGLEKLGIFVKTITDNGAAARDGRIQVNDQIIEVDGKSLVGVTQAYAASVL  530

Query  1347  RNTSGLVRFVIGRERDP-NSEVAMLIRQSLQADKEREQQANSASQ---RGSEDISVGGMG  1402
             RNTSGLV+F IGRERDP NSEVA LIR SLQAD+E+E++     +   R + D S     
Sbjct  531   RNTSGLVKFQIGRERDPENSEVAQLIRLSLQADREKEERLKRQQEEYLRRTLDYSEDST-  589

Query  1403  GIPGSPAMSSCSEGEPPQSPIENYLSSSGRSRSPIISSSMPPHTSATTQNDVDSLRLLLQ  1462
                  P  ++ S  E P SP++                  P    AT   +V+SL+ LLQ
Sbjct  590   ----QPVSANSSVCEGPSSPVQ---------------VEHPMEVEATHSQEVESLKRLLQ  630

Query  1463  ESQYKLALADGEVEKLKAKLVDLENSGAGSEEYAAKLRESGLRLHESERALGTARQDLIA  1522
             ES+    + +  ++ LK KLV LE +G  +E  + +LR       +SER LG  R++   
Sbjct  631   ESEMGCLVKEEIIQNLKRKLVKLETTGNENELLSERLR-------QSERELGNIRKEAAN  683

Query  1523  AREMLSQATAQNAALQQKYARARRAARELR---TDIAARDEFYQQLLQEKDTEYNALVKS  1579
              + ML Q+  Q  AL +KY +A+R  RE +    D+  R+EFYQQLLQEKDTEYNALVK 
Sbjct  684   LQNMLQQSQGQYMALDKKYNKAKRLVREYQQRELDMCHREEFYQQLLQEKDTEYNALVKK  743

Query  1580  LKDRVITLEVELTETQRRFGLPVRLPYDGTTARIVTPQLSRRQLPPPP--SSTSCQLSDT  1637
             LKDRVI LE EL ETQR+ G PV LPYD  T ++ TPQ+ R+  PP P       +LSDT
Sbjct  744   LKDRVINLEHELQETQRKAGFPVGLPYDSATLKL-TPQMMRKT-PPKPLFHKLETELSDT  801

Query  1638  ETSDLSSPDDGDKTATVERKLPLPLPVKEELDRAVPAHRLLDNSAGKSKAELASRGGLAN  1697
             E SDLS   DG KTATVERK    +PVK+ELD AVP H LLDNS  K+K +LASRGGLAN
Sbjct  802   EISDLSPDGDGVKTATVERK----VPVKDELDAAVPQHELLDNSINKTKIDLASRGGLAN  857

Query  1698  RQLPKRSGGLSNSSSDYG  1715
             RQLP  +G   NSS+  G
Sbjct  858   RQLPSANG---NSSTSNG  872


 Score = 146 bits (368),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 92/219 (42%), Positives = 129/219 (59%), Gaps = 19/219 (9%)

Query  1804  PPASFAEQLKQVLAERERRLGGNDMSSSRESSGDFSDLNNPHSSDPALVTHHLVEEIRQA  1863
             P +SF +QL Q L++RERRLG     SSR SS D++++N   S+  A+    L+ EIRQA
Sbjct  1104  PGSSFTDQLNQALSDRERRLGD---GSSRHSSDDYTEINKSQSA-AAINCKTLINEIRQA  1159

Query  1864  VSEANQRVKKATIPSSNLIGSGSTPWHHPGSSPSSLSSGGSVSPPAVDPSPSKTDTSEVW  1923
             V+EA  +   A         +   P HH  +SP+S+SSG S SP     SPS+T      
Sbjct  1160  VNEAQPKGALAAAAPPANPAAAVRP-HHRSASPTSMSSGCS-SPGY---SPSRT------  1208

Query  1924  LPPHPSDFGLGDKKS----HFWQNAPVTDWSKEQVCQWLSGIGLERYAPRFLETGINGGN  1979
             L    S     D+K+    + ++  PV +W+K+QV  WL GI LERY P F E  + GG 
Sbjct  1209  LDLSGSSSSFSDRKAMAAGYTYKGGPVHEWTKDQVGHWLMGIELERYIPVFKENNVEGGA  1268

Query  1980  LLRLESRDLKAFGICGDEKSHLKRKLKELRAQADRERKE  2018
             LL L+S+D K  GICGD+K  LK++LK+L+A  ++ERK+
Sbjct  1269  LLTLDSKDFKTLGICGDDKHRLKKRLKDLKANIEKERKD  1307


 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 1/41 (2%)

Query  1023  PDTMTADEAENLLSSRILEKKIRQGSALLSDEEAQEIARLL  1063
             PD MTA EAE LLSS ILE KIRQ S LLSDE+A+E+ ++L
Sbjct  55    PDDMTAAEAERLLSSSILENKIRQQS-LLSDEQAKEVEQIL  94


>M9NFI9_DROME unnamed protein product
Length=2148

 Score = 578 bits (1490),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 352/678 (52%), Positives = 420/678 (62%), Gaps = 94/678 (14%)

Query  1094  DNTPDWLSDVLSAPDTSLINSTI----------------NDYSLSHRSRSDLTI------  1131
             D+ P+WL DVL AP  SL N  I                N Y L H   SDL        
Sbjct  1037  DDEPEWLRDVLEAPKRSLENLLITSATSSRAPGQREELENGYDL-HEKHSDLNQTYITGG  1095

Query  1132  DSLTESQVGSVTGSESGLLGSVNSLND---------TYEINDD-------------TETE  1169
             +SL ES V   +      L    +++D         TY + D              TE +
Sbjct  1096  ESLHESIVSVESTQSDATLNQTTTIDDSIISSKHNSTYSLADAEQATSSTVLSTGVTELD  1155

Query  1170  HQDEYVP---PTPGKVVLVENGVHYFEDGHFWMEVAGIPESDDEKDDYPTNIPIKKMSKV  1226
                 Y+P   P   K VLVE GVHYFEDG+FWMEV G+ + DD+   YP  I ++K  KV
Sbjct  1156  DSQYYIPEYPPVRSKEVLVEAGVHYFEDGNFWMEVPGLLDFDDDDCSYPP-ITVRKNPKV  1214

Query  1227  SFDTKPMRVYSTHSVNEYDRRNEDVDPVAASAEYELEKRVEKMEVFPVELMKGPEGLGLS  1286
              F + P+ VYST SVN+YDRRNEDVDPVAASAEYELEKRVEKM VFPVELMKGPEGLGLS
Sbjct  1215  RFSSGPIHVYSTFSVNDYDRRNEDVDPVAASAEYELEKRVEKMHVFPVELMKGPEGLGLS  1274

Query  1287  IIGMGVGADAGLEKLGIFVKTITEKGAAAREGRIQVNDQIVEVDGKSLVGVTQAYAASVL  1346
             IIGMGVGADAGLEKLGIFVKTIT+ GAAAR+GRIQVNDQI+EVDGKSLVGVTQAYAASVL
Sbjct  1275  IIGMGVGADAGLEKLGIFVKTITDNGAAARDGRIQVNDQIIEVDGKSLVGVTQAYAASVL  1334

Query  1347  RNTSGLVRFVIGRERDP-NSEVAMLIRQSLQADKEREQQANSASQ---RGSEDISVGGMG  1402
             RNTSGLV+F IGRERDP NSEVA LIR SLQAD+E+E++     +   R + D S     
Sbjct  1335  RNTSGLVKFQIGRERDPENSEVAQLIRLSLQADREKEERLKRQQEEYLRRTLDYSEDST-  1393

Query  1403  GIPGSPAMSSCSEGEPPQSPIENYLSSSGRSRSPIISSSMPPHTSATTQNDVDSLRLLLQ  1462
                  P  ++ S  E P SP++                  P    AT   +V+SL+ LLQ
Sbjct  1394  ----QPVSANSSVCEGPSSPVQ---------------VEHPMEVEATHSQEVESLKRLLQ  1434

Query  1463  ESQYKLALADGEVEKLKAKLVDLENSGAGSEEYAAKLRESGLRLHESERALGTARQDLIA  1522
             ES+    + +  ++ LK KLV LE +G  +E  + +LR       +SER LG  R++   
Sbjct  1435  ESEMGCLVKEEIIQNLKRKLVKLETTGNENELLSERLR-------QSERELGNIRKEAAN  1487

Query  1523  AREMLSQATAQNAALQQKYARARRAARELR---TDIAARDEFYQQLLQEKDTEYNALVKS  1579
              + ML Q+  Q  AL +KY +A+R  RE +    D+  R+EFYQQLLQEKDTEYNALVK 
Sbjct  1488  LQNMLQQSQGQYMALDKKYNKAKRLVREYQQRELDMCHREEFYQQLLQEKDTEYNALVKK  1547

Query  1580  LKDRVITLEVELTETQRRFGLPVRLPYDGTTARIVTPQLSRRQLPPPP--SSTSCQLSDT  1637
             LKDRVI LE EL ETQR+ G PV LPYD  T ++ TPQ+ R+  PP P       +LSDT
Sbjct  1548  LKDRVINLEHELQETQRKAGFPVGLPYDSATLKL-TPQMMRKT-PPKPLFHKLETELSDT  1605

Query  1638  ETSDLSSPDDGDKTATVERKLPLPLPVKEELDRAVPAHRLLDNSAGKSKAELASRGGLAN  1697
             E SDLS   DG KTATVERK    +PVK+ELD AVP H LLDNS  K+K +LASRGGLAN
Sbjct  1606  EISDLSPDGDGVKTATVERK----VPVKDELDAAVPQHELLDNSINKTKIDLASRGGLAN  1661

Query  1698  RQLPKRSGGLSNSSSDYG  1715
             RQLP  +G   NSS+  G
Sbjct  1662  RQLPSANG---NSSTSNG  1676


 Score = 148 bits (373),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 97/234 (41%), Positives = 135/234 (58%), Gaps = 35/234 (15%)

Query  1804  PPASFAEQLKQVLAERERRLGGNDMSSSRESSGDFSDLNNPHSSDPALVTHHLVEEIRQA  1863
             P +SF +QL Q L++RERRLG     SSR SS D++++N   S+  A+    L+ EIRQA
Sbjct  1908  PGSSFTDQLNQALSDRERRLGDG---SSRHSSDDYTEINKSQSA-AAINCKTLINEIRQA  1963

Query  1864  VSEANQRVKKATIPSSNLIGSGSTPW--------------HHPGS-SPSSLSSGGSVSPP  1908
             V+EA  +VK+  +P S L   G+ PW              H  G  SP+S+SSG   S P
Sbjct  1964  VNEAQPKVKQ-VVPQS-LSPPGTVPWQQQHHQQIQQQPSAHTTGPPSPTSMSSG--CSSP  2019

Query  1909  AVDPSPSKTDTSEVWLPPHPSDFGLGDKKS----HFWQNAPVTDWSKEQVCQWLSGIGLE  1964
                 SPS+T      L    S     D+K+    + ++  PV +W+K+QV  WL GI LE
Sbjct  2020  GY--SPSRT------LDLSGSSSSFSDRKAMAAGYTYKGGPVHEWTKDQVGHWLMGIELE  2071

Query  1965  RYAPRFLETGINGGNLLRLESRDLKAFGICGDEKSHLKRKLKELRAQADRERKE  2018
             RY P F E  + GG LL L+S+D K  GICGD+K  LK++LK+L+A  ++ERK+
Sbjct  2072  RYIPVFKENNVEGGALLTLDSKDFKTLGICGDDKHRLKKRLKDLKANIEKERKD  2125


 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 82/247 (33%), Positives = 108/247 (44%), Gaps = 41/247 (17%)

Query  14   KVSAIANIFQSKP-------QLDNLIHRTNNILSDGFKEPAVPLKESPTQVTVVRTESHV  66
            KVS IANIFQ KP       QL  +        +         ++ +P     VRTESH 
Sbjct  14   KVSQIANIFQRKPIEIQPVEQLSAVAAAHAAAAAAAAAAHHAHVQGAPA----VRTESHS  69

Query  67   ARFNNARALFEKLGEENKPNKPVDRITKPSNLHGLRSRSSSANSGSGCTSPARSPRPRSP  126
            ARFNNARALFEKLG E+  N    R+ +  +        S  +S          P+ R+P
Sbjct  70   ARFNNARALFEKLGVESNSNV-SSRLLRSGSREDNLCDGSDRSSSRSSDRSQSPPKRRTP  128

Query  127  SPPGTRDHLSNWSASVPALNA---ERHFENG--------------------HNHG-LDNI  162
             P G     +N +A++ A N    E+   N                     HN   L + 
Sbjct  129  FPSGVSLVHNNNNAAIVAQNGVPPEQRLSNSKFIVEPAAQVVPTSVVKYPQHNISRLKSE  188

Query  163  PDKHKSRAGFGKFDKNYGKENRLDDRPEKPEKPERRLNSKELIEKQKNWTSHFSKTRPSR  222
                      G     +       D+P   EKPER+ NS+ELIEKQK WTSHF+KT+ +R
Sbjct  189  EPSPVPPPASGSVSALFASSG--GDKP---EKPERKFNSRELIEKQKKWTSHFTKTKTTR  243

Query  223  YNSDPNR  229
             +SD NR
Sbjct  244  THSDLNR  250


 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 1/41 (2%)

Query  1023  PDTMTADEAENLLSSRILEKKIRQGSALLSDEEAQEIARLL  1063
             PD MTA EAE LLSS ILE KIRQ S LLSDE+A+E+ ++L
Sbjct  859   PDDMTAAEAERLLSSSILENKIRQQS-LLSDEQAKEVEQIL  898


 Score = 37.7 bits (86),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 15/24 (63%), Positives = 21/24 (88%), Gaps = 0/24 (0%)

Query  652  RRSHVRVDLQAAGLGQRPPSVISS  675
            +RS + V++ AAGLGQRPPS+IS+
Sbjct  537  KRSSITVNMPAAGLGQRPPSIIST  560


>M9NEY3_DROME unnamed protein product
Length=2134

 Score = 577 bits (1488),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 352/678 (52%), Positives = 420/678 (62%), Gaps = 94/678 (14%)

Query  1094  DNTPDWLSDVLSAPDTSLINSTI----------------NDYSLSHRSRSDLTI------  1131
             D+ P+WL DVL AP  SL N  I                N Y L H   SDL        
Sbjct  1037  DDEPEWLRDVLEAPKRSLENLLITSATSSRAPGQREELENGYDL-HEKHSDLNQTYITGG  1095

Query  1132  DSLTESQVGSVTGSESGLLGSVNSLND---------TYEINDD-------------TETE  1169
             +SL ES V   +      L    +++D         TY + D              TE +
Sbjct  1096  ESLHESIVSVESTQSDATLNQTTTIDDSIISSKHNSTYSLADAEQATSSTVLSTGVTELD  1155

Query  1170  HQDEYVP---PTPGKVVLVENGVHYFEDGHFWMEVAGIPESDDEKDDYPTNIPIKKMSKV  1226
                 Y+P   P   K VLVE GVHYFEDG+FWMEV G+ + DD+   YP  I ++K  KV
Sbjct  1156  DSQYYIPEYPPVRSKEVLVEAGVHYFEDGNFWMEVPGLLDFDDDDCSYPP-ITVRKNPKV  1214

Query  1227  SFDTKPMRVYSTHSVNEYDRRNEDVDPVAASAEYELEKRVEKMEVFPVELMKGPEGLGLS  1286
              F + P+ VYST SVN+YDRRNEDVDPVAASAEYELEKRVEKM VFPVELMKGPEGLGLS
Sbjct  1215  RFSSGPIHVYSTFSVNDYDRRNEDVDPVAASAEYELEKRVEKMHVFPVELMKGPEGLGLS  1274

Query  1287  IIGMGVGADAGLEKLGIFVKTITEKGAAAREGRIQVNDQIVEVDGKSLVGVTQAYAASVL  1346
             IIGMGVGADAGLEKLGIFVKTIT+ GAAAR+GRIQVNDQI+EVDGKSLVGVTQAYAASVL
Sbjct  1275  IIGMGVGADAGLEKLGIFVKTITDNGAAARDGRIQVNDQIIEVDGKSLVGVTQAYAASVL  1334

Query  1347  RNTSGLVRFVIGRERDP-NSEVAMLIRQSLQADKEREQQANSASQ---RGSEDISVGGMG  1402
             RNTSGLV+F IGRERDP NSEVA LIR SLQAD+E+E++     +   R + D S     
Sbjct  1335  RNTSGLVKFQIGRERDPENSEVAQLIRLSLQADREKEERLKRQQEEYLRRTLDYSEDST-  1393

Query  1403  GIPGSPAMSSCSEGEPPQSPIENYLSSSGRSRSPIISSSMPPHTSATTQNDVDSLRLLLQ  1462
                  P  ++ S  E P SP++                  P    AT   +V+SL+ LLQ
Sbjct  1394  ----QPVSANSSVCEGPSSPVQ---------------VEHPMEVEATHSQEVESLKRLLQ  1434

Query  1463  ESQYKLALADGEVEKLKAKLVDLENSGAGSEEYAAKLRESGLRLHESERALGTARQDLIA  1522
             ES+    + +  ++ LK KLV LE +G  +E  + +LR       +SER LG  R++   
Sbjct  1435  ESEMGCLVKEEIIQNLKRKLVKLETTGNENELLSERLR-------QSERELGNIRKEAAN  1487

Query  1523  AREMLSQATAQNAALQQKYARARRAARELR---TDIAARDEFYQQLLQEKDTEYNALVKS  1579
              + ML Q+  Q  AL +KY +A+R  RE +    D+  R+EFYQQLLQEKDTEYNALVK 
Sbjct  1488  LQNMLQQSQGQYMALDKKYNKAKRLVREYQQRELDMCHREEFYQQLLQEKDTEYNALVKK  1547

Query  1580  LKDRVITLEVELTETQRRFGLPVRLPYDGTTARIVTPQLSRRQLPPPP--SSTSCQLSDT  1637
             LKDRVI LE EL ETQR+ G PV LPYD  T ++ TPQ+ R+  PP P       +LSDT
Sbjct  1548  LKDRVINLEHELQETQRKAGFPVGLPYDSATLKL-TPQMMRKT-PPKPLFHKLETELSDT  1605

Query  1638  ETSDLSSPDDGDKTATVERKLPLPLPVKEELDRAVPAHRLLDNSAGKSKAELASRGGLAN  1697
             E SDLS   DG KTATVERK    +PVK+ELD AVP H LLDNS  K+K +LASRGGLAN
Sbjct  1606  EISDLSPDGDGVKTATVERK----VPVKDELDAAVPQHELLDNSINKTKIDLASRGGLAN  1661

Query  1698  RQLPKRSGGLSNSSSDYG  1715
             RQLP  +G   NSS+  G
Sbjct  1662  RQLPSANG---NSSTSNG  1676


 Score = 139 bits (350),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 91/227 (40%), Positives = 129/227 (57%), Gaps = 35/227 (15%)

Query  1804  PPASFAEQLKQVLAERERRLGGNDMSSSRESSGDFSDLNNPHSSDPALVTHHLVEEIRQA  1863
             P +SF +QL Q L++RERRLG     SSR SS D++++N   S+  A+    L+ EIRQA
Sbjct  1908  PGSSFTDQLNQALSDRERRLGDG---SSRHSSDDYTEINKSQSA-AAINCKTLINEIRQA  1963

Query  1864  VSEANQRV--------KKATIPSSNLIGSGSTPWHHPGSSPSSLSSGGSVSPPAVDPSPS  1915
             V+EA  +V        +    PS++  G           SP+S+SSG   S P    SPS
Sbjct  1964  VNEAQPKVPWQQQHHQQIQQQPSAHTTGP---------PSPTSMSSG--CSSPGY--SPS  2010

Query  1916  KTDTSEVWLPPHPSDFGLGDKKS----HFWQNAPVTDWSKEQVCQWLSGIGLERYAPRFL  1971
             +T      L    S     D+K+    + ++  PV +W+K+QV  WL GI LERY P F 
Sbjct  2011  RT------LDLSGSSSSFSDRKAMAAGYTYKGGPVHEWTKDQVGHWLMGIELERYIPVFK  2064

Query  1972  ETGINGGNLLRLESRDLKAFGICGDEKSHLKRKLKELRAQADRERKE  2018
             E  + GG LL L+S+D K  GICGD+K  LK++LK+L+A  ++ERK+
Sbjct  2065  ENNVEGGALLTLDSKDFKTLGICGDDKHRLKKRLKDLKANIEKERKD  2111


 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 82/247 (33%), Positives = 108/247 (44%), Gaps = 41/247 (17%)

Query  14   KVSAIANIFQSKP-------QLDNLIHRTNNILSDGFKEPAVPLKESPTQVTVVRTESHV  66
            KVS IANIFQ KP       QL  +        +         ++ +P     VRTESH 
Sbjct  14   KVSQIANIFQRKPIEIQPVEQLSAVAAAHAAAAAAAAAAHHAHVQGAPA----VRTESHS  69

Query  67   ARFNNARALFEKLGEENKPNKPVDRITKPSNLHGLRSRSSSANSGSGCTSPARSPRPRSP  126
            ARFNNARALFEKLG E+  N    R+ +  +        S  +S          P+ R+P
Sbjct  70   ARFNNARALFEKLGVESNSNVS-SRLLRSGSREDNLCDGSDRSSSRSSDRSQSPPKRRTP  128

Query  127  SPPGTRDHLSNWSASVPALNA---ERHFENG--------------------HNHG-LDNI  162
             P G     +N +A++ A N    E+   N                     HN   L + 
Sbjct  129  FPSGVSLVHNNNNAAIVAQNGVPPEQRLSNSKFIVEPAAQVVPTSVVKYPQHNISRLKSE  188

Query  163  PDKHKSRAGFGKFDKNYGKENRLDDRPEKPEKPERRLNSKELIEKQKNWTSHFSKTRPSR  222
                      G     +       D+P   EKPER+ NS+ELIEKQK WTSHF+KT+ +R
Sbjct  189  EPSPVPPPASGSVSALFASSG--GDKP---EKPERKFNSRELIEKQKKWTSHFTKTKTTR  243

Query  223  YNSDPNR  229
             +SD NR
Sbjct  244  THSDLNR  250


 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 1/41 (2%)

Query  1023  PDTMTADEAENLLSSRILEKKIRQGSALLSDEEAQEIARLL  1063
             PD MTA EAE LLSS ILE KIRQ S LLSDE+A+E+ ++L
Sbjct  859   PDDMTAAEAERLLSSSILENKIRQQS-LLSDEQAKEVEQIL  898


 Score = 37.7 bits (86),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 15/24 (63%), Positives = 21/24 (88%), Gaps = 0/24 (0%)

Query  652  RRSHVRVDLQAAGLGQRPPSVISS  675
            +RS + V++ AAGLGQRPPS+IS+
Sbjct  537  KRSSITVNMPAAGLGQRPPSIIST  560



Lambda      K        H
   0.306    0.123    0.336 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 27409708836


Query= XP_050573061.1 uncharacterized protein LOC126913872 isoform X3
[Bombus affinis]

Length=2031
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9GQA3_DROME  unnamed protein product                                 575     2e-176
M9NEY3_DROME  unnamed protein product                                 579     6e-172
M9NFI9_DROME  unnamed protein product                                 579     9e-172


>Q9GQA3_DROME unnamed protein product
Length=1330

 Score = 575 bits (1481),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 353/692 (51%), Positives = 421/692 (61%), Gaps = 111/692 (16%)

Query  1094  DNTPDWLSDVLSAPDTSLINSTI----------------NDYSLSHRSRSDLTI------  1131
             D+ P+WL DVL AP  SL N  I                N Y L H   SDL        
Sbjct  233   DDEPEWLRDVLEAPKRSLENLLITSATSSRAPGQREELENGYDL-HEKHSDLNQTYITGG  291

Query  1132  DSLTESQVGSVTGSESGLLGSVNSLND---------TYEINDD-------------TETE  1169
             +SL ES V   +      L    +++D         TY + D              TE +
Sbjct  292   ESLHESIVSVESTQSDATLNQTTTIDDSIISSKHNSTYSLADAEQATSSTVLSTGVTELD  351

Query  1170  HQDEYVP---PTPGKVVLVENGVHYFEDGHFWMEVAGIPESDDEKDDYPTNIPIKKMSKV  1226
                 Y+P   P   K VLVE GVHYFEDG+FWMEV G+ + DD+   YP  I ++K  KV
Sbjct  352   DSQYYIPEYPPVRSKEVLVEAGVHYFEDGNFWMEVPGLLDFDDDDCSYPP-ITVRKNPKV  410

Query  1227  SFDTKPMRVYSTHSVNEYDRRNEDVDPVAASAEYELEKRVEKMEVFPVELMKGPEGLGLS  1286
              F + P+ V ST SVN+YDRRNEDVDPVAASAEYELEKRVEKM VFPVELMKGPEGLGLS
Sbjct  411   RFSSGPIHVCSTFSVNDYDRRNEDVDPVAASAEYELEKRVEKMHVFPVELMKGPEGLGLS  470

Query  1287  IIGMGVGADAGLEKLGIFVKTITEKGAAAREGRIQVNDQIVEVDGKSLVGVTQAYAASVL  1346
             IIGMGVGADAGLEKLGIFVKTIT+ GAAAR+GRIQVNDQI+EVDGKSLVGVTQAYAASVL
Sbjct  471   IIGMGVGADAGLEKLGIFVKTITDNGAAARDGRIQVNDQIIEVDGKSLVGVTQAYAASVL  530

Query  1347  RNTSGLVRFVIGRERDP-NSEVAMLIRQSLQADKE------REQQANSARKLNFSDASPD  1399
             RNTSGLV+F IGRERDP NSEVA LIR SLQAD+E      R+Q+    R L++S+ S  
Sbjct  531   RNTSGLVKFQIGRERDPENSEVAQLIRLSLQADREKEERLKRQQEEYLRRTLDYSEDST-  589

Query  1400  SQRGSEDISVGGMGGIPGSPAMSSCSEGEPPQSPIENYLSSSGRSRSPIISSSMPPHTSA  1459
                                P  ++ S  E P SP++                  P    A
Sbjct  590   ------------------QPVSANSSVCEGPSSPVQ---------------VEHPMEVEA  616

Query  1460  TTQNDVDSLRLLLQESQYKLALADGEVEKLKAKLVDLENSGAGSEEYAAKLRESGLRLHE  1519
             T   +V+SL+ LLQES+    + +  ++ LK KLV LE +G  +E  + +LR       +
Sbjct  617   THSQEVESLKRLLQESEMGCLVKEEIIQNLKRKLVKLETTGNENELLSERLR-------Q  669

Query  1520  SERALGTARQDLIAAREMLSQATAQNAALQQKYARARRAARELR---TDIAARDEFYQQL  1576
             SER LG  R++    + ML Q+  Q  AL +KY +A+R  RE +    D+  R+EFYQQL
Sbjct  670   SERELGNIRKEAANLQNMLQQSQGQYMALDKKYNKAKRLVREYQQRELDMCHREEFYQQL  729

Query  1577  LQEKDTEYNALVKSLKDRVITLEVELTETQRRFGLPVRLPYDGTTARIVTPQLSRRQLPP  1636
             LQEKDTEYNALVK LKDRVI LE EL ETQR+ G PV LPYD  T ++ TPQ+ R+  PP
Sbjct  730   LQEKDTEYNALVKKLKDRVINLEHELQETQRKAGFPVGLPYDSATLKL-TPQMMRKT-PP  787

Query  1637  PP--SSTSCQLSDTETSDLSSPDDGDKTATVERKLPLPLPVKEELDRAVPAHRLLDNSAG  1694
              P       +LSDTE SDLS   DG KTATVERK    +PVK+ELD AVP H LLDNS  
Sbjct  788   KPLFHKLETELSDTEISDLSPDGDGVKTATVERK----VPVKDELDAAVPQHELLDNSIN  843

Query  1695  KSKAELASRGGLANRQLPKRSGGLSNSSSDYG  1726
             K+K +LASRGGLANRQLP  +G   NSS+  G
Sbjct  844   KTKIDLASRGGLANRQLPSANG---NSSTSNG  872


 Score = 148 bits (374),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 87/211 (41%), Positives = 124/211 (59%), Gaps = 19/211 (9%)

Query  1815  PPASFAEQLKQVLAERERRLGGNDMSSSRESSGDFSDLNNPHSSDPALVTHHLVEEIRQA  1874
             P +SF +QL Q L++RERRLG     SSR SS D++++N   S+  A+    L+ EIRQA
Sbjct  1104  PGSSFTDQLNQALSDRERRLGD---GSSRHSSDDYTEINKSQSA-AAINCKTLINEIRQA  1159

Query  1875  VSEANQRVKKATIPSSNLIGSGSTPWHHPGSSPSSLSSGGSVSPPAVDPSPS--------  1926
             V+EA  +   A         +   P HH  +SP+S+SSG   S P   PS +        
Sbjct  1160  VNEAQPKGALAAAAPPANPAAAVRP-HHRSASPTSMSSG--CSSPGYSPSRTLDLSGSSS  1216

Query  1927  KTGDKKS----HFWQNAPVTDWSKEQVCQWLSGIGLERYAPRFLETGINGGNLLRLESRD  1982
                D+K+    + ++  PV +W+K+QV  WL GI LERY P F E  + GG LL L+S+D
Sbjct  1217  SFSDRKAMAAGYTYKGGPVHEWTKDQVGHWLMGIELERYIPVFKENNVEGGALLTLDSKD  1276

Query  1983  LKAFGICGDEKSHLKRKLKELRAQADRERKE  2013
              K  GICGD+K  LK++LK+L+A  ++ERK+
Sbjct  1277  FKTLGICGDDKHRLKKRLKDLKANIEKERKD  1307


 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 1/41 (2%)

Query  1023  PDTMTADEAENLLSSRILEKKIRQGSALLSDEEAQEIARLL  1063
             PD MTA EAE LLSS ILE KIRQ S LLSDE+A+E+ ++L
Sbjct  55    PDDMTAAEAERLLSSSILENKIRQQS-LLSDEQAKEVEQIL  94


>M9NEY3_DROME unnamed protein product
Length=2134

 Score = 579 bits (1493),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 357/692 (52%), Positives = 426/692 (62%), Gaps = 111/692 (16%)

Query  1094  DNTPDWLSDVLSAPDTSLINSTI----------------NDYSLSHRSRSDLTI------  1131
             D+ P+WL DVL AP  SL N  I                N Y L H   SDL        
Sbjct  1037  DDEPEWLRDVLEAPKRSLENLLITSATSSRAPGQREELENGYDL-HEKHSDLNQTYITGG  1095

Query  1132  DSLTESQVGSVTGSESGLLGSVNSLND---------TYEINDD-------------TETE  1169
             +SL ES V   +      L    +++D         TY + D              TE +
Sbjct  1096  ESLHESIVSVESTQSDATLNQTTTIDDSIISSKHNSTYSLADAEQATSSTVLSTGVTELD  1155

Query  1170  HQDEYVP---PTPGKVVLVENGVHYFEDGHFWMEVAGIPESDDEKDDYPTNIPIKKMSKV  1226
                 Y+P   P   K VLVE GVHYFEDG+FWMEV G+ + DD+   YP  I ++K  KV
Sbjct  1156  DSQYYIPEYPPVRSKEVLVEAGVHYFEDGNFWMEVPGLLDFDDDDCSYPP-ITVRKNPKV  1214

Query  1227  SFDTKPMRVYSTHSVNEYDRRNEDVDPVAASAEYELEKRVEKMEVFPVELMKGPEGLGLS  1286
              F + P+ VYST SVN+YDRRNEDVDPVAASAEYELEKRVEKM VFPVELMKGPEGLGLS
Sbjct  1215  RFSSGPIHVYSTFSVNDYDRRNEDVDPVAASAEYELEKRVEKMHVFPVELMKGPEGLGLS  1274

Query  1287  IIGMGVGADAGLEKLGIFVKTITEKGAAAREGRIQVNDQIVEVDGKSLVGVTQAYAASVL  1346
             IIGMGVGADAGLEKLGIFVKTIT+ GAAAR+GRIQVNDQI+EVDGKSLVGVTQAYAASVL
Sbjct  1275  IIGMGVGADAGLEKLGIFVKTITDNGAAARDGRIQVNDQIIEVDGKSLVGVTQAYAASVL  1334

Query  1347  RNTSGLVRFVIGRERDP-NSEVAMLIRQSLQADKE------REQQANSARKLNFSDASPD  1399
             RNTSGLV+F IGRERDP NSEVA LIR SLQAD+E      R+Q+    R L++S+ S  
Sbjct  1335  RNTSGLVKFQIGRERDPENSEVAQLIRLSLQADREKEERLKRQQEEYLRRTLDYSEDS--  1392

Query  1400  SQRGSEDISVGGMGGIPGSPAMSSCSEGEPPQSPIENYLSSSGRSRSPIISSSMPPHTSA  1459
                 ++ +S           A SS  EG  P SP++                  P    A
Sbjct  1393  ----TQPVS-----------ANSSVCEG--PSSPVQ---------------VEHPMEVEA  1420

Query  1460  TTQNDVDSLRLLLQESQYKLALADGEVEKLKAKLVDLENSGAGSEEYAAKLRESGLRLHE  1519
             T   +V+SL+ LLQES+    + +  ++ LK KLV LE +G  +E  + +LR       +
Sbjct  1421  THSQEVESLKRLLQESEMGCLVKEEIIQNLKRKLVKLETTGNENELLSERLR-------Q  1473

Query  1520  SERALGTARQDLIAAREMLSQATAQNAALQQKYARARRAARELR---TDIAARDEFYQQL  1576
             SER LG  R++    + ML Q+  Q  AL +KY +A+R  RE +    D+  R+EFYQQL
Sbjct  1474  SERELGNIRKEAANLQNMLQQSQGQYMALDKKYNKAKRLVREYQQRELDMCHREEFYQQL  1533

Query  1577  LQEKDTEYNALVKSLKDRVITLEVELTETQRRFGLPVRLPYDGTTARIVTPQLSRRQLPP  1636
             LQEKDTEYNALVK LKDRVI LE EL ETQR+ G PV LPYD  T ++ TPQ+ R+  PP
Sbjct  1534  LQEKDTEYNALVKKLKDRVINLEHELQETQRKAGFPVGLPYDSATLKL-TPQMMRKT-PP  1591

Query  1637  PP--SSTSCQLSDTETSDLSSPDDGDKTATVERKLPLPLPVKEELDRAVPAHRLLDNSAG  1694
              P       +LSDTE SDLS   DG KTATVERK    +PVK+ELD AVP H LLDNS  
Sbjct  1592  KPLFHKLETELSDTEISDLSPDGDGVKTATVERK----VPVKDELDAAVPQHELLDNSIN  1647

Query  1695  KSKAELASRGGLANRQLPKRSGGLSNSSSDYG  1726
             K+K +LASRGGLANRQLP  +G   NSS+  G
Sbjct  1648  KTKIDLASRGGLANRQLPSANG---NSSTSNG  1676


 Score = 142 bits (358),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 87/219 (40%), Positives = 125/219 (57%), Gaps = 35/219 (16%)

Query  1815  PPASFAEQLKQVLAERERRLGGNDMSSSRESSGDFSDLNNPHSSDPALVTHHLVEEIRQA  1874
             P +SF +QL Q L++RERRLG     SSR SS D++++N   S+  A+    L+ EIRQA
Sbjct  1908  PGSSFTDQLNQALSDRERRLGDG---SSRHSSDDYTEINKSQSA-AAINCKTLINEIRQA  1963

Query  1875  VSEANQRV--------KKATIPSSNLIGSGSTPWHHPGSSPSSLSSGGSVSPPAVDPSPS  1926
             V+EA  +V        +    PS++  G           SP+S+SSG   S P   PS +
Sbjct  1964  VNEAQPKVPWQQQHHQQIQQQPSAHTTGP---------PSPTSMSSG--CSSPGYSPSRT  2012

Query  1927  --------KTGDKKS----HFWQNAPVTDWSKEQVCQWLSGIGLERYAPRFLETGINGGN  1974
                        D+K+    + ++  PV +W+K+QV  WL GI LERY P F E  + GG 
Sbjct  2013  LDLSGSSSSFSDRKAMAAGYTYKGGPVHEWTKDQVGHWLMGIELERYIPVFKENNVEGGA  2072

Query  1975  LLRLESRDLKAFGICGDEKSHLKRKLKELRAQADRERKE  2013
             LL L+S+D K  GICGD+K  LK++LK+L+A  ++ERK+
Sbjct  2073  LLTLDSKDFKTLGICGDDKHRLKKRLKDLKANIEKERKD  2111


 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 82/247 (33%), Positives = 108/247 (44%), Gaps = 41/247 (17%)

Query  14   KVSAIANIFQSKP-------QLDNLIHRTNNILSDGFKEPAVPLKESPTQVTVVRTESHV  66
            KVS IANIFQ KP       QL  +        +         ++ +P     VRTESH 
Sbjct  14   KVSQIANIFQRKPIEIQPVEQLSAVAAAHAAAAAAAAAAHHAHVQGAPA----VRTESHS  69

Query  67   ARFNNARALFEKLGEENKPNKPVDRITKPSNLHGLRSRSSSANSGSGCTSPARSPRPRSP  126
            ARFNNARALFEKLG E+  N    R+ +  +        S  +S          P+ R+P
Sbjct  70   ARFNNARALFEKLGVESNSNV-SSRLLRSGSREDNLCDGSDRSSSRSSDRSQSPPKRRTP  128

Query  127  SPPGTRDHLSNWSASVPALNA---ERHFENG--------------------HNHG-LDNI  162
             P G     +N +A++ A N    E+   N                     HN   L + 
Sbjct  129  FPSGVSLVHNNNNAAIVAQNGVPPEQRLSNSKFIVEPAAQVVPTSVVKYPQHNISRLKSE  188

Query  163  PDKHKSRAGFGKFDKNYGKENRLDDRPEKPEKPERRLNSKELIEKQKNWTSHFSKTRPSR  222
                      G     +       D+P   EKPER+ NS+ELIEKQK WTSHF+KT+ +R
Sbjct  189  EPSPVPPPASGSVSALFASSG--GDKP---EKPERKFNSRELIEKQKKWTSHFTKTKTTR  243

Query  223  YNSDPNR  229
             +SD NR
Sbjct  244  THSDLNR  250


 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 1/41 (2%)

Query  1023  PDTMTADEAENLLSSRILEKKIRQGSALLSDEEAQEIARLL  1063
             PD MTA EAE LLSS ILE KIRQ S LLSDE+A+E+ ++L
Sbjct  859   PDDMTAAEAERLLSSSILENKIRQQS-LLSDEQAKEVEQIL  898


 Score = 37.7 bits (86),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 15/24 (63%), Positives = 21/24 (88%), Gaps = 0/24 (0%)

Query  652  RRSHVRVDLQAAGLGQRPPSVISS  675
            +RS + V++ AAGLGQRPPS+IS+
Sbjct  537  KRSSITVNMPAAGLGQRPPSIIST  560


>M9NFI9_DROME unnamed protein product
Length=2148

 Score = 579 bits (1492),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 357/692 (52%), Positives = 426/692 (62%), Gaps = 111/692 (16%)

Query  1094  DNTPDWLSDVLSAPDTSLINSTI----------------NDYSLSHRSRSDLTI------  1131
             D+ P+WL DVL AP  SL N  I                N Y L H   SDL        
Sbjct  1037  DDEPEWLRDVLEAPKRSLENLLITSATSSRAPGQREELENGYDL-HEKHSDLNQTYITGG  1095

Query  1132  DSLTESQVGSVTGSESGLLGSVNSLND---------TYEINDD-------------TETE  1169
             +SL ES V   +      L    +++D         TY + D              TE +
Sbjct  1096  ESLHESIVSVESTQSDATLNQTTTIDDSIISSKHNSTYSLADAEQATSSTVLSTGVTELD  1155

Query  1170  HQDEYVP---PTPGKVVLVENGVHYFEDGHFWMEVAGIPESDDEKDDYPTNIPIKKMSKV  1226
                 Y+P   P   K VLVE GVHYFEDG+FWMEV G+ + DD+   YP  I ++K  KV
Sbjct  1156  DSQYYIPEYPPVRSKEVLVEAGVHYFEDGNFWMEVPGLLDFDDDDCSYPP-ITVRKNPKV  1214

Query  1227  SFDTKPMRVYSTHSVNEYDRRNEDVDPVAASAEYELEKRVEKMEVFPVELMKGPEGLGLS  1286
              F + P+ VYST SVN+YDRRNEDVDPVAASAEYELEKRVEKM VFPVELMKGPEGLGLS
Sbjct  1215  RFSSGPIHVYSTFSVNDYDRRNEDVDPVAASAEYELEKRVEKMHVFPVELMKGPEGLGLS  1274

Query  1287  IIGMGVGADAGLEKLGIFVKTITEKGAAAREGRIQVNDQIVEVDGKSLVGVTQAYAASVL  1346
             IIGMGVGADAGLEKLGIFVKTIT+ GAAAR+GRIQVNDQI+EVDGKSLVGVTQAYAASVL
Sbjct  1275  IIGMGVGADAGLEKLGIFVKTITDNGAAARDGRIQVNDQIIEVDGKSLVGVTQAYAASVL  1334

Query  1347  RNTSGLVRFVIGRERDP-NSEVAMLIRQSLQADKE------REQQANSARKLNFSDASPD  1399
             RNTSGLV+F IGRERDP NSEVA LIR SLQAD+E      R+Q+    R L++S+ S  
Sbjct  1335  RNTSGLVKFQIGRERDPENSEVAQLIRLSLQADREKEERLKRQQEEYLRRTLDYSEDS--  1392

Query  1400  SQRGSEDISVGGMGGIPGSPAMSSCSEGEPPQSPIENYLSSSGRSRSPIISSSMPPHTSA  1459
                 ++ +S           A SS  EG  P SP++                  P    A
Sbjct  1393  ----TQPVS-----------ANSSVCEG--PSSPVQ---------------VEHPMEVEA  1420

Query  1460  TTQNDVDSLRLLLQESQYKLALADGEVEKLKAKLVDLENSGAGSEEYAAKLRESGLRLHE  1519
             T   +V+SL+ LLQES+    + +  ++ LK KLV LE +G  +E  + +LR       +
Sbjct  1421  THSQEVESLKRLLQESEMGCLVKEEIIQNLKRKLVKLETTGNENELLSERLR-------Q  1473

Query  1520  SERALGTARQDLIAAREMLSQATAQNAALQQKYARARRAARELR---TDIAARDEFYQQL  1576
             SER LG  R++    + ML Q+  Q  AL +KY +A+R  RE +    D+  R+EFYQQL
Sbjct  1474  SERELGNIRKEAANLQNMLQQSQGQYMALDKKYNKAKRLVREYQQRELDMCHREEFYQQL  1533

Query  1577  LQEKDTEYNALVKSLKDRVITLEVELTETQRRFGLPVRLPYDGTTARIVTPQLSRRQLPP  1636
             LQEKDTEYNALVK LKDRVI LE EL ETQR+ G PV LPYD  T ++ TPQ+ R+  PP
Sbjct  1534  LQEKDTEYNALVKKLKDRVINLEHELQETQRKAGFPVGLPYDSATLKL-TPQMMRKT-PP  1591

Query  1637  PP--SSTSCQLSDTETSDLSSPDDGDKTATVERKLPLPLPVKEELDRAVPAHRLLDNSAG  1694
              P       +LSDTE SDLS   DG KTATVERK    +PVK+ELD AVP H LLDNS  
Sbjct  1592  KPLFHKLETELSDTEISDLSPDGDGVKTATVERK----VPVKDELDAAVPQHELLDNSIN  1647

Query  1695  KSKAELASRGGLANRQLPKRSGGLSNSSSDYG  1726
             K+K +LASRGGLANRQLP  +G   NSS+  G
Sbjct  1648  KTKIDLASRGGLANRQLPSANG---NSSTSNG  1676


 Score = 150 bits (380),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 93/226 (41%), Positives = 131/226 (58%), Gaps = 35/226 (15%)

Query  1815  PPASFAEQLKQVLAERERRLGGNDMSSSRESSGDFSDLNNPHSSDPALVTHHLVEEIRQA  1874
             P +SF +QL Q L++RERRLG     SSR SS D++++N   S+  A+    L+ EIRQA
Sbjct  1908  PGSSFTDQLNQALSDRERRLGDG---SSRHSSDDYTEINKSQSA-AAINCKTLINEIRQA  1963

Query  1875  VSEANQRVKKATIPSSNLIGSGSTPW--------------HHPGS-SPSSLSSGGSVSPP  1919
             V+EA  +VK+  +P S L   G+ PW              H  G  SP+S+SSG   S P
Sbjct  1964  VNEAQPKVKQ-VVPQS-LSPPGTVPWQQQHHQQIQQQPSAHTTGPPSPTSMSSG--CSSP  2019

Query  1920  AVDPSPS--------KTGDKKS----HFWQNAPVTDWSKEQVCQWLSGIGLERYAPRFLE  1967
                PS +           D+K+    + ++  PV +W+K+QV  WL GI LERY P F E
Sbjct  2020  GYSPSRTLDLSGSSSSFSDRKAMAAGYTYKGGPVHEWTKDQVGHWLMGIELERYIPVFKE  2079

Query  1968  TGINGGNLLRLESRDLKAFGICGDEKSHLKRKLKELRAQADRERKE  2013
               + GG LL L+S+D K  GICGD+K  LK++LK+L+A  ++ERK+
Sbjct  2080  NNVEGGALLTLDSKDFKTLGICGDDKHRLKKRLKDLKANIEKERKD  2125


 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 82/247 (33%), Positives = 108/247 (44%), Gaps = 41/247 (17%)

Query  14   KVSAIANIFQSKP-------QLDNLIHRTNNILSDGFKEPAVPLKESPTQVTVVRTESHV  66
            KVS IANIFQ KP       QL  +        +         ++ +P     VRTESH 
Sbjct  14   KVSQIANIFQRKPIEIQPVEQLSAVAAAHAAAAAAAAAAHHAHVQGAPA----VRTESHS  69

Query  67   ARFNNARALFEKLGEENKPNKPVDRITKPSNLHGLRSRSSSANSGSGCTSPARSPRPRSP  126
            ARFNNARALFEKLG E+  N    R+ +  +        S  +S          P+ R+P
Sbjct  70   ARFNNARALFEKLGVESNSNV-SSRLLRSGSREDNLCDGSDRSSSRSSDRSQSPPKRRTP  128

Query  127  SPPGTRDHLSNWSASVPALNA---ERHFENG--------------------HNHG-LDNI  162
             P G     +N +A++ A N    E+   N                     HN   L + 
Sbjct  129  FPSGVSLVHNNNNAAIVAQNGVPPEQRLSNSKFIVEPAAQVVPTSVVKYPQHNISRLKSE  188

Query  163  PDKHKSRAGFGKFDKNYGKENRLDDRPEKPEKPERRLNSKELIEKQKNWTSHFSKTRPSR  222
                      G     +       D+P   EKPER+ NS+ELIEKQK WTSHF+KT+ +R
Sbjct  189  EPSPVPPPASGSVSALFASSG--GDKP---EKPERKFNSRELIEKQKKWTSHFTKTKTTR  243

Query  223  YNSDPNR  229
             +SD NR
Sbjct  244  THSDLNR  250


 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 1/41 (2%)

Query  1023  PDTMTADEAENLLSSRILEKKIRQGSALLSDEEAQEIARLL  1063
             PD MTA EAE LLSS ILE KIRQ S LLSDE+A+E+ ++L
Sbjct  859   PDDMTAAEAERLLSSSILENKIRQQS-LLSDEQAKEVEQIL  898


 Score = 37.7 bits (86),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 15/24 (63%), Positives = 21/24 (88%), Gaps = 0/24 (0%)

Query  652  RRSHVRVDLQAAGLGQRPPSVISS  675
            +RS + V++ AAGLGQRPPS+IS+
Sbjct  537  KRSSITVNMPAAGLGQRPPSIIST  560



Lambda      K        H
   0.306    0.123    0.336 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 27409708836


Query= XP_050573062.1 uncharacterized protein LOC126913872 isoform X4
[Bombus affinis]

Length=2029
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9GQA3_DROME  unnamed protein product                                 558     1e-170
M9NDX8_DROME  unnamed protein product                                 574     3e-170
Q9W003_DROME  unnamed protein product                                 568     3e-168


>Q9GQA3_DROME unnamed protein product
Length=1330

 Score = 558 bits (1439),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 349/692 (50%), Positives = 412/692 (60%), Gaps = 129/692 (19%)

Query  1094  DNTPDWLSDVLSAPDTSLINSTI----------------NDYSLSHRSRSDLTI------  1131
             D+ P+WL DVL AP  SL N  I                N Y L H   SDL        
Sbjct  233   DDEPEWLRDVLEAPKRSLENLLITSATSSRAPGQREELENGYDL-HEKHSDLNQTYITGG  291

Query  1132  DSLTESQVGSVTGSESGLLGSVNSLND---------TYEINDD-------------TETE  1169
             +SL ES V   +      L    +++D         TY + D              TE +
Sbjct  292   ESLHESIVSVESTQSDATLNQTTTIDDSIISSKHNSTYSLADAEQATSSTVLSTGVTELD  351

Query  1170  HQDEYVP---PTPGKVVLVENGVHYFEDGHFWMEVAGIPESDDEKDDYPTNIPIKKMSKV  1226
                 Y+P   P   K VLVE GVHYFEDG+FWMEV G+ + DD+   YP  I ++K  KV
Sbjct  352   DSQYYIPEYPPVRSKEVLVEAGVHYFEDGNFWMEVPGLLDFDDDDCSYPP-ITVRKNPKV  410

Query  1227  SFDTKPMRVYSTHSVNEYDRRNEDVDPVAASAEYELEKRVEKMEVFPVELMKGPEGLGLS  1286
              F + P+ V ST SVN+YDRRNEDVDPVAASAEYELEKRVEKM VFPVELMKGPEGLGLS
Sbjct  411   RFSSGPIHVCSTFSVNDYDRRNEDVDPVAASAEYELEKRVEKMHVFPVELMKGPEGLGLS  470

Query  1287  IIGMGVGADAGLEKLGIFVKTITEKGAAAREGRIQVNDQIVEVDGKSLVGVTQAYAASVL  1346
             IIGMGVGADAGLEKLGIFVKTIT+ GAAAR+GRIQVNDQI+EVDGKSLVGVTQAYAASVL
Sbjct  471   IIGMGVGADAGLEKLGIFVKTITDNGAAARDGRIQVNDQIIEVDGKSLVGVTQAYAASVL  530

Query  1347  RNTSGLVRFVIGRERDP-NSEVAMLIRQSLQADKE------REQQANSARKLNFSDASPD  1399
             RNTSGLV+F IGRERDP NSEVA LIR SLQAD+E      R+Q+    R L++S+ S  
Sbjct  531   RNTSGLVKFQIGRERDPENSEVAQLIRLSLQADREKEERLKRQQEEYLRRTLDYSEDST-  589

Query  1400  SQRGSEDISVGGMGGIPGSPAMSSCSEGEPPQSPIENYLSSSGRSRSPIISSSMPPHTSA  1459
                                P  ++ S  E P SP++                  P    A
Sbjct  590   ------------------QPVSANSSVCEGPSSPVQ---------------VEHPMEVEA  616

Query  1460  TTQNDVDSLRLLLQE------------------LVDLENSGAGSEEYAAKLRESGLRLHE  1501
             T   +V+SL+ LLQE                  LV LE +G  +E  + +LR       +
Sbjct  617   THSQEVESLKRLLQESEMGCLVKEEIIQNLKRKLVKLETTGNENELLSERLR-------Q  669

Query  1502  SERALGTARQDLIAAREMLSQATAQNAALQQKYARARRAARELR---TDIAARDEFYQQL  1558
             SER LG  R++    + ML Q+  Q  AL +KY +A+R  RE +    D+  R+EFYQQL
Sbjct  670   SERELGNIRKEAANLQNMLQQSQGQYMALDKKYNKAKRLVREYQQRELDMCHREEFYQQL  729

Query  1559  LQEKDTEYNALVKSLKDRVITLEVELTETQRRFGLPVRLPYDGTTARIVTPQLSRRQLPP  1618
             LQEKDTEYNALVK LKDRVI LE EL ETQR+ G PV LPYD  T ++ TPQ+ R+  PP
Sbjct  730   LQEKDTEYNALVKKLKDRVINLEHELQETQRKAGFPVGLPYDSATLKL-TPQMMRKT-PP  787

Query  1619  PP--SSTSCQLSDTETSDLSSPDDGDKTATVERKLPLPLPVKEELDRAVPAHRLLDNSAG  1676
              P       +LSDTE SDLS   DG KTATVERK    +PVK+ELD AVP H LLDNS  
Sbjct  788   KPLFHKLETELSDTEISDLSPDGDGVKTATVERK----VPVKDELDAAVPQHELLDNSIN  843

Query  1677  KSKAELASRGGLANRQLPKRSGGLSNSSSDYG  1708
             K+K +LASRGGLANRQLP  +G   NSS+  G
Sbjct  844   KTKIDLASRGGLANRQLPSANG---NSSTSNG  872


 Score = 146 bits (368),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 91/219 (42%), Positives = 128/219 (58%), Gaps = 19/219 (9%)

Query  1797  PPASFAEQLKQVLAERERRLGGNDMSSSRESSGDFSDLNNPHSSDPALVTHHLVEEIRQA  1856
             P +SF +QL Q L++RERRLG     SSR SS D++++N   S+  A+    L+ EIRQA
Sbjct  1104  PGSSFTDQLNQALSDRERRLGD---GSSRHSSDDYTEINKSQSA-AAINCKTLINEIRQA  1159

Query  1857  VSEANQRVKKATIPSSNLIGSGSTPWHHPGSSPSSLSSGGSVSPPAVDPSPSKTDTSEVW  1916
             V+EA  +   A         +   P HH  +SP+S+SSG   S P    SPS+T      
Sbjct  1160  VNEAQPKGALAAAAPPANPAAAVRP-HHRSASPTSMSSG--CSSPGY--SPSRT------  1208

Query  1917  LPPHPSDFGLGDKKS----HFWQNAPVTDWSKEQVCQWLSGIGLERYAPRFLETGINGGN  1972
             L    S     D+K+    + ++  PV +W+K+QV  WL GI LERY P F E  + GG 
Sbjct  1209  LDLSGSSSSFSDRKAMAAGYTYKGGPVHEWTKDQVGHWLMGIELERYIPVFKENNVEGGA  1268

Query  1973  LLRLESRDLKAFGICGDEKSHLKRKLKELRAQADRERKE  2011
             LL L+S+D K  GICGD+K  LK++LK+L+A  ++ERK+
Sbjct  1269  LLTLDSKDFKTLGICGDDKHRLKKRLKDLKANIEKERKD  1307


 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 1/41 (2%)

Query  1023  PDTMTADEAENLLSSRILEKKIRQGSALLSDEEAQEIARLL  1063
             PD MTA EAE LLSS ILE KIRQ S LLSDE+A+E+ ++L
Sbjct  55    PDDMTAAEAERLLSSSILENKIRQQS-LLSDEQAKEVEQIL  94


>M9NDX8_DROME unnamed protein product
Length=2116

 Score = 574 bits (1479),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 353/674 (52%), Positives = 417/674 (62%), Gaps = 111/674 (16%)

Query  1094  DNTPDWLSDVLSAPDTSLINSTI----------------NDYSLSHRSRSDLTI------  1131
             D+ P+WL DVL AP  SL N  I                N Y L H   SDL        
Sbjct  1037  DDEPEWLRDVLEAPKRSLENLLITSATSSRAPGQREELENGYDL-HEKHSDLNQTYITGG  1095

Query  1132  DSLTESQVGSVTGSESGLLGSVNSLND---------TYEINDD-------------TETE  1169
             +SL ES V   +      L    +++D         TY + D              TE +
Sbjct  1096  ESLHESIVSVESTQSDATLNQTTTIDDSIISSKHNSTYSLADAEQATSSTVLSTGVTELD  1155

Query  1170  HQDEYVP---PTPGKVVLVENGVHYFEDGHFWMEVAGIPESDDEKDDYPTNIPIKKMSKV  1226
                 Y+P   P   K VLVE GVHYFEDG+FWMEV G+ + DD+   YP  I ++K  KV
Sbjct  1156  DSQYYIPEYPPVRSKEVLVEAGVHYFEDGNFWMEVPGLLDFDDDDCSYPP-ITVRKNPKV  1214

Query  1227  SFDTKPMRVYSTHSVNEYDRRNEDVDPVAASAEYELEKRVEKMEVFPVELMKGPEGLGLS  1286
              F + P+ VYST SVN+YDRRNEDVDPVAASAEYELEKRVEKM VFPVELMKGPEGLGLS
Sbjct  1215  RFSSGPIHVYSTFSVNDYDRRNEDVDPVAASAEYELEKRVEKMHVFPVELMKGPEGLGLS  1274

Query  1287  IIGMGVGADAGLEKLGIFVKTITEKGAAAREGRIQVNDQIVEVDGKSLVGVTQAYAASVL  1346
             IIGMGVGADAGLEKLGIFVKTIT+ GAAAR+GRIQVNDQI+EVDGKSLVGVTQAYAASVL
Sbjct  1275  IIGMGVGADAGLEKLGIFVKTITDNGAAARDGRIQVNDQIIEVDGKSLVGVTQAYAASVL  1334

Query  1347  RNTSGLVRFVIGRERDP-NSEVAMLIRQSLQADKE------REQQANSARKLNFSDASPD  1399
             RNTSGLV+F IGRERDP NSEVA LIR SLQAD+E      R+Q+    R L++S+ S  
Sbjct  1335  RNTSGLVKFQIGRERDPENSEVAQLIRLSLQADREKEERLKRQQEEYLRRTLDYSEDS--  1392

Query  1400  SQRGSEDISVGGMGGIPGSPAMSSCSEGEPPQSPIENYLSSSGRSRSPIISSSMPPHTSA  1459
                 ++ +S           A SS  EG  P SP++                  P    A
Sbjct  1393  ----TQPVS-----------ANSSVCEG--PSSPVQ---------------VEHPMEVEA  1420

Query  1460  TTQNDVDSLRLLLQELVDLENSGAGSEEYAAKLRESGLRLHESERALGTARQDLIAAREM  1519
             T   +V+SL+ LLQELV LE +G  +E  + +LR       +SER LG  R++    + M
Sbjct  1421  THSQEVESLKRLLQELVKLETTGNENELLSERLR-------QSERELGNIRKEAANLQNM  1473

Query  1520  LSQATAQNAALQQKYARARRAARELR---TDIAARDEFYQQLLQEKDTEYNALVKSLKDR  1576
             L Q+  Q  AL +KY +A+R  RE +    D+  R+EFYQQLLQEKDTEYNALVK LKDR
Sbjct  1474  LQQSQGQYMALDKKYNKAKRLVREYQQRELDMCHREEFYQQLLQEKDTEYNALVKKLKDR  1533

Query  1577  VITLEVELTETQRRFGLPVRLPYDGTTARIVTPQLSRRQLPPPP--SSTSCQLSDTETSD  1634
             VI LE EL ETQR+ G PV LPYD  T ++ TPQ+ R+  PP P       +LSDTE SD
Sbjct  1534  VINLEHELQETQRKAGFPVGLPYDSATLKL-TPQMMRKT-PPKPLFHKLETELSDTEISD  1591

Query  1635  LSSPDDGDKTATVERKLPLPLPVKEELDRAVPAHRLLDNSAGKSKAELASRGGLANRQLP  1694
             LS   DG KTATVERK    +PVK+ELD AVP H LLDNS  K+K +LASRGGLANRQLP
Sbjct  1592  LSPDGDGVKTATVERK----VPVKDELDAAVPQHELLDNSINKTKIDLASRGGLANRQLP  1647

Query  1695  KRSGGLSNSSSDYG  1708
               +G   NSS+  G
Sbjct  1648  SANG---NSSTSNG  1658


 Score = 139 bits (351),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 91/227 (40%), Positives = 129/227 (57%), Gaps = 35/227 (15%)

Query  1797  PPASFAEQLKQVLAERERRLGGNDMSSSRESSGDFSDLNNPHSSDPALVTHHLVEEIRQA  1856
             P +SF +QL Q L++RERRLG     SSR SS D++++N   S+  A+    L+ EIRQA
Sbjct  1890  PGSSFTDQLNQALSDRERRLGDG---SSRHSSDDYTEINKSQSA-AAINCKTLINEIRQA  1945

Query  1857  VSEANQRV--------KKATIPSSNLIGSGSTPWHHPGSSPSSLSSGGSVSPPAVDPSPS  1908
             V+EA  +V        +    PS++  G           SP+S+SSG   S P    SPS
Sbjct  1946  VNEAQPKVPWQQQHHQQIQQQPSAHTTGP---------PSPTSMSSG--CSSPGY--SPS  1992

Query  1909  KTDTSEVWLPPHPSDFGLGDKKS----HFWQNAPVTDWSKEQVCQWLSGIGLERYAPRFL  1964
             +T      L    S     D+K+    + ++  PV +W+K+QV  WL GI LERY P F 
Sbjct  1993  RT------LDLSGSSSSFSDRKAMAAGYTYKGGPVHEWTKDQVGHWLMGIELERYIPVFK  2046

Query  1965  ETGINGGNLLRLESRDLKAFGICGDEKSHLKRKLKELRAQADRERKE  2011
             E  + GG LL L+S+D K  GICGD+K  LK++LK+L+A  ++ERK+
Sbjct  2047  ENNVEGGALLTLDSKDFKTLGICGDDKHRLKKRLKDLKANIEKERKD  2093


 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 82/247 (33%), Positives = 108/247 (44%), Gaps = 41/247 (17%)

Query  14   KVSAIANIFQSKP-------QLDNLIHRTNNILSDGFKEPAVPLKESPTQVTVVRTESHV  66
            KVS IANIFQ KP       QL  +        +         ++ +P     VRTESH 
Sbjct  14   KVSQIANIFQRKPIEIQPVEQLSAVAAAHAAAAAAAAAAHHAHVQGAPA----VRTESHS  69

Query  67   ARFNNARALFEKLGEENKPNKPVDRITKPSNLHGLRSRSSSANSGSGCTSPARSPRPRSP  126
            ARFNNARALFEKLG E+  N    R+ +  +        S  +S          P+ R+P
Sbjct  70   ARFNNARALFEKLGVESNSNV-SSRLLRSGSREDNLCDGSDRSSSRSSDRSQSPPKRRTP  128

Query  127  SPPGTRDHLSNWSASVPALNA---ERHFENG--------------------HNHG-LDNI  162
             P G     +N +A++ A N    E+   N                     HN   L + 
Sbjct  129  FPSGVSLVHNNNNAAIVAQNGVPPEQRLSNSKFIVEPAAQVVPTSVVKYPQHNISRLKSE  188

Query  163  PDKHKSRAGFGKFDKNYGKENRLDDRPEKPEKPERRLNSKELIEKQKNWTSHFSKTRPSR  222
                      G     +       D+P   EKPER+ NS+ELIEKQK WTSHF+KT+ +R
Sbjct  189  EPSPVPPPASGSVSALFASSG--GDKP---EKPERKFNSRELIEKQKKWTSHFTKTKTTR  243

Query  223  YNSDPNR  229
             +SD NR
Sbjct  244  THSDLNR  250


 Score = 51.6 bits (122),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 1/41 (2%)

Query  1023  PDTMTADEAENLLSSRILEKKIRQGSALLSDEEAQEIARLL  1063
             PD MTA EAE LLSS ILE KIRQ S LLSDE+A+E+ ++L
Sbjct  859   PDDMTAAEAERLLSSSILENKIRQQS-LLSDEQAKEVEQIL  898


 Score = 37.7 bits (86),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 15/24 (63%), Positives = 21/24 (88%), Gaps = 0/24 (0%)

Query  652  RRSHVRVDLQAAGLGQRPPSVISS  675
            +RS + V++ AAGLGQRPPS+IS+
Sbjct  537  KRSSITVNMPAAGLGQRPPSIIST  560


>Q9W003_DROME unnamed protein product
Length=2119

 Score = 568 bits (1465),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 353/677 (52%), Positives = 417/677 (62%), Gaps = 114/677 (17%)

Query  1094  DNTPDWLSDVLSAPDTSLINSTI----------------NDYSLSHRSRSDLTI------  1131
             D+ P+WL DVL AP  SL N  I                N Y L H   SDL        
Sbjct  1037  DDEPEWLRDVLEAPKRSLENLLITSATSSRAPGQREELENGYDL-HEKHSDLNQTYITGG  1095

Query  1132  DSLTESQVGSVTGSESGLLGSVNSLND---------TYEINDD-------------TETE  1169
             +SL ES V   +      L    +++D         TY + D              TE +
Sbjct  1096  ESLHESIVSVESTQSDATLNQTTTIDDSIISSKHNSTYSLADAEQATSSTVLSTGVTELD  1155

Query  1170  HQDEYVP---PTPGKVVLVENGVHYFEDGHFWMEVAGIPESDDEKDDYPTNIPIKKMSKV  1226
                 Y+P   P   K VLVE GVHYFEDG+FWMEV G+ + DD+   YP  I ++K  KV
Sbjct  1156  DSQYYIPEYPPVRSKEVLVEAGVHYFEDGNFWMEVPGLLDFDDDDCSYPP-ITVRKNPKV  1214

Query  1227  SFDTKPMRVYSTHSVNEYDRRNEDVDPVAASAEYELEKRVEKMEVFPVELMKGPEGLGLS  1286
              F + P+ VYST SVN+YDRRNEDVDPVAASAEYELEKRVEKM VFPVELMKGPEGLGLS
Sbjct  1215  RFSSGPIHVYSTFSVNDYDRRNEDVDPVAASAEYELEKRVEKMHVFPVELMKGPEGLGLS  1274

Query  1287  IIGMGVGADAGLEKLGIFVKTITEKGAAAREGRIQVNDQIVEVDGKSLVGVTQAYAASVL  1346
             IIGMGVGADAGLEKLGIFVKTIT+ GAAAR+GRIQVNDQI+EVDGKSLVGVTQAYAASVL
Sbjct  1275  IIGMGVGADAGLEKLGIFVKTITDNGAAARDGRIQVNDQIIEVDGKSLVGVTQAYAASVL  1334

Query  1347  RNTSGLVRFVIGRERDP-NSEVAMLIRQSLQADKE------REQQANSARKLNFSDASPD  1399
             RNTSGLV+F IGRERDP NSEVA LIR SLQAD+E      R+Q+    R L++S+ S  
Sbjct  1335  RNTSGLVKFQIGRERDPENSEVAQLIRLSLQADREKEERLKRQQEEYLRRTLDYSEDS--  1392

Query  1400  SQRGSEDISVGGMGGIPGSPAMSSCSEGEPPQSPIENYLSSSGRSRSPIISSSMPPHTSA  1459
                 ++ +S           A SS  EG  P SP++                  P    A
Sbjct  1393  ----TQPVS-----------ANSSVCEG--PSSPVQ---------------VEHPMEVEA  1420

Query  1460  TTQNDVDSLRLLLQE---LVDLENSGAGSEEYAAKLRESGLRLHESERALGTARQDLIAA  1516
             T   +V+SL+ LLQE   LV LE +G  +E  + +LR       +SER LG  R++    
Sbjct  1421  THSQEVESLKRLLQEHKALVKLETTGNENELLSERLR-------QSERELGNIRKEAANL  1473

Query  1517  REMLSQATAQNAALQQKYARARRAARELR---TDIAARDEFYQQLLQEKDTEYNALVKSL  1573
             + ML Q+  Q  AL +KY +A+R  RE +    D+  R+EFYQQLLQEKDTEYNALVK L
Sbjct  1474  QNMLQQSQGQYMALDKKYNKAKRLVREYQQRELDMCHREEFYQQLLQEKDTEYNALVKKL  1533

Query  1574  KDRVITLEVELTETQRRFGLPVRLPYDGTTARIVTPQLSRRQLPPPP--SSTSCQLSDTE  1631
             KDRVI LE EL ETQR+ G PV LPYD  T ++ TPQ+ R+  PP P       +LSDTE
Sbjct  1534  KDRVINLEHELQETQRKAGFPVGLPYDSATLKL-TPQMMRKT-PPKPLFHKLETELSDTE  1591

Query  1632  TSDLSSPDDGDKTATVERKLPLPLPVKEELDRAVPAHRLLDNSAGKSKAELASRGGLANR  1691
              SDLS   DG KTATVERK    +PVK+ELD AVP H LLDNS  K+K +LASRGGLANR
Sbjct  1592  ISDLSPDGDGVKTATVERK----VPVKDELDAAVPQHELLDNSINKTKIDLASRGGLANR  1647

Query  1692  QLPKRSGGLSNSSSDYG  1708
             QLP  +G   NSS+  G
Sbjct  1648  QLPSANG---NSSTSNG  1661


 Score = 139 bits (350),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 91/227 (40%), Positives = 129/227 (57%), Gaps = 35/227 (15%)

Query  1797  PPASFAEQLKQVLAERERRLGGNDMSSSRESSGDFSDLNNPHSSDPALVTHHLVEEIRQA  1856
             P +SF +QL Q L++RERRLG     SSR SS D++++N   S+  A+    L+ EIRQA
Sbjct  1893  PGSSFTDQLNQALSDRERRLGDG---SSRHSSDDYTEINKSQSA-AAINCKTLINEIRQA  1948

Query  1857  VSEANQRV--------KKATIPSSNLIGSGSTPWHHPGSSPSSLSSGGSVSPPAVDPSPS  1908
             V+EA  +V        +    PS++  G           SP+S+SSG   S P    SPS
Sbjct  1949  VNEAQPKVPWQQQHHQQIQQQPSAHTTGP---------PSPTSMSSG--CSSPGY--SPS  1995

Query  1909  KTDTSEVWLPPHPSDFGLGDKKS----HFWQNAPVTDWSKEQVCQWLSGIGLERYAPRFL  1964
             +T      L    S     D+K+    + ++  PV +W+K+QV  WL GI LERY P F 
Sbjct  1996  RT------LDLSGSSSSFSDRKAMAAGYTYKGGPVHEWTKDQVGHWLMGIELERYIPVFK  2049

Query  1965  ETGINGGNLLRLESRDLKAFGICGDEKSHLKRKLKELRAQADRERKE  2011
             E  + GG LL L+S+D K  GICGD+K  LK++LK+L+A  ++ERK+
Sbjct  2050  ENNVEGGALLTLDSKDFKTLGICGDDKHRLKKRLKDLKANIEKERKD  2096


 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 82/247 (33%), Positives = 108/247 (44%), Gaps = 41/247 (17%)

Query  14   KVSAIANIFQSKP-------QLDNLIHRTNNILSDGFKEPAVPLKESPTQVTVVRTESHV  66
            KVS IANIFQ KP       QL  +        +         ++ +P     VRTESH 
Sbjct  14   KVSQIANIFQRKPIEIQPVEQLSAVAAAHAAAAAAAAAAHHAHVQGAPA----VRTESHS  69

Query  67   ARFNNARALFEKLGEENKPNKPVDRITKPSNLHGLRSRSSSANSGSGCTSPARSPRPRSP  126
            ARFNNARALFEKLG E+  N    R+ +  +        S  +S          P+ R+P
Sbjct  70   ARFNNARALFEKLGVESNSNV-SSRLLRSGSREDNLCDGSDRSSSRSSDRSQSPPKRRTP  128

Query  127  SPPGTRDHLSNWSASVPALNA---ERHFENG--------------------HNHG-LDNI  162
             P G     +N +A++ A N    E+   N                     HN   L + 
Sbjct  129  FPSGVSLVHNNNNAAIVAQNGVPPEQRLSNSKFIVEPAAQVVPTSVVKYPQHNISRLKSE  188

Query  163  PDKHKSRAGFGKFDKNYGKENRLDDRPEKPEKPERRLNSKELIEKQKNWTSHFSKTRPSR  222
                      G     +       D+P   EKPER+ NS+ELIEKQK WTSHF+KT+ +R
Sbjct  189  EPSPVPPPASGSVSALFASSG--GDKP---EKPERKFNSRELIEKQKKWTSHFTKTKTTR  243

Query  223  YNSDPNR  229
             +SD NR
Sbjct  244  THSDLNR  250


 Score = 51.6 bits (122),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 1/41 (2%)

Query  1023  PDTMTADEAENLLSSRILEKKIRQGSALLSDEEAQEIARLL  1063
             PD MTA EAE LLSS ILE KIRQ S LLSDE+A+E+ ++L
Sbjct  859   PDDMTAAEAERLLSSSILENKIRQQS-LLSDEQAKEVEQIL  898


 Score = 37.7 bits (86),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 15/24 (63%), Positives = 21/24 (88%), Gaps = 0/24 (0%)

Query  652  RRSHVRVDLQAAGLGQRPPSVISS  675
            +RS + V++ AAGLGQRPPS+IS+
Sbjct  537  KRSSITVNMPAAGLGQRPPSIIST  560



Lambda      K        H
   0.306    0.123    0.336 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 27409708836


Query= XP_050573063.1 uncharacterized protein LOC126913872 isoform X5
[Bombus affinis]

Length=2013
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9GQA3_DROME  unnamed protein product                                 573     4e-176
M9NFI9_DROME  unnamed protein product                                 578     1e-171
M9NEY3_DROME  unnamed protein product                                 578     2e-171


>Q9GQA3_DROME unnamed protein product
Length=1330

 Score = 573 bits (1478),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 353/692 (51%), Positives = 421/692 (61%), Gaps = 111/692 (16%)

Query  1060  DNTPDWLSDVLSAPDTSLINSTI----------------NDYSLSHRSRSDLTI------  1097
             D+ P+WL DVL AP  SL N  I                N Y L H   SDL        
Sbjct  233   DDEPEWLRDVLEAPKRSLENLLITSATSSRAPGQREELENGYDL-HEKHSDLNQTYITGG  291

Query  1098  DSLTESQVGSVTGSESGLLGSVNSLND---------TYEINDD-------------TETE  1135
             +SL ES V   +      L    +++D         TY + D              TE +
Sbjct  292   ESLHESIVSVESTQSDATLNQTTTIDDSIISSKHNSTYSLADAEQATSSTVLSTGVTELD  351

Query  1136  HQDEYVP---PTPGKVVLVENGVHYFEDGHFWMEVAGIPESDDEKDDYPTNIPIKKMSKV  1192
                 Y+P   P   K VLVE GVHYFEDG+FWMEV G+ + DD+   YP  I ++K  KV
Sbjct  352   DSQYYIPEYPPVRSKEVLVEAGVHYFEDGNFWMEVPGLLDFDDDDCSYPP-ITVRKNPKV  410

Query  1193  SFDTKPMRVYSTHSVNEYDRRNEDVDPVAASAEYELEKRVEKMEVFPVELMKGPEGLGLS  1252
              F + P+ V ST SVN+YDRRNEDVDPVAASAEYELEKRVEKM VFPVELMKGPEGLGLS
Sbjct  411   RFSSGPIHVCSTFSVNDYDRRNEDVDPVAASAEYELEKRVEKMHVFPVELMKGPEGLGLS  470

Query  1253  IIGMGVGADAGLEKLGIFVKTITEKGAAAREGRIQVNDQIVEVDGKSLVGVTQAYAASVL  1312
             IIGMGVGADAGLEKLGIFVKTIT+ GAAAR+GRIQVNDQI+EVDGKSLVGVTQAYAASVL
Sbjct  471   IIGMGVGADAGLEKLGIFVKTITDNGAAARDGRIQVNDQIIEVDGKSLVGVTQAYAASVL  530

Query  1313  RNTSGLVRFVIGRERDP-NSEVAMLIRQSLQADKE------REQQANSARKLNFSDASPD  1365
             RNTSGLV+F IGRERDP NSEVA LIR SLQAD+E      R+Q+    R L++S+ S  
Sbjct  531   RNTSGLVKFQIGRERDPENSEVAQLIRLSLQADREKEERLKRQQEEYLRRTLDYSEDST-  589

Query  1366  SQRGSEDISVGGMGGIPGSPAMSSCSEGEPPQSPIENYLSSSGRSRSPIISSSMPPHTSA  1425
                                P  ++ S  E P SP++                  P    A
Sbjct  590   ------------------QPVSANSSVCEGPSSPVQ---------------VEHPMEVEA  616

Query  1426  TTQNDVDSLRLLLQESQYKLALADGEVEKLKAKLVDLENSGAGSEEYAAKLRESGLRLHE  1485
             T   +V+SL+ LLQES+    + +  ++ LK KLV LE +G  +E  + +LR       +
Sbjct  617   THSQEVESLKRLLQESEMGCLVKEEIIQNLKRKLVKLETTGNENELLSERLR-------Q  669

Query  1486  SERALGTARQDLIAAREMLSQATAQNAALQQKYARARRAARELR---TDIAARDEFYQQL  1542
             SER LG  R++    + ML Q+  Q  AL +KY +A+R  RE +    D+  R+EFYQQL
Sbjct  670   SERELGNIRKEAANLQNMLQQSQGQYMALDKKYNKAKRLVREYQQRELDMCHREEFYQQL  729

Query  1543  LQEKDTEYNALVKSLKDRVITLEVELTETQRRFGLPVRLPYDGTTARIVTPQLSRRQLPP  1602
             LQEKDTEYNALVK LKDRVI LE EL ETQR+ G PV LPYD  T ++ TPQ+ R+  PP
Sbjct  730   LQEKDTEYNALVKKLKDRVINLEHELQETQRKAGFPVGLPYDSATLKL-TPQMMRKT-PP  787

Query  1603  PP--SSTSCQLSDTETSDLSSPDDGDKTATVERKLPLPLPVKEELDRAVPAHRLLDNSAG  1660
              P       +LSDTE SDLS   DG KTATVERK    +PVK+ELD AVP H LLDNS  
Sbjct  788   KPLFHKLETELSDTEISDLSPDGDGVKTATVERK----VPVKDELDAAVPQHELLDNSIN  843

Query  1661  KSKAELASRGGLANRQLPKRSGGLSNSSSDYG  1692
             K+K +LASRGGLANRQLP  +G   NSS+  G
Sbjct  844   KTKIDLASRGGLANRQLPSANG---NSSTSNG  872


 Score = 145 bits (367),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 91/219 (42%), Positives = 128/219 (58%), Gaps = 19/219 (9%)

Query  1781  PPASFAEQLKQVLAERERRLGGNDMSSSRESSGDFSDLNNPHSSDPALVTHHLVEEIRQA  1840
             P +SF +QL Q L++RERRLG     SSR SS D++++N   S+  A+    L+ EIRQA
Sbjct  1104  PGSSFTDQLNQALSDRERRLGD---GSSRHSSDDYTEINKSQSA-AAINCKTLINEIRQA  1159

Query  1841  VSEANQRVKKATIPSSNLIGSGSTPWHHPGSSPSSLSSGGSVSPPAVDPSPSKTDTSEVW  1900
             V+EA  +   A         +   P HH  +SP+S+SSG   S P    SPS+T      
Sbjct  1160  VNEAQPKGALAAAAPPANPAAAVRP-HHRSASPTSMSSG--CSSPGY--SPSRT------  1208

Query  1901  LPPHPSDFGLGDKKS----HFWQNAPVTDWSKEQVCQWLSGIGLERYAPRFLETGINGGN  1956
             L    S     D+K+    + ++  PV +W+K+QV  WL GI LERY P F E  + GG 
Sbjct  1209  LDLSGSSSSFSDRKAMAAGYTYKGGPVHEWTKDQVGHWLMGIELERYIPVFKENNVEGGA  1268

Query  1957  LLRLESRDLKAFGICGDEKSHLKRKLKELRAQADRERKE  1995
             LL L+S+D K  GICGD+K  LK++LK+L+A  ++ERK+
Sbjct  1269  LLTLDSKDFKTLGICGDDKHRLKKRLKDLKANIEKERKD  1307


 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 1/41 (2%)

Query  989   PDTMTADEAENLLSSRILEKKIRQGSALLSDEEAQEIARLL  1029
             PD MTA EAE LLSS ILE KIRQ S LLSDE+A+E+ ++L
Sbjct  55    PDDMTAAEAERLLSSSILENKIRQQS-LLSDEQAKEVEQIL  94


>M9NFI9_DROME unnamed protein product
Length=2148

 Score = 578 bits (1490),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 357/692 (52%), Positives = 426/692 (62%), Gaps = 111/692 (16%)

Query  1060  DNTPDWLSDVLSAPDTSLINSTI----------------NDYSLSHRSRSDLTI------  1097
             D+ P+WL DVL AP  SL N  I                N Y L H   SDL        
Sbjct  1037  DDEPEWLRDVLEAPKRSLENLLITSATSSRAPGQREELENGYDL-HEKHSDLNQTYITGG  1095

Query  1098  DSLTESQVGSVTGSESGLLGSVNSLND---------TYEINDD-------------TETE  1135
             +SL ES V   +      L    +++D         TY + D              TE +
Sbjct  1096  ESLHESIVSVESTQSDATLNQTTTIDDSIISSKHNSTYSLADAEQATSSTVLSTGVTELD  1155

Query  1136  HQDEYVP---PTPGKVVLVENGVHYFEDGHFWMEVAGIPESDDEKDDYPTNIPIKKMSKV  1192
                 Y+P   P   K VLVE GVHYFEDG+FWMEV G+ + DD+   YP  I ++K  KV
Sbjct  1156  DSQYYIPEYPPVRSKEVLVEAGVHYFEDGNFWMEVPGLLDFDDDDCSYPP-ITVRKNPKV  1214

Query  1193  SFDTKPMRVYSTHSVNEYDRRNEDVDPVAASAEYELEKRVEKMEVFPVELMKGPEGLGLS  1252
              F + P+ VYST SVN+YDRRNEDVDPVAASAEYELEKRVEKM VFPVELMKGPEGLGLS
Sbjct  1215  RFSSGPIHVYSTFSVNDYDRRNEDVDPVAASAEYELEKRVEKMHVFPVELMKGPEGLGLS  1274

Query  1253  IIGMGVGADAGLEKLGIFVKTITEKGAAAREGRIQVNDQIVEVDGKSLVGVTQAYAASVL  1312
             IIGMGVGADAGLEKLGIFVKTIT+ GAAAR+GRIQVNDQI+EVDGKSLVGVTQAYAASVL
Sbjct  1275  IIGMGVGADAGLEKLGIFVKTITDNGAAARDGRIQVNDQIIEVDGKSLVGVTQAYAASVL  1334

Query  1313  RNTSGLVRFVIGRERDP-NSEVAMLIRQSLQADKE------REQQANSARKLNFSDASPD  1365
             RNTSGLV+F IGRERDP NSEVA LIR SLQAD+E      R+Q+    R L++S+ S  
Sbjct  1335  RNTSGLVKFQIGRERDPENSEVAQLIRLSLQADREKEERLKRQQEEYLRRTLDYSEDS--  1392

Query  1366  SQRGSEDISVGGMGGIPGSPAMSSCSEGEPPQSPIENYLSSSGRSRSPIISSSMPPHTSA  1425
                 ++ +S           A SS  EG  P SP++                  P    A
Sbjct  1393  ----TQPVS-----------ANSSVCEG--PSSPVQ---------------VEHPMEVEA  1420

Query  1426  TTQNDVDSLRLLLQESQYKLALADGEVEKLKAKLVDLENSGAGSEEYAAKLRESGLRLHE  1485
             T   +V+SL+ LLQES+    + +  ++ LK KLV LE +G  +E  + +LR       +
Sbjct  1421  THSQEVESLKRLLQESEMGCLVKEEIIQNLKRKLVKLETTGNENELLSERLR-------Q  1473

Query  1486  SERALGTARQDLIAAREMLSQATAQNAALQQKYARARRAARELR---TDIAARDEFYQQL  1542
             SER LG  R++    + ML Q+  Q  AL +KY +A+R  RE +    D+  R+EFYQQL
Sbjct  1474  SERELGNIRKEAANLQNMLQQSQGQYMALDKKYNKAKRLVREYQQRELDMCHREEFYQQL  1533

Query  1543  LQEKDTEYNALVKSLKDRVITLEVELTETQRRFGLPVRLPYDGTTARIVTPQLSRRQLPP  1602
             LQEKDTEYNALVK LKDRVI LE EL ETQR+ G PV LPYD  T ++ TPQ+ R+  PP
Sbjct  1534  LQEKDTEYNALVKKLKDRVINLEHELQETQRKAGFPVGLPYDSATLKL-TPQMMRKT-PP  1591

Query  1603  PP--SSTSCQLSDTETSDLSSPDDGDKTATVERKLPLPLPVKEELDRAVPAHRLLDNSAG  1660
              P       +LSDTE SDLS   DG KTATVERK    +PVK+ELD AVP H LLDNS  
Sbjct  1592  KPLFHKLETELSDTEISDLSPDGDGVKTATVERK----VPVKDELDAAVPQHELLDNSIN  1647

Query  1661  KSKAELASRGGLANRQLPKRSGGLSNSSSDYG  1692
             K+K +LASRGGLANRQLP  +G   NSS+  G
Sbjct  1648  KTKIDLASRGGLANRQLPSANG---NSSTSNG  1676


 Score = 147 bits (372),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 97/234 (41%), Positives = 135/234 (58%), Gaps = 35/234 (15%)

Query  1781  PPASFAEQLKQVLAERERRLGGNDMSSSRESSGDFSDLNNPHSSDPALVTHHLVEEIRQA  1840
             P +SF +QL Q L++RERRLG     SSR SS D++++N   S+  A+    L+ EIRQA
Sbjct  1908  PGSSFTDQLNQALSDRERRLGDG---SSRHSSDDYTEINKSQSA-AAINCKTLINEIRQA  1963

Query  1841  VSEANQRVKKATIPSSNLIGSGSTPW--------------HHPGS-SPSSLSSGGSVSPP  1885
             V+EA  +VK+  +P S L   G+ PW              H  G  SP+S+SSG   S P
Sbjct  1964  VNEAQPKVKQ-VVPQS-LSPPGTVPWQQQHHQQIQQQPSAHTTGPPSPTSMSSG--CSSP  2019

Query  1886  AVDPSPSKTDTSEVWLPPHPSDFGLGDKKS----HFWQNAPVTDWSKEQVCQWLSGIGLE  1941
                 SPS+T      L    S     D+K+    + ++  PV +W+K+QV  WL GI LE
Sbjct  2020  GY--SPSRT------LDLSGSSSSFSDRKAMAAGYTYKGGPVHEWTKDQVGHWLMGIELE  2071

Query  1942  RYAPRFLETGINGGNLLRLESRDLKAFGICGDEKSHLKRKLKELRAQADRERKE  1995
             RY P F E  + GG LL L+S+D K  GICGD+K  LK++LK+L+A  ++ERK+
Sbjct  2072  RYIPVFKENNVEGGALLTLDSKDFKTLGICGDDKHRLKKRLKDLKANIEKERKD  2125


 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 82/247 (33%), Positives = 108/247 (44%), Gaps = 41/247 (17%)

Query  14   KVSAIANIFQSKP-------QLDNLIHRTNNILSDGFKEPAVPLKESPTQVTVVRTESHV  66
            KVS IANIFQ KP       QL  +        +         ++ +P     VRTESH 
Sbjct  14   KVSQIANIFQRKPIEIQPVEQLSAVAAAHAAAAAAAAAAHHAHVQGAPA----VRTESHS  69

Query  67   ARFNNARALFEKLGEENKPNKPVDRITKPSNLHGLRSRSSSANSGSGCTSPARSPRPRSP  126
            ARFNNARALFEKLG E+  N    R+ +  +        S  +S          P+ R+P
Sbjct  70   ARFNNARALFEKLGVESNSNV-SSRLLRSGSREDNLCDGSDRSSSRSSDRSQSPPKRRTP  128

Query  127  SPPGTRDHLSNWSASVPALNA---ERHFENG--------------------HNHG-LDNI  162
             P G     +N +A++ A N    E+   N                     HN   L + 
Sbjct  129  FPSGVSLVHNNNNAAIVAQNGVPPEQRLSNSKFIVEPAAQVVPTSVVKYPQHNISRLKSE  188

Query  163  PDKHKSRAGFGKFDKNYGKENRLDDRPEKPEKPERRLNSKELIEKQKNWTSHFSKTRPSR  222
                      G     +       D+P   EKPER+ NS+ELIEKQK WTSHF+KT+ +R
Sbjct  189  EPSPVPPPASGSVSALFASSG--GDKP---EKPERKFNSRELIEKQKKWTSHFTKTKTTR  243

Query  223  YNSDPNR  229
             +SD NR
Sbjct  244  THSDLNR  250


 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 1/41 (2%)

Query  989   PDTMTADEAENLLSSRILEKKIRQGSALLSDEEAQEIARLL  1029
             PD MTA EAE LLSS ILE KIRQ S LLSDE+A+E+ ++L
Sbjct  859   PDDMTAAEAERLLSSSILENKIRQQS-LLSDEQAKEVEQIL  898


 Score = 37.7 bits (86),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 15/24 (63%), Positives = 21/24 (88%), Gaps = 0/24 (0%)

Query  618  RRSHVRVDLQAAGLGQRPPSVISS  641
            +RS + V++ AAGLGQRPPS+IS+
Sbjct  537  KRSSITVNMPAAGLGQRPPSIIST  560


>M9NEY3_DROME unnamed protein product
Length=2134

 Score = 578 bits (1489),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 357/692 (52%), Positives = 426/692 (62%), Gaps = 111/692 (16%)

Query  1060  DNTPDWLSDVLSAPDTSLINSTI----------------NDYSLSHRSRSDLTI------  1097
             D+ P+WL DVL AP  SL N  I                N Y L H   SDL        
Sbjct  1037  DDEPEWLRDVLEAPKRSLENLLITSATSSRAPGQREELENGYDL-HEKHSDLNQTYITGG  1095

Query  1098  DSLTESQVGSVTGSESGLLGSVNSLND---------TYEINDD-------------TETE  1135
             +SL ES V   +      L    +++D         TY + D              TE +
Sbjct  1096  ESLHESIVSVESTQSDATLNQTTTIDDSIISSKHNSTYSLADAEQATSSTVLSTGVTELD  1155

Query  1136  HQDEYVP---PTPGKVVLVENGVHYFEDGHFWMEVAGIPESDDEKDDYPTNIPIKKMSKV  1192
                 Y+P   P   K VLVE GVHYFEDG+FWMEV G+ + DD+   YP  I ++K  KV
Sbjct  1156  DSQYYIPEYPPVRSKEVLVEAGVHYFEDGNFWMEVPGLLDFDDDDCSYPP-ITVRKNPKV  1214

Query  1193  SFDTKPMRVYSTHSVNEYDRRNEDVDPVAASAEYELEKRVEKMEVFPVELMKGPEGLGLS  1252
              F + P+ VYST SVN+YDRRNEDVDPVAASAEYELEKRVEKM VFPVELMKGPEGLGLS
Sbjct  1215  RFSSGPIHVYSTFSVNDYDRRNEDVDPVAASAEYELEKRVEKMHVFPVELMKGPEGLGLS  1274

Query  1253  IIGMGVGADAGLEKLGIFVKTITEKGAAAREGRIQVNDQIVEVDGKSLVGVTQAYAASVL  1312
             IIGMGVGADAGLEKLGIFVKTIT+ GAAAR+GRIQVNDQI+EVDGKSLVGVTQAYAASVL
Sbjct  1275  IIGMGVGADAGLEKLGIFVKTITDNGAAARDGRIQVNDQIIEVDGKSLVGVTQAYAASVL  1334

Query  1313  RNTSGLVRFVIGRERDP-NSEVAMLIRQSLQADKE------REQQANSARKLNFSDASPD  1365
             RNTSGLV+F IGRERDP NSEVA LIR SLQAD+E      R+Q+    R L++S+ S  
Sbjct  1335  RNTSGLVKFQIGRERDPENSEVAQLIRLSLQADREKEERLKRQQEEYLRRTLDYSEDS--  1392

Query  1366  SQRGSEDISVGGMGGIPGSPAMSSCSEGEPPQSPIENYLSSSGRSRSPIISSSMPPHTSA  1425
                 ++ +S           A SS  EG  P SP++                  P    A
Sbjct  1393  ----TQPVS-----------ANSSVCEG--PSSPVQ---------------VEHPMEVEA  1420

Query  1426  TTQNDVDSLRLLLQESQYKLALADGEVEKLKAKLVDLENSGAGSEEYAAKLRESGLRLHE  1485
             T   +V+SL+ LLQES+    + +  ++ LK KLV LE +G  +E  + +LR       +
Sbjct  1421  THSQEVESLKRLLQESEMGCLVKEEIIQNLKRKLVKLETTGNENELLSERLR-------Q  1473

Query  1486  SERALGTARQDLIAAREMLSQATAQNAALQQKYARARRAARELR---TDIAARDEFYQQL  1542
             SER LG  R++    + ML Q+  Q  AL +KY +A+R  RE +    D+  R+EFYQQL
Sbjct  1474  SERELGNIRKEAANLQNMLQQSQGQYMALDKKYNKAKRLVREYQQRELDMCHREEFYQQL  1533

Query  1543  LQEKDTEYNALVKSLKDRVITLEVELTETQRRFGLPVRLPYDGTTARIVTPQLSRRQLPP  1602
             LQEKDTEYNALVK LKDRVI LE EL ETQR+ G PV LPYD  T ++ TPQ+ R+  PP
Sbjct  1534  LQEKDTEYNALVKKLKDRVINLEHELQETQRKAGFPVGLPYDSATLKL-TPQMMRKT-PP  1591

Query  1603  PP--SSTSCQLSDTETSDLSSPDDGDKTATVERKLPLPLPVKEELDRAVPAHRLLDNSAG  1660
              P       +LSDTE SDLS   DG KTATVERK    +PVK+ELD AVP H LLDNS  
Sbjct  1592  KPLFHKLETELSDTEISDLSPDGDGVKTATVERK----VPVKDELDAAVPQHELLDNSIN  1647

Query  1661  KSKAELASRGGLANRQLPKRSGGLSNSSSDYG  1692
             K+K +LASRGGLANRQLP  +G   NSS+  G
Sbjct  1648  KTKIDLASRGGLANRQLPSANG---NSSTSNG  1676


 Score = 139 bits (350),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 91/227 (40%), Positives = 129/227 (57%), Gaps = 35/227 (15%)

Query  1781  PPASFAEQLKQVLAERERRLGGNDMSSSRESSGDFSDLNNPHSSDPALVTHHLVEEIRQA  1840
             P +SF +QL Q L++RERRLG     SSR SS D++++N   S+  A+    L+ EIRQA
Sbjct  1908  PGSSFTDQLNQALSDRERRLGDG---SSRHSSDDYTEINKSQSA-AAINCKTLINEIRQA  1963

Query  1841  VSEANQRV--------KKATIPSSNLIGSGSTPWHHPGSSPSSLSSGGSVSPPAVDPSPS  1892
             V+EA  +V        +    PS++  G           SP+S+SSG   S P    SPS
Sbjct  1964  VNEAQPKVPWQQQHHQQIQQQPSAHTTGP---------PSPTSMSSG--CSSPGY--SPS  2010

Query  1893  KTDTSEVWLPPHPSDFGLGDKKS----HFWQNAPVTDWSKEQVCQWLSGIGLERYAPRFL  1948
             +T      L    S     D+K+    + ++  PV +W+K+QV  WL GI LERY P F 
Sbjct  2011  RT------LDLSGSSSSFSDRKAMAAGYTYKGGPVHEWTKDQVGHWLMGIELERYIPVFK  2064

Query  1949  ETGINGGNLLRLESRDLKAFGICGDEKSHLKRKLKELRAQADRERKE  1995
             E  + GG LL L+S+D K  GICGD+K  LK++LK+L+A  ++ERK+
Sbjct  2065  ENNVEGGALLTLDSKDFKTLGICGDDKHRLKKRLKDLKANIEKERKD  2111


 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 82/247 (33%), Positives = 108/247 (44%), Gaps = 41/247 (17%)

Query  14   KVSAIANIFQSKP-------QLDNLIHRTNNILSDGFKEPAVPLKESPTQVTVVRTESHV  66
            KVS IANIFQ KP       QL  +        +         ++ +P     VRTESH 
Sbjct  14   KVSQIANIFQRKPIEIQPVEQLSAVAAAHAAAAAAAAAAHHAHVQGAP----AVRTESHS  69

Query  67   ARFNNARALFEKLGEENKPNKPVDRITKPSNLHGLRSRSSSANSGSGCTSPARSPRPRSP  126
            ARFNNARALFEKLG E+  N    R+ +  +        S  +S          P+ R+P
Sbjct  70   ARFNNARALFEKLGVESNSNVS-SRLLRSGSREDNLCDGSDRSSSRSSDRSQSPPKRRTP  128

Query  127  SPPGTRDHLSNWSASVPALNA---ERHFENG--------------------HNHG-LDNI  162
             P G     +N +A++ A N    E+   N                     HN   L + 
Sbjct  129  FPSGVSLVHNNNNAAIVAQNGVPPEQRLSNSKFIVEPAAQVVPTSVVKYPQHNISRLKSE  188

Query  163  PDKHKSRAGFGKFDKNYGKENRLDDRPEKPEKPERRLNSKELIEKQKNWTSHFSKTRPSR  222
                      G     +       D+P   EKPER+ NS+ELIEKQK WTSHF+KT+ +R
Sbjct  189  EPSPVPPPASGSVSALFASSG--GDKP---EKPERKFNSRELIEKQKKWTSHFTKTKTTR  243

Query  223  YNSDPNR  229
             +SD NR
Sbjct  244  THSDLNR  250


 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 1/41 (2%)

Query  989   PDTMTADEAENLLSSRILEKKIRQGSALLSDEEAQEIARLL  1029
             PD MTA EAE LLSS ILE KIRQ S LLSDE+A+E+ ++L
Sbjct  859   PDDMTAAEAERLLSSSILENKIRQQS-LLSDEQAKEVEQIL  898


 Score = 37.7 bits (86),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 15/24 (63%), Positives = 21/24 (88%), Gaps = 0/24 (0%)

Query  618  RRSHVRVDLQAAGLGQRPPSVISS  641
            +RS + V++ AAGLGQRPPS+IS+
Sbjct  537  KRSSITVNMPAAGLGQRPPSIIST  560



Lambda      K        H
   0.306    0.123    0.336 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 27409708836


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Nov 7, 2022  4:57 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_050573064.1 uncharacterized protein LOC126913872 isoform X6
[Bombus affinis]

Length=1965
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9GQA3_DROME  unnamed protein product                                 563     2e-172
M9NEY3_DROME  unnamed protein product                                 566     9e-168
M9NFI9_DROME  unnamed protein product                                 566     1e-167


>Q9GQA3_DROME unnamed protein product
Length=1330

 Score = 563 bits (1450),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 323/576 (56%), Positives = 383/576 (66%), Gaps = 66/576 (11%)

Query  1084  TETEHQDEYVP---PTPGKVVLVENGVHYFEDGHFWMEVAGIPESDDEKDDYPTNIPIKK  1140
             TE +    Y+P   P   K VLVE GVHYFEDG+FWMEV G+ + DD+   YP  I ++K
Sbjct  348   TELDDSQYYIPEYPPVRSKEVLVEAGVHYFEDGNFWMEVPGLLDFDDDDCSYPP-ITVRK  406

Query  1141  MSKVSFDTKPMRVYSTHSVNEYDRRNEDVDPVAASAEYELEKRVEKMEVFPVELMKGPEG  1200
               KV F + P+ V ST SVN+YDRRNEDVDPVAASAEYELEKRVEKM VFPVELMKGPEG
Sbjct  407   NPKVRFSSGPIHVCSTFSVNDYDRRNEDVDPVAASAEYELEKRVEKMHVFPVELMKGPEG  466

Query  1201  LGLSIIGMGVGADAGLEKLGIFVKTITEKGAAAREGRIQVNDQIVEVDGKSLVGVTQAYA  1260
             LGLSIIGMGVGADAGLEKLGIFVKTIT+ GAAAR+GRIQVNDQI+EVDGKSLVGVTQAYA
Sbjct  467   LGLSIIGMGVGADAGLEKLGIFVKTITDNGAAARDGRIQVNDQIIEVDGKSLVGVTQAYA  526

Query  1261  ASVLRNTSGLVRFVIGRERDP-NSEVAMLIRQSLQADKE------REQQANSARKLNFSD  1313
             ASVLRNTSGLV+F IGRERDP NSEVA LIR SLQAD+E      R+Q+    R L++S+
Sbjct  527   ASVLRNTSGLVKFQIGRERDPENSEVAQLIRLSLQADREKEERLKRQQEEYLRRTLDYSE  586

Query  1314  ASPDSQRGSEDISVGGMGGIPGSPAMSSCSEGEPPQSPIENYLSSSGRSRSPIISSSMPP  1373
              S                     P  ++ S  E P SP++                  P 
Sbjct  587   DST-------------------QPVSANSSVCEGPSSPVQ---------------VEHPM  612

Query  1374  HTSATTQNDVDSLRLLLQESQYKLALADGEVEKLKAKLVDLENSGAGSEEYAAKLRESGL  1433
                AT   +V+SL+ LLQES+    + +  ++ LK KLV LE +G  +E  + +LR    
Sbjct  613   EVEATHSQEVESLKRLLQESEMGCLVKEEIIQNLKRKLVKLETTGNENELLSERLR----  668

Query  1434  RLHESERALGTARQDLIAAREMLSQATAQNAALQQKYARARRAARELR---TDIAARDEF  1490
                +SER LG  R++    + ML Q+  Q  AL +KY +A+R  RE +    D+  R+EF
Sbjct  669   ---QSERELGNIRKEAANLQNMLQQSQGQYMALDKKYNKAKRLVREYQQRELDMCHREEF  725

Query  1491  YQQLLQEKDTEYNALVKSLKDRVITLEVELTETQRRFGLPVRLPYDGTTARIVTPQLSRR  1550
             YQQLLQEKDTEYNALVK LKDRVI LE EL ETQR+ G PV LPYD  T ++ TPQ+ R+
Sbjct  726   YQQLLQEKDTEYNALVKKLKDRVINLEHELQETQRKAGFPVGLPYDSATLKL-TPQMMRK  784

Query  1551  QLPPPP--SSTSCQLSDTETSDLSSPDDGDKTATVERKLPLPLPVKEELDRAVPAHRLLD  1608
               PP P       +LSDTE SDLS   DG KTATVERK    +PVK+ELD AVP H LLD
Sbjct  785   T-PPKPLFHKLETELSDTEISDLSPDGDGVKTATVERK----VPVKDELDAAVPQHELLD  839

Query  1609  NSAGKSKAELASRGGLANRQLPKRSGGLSNSSSDYG  1644
             NS  K+K +LASRGGLANRQLP  +G   NSS+  G
Sbjct  840   NSINKTKIDLASRGGLANRQLPSANG---NSSTSNG  872


 Score = 146 bits (368),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 91/219 (42%), Positives = 128/219 (58%), Gaps = 19/219 (9%)

Query  1733  PPASFAEQLKQVLAERERRLGGNDMSSSRESSGDFSDLNNPHSSDPALVTHHLVEEIRQA  1792
             P +SF +QL Q L++RERRLG     SSR SS D++++N   S+  A+    L+ EIRQA
Sbjct  1104  PGSSFTDQLNQALSDRERRLGD---GSSRHSSDDYTEINKSQSA-AAINCKTLINEIRQA  1159

Query  1793  VSEANQRVKKATIPSSNLIGSGSTPWHHPGSSPSSLSSGGSVSPPAVDPSPSKTDTSEVW  1852
             V+EA  +   A         +   P HH  +SP+S+SSG   S P    SPS+T      
Sbjct  1160  VNEAQPKGALAAAAPPANPAAAVRP-HHRSASPTSMSSG--CSSPGY--SPSRT------  1208

Query  1853  LPPHPSDFGLGDKKS----HFWQNAPVTDWSKEQVCQWLSGIGLERYAPRFLETGINGGN  1908
             L    S     D+K+    + ++  PV +W+K+QV  WL GI LERY P F E  + GG 
Sbjct  1209  LDLSGSSSSFSDRKAMAAGYTYKGGPVHEWTKDQVGHWLMGIELERYIPVFKENNVEGGA  1268

Query  1909  LLRLESRDLKAFGICGDEKSHLKRKLKELRAQADRERKE  1947
             LL L+S+D K  GICGD+K  LK++LK+L+A  ++ERK+
Sbjct  1269  LLTLDSKDFKTLGICGDDKHRLKKRLKDLKANIEKERKD  1307


>M9NEY3_DROME unnamed protein product
Length=2134

 Score = 566 bits (1459),  Expect = 9e-168, Method: Compositional matrix adjust.
 Identities = 327/576 (57%), Positives = 388/576 (67%), Gaps = 66/576 (11%)

Query  1084  TETEHQDEYVP---PTPGKVVLVENGVHYFEDGHFWMEVAGIPESDDEKDDYPTNIPIKK  1140
             TE +    Y+P   P   K VLVE GVHYFEDG+FWMEV G+ + DD+   YP  I ++K
Sbjct  1152  TELDDSQYYIPEYPPVRSKEVLVEAGVHYFEDGNFWMEVPGLLDFDDDDCSYPP-ITVRK  1210

Query  1141  MSKVSFDTKPMRVYSTHSVNEYDRRNEDVDPVAASAEYELEKRVEKMEVFPVELMKGPEG  1200
               KV F + P+ VYST SVN+YDRRNEDVDPVAASAEYELEKRVEKM VFPVELMKGPEG
Sbjct  1211  NPKVRFSSGPIHVYSTFSVNDYDRRNEDVDPVAASAEYELEKRVEKMHVFPVELMKGPEG  1270

Query  1201  LGLSIIGMGVGADAGLEKLGIFVKTITEKGAAAREGRIQVNDQIVEVDGKSLVGVTQAYA  1260
             LGLSIIGMGVGADAGLEKLGIFVKTIT+ GAAAR+GRIQVNDQI+EVDGKSLVGVTQAYA
Sbjct  1271  LGLSIIGMGVGADAGLEKLGIFVKTITDNGAAARDGRIQVNDQIIEVDGKSLVGVTQAYA  1330

Query  1261  ASVLRNTSGLVRFVIGRERDP-NSEVAMLIRQSLQADKE------REQQANSARKLNFSD  1313
             ASVLRNTSGLV+F IGRERDP NSEVA LIR SLQAD+E      R+Q+    R L++S+
Sbjct  1331  ASVLRNTSGLVKFQIGRERDPENSEVAQLIRLSLQADREKEERLKRQQEEYLRRTLDYSE  1390

Query  1314  ASPDSQRGSEDISVGGMGGIPGSPAMSSCSEGEPPQSPIENYLSSSGRSRSPIISSSMPP  1373
              S      ++ +S           A SS  EG  P SP++                  P 
Sbjct  1391  DS------TQPVS-----------ANSSVCEG--PSSPVQ---------------VEHPM  1416

Query  1374  HTSATTQNDVDSLRLLLQESQYKLALADGEVEKLKAKLVDLENSGAGSEEYAAKLRESGL  1433
                AT   +V+SL+ LLQES+    + +  ++ LK KLV LE +G  +E  + +LR    
Sbjct  1417  EVEATHSQEVESLKRLLQESEMGCLVKEEIIQNLKRKLVKLETTGNENELLSERLR----  1472

Query  1434  RLHESERALGTARQDLIAAREMLSQATAQNAALQQKYARARRAARELR---TDIAARDEF  1490
                +SER LG  R++    + ML Q+  Q  AL +KY +A+R  RE +    D+  R+EF
Sbjct  1473  ---QSERELGNIRKEAANLQNMLQQSQGQYMALDKKYNKAKRLVREYQQRELDMCHREEF  1529

Query  1491  YQQLLQEKDTEYNALVKSLKDRVITLEVELTETQRRFGLPVRLPYDGTTARIVTPQLSRR  1550
             YQQLLQEKDTEYNALVK LKDRVI LE EL ETQR+ G PV LPYD  T ++ TPQ+ R+
Sbjct  1530  YQQLLQEKDTEYNALVKKLKDRVINLEHELQETQRKAGFPVGLPYDSATLKL-TPQMMRK  1588

Query  1551  QLPPPP--SSTSCQLSDTETSDLSSPDDGDKTATVERKLPLPLPVKEELDRAVPAHRLLD  1608
               PP P       +LSDTE SDLS   DG KTATVERK    +PVK+ELD AVP H LLD
Sbjct  1589  T-PPKPLFHKLETELSDTEISDLSPDGDGVKTATVERK----VPVKDELDAAVPQHELLD  1643

Query  1609  NSAGKSKAELASRGGLANRQLPKRSGGLSNSSSDYG  1644
             NS  K+K +LASRGGLANRQLP  +G   NSS+  G
Sbjct  1644  NSINKTKIDLASRGGLANRQLPSANG---NSSTSNG  1676


 Score = 139 bits (351),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 91/227 (40%), Positives = 129/227 (57%), Gaps = 35/227 (15%)

Query  1733  PPASFAEQLKQVLAERERRLGGNDMSSSRESSGDFSDLNNPHSSDPALVTHHLVEEIRQA  1792
             P +SF +QL Q L++RERRLG     SSR SS D++++N   S+  A+    L+ EIRQA
Sbjct  1908  PGSSFTDQLNQALSDRERRLGDG---SSRHSSDDYTEINKSQSA-AAINCKTLINEIRQA  1963

Query  1793  VSEANQRV--------KKATIPSSNLIGSGSTPWHHPGSSPSSLSSGGSVSPPAVDPSPS  1844
             V+EA  +V        +    PS++  G           SP+S+SSG   S P    SPS
Sbjct  1964  VNEAQPKVPWQQQHHQQIQQQPSAHTTGP---------PSPTSMSSG--CSSPGY--SPS  2010

Query  1845  KTDTSEVWLPPHPSDFGLGDKKS----HFWQNAPVTDWSKEQVCQWLSGIGLERYAPRFL  1900
             +T      L    S     D+K+    + ++  PV +W+K+QV  WL GI LERY P F 
Sbjct  2011  RT------LDLSGSSSSFSDRKAMAAGYTYKGGPVHEWTKDQVGHWLMGIELERYIPVFK  2064

Query  1901  ETGINGGNLLRLESRDLKAFGICGDEKSHLKRKLKELRAQADRERKE  1947
             E  + GG LL L+S+D K  GICGD+K  LK++LK+L+A  ++ERK+
Sbjct  2065  ENNVEGGALLTLDSKDFKTLGICGDDKHRLKKRLKDLKANIEKERKD  2111


 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 82/247 (33%), Positives = 108/247 (44%), Gaps = 41/247 (17%)

Query  14   KVSAIANIFQSKP-------QLDNLIHRTNNILSDGFKEPAVPLKESPTQVTVVRTESHV  66
            KVS IANIFQ KP       QL  +        +         ++ +P     VRTESH 
Sbjct  14   KVSQIANIFQRKPIEIQPVEQLSAVAAAHAAAAAAAAAAHHAHVQGAPA----VRTESHS  69

Query  67   ARFNNARALFEKLGEENKPNKPVDRITKPSNLHGLRSRSSSANSGSGCTSPARSPRPRSP  126
            ARFNNARALFEKLG E+  N    R+ +  +        S  +S          P+ R+P
Sbjct  70   ARFNNARALFEKLGVESNSNVS-SRLLRSGSREDNLCDGSDRSSSRSSDRSQSPPKRRTP  128

Query  127  SPPGTRDHLSNWSASVPALNA---ERHFENG--------------------HNHG-LDNI  162
             P G     +N +A++ A N    E+   N                     HN   L + 
Sbjct  129  FPSGVSLVHNNNNAAIVAQNGVPPEQRLSNSKFIVEPAAQVVPTSVVKYPQHNISRLKSE  188

Query  163  PDKHKSRAGFGKFDKNYGKENRLDDRPEKPEKPERRLNSKELIEKQKNWTSHFSKTRPSR  222
                      G     +       D+P   EKPER+ NS+ELIEKQK WTSHF+KT+ +R
Sbjct  189  EPSPVPPPASGSVSALFASSG--GDKP---EKPERKFNSRELIEKQKKWTSHFTKTKTTR  243

Query  223  YNSDPNR  229
             +SD NR
Sbjct  244  THSDLNR  250


 Score = 37.7 bits (86),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 15/24 (63%), Positives = 21/24 (88%), Gaps = 0/24 (0%)

Query  652  RRSHVRVDLQAAGLGQRPPSVISS  675
            +RS + V++ AAGLGQRPPS+IS+
Sbjct  537  KRSSITVNMPAAGLGQRPPSIIST  560


>M9NFI9_DROME unnamed protein product
Length=2148

 Score = 566 bits (1458),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 327/576 (57%), Positives = 388/576 (67%), Gaps = 66/576 (11%)

Query  1084  TETEHQDEYVP---PTPGKVVLVENGVHYFEDGHFWMEVAGIPESDDEKDDYPTNIPIKK  1140
             TE +    Y+P   P   K VLVE GVHYFEDG+FWMEV G+ + DD+   YP  I ++K
Sbjct  1152  TELDDSQYYIPEYPPVRSKEVLVEAGVHYFEDGNFWMEVPGLLDFDDDDCSYPP-ITVRK  1210

Query  1141  MSKVSFDTKPMRVYSTHSVNEYDRRNEDVDPVAASAEYELEKRVEKMEVFPVELMKGPEG  1200
               KV F + P+ VYST SVN+YDRRNEDVDPVAASAEYELEKRVEKM VFPVELMKGPEG
Sbjct  1211  NPKVRFSSGPIHVYSTFSVNDYDRRNEDVDPVAASAEYELEKRVEKMHVFPVELMKGPEG  1270

Query  1201  LGLSIIGMGVGADAGLEKLGIFVKTITEKGAAAREGRIQVNDQIVEVDGKSLVGVTQAYA  1260
             LGLSIIGMGVGADAGLEKLGIFVKTIT+ GAAAR+GRIQVNDQI+EVDGKSLVGVTQAYA
Sbjct  1271  LGLSIIGMGVGADAGLEKLGIFVKTITDNGAAARDGRIQVNDQIIEVDGKSLVGVTQAYA  1330

Query  1261  ASVLRNTSGLVRFVIGRERDP-NSEVAMLIRQSLQADKE------REQQANSARKLNFSD  1313
             ASVLRNTSGLV+F IGRERDP NSEVA LIR SLQAD+E      R+Q+    R L++S+
Sbjct  1331  ASVLRNTSGLVKFQIGRERDPENSEVAQLIRLSLQADREKEERLKRQQEEYLRRTLDYSE  1390

Query  1314  ASPDSQRGSEDISVGGMGGIPGSPAMSSCSEGEPPQSPIENYLSSSGRSRSPIISSSMPP  1373
              S      ++ +S           A SS  EG  P SP++                  P 
Sbjct  1391  DS------TQPVS-----------ANSSVCEG--PSSPVQ---------------VEHPM  1416

Query  1374  HTSATTQNDVDSLRLLLQESQYKLALADGEVEKLKAKLVDLENSGAGSEEYAAKLRESGL  1433
                AT   +V+SL+ LLQES+    + +  ++ LK KLV LE +G  +E  + +LR    
Sbjct  1417  EVEATHSQEVESLKRLLQESEMGCLVKEEIIQNLKRKLVKLETTGNENELLSERLR----  1472

Query  1434  RLHESERALGTARQDLIAAREMLSQATAQNAALQQKYARARRAARELR---TDIAARDEF  1490
                +SER LG  R++    + ML Q+  Q  AL +KY +A+R  RE +    D+  R+EF
Sbjct  1473  ---QSERELGNIRKEAANLQNMLQQSQGQYMALDKKYNKAKRLVREYQQRELDMCHREEF  1529

Query  1491  YQQLLQEKDTEYNALVKSLKDRVITLEVELTETQRRFGLPVRLPYDGTTARIVTPQLSRR  1550
             YQQLLQEKDTEYNALVK LKDRVI LE EL ETQR+ G PV LPYD  T ++ TPQ+ R+
Sbjct  1530  YQQLLQEKDTEYNALVKKLKDRVINLEHELQETQRKAGFPVGLPYDSATLKL-TPQMMRK  1588

Query  1551  QLPPPP--SSTSCQLSDTETSDLSSPDDGDKTATVERKLPLPLPVKEELDRAVPAHRLLD  1608
               PP P       +LSDTE SDLS   DG KTATVERK    +PVK+ELD AVP H LLD
Sbjct  1589  T-PPKPLFHKLETELSDTEISDLSPDGDGVKTATVERK----VPVKDELDAAVPQHELLD  1643

Query  1609  NSAGKSKAELASRGGLANRQLPKRSGGLSNSSSDYG  1644
             NS  K+K +LASRGGLANRQLP  +G   NSS+  G
Sbjct  1644  NSINKTKIDLASRGGLANRQLPSANG---NSSTSNG  1676


 Score = 148 bits (373),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 97/234 (41%), Positives = 135/234 (58%), Gaps = 35/234 (15%)

Query  1733  PPASFAEQLKQVLAERERRLGGNDMSSSRESSGDFSDLNNPHSSDPALVTHHLVEEIRQA  1792
             P +SF +QL Q L++RERRLG     SSR SS D++++N   S+  A+    L+ EIRQA
Sbjct  1908  PGSSFTDQLNQALSDRERRLGDG---SSRHSSDDYTEINKSQSA-AAINCKTLINEIRQA  1963

Query  1793  VSEANQRVKKATIPSSNLIGSGSTPW--------------HHPGS-SPSSLSSGGSVSPP  1837
             V+EA  +VK+  +P S L   G+ PW              H  G  SP+S+SSG   S P
Sbjct  1964  VNEAQPKVKQ-VVPQS-LSPPGTVPWQQQHHQQIQQQPSAHTTGPPSPTSMSSG--CSSP  2019

Query  1838  AVDPSPSKTDTSEVWLPPHPSDFGLGDKKS----HFWQNAPVTDWSKEQVCQWLSGIGLE  1893
                 SPS+T      L    S     D+K+    + ++  PV +W+K+QV  WL GI LE
Sbjct  2020  GY--SPSRT------LDLSGSSSSFSDRKAMAAGYTYKGGPVHEWTKDQVGHWLMGIELE  2071

Query  1894  RYAPRFLETGINGGNLLRLESRDLKAFGICGDEKSHLKRKLKELRAQADRERKE  1947
             RY P F E  + GG LL L+S+D K  GICGD+K  LK++LK+L+A  ++ERK+
Sbjct  2072  RYIPVFKENNVEGGALLTLDSKDFKTLGICGDDKHRLKKRLKDLKANIEKERKD  2125


 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 82/247 (33%), Positives = 108/247 (44%), Gaps = 41/247 (17%)

Query  14   KVSAIANIFQSKP-------QLDNLIHRTNNILSDGFKEPAVPLKESPTQVTVVRTESHV  66
            KVS IANIFQ KP       QL  +        +         ++ +P     VRTESH 
Sbjct  14   KVSQIANIFQRKPIEIQPVEQLSAVAAAHAAAAAAAAAAHHAHVQGAPA----VRTESHS  69

Query  67   ARFNNARALFEKLGEENKPNKPVDRITKPSNLHGLRSRSSSANSGSGCTSPARSPRPRSP  126
            ARFNNARALFEKLG E+  N    R+ +  +        S  +S          P+ R+P
Sbjct  70   ARFNNARALFEKLGVESNSNVS-SRLLRSGSREDNLCDGSDRSSSRSSDRSQSPPKRRTP  128

Query  127  SPPGTRDHLSNWSASVPALNA---ERHFENG--------------------HNHG-LDNI  162
             P G     +N +A++ A N    E+   N                     HN   L + 
Sbjct  129  FPSGVSLVHNNNNAAIVAQNGVPPEQRLSNSKFIVEPAAQVVPTSVVKYPQHNISRLKSE  188

Query  163  PDKHKSRAGFGKFDKNYGKENRLDDRPEKPEKPERRLNSKELIEKQKNWTSHFSKTRPSR  222
                      G     +       D+P   EKPER+ NS+ELIEKQK WTSHF+KT+ +R
Sbjct  189  EPSPVPPPASGSVSALFASSG--GDKP---EKPERKFNSRELIEKQKKWTSHFTKTKTTR  243

Query  223  YNSDPNR  229
             +SD NR
Sbjct  244  THSDLNR  250


 Score = 37.7 bits (86),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 15/24 (63%), Positives = 21/24 (88%), Gaps = 0/24 (0%)

Query  652  RRSHVRVDLQAAGLGQRPPSVISS  675
            +RS + V++ AAGLGQRPPS+IS+
Sbjct  537  KRSSITVNMPAAGLGQRPPSIIST  560



Lambda      K        H
   0.306    0.123    0.337 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 26305322736


Query= XP_050573065.1 uncharacterized protein LOC126913873 isoform X1
[Bombus affinis]

Length=1574
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q09603_CAEEL  unnamed protein product                                 131     1e-32
Q9VPB0_DROME  unnamed protein product                                 129     7e-30
M9PG82_DROME  unnamed protein product                                 129     8e-30


>Q09603_CAEEL unnamed protein product
Length=385

 Score = 131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 82/254 (32%), Positives = 136/254 (54%), Gaps = 6/254 (2%)

Query  1319  INIRRHGNLVQLILTPSSSTKIRNALTLQVMQEFRETLSILKKDDDCRVVLLTSTGSSFC  1378
             +++ R G + ++ L   +  K  NALTL++ Q  ++ L +   D    + ++T+ GS +C
Sbjct  129   LSVTREGKVFKIAL---NRPKKFNALTLEMYQGIQKALEVSNNDKSTSITVITANGSYYC  185

Query  1379  EGLELSML---LHTNKEKRRIHAQEMADAVKDFIKSLASFNKPIVAGVQGAAVGLGVTML  1435
              G +L+         KE+    A      +KD++ +  +  KP++A + G AVG+ VT+L
Sbjct  186   AGNDLTNFKAAAGGTKEQIADMANTAKVIMKDYVNAYINHEKPLIALINGPAVGIAVTVL  245

Query  1436  PLFDLVIASDKATFSTPYGKLGQIAEGAAVFTLSHILGSAITSELLLGGRTLTASEALRA  1495
              +FD VIA+DKA+F TP+  LGQ  EG + +T   I+GS   SE+LL  + ++A  A   
Sbjct  246   GMFDYVIATDKASFHTPFAPLGQSPEGVSSYTFPLIMGSLRASEMLLVCKKISAQTAKDY  305

Query  1496  GLVTRVLWPDRFQVELLPTLKAMSEQSSQSMEATKTLLRHSLRKKLDAALESETYLLIQH  1555
             GLV  V+    FQ     T++A S+   +++   K LLR   ++KL      E   + + 
Sbjct  306   GLVNEVVPDAEFQSHAQKTVEAFSQLPPETLRINKKLLRSLHKEKLLEVNNIEADQICER  365

Query  1556  WCSVECQTAIKAYI  1569
             W S EC  AI A++
Sbjct  366   WQSKECHQAIAAFM  379


>Q9VPB0_DROME unnamed protein product
Length=926

 Score = 129 bits (324),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 71/225 (32%), Positives = 121/225 (54%), Gaps = 1/225 (0%)

Query  1347  QVMQEFRETLSILKKDDDCRVVLLTSTGSSFCEGLELSMLLHTNKEKRRIHAQEMADAVK  1406
             Q++++  +TLS + +  +   VLLT  G  FC+G++   L+  + EKR+  A ++A A+K
Sbjct  698   QLLEQLNDTLSSVARKGEFNTVLLTVEGPQFCQGIDCQELIQGSLEKRKDSASQLAVALK  757

Query  1407  DFIKSLASFNKPIVAGVQGAAVGLGVTMLPLFDLVIASDKATFSTPYGKLGQIAEGAAVF  1466
              ++++LA+F KP+VAG+ G+ + LGV  LP  D V+ASD  +F T Y KLGQ+ EG A++
Sbjct  758   CYLRTLATFPKPLVAGIVGSQINLGVMQLPFADYVVASDDCSFETNYAKLGQLPEGYALW  817

Query  1467  TLSHILGSAITSELLLGGRTLTASEALRA-GLVTRVLWPDRFQVELLPTLKAMSEQSSQS  1525
                  + S + S L L G  L A+E L +   V ++          L   K +S  S++ 
Sbjct  818   HGHQRVSSEVHSRLFLMGERLFATELLESNSFVDKICKARNVNEMALAKAKQISTSSAEM  877

Query  1526  MEATKTLLRHSLRKKLDAALESETYLLIQHWCSVECQTAIKAYID  1570
                 K L   ++       L+ E  ++ + W + +C    K Y++
Sbjct  878   YRTLKKLNHSAVNVTKFPRLDEELKVIGEQWVTADCLANFKRYLN  922


 Score = 36.2 bits (82),  Expect = 0.31, Method: Compositional matrix adjust.
 Identities = 21/81 (26%), Positives = 42/81 (52%), Gaps = 3/81 (4%)

Query  924   TKQNIAVKKILRQNISSNKKTATLKSKLNTSKKSGSKIVSKTKRSTENNAGDSKPKKKII  983
             TK+ +A KK   ++ +   ++    + +  +++  S +  + +      A     KKK +
Sbjct  429   TKKEVAPKK---RSATPTARSTKAGTPVGGTERGPSPVKRRAQTPNTGLANGGTQKKKKV  485

Query  984   NEIDRLLQDEGVVNLLYDVEQ  1004
             +EIDRL+ DEG  N+++ VE 
Sbjct  486   SEIDRLMGDEGAANMIHAVEH  506


>M9PG82_DROME unnamed protein product
Length=924

 Score = 129 bits (323),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 71/225 (32%), Positives = 121/225 (54%), Gaps = 1/225 (0%)

Query  1347  QVMQEFRETLSILKKDDDCRVVLLTSTGSSFCEGLELSMLLHTNKEKRRIHAQEMADAVK  1406
             Q++++  +TLS + +  +   VLLT  G  FC+G++   L+  + EKR+  A ++A A+K
Sbjct  696   QLLEQLNDTLSSVARKGEFNTVLLTVEGPQFCQGIDCQELIQGSLEKRKDSASQLAVALK  755

Query  1407  DFIKSLASFNKPIVAGVQGAAVGLGVTMLPLFDLVIASDKATFSTPYGKLGQIAEGAAVF  1466
              ++++LA+F KP+VAG+ G+ + LGV  LP  D V+ASD  +F T Y KLGQ+ EG A++
Sbjct  756   CYLRTLATFPKPLVAGIVGSQINLGVMQLPFADYVVASDDCSFETNYAKLGQLPEGYALW  815

Query  1467  TLSHILGSAITSELLLGGRTLTASEALRA-GLVTRVLWPDRFQVELLPTLKAMSEQSSQS  1525
                  + S + S L L G  L A+E L +   V ++          L   K +S  S++ 
Sbjct  816   HGHQRVSSEVHSRLFLMGERLFATELLESNSFVDKICKARNVNEMALAKAKQISTSSAEM  875

Query  1526  MEATKTLLRHSLRKKLDAALESETYLLIQHWCSVECQTAIKAYID  1570
                 K L   ++       L+ E  ++ + W + +C    K Y++
Sbjct  876   YRTLKKLNHSAVNVTKFPRLDEELKVIGEQWVTADCLANFKRYLN  920


 Score = 36.2 bits (82),  Expect = 0.29, Method: Compositional matrix adjust.
 Identities = 21/81 (26%), Positives = 42/81 (52%), Gaps = 3/81 (4%)

Query  924   TKQNIAVKKILRQNISSNKKTATLKSKLNTSKKSGSKIVSKTKRSTENNAGDSKPKKKII  983
             TK+ +A KK   ++ +   ++    + +  +++  S +  + +      A     KKK +
Sbjct  429   TKKEVAPKK---RSATPTARSTKAGTPVGGTERGPSPVKRRAQTPNTGLANGGTQKKKKV  485

Query  984   NEIDRLLQDEGVVNLLYDVEQ  1004
             +EIDRL+ DEG  N+++ VE 
Sbjct  486   SEIDRLMGDEGAANMIHAVEH  506



Lambda      K        H
   0.306    0.123    0.337 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 26305322736


Query= XP_050573066.1 GDP-mannose 4,6 dehydratase isoform X2 [Bombus
affinis]

Length=356
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GMDS_DROME  unnamed protein product                                   580     0.0  
GMD1_CAEEL  unnamed protein product                                   512     0.0  
GMD2_CAEEL  unnamed protein product                                   506     0.0  


>GMDS_DROME unnamed protein product
Length=395

 Score = 580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/350 (75%), Positives = 308/350 (88%), Gaps = 0/350 (0%)

Query  4    DGRRRVALITGITGQDGSYLAEFLLEKGYDVHGIIRRASSFNTARIQHLYADPKCHRQGR  63
            D R +VALITGITGQDGSYLAEFLL+K Y+VHGIIRRAS+FNT RI+HLYADPK H+ GR
Sbjct  43   DSRDKVALITGITGQDGSYLAEFLLKKDYEVHGIIRRASTFNTTRIEHLYADPKAHKGGR  102

Query  64   MKLHYGDMTDSSSLVKVISSVQPTEIYNLAAQSHVMVSFEVSEYTAEVDAVGTVRLLDAI  123
            MKLHYGDMTDSSSLVK+I+ V+PTEIYNLAAQSHV VSF++SEYTAEVDAVGT+R+LDAI
Sbjct  103  MKLHYGDMTDSSSLVKIINMVKPTEIYNLAAQSHVKVSFDLSEYTAEVDAVGTLRILDAI  162

Query  124  RTCGLEKSVKFYHASTSELYGRVTQVPQNEKTPFYPRSPYACAKLYSFWIVVNYREAYNM  183
            RTCG+EK+V+FY ASTSELYG+V + PQNE+TPFYPRSPYACAK+Y FWIV+NYREAYNM
Sbjct  163  RTCGMEKNVRFYQASTSELYGKVVETPQNEQTPFYPRSPYACAKMYGFWIVINYREAYNM  222

Query  184  FACNGILFNHESPRRGENFVTRKVTRSIAKIQLGLQDVLELGNLDAKRDWGHAKDYVEAM  243
            +ACNGILFNHESPRRGENFVTRK+TRS+AKI     +  ELGNLD+KRDWGHA DYVEAM
Sbjct  223  YACNGILFNHESPRRGENFVTRKITRSVAKIYHKQMEYFELGNLDSKRDWGHASDYVEAM  282

Query  244  WLMLQQPIPDDYVIATGETHSVREFVEAAFLYVGRTIKWEGEGINEIGQDAQTGQVLVKV  303
            W+MLQ+  P DYVIATGETHSVREFVEAAF ++ R I W+G+G++E+G +  TG V V++
Sbjct  283  WMMLQRESPSDYVIATGETHSVREFVEAAFKHIDREITWKGKGVDEVGVENGTGIVRVRI  342

Query  304  NPKYFRPTEVDVLLGDANKAKEKIGWKPTVTFEGLVKDMMDSDLELMRKN  353
            NPKYFRPTEVD+L GDA+KA  ++ W P VTF  LV DMM +D+ELMRKN
Sbjct  343  NPKYFRPTEVDLLQGDASKANRELNWTPKVTFVELVSDMMKADIELMRKN  392


>GMD1_CAEEL unnamed protein product
Length=399

 Score = 512 bits (1319),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 237/351 (68%), Positives = 290/351 (83%), Gaps = 2/351 (1%)

Query  7    RRVALITGITGQDGSYLAEFLLEKGYDVHGIIRRASSFNTARIQHLYADPKCHR-QGRMK  65
            R+VALITGI+GQDGSYLAE LL KGY VHGIIRR+SSFNTARI+HLY++P  H       
Sbjct  50   RKVALITGISGQDGSYLAELLLSKGYKVHGIIRRSSSFNTARIEHLYSNPITHHGDSSFS  109

Query  66   LHYGDMTDSSSLVKVISSVQPTEIYNLAAQSHVMVSFEVSEYTAEVDAVGTVRLLDAIRT  125
            LHYGDMTDSS L+K+IS+++PTE+Y+LAAQSHV VSF++ EYTAEVDAVGT+RLLDAI  
Sbjct  110  LHYGDMTDSSCLIKLISTIEPTEVYHLAAQSHVKVSFDLPEYTAEVDAVGTLRLLDAIHA  169

Query  126  CGLEKSVKFYHASTSELYGRVTQVPQNEKTPFYPRSPYACAKLYSFWIVVNYREAYNMFA  185
            C L + V+FY ASTSELYG+V ++PQ+EKTPFYPRSPYA AK+Y +WIVVNYREAYNMFA
Sbjct  170  CRLTEKVRFYQASTSELYGKVQEIPQSEKTPFYPRSPYAVAKMYGYWIVVNYREAYNMFA  229

Query  186  CNGILFNHESPRRGENFVTRKVTRSIAKIQLGLQDVLELGNLDAKRDWGHAKDYVEAMWL  245
            CNGILFNHESPRRGE FVTRK+TRS+AKI LG Q+ +ELGNL A RDWGHA++YVEAMW 
Sbjct  230  CNGILFNHESPRRGETFVTRKITRSVAKISLGQQESIELGNLSALRDWGHAREYVEAMWR  289

Query  246  MLQQPIPDDYVIATGETHSVREFVEAAFLYVGRTIKWEGEGINEIGQDAQTGQVLVKVNP  305
            +LQ   PDD+VIATG+  SVREF   AF  +G  ++WEGEG+ E+G++ + G + VKV+P
Sbjct  290  ILQHDSPDDFVIATGKQFSVREFCNLAFAEIGEVLQWEGEGVEEVGKN-KDGVIRVKVSP  348

Query  306  KYFRPTEVDVLLGDANKAKEKIGWKPTVTFEGLVKDMMDSDLELMRKNSNA  356
            KY+RPTEV+ LLG+A KAK+ +GW+  VT   LVK+M+ SD+ LM+ N  A
Sbjct  349  KYYRPTEVETLLGNAEKAKKTLGWEAKVTVPELVKEMVASDIILMKSNPMA  399


>GMD2_CAEEL unnamed protein product
Length=382

 Score = 506 bits (1302),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 237/351 (68%), Positives = 286/351 (81%), Gaps = 2/351 (1%)

Query  7    RRVALITGITGQDGSYLAEFLLEKGYDVHGIIRRASSFNTARIQHLYADPKCHR-QGRMK  65
            R+VALITGITGQDGSYLAE LL KGY VHGIIRR+SSFNTARI+HLY +P  H       
Sbjct  33   RKVALITGITGQDGSYLAELLLSKGYKVHGIIRRSSSFNTARIEHLYGNPVTHNGSASFS  92

Query  66   LHYGDMTDSSSLVKVISSVQPTEIYNLAAQSHVMVSFEVSEYTAEVDAVGTVRLLDAIRT  125
            LHYGDMTDSS L+K+IS+++PTEIY+LAAQSHV VSF++ EYTAEVDAVGT+RLLDAI  
Sbjct  93   LHYGDMTDSSCLIKLISTIEPTEIYHLAAQSHVKVSFDLPEYTAEVDAVGTLRLLDAIHA  152

Query  126  CGLEKSVKFYHASTSELYGRVTQVPQNEKTPFYPRSPYACAKLYSFWIVVNYREAYNMFA  185
            C L + V+FY ASTSELYG+V ++PQ+E TPFYPRSPYA AK+Y +WIVVNYREAY MFA
Sbjct  153  CRLTEKVRFYQASTSELYGKVQEIPQSELTPFYPRSPYAVAKMYGYWIVVNYREAYKMFA  212

Query  186  CNGILFNHESPRRGENFVTRKVTRSIAKIQLGLQDVLELGNLDAKRDWGHAKDYVEAMWL  245
            CNGILFNHESPRRGE FVTRK+TRS+AKI L  Q+ +ELGNL A RDWGHAK+YVEAMW 
Sbjct  213  CNGILFNHESPRRGETFVTRKITRSVAKISLRQQEHIELGNLSALRDWGHAKEYVEAMWR  272

Query  246  MLQQPIPDDYVIATGETHSVREFVEAAFLYVGRTIKWEGEGINEIGQDAQTGQVLVKVNP  305
            +LQQ  PDD+VIATG+  SVREF   AF  +G  + WEGEG++E+G++ Q G V VKV+P
Sbjct  273  ILQQDTPDDFVIATGKQFSVREFCNLAFAEIGEQLVWEGEGVDEVGKN-QDGVVRVKVSP  331

Query  306  KYFRPTEVDVLLGDANKAKEKIGWKPTVTFEGLVKDMMDSDLELMRKNSNA  356
            KY+RPTEV+ LLG+  KA++ +GW+P +T   LVK+M+ SD+ LM  +  A
Sbjct  332  KYYRPTEVETLLGNPAKARKTLGWEPKITVPELVKEMVASDIALMEADPMA  382



Lambda      K        H
   0.306    0.123    0.337 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 26305322736


Query= XP_050573067.1 uncharacterized protein LOC126913873 isoform X1
[Bombus affinis]

Length=1574
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q09603_CAEEL  unnamed protein product                                 131     1e-32
Q9VPB0_DROME  unnamed protein product                                 129     7e-30
M9PG82_DROME  unnamed protein product                                 129     8e-30


>Q09603_CAEEL unnamed protein product
Length=385

 Score = 131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 82/254 (32%), Positives = 136/254 (54%), Gaps = 6/254 (2%)

Query  1319  INIRRHGNLVQLILTPSSSTKIRNALTLQVMQEFRETLSILKKDDDCRVVLLTSTGSSFC  1378
             +++ R G + ++ L   +  K  NALTL++ Q  ++ L +   D    + ++T+ GS +C
Sbjct  129   LSVTREGKVFKIAL---NRPKKFNALTLEMYQGIQKALEVSNNDKSTSITVITANGSYYC  185

Query  1379  EGLELSML---LHTNKEKRRIHAQEMADAVKDFIKSLASFNKPIVAGVQGAAVGLGVTML  1435
              G +L+         KE+    A      +KD++ +  +  KP++A + G AVG+ VT+L
Sbjct  186   AGNDLTNFKAAAGGTKEQIADMANTAKVIMKDYVNAYINHEKPLIALINGPAVGIAVTVL  245

Query  1436  PLFDLVIASDKATFSTPYGKLGQIAEGAAVFTLSHILGSAITSELLLGGRTLTASEALRA  1495
              +FD VIA+DKA+F TP+  LGQ  EG + +T   I+GS   SE+LL  + ++A  A   
Sbjct  246   GMFDYVIATDKASFHTPFAPLGQSPEGVSSYTFPLIMGSLRASEMLLVCKKISAQTAKDY  305

Query  1496  GLVTRVLWPDRFQVELLPTLKAMSEQSSQSMEATKTLLRHSLRKKLDAALESETYLLIQH  1555
             GLV  V+    FQ     T++A S+   +++   K LLR   ++KL      E   + + 
Sbjct  306   GLVNEVVPDAEFQSHAQKTVEAFSQLPPETLRINKKLLRSLHKEKLLEVNNIEADQICER  365

Query  1556  WCSVECQTAIKAYI  1569
             W S EC  AI A++
Sbjct  366   WQSKECHQAIAAFM  379


>Q9VPB0_DROME unnamed protein product
Length=926

 Score = 129 bits (324),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 71/225 (32%), Positives = 121/225 (54%), Gaps = 1/225 (0%)

Query  1347  QVMQEFRETLSILKKDDDCRVVLLTSTGSSFCEGLELSMLLHTNKEKRRIHAQEMADAVK  1406
             Q++++  +TLS + +  +   VLLT  G  FC+G++   L+  + EKR+  A ++A A+K
Sbjct  698   QLLEQLNDTLSSVARKGEFNTVLLTVEGPQFCQGIDCQELIQGSLEKRKDSASQLAVALK  757

Query  1407  DFIKSLASFNKPIVAGVQGAAVGLGVTMLPLFDLVIASDKATFSTPYGKLGQIAEGAAVF  1466
              ++++LA+F KP+VAG+ G+ + LGV  LP  D V+ASD  +F T Y KLGQ+ EG A++
Sbjct  758   CYLRTLATFPKPLVAGIVGSQINLGVMQLPFADYVVASDDCSFETNYAKLGQLPEGYALW  817

Query  1467  TLSHILGSAITSELLLGGRTLTASEALRA-GLVTRVLWPDRFQVELLPTLKAMSEQSSQS  1525
                  + S + S L L G  L A+E L +   V ++          L   K +S  S++ 
Sbjct  818   HGHQRVSSEVHSRLFLMGERLFATELLESNSFVDKICKARNVNEMALAKAKQISTSSAEM  877

Query  1526  MEATKTLLRHSLRKKLDAALESETYLLIQHWCSVECQTAIKAYID  1570
                 K L   ++       L+ E  ++ + W + +C    K Y++
Sbjct  878   YRTLKKLNHSAVNVTKFPRLDEELKVIGEQWVTADCLANFKRYLN  922


 Score = 36.2 bits (82),  Expect = 0.31, Method: Compositional matrix adjust.
 Identities = 21/81 (26%), Positives = 42/81 (52%), Gaps = 3/81 (4%)

Query  924   TKQNIAVKKILRQNISSNKKTATLKSKLNTSKKSGSKIVSKTKRSTENNAGDSKPKKKII  983
             TK+ +A KK   ++ +   ++    + +  +++  S +  + +      A     KKK +
Sbjct  429   TKKEVAPKK---RSATPTARSTKAGTPVGGTERGPSPVKRRAQTPNTGLANGGTQKKKKV  485

Query  984   NEIDRLLQDEGVVNLLYDVEQ  1004
             +EIDRL+ DEG  N+++ VE 
Sbjct  486   SEIDRLMGDEGAANMIHAVEH  506


>M9PG82_DROME unnamed protein product
Length=924

 Score = 129 bits (323),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 71/225 (32%), Positives = 121/225 (54%), Gaps = 1/225 (0%)

Query  1347  QVMQEFRETLSILKKDDDCRVVLLTSTGSSFCEGLELSMLLHTNKEKRRIHAQEMADAVK  1406
             Q++++  +TLS + +  +   VLLT  G  FC+G++   L+  + EKR+  A ++A A+K
Sbjct  696   QLLEQLNDTLSSVARKGEFNTVLLTVEGPQFCQGIDCQELIQGSLEKRKDSASQLAVALK  755

Query  1407  DFIKSLASFNKPIVAGVQGAAVGLGVTMLPLFDLVIASDKATFSTPYGKLGQIAEGAAVF  1466
              ++++LA+F KP+VAG+ G+ + LGV  LP  D V+ASD  +F T Y KLGQ+ EG A++
Sbjct  756   CYLRTLATFPKPLVAGIVGSQINLGVMQLPFADYVVASDDCSFETNYAKLGQLPEGYALW  815

Query  1467  TLSHILGSAITSELLLGGRTLTASEALRA-GLVTRVLWPDRFQVELLPTLKAMSEQSSQS  1525
                  + S + S L L G  L A+E L +   V ++          L   K +S  S++ 
Sbjct  816   HGHQRVSSEVHSRLFLMGERLFATELLESNSFVDKICKARNVNEMALAKAKQISTSSAEM  875

Query  1526  MEATKTLLRHSLRKKLDAALESETYLLIQHWCSVECQTAIKAYID  1570
                 K L   ++       L+ E  ++ + W + +C    K Y++
Sbjct  876   YRTLKKLNHSAVNVTKFPRLDEELKVIGEQWVTADCLANFKRYLN  920


 Score = 36.2 bits (82),  Expect = 0.29, Method: Compositional matrix adjust.
 Identities = 21/81 (26%), Positives = 42/81 (52%), Gaps = 3/81 (4%)

Query  924   TKQNIAVKKILRQNISSNKKTATLKSKLNTSKKSGSKIVSKTKRSTENNAGDSKPKKKII  983
             TK+ +A KK   ++ +   ++    + +  +++  S +  + +      A     KKK +
Sbjct  429   TKKEVAPKK---RSATPTARSTKAGTPVGGTERGPSPVKRRAQTPNTGLANGGTQKKKKV  485

Query  984   NEIDRLLQDEGVVNLLYDVEQ  1004
             +EIDRL+ DEG  N+++ VE 
Sbjct  486   SEIDRLMGDEGAANMIHAVEH  506



Lambda      K        H
   0.306    0.123    0.337 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 26305322736


Query= XP_050573068.1 uncharacterized protein LOC126913873 isoform X1
[Bombus affinis]

Length=1574
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q09603_CAEEL  unnamed protein product                                 131     1e-32
Q9VPB0_DROME  unnamed protein product                                 129     7e-30
M9PG82_DROME  unnamed protein product                                 129     8e-30


>Q09603_CAEEL unnamed protein product
Length=385

 Score = 131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 82/254 (32%), Positives = 136/254 (54%), Gaps = 6/254 (2%)

Query  1319  INIRRHGNLVQLILTPSSSTKIRNALTLQVMQEFRETLSILKKDDDCRVVLLTSTGSSFC  1378
             +++ R G + ++ L   +  K  NALTL++ Q  ++ L +   D    + ++T+ GS +C
Sbjct  129   LSVTREGKVFKIAL---NRPKKFNALTLEMYQGIQKALEVSNNDKSTSITVITANGSYYC  185

Query  1379  EGLELSML---LHTNKEKRRIHAQEMADAVKDFIKSLASFNKPIVAGVQGAAVGLGVTML  1435
              G +L+         KE+    A      +KD++ +  +  KP++A + G AVG+ VT+L
Sbjct  186   AGNDLTNFKAAAGGTKEQIADMANTAKVIMKDYVNAYINHEKPLIALINGPAVGIAVTVL  245

Query  1436  PLFDLVIASDKATFSTPYGKLGQIAEGAAVFTLSHILGSAITSELLLGGRTLTASEALRA  1495
              +FD VIA+DKA+F TP+  LGQ  EG + +T   I+GS   SE+LL  + ++A  A   
Sbjct  246   GMFDYVIATDKASFHTPFAPLGQSPEGVSSYTFPLIMGSLRASEMLLVCKKISAQTAKDY  305

Query  1496  GLVTRVLWPDRFQVELLPTLKAMSEQSSQSMEATKTLLRHSLRKKLDAALESETYLLIQH  1555
             GLV  V+    FQ     T++A S+   +++   K LLR   ++KL      E   + + 
Sbjct  306   GLVNEVVPDAEFQSHAQKTVEAFSQLPPETLRINKKLLRSLHKEKLLEVNNIEADQICER  365

Query  1556  WCSVECQTAIKAYI  1569
             W S EC  AI A++
Sbjct  366   WQSKECHQAIAAFM  379


>Q9VPB0_DROME unnamed protein product
Length=926

 Score = 129 bits (324),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 71/225 (32%), Positives = 121/225 (54%), Gaps = 1/225 (0%)

Query  1347  QVMQEFRETLSILKKDDDCRVVLLTSTGSSFCEGLELSMLLHTNKEKRRIHAQEMADAVK  1406
             Q++++  +TLS + +  +   VLLT  G  FC+G++   L+  + EKR+  A ++A A+K
Sbjct  698   QLLEQLNDTLSSVARKGEFNTVLLTVEGPQFCQGIDCQELIQGSLEKRKDSASQLAVALK  757

Query  1407  DFIKSLASFNKPIVAGVQGAAVGLGVTMLPLFDLVIASDKATFSTPYGKLGQIAEGAAVF  1466
              ++++LA+F KP+VAG+ G+ + LGV  LP  D V+ASD  +F T Y KLGQ+ EG A++
Sbjct  758   CYLRTLATFPKPLVAGIVGSQINLGVMQLPFADYVVASDDCSFETNYAKLGQLPEGYALW  817

Query  1467  TLSHILGSAITSELLLGGRTLTASEALRA-GLVTRVLWPDRFQVELLPTLKAMSEQSSQS  1525
                  + S + S L L G  L A+E L +   V ++          L   K +S  S++ 
Sbjct  818   HGHQRVSSEVHSRLFLMGERLFATELLESNSFVDKICKARNVNEMALAKAKQISTSSAEM  877

Query  1526  MEATKTLLRHSLRKKLDAALESETYLLIQHWCSVECQTAIKAYID  1570
                 K L   ++       L+ E  ++ + W + +C    K Y++
Sbjct  878   YRTLKKLNHSAVNVTKFPRLDEELKVIGEQWVTADCLANFKRYLN  922


 Score = 36.2 bits (82),  Expect = 0.31, Method: Compositional matrix adjust.
 Identities = 21/81 (26%), Positives = 42/81 (52%), Gaps = 3/81 (4%)

Query  924   TKQNIAVKKILRQNISSNKKTATLKSKLNTSKKSGSKIVSKTKRSTENNAGDSKPKKKII  983
             TK+ +A KK   ++ +   ++    + +  +++  S +  + +      A     KKK +
Sbjct  429   TKKEVAPKK---RSATPTARSTKAGTPVGGTERGPSPVKRRAQTPNTGLANGGTQKKKKV  485

Query  984   NEIDRLLQDEGVVNLLYDVEQ  1004
             +EIDRL+ DEG  N+++ VE 
Sbjct  486   SEIDRLMGDEGAANMIHAVEH  506


>M9PG82_DROME unnamed protein product
Length=924

 Score = 129 bits (323),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 71/225 (32%), Positives = 121/225 (54%), Gaps = 1/225 (0%)

Query  1347  QVMQEFRETLSILKKDDDCRVVLLTSTGSSFCEGLELSMLLHTNKEKRRIHAQEMADAVK  1406
             Q++++  +TLS + +  +   VLLT  G  FC+G++   L+  + EKR+  A ++A A+K
Sbjct  696   QLLEQLNDTLSSVARKGEFNTVLLTVEGPQFCQGIDCQELIQGSLEKRKDSASQLAVALK  755

Query  1407  DFIKSLASFNKPIVAGVQGAAVGLGVTMLPLFDLVIASDKATFSTPYGKLGQIAEGAAVF  1466
              ++++LA+F KP+VAG+ G+ + LGV  LP  D V+ASD  +F T Y KLGQ+ EG A++
Sbjct  756   CYLRTLATFPKPLVAGIVGSQINLGVMQLPFADYVVASDDCSFETNYAKLGQLPEGYALW  815

Query  1467  TLSHILGSAITSELLLGGRTLTASEALRA-GLVTRVLWPDRFQVELLPTLKAMSEQSSQS  1525
                  + S + S L L G  L A+E L +   V ++          L   K +S  S++ 
Sbjct  816   HGHQRVSSEVHSRLFLMGERLFATELLESNSFVDKICKARNVNEMALAKAKQISTSSAEM  875

Query  1526  MEATKTLLRHSLRKKLDAALESETYLLIQHWCSVECQTAIKAYID  1570
                 K L   ++       L+ E  ++ + W + +C    K Y++
Sbjct  876   YRTLKKLNHSAVNVTKFPRLDEELKVIGEQWVTADCLANFKRYLN  920


 Score = 36.2 bits (82),  Expect = 0.29, Method: Compositional matrix adjust.
 Identities = 21/81 (26%), Positives = 42/81 (52%), Gaps = 3/81 (4%)

Query  924   TKQNIAVKKILRQNISSNKKTATLKSKLNTSKKSGSKIVSKTKRSTENNAGDSKPKKKII  983
             TK+ +A KK   ++ +   ++    + +  +++  S +  + +      A     KKK +
Sbjct  429   TKKEVAPKK---RSATPTARSTKAGTPVGGTERGPSPVKRRAQTPNTGLANGGTQKKKKV  485

Query  984   NEIDRLLQDEGVVNLLYDVEQ  1004
             +EIDRL+ DEG  N+++ VE 
Sbjct  486   SEIDRLMGDEGAANMIHAVEH  506



Lambda      K        H
   0.306    0.123    0.337 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 26305322736


Query= XP_050573069.1 uncharacterized protein LOC126913873 isoform X1
[Bombus affinis]

Length=1574
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q09603_CAEEL  unnamed protein product                                 131     1e-32
Q9VPB0_DROME  unnamed protein product                                 129     7e-30
M9PG82_DROME  unnamed protein product                                 129     8e-30


>Q09603_CAEEL unnamed protein product
Length=385

 Score = 131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 82/254 (32%), Positives = 136/254 (54%), Gaps = 6/254 (2%)

Query  1319  INIRRHGNLVQLILTPSSSTKIRNALTLQVMQEFRETLSILKKDDDCRVVLLTSTGSSFC  1378
             +++ R G + ++ L   +  K  NALTL++ Q  ++ L +   D    + ++T+ GS +C
Sbjct  129   LSVTREGKVFKIAL---NRPKKFNALTLEMYQGIQKALEVSNNDKSTSITVITANGSYYC  185

Query  1379  EGLELSML---LHTNKEKRRIHAQEMADAVKDFIKSLASFNKPIVAGVQGAAVGLGVTML  1435
              G +L+         KE+    A      +KD++ +  +  KP++A + G AVG+ VT+L
Sbjct  186   AGNDLTNFKAAAGGTKEQIADMANTAKVIMKDYVNAYINHEKPLIALINGPAVGIAVTVL  245

Query  1436  PLFDLVIASDKATFSTPYGKLGQIAEGAAVFTLSHILGSAITSELLLGGRTLTASEALRA  1495
              +FD VIA+DKA+F TP+  LGQ  EG + +T   I+GS   SE+LL  + ++A  A   
Sbjct  246   GMFDYVIATDKASFHTPFAPLGQSPEGVSSYTFPLIMGSLRASEMLLVCKKISAQTAKDY  305

Query  1496  GLVTRVLWPDRFQVELLPTLKAMSEQSSQSMEATKTLLRHSLRKKLDAALESETYLLIQH  1555
             GLV  V+    FQ     T++A S+   +++   K LLR   ++KL      E   + + 
Sbjct  306   GLVNEVVPDAEFQSHAQKTVEAFSQLPPETLRINKKLLRSLHKEKLLEVNNIEADQICER  365

Query  1556  WCSVECQTAIKAYI  1569
             W S EC  AI A++
Sbjct  366   WQSKECHQAIAAFM  379


>Q9VPB0_DROME unnamed protein product
Length=926

 Score = 129 bits (324),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 71/225 (32%), Positives = 121/225 (54%), Gaps = 1/225 (0%)

Query  1347  QVMQEFRETLSILKKDDDCRVVLLTSTGSSFCEGLELSMLLHTNKEKRRIHAQEMADAVK  1406
             Q++++  +TLS + +  +   VLLT  G  FC+G++   L+  + EKR+  A ++A A+K
Sbjct  698   QLLEQLNDTLSSVARKGEFNTVLLTVEGPQFCQGIDCQELIQGSLEKRKDSASQLAVALK  757

Query  1407  DFIKSLASFNKPIVAGVQGAAVGLGVTMLPLFDLVIASDKATFSTPYGKLGQIAEGAAVF  1466
              ++++LA+F KP+VAG+ G+ + LGV  LP  D V+ASD  +F T Y KLGQ+ EG A++
Sbjct  758   CYLRTLATFPKPLVAGIVGSQINLGVMQLPFADYVVASDDCSFETNYAKLGQLPEGYALW  817

Query  1467  TLSHILGSAITSELLLGGRTLTASEALRA-GLVTRVLWPDRFQVELLPTLKAMSEQSSQS  1525
                  + S + S L L G  L A+E L +   V ++          L   K +S  S++ 
Sbjct  818   HGHQRVSSEVHSRLFLMGERLFATELLESNSFVDKICKARNVNEMALAKAKQISTSSAEM  877

Query  1526  MEATKTLLRHSLRKKLDAALESETYLLIQHWCSVECQTAIKAYID  1570
                 K L   ++       L+ E  ++ + W + +C    K Y++
Sbjct  878   YRTLKKLNHSAVNVTKFPRLDEELKVIGEQWVTADCLANFKRYLN  922


 Score = 36.2 bits (82),  Expect = 0.31, Method: Compositional matrix adjust.
 Identities = 21/81 (26%), Positives = 42/81 (52%), Gaps = 3/81 (4%)

Query  924   TKQNIAVKKILRQNISSNKKTATLKSKLNTSKKSGSKIVSKTKRSTENNAGDSKPKKKII  983
             TK+ +A KK   ++ +   ++    + +  +++  S +  + +      A     KKK +
Sbjct  429   TKKEVAPKK---RSATPTARSTKAGTPVGGTERGPSPVKRRAQTPNTGLANGGTQKKKKV  485

Query  984   NEIDRLLQDEGVVNLLYDVEQ  1004
             +EIDRL+ DEG  N+++ VE 
Sbjct  486   SEIDRLMGDEGAANMIHAVEH  506


>M9PG82_DROME unnamed protein product
Length=924

 Score = 129 bits (323),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 71/225 (32%), Positives = 121/225 (54%), Gaps = 1/225 (0%)

Query  1347  QVMQEFRETLSILKKDDDCRVVLLTSTGSSFCEGLELSMLLHTNKEKRRIHAQEMADAVK  1406
             Q++++  +TLS + +  +   VLLT  G  FC+G++   L+  + EKR+  A ++A A+K
Sbjct  696   QLLEQLNDTLSSVARKGEFNTVLLTVEGPQFCQGIDCQELIQGSLEKRKDSASQLAVALK  755

Query  1407  DFIKSLASFNKPIVAGVQGAAVGLGVTMLPLFDLVIASDKATFSTPYGKLGQIAEGAAVF  1466
              ++++LA+F KP+VAG+ G+ + LGV  LP  D V+ASD  +F T Y KLGQ+ EG A++
Sbjct  756   CYLRTLATFPKPLVAGIVGSQINLGVMQLPFADYVVASDDCSFETNYAKLGQLPEGYALW  815

Query  1467  TLSHILGSAITSELLLGGRTLTASEALRA-GLVTRVLWPDRFQVELLPTLKAMSEQSSQS  1525
                  + S + S L L G  L A+E L +   V ++          L   K +S  S++ 
Sbjct  816   HGHQRVSSEVHSRLFLMGERLFATELLESNSFVDKICKARNVNEMALAKAKQISTSSAEM  875

Query  1526  MEATKTLLRHSLRKKLDAALESETYLLIQHWCSVECQTAIKAYID  1570
                 K L   ++       L+ E  ++ + W + +C    K Y++
Sbjct  876   YRTLKKLNHSAVNVTKFPRLDEELKVIGEQWVTADCLANFKRYLN  920


 Score = 36.2 bits (82),  Expect = 0.29, Method: Compositional matrix adjust.
 Identities = 21/81 (26%), Positives = 42/81 (52%), Gaps = 3/81 (4%)

Query  924   TKQNIAVKKILRQNISSNKKTATLKSKLNTSKKSGSKIVSKTKRSTENNAGDSKPKKKII  983
             TK+ +A KK   ++ +   ++    + +  +++  S +  + +      A     KKK +
Sbjct  429   TKKEVAPKK---RSATPTARSTKAGTPVGGTERGPSPVKRRAQTPNTGLANGGTQKKKKV  485

Query  984   NEIDRLLQDEGVVNLLYDVEQ  1004
             +EIDRL+ DEG  N+++ VE 
Sbjct  486   SEIDRLMGDEGAANMIHAVEH  506



Lambda      K        H
   0.306    0.123    0.337 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 26305322736


Query= XP_050573070.1 uncharacterized protein LOC126913873 isoform X1
[Bombus affinis]

Length=1574
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q09603_CAEEL  unnamed protein product                                 131     1e-32
Q9VPB0_DROME  unnamed protein product                                 129     7e-30
M9PG82_DROME  unnamed protein product                                 129     8e-30


>Q09603_CAEEL unnamed protein product
Length=385

 Score = 131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 82/254 (32%), Positives = 136/254 (54%), Gaps = 6/254 (2%)

Query  1319  INIRRHGNLVQLILTPSSSTKIRNALTLQVMQEFRETLSILKKDDDCRVVLLTSTGSSFC  1378
             +++ R G + ++ L   +  K  NALTL++ Q  ++ L +   D    + ++T+ GS +C
Sbjct  129   LSVTREGKVFKIAL---NRPKKFNALTLEMYQGIQKALEVSNNDKSTSITVITANGSYYC  185

Query  1379  EGLELSML---LHTNKEKRRIHAQEMADAVKDFIKSLASFNKPIVAGVQGAAVGLGVTML  1435
              G +L+         KE+    A      +KD++ +  +  KP++A + G AVG+ VT+L
Sbjct  186   AGNDLTNFKAAAGGTKEQIADMANTAKVIMKDYVNAYINHEKPLIALINGPAVGIAVTVL  245

Query  1436  PLFDLVIASDKATFSTPYGKLGQIAEGAAVFTLSHILGSAITSELLLGGRTLTASEALRA  1495
              +FD VIA+DKA+F TP+  LGQ  EG + +T   I+GS   SE+LL  + ++A  A   
Sbjct  246   GMFDYVIATDKASFHTPFAPLGQSPEGVSSYTFPLIMGSLRASEMLLVCKKISAQTAKDY  305

Query  1496  GLVTRVLWPDRFQVELLPTLKAMSEQSSQSMEATKTLLRHSLRKKLDAALESETYLLIQH  1555
             GLV  V+    FQ     T++A S+   +++   K LLR   ++KL      E   + + 
Sbjct  306   GLVNEVVPDAEFQSHAQKTVEAFSQLPPETLRINKKLLRSLHKEKLLEVNNIEADQICER  365

Query  1556  WCSVECQTAIKAYI  1569
             W S EC  AI A++
Sbjct  366   WQSKECHQAIAAFM  379


>Q9VPB0_DROME unnamed protein product
Length=926

 Score = 129 bits (324),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 71/225 (32%), Positives = 121/225 (54%), Gaps = 1/225 (0%)

Query  1347  QVMQEFRETLSILKKDDDCRVVLLTSTGSSFCEGLELSMLLHTNKEKRRIHAQEMADAVK  1406
             Q++++  +TLS + +  +   VLLT  G  FC+G++   L+  + EKR+  A ++A A+K
Sbjct  698   QLLEQLNDTLSSVARKGEFNTVLLTVEGPQFCQGIDCQELIQGSLEKRKDSASQLAVALK  757

Query  1407  DFIKSLASFNKPIVAGVQGAAVGLGVTMLPLFDLVIASDKATFSTPYGKLGQIAEGAAVF  1466
              ++++LA+F KP+VAG+ G+ + LGV  LP  D V+ASD  +F T Y KLGQ+ EG A++
Sbjct  758   CYLRTLATFPKPLVAGIVGSQINLGVMQLPFADYVVASDDCSFETNYAKLGQLPEGYALW  817

Query  1467  TLSHILGSAITSELLLGGRTLTASEALRA-GLVTRVLWPDRFQVELLPTLKAMSEQSSQS  1525
                  + S + S L L G  L A+E L +   V ++          L   K +S  S++ 
Sbjct  818   HGHQRVSSEVHSRLFLMGERLFATELLESNSFVDKICKARNVNEMALAKAKQISTSSAEM  877

Query  1526  MEATKTLLRHSLRKKLDAALESETYLLIQHWCSVECQTAIKAYID  1570
                 K L   ++       L+ E  ++ + W + +C    K Y++
Sbjct  878   YRTLKKLNHSAVNVTKFPRLDEELKVIGEQWVTADCLANFKRYLN  922


 Score = 36.2 bits (82),  Expect = 0.31, Method: Compositional matrix adjust.
 Identities = 21/81 (26%), Positives = 42/81 (52%), Gaps = 3/81 (4%)

Query  924   TKQNIAVKKILRQNISSNKKTATLKSKLNTSKKSGSKIVSKTKRSTENNAGDSKPKKKII  983
             TK+ +A KK   ++ +   ++    + +  +++  S +  + +      A     KKK +
Sbjct  429   TKKEVAPKK---RSATPTARSTKAGTPVGGTERGPSPVKRRAQTPNTGLANGGTQKKKKV  485

Query  984   NEIDRLLQDEGVVNLLYDVEQ  1004
             +EIDRL+ DEG  N+++ VE 
Sbjct  486   SEIDRLMGDEGAANMIHAVEH  506


>M9PG82_DROME unnamed protein product
Length=924

 Score = 129 bits (323),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 71/225 (32%), Positives = 121/225 (54%), Gaps = 1/225 (0%)

Query  1347  QVMQEFRETLSILKKDDDCRVVLLTSTGSSFCEGLELSMLLHTNKEKRRIHAQEMADAVK  1406
             Q++++  +TLS + +  +   VLLT  G  FC+G++   L+  + EKR+  A ++A A+K
Sbjct  696   QLLEQLNDTLSSVARKGEFNTVLLTVEGPQFCQGIDCQELIQGSLEKRKDSASQLAVALK  755

Query  1407  DFIKSLASFNKPIVAGVQGAAVGLGVTMLPLFDLVIASDKATFSTPYGKLGQIAEGAAVF  1466
              ++++LA+F KP+VAG+ G+ + LGV  LP  D V+ASD  +F T Y KLGQ+ EG A++
Sbjct  756   CYLRTLATFPKPLVAGIVGSQINLGVMQLPFADYVVASDDCSFETNYAKLGQLPEGYALW  815

Query  1467  TLSHILGSAITSELLLGGRTLTASEALRA-GLVTRVLWPDRFQVELLPTLKAMSEQSSQS  1525
                  + S + S L L G  L A+E L +   V ++          L   K +S  S++ 
Sbjct  816   HGHQRVSSEVHSRLFLMGERLFATELLESNSFVDKICKARNVNEMALAKAKQISTSSAEM  875

Query  1526  MEATKTLLRHSLRKKLDAALESETYLLIQHWCSVECQTAIKAYID  1570
                 K L   ++       L+ E  ++ + W + +C    K Y++
Sbjct  876   YRTLKKLNHSAVNVTKFPRLDEELKVIGEQWVTADCLANFKRYLN  920


 Score = 36.2 bits (82),  Expect = 0.29, Method: Compositional matrix adjust.
 Identities = 21/81 (26%), Positives = 42/81 (52%), Gaps = 3/81 (4%)

Query  924   TKQNIAVKKILRQNISSNKKTATLKSKLNTSKKSGSKIVSKTKRSTENNAGDSKPKKKII  983
             TK+ +A KK   ++ +   ++    + +  +++  S +  + +      A     KKK +
Sbjct  429   TKKEVAPKK---RSATPTARSTKAGTPVGGTERGPSPVKRRAQTPNTGLANGGTQKKKKV  485

Query  984   NEIDRLLQDEGVVNLLYDVEQ  1004
             +EIDRL+ DEG  N+++ VE 
Sbjct  486   SEIDRLMGDEGAANMIHAVEH  506



Lambda      K        H
   0.306    0.123    0.337 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 26305322736


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Nov 7, 2022  4:57 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_050573071.1 uncharacterized protein LOC126913873 isoform X2
[Bombus affinis]

Length=1551
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q09603_CAEEL  unnamed protein product                                 132     1e-32
Q9VPB0_DROME  unnamed protein product                                 129     8e-30
M9PG82_DROME  unnamed protein product                                 129     9e-30


>Q09603_CAEEL unnamed protein product
Length=385

 Score = 132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 82/254 (32%), Positives = 136/254 (54%), Gaps = 6/254 (2%)

Query  1296  INIRRHGNLVQLILTPSSSTKIRNALTLQVMQEFRETLSILKKDDDCRVVLLTSTGSSFC  1355
             +++ R G + ++ L   +  K  NALTL++ Q  ++ L +   D    + ++T+ GS +C
Sbjct  129   LSVTREGKVFKIAL---NRPKKFNALTLEMYQGIQKALEVSNNDKSTSITVITANGSYYC  185

Query  1356  EGLELSML---LHTNKEKRRIHAQEMADAVKDFIKSLASFNKPIVAGVQGAAVGLGVTML  1412
              G +L+         KE+    A      +KD++ +  +  KP++A + G AVG+ VT+L
Sbjct  186   AGNDLTNFKAAAGGTKEQIADMANTAKVIMKDYVNAYINHEKPLIALINGPAVGIAVTVL  245

Query  1413  PLFDLVIASDKATFSTPYGKLGQIAEGAAVFTLSHILGSAITSELLLGGRTLTASEALRA  1472
              +FD VIA+DKA+F TP+  LGQ  EG + +T   I+GS   SE+LL  + ++A  A   
Sbjct  246   GMFDYVIATDKASFHTPFAPLGQSPEGVSSYTFPLIMGSLRASEMLLVCKKISAQTAKDY  305

Query  1473  GLVTRVLWPDRFQVELLPTLKAMSEQSSQSMEATKTLLRHSLRKKLDAALESETYLLIQH  1532
             GLV  V+    FQ     T++A S+   +++   K LLR   ++KL      E   + + 
Sbjct  306   GLVNEVVPDAEFQSHAQKTVEAFSQLPPETLRINKKLLRSLHKEKLLEVNNIEADQICER  365

Query  1533  WCSVECQTAIKAYI  1546
             W S EC  AI A++
Sbjct  366   WQSKECHQAIAAFM  379


>Q9VPB0_DROME unnamed protein product
Length=926

 Score = 129 bits (323),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 71/225 (32%), Positives = 121/225 (54%), Gaps = 1/225 (0%)

Query  1324  QVMQEFRETLSILKKDDDCRVVLLTSTGSSFCEGLELSMLLHTNKEKRRIHAQEMADAVK  1383
             Q++++  +TLS + +  +   VLLT  G  FC+G++   L+  + EKR+  A ++A A+K
Sbjct  698   QLLEQLNDTLSSVARKGEFNTVLLTVEGPQFCQGIDCQELIQGSLEKRKDSASQLAVALK  757

Query  1384  DFIKSLASFNKPIVAGVQGAAVGLGVTMLPLFDLVIASDKATFSTPYGKLGQIAEGAAVF  1443
              ++++LA+F KP+VAG+ G+ + LGV  LP  D V+ASD  +F T Y KLGQ+ EG A++
Sbjct  758   CYLRTLATFPKPLVAGIVGSQINLGVMQLPFADYVVASDDCSFETNYAKLGQLPEGYALW  817

Query  1444  TLSHILGSAITSELLLGGRTLTASEALRA-GLVTRVLWPDRFQVELLPTLKAMSEQSSQS  1502
                  + S + S L L G  L A+E L +   V ++          L   K +S  S++ 
Sbjct  818   HGHQRVSSEVHSRLFLMGERLFATELLESNSFVDKICKARNVNEMALAKAKQISTSSAEM  877

Query  1503  MEATKTLLRHSLRKKLDAALESETYLLIQHWCSVECQTAIKAYID  1547
                 K L   ++       L+ E  ++ + W + +C    K Y++
Sbjct  878   YRTLKKLNHSAVNVTKFPRLDEELKVIGEQWVTADCLANFKRYLN  922


 Score = 36.2 bits (82),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 43/83 (52%), Gaps = 3/83 (4%)

Query  922   SITKQNIAVKKILRQNISSNKKTATLKSKLNTSKKSGSKIVSKTKRSTENNAGDSKPKKK  981
             + TK+ +A KK   ++ +   ++    + +  +++  S +  + +      A     KKK
Sbjct  427   TTTKKEVAPKK---RSATPTARSTKAGTPVGGTERGPSPVKRRAQTPNTGLANGGTQKKK  483

Query  982   IINEIDRLLQDEGVVNLLYDVEQ  1004
              ++EIDRL+ DEG  N+++ VE 
Sbjct  484   KVSEIDRLMGDEGAANMIHAVEH  506


>M9PG82_DROME unnamed protein product
Length=924

 Score = 129 bits (323),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 71/225 (32%), Positives = 121/225 (54%), Gaps = 1/225 (0%)

Query  1324  QVMQEFRETLSILKKDDDCRVVLLTSTGSSFCEGLELSMLLHTNKEKRRIHAQEMADAVK  1383
             Q++++  +TLS + +  +   VLLT  G  FC+G++   L+  + EKR+  A ++A A+K
Sbjct  696   QLLEQLNDTLSSVARKGEFNTVLLTVEGPQFCQGIDCQELIQGSLEKRKDSASQLAVALK  755

Query  1384  DFIKSLASFNKPIVAGVQGAAVGLGVTMLPLFDLVIASDKATFSTPYGKLGQIAEGAAVF  1443
              ++++LA+F KP+VAG+ G+ + LGV  LP  D V+ASD  +F T Y KLGQ+ EG A++
Sbjct  756   CYLRTLATFPKPLVAGIVGSQINLGVMQLPFADYVVASDDCSFETNYAKLGQLPEGYALW  815

Query  1444  TLSHILGSAITSELLLGGRTLTASEALRA-GLVTRVLWPDRFQVELLPTLKAMSEQSSQS  1502
                  + S + S L L G  L A+E L +   V ++          L   K +S  S++ 
Sbjct  816   HGHQRVSSEVHSRLFLMGERLFATELLESNSFVDKICKARNVNEMALAKAKQISTSSAEM  875

Query  1503  MEATKTLLRHSLRKKLDAALESETYLLIQHWCSVECQTAIKAYID  1547
                 K L   ++       L+ E  ++ + W + +C    K Y++
Sbjct  876   YRTLKKLNHSAVNVTKFPRLDEELKVIGEQWVTADCLANFKRYLN  920


 Score = 36.2 bits (82),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 43/83 (52%), Gaps = 3/83 (4%)

Query  922   SITKQNIAVKKILRQNISSNKKTATLKSKLNTSKKSGSKIVSKTKRSTENNAGDSKPKKK  981
             + TK+ +A KK   ++ +   ++    + +  +++  S +  + +      A     KKK
Sbjct  427   TTTKKEVAPKK---RSATPTARSTKAGTPVGGTERGPSPVKRRAQTPNTGLANGGTQKKK  483

Query  982   IINEIDRLLQDEGVVNLLYDVEQ  1004
              ++EIDRL+ DEG  N+++ VE 
Sbjct  484   KVSEIDRLMGDEGAANMIHAVEH  506



Lambda      K        H
   0.307    0.125    0.328 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 20462640800


Query= XP_050573072.1 uncharacterized protein LOC126913873 isoform X3
[Bombus affinis]

Length=1543
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q09603_CAEEL  unnamed protein product                                 132     1e-32
Q9VPB0_DROME  unnamed protein product                                 129     7e-30
M9PG82_DROME  unnamed protein product                                 129     8e-30


>Q09603_CAEEL unnamed protein product
Length=385

 Score = 132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 82/254 (32%), Positives = 136/254 (54%), Gaps = 6/254 (2%)

Query  1288  INIRRHGNLVQLILTPSSSTKIRNALTLQVMQEFRETLSILKKDDDCRVVLLTSTGSSFC  1347
             +++ R G + ++ L   +  K  NALTL++ Q  ++ L +   D    + ++T+ GS +C
Sbjct  129   LSVTREGKVFKIAL---NRPKKFNALTLEMYQGIQKALEVSNNDKSTSITVITANGSYYC  185

Query  1348  EGLELSML---LHTNKEKRRIHAQEMADAVKDFIKSLASFNKPIVAGVQGAAVGLGVTML  1404
              G +L+         KE+    A      +KD++ +  +  KP++A + G AVG+ VT+L
Sbjct  186   AGNDLTNFKAAAGGTKEQIADMANTAKVIMKDYVNAYINHEKPLIALINGPAVGIAVTVL  245

Query  1405  PLFDLVIASDKATFSTPYGKLGQIAEGAAVFTLSHILGSAITSELLLGGRTLTASEALRA  1464
              +FD VIA+DKA+F TP+  LGQ  EG + +T   I+GS   SE+LL  + ++A  A   
Sbjct  246   GMFDYVIATDKASFHTPFAPLGQSPEGVSSYTFPLIMGSLRASEMLLVCKKISAQTAKDY  305

Query  1465  GLVTRVLWPDRFQVELLPTLKAMSEQSSQSMEATKTLLRHSLRKKLDAALESETYLLIQH  1524
             GLV  V+    FQ     T++A S+   +++   K LLR   ++KL      E   + + 
Sbjct  306   GLVNEVVPDAEFQSHAQKTVEAFSQLPPETLRINKKLLRSLHKEKLLEVNNIEADQICER  365

Query  1525  WCSVECQTAIKAYI  1538
             W S EC  AI A++
Sbjct  366   WQSKECHQAIAAFM  379


>Q9VPB0_DROME unnamed protein product
Length=926

 Score = 129 bits (324),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 71/225 (32%), Positives = 121/225 (54%), Gaps = 1/225 (0%)

Query  1316  QVMQEFRETLSILKKDDDCRVVLLTSTGSSFCEGLELSMLLHTNKEKRRIHAQEMADAVK  1375
             Q++++  +TLS + +  +   VLLT  G  FC+G++   L+  + EKR+  A ++A A+K
Sbjct  698   QLLEQLNDTLSSVARKGEFNTVLLTVEGPQFCQGIDCQELIQGSLEKRKDSASQLAVALK  757

Query  1376  DFIKSLASFNKPIVAGVQGAAVGLGVTMLPLFDLVIASDKATFSTPYGKLGQIAEGAAVF  1435
              ++++LA+F KP+VAG+ G+ + LGV  LP  D V+ASD  +F T Y KLGQ+ EG A++
Sbjct  758   CYLRTLATFPKPLVAGIVGSQINLGVMQLPFADYVVASDDCSFETNYAKLGQLPEGYALW  817

Query  1436  TLSHILGSAITSELLLGGRTLTASEALRA-GLVTRVLWPDRFQVELLPTLKAMSEQSSQS  1494
                  + S + S L L G  L A+E L +   V ++          L   K +S  S++ 
Sbjct  818   HGHQRVSSEVHSRLFLMGERLFATELLESNSFVDKICKARNVNEMALAKAKQISTSSAEM  877

Query  1495  MEATKTLLRHSLRKKLDAALESETYLLIQHWCSVECQTAIKAYID  1539
                 K L   ++       L+ E  ++ + W + +C    K Y++
Sbjct  878   YRTLKKLNHSAVNVTKFPRLDEELKVIGEQWVTADCLANFKRYLN  922


 Score = 36.2 bits (82),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 43/83 (52%), Gaps = 3/83 (4%)

Query  922   SITKQNIAVKKILRQNISSNKKTATLKSKLNTSKKSGSKIVSKTKRSTENNAGDSKPKKK  981
             + TK+ +A KK   ++ +   ++    + +  +++  S +  + +      A     KKK
Sbjct  427   TTTKKEVAPKK---RSATPTARSTKAGTPVGGTERGPSPVKRRAQTPNTGLANGGTQKKK  483

Query  982   IINEIDRLLQDEGVVNLLYDVEQ  1004
              ++EIDRL+ DEG  N+++ VE 
Sbjct  484   KVSEIDRLMGDEGAANMIHAVEH  506


>M9PG82_DROME unnamed protein product
Length=924

 Score = 129 bits (323),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 71/225 (32%), Positives = 121/225 (54%), Gaps = 1/225 (0%)

Query  1316  QVMQEFRETLSILKKDDDCRVVLLTSTGSSFCEGLELSMLLHTNKEKRRIHAQEMADAVK  1375
             Q++++  +TLS + +  +   VLLT  G  FC+G++   L+  + EKR+  A ++A A+K
Sbjct  696   QLLEQLNDTLSSVARKGEFNTVLLTVEGPQFCQGIDCQELIQGSLEKRKDSASQLAVALK  755

Query  1376  DFIKSLASFNKPIVAGVQGAAVGLGVTMLPLFDLVIASDKATFSTPYGKLGQIAEGAAVF  1435
              ++++LA+F KP+VAG+ G+ + LGV  LP  D V+ASD  +F T Y KLGQ+ EG A++
Sbjct  756   CYLRTLATFPKPLVAGIVGSQINLGVMQLPFADYVVASDDCSFETNYAKLGQLPEGYALW  815

Query  1436  TLSHILGSAITSELLLGGRTLTASEALRA-GLVTRVLWPDRFQVELLPTLKAMSEQSSQS  1494
                  + S + S L L G  L A+E L +   V ++          L   K +S  S++ 
Sbjct  816   HGHQRVSSEVHSRLFLMGERLFATELLESNSFVDKICKARNVNEMALAKAKQISTSSAEM  875

Query  1495  MEATKTLLRHSLRKKLDAALESETYLLIQHWCSVECQTAIKAYID  1539
                 K L   ++       L+ E  ++ + W + +C    K Y++
Sbjct  876   YRTLKKLNHSAVNVTKFPRLDEELKVIGEQWVTADCLANFKRYLN  920


 Score = 36.2 bits (82),  Expect = 0.27, Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 43/83 (52%), Gaps = 3/83 (4%)

Query  922   SITKQNIAVKKILRQNISSNKKTATLKSKLNTSKKSGSKIVSKTKRSTENNAGDSKPKKK  981
             + TK+ +A KK   ++ +   ++    + +  +++  S +  + +      A     KKK
Sbjct  427   TTTKKEVAPKK---RSATPTARSTKAGTPVGGTERGPSPVKRRAQTPNTGLANGGTQKKK  483

Query  982   IINEIDRLLQDEGVVNLLYDVEQ  1004
              ++EIDRL+ DEG  N+++ VE 
Sbjct  484   KVSEIDRLMGDEGAANMIHAVEH  506



Lambda      K        H
   0.307    0.125    0.328 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 20462640800


Query= XP_050573073.1 protein virilizer [Bombus affinis]

Length=1490
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

VIR_DROME  unnamed protein product                                    266     6e-72
Q386T1_TRYB2  unnamed protein product                                 33.5    1.6  
MEL28_CAEEL  unnamed protein product                                  33.1    2.7  


>VIR_DROME unnamed protein product
Length=1854

 Score = 266 bits (681),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 263/880 (30%), Positives = 406/880 (46%), Gaps = 120/880 (14%)

Query  686   SNLCEFSAEIISATIRYSDRIEVFQNRAGIILEKSRTQ--------AVLKDVTSYLSTAA  737
             S +  ++ +++ A +RY ++++      G+ILE ++          AVL+++  Y+    
Sbjct  941   SPVLSYAVDMVDACVRYCEQLDYLIEHGGVILELAKNHETFEPSVSAVLQEMYVYMKPLE  1000

Query  738   QPSHWNYGDVSPLVACIRKNADKAASLPGQLITACRILYYLVFPSNNDVDPMEPYIE-LK  796
               + + Y D+ PLV  I ++ D   + PG LI A RIL YL            P  E LK
Sbjct  1001  AINVFVYDDIMPLVEVIGRSLDYLTTFPGDLIMAMRILRYLSISKPLAGQKAPPVTEELK  1060

Query  797   YRNALTQLFAADGLTALIAVMANISEFYEQPFLHRAALTGRRGLALVALLLPCVRLTRAL  856
             +R    QL+AADG+   I +M  +  ++EQP  H  AL   +G+    ++LP +++ R L
Sbjct  1061  HRFVALQLYAADGVQLCIQIMERLCAYFEQPGAHAPALMTIQGVHCCQIMLPTLQILREL  1120

Query  857   LERLVKCMATDFKDLTAVIPLLGVYSLVEAIPPIRI-----VQTLSEEIVGTLLVFTQAV  911
             L   + C    +KDLTA+  L+ VY L+    P R      V+    E+V TLL +TQ  
Sbjct  1121  LSYAILCRDGTYKDLTAIDHLVKVYYLLYYF-PTRCQAGPEVEQCKMEVVQTLLAYTQPN  1179

Query  912   DSDGSGNVAKSLWTQMLGEVLKMVSLSPCNFIPGLKLLTRLLPPVLTSK----QTMLTED  967
             + D   ++ KSLWT M+ EVLK V   P +FIPGLKLL  LLP  L         +  + 
Sbjct  1180  EQD-EESLHKSLWTLMIREVLKNVD-GPAHFIPGLKLLAELLPLPLPMPQPLCDQLQQQH  1237

Query  968   ATRVLGLRKLWSAHLQAQANNLTETLRLLCASWNKDLLILLSKVCKQLSDLAAPTALLVG  1027
               R++  RKLWSAHL  Q+  + + +  L  S    L  LL +VC QLSDLA    LL+ 
Sbjct  1238  KQRLITERKLWSAHLHPQSGQIAKLVEALAPSSFPQLSELLQRVCMQLSDLAPNMTLLIA  1297

Query  1028  RCLLD---------GVIAATPLESNVLILALLSELARHAPMKATLLTLTSPASRAQVKSD  1078
             + + +           I  T LE    +L   + L   AP+K+++L++ S          
Sbjct  1298  KTITELLCNEYQTSNCIPTTNLER---LLRFSTRLCAFAPLKSSMLSILS----------  1344

Query  1079  QKYPPVIEMMCTALKNTNDV--RMQYEILDIFETLCDCTLSLMQEDVNEPFEKRLTHSVP  1136
              K+  + + +  AL   NDV    Q  +  I ++  D  +SL+           L  ++P
Sbjct  1345  GKFWELFQSLL-ALNEFNDVVSNCQEAVHRILDSFLDSGISLISHKSTASPALNLAAALP  1403

Query  1137  SKEPLLSILAVLIDILATSTKFEPDILRSTLRILLSLISHNYGLYHVKSCLENNPDALRS  1196
              KE +  I+  +   L TS +    I    +R L+ L  H++  YH+   L+      ++
Sbjct  1404  PKELIPRIIDAVFSNL-TSVEVTHGISILAVRNLVILTEHDFTFYHLAQLLKQKITEFQA  1462

Query  1197  LLDHILVF-EDPEAQPVIDLTIMFLENLIA-------SESQGRSLYLRIQQLAALILWDK  1248
              ++ +++  E  E    I+  I+ L +L         S    R+L L   +LA L+ +  
Sbjct  1463  WMERVILHNETVEYNANIESLILLLRSLTQIEPPPAMSAMPHRTLKLGATELAQLVEFQD  1522

Query  1249  -----------------------NDHPLEKIKR-------AQELVEILKSAEDKE-EKEP  1277
                                    N+  L  +K+        QE++    +    E E E 
Sbjct  1523  IELAKPPVLSRILTVMEKHKAVANEAALSDLKQLILLQASKQEILAGTSTETPPEAEGEA  1582

Query  1278  IPE--------MLEPLLPTPEALLNQFSQRCLGTPDFASKRPKKFT---FMCPNQAPNEN  1326
              P          +EP LP  E ++ Q+  R + T   A+    + T   ++ P   P E 
Sbjct  1583  NPSASSCSASLTVEPYLPQAEGIVTQYEARPIFTRFCATAENAQLTARYWLDP--LPIEL  1640

Query  1327  TVDLLALAAELLPTDFNLLTEAQNLCSKTPPD-----DATQPLQSKAQTDDQENRDVQKQ  1381
               D+     E +  D   LT+  N+C    PD     D+ + +        Q NR++   
Sbjct  1641  IEDMNEPIYERIACD---LTDLANVCLN--PDLNVAGDSKRVMNLSGSP--QSNREMTP-  1692

Query  1382  TTSPVSKVKQPFVTPMRGRTQ---FTNSLRGAPVVGSVGRGADPFRSRPPNTSRPPSLHV  1438
              T+P  + ++  V P  GR +   F +S+RG           D FRSRPPNTSRPPSLHV
Sbjct  1693  -TAPCFRTRRVEVEPATGRPEKKMFVSSVRGRGFARPPPSRGDLFRSRPPNTSRPPSLHV  1751

Query  1439  DDFVALETCGAQPTGPTGYNKLS--IRGTCPSRAINTGTR  1476
             DDF+ALETCGAQPTGPTGYNK+   +RG+   R  N G+R
Sbjct  1752  DDFLALETCGAQPTGPTGYNKIPSMLRGSRVGR--NRGSR  1789


 Score = 204 bits (519),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 110/131 (84%), Gaps = 0/131 (0%)

Query  2    DNTELLFFDTFSHDISEELNLDLVQFPKPVYISEVRIIPLGARVQADFPGGVRLGATNPS  61
            D +ELLFFDTFSH+   ++NLDLVQFPKPV+I++VRIIPLGARVQADFPGGVRLGATNPS
Sbjct  6    DGSELLFFDTFSHEEVTDINLDLVQFPKPVFITQVRIIPLGARVQADFPGGVRLGATNPS  65

Query  62   QFEIEFFVNDLSKPGASTFESLGELEYKQNIHIQLECERKQIPTDGLVLRGWYTTITLAV  121
            +F++EFFVNDL  P AS FE+LG L Y QN  I L+C +++I TDGLVLRGWY+TITLA+
Sbjct  66   KFDLEFFVNDLGMPAASAFENLGLLRYNQNDCIHLDCSQEKIVTDGLVLRGWYSTITLAI  125

Query  122  YGTLTKSLNNP  132
            YG  T S+  P
Sbjct  126  YGIFTNSVTEP  136


 Score = 87.4 bits (215),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 91/306 (30%), Positives = 140/306 (46%), Gaps = 41/306 (13%)

Query  240  SPESISAEEEEAEQDGGEQETGEPFEPILSDEDIMADDIPPT---------VEYECENIQ  290
            S ES+   E + + +       E FEPILSD++I+ DD              E E E   
Sbjct  326  SSESLHRGERDRDDEDRSCTPQEQFEPILSDDEIIGDDEEDDAVDAAAIAEYERELEAAA  385

Query  291  LNNIYSITPPDLFE-LEESLNVVE---ECHINKEMLDKIHEIF----QSISKSVLHF---  339
                 +I   D FE  ++ L V E     H  KE+            Q+  ++V  F   
Sbjct  386  AAAPPAI---DAFEPWQKPLLVFEGDMAAHFCKELETLKLLFKKLVLQTRCENVNAFSEE  442

Query  340  NNASGQEKEAFVHNCESLCAILSPF--HLNNTDF-------ND------LTNIVNAGLDM  384
            + AS  E+E FV+  E L   L     H    +F       ND        N++   L  
Sbjct  443  HGASVDEREQFVYLGEQLNNQLGYLAQHYKRRNFVLQQFFGNDELHLRQAANVLQIALSF  502

Query  385  DLACAQPQPAYKVRHVKVGVRLAETLCKLPQGPDILLK---VDAPYKLLALCMRENVALP  441
              AC QPQPA+K+RH+K+G R+AE L    +    LLK    D    +  L     +AL 
Sbjct  503  QAACMQPQPAFKIRHIKLGARMAELLGSSEELFQHLLKEHKFDIFEAVFRLYHEPYMALS  562

Query  442  VKLSALRTLDAALISPIIVREFLISKSNLYKNALMMLDTAKLARLKYALSSLLRKVHTYE  501
            +KL  L+ + A L + + +  F+ +K+N Y+  +  + TAKL R KYAL ++++K+H +E
Sbjct  563  IKLQLLKAVYALLDTRMGIEHFMGAKNNGYQMIVEAIKTAKLTRTKYALQAIIKKLHLWE  622

Query  502  FLDEMK  507
             L+ ++
Sbjct  623  GLESVQ  628


>Q386T1_TRYB2 unnamed protein product
Length=862

 Score = 33.5 bits (75),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 28/113 (25%), Positives = 43/113 (38%), Gaps = 20/113 (18%)

Query  1321  QAPNENTVDLLALAAELLPTDFNLLTEAQNLCSKTPPDDATQPLQS--------------  1366
             Q   +  VD L +A++           A+ L S+ PP+ AT  L                
Sbjct  144   QQTRDGLVDKLKVASKAFQNATGYYEMAEGLLSRLPPELATGDLTHESLSLLKRICAAMT  203

Query  1367  ------KAQTDDQENRDVQKQTTSPVSKVKQPFVTPMRGRTQFTNSLRGAPVV  1413
                   KA+ D ++N  V  +      KV Q   T ++    +TNS RG+  V
Sbjct  204   HHCAYLKAEIDMKDNHSVLSKIAREGGKVYQIVATSLKESAWYTNSRRGSKAV  256


>MEL28_CAEEL unnamed protein product
Length=1784

 Score = 33.1 bits (74),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 38/88 (43%), Gaps = 15/88 (17%)

Query  1394  VTPMRGRTQFTNSLRGAPVVGSVGRGADP---FRSRPPNTSRPPSLHVDDFVALETCGAQ  1450
              TP RGR    ++  G+P VGS  RG  P   F ++     R  S  ++          Q
Sbjct  1629  TTPKRGRPAKKDA--GSPKVGSKARGTKPKSIFENQEDEEDRSSSPDIE----------Q  1676

Query  1451  PTGPTGYNKLSIRGTCPSRAINTGTRSR  1478
             P  PT  +K + R    S +I+  ++ +
Sbjct  1677  PATPTRSSKRTARSRANSESIDDDSKQK  1704



Lambda      K        H
   0.307    0.125    0.328 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 20462640800


Query= XP_050573074.1 protein virilizer [Bombus affinis]

Length=1490
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

VIR_DROME  unnamed protein product                                    266     6e-72
Q386T1_TRYB2  unnamed protein product                                 33.5    1.6  
MEL28_CAEEL  unnamed protein product                                  33.1    2.7  


>VIR_DROME unnamed protein product
Length=1854

 Score = 266 bits (681),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 263/880 (30%), Positives = 406/880 (46%), Gaps = 120/880 (14%)

Query  686   SNLCEFSAEIISATIRYSDRIEVFQNRAGIILEKSRTQ--------AVLKDVTSYLSTAA  737
             S +  ++ +++ A +RY ++++      G+ILE ++          AVL+++  Y+    
Sbjct  941   SPVLSYAVDMVDACVRYCEQLDYLIEHGGVILELAKNHETFEPSVSAVLQEMYVYMKPLE  1000

Query  738   QPSHWNYGDVSPLVACIRKNADKAASLPGQLITACRILYYLVFPSNNDVDPMEPYIE-LK  796
               + + Y D+ PLV  I ++ D   + PG LI A RIL YL            P  E LK
Sbjct  1001  AINVFVYDDIMPLVEVIGRSLDYLTTFPGDLIMAMRILRYLSISKPLAGQKAPPVTEELK  1060

Query  797   YRNALTQLFAADGLTALIAVMANISEFYEQPFLHRAALTGRRGLALVALLLPCVRLTRAL  856
             +R    QL+AADG+   I +M  +  ++EQP  H  AL   +G+    ++LP +++ R L
Sbjct  1061  HRFVALQLYAADGVQLCIQIMERLCAYFEQPGAHAPALMTIQGVHCCQIMLPTLQILREL  1120

Query  857   LERLVKCMATDFKDLTAVIPLLGVYSLVEAIPPIRI-----VQTLSEEIVGTLLVFTQAV  911
             L   + C    +KDLTA+  L+ VY L+    P R      V+    E+V TLL +TQ  
Sbjct  1121  LSYAILCRDGTYKDLTAIDHLVKVYYLLYYF-PTRCQAGPEVEQCKMEVVQTLLAYTQPN  1179

Query  912   DSDGSGNVAKSLWTQMLGEVLKMVSLSPCNFIPGLKLLTRLLPPVLTSK----QTMLTED  967
             + D   ++ KSLWT M+ EVLK V   P +FIPGLKLL  LLP  L         +  + 
Sbjct  1180  EQD-EESLHKSLWTLMIREVLKNVD-GPAHFIPGLKLLAELLPLPLPMPQPLCDQLQQQH  1237

Query  968   ATRVLGLRKLWSAHLQAQANNLTETLRLLCASWNKDLLILLSKVCKQLSDLAAPTALLVG  1027
               R++  RKLWSAHL  Q+  + + +  L  S    L  LL +VC QLSDLA    LL+ 
Sbjct  1238  KQRLITERKLWSAHLHPQSGQIAKLVEALAPSSFPQLSELLQRVCMQLSDLAPNMTLLIA  1297

Query  1028  RCLLD---------GVIAATPLESNVLILALLSELARHAPMKATLLTLTSPASRAQVKSD  1078
             + + +           I  T LE    +L   + L   AP+K+++L++ S          
Sbjct  1298  KTITELLCNEYQTSNCIPTTNLER---LLRFSTRLCAFAPLKSSMLSILS----------  1344

Query  1079  QKYPPVIEMMCTALKNTNDV--RMQYEILDIFETLCDCTLSLMQEDVNEPFEKRLTHSVP  1136
              K+  + + +  AL   NDV    Q  +  I ++  D  +SL+           L  ++P
Sbjct  1345  GKFWELFQSLL-ALNEFNDVVSNCQEAVHRILDSFLDSGISLISHKSTASPALNLAAALP  1403

Query  1137  SKEPLLSILAVLIDILATSTKFEPDILRSTLRILLSLISHNYGLYHVKSCLENNPDALRS  1196
              KE +  I+  +   L TS +    I    +R L+ L  H++  YH+   L+      ++
Sbjct  1404  PKELIPRIIDAVFSNL-TSVEVTHGISILAVRNLVILTEHDFTFYHLAQLLKQKITEFQA  1462

Query  1197  LLDHILVF-EDPEAQPVIDLTIMFLENLIA-------SESQGRSLYLRIQQLAALILWDK  1248
              ++ +++  E  E    I+  I+ L +L         S    R+L L   +LA L+ +  
Sbjct  1463  WMERVILHNETVEYNANIESLILLLRSLTQIEPPPAMSAMPHRTLKLGATELAQLVEFQD  1522

Query  1249  -----------------------NDHPLEKIKR-------AQELVEILKSAEDKE-EKEP  1277
                                    N+  L  +K+        QE++    +    E E E 
Sbjct  1523  IELAKPPVLSRILTVMEKHKAVANEAALSDLKQLILLQASKQEILAGTSTETPPEAEGEA  1582

Query  1278  IPE--------MLEPLLPTPEALLNQFSQRCLGTPDFASKRPKKFT---FMCPNQAPNEN  1326
              P          +EP LP  E ++ Q+  R + T   A+    + T   ++ P   P E 
Sbjct  1583  NPSASSCSASLTVEPYLPQAEGIVTQYEARPIFTRFCATAENAQLTARYWLDP--LPIEL  1640

Query  1327  TVDLLALAAELLPTDFNLLTEAQNLCSKTPPD-----DATQPLQSKAQTDDQENRDVQKQ  1381
               D+     E +  D   LT+  N+C    PD     D+ + +        Q NR++   
Sbjct  1641  IEDMNEPIYERIACD---LTDLANVCLN--PDLNVAGDSKRVMNLSGSP--QSNREMTP-  1692

Query  1382  TTSPVSKVKQPFVTPMRGRTQ---FTNSLRGAPVVGSVGRGADPFRSRPPNTSRPPSLHV  1438
              T+P  + ++  V P  GR +   F +S+RG           D FRSRPPNTSRPPSLHV
Sbjct  1693  -TAPCFRTRRVEVEPATGRPEKKMFVSSVRGRGFARPPPSRGDLFRSRPPNTSRPPSLHV  1751

Query  1439  DDFVALETCGAQPTGPTGYNKLS--IRGTCPSRAINTGTR  1476
             DDF+ALETCGAQPTGPTGYNK+   +RG+   R  N G+R
Sbjct  1752  DDFLALETCGAQPTGPTGYNKIPSMLRGSRVGR--NRGSR  1789


 Score = 204 bits (519),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 110/131 (84%), Gaps = 0/131 (0%)

Query  2    DNTELLFFDTFSHDISEELNLDLVQFPKPVYISEVRIIPLGARVQADFPGGVRLGATNPS  61
            D +ELLFFDTFSH+   ++NLDLVQFPKPV+I++VRIIPLGARVQADFPGGVRLGATNPS
Sbjct  6    DGSELLFFDTFSHEEVTDINLDLVQFPKPVFITQVRIIPLGARVQADFPGGVRLGATNPS  65

Query  62   QFEIEFFVNDLSKPGASTFESLGELEYKQNIHIQLECERKQIPTDGLVLRGWYTTITLAV  121
            +F++EFFVNDL  P AS FE+LG L Y QN  I L+C +++I TDGLVLRGWY+TITLA+
Sbjct  66   KFDLEFFVNDLGMPAASAFENLGLLRYNQNDCIHLDCSQEKIVTDGLVLRGWYSTITLAI  125

Query  122  YGTLTKSLNNP  132
            YG  T S+  P
Sbjct  126  YGIFTNSVTEP  136


 Score = 87.4 bits (215),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 91/306 (30%), Positives = 140/306 (46%), Gaps = 41/306 (13%)

Query  240  SPESISAEEEEAEQDGGEQETGEPFEPILSDEDIMADDIPPT---------VEYECENIQ  290
            S ES+   E + + +       E FEPILSD++I+ DD              E E E   
Sbjct  326  SSESLHRGERDRDDEDRSCTPQEQFEPILSDDEIIGDDEEDDAVDAAAIAEYERELEAAA  385

Query  291  LNNIYSITPPDLFE-LEESLNVVE---ECHINKEMLDKIHEIF----QSISKSVLHF---  339
                 +I   D FE  ++ L V E     H  KE+            Q+  ++V  F   
Sbjct  386  AAAPPAI---DAFEPWQKPLLVFEGDMAAHFCKELETLKLLFKKLVLQTRCENVNAFSEE  442

Query  340  NNASGQEKEAFVHNCESLCAILSPF--HLNNTDF-------ND------LTNIVNAGLDM  384
            + AS  E+E FV+  E L   L     H    +F       ND        N++   L  
Sbjct  443  HGASVDEREQFVYLGEQLNNQLGYLAQHYKRRNFVLQQFFGNDELHLRQAANVLQIALSF  502

Query  385  DLACAQPQPAYKVRHVKVGVRLAETLCKLPQGPDILLK---VDAPYKLLALCMRENVALP  441
              AC QPQPA+K+RH+K+G R+AE L    +    LLK    D    +  L     +AL 
Sbjct  503  QAACMQPQPAFKIRHIKLGARMAELLGSSEELFQHLLKEHKFDIFEAVFRLYHEPYMALS  562

Query  442  VKLSALRTLDAALISPIIVREFLISKSNLYKNALMMLDTAKLARLKYALSSLLRKVHTYE  501
            +KL  L+ + A L + + +  F+ +K+N Y+  +  + TAKL R KYAL ++++K+H +E
Sbjct  563  IKLQLLKAVYALLDTRMGIEHFMGAKNNGYQMIVEAIKTAKLTRTKYALQAIIKKLHLWE  622

Query  502  FLDEMK  507
             L+ ++
Sbjct  623  GLESVQ  628


>Q386T1_TRYB2 unnamed protein product
Length=862

 Score = 33.5 bits (75),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 28/113 (25%), Positives = 43/113 (38%), Gaps = 20/113 (18%)

Query  1321  QAPNENTVDLLALAAELLPTDFNLLTEAQNLCSKTPPDDATQPLQS--------------  1366
             Q   +  VD L +A++           A+ L S+ PP+ AT  L                
Sbjct  144   QQTRDGLVDKLKVASKAFQNATGYYEMAEGLLSRLPPELATGDLTHESLSLLKRICAAMT  203

Query  1367  ------KAQTDDQENRDVQKQTTSPVSKVKQPFVTPMRGRTQFTNSLRGAPVV  1413
                   KA+ D ++N  V  +      KV Q   T ++    +TNS RG+  V
Sbjct  204   HHCAYLKAEIDMKDNHSVLSKIAREGGKVYQIVATSLKESAWYTNSRRGSKAV  256


>MEL28_CAEEL unnamed protein product
Length=1784

 Score = 33.1 bits (74),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 38/88 (43%), Gaps = 15/88 (17%)

Query  1394  VTPMRGRTQFTNSLRGAPVVGSVGRGADP---FRSRPPNTSRPPSLHVDDFVALETCGAQ  1450
              TP RGR    ++  G+P VGS  RG  P   F ++     R  S  ++          Q
Sbjct  1629  TTPKRGRPAKKDA--GSPKVGSKARGTKPKSIFENQEDEEDRSSSPDIE----------Q  1676

Query  1451  PTGPTGYNKLSIRGTCPSRAINTGTRSR  1478
             P  PT  +K + R    S +I+  ++ +
Sbjct  1677  PATPTRSSKRTARSRANSESIDDDSKQK  1704



Lambda      K        H
   0.307    0.125    0.328 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 20462640800


Query= XP_050573075.1 toll-like receptor Tollo [Bombus affinis]

Length=1309
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TOLL8_DROME  unnamed protein product                                  949     0.0  
TOLL6_DROME  unnamed protein product                                  914     0.0  
TOLL7_DROME  unnamed protein product                                  873     0.0  


>TOLL8_DROME unnamed protein product
Length=1346

 Score = 949 bits (2454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 509/1200 (42%), Positives = 734/1200 (61%), Gaps = 61/1200 (5%)

Query  33    EAPTGCEWKKDGEDGEKALACRVRTIANVPSLIGNLSAIQVDSISSLALECSDVLFFESQ  92
             +AP  C W   GE  +  L C +RTI N      N S IQ  +   L LEC+D LFF+S 
Sbjct  31    QAPDECRWSGGGEH-DITLVCHLRTI-NSELENTNFSVIQPQNTVRLRLECNDALFFQSS  88

Query  93    IDGPHGFFSPLPRLEKLRVDYCKIRYLPGGVFASAHNLRTLSVRTHNGDWSAMTLELHRD  152
             +  P  F S L  L  L ++YCK+  L  G F     LR L++RTHNGDWS M+LE+  +
Sbjct  89    L-SPDSFRS-LVELRDLTIEYCKLGNLTDGSFRGLQELRNLTIRTHNGDWSTMSLEMASN  146

Query  153   SLRSLTYLQHLDLADNNLWTLPSELLCPVQSLATLNLTRNKLQDIVSLGFSDLVES----  208
             S      L+ LDL+ NN+W +P  ++CP++SL  LN + NK+QDI +  FS  + S    
Sbjct  147   SFVEFRQLERLDLSLNNIWLIPDGMVCPLKSLQHLNASYNKIQDISNFYFSASLSSRKAR  206

Query  209   -CTPSLEVLDLSNNDLSTLHDRALSNLRSLTVLKLQENVITAVGDHALAGLTALHSLNMS  267
              C  +L+ LDLS N + +L    LS L  LT L + +N ++ + D A  GL +L  +++S
Sbjct  207   VCGSTLQSLDLSANKMVSLPTAMLSALGRLTHLNMAKNSMSFLADRAFEGLLSLRVVDLS  266

Query  268   SNRLVALPPELFSRTKELRELILSNNSLAVLAPGLLDNLDELQILDLNSNELTNRWVNRD  327
             +NRL +LPPELF+ TK+L+E+ L NNS+ VLAPG+   L EL +LDL SNEL ++W+N  
Sbjct  267   ANRLTSLPPELFAETKQLQEIYLRNNSINVLAPGIFGELAELLVLDLASNELNSQWINAA  326

Query  328   TFSRLVRLVILDLSFNALTRIDAHVFKGLYSLQILKLEHNNIETLVDGCFGSLTNLHSLT  387
             TF  L RL++LDLS N ++R++AH+F+ L SLQILKLE N I+ L  G F  LTNLH+L 
Sbjct  327   TFVGLKRLMMLDLSANKISRLEAHIFRPLASLQILKLEDNYIDQLPGGIFADLTNLHTLI  386

Query  388   LSHNRIARFDPAHTIGLTTLNQLFLDTNKLKTLHRHVFDNLTGLQDLSLRANYLTEIPYA  447
             LS NRI+  +     GL  L  L LD N++  + +    N + LQDL L  N L  +P A
Sbjct  387   LSRNRISVIEQRTLQGLKNLLVLSLDFNRISRMDQRSLVNCSQLQDLHLNDNKLQAVPEA  446

Query  448   VRVLRSLKTLDLGKNHVSRIDNDSFDGLSELYGLRLVDNKLENVSREAFAALPALQVLNL  507
             +  ++ LKTLD+G+N +S+I+N S   L  LYGLR+ +N L ++ R  F  + +LQ+LNL
Sbjct  447   LAHVQLLKTLDVGENMISQIENTSITQLESLYGLRMTENSLTHIRRGVFDRMSSLQILNL  506

Query  508   ANNYIRHVEQSAFANNPVLRAIRLDGNQLTEIRGAFTSLTTLVWLNVSDNKLLWFDYSHL  567
             + N ++ +E  +   N  L+AIRLDGNQL  I G FT L  LVWLN+S N+L  FDYSH+
Sbjct  507   SQNKLKSIEAGSLQRNSQLQAIRLDGNQLKSIAGLFTELPNLVWLNISGNRLEKFDYSHI  566

Query  568   PSSIEWLDIHANQISELGNYYAVRNTLRIKLLDASYNQIVEIADANVPDSVETLVLNNNK  627
             P  ++WLD+ AN+I++LGNY+ + + L +   DASYN + EI  +++P+SVE L LN+N+
Sbjct  567   PIGLQWLDVRANRITQLGNYFEIESELSLSTFDASYNLLTEITASSIPNSVEVLYLNDNQ  626

Query  628   IRAIVPGTFLQKRSLQKVVLYENEIRSLDVASIALQTVPEDEELPQFYIGNNPILCNCSM  687
             I  I P TF +K +L +V L  N + +L+  ++ L  + ED E+P+FYIG+N   C+C++
Sbjct  627   ISKIQPYTFFKKPNLTRVDLVRNRLTTLEPNALRLSPIAEDREIPEFYIGHNAYECDCNL  686

Query  688   EWLPRINEMARLRQHPRVMDLDSVTCEMVHARATPRRPLLSLKPKDFLCQYVAHCFALCH  747
             +WL ++N  +R +  P++MDLD + C + +AR +    L+  K  DFLC+Y +HCFALCH
Sbjct  687   DWLQKVNRESRTQ--PQLMDLDQIHCRLAYARGSSHVSLIEAKSDDFLCKYASHCFALCH  744

Query  748   CCDFDACDCEMTCPDNCSCYHDHSWSSNVVDCSNAGYKH-VPERIPMDATEIYLDGNELG  806
             CCDF ACDC+M CPD CSCYHD SW+SNVVDCS A Y+  +P  IPMD+T++YLDGN   
Sbjct  745   CCDFQACDCKMECPDRCSCYHDQSWTSNVVDCSRASYEQTLPSHIPMDSTQLYLDGNNFR  804

Query  807   DLGSHVFIGKRRLEVLFLNNSGISAIHNFTFNGVGALRVLHLEDNALRELRGFEFDQLER  866
             +L SH FIG++RL+VL LN+S I  +HN TF G+  L VL L+ N L+ L G EF  L+ 
Sbjct  805   ELQSHAFIGRKRLKVLHLNHSRIEVLHNRTFYGLLELEVLQLQSNQLKALNGNEFQGLDN  864

Query  867   MSELYLDHNAIATVGNTTFKKMKNLEVLRLDSNRIVNFRPWEALPSVGDSTRVALEGNAW  926
             + ELYL HNAIAT+   TF  + +L++LRLD N I +F  W  LPS  +  R+A   N W
Sbjct  865   LQELYLQHNAIATIDTLTFTHLYHLKILRLDHNAITSFAVWNFLPSYLNELRLA--SNPW  922

Query  927   SCECGSAAKLRGWLAEHRG--DPEKMYCRDGAETLAQAM---KRCGDPSTEAVSRGIQEI  981
             +C C    KLR ++  H    D  KM C   +    Q M      G+P++  V +  Q +
Sbjct  923   TCSCEFIDKLRDYINRHEYVVDKLKMKCDVISGNSTQQMVIYPGSGEPASLPVVQCSQTL  982

Query  982   PL-----------LGG-------------------NFVPLLAGALVVVIAICLFVALAFA  1011
             PL            GG                   +++P+L   L   I + + ++L F 
Sbjct  983   PLGLDNNFNYAEQAGGENASNATSTKMILNQPPKLDYIPILVAILTAFIFVMICISLVFI  1042

Query  1012  FRQDVRLWAHARYGLRL--GKMTTPPDEERDRLYDGYIVYSERDEDFVSRFLAAELE--Q  1067
             FRQ++R+W H+R+G+RL           ER++L+D ++ YS +DE FV+  LA  LE  +
Sbjct  1043  FRQEMRVWCHSRFGVRLFYNAQKDVDKNEREKLFDAFVSYSSKDELFVNEELAPMLEMGE  1102

Query  1068  SGLALCLHWRDLP-PARPQEAVPPAAAAARRVVIIFSPVFLANEWQHTEFRAALRTALEN  1126
                 LCLH RD P      E +  A  ++RR +++ S  F+ +EW   EF++A ++ L +
Sbjct  1103  HRYKLCLHQRDFPVGGYLPETIVQAIDSSRRTIMVVSENFIKSEWCRFEFKSAHQSVLRD  1162

Query  1127  IRPSSRKRRVVILLATEAPAR--DPEFQLLLQTCTVVMWGEKRFWEKLRFAMPDSMGKRR  1184
                  R+RR+++++  E P +  DP+ +L L+T T + WG+K FW+KLRFA+PD    +R
Sbjct  1163  -----RRRRLIVIVLGEVPQKELDPDLRLYLKTNTYLQWGDKLFWQKLRFALPDVSSSQR  1217


>TOLL6_DROME unnamed protein product
Length=1514

 Score = 914 bits (2362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 474/1195 (40%), Positives = 727/1195 (61%), Gaps = 51/1195 (4%)

Query  33    EAPTGCEWKKDG--EDGEKALACRVRTIANVPSLIGNLSAIQVDSISSLALECSDVLFFE  90
             +AP  C +      +  E AL C +RT+ N      N S I  +   +L + C+D +  +
Sbjct  76    DAPDDCHFMPAAGLDQPEIALTCNLRTV-NSEFDTTNFSVIPAEHTIALHILCNDEIMAK  134

Query  91    SQIDGPHGFFSPLPRLEKLRVDYCKIRYLPGGVFASAHNLRTLSVRTHNGDWSAMTLELH  150
             S+++     F+ L RL++L + YCK+  L   V      LR L++RTHN  W A+  E+ 
Sbjct  135   SRLEAQS--FAHLVRLQQLSIQYCKLGRLGRQVLDGLEQLRNLTLRTHNILWPALNFEIE  192

Query  151   RDSLRSLTYLQHLDLADNNLWTLPSELLCPVQSLATLNLTRNKLQDIVSLGFSDLVESCT  210
              D+      L+ LDL+ NN+W+LP  + C +  L+ LN++ N+LQD+  LGF D  +  T
Sbjct  193   ADAFSVTRRLERLDLSSNNIWSLPDNIFCTLSELSALNMSENRLQDVNELGFRDRSKEPT  252

Query  211   PS------------------------LEVLDLSNNDLSTLHDRALSNLRSLTVLKLQENV  246
                                       LE LD+S+ND   L       LR L VL +  N 
Sbjct  253   NGSTESTSTTESAKKSSSSSTSCSLDLEYLDVSHNDFVVLPANGFGTLRRLRVLSVNNNG  312

Query  247   ITAVGDHALAGLTALHSLNMSSNRLVALPPELFS-RTKELRELILSNNSLAVLAPGLLDN  305
             I+ + D AL+GL  L  LN+SSN++VALP ELF+ + K ++E+ L NNS++VL P L  N
Sbjct  313   ISMIADKALSGLKNLQILNLSSNKIVALPTELFAEQAKIIQEVYLQNNSISVLNPQLFSN  372

Query  306   LDELQILDLNSNELTNRWVNRDTFSRLVRLVILDLSFNALTRIDAHVFKGLYSLQILKLE  365
             LD+LQ LDL+ N++T+ W++++TF  L+RLV+L+LS N LT+++  +F  LY+LQIL L 
Sbjct  373   LDQLQALDLSMNQITSTWIDKNTFVGLIRLVLLNLSHNKLTKLEPEIFSDLYTLQILNLR  432

Query  366   HNNIETLVDGCFGSLTNLHSLTLSHNRIARFDPAHTIGLTTLNQLFLDTNKLKTLHRHVF  425
             HN +E +    F  + NLH+L LSHN++   D     GL  L+ L LD N L  +H   F
Sbjct  433   HNQLENIAADTFAPMNNLHTLLLSHNKLKYLDAYALNGLYVLSLLSLDNNALIGVHPDAF  492

Query  426   DNLTGLQDLSLRANYLTEIPYAVRVLRSLKTLDLGKNHVSRIDNDSFDGLSELYGLRLVD  485
              N + LQDL+L  N L  +P A+R +R L+T+DLG+N ++ +++ +F GL  LYGLRL+ 
Sbjct  493   RNCSALQDLNLNGNQLKTVPLALRNMRHLRTVDLGENMITVMEDSAFKGLGNLYGLRLIG  552

Query  486   NKLENVSREAFAALPALQVLNLANNYIRHVEQSAFANNPVLRAIRLDGNQLTEIRGAFTS  545
             N LEN++   F  LP LQ+LNLA N I  VE  AF     ++A+RLDGN+L +I G F++
Sbjct  553   NYLENITMHTFRDLPNLQILNLARNRIAVVEPGAFEMTSSIQAVRLDGNELNDINGLFSN  612

Query  546   LTTLVWLNVSDNKLLWFDYSHLPSSIEWLDIHANQISELGNYYAVRNTLRIKLLDASYNQ  605
             + +L+WLN+SDN+L  FDY H+PS+++WLD+H N++S L N + + + L+++ LD S+NQ
Sbjct  613   MPSLLWLNISDNRLESFDYGHVPSTLQWLDLHKNRLSSLSNRFGLDSELKLQTLDVSFNQ  672

Query  606   IVEIADANVPDSVETLVLNNNKIRAIVPGTFLQKRSLQKVVLYENEIRSLDVASIALQTV  665
             +  I  +++P+S+E L LN+N I  + P TF+ K +L +V LY N+I +LD+ S+ +  V
Sbjct  673   LQRIGPSSIPNSIELLFLNDNLITTVDPDTFMHKTNLTRVDLYANQITTLDIKSLRILPV  732

Query  666   PEDEELPQFYIGNNPILCNCSMEWLPRINEMARLRQHPRVMDLDSVTCEMVHARATPRRP  725
              E   LP+FYIG NP  C+C+++WL +IN +   RQ+PR+MDL+++ C++++ R     P
Sbjct  733   WEHRALPEFYIGGNPFTCDCNIDWLQKINHITS-RQYPRIMDLETIYCKLLNNRERAYIP  791

Query  726   LLSLKPKDFLCQYVAHCFALCHCCDFDACDCEMTCPDNCSCYHDHSWSSNVVDCSNAGYK  785
             L+  +PK FLC Y  HCFA+CHCC+FDACDCEMTCP NC+C+HD +WS+N+V+CS A Y 
Sbjct  792   LIEAEPKHFLCTYKTHCFAVCHCCEFDACDCEMTCPTNCTCFHDQTWSTNIVECSGAAYS  851

Query  786   HVPERIPMDATEIYLDGNELGDLGSHVFIGKRRLEVLFLNNSGISAIHNFTFNGVGALRV  845
              +P R+PMD +E+Y+DGN   +L  H F+G++ L VL+ NNS ++ I+N TF+G+  L +
Sbjct  852   EMPRRVPMDTSELYIDGNNFVELAGHSFLGRKNLAVLYANNSNVAHIYNTTFSGLKRLLI  911

Query  846   LHLEDNALRELRGFEFDQLERMSELYLDHNAIATVGNTTFKKMKNLEVLRLDSNRIVNFR  905
             LHLEDN +  L G EF  LE + ELYL  N IA++ N +F+ ++ LEVLRLD NR+++F 
Sbjct  912   LHLEDNHIISLEGNEFHNLENLRELYLQSNKIASIANGSFQMLRKLEVLRLDGNRLMHFE  971

Query  906   PWEALPSVGDSTRVALEGNAWSCECGSAAKLRGWL---AEHRGDPEKMYC-RDGAETLAQ  961
              W+ L +      ++L  N WSCECG  A+ R +L   +E   D  ++ C  + A ++ +
Sbjct  972   VWQ-LSANPYLVEISLADNQWSCECGYLARFRNYLGQSSEKIIDASRVSCIYNNATSVLR  1030

Query  962   AMKRCGDPSTEAVSRGIQEIPLLGGNFVPLLAGALVVVIAICLFVALAFAFRQDVRLWAH  1021
                       + V+  +    + G   +PLL  A    +A    +   F +R ++++WAH
Sbjct  1031  EKNGTKCTLRDGVAHYMHTNEIEG--LLPLLLVATCAFVAFFGLIFGLFCYRHELKIWAH  1088

Query  1022  ARYGLRLGKMTTP---PDEERDRLYDGYIVYSERDEDFVSRFLAAELEQS-GLALCLHWR  1077
             +   L      +P      +++R  D Y  YS +DE FV++ LA  LE   G  LCLH+R
Sbjct  1089  STNCLMNFCYKSPRFVDQLDKERPNDAYFAYSLQDEHFVNQILAQTLENDIGYRLCLHYR  1148

Query  1078  DLP-PARPQEAVPPAAAAARRVVIIFSPVFLANEWQHTEFRAALRTALENIRPSSRKRRV  1136
             D+   A   +A+  AA +A++ V++ S  FL NEW   E+++AL   ++      R++RV
Sbjct  1149  DVNINAYITDALIEAAESAKQFVLVLSKNFLYNEWSRFEYKSALHELVK------RRKRV  1202

Query  1137  VILLATEAPARDPEFQL--LLQTCTVVMWGEKRFWEKLRFAMPDSMGKRRDSKKV  1189
             V +L  + P RD +  +   L+T T + W +K+FW+KLR A+P   G+  ++K+V
Sbjct  1203  VFILYGDLPQRDIDMDMRHYLRTSTCIEWDDKKFWQKLRLALPLPNGRGNNNKRV  1257


>TOLL7_DROME unnamed protein product
Length=1446

 Score = 873 bits (2256),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 511/1316 (39%), Positives = 744/1316 (57%), Gaps = 98/1316 (7%)

Query  35    PTG----CEWKKDGEDGEKALACRVRTIANVPSLIGNLSAIQVDSISSLALECSDVLFFE  90
             P+G    C W  +G     ++ C +R I   P L  +L     D  S L ++CS++  FE
Sbjct  70    PSGPANQCSWSYNGT---SSVHCALRLIERQPGL--DLQG--ADGSSQLTIQCSELYLFE  122

Query  91    SQIDGPHGFFSPLPRLEKLRVDYCKIRYLPGGVFASAHNLRTLSVRTHNGDWSAM-TLEL  149
             S +  P   F+ L  LE LR+D CK+  LP   F     L++L + THN +W    TLEL
Sbjct  123   STL--PVAVFARLQTLEALRLDSCKLLQLPNNAFEGLATLKSLRLSTHNSEWGPTRTLEL  180

Query  150   HRDSLRSLTYLQHLDLADNNLWTLPSELLCPVQSLATLNLTRNKLQDIVSLGFSDL----  205
               DSL  L  L  LDL DNNL  LPS  LCPV +L  LNLTRN+++    +GF+D+    
Sbjct  181   FPDSLGGLKQLTDLDLGDNNLRQLPSGFLCPVGNLQVLNLTRNRIRTAEQMGFADMNCGA  240

Query  206   -VESCTPSLEVLDLSNNDLSTLHDR-ALSNLRSLTVLKLQENVITAVGDHALAGLTALHS  263
                S    L+VLD S+N+L ++ +   +S LR L  L L  N ++ +   ALAGL +L  
Sbjct  241   GSGSAGSELQVLDASHNELRSISESWGISRLRRLQHLNLAYNNLSELSGEALAGLASLRI  300

Query  264   LNMSSNRLVALPPELFSRTKELRELILSNNSLAVLAPGLLDNLDELQILDLNSNELTNRW  323
             +N+S+N L  LP  LF+ +KELRE+ L  N L  L  GL   L++L ++DL+ N+LT+  
Sbjct  301   VNLSNNHLETLPEGLFAGSKELREIHLQQNELYELPKGLFHRLEQLLVVDLSGNQLTSNH  360

Query  324   VNRDTFSRLVRLVILDLSFNALTRIDAHVFKGLYSLQILKLEHNNIETLVDGCFGSLTNL  383
             V+  TF+ L+RL++L+L+ NALTRID   FK LY LQIL L +N+I  + D  F  L NL
Sbjct  361   VDNTTFAGLIRLIVLNLAHNALTRIDYRTFKELYFLQILNLRNNSIGHIEDNAFLPLYNL  420

Query  384   HSLTLSHNRIARFDPAHTIGLTTLNQLFLDTNKLKTLHRHVFDNLTGLQDLSLRANYLTE  443
             H+L L+ NR+   D     GL  L++L L+ N +  +   VF N + L++L L +N L E
Sbjct  421   HTLNLAENRLHTLDDKLFNGLYVLSKLTLNNNLISVVEPAVFKNCSDLKELDLSSNQLNE  480

Query  444   IPYAVRVLRSLKTLDLGKNHVSRIDNDSFDGLSELYGLRLVDNKLENVSREAFAALPALQ  503
             +P A++ L  L+TLDLG+N +   DN SF  L +L GLRL+DN++ N++   F  LP L 
Sbjct  481   VPRALQDLAMLRTLDLGENQIRTFDNQSFKNLHQLTGLRLIDNQIGNITVGMFQDLPRLS  540

Query  504   VLNLANNYIRHVEQSAFANNPVLRAIRLDGNQLTEIRGAFTSLTTLVWLNVSDNKLLWFD  563
             VLNLA N I+ +E+ +F  N  L AIRLD N L +I G F +L +L+WLN+S+N L+WFD
Sbjct  541   VLNLAKNRIQSIERGSFDKNFELEAIRLDRNFLADINGVFATLVSLLWLNLSENHLVWFD  600

Query  564   YSHLPSSIEWLDIHANQISELGNYYAVRNTLRIKLLDASYNQIVEIADANVPDSVETLVL  623
             Y+ +PS+++WLDIH N I  LGNYY ++  +R+K LDAS+N+I EI   ++P+++E L +
Sbjct  601   YAFIPSNLKWLDIHGNYIEALGNYYKLQEEIRVKTLDASHNRITEIGPMSIPNTIELLFI  660

Query  624   NNNKIRAIVPGTFLQKRSLQKVVLYENEIRSLDVASIALQTVPEDEELPQFYIGNNPILC  683
             NNN I  + P  F+ K +L +V LY N++  L +  + +  V   + LP+FY+G NP  C
Sbjct  661   NNNLIGNVQPNAFVDKANLARVDLYANQLSKLQLQQLRVAPVVAPKPLPEFYLGGNPFEC  720

Query  684   NCSMEWLPRINEMARLRQHPRVMDLDSVTCEMVHARATPRRPLLSLKPKDFLCQYVAHCF  743
             +C+M+WL RIN +   RQHPRVMD+ ++ C M HAR    RPL  L+P+DFLC+Y +HCF
Sbjct  721   DCTMDWLQRINNLTT-RQHPRVMDMANIECVMPHARGAAVRPLSGLRPQDFLCRYESHCF  779

Query  744   ALCHCCDFDACDCEMTCPDNCSCYHDHSWSSNVVDCSNAGYKHVPERIPMDATEIYLDGN  803
             ALCHCCDFDACDCEMTCP NC+CYHD  WS+NVVDC       +P R+PMD++ +YLDGN
Sbjct  780   ALCHCCDFDACDCEMTCPSNCTCYHDQIWSTNVVDCGGQQTTELPRRVPMDSSVVYLDGN  839

Query  804   ELGDLGSHVFIGKRRLEVLFLNNSGISAIHNFTFNGVGALRVLHLEDNALRELRGFEFDQ  863
                 L +H FIG++ L  L++N S ++AI N TF  + +L++LHL DN LR L G+EF+Q
Sbjct  840   NFPVLKNHAFIGRKNLRALYVNGSQVAAIQNRTFASLASLQLLHLADNKLRTLHGYEFEQ  899

Query  864   LERMSELYLDHNAIATVGNTTFKKMKNLEVLRLDSNRIVNFRPWEALPSVGDSTR---VA  920
             L  + ELYL +N + T+ N T   +  LE++R+D NR+V    W+ + +    TR   ++
Sbjct  900   LSALRELYLQNNQLTTIENATLAPLAALELIRIDGNRLVTLPIWQ-MHATHFGTRLKSIS  958

Query  921   LEGNAWSCECGSAAKLRGWLAEHR---GDPEKMYCRDGAETLAQAMKRCGDPSTEAVSRG  977
             L  N WSC C     L  ++A++     D + +YC   +     A       ++ ++ + 
Sbjct  959   LGRNQWSCRCQFLQALTSYVADNALIVQDAQDIYCMAASSGTGSAALEDSSSNSGSLEKR  1018

Query  978   IQEIPLLGGNFVPLLAGALVVVIAI-----------------CLFVALAFAFRQDVRLWA  1020
               +    G       +G  ++   I                  + +A+ FAFR+ +R+W 
Sbjct  1019  ELDFNATGAACTDYYSGGSMLQHGIPESYIPLLAAALALLFLLVVIAMVFAFRESLRIWL  1078

Query  1021  HARYGLRLGKMTTPPDEERDRLYDGYIVYSERDEDFVSRFLAAELE--QSGLALCLHWRD  1078
              A YG+R   +  P  EE ++LYD  +++S +D +FV + LAA+LE  +  L +CL  RD
Sbjct  1079  FAHYGVR---VFGPRCEESEKLYDAVLLHSAKDSEFVCQHLAAQLETGRPPLRVCLQHRD  1135

Query  1079  LPPARPQEAVPPAAAAARRVVIIFSPVFLANEWQHTEFRAALRTALENIRPSSRKRRVVI  1138
             L        +  A   +RRVVI+ +  FL  EW   E R ++  AL       R +++VI
Sbjct  1136  LAHDATHYQLLEATRVSRRVVILLTRNFLQTEWARCELRRSVHDALR-----GRPQKLVI  1190

Query  1139  L----LATEAPARDPEFQLLLQTCTV--VMWGEKRFWEKLRFAMPDSMGKRRDSKKV---  1189
             +    +A EA + D E    L+T  V  +   ++ FWEKLR+A+P      R +      
Sbjct  1191  IEEPEVAFEAES-DIELLPYLKTSAVHRIRRSDRHFWEKLRYALPVDYPTFRGNNYTLEL  1249

Query  1190  ----NDRNRKPAR----YTAAPSAGDVWTKPNGVL-------VAPVHAPTP------TPT  1228
                 ++R ++PA     Y  AP     +  P   +       V PV+A  P      T T
Sbjct  1250  DHHNHERVKQPASPGLLYRQAPPPA--YCGPADAVGIGAVPQVVPVNASVPAEQNYSTAT  1307

Query  1229  QSTYVSSASSRTEDEDSGAEHQHQHQHQHGGYSALHTGNARPASLSSRGSHLYSTI  1284
              +T       R E   SG+   H   H H  Y   H    RP S      H+YS+I
Sbjct  1308  TATPSPRPQRRGEQPGSGSGGNH---HLHAQYYQHH--GMRPPS-----EHIYSSI  1353



Lambda      K        H
   0.307    0.125    0.328 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 20462640800


Query= XP_050573076.1 glucose transporter type 1 isoform X11 [Bombus
affinis]

Length=833
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GTR1_DROME  unnamed protein product                                   862     0.0   
FGT1_CAEEL  unnamed protein product                                   375     3e-121
Q7KJP2_DROME  unnamed protein product                                 201     2e-56 


>GTR1_DROME unnamed protein product
Length=1440

 Score = 862 bits (2228),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/483 (88%), Positives = 451/483 (93%), Gaps = 7/483 (1%)

Query  339  LLEQGLTLFLSYAILAAVLGMLQFGYNTGVINAPEVNIENFMKDVYKDRYGEDISDDSVK  398
            L   GLT FL+Y+I +AVLGMLQFGYNTGVINAPE NIENFMKDVYKDRYGEDIS++ ++
Sbjct  4    LCAPGLTFFLTYSIFSAVLGMLQFGYNTGVINAPEKNIENFMKDVYKDRYGEDISEEFIQ  63

Query  399  KLYSVAVSIFAIGGMLGGFSGGIIANRFGRKGGLLLNNVLGIVGACLMGCTKIAHSYEML  458
            +LYSVAVSIFAIGGMLGGFSGG +ANRFGRKGGLLLNNVLGI GACLMG TK++HSYEML
Sbjct  64   QLYSVAVSIFAIGGMLGGFSGGWMANRFGRKGGLLLNNVLGIAGACLMGFTKVSHSYEML  123

Query  459  FFGRFIIGVNCGLNTSLVPMYISEIAPLNLRGGLGTVNQLAVTVGLLVSQVLGIEQILGT  518
            F GRFIIGVNCGLNTSLVPMYISEIAPLNLRGGLGTVNQLAVTVGLL+SQVLGIEQILGT
Sbjct  124  FLGRFIIGVNCGLNTSLVPMYISEIAPLNLRGGLGTVNQLAVTVGLLLSQVLGIEQILGT  183

Query  519  NEGWPVLLGLAICPAILQLLLLPVCPESPRYLLITKQWEEEARKALRRLRASNQVEEDIE  578
            NEGWP+LLGLAICPAILQL+LLPVCPESPRYLLITKQWEEEARKALRRLRAS  VEEDIE
Sbjct  184  NEGWPILLGLAICPAILQLILLPVCPESPRYLLITKQWEEEARKALRRLRASGSVEEDIE  243

Query  579  EMRAEERAQQAESRISMTELICSPTLRAPLVIGVVMQLSQQLSGINAVFYYSTNLFTSSG  638
            EMRAEERAQQ+ES IS  ELICSPTLR PL+IG+VMQLSQQ SGINAVFYYST+LF SSG
Sbjct  244  EMRAEERAQQSESHISTMELICSPTLRPPLIIGIVMQLSQQFSGINAVFYYSTSLFMSSG  303

Query  639  LTEESAKFATIGIGAIMVLMTLGSIPLMDRTGRRTLHLYGLGGMFIFSIFITISFLIKEF  698
            LTEESAKFATIGIGAIMV+MTL SIPLMDRTGRRTLHLYGLGGMFIFSIFITISFLIK  
Sbjct  304  LTEESAKFATIGIGAIMVVMTLVSIPLMDRTGRRTLHLYGLGGMFIFSIFITISFLIK--  361

Query  699  FGYVQEMIDWMSYLSVVSTLSFVVFFAVGPGSIPWMITAELFSQGPRPAAMSIAVLVNWM  758
                 EMIDWMSYLSVV+TL FVVFFAVGPGSIPWMITAELFSQGPRP+AM+IAVLVNWM
Sbjct  362  -----EMIDWMSYLSVVATLGFVVFFAVGPGSIPWMITAELFSQGPRPSAMAIAVLVNWM  416

Query  759  ANFLVGIGFPSMKTSLENYTFLPFSAFLAIFWIFTYKKVPETKNKTFEEILALFRHGNDR  818
            ANF+VGIGFPSMKT+LENYTFLPFS FLAIFWIFTYKKVPETKNKTFEEILALFRH N R
Sbjct  417  ANFVVGIGFPSMKTALENYTFLPFSVFLAIFWIFTYKKVPETKNKTFEEILALFRHNNGR  476

Query  819  SSL  821
            S L
Sbjct  477  SML  479


>FGT1_CAEEL unnamed protein product
Length=510

 Score = 375 bits (964),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 202/480 (42%), Positives = 302/480 (63%), Gaps = 8/480 (2%)

Query  335  RKLRLLEQGLTLFLSYAILAAVLGMLQFGYNTGVINAPEVNIENFMKDVYKDRYGEDISD  394
            +K+   +  LT  L+++     L   QFGY+ G +NAP   I  ++   +KD + +++S 
Sbjct  33   QKIIFPDGKLTKCLAFSAFVITLASFQFGYHIGCVNAPGGLITEWIIGSHKDLFDKELSR  92

Query  395  DSVKKLYSVAVSIFAIGGMLGGFSGGIIANRFGRKGGLLLNNVLGIVGACLMGCTKIAHS  454
            ++    +SVAVS+FA+GGM+GG S G +A++ GR+G L  NN+L +  A LMG  K   +
Sbjct  93   ENADLAWSVAVSVFAVGGMIGGLSSGWLADKVGRRGALFYNNLLALAAAALMGLAKSVGA  152

Query  455  YEMLFFGRFIIGVNCGLNTSLVPMYISEIAPLNLRGGLGTVNQLAVTVGLLVSQVLGIEQ  514
            Y M+  GR IIG+NCG +++LVPM+++EI+P NLRG LG+++QL VT+ +LVSQ+ G+  
Sbjct  153  YPMVILGRLIIGLNCGFSSALVPMFLTEISPNNLRGMLGSLHQLLVTIAILVSQIFGLPH  212

Query  515  ILGTNEGWPVLLGLAICPAILQLLLLPVCPESPRYLLITKQWEEEARKALRRLRASNQVE  574
            +LGT + WP++    + PA+LQL LL +CPESP+Y +  +    EA  AL++LR +  V 
Sbjct  213  LLGTGDRWPLIFAFTVVPAVLQLALLMLCPESPKYTMAVRGQRNEAESALKKLRDTEDVS  272

Query  575  EDIEEMRAEERAQQAESRISMTELICSPTLRAPLVIGVVMQLSQQLSGINAVFYYSTNLF  634
             +IE M+ E  A   + +  M ++     L  P+ I ++M L+QQLSGIN   +YST +F
Sbjct  273  TEIEAMQEEATAAGVQEKPKMGDMF-KGALLWPMSIAIMMMLAQQLSGINVAMFYSTVIF  331

Query  635  TSSGLTEESAKFATIGIGAIMVLMTLGSIPLMD--RTGRRTLHLYGLGGMFIFSIFITIS  692
              +GLT     +ATIG+GA+ V+MTL S+ L+D  + GRR+L L GL GMF+ ++ +  +
Sbjct  332  RGAGLTGNEPFYATIGMGAVNVIMTLISVWLVDHPKFGRRSLLLAGLTGMFVSTLLLVGA  391

Query  693  FLIKEFFGYVQEMIDWMSYLSVVSTLSFVVFFAVGPGSIPWMITAELFSQGPRPAAMSIA  752
              I+   G       W SY ++   L FV+ FA GPG+IPW   +E+F    R  A SIA
Sbjct  392  LTIQNSGGD-----KWASYSAIGFVLLFVISFATGPGAIPWFFVSEIFDSSARGNANSIA  446

Query  753  VLVNWMANFLVGIGFPSMKTSLENYTFLPFSAFLAIFWIFTYKKVPETKNKTFEEILALF  812
            V+VNW AN LVG+ F  +   ++ Y+F  FS FLA F  +T+K VPETK K+ E+I A F
Sbjct  447  VMVNWAANLLVGLTFLPINNLMQQYSFFIFSGFLAFFIFYTWKFVPETKGKSIEQIQAEF  506


>Q7KJP2_DROME unnamed protein product
Length=476

 Score = 201 bits (512),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 148/485 (31%), Positives = 249/485 (51%), Gaps = 29/485 (6%)

Query  341  EQGLTLFLSYAILAAVLG-MLQFGYNTGVINAPEVNIENFMKDVYKDRYGEDISDDSVKK  399
            +QG T  L    +   +G ++  GY  GV+NAP   I +++ +   +RY   + D  +  
Sbjct  5    KQGWTCLLVLICVCITVGTVIPVGYAFGVMNAPSAFIRSWIMESVLERYSSRLGDSQMTI  64

Query  400  LYSVAVSIFAIGGMLGGFSGGIIANRFGRKGGLLLNNVLGIVGA-CLMGCTKIAHSYEML  458
            + S  VSIF IGGMLG     I + R GR+G L L+ +L +V   C + C ++A+S EML
Sbjct  65   IMSTVVSIFLIGGMLGAPFAPIFSARLGRRGILTLSGLLLLVSCICQLFC-RMANSIEML  123

Query  459  FFGRFIIGVNCGLNTSLVPMYISEIAPLNLRGGLGTVNQLAVTVGLLVSQVLGIEQILGT  518
              GR I G+   L  +  PMY+ E+AP  L G +G    + +T G+++ QV   + +LGT
Sbjct  124  LLGRLIGGLAAALIYATQPMYLVELAPAELSGSVGVFTCIGLTGGIVLGQVFSFDFLLGT  183

Query  519  NEGWPVLLGLAICPAILQLLLLPVCPESPRYLLITKQWEEEARKALRRLRAS-NQVEEDI  577
             + WP  L  +    ++ L  +   PESPR+L+ ++   E+AR  L RLR    +V  ++
Sbjct  184  EKLWPYALSGSAIFVLIGLAPIFWFPESPRFLM-SQGRREKARVTLMRLRRDEGRVNAEM  242

Query  578  EEMRAEERAQQAESRISMTELICSPTLRAPLVIGVVMQLSQQLSGINAVFYYSTNLFTSS  637
             E    E +   E +++M +++C+  L+ PL I       QQ+SGI+A+++YS  +FT S
Sbjct  243  AEF---EVSSTDEGQVTMKQVLCNSKLKLPLFIVCSFHFVQQMSGISAIWFYSIEIFTQS  299

Query  638  GLTEESAKFATIGIGAIMVLMTLGSIPLMDRTGRRTLHLYGLGGMFIFSIFITISFLIKE  697
            G T   A +    +G +  +  L    LM    RR +              +TIS L   
Sbjct  300  GFTAAVAMWLNFALGLLNFISALMGPWLMRSFNRRLM--------------MTISCLCSA  345

Query  698  FF-------GYVQEMIDWMSYLSVVSTLSFVVFFAVGPGSIPWMITAELFSQGPRPAAMS  750
             F         +   I   S+  +     +++ F +G G  P+ I +E+F    RP+AM+
Sbjct  346  IFLVLLVVGLELMSTIHEFSFTCIAFLSLYIITFNMGLGPTPYFIGSEIFETASRPSAMA  405

Query  751  IAVLVNWMANFLVGIGFPSMKTSLENYTFLPFSAFLAIFWIFTYKKVPETKNKTFEEILA  810
            +    NW+ANF++ + FP++ ++   + FL    F A  ++ TY+ +PET+N+  +++  
Sbjct  406  LGSFFNWLANFVLNMIFPTLNSATGPFVFLLCVVFCAYGFLLTYRYLPETRNRDAKDVAQ  465

Query  811  LFRHG  815
            L  +G
Sbjct  466  LMENG  470



Lambda      K        H
   0.307    0.125    0.328 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 20462640800


Query= XP_050573077.1 GDP-mannose 4,6 dehydratase isoform X3 [Bombus
affinis]

Length=341
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GMDS_DROME  unnamed protein product                                   556     0.0   
GMD1_CAEEL  unnamed protein product                                   494     2e-176
GMD2_CAEEL  unnamed protein product                                   491     5e-175


>GMDS_DROME unnamed protein product
Length=395

 Score = 556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/332 (76%), Positives = 294/332 (89%), Gaps = 0/332 (0%)

Query  4    DGRRRVALITGITGQDGSYLAEFLLEKGYDVHGIIRRASSFNTARIQHLYADPKCHRQGR  63
            D R +VALITGITGQDGSYLAEFLL+K Y+VHGIIRRAS+FNT RI+HLYADPK H+ GR
Sbjct  43   DSRDKVALITGITGQDGSYLAEFLLKKDYEVHGIIRRASTFNTTRIEHLYADPKAHKGGR  102

Query  64   MKLHYGDMTDSSSLVKVISSVQPTEIYNLAAQSHVMVSFEVSEYTAEVDAVGTVRLLDAI  123
            MKLHYGDMTDSSSLVK+I+ V+PTEIYNLAAQSHV VSF++SEYTAEVDAVGT+R+LDAI
Sbjct  103  MKLHYGDMTDSSSLVKIINMVKPTEIYNLAAQSHVKVSFDLSEYTAEVDAVGTLRILDAI  162

Query  124  RTCGLEKSVKFYHASTSELYGRVTQVPQNEKTPFYPRSPYACAKLYSFWIVVNYREAYNM  183
            RTCG+EK+V+FY ASTSELYG+V + PQNE+TPFYPRSPYACAK+Y FWIV+NYREAYNM
Sbjct  163  RTCGMEKNVRFYQASTSELYGKVVETPQNEQTPFYPRSPYACAKMYGFWIVINYREAYNM  222

Query  184  FACNGILFNHESPRRGENFVTRKVTRSIAKIQLGLQDVLELGNLDAKRDWGHAKDYVEAM  243
            +ACNGILFNHESPRRGENFVTRK+TRS+AKI     +  ELGNLD+KRDWGHA DYVEAM
Sbjct  223  YACNGILFNHESPRRGENFVTRKITRSVAKIYHKQMEYFELGNLDSKRDWGHASDYVEAM  282

Query  244  WLMLQQPIPDDYVIATGETHSVREFVEAAFLYVGRTIKWEGEGINEIGQDAQTGQVLVKV  303
            W+MLQ+  P DYVIATGETHSVREFVEAAF ++ R I W+G+G++E+G +  TG V V++
Sbjct  283  WMMLQRESPSDYVIATGETHSVREFVEAAFKHIDREITWKGKGVDEVGVENGTGIVRVRI  342

Query  304  NPKYFRPTEVDVLLGDANKAKEKIGWKPTVTF  335
            NPKYFRPTEVD+L GDA+KA  ++ W P VTF
Sbjct  343  NPKYFRPTEVDLLQGDASKANRELNWTPKVTF  374


>GMD1_CAEEL unnamed protein product
Length=399

 Score = 494 bits (1273),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 227/329 (69%), Positives = 276/329 (84%), Gaps = 2/329 (1%)

Query  7    RRVALITGITGQDGSYLAEFLLEKGYDVHGIIRRASSFNTARIQHLYADPKCHR-QGRMK  65
            R+VALITGI+GQDGSYLAE LL KGY VHGIIRR+SSFNTARI+HLY++P  H       
Sbjct  50   RKVALITGISGQDGSYLAELLLSKGYKVHGIIRRSSSFNTARIEHLYSNPITHHGDSSFS  109

Query  66   LHYGDMTDSSSLVKVISSVQPTEIYNLAAQSHVMVSFEVSEYTAEVDAVGTVRLLDAIRT  125
            LHYGDMTDSS L+K+IS+++PTE+Y+LAAQSHV VSF++ EYTAEVDAVGT+RLLDAI  
Sbjct  110  LHYGDMTDSSCLIKLISTIEPTEVYHLAAQSHVKVSFDLPEYTAEVDAVGTLRLLDAIHA  169

Query  126  CGLEKSVKFYHASTSELYGRVTQVPQNEKTPFYPRSPYACAKLYSFWIVVNYREAYNMFA  185
            C L + V+FY ASTSELYG+V ++PQ+EKTPFYPRSPYA AK+Y +WIVVNYREAYNMFA
Sbjct  170  CRLTEKVRFYQASTSELYGKVQEIPQSEKTPFYPRSPYAVAKMYGYWIVVNYREAYNMFA  229

Query  186  CNGILFNHESPRRGENFVTRKVTRSIAKIQLGLQDVLELGNLDAKRDWGHAKDYVEAMWL  245
            CNGILFNHESPRRGE FVTRK+TRS+AKI LG Q+ +ELGNL A RDWGHA++YVEAMW 
Sbjct  230  CNGILFNHESPRRGETFVTRKITRSVAKISLGQQESIELGNLSALRDWGHAREYVEAMWR  289

Query  246  MLQQPIPDDYVIATGETHSVREFVEAAFLYVGRTIKWEGEGINEIGQDAQTGQVLVKVNP  305
            +LQ   PDD+VIATG+  SVREF   AF  +G  ++WEGEG+ E+G++ + G + VKV+P
Sbjct  290  ILQHDSPDDFVIATGKQFSVREFCNLAFAEIGEVLQWEGEGVEEVGKN-KDGVIRVKVSP  348

Query  306  KYFRPTEVDVLLGDANKAKEKIGWKPTVT  334
            KY+RPTEV+ LLG+A KAK+ +GW+  VT
Sbjct  349  KYYRPTEVETLLGNAEKAKKTLGWEAKVT  377


>GMD2_CAEEL unnamed protein product
Length=382

 Score = 491 bits (1263),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 228/329 (69%), Positives = 273/329 (83%), Gaps = 2/329 (1%)

Query  7    RRVALITGITGQDGSYLAEFLLEKGYDVHGIIRRASSFNTARIQHLYADPKCHR-QGRMK  65
            R+VALITGITGQDGSYLAE LL KGY VHGIIRR+SSFNTARI+HLY +P  H       
Sbjct  33   RKVALITGITGQDGSYLAELLLSKGYKVHGIIRRSSSFNTARIEHLYGNPVTHNGSASFS  92

Query  66   LHYGDMTDSSSLVKVISSVQPTEIYNLAAQSHVMVSFEVSEYTAEVDAVGTVRLLDAIRT  125
            LHYGDMTDSS L+K+IS+++PTEIY+LAAQSHV VSF++ EYTAEVDAVGT+RLLDAI  
Sbjct  93   LHYGDMTDSSCLIKLISTIEPTEIYHLAAQSHVKVSFDLPEYTAEVDAVGTLRLLDAIHA  152

Query  126  CGLEKSVKFYHASTSELYGRVTQVPQNEKTPFYPRSPYACAKLYSFWIVVNYREAYNMFA  185
            C L + V+FY ASTSELYG+V ++PQ+E TPFYPRSPYA AK+Y +WIVVNYREAY MFA
Sbjct  153  CRLTEKVRFYQASTSELYGKVQEIPQSELTPFYPRSPYAVAKMYGYWIVVNYREAYKMFA  212

Query  186  CNGILFNHESPRRGENFVTRKVTRSIAKIQLGLQDVLELGNLDAKRDWGHAKDYVEAMWL  245
            CNGILFNHESPRRGE FVTRK+TRS+AKI L  Q+ +ELGNL A RDWGHAK+YVEAMW 
Sbjct  213  CNGILFNHESPRRGETFVTRKITRSVAKISLRQQEHIELGNLSALRDWGHAKEYVEAMWR  272

Query  246  MLQQPIPDDYVIATGETHSVREFVEAAFLYVGRTIKWEGEGINEIGQDAQTGQVLVKVNP  305
            +LQQ  PDD+VIATG+  SVREF   AF  +G  + WEGEG++E+G++ Q G V VKV+P
Sbjct  273  ILQQDTPDDFVIATGKQFSVREFCNLAFAEIGEQLVWEGEGVDEVGKN-QDGVVRVKVSP  331

Query  306  KYFRPTEVDVLLGDANKAKEKIGWKPTVT  334
            KY+RPTEV+ LLG+  KA++ +GW+P +T
Sbjct  332  KYYRPTEVETLLGNPAKARKTLGWEPKIT  360



Lambda      K        H
   0.307    0.125    0.328 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 20462640800


Query= XP_050573078.1 unconventional myosin-IXb isoform X1 [Bombus affinis]

Length=1234
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

B5RJR1_DROME  unnamed protein product                                 1375    0.0  
M9MRE4_DROME  unnamed protein product                                 1373    0.0  
Q95VU9_DROME  unnamed protein product                                 1373    0.0  


>B5RJR1_DROME unnamed protein product
Length=1244

 Score = 1375 bits (3558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 696/961 (72%), Positives = 774/961 (81%), Gaps = 38/961 (4%)

Query  301   GPATSTALDDLIHLPGPLTEDAVLKCLQARFCAKQYHTNVGPILVCINPYTDVRNPLTLT  360
             G ++   + DLIHL GPLTE AV++ LQARF  ++Y TNVGPIL+ INPY DV NPLTLT
Sbjct  286   GNSSPKDMQDLIHLSGPLTEHAVMRTLQARFNERRYFTNVGPILLSINPYLDVGNPLTLT  345

Query  361   STRAVPLAPQLNKVVQEAVRQQSETGYPQAIILSGTSGSGKTYASMLLLRQLFDVAGGGP  420
             STRA+PLAPQL K+VQEAVRQQSETGYPQAIILSGTSG+GKT  +ML+LRQLF +AGGGP
Sbjct  346   STRAMPLAPQLQKIVQEAVRQQSETGYPQAIILSGTSGAGKTANAMLMLRQLFAIAGGGP  405

Query  421   ETDAFKHLAAAFTVLRSLGSAKTATNSESSRIGHFIEVQVTDGALYRTKIHCYFLDQTRV  480
             ETDAFKHLAAAFTVLRSLGSAKT TNSESSRIG FIEVQVTDGALYRTKIHCYFLDQTRV
Sbjct  406   ETDAFKHLAAAFTVLRSLGSAKTTTNSESSRIGQFIEVQVTDGALYRTKIHCYFLDQTRV  465

Query  481   IRPLPDEKNYHIFYQMLAGLSHEERVKLNLEGYNLKNLRYLQHGDTRQDEAEDAIRFQAW  540
             IRPLP EKNYHIFYQ+LAGLS EER KL+L+GY+  NLRYL+ GD  Q+E EDA RFQAW
Sbjct  466   IRPLPKEKNYHIFYQLLAGLSREERQKLHLDGYSPANLRYLR-GDIGQNEQEDAARFQAW  524

Query  541   KACLGVLGIPFLDVVRVLAAVLILGNVGFTDRPGVEVGVIGENELASVAALLGVPPPALL  600
             K CLG+LGIPFLDVVRVLAAVL+LGNV F D  G+EV V GE EL SVA+LLGVPP AL 
Sbjct  525   KTCLGILGIPFLDVVRVLAAVLLLGNVQFIDGGGLEVDVKGETELNSVASLLGVPPAALF  584

Query  601   RGLTSRTHNARGQLVKSVCDANMSNMTRDSLAKALYCRTVATIVRRANSLKRLGSTLGTL  660
             RGLT+RTHN RGQLVKSVC    +NMTRD LAKALYCRTVATIVRRANSLKRLGSTLGTL
Sbjct  585   RGLTTRTHNVRGQLVKSVCGDGDANMTRDCLAKALYCRTVATIVRRANSLKRLGSTLGTL  644

Query  661   SSDSNESVHNQAEVTSQHASTIGSSAGGTGSRSMTALNNAVRHAT-DGFIGILDMFGFED  719
             SSDSNESVHNQA+V SQHASTIG   G  GS+SM ALNNAVRHAT DGFIGILDMFGFE+
Sbjct  645   SSDSNESVHNQADVASQHASTIG--GGNAGSKSMAALNNAVRHATSDGFIGILDMFGFEE  702

Query  720   PKP-SQLEHLCINLCAETMQHFYNTHIFKSSIESCRDEGIRCDVEVDYVDNVPCIDLISS  778
             P P + LEHLCINLCAETMQHFYNTHIFKSS+ESCRDEGI CD EVDYVDNVPCIDLISS
Sbjct  703   PSPHAHLEHLCINLCAETMQHFYNTHIFKSSVESCRDEGIVCDTEVDYVDNVPCIDLISS  762

Query  779   LRTGLLSMLDVECSIRGTAESYVAKVKVQHKQNPRLFEPRTV---DCRSFGIQHFAGRVT  835
             LRTGLLSMLD ECS+RGTAESYV K+KVQH+ + RL    T    D R F I+HFAGRV 
Sbjct  763   LRTGLLSMLDAECSVRGTAESYVTKLKVQHRSSTRLETKPTAEPHDPRMFLIRHFAGRVE  822

Query  836   YDASDFLDTNKDVVPDDLVAVFYKHTCSFGFATHLFGSELKALYASDTVPRGVSFRISPT  895
             YD +DFLDTN+DVVPDDLV VFYKHTC+FGFATHLFGSELKALYA    PRG+SFRISPT
Sbjct  823   YDTTDFLDTNRDVVPDDLVGVFYKHTCNFGFATHLFGSELKALYAQQQAPRGLSFRISPT  882

Query  896   SHTDLLNGDEPISTLTQDFHTRLDNLLRTLVHARPHFVRCIRSNGTETPLHLDRGVTMRQ  955
             SH+DLLNGDEP+STLTQDFHTRLDNLLRTLVHARPHFVRCIRSNGTE     DR   +RQ
Sbjct  883   SHSDLLNGDEPVSTLTQDFHTRLDNLLRTLVHARPHFVRCIRSNGTEAARSFDRATVVRQ  942

Query  956   IRSLQVLETVNLMAGGYPHRMRFKAFNARYRLIAPFKQLRRAEEQAVEDTKLILQNAQQL  1015
             IRSLQVLETVNLMA G+PHRMRFK FNARYR++APF+ LRR+E++A+ED +LIL+ A + 
Sbjct  943   IRSLQVLETVNLMASGFPHRMRFKQFNARYRMLAPFRLLRRSEDKALEDCQLILKYAMEQ  1002

Query  1016  KSKFGASTS--WALGKRHIFLSEGIRQQLENLRSETRRKAATVIQSTWRGWRVRRRWPLR  1073
                   S +  WA GKRH+FLSEGIRQ LE+LR+E R K+AT++Q+TWRGW  R++    
Sbjct  1003  PPVLDGSVTLAWAPGKRHVFLSEGIRQHLEHLRTEIRHKSATLMQATWRGWWWRKKMGNG  1062

Query  1074  KTTIGVTSGIGQKK-PQQPTSANTGTVQRNV------------------------TTATG  1108
                     G+ Q   P   T+ N+    +                          TT+ G
Sbjct  1063  GAKRSKIPGLQQAPLPNNKTTPNSAAQNKAASSTMAALAAVAAAAPISVPRLSAKTTSLG  1122

Query  1109  T-GTGTRPRPQPIAGTPPPDPSEKCADQKMIQQTCTLFGLDLERPPPVPPSRSYTVTGNT  1167
               GT  RPRPQPIAGTPPPDP EKC DQK+IQQTC LFGLDLERPPPVPPSRSYT+TGN+
Sbjct  1123  IGGTVARPRPQPIAGTPPPDPQEKC-DQKIIQQTCNLFGLDLERPPPVPPSRSYTITGNS  1181

Query  1168  KLGYPQTRIMKMPFPEEGEGEV-VLLKGETVLVVGASPRRGHLLVEHNNTTLHVPYQFME  1226
             K+ YPQ R+MKM FPEEG+ E   L KGE V VVGAS  RGHL+VEH   + HVP+QFM 
Sbjct  1182  KISYPQNRVMKMNFPEEGQSEAPQLKKGEAVTVVGASTVRGHLMVEHKGQSFHVPFQFMT  1241

Query  1227  L  1227
             L
Sbjct  1242  L  1242


 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 44/68 (65%), Gaps = 1/68 (1%)

Query  110  LQTWLLQRSKLSSDASSSNEAVHLQQRLRSLSTELVTLRNRLHVNQPPNNSGPNSGASAP  169
            LQ +     KL  DASSSNEAVHLQQRL+SLSTELVTLRNRLHV   P         + P
Sbjct  19   LQKFWETEKKLQ-DASSSNEAVHLQQRLKSLSTELVTLRNRLHVGHGPGQGQSQGNGAQP  77

Query  170  LSKSPEKG  177
            ++ +P  G
Sbjct  78   VAPAPNAG  85


>M9MRE4_DROME unnamed protein product
Length=1426

 Score = 1373 bits (3555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 696/961 (72%), Positives = 774/961 (81%), Gaps = 38/961 (4%)

Query  301   GPATSTALDDLIHLPGPLTEDAVLKCLQARFCAKQYHTNVGPILVCINPYTDVRNPLTLT  360
             G ++   + DLIHL GPLTE AV++ LQARF  ++Y TNVGPIL+ INPY DV NPLTLT
Sbjct  468   GNSSPKDMQDLIHLSGPLTEHAVMRTLQARFNERRYFTNVGPILLSINPYLDVGNPLTLT  527

Query  361   STRAVPLAPQLNKVVQEAVRQQSETGYPQAIILSGTSGSGKTYASMLLLRQLFDVAGGGP  420
             STRA+PLAPQL K+VQEAVRQQSETGYPQAIILSGTSG+GKT  +ML+LRQLF +AGGGP
Sbjct  528   STRAMPLAPQLQKIVQEAVRQQSETGYPQAIILSGTSGAGKTANAMLMLRQLFAIAGGGP  587

Query  421   ETDAFKHLAAAFTVLRSLGSAKTATNSESSRIGHFIEVQVTDGALYRTKIHCYFLDQTRV  480
             ETDAFKHLAAAFTVLRSLGSAKT TNSESSRIG FIEVQVTDGALYRTKIHCYFLDQTRV
Sbjct  588   ETDAFKHLAAAFTVLRSLGSAKTTTNSESSRIGQFIEVQVTDGALYRTKIHCYFLDQTRV  647

Query  481   IRPLPDEKNYHIFYQMLAGLSHEERVKLNLEGYNLKNLRYLQHGDTRQDEAEDAIRFQAW  540
             IRPLP EKNYHIFYQ+LAGLS EER KL+L+GY+  NLRYL+ GD  Q+E EDA RFQAW
Sbjct  648   IRPLPKEKNYHIFYQLLAGLSREERQKLHLDGYSPANLRYLR-GDIGQNEQEDAARFQAW  706

Query  541   KACLGVLGIPFLDVVRVLAAVLILGNVGFTDRPGVEVGVIGENELASVAALLGVPPPALL  600
             K CLG+LGIPFLDVVRVLAAVL+LGNV F D  G+EV V GE EL SVA+LLGVPP AL 
Sbjct  707   KTCLGILGIPFLDVVRVLAAVLLLGNVQFIDGGGLEVDVKGETELNSVASLLGVPPAALF  766

Query  601   RGLTSRTHNARGQLVKSVCDANMSNMTRDSLAKALYCRTVATIVRRANSLKRLGSTLGTL  660
             RGLT+RTHN RGQLVKSVC    +NMTRD LAKALYCRTVATIVRRANSLKRLGSTLGTL
Sbjct  767   RGLTTRTHNVRGQLVKSVCGDGDANMTRDCLAKALYCRTVATIVRRANSLKRLGSTLGTL  826

Query  661   SSDSNESVHNQAEVTSQHASTIGSSAGGTGSRSMTALNNAVRHAT-DGFIGILDMFGFED  719
             SSDSNESVHNQA+V SQHASTIG   G  GS+SM ALNNAVRHAT DGFIGILDMFGFE+
Sbjct  827   SSDSNESVHNQADVASQHASTIG--GGNAGSKSMAALNNAVRHATSDGFIGILDMFGFEE  884

Query  720   PKP-SQLEHLCINLCAETMQHFYNTHIFKSSIESCRDEGIRCDVEVDYVDNVPCIDLISS  778
             P P + LEHLCINLCAETMQHFYNTHIFKSS+ESCRDEGI CD EVDYVDNVPCIDLISS
Sbjct  885   PSPHAHLEHLCINLCAETMQHFYNTHIFKSSVESCRDEGIVCDTEVDYVDNVPCIDLISS  944

Query  779   LRTGLLSMLDVECSIRGTAESYVAKVKVQHKQNPRLFEPRTV---DCRSFGIQHFAGRVT  835
             LRTGLLSMLD ECS+RGTAESYV K+KVQH+ + RL    T    D R F I+HFAGRV 
Sbjct  945   LRTGLLSMLDAECSVRGTAESYVTKLKVQHRSSTRLETKPTAEPHDPRMFLIRHFAGRVE  1004

Query  836   YDASDFLDTNKDVVPDDLVAVFYKHTCSFGFATHLFGSELKALYASDTVPRGVSFRISPT  895
             YD +DFLDTN+DVVPDDLV VFYKHTC+FGFATHLFGSELKALYA    PRG+SFRISPT
Sbjct  1005  YDTTDFLDTNRDVVPDDLVGVFYKHTCNFGFATHLFGSELKALYAQQQAPRGLSFRISPT  1064

Query  896   SHTDLLNGDEPISTLTQDFHTRLDNLLRTLVHARPHFVRCIRSNGTETPLHLDRGVTMRQ  955
             SH+DLLNGDEP+STLTQDFHTRLDNLLRTLVHARPHFVRCIRSNGTE     DR   +RQ
Sbjct  1065  SHSDLLNGDEPVSTLTQDFHTRLDNLLRTLVHARPHFVRCIRSNGTEAARSFDRATVVRQ  1124

Query  956   IRSLQVLETVNLMAGGYPHRMRFKAFNARYRLIAPFKQLRRAEEQAVEDTKLILQNAQQL  1015
             IRSLQVLETVNLMA G+PHRMRFK FNARYR++APF+ LRR+E++A+ED +LIL+ A + 
Sbjct  1125  IRSLQVLETVNLMASGFPHRMRFKQFNARYRMLAPFRLLRRSEDKALEDCQLILKYAMEQ  1184

Query  1016  KSKFGASTS--WALGKRHIFLSEGIRQQLENLRSETRRKAATVIQSTWRGWRVRRRWPLR  1073
                   S +  WA GKRH+FLSEGIRQ LE+LR+E R K+AT++Q+TWRGW  R++    
Sbjct  1185  PPVLDGSVTLAWAPGKRHVFLSEGIRQHLEHLRTEIRHKSATLMQATWRGWWWRKKMGNG  1244

Query  1074  KTTIGVTSGIGQKK-PQQPTSANTGTVQRNV------------------------TTATG  1108
                     G+ Q   P   T+ N+    +                          TT+ G
Sbjct  1245  GAKRSKIPGLQQAPLPNNKTTPNSAAQNKAASSTMAALAAVAAAAPISVPRLSAKTTSLG  1304

Query  1109  T-GTGTRPRPQPIAGTPPPDPSEKCADQKMIQQTCTLFGLDLERPPPVPPSRSYTVTGNT  1167
               GT  RPRPQPIAGTPPPDP EKC DQK+IQQTC LFGLDLERPPPVPPSRSYT+TGN+
Sbjct  1305  IGGTVARPRPQPIAGTPPPDPQEKC-DQKIIQQTCNLFGLDLERPPPVPPSRSYTITGNS  1363

Query  1168  KLGYPQTRIMKMPFPEEGEGEV-VLLKGETVLVVGASPRRGHLLVEHNNTTLHVPYQFME  1226
             K+ YPQ R+MKM FPEEG+ E   L KGE V VVGAS  RGHL+VEH   + HVP+QFM 
Sbjct  1364  KISYPQNRVMKMNFPEEGQSEAPQLKKGEAVTVVGASTVRGHLMVEHKGQSFHVPFQFMT  1423

Query  1227  L  1227
             L
Sbjct  1424  L  1424


 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 40/56 (71%), Gaps = 0/56 (0%)

Query  122  SDASSSNEAVHLQQRLRSLSTELVTLRNRLHVNQPPNNSGPNSGASAPLSKSPEKG  177
            +DASSSNEAVHLQQRL+SLSTELVTLRNRLHV   P         + P++ +P  G
Sbjct  212  TDASSSNEAVHLQQRLKSLSTELVTLRNRLHVGHGPGQGQSQGNGAQPVAPAPNAG  267


 Score = 36.2 bits (82),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 36/62 (58%), Gaps = 3/62 (5%)

Query  84   FRKCDEFLKRHGIRPEFFCRHRERLALQTWLLQRSKLSS---DASSSNEAVHLQQRLRSL  140
             R C++FL RH +RP+FFC++ + ++  T   +++K S+      S++  V +Q  L+  
Sbjct  115  LRLCEDFLCRHRMRPDFFCQYHKAVSSTTPSPKQTKTSTPIVQCKSASPPVKVQSDLKDF  174

Query  141  ST  142
             +
Sbjct  175  KS  176


>Q95VU9_DROME unnamed protein product
Length=1232

 Score = 1373 bits (3553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 696/961 (72%), Positives = 774/961 (81%), Gaps = 38/961 (4%)

Query  301   GPATSTALDDLIHLPGPLTEDAVLKCLQARFCAKQYHTNVGPILVCINPYTDVRNPLTLT  360
             G ++   + DLIHL GPLTE AV++ LQARF  ++Y TNVGPIL+ INPY DV NPLTLT
Sbjct  274   GNSSPKDMQDLIHLSGPLTEHAVMRTLQARFNERRYFTNVGPILLSINPYLDVGNPLTLT  333

Query  361   STRAVPLAPQLNKVVQEAVRQQSETGYPQAIILSGTSGSGKTYASMLLLRQLFDVAGGGP  420
             STRA+PLAPQL K+VQEAVRQQSETGYPQAIILSGTSG+GKT  +ML+LRQLF +AGGGP
Sbjct  334   STRAMPLAPQLQKIVQEAVRQQSETGYPQAIILSGTSGAGKTANAMLMLRQLFAIAGGGP  393

Query  421   ETDAFKHLAAAFTVLRSLGSAKTATNSESSRIGHFIEVQVTDGALYRTKIHCYFLDQTRV  480
             ETDAFKHLAAAFTVLRSLGSAKT TNSESSRIG FIEVQVTDGALYRTKIHCYFLDQTRV
Sbjct  394   ETDAFKHLAAAFTVLRSLGSAKTTTNSESSRIGQFIEVQVTDGALYRTKIHCYFLDQTRV  453

Query  481   IRPLPDEKNYHIFYQMLAGLSHEERVKLNLEGYNLKNLRYLQHGDTRQDEAEDAIRFQAW  540
             IRPLP EKNYHIFYQ+LAGLS EER KL+L+GY+  NLRYL+ GD  Q+E EDA RFQAW
Sbjct  454   IRPLPKEKNYHIFYQLLAGLSREERQKLHLDGYSPANLRYLR-GDIGQNEQEDAARFQAW  512

Query  541   KACLGVLGIPFLDVVRVLAAVLILGNVGFTDRPGVEVGVIGENELASVAALLGVPPPALL  600
             K CLG+LGIPFLDVVRVLAAVL+LGNV F D  G+EV V GE EL SVA+LLGVPP AL 
Sbjct  513   KTCLGILGIPFLDVVRVLAAVLLLGNVQFIDGGGLEVDVKGETELNSVASLLGVPPAALF  572

Query  601   RGLTSRTHNARGQLVKSVCDANMSNMTRDSLAKALYCRTVATIVRRANSLKRLGSTLGTL  660
             RGLT+RTHN RGQLVKSVC    +NMTRD LAKALYCRTVATIVRRANSLKRLGSTLGTL
Sbjct  573   RGLTTRTHNVRGQLVKSVCGDGDANMTRDCLAKALYCRTVATIVRRANSLKRLGSTLGTL  632

Query  661   SSDSNESVHNQAEVTSQHASTIGSSAGGTGSRSMTALNNAVRHAT-DGFIGILDMFGFED  719
             SSDSNESVHNQA+V SQHASTIG   G  GS+SM ALNNAVRHAT DGFIGILDMFGFE+
Sbjct  633   SSDSNESVHNQADVASQHASTIG--GGNAGSKSMAALNNAVRHATSDGFIGILDMFGFEE  690

Query  720   PKP-SQLEHLCINLCAETMQHFYNTHIFKSSIESCRDEGIRCDVEVDYVDNVPCIDLISS  778
             P P + LEHLCINLCAETMQHFYNTHIFKSS+ESCRDEGI CD EVDYVDNVPCIDLISS
Sbjct  691   PSPHAHLEHLCINLCAETMQHFYNTHIFKSSVESCRDEGIVCDTEVDYVDNVPCIDLISS  750

Query  779   LRTGLLSMLDVECSIRGTAESYVAKVKVQHKQNPRLFEPRTV---DCRSFGIQHFAGRVT  835
             LRTGLLSMLD ECS+RGTAESYV K+KVQH+ + RL    T    D R F I+HFAGRV 
Sbjct  751   LRTGLLSMLDAECSVRGTAESYVTKLKVQHRSSTRLETKPTAEPHDPRMFLIRHFAGRVE  810

Query  836   YDASDFLDTNKDVVPDDLVAVFYKHTCSFGFATHLFGSELKALYASDTVPRGVSFRISPT  895
             YD +DFLDTN+DVVPDDLV VFYKHTC+FGFATHLFGSELKALYA    PRG+SFRISPT
Sbjct  811   YDTTDFLDTNRDVVPDDLVGVFYKHTCNFGFATHLFGSELKALYAQQQAPRGLSFRISPT  870

Query  896   SHTDLLNGDEPISTLTQDFHTRLDNLLRTLVHARPHFVRCIRSNGTETPLHLDRGVTMRQ  955
             SH+DLLNGDEP+STLTQDFHTRLDNLLRTLVHARPHFVRCIRSNGTE     DR   +RQ
Sbjct  871   SHSDLLNGDEPVSTLTQDFHTRLDNLLRTLVHARPHFVRCIRSNGTEAARSFDRATVVRQ  930

Query  956   IRSLQVLETVNLMAGGYPHRMRFKAFNARYRLIAPFKQLRRAEEQAVEDTKLILQNAQQL  1015
             IRSLQVLETVNLMA G+PHRMRFK FNARYR++APF+ LRR+E++A+ED +LIL+ A + 
Sbjct  931   IRSLQVLETVNLMASGFPHRMRFKQFNARYRMLAPFRLLRRSEDKALEDCQLILKYAMEQ  990

Query  1016  KSKFGASTS--WALGKRHIFLSEGIRQQLENLRSETRRKAATVIQSTWRGWRVRRRWPLR  1073
                   S +  WA GKRH+FLSEGIRQ LE+LR+E R K+AT++Q+TWRGW  R++    
Sbjct  991   PPVLDGSVTLAWAPGKRHVFLSEGIRQHLEHLRTEIRHKSATLMQATWRGWWWRKKMGNG  1050

Query  1074  KTTIGVTSGIGQKK-PQQPTSANTGTVQRNV------------------------TTATG  1108
                     G+ Q   P   T+ N+    +                          TT+ G
Sbjct  1051  GAKRSKIPGLQQAPLPNNKTTPNSAAQNKAASSTMAALAAVAAAAPISVPRLSAKTTSLG  1110

Query  1109  T-GTGTRPRPQPIAGTPPPDPSEKCADQKMIQQTCTLFGLDLERPPPVPPSRSYTVTGNT  1167
               GT  RPRPQPIAGTPPPDP EKC DQK+IQQTC LFGLDLERPPPVPPSRSYT+TGN+
Sbjct  1111  IGGTVARPRPQPIAGTPPPDPQEKC-DQKIIQQTCNLFGLDLERPPPVPPSRSYTITGNS  1169

Query  1168  KLGYPQTRIMKMPFPEEGEGEV-VLLKGETVLVVGASPRRGHLLVEHNNTTLHVPYQFME  1226
             K+ YPQ R+MKM FPEEG+ E   L KGE V VVGAS  RGHL+VEH   + HVP+QFM 
Sbjct  1170  KISYPQNRVMKMNFPEEGQSEAPQLKKGEAVTVVGASTVRGHLMVEHKGQSFHVPFQFMT  1229

Query  1227  L  1227
             L
Sbjct  1230  L  1230


 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 39/55 (71%), Gaps = 0/55 (0%)

Query  123  DASSSNEAVHLQQRLRSLSTELVTLRNRLHVNQPPNNSGPNSGASAPLSKSPEKG  177
            DASSSNEAVHLQQRL+SLSTELVTLRNRLHV   P         + P++ +P  G
Sbjct  19   DASSSNEAVHLQQRLKSLSTELVTLRNRLHVGHGPGQGQSQGNGAQPVAPAPNAG  73



Lambda      K        H
   0.307    0.125    0.328 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 20462640800


Query= XP_050573079.1 unconventional myosin-IXb isoform X1 [Bombus affinis]

Length=1234
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

B5RJR1_DROME  unnamed protein product                                 1375    0.0  
M9MRE4_DROME  unnamed protein product                                 1373    0.0  
Q95VU9_DROME  unnamed protein product                                 1373    0.0  


>B5RJR1_DROME unnamed protein product
Length=1244

 Score = 1375 bits (3558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 696/961 (72%), Positives = 774/961 (81%), Gaps = 38/961 (4%)

Query  301   GPATSTALDDLIHLPGPLTEDAVLKCLQARFCAKQYHTNVGPILVCINPYTDVRNPLTLT  360
             G ++   + DLIHL GPLTE AV++ LQARF  ++Y TNVGPIL+ INPY DV NPLTLT
Sbjct  286   GNSSPKDMQDLIHLSGPLTEHAVMRTLQARFNERRYFTNVGPILLSINPYLDVGNPLTLT  345

Query  361   STRAVPLAPQLNKVVQEAVRQQSETGYPQAIILSGTSGSGKTYASMLLLRQLFDVAGGGP  420
             STRA+PLAPQL K+VQEAVRQQSETGYPQAIILSGTSG+GKT  +ML+LRQLF +AGGGP
Sbjct  346   STRAMPLAPQLQKIVQEAVRQQSETGYPQAIILSGTSGAGKTANAMLMLRQLFAIAGGGP  405

Query  421   ETDAFKHLAAAFTVLRSLGSAKTATNSESSRIGHFIEVQVTDGALYRTKIHCYFLDQTRV  480
             ETDAFKHLAAAFTVLRSLGSAKT TNSESSRIG FIEVQVTDGALYRTKIHCYFLDQTRV
Sbjct  406   ETDAFKHLAAAFTVLRSLGSAKTTTNSESSRIGQFIEVQVTDGALYRTKIHCYFLDQTRV  465

Query  481   IRPLPDEKNYHIFYQMLAGLSHEERVKLNLEGYNLKNLRYLQHGDTRQDEAEDAIRFQAW  540
             IRPLP EKNYHIFYQ+LAGLS EER KL+L+GY+  NLRYL+ GD  Q+E EDA RFQAW
Sbjct  466   IRPLPKEKNYHIFYQLLAGLSREERQKLHLDGYSPANLRYLR-GDIGQNEQEDAARFQAW  524

Query  541   KACLGVLGIPFLDVVRVLAAVLILGNVGFTDRPGVEVGVIGENELASVAALLGVPPPALL  600
             K CLG+LGIPFLDVVRVLAAVL+LGNV F D  G+EV V GE EL SVA+LLGVPP AL 
Sbjct  525   KTCLGILGIPFLDVVRVLAAVLLLGNVQFIDGGGLEVDVKGETELNSVASLLGVPPAALF  584

Query  601   RGLTSRTHNARGQLVKSVCDANMSNMTRDSLAKALYCRTVATIVRRANSLKRLGSTLGTL  660
             RGLT+RTHN RGQLVKSVC    +NMTRD LAKALYCRTVATIVRRANSLKRLGSTLGTL
Sbjct  585   RGLTTRTHNVRGQLVKSVCGDGDANMTRDCLAKALYCRTVATIVRRANSLKRLGSTLGTL  644

Query  661   SSDSNESVHNQAEVTSQHASTIGSSAGGTGSRSMTALNNAVRHAT-DGFIGILDMFGFED  719
             SSDSNESVHNQA+V SQHASTIG   G  GS+SM ALNNAVRHAT DGFIGILDMFGFE+
Sbjct  645   SSDSNESVHNQADVASQHASTIG--GGNAGSKSMAALNNAVRHATSDGFIGILDMFGFEE  702

Query  720   PKP-SQLEHLCINLCAETMQHFYNTHIFKSSIESCRDEGIRCDVEVDYVDNVPCIDLISS  778
             P P + LEHLCINLCAETMQHFYNTHIFKSS+ESCRDEGI CD EVDYVDNVPCIDLISS
Sbjct  703   PSPHAHLEHLCINLCAETMQHFYNTHIFKSSVESCRDEGIVCDTEVDYVDNVPCIDLISS  762

Query  779   LRTGLLSMLDVECSIRGTAESYVAKVKVQHKQNPRLFEPRTV---DCRSFGIQHFAGRVT  835
             LRTGLLSMLD ECS+RGTAESYV K+KVQH+ + RL    T    D R F I+HFAGRV 
Sbjct  763   LRTGLLSMLDAECSVRGTAESYVTKLKVQHRSSTRLETKPTAEPHDPRMFLIRHFAGRVE  822

Query  836   YDASDFLDTNKDVVPDDLVAVFYKHTCSFGFATHLFGSELKALYASDTVPRGVSFRISPT  895
             YD +DFLDTN+DVVPDDLV VFYKHTC+FGFATHLFGSELKALYA    PRG+SFRISPT
Sbjct  823   YDTTDFLDTNRDVVPDDLVGVFYKHTCNFGFATHLFGSELKALYAQQQAPRGLSFRISPT  882

Query  896   SHTDLLNGDEPISTLTQDFHTRLDNLLRTLVHARPHFVRCIRSNGTETPLHLDRGVTMRQ  955
             SH+DLLNGDEP+STLTQDFHTRLDNLLRTLVHARPHFVRCIRSNGTE     DR   +RQ
Sbjct  883   SHSDLLNGDEPVSTLTQDFHTRLDNLLRTLVHARPHFVRCIRSNGTEAARSFDRATVVRQ  942

Query  956   IRSLQVLETVNLMAGGYPHRMRFKAFNARYRLIAPFKQLRRAEEQAVEDTKLILQNAQQL  1015
             IRSLQVLETVNLMA G+PHRMRFK FNARYR++APF+ LRR+E++A+ED +LIL+ A + 
Sbjct  943   IRSLQVLETVNLMASGFPHRMRFKQFNARYRMLAPFRLLRRSEDKALEDCQLILKYAMEQ  1002

Query  1016  KSKFGASTS--WALGKRHIFLSEGIRQQLENLRSETRRKAATVIQSTWRGWRVRRRWPLR  1073
                   S +  WA GKRH+FLSEGIRQ LE+LR+E R K+AT++Q+TWRGW  R++    
Sbjct  1003  PPVLDGSVTLAWAPGKRHVFLSEGIRQHLEHLRTEIRHKSATLMQATWRGWWWRKKMGNG  1062

Query  1074  KTTIGVTSGIGQKK-PQQPTSANTGTVQRNV------------------------TTATG  1108
                     G+ Q   P   T+ N+    +                          TT+ G
Sbjct  1063  GAKRSKIPGLQQAPLPNNKTTPNSAAQNKAASSTMAALAAVAAAAPISVPRLSAKTTSLG  1122

Query  1109  T-GTGTRPRPQPIAGTPPPDPSEKCADQKMIQQTCTLFGLDLERPPPVPPSRSYTVTGNT  1167
               GT  RPRPQPIAGTPPPDP EKC DQK+IQQTC LFGLDLERPPPVPPSRSYT+TGN+
Sbjct  1123  IGGTVARPRPQPIAGTPPPDPQEKC-DQKIIQQTCNLFGLDLERPPPVPPSRSYTITGNS  1181

Query  1168  KLGYPQTRIMKMPFPEEGEGEV-VLLKGETVLVVGASPRRGHLLVEHNNTTLHVPYQFME  1226
             K+ YPQ R+MKM FPEEG+ E   L KGE V VVGAS  RGHL+VEH   + HVP+QFM 
Sbjct  1182  KISYPQNRVMKMNFPEEGQSEAPQLKKGEAVTVVGASTVRGHLMVEHKGQSFHVPFQFMT  1241

Query  1227  L  1227
             L
Sbjct  1242  L  1242


 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 44/68 (65%), Gaps = 1/68 (1%)

Query  110  LQTWLLQRSKLSSDASSSNEAVHLQQRLRSLSTELVTLRNRLHVNQPPNNSGPNSGASAP  169
            LQ +     KL  DASSSNEAVHLQQRL+SLSTELVTLRNRLHV   P         + P
Sbjct  19   LQKFWETEKKLQ-DASSSNEAVHLQQRLKSLSTELVTLRNRLHVGHGPGQGQSQGNGAQP  77

Query  170  LSKSPEKG  177
            ++ +P  G
Sbjct  78   VAPAPNAG  85


>M9MRE4_DROME unnamed protein product
Length=1426

 Score = 1373 bits (3555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 696/961 (72%), Positives = 774/961 (81%), Gaps = 38/961 (4%)

Query  301   GPATSTALDDLIHLPGPLTEDAVLKCLQARFCAKQYHTNVGPILVCINPYTDVRNPLTLT  360
             G ++   + DLIHL GPLTE AV++ LQARF  ++Y TNVGPIL+ INPY DV NPLTLT
Sbjct  468   GNSSPKDMQDLIHLSGPLTEHAVMRTLQARFNERRYFTNVGPILLSINPYLDVGNPLTLT  527

Query  361   STRAVPLAPQLNKVVQEAVRQQSETGYPQAIILSGTSGSGKTYASMLLLRQLFDVAGGGP  420
             STRA+PLAPQL K+VQEAVRQQSETGYPQAIILSGTSG+GKT  +ML+LRQLF +AGGGP
Sbjct  528   STRAMPLAPQLQKIVQEAVRQQSETGYPQAIILSGTSGAGKTANAMLMLRQLFAIAGGGP  587

Query  421   ETDAFKHLAAAFTVLRSLGSAKTATNSESSRIGHFIEVQVTDGALYRTKIHCYFLDQTRV  480
             ETDAFKHLAAAFTVLRSLGSAKT TNSESSRIG FIEVQVTDGALYRTKIHCYFLDQTRV
Sbjct  588   ETDAFKHLAAAFTVLRSLGSAKTTTNSESSRIGQFIEVQVTDGALYRTKIHCYFLDQTRV  647

Query  481   IRPLPDEKNYHIFYQMLAGLSHEERVKLNLEGYNLKNLRYLQHGDTRQDEAEDAIRFQAW  540
             IRPLP EKNYHIFYQ+LAGLS EER KL+L+GY+  NLRYL+ GD  Q+E EDA RFQAW
Sbjct  648   IRPLPKEKNYHIFYQLLAGLSREERQKLHLDGYSPANLRYLR-GDIGQNEQEDAARFQAW  706

Query  541   KACLGVLGIPFLDVVRVLAAVLILGNVGFTDRPGVEVGVIGENELASVAALLGVPPPALL  600
             K CLG+LGIPFLDVVRVLAAVL+LGNV F D  G+EV V GE EL SVA+LLGVPP AL 
Sbjct  707   KTCLGILGIPFLDVVRVLAAVLLLGNVQFIDGGGLEVDVKGETELNSVASLLGVPPAALF  766

Query  601   RGLTSRTHNARGQLVKSVCDANMSNMTRDSLAKALYCRTVATIVRRANSLKRLGSTLGTL  660
             RGLT+RTHN RGQLVKSVC    +NMTRD LAKALYCRTVATIVRRANSLKRLGSTLGTL
Sbjct  767   RGLTTRTHNVRGQLVKSVCGDGDANMTRDCLAKALYCRTVATIVRRANSLKRLGSTLGTL  826

Query  661   SSDSNESVHNQAEVTSQHASTIGSSAGGTGSRSMTALNNAVRHAT-DGFIGILDMFGFED  719
             SSDSNESVHNQA+V SQHASTIG   G  GS+SM ALNNAVRHAT DGFIGILDMFGFE+
Sbjct  827   SSDSNESVHNQADVASQHASTIG--GGNAGSKSMAALNNAVRHATSDGFIGILDMFGFEE  884

Query  720   PKP-SQLEHLCINLCAETMQHFYNTHIFKSSIESCRDEGIRCDVEVDYVDNVPCIDLISS  778
             P P + LEHLCINLCAETMQHFYNTHIFKSS+ESCRDEGI CD EVDYVDNVPCIDLISS
Sbjct  885   PSPHAHLEHLCINLCAETMQHFYNTHIFKSSVESCRDEGIVCDTEVDYVDNVPCIDLISS  944

Query  779   LRTGLLSMLDVECSIRGTAESYVAKVKVQHKQNPRLFEPRTV---DCRSFGIQHFAGRVT  835
             LRTGLLSMLD ECS+RGTAESYV K+KVQH+ + RL    T    D R F I+HFAGRV 
Sbjct  945   LRTGLLSMLDAECSVRGTAESYVTKLKVQHRSSTRLETKPTAEPHDPRMFLIRHFAGRVE  1004

Query  836   YDASDFLDTNKDVVPDDLVAVFYKHTCSFGFATHLFGSELKALYASDTVPRGVSFRISPT  895
             YD +DFLDTN+DVVPDDLV VFYKHTC+FGFATHLFGSELKALYA    PRG+SFRISPT
Sbjct  1005  YDTTDFLDTNRDVVPDDLVGVFYKHTCNFGFATHLFGSELKALYAQQQAPRGLSFRISPT  1064

Query  896   SHTDLLNGDEPISTLTQDFHTRLDNLLRTLVHARPHFVRCIRSNGTETPLHLDRGVTMRQ  955
             SH+DLLNGDEP+STLTQDFHTRLDNLLRTLVHARPHFVRCIRSNGTE     DR   +RQ
Sbjct  1065  SHSDLLNGDEPVSTLTQDFHTRLDNLLRTLVHARPHFVRCIRSNGTEAARSFDRATVVRQ  1124

Query  956   IRSLQVLETVNLMAGGYPHRMRFKAFNARYRLIAPFKQLRRAEEQAVEDTKLILQNAQQL  1015
             IRSLQVLETVNLMA G+PHRMRFK FNARYR++APF+ LRR+E++A+ED +LIL+ A + 
Sbjct  1125  IRSLQVLETVNLMASGFPHRMRFKQFNARYRMLAPFRLLRRSEDKALEDCQLILKYAMEQ  1184

Query  1016  KSKFGASTS--WALGKRHIFLSEGIRQQLENLRSETRRKAATVIQSTWRGWRVRRRWPLR  1073
                   S +  WA GKRH+FLSEGIRQ LE+LR+E R K+AT++Q+TWRGW  R++    
Sbjct  1185  PPVLDGSVTLAWAPGKRHVFLSEGIRQHLEHLRTEIRHKSATLMQATWRGWWWRKKMGNG  1244

Query  1074  KTTIGVTSGIGQKK-PQQPTSANTGTVQRNV------------------------TTATG  1108
                     G+ Q   P   T+ N+    +                          TT+ G
Sbjct  1245  GAKRSKIPGLQQAPLPNNKTTPNSAAQNKAASSTMAALAAVAAAAPISVPRLSAKTTSLG  1304

Query  1109  T-GTGTRPRPQPIAGTPPPDPSEKCADQKMIQQTCTLFGLDLERPPPVPPSRSYTVTGNT  1167
               GT  RPRPQPIAGTPPPDP EKC DQK+IQQTC LFGLDLERPPPVPPSRSYT+TGN+
Sbjct  1305  IGGTVARPRPQPIAGTPPPDPQEKC-DQKIIQQTCNLFGLDLERPPPVPPSRSYTITGNS  1363

Query  1168  KLGYPQTRIMKMPFPEEGEGEV-VLLKGETVLVVGASPRRGHLLVEHNNTTLHVPYQFME  1226
             K+ YPQ R+MKM FPEEG+ E   L KGE V VVGAS  RGHL+VEH   + HVP+QFM 
Sbjct  1364  KISYPQNRVMKMNFPEEGQSEAPQLKKGEAVTVVGASTVRGHLMVEHKGQSFHVPFQFMT  1423

Query  1227  L  1227
             L
Sbjct  1424  L  1424


 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 40/56 (71%), Gaps = 0/56 (0%)

Query  122  SDASSSNEAVHLQQRLRSLSTELVTLRNRLHVNQPPNNSGPNSGASAPLSKSPEKG  177
            +DASSSNEAVHLQQRL+SLSTELVTLRNRLHV   P         + P++ +P  G
Sbjct  212  TDASSSNEAVHLQQRLKSLSTELVTLRNRLHVGHGPGQGQSQGNGAQPVAPAPNAG  267


 Score = 36.2 bits (82),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 36/62 (58%), Gaps = 3/62 (5%)

Query  84   FRKCDEFLKRHGIRPEFFCRHRERLALQTWLLQRSKLSS---DASSSNEAVHLQQRLRSL  140
             R C++FL RH +RP+FFC++ + ++  T   +++K S+      S++  V +Q  L+  
Sbjct  115  LRLCEDFLCRHRMRPDFFCQYHKAVSSTTPSPKQTKTSTPIVQCKSASPPVKVQSDLKDF  174

Query  141  ST  142
             +
Sbjct  175  KS  176


>Q95VU9_DROME unnamed protein product
Length=1232

 Score = 1373 bits (3553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 696/961 (72%), Positives = 774/961 (81%), Gaps = 38/961 (4%)

Query  301   GPATSTALDDLIHLPGPLTEDAVLKCLQARFCAKQYHTNVGPILVCINPYTDVRNPLTLT  360
             G ++   + DLIHL GPLTE AV++ LQARF  ++Y TNVGPIL+ INPY DV NPLTLT
Sbjct  274   GNSSPKDMQDLIHLSGPLTEHAVMRTLQARFNERRYFTNVGPILLSINPYLDVGNPLTLT  333

Query  361   STRAVPLAPQLNKVVQEAVRQQSETGYPQAIILSGTSGSGKTYASMLLLRQLFDVAGGGP  420
             STRA+PLAPQL K+VQEAVRQQSETGYPQAIILSGTSG+GKT  +ML+LRQLF +AGGGP
Sbjct  334   STRAMPLAPQLQKIVQEAVRQQSETGYPQAIILSGTSGAGKTANAMLMLRQLFAIAGGGP  393

Query  421   ETDAFKHLAAAFTVLRSLGSAKTATNSESSRIGHFIEVQVTDGALYRTKIHCYFLDQTRV  480
             ETDAFKHLAAAFTVLRSLGSAKT TNSESSRIG FIEVQVTDGALYRTKIHCYFLDQTRV
Sbjct  394   ETDAFKHLAAAFTVLRSLGSAKTTTNSESSRIGQFIEVQVTDGALYRTKIHCYFLDQTRV  453

Query  481   IRPLPDEKNYHIFYQMLAGLSHEERVKLNLEGYNLKNLRYLQHGDTRQDEAEDAIRFQAW  540
             IRPLP EKNYHIFYQ+LAGLS EER KL+L+GY+  NLRYL+ GD  Q+E EDA RFQAW
Sbjct  454   IRPLPKEKNYHIFYQLLAGLSREERQKLHLDGYSPANLRYLR-GDIGQNEQEDAARFQAW  512

Query  541   KACLGVLGIPFLDVVRVLAAVLILGNVGFTDRPGVEVGVIGENELASVAALLGVPPPALL  600
             K CLG+LGIPFLDVVRVLAAVL+LGNV F D  G+EV V GE EL SVA+LLGVPP AL 
Sbjct  513   KTCLGILGIPFLDVVRVLAAVLLLGNVQFIDGGGLEVDVKGETELNSVASLLGVPPAALF  572

Query  601   RGLTSRTHNARGQLVKSVCDANMSNMTRDSLAKALYCRTVATIVRRANSLKRLGSTLGTL  660
             RGLT+RTHN RGQLVKSVC    +NMTRD LAKALYCRTVATIVRRANSLKRLGSTLGTL
Sbjct  573   RGLTTRTHNVRGQLVKSVCGDGDANMTRDCLAKALYCRTVATIVRRANSLKRLGSTLGTL  632

Query  661   SSDSNESVHNQAEVTSQHASTIGSSAGGTGSRSMTALNNAVRHAT-DGFIGILDMFGFED  719
             SSDSNESVHNQA+V SQHASTIG   G  GS+SM ALNNAVRHAT DGFIGILDMFGFE+
Sbjct  633   SSDSNESVHNQADVASQHASTIG--GGNAGSKSMAALNNAVRHATSDGFIGILDMFGFEE  690

Query  720   PKP-SQLEHLCINLCAETMQHFYNTHIFKSSIESCRDEGIRCDVEVDYVDNVPCIDLISS  778
             P P + LEHLCINLCAETMQHFYNTHIFKSS+ESCRDEGI CD EVDYVDNVPCIDLISS
Sbjct  691   PSPHAHLEHLCINLCAETMQHFYNTHIFKSSVESCRDEGIVCDTEVDYVDNVPCIDLISS  750

Query  779   LRTGLLSMLDVECSIRGTAESYVAKVKVQHKQNPRLFEPRTV---DCRSFGIQHFAGRVT  835
             LRTGLLSMLD ECS+RGTAESYV K+KVQH+ + RL    T    D R F I+HFAGRV 
Sbjct  751   LRTGLLSMLDAECSVRGTAESYVTKLKVQHRSSTRLETKPTAEPHDPRMFLIRHFAGRVE  810

Query  836   YDASDFLDTNKDVVPDDLVAVFYKHTCSFGFATHLFGSELKALYASDTVPRGVSFRISPT  895
             YD +DFLDTN+DVVPDDLV VFYKHTC+FGFATHLFGSELKALYA    PRG+SFRISPT
Sbjct  811   YDTTDFLDTNRDVVPDDLVGVFYKHTCNFGFATHLFGSELKALYAQQQAPRGLSFRISPT  870

Query  896   SHTDLLNGDEPISTLTQDFHTRLDNLLRTLVHARPHFVRCIRSNGTETPLHLDRGVTMRQ  955
             SH+DLLNGDEP+STLTQDFHTRLDNLLRTLVHARPHFVRCIRSNGTE     DR   +RQ
Sbjct  871   SHSDLLNGDEPVSTLTQDFHTRLDNLLRTLVHARPHFVRCIRSNGTEAARSFDRATVVRQ  930

Query  956   IRSLQVLETVNLMAGGYPHRMRFKAFNARYRLIAPFKQLRRAEEQAVEDTKLILQNAQQL  1015
             IRSLQVLETVNLMA G+PHRMRFK FNARYR++APF+ LRR+E++A+ED +LIL+ A + 
Sbjct  931   IRSLQVLETVNLMASGFPHRMRFKQFNARYRMLAPFRLLRRSEDKALEDCQLILKYAMEQ  990

Query  1016  KSKFGASTS--WALGKRHIFLSEGIRQQLENLRSETRRKAATVIQSTWRGWRVRRRWPLR  1073
                   S +  WA GKRH+FLSEGIRQ LE+LR+E R K+AT++Q+TWRGW  R++    
Sbjct  991   PPVLDGSVTLAWAPGKRHVFLSEGIRQHLEHLRTEIRHKSATLMQATWRGWWWRKKMGNG  1050

Query  1074  KTTIGVTSGIGQKK-PQQPTSANTGTVQRNV------------------------TTATG  1108
                     G+ Q   P   T+ N+    +                          TT+ G
Sbjct  1051  GAKRSKIPGLQQAPLPNNKTTPNSAAQNKAASSTMAALAAVAAAAPISVPRLSAKTTSLG  1110

Query  1109  T-GTGTRPRPQPIAGTPPPDPSEKCADQKMIQQTCTLFGLDLERPPPVPPSRSYTVTGNT  1167
               GT  RPRPQPIAGTPPPDP EKC DQK+IQQTC LFGLDLERPPPVPPSRSYT+TGN+
Sbjct  1111  IGGTVARPRPQPIAGTPPPDPQEKC-DQKIIQQTCNLFGLDLERPPPVPPSRSYTITGNS  1169

Query  1168  KLGYPQTRIMKMPFPEEGEGEV-VLLKGETVLVVGASPRRGHLLVEHNNTTLHVPYQFME  1226
             K+ YPQ R+MKM FPEEG+ E   L KGE V VVGAS  RGHL+VEH   + HVP+QFM 
Sbjct  1170  KISYPQNRVMKMNFPEEGQSEAPQLKKGEAVTVVGASTVRGHLMVEHKGQSFHVPFQFMT  1229

Query  1227  L  1227
             L
Sbjct  1230  L  1230


 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 39/55 (71%), Gaps = 0/55 (0%)

Query  123  DASSSNEAVHLQQRLRSLSTELVTLRNRLHVNQPPNNSGPNSGASAPLSKSPEKG  177
            DASSSNEAVHLQQRL+SLSTELVTLRNRLHV   P         + P++ +P  G
Sbjct  19   DASSSNEAVHLQQRLKSLSTELVTLRNRLHVGHGPGQGQSQGNGAQPVAPAPNAG  73



Lambda      K        H
   0.307    0.125    0.328 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 20462640800


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Nov 7, 2022  4:57 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_050573080.1 unconventional myosin-IXb isoform X1 [Bombus affinis]

Length=1234
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

B5RJR1_DROME  unnamed protein product                                 1375    0.0  
M9MRE4_DROME  unnamed protein product                                 1373    0.0  
Q95VU9_DROME  unnamed protein product                                 1373    0.0  


>B5RJR1_DROME unnamed protein product
Length=1244

 Score = 1375 bits (3558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 696/961 (72%), Positives = 774/961 (81%), Gaps = 38/961 (4%)

Query  301   GPATSTALDDLIHLPGPLTEDAVLKCLQARFCAKQYHTNVGPILVCINPYTDVRNPLTLT  360
             G ++   + DLIHL GPLTE AV++ LQARF  ++Y TNVGPIL+ INPY DV NPLTLT
Sbjct  286   GNSSPKDMQDLIHLSGPLTEHAVMRTLQARFNERRYFTNVGPILLSINPYLDVGNPLTLT  345

Query  361   STRAVPLAPQLNKVVQEAVRQQSETGYPQAIILSGTSGSGKTYASMLLLRQLFDVAGGGP  420
             STRA+PLAPQL K+VQEAVRQQSETGYPQAIILSGTSG+GKT  +ML+LRQLF +AGGGP
Sbjct  346   STRAMPLAPQLQKIVQEAVRQQSETGYPQAIILSGTSGAGKTANAMLMLRQLFAIAGGGP  405

Query  421   ETDAFKHLAAAFTVLRSLGSAKTATNSESSRIGHFIEVQVTDGALYRTKIHCYFLDQTRV  480
             ETDAFKHLAAAFTVLRSLGSAKT TNSESSRIG FIEVQVTDGALYRTKIHCYFLDQTRV
Sbjct  406   ETDAFKHLAAAFTVLRSLGSAKTTTNSESSRIGQFIEVQVTDGALYRTKIHCYFLDQTRV  465

Query  481   IRPLPDEKNYHIFYQMLAGLSHEERVKLNLEGYNLKNLRYLQHGDTRQDEAEDAIRFQAW  540
             IRPLP EKNYHIFYQ+LAGLS EER KL+L+GY+  NLRYL+ GD  Q+E EDA RFQAW
Sbjct  466   IRPLPKEKNYHIFYQLLAGLSREERQKLHLDGYSPANLRYLR-GDIGQNEQEDAARFQAW  524

Query  541   KACLGVLGIPFLDVVRVLAAVLILGNVGFTDRPGVEVGVIGENELASVAALLGVPPPALL  600
             K CLG+LGIPFLDVVRVLAAVL+LGNV F D  G+EV V GE EL SVA+LLGVPP AL 
Sbjct  525   KTCLGILGIPFLDVVRVLAAVLLLGNVQFIDGGGLEVDVKGETELNSVASLLGVPPAALF  584

Query  601   RGLTSRTHNARGQLVKSVCDANMSNMTRDSLAKALYCRTVATIVRRANSLKRLGSTLGTL  660
             RGLT+RTHN RGQLVKSVC    +NMTRD LAKALYCRTVATIVRRANSLKRLGSTLGTL
Sbjct  585   RGLTTRTHNVRGQLVKSVCGDGDANMTRDCLAKALYCRTVATIVRRANSLKRLGSTLGTL  644

Query  661   SSDSNESVHNQAEVTSQHASTIGSSAGGTGSRSMTALNNAVRHAT-DGFIGILDMFGFED  719
             SSDSNESVHNQA+V SQHASTIG   G  GS+SM ALNNAVRHAT DGFIGILDMFGFE+
Sbjct  645   SSDSNESVHNQADVASQHASTIG--GGNAGSKSMAALNNAVRHATSDGFIGILDMFGFEE  702

Query  720   PKP-SQLEHLCINLCAETMQHFYNTHIFKSSIESCRDEGIRCDVEVDYVDNVPCIDLISS  778
             P P + LEHLCINLCAETMQHFYNTHIFKSS+ESCRDEGI CD EVDYVDNVPCIDLISS
Sbjct  703   PSPHAHLEHLCINLCAETMQHFYNTHIFKSSVESCRDEGIVCDTEVDYVDNVPCIDLISS  762

Query  779   LRTGLLSMLDVECSIRGTAESYVAKVKVQHKQNPRLFEPRTV---DCRSFGIQHFAGRVT  835
             LRTGLLSMLD ECS+RGTAESYV K+KVQH+ + RL    T    D R F I+HFAGRV 
Sbjct  763   LRTGLLSMLDAECSVRGTAESYVTKLKVQHRSSTRLETKPTAEPHDPRMFLIRHFAGRVE  822

Query  836   YDASDFLDTNKDVVPDDLVAVFYKHTCSFGFATHLFGSELKALYASDTVPRGVSFRISPT  895
             YD +DFLDTN+DVVPDDLV VFYKHTC+FGFATHLFGSELKALYA    PRG+SFRISPT
Sbjct  823   YDTTDFLDTNRDVVPDDLVGVFYKHTCNFGFATHLFGSELKALYAQQQAPRGLSFRISPT  882

Query  896   SHTDLLNGDEPISTLTQDFHTRLDNLLRTLVHARPHFVRCIRSNGTETPLHLDRGVTMRQ  955
             SH+DLLNGDEP+STLTQDFHTRLDNLLRTLVHARPHFVRCIRSNGTE     DR   +RQ
Sbjct  883   SHSDLLNGDEPVSTLTQDFHTRLDNLLRTLVHARPHFVRCIRSNGTEAARSFDRATVVRQ  942

Query  956   IRSLQVLETVNLMAGGYPHRMRFKAFNARYRLIAPFKQLRRAEEQAVEDTKLILQNAQQL  1015
             IRSLQVLETVNLMA G+PHRMRFK FNARYR++APF+ LRR+E++A+ED +LIL+ A + 
Sbjct  943   IRSLQVLETVNLMASGFPHRMRFKQFNARYRMLAPFRLLRRSEDKALEDCQLILKYAMEQ  1002

Query  1016  KSKFGASTS--WALGKRHIFLSEGIRQQLENLRSETRRKAATVIQSTWRGWRVRRRWPLR  1073
                   S +  WA GKRH+FLSEGIRQ LE+LR+E R K+AT++Q+TWRGW  R++    
Sbjct  1003  PPVLDGSVTLAWAPGKRHVFLSEGIRQHLEHLRTEIRHKSATLMQATWRGWWWRKKMGNG  1062

Query  1074  KTTIGVTSGIGQKK-PQQPTSANTGTVQRNV------------------------TTATG  1108
                     G+ Q   P   T+ N+    +                          TT+ G
Sbjct  1063  GAKRSKIPGLQQAPLPNNKTTPNSAAQNKAASSTMAALAAVAAAAPISVPRLSAKTTSLG  1122

Query  1109  T-GTGTRPRPQPIAGTPPPDPSEKCADQKMIQQTCTLFGLDLERPPPVPPSRSYTVTGNT  1167
               GT  RPRPQPIAGTPPPDP EKC DQK+IQQTC LFGLDLERPPPVPPSRSYT+TGN+
Sbjct  1123  IGGTVARPRPQPIAGTPPPDPQEKC-DQKIIQQTCNLFGLDLERPPPVPPSRSYTITGNS  1181

Query  1168  KLGYPQTRIMKMPFPEEGEGEV-VLLKGETVLVVGASPRRGHLLVEHNNTTLHVPYQFME  1226
             K+ YPQ R+MKM FPEEG+ E   L KGE V VVGAS  RGHL+VEH   + HVP+QFM 
Sbjct  1182  KISYPQNRVMKMNFPEEGQSEAPQLKKGEAVTVVGASTVRGHLMVEHKGQSFHVPFQFMT  1241

Query  1227  L  1227
             L
Sbjct  1242  L  1242


 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 44/68 (65%), Gaps = 1/68 (1%)

Query  110  LQTWLLQRSKLSSDASSSNEAVHLQQRLRSLSTELVTLRNRLHVNQPPNNSGPNSGASAP  169
            LQ +     KL  DASSSNEAVHLQQRL+SLSTELVTLRNRLHV   P         + P
Sbjct  19   LQKFWETEKKLQ-DASSSNEAVHLQQRLKSLSTELVTLRNRLHVGHGPGQGQSQGNGAQP  77

Query  170  LSKSPEKG  177
            ++ +P  G
Sbjct  78   VAPAPNAG  85


>M9MRE4_DROME unnamed protein product
Length=1426

 Score = 1373 bits (3555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 696/961 (72%), Positives = 774/961 (81%), Gaps = 38/961 (4%)

Query  301   GPATSTALDDLIHLPGPLTEDAVLKCLQARFCAKQYHTNVGPILVCINPYTDVRNPLTLT  360
             G ++   + DLIHL GPLTE AV++ LQARF  ++Y TNVGPIL+ INPY DV NPLTLT
Sbjct  468   GNSSPKDMQDLIHLSGPLTEHAVMRTLQARFNERRYFTNVGPILLSINPYLDVGNPLTLT  527

Query  361   STRAVPLAPQLNKVVQEAVRQQSETGYPQAIILSGTSGSGKTYASMLLLRQLFDVAGGGP  420
             STRA+PLAPQL K+VQEAVRQQSETGYPQAIILSGTSG+GKT  +ML+LRQLF +AGGGP
Sbjct  528   STRAMPLAPQLQKIVQEAVRQQSETGYPQAIILSGTSGAGKTANAMLMLRQLFAIAGGGP  587

Query  421   ETDAFKHLAAAFTVLRSLGSAKTATNSESSRIGHFIEVQVTDGALYRTKIHCYFLDQTRV  480
             ETDAFKHLAAAFTVLRSLGSAKT TNSESSRIG FIEVQVTDGALYRTKIHCYFLDQTRV
Sbjct  588   ETDAFKHLAAAFTVLRSLGSAKTTTNSESSRIGQFIEVQVTDGALYRTKIHCYFLDQTRV  647

Query  481   IRPLPDEKNYHIFYQMLAGLSHEERVKLNLEGYNLKNLRYLQHGDTRQDEAEDAIRFQAW  540
             IRPLP EKNYHIFYQ+LAGLS EER KL+L+GY+  NLRYL+ GD  Q+E EDA RFQAW
Sbjct  648   IRPLPKEKNYHIFYQLLAGLSREERQKLHLDGYSPANLRYLR-GDIGQNEQEDAARFQAW  706

Query  541   KACLGVLGIPFLDVVRVLAAVLILGNVGFTDRPGVEVGVIGENELASVAALLGVPPPALL  600
             K CLG+LGIPFLDVVRVLAAVL+LGNV F D  G+EV V GE EL SVA+LLGVPP AL 
Sbjct  707   KTCLGILGIPFLDVVRVLAAVLLLGNVQFIDGGGLEVDVKGETELNSVASLLGVPPAALF  766

Query  601   RGLTSRTHNARGQLVKSVCDANMSNMTRDSLAKALYCRTVATIVRRANSLKRLGSTLGTL  660
             RGLT+RTHN RGQLVKSVC    +NMTRD LAKALYCRTVATIVRRANSLKRLGSTLGTL
Sbjct  767   RGLTTRTHNVRGQLVKSVCGDGDANMTRDCLAKALYCRTVATIVRRANSLKRLGSTLGTL  826

Query  661   SSDSNESVHNQAEVTSQHASTIGSSAGGTGSRSMTALNNAVRHAT-DGFIGILDMFGFED  719
             SSDSNESVHNQA+V SQHASTIG   G  GS+SM ALNNAVRHAT DGFIGILDMFGFE+
Sbjct  827   SSDSNESVHNQADVASQHASTIG--GGNAGSKSMAALNNAVRHATSDGFIGILDMFGFEE  884

Query  720   PKP-SQLEHLCINLCAETMQHFYNTHIFKSSIESCRDEGIRCDVEVDYVDNVPCIDLISS  778
             P P + LEHLCINLCAETMQHFYNTHIFKSS+ESCRDEGI CD EVDYVDNVPCIDLISS
Sbjct  885   PSPHAHLEHLCINLCAETMQHFYNTHIFKSSVESCRDEGIVCDTEVDYVDNVPCIDLISS  944

Query  779   LRTGLLSMLDVECSIRGTAESYVAKVKVQHKQNPRLFEPRTV---DCRSFGIQHFAGRVT  835
             LRTGLLSMLD ECS+RGTAESYV K+KVQH+ + RL    T    D R F I+HFAGRV 
Sbjct  945   LRTGLLSMLDAECSVRGTAESYVTKLKVQHRSSTRLETKPTAEPHDPRMFLIRHFAGRVE  1004

Query  836   YDASDFLDTNKDVVPDDLVAVFYKHTCSFGFATHLFGSELKALYASDTVPRGVSFRISPT  895
             YD +DFLDTN+DVVPDDLV VFYKHTC+FGFATHLFGSELKALYA    PRG+SFRISPT
Sbjct  1005  YDTTDFLDTNRDVVPDDLVGVFYKHTCNFGFATHLFGSELKALYAQQQAPRGLSFRISPT  1064

Query  896   SHTDLLNGDEPISTLTQDFHTRLDNLLRTLVHARPHFVRCIRSNGTETPLHLDRGVTMRQ  955
             SH+DLLNGDEP+STLTQDFHTRLDNLLRTLVHARPHFVRCIRSNGTE     DR   +RQ
Sbjct  1065  SHSDLLNGDEPVSTLTQDFHTRLDNLLRTLVHARPHFVRCIRSNGTEAARSFDRATVVRQ  1124

Query  956   IRSLQVLETVNLMAGGYPHRMRFKAFNARYRLIAPFKQLRRAEEQAVEDTKLILQNAQQL  1015
             IRSLQVLETVNLMA G+PHRMRFK FNARYR++APF+ LRR+E++A+ED +LIL+ A + 
Sbjct  1125  IRSLQVLETVNLMASGFPHRMRFKQFNARYRMLAPFRLLRRSEDKALEDCQLILKYAMEQ  1184

Query  1016  KSKFGASTS--WALGKRHIFLSEGIRQQLENLRSETRRKAATVIQSTWRGWRVRRRWPLR  1073
                   S +  WA GKRH+FLSEGIRQ LE+LR+E R K+AT++Q+TWRGW  R++    
Sbjct  1185  PPVLDGSVTLAWAPGKRHVFLSEGIRQHLEHLRTEIRHKSATLMQATWRGWWWRKKMGNG  1244

Query  1074  KTTIGVTSGIGQKK-PQQPTSANTGTVQRNV------------------------TTATG  1108
                     G+ Q   P   T+ N+    +                          TT+ G
Sbjct  1245  GAKRSKIPGLQQAPLPNNKTTPNSAAQNKAASSTMAALAAVAAAAPISVPRLSAKTTSLG  1304

Query  1109  T-GTGTRPRPQPIAGTPPPDPSEKCADQKMIQQTCTLFGLDLERPPPVPPSRSYTVTGNT  1167
               GT  RPRPQPIAGTPPPDP EKC DQK+IQQTC LFGLDLERPPPVPPSRSYT+TGN+
Sbjct  1305  IGGTVARPRPQPIAGTPPPDPQEKC-DQKIIQQTCNLFGLDLERPPPVPPSRSYTITGNS  1363

Query  1168  KLGYPQTRIMKMPFPEEGEGEV-VLLKGETVLVVGASPRRGHLLVEHNNTTLHVPYQFME  1226
             K+ YPQ R+MKM FPEEG+ E   L KGE V VVGAS  RGHL+VEH   + HVP+QFM 
Sbjct  1364  KISYPQNRVMKMNFPEEGQSEAPQLKKGEAVTVVGASTVRGHLMVEHKGQSFHVPFQFMT  1423

Query  1227  L  1227
             L
Sbjct  1424  L  1424


 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 40/56 (71%), Gaps = 0/56 (0%)

Query  122  SDASSSNEAVHLQQRLRSLSTELVTLRNRLHVNQPPNNSGPNSGASAPLSKSPEKG  177
            +DASSSNEAVHLQQRL+SLSTELVTLRNRLHV   P         + P++ +P  G
Sbjct  212  TDASSSNEAVHLQQRLKSLSTELVTLRNRLHVGHGPGQGQSQGNGAQPVAPAPNAG  267


 Score = 36.2 bits (82),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 36/62 (58%), Gaps = 3/62 (5%)

Query  84   FRKCDEFLKRHGIRPEFFCRHRERLALQTWLLQRSKLSS---DASSSNEAVHLQQRLRSL  140
             R C++FL RH +RP+FFC++ + ++  T   +++K S+      S++  V +Q  L+  
Sbjct  115  LRLCEDFLCRHRMRPDFFCQYHKAVSSTTPSPKQTKTSTPIVQCKSASPPVKVQSDLKDF  174

Query  141  ST  142
             +
Sbjct  175  KS  176


>Q95VU9_DROME unnamed protein product
Length=1232

 Score = 1373 bits (3553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 696/961 (72%), Positives = 774/961 (81%), Gaps = 38/961 (4%)

Query  301   GPATSTALDDLIHLPGPLTEDAVLKCLQARFCAKQYHTNVGPILVCINPYTDVRNPLTLT  360
             G ++   + DLIHL GPLTE AV++ LQARF  ++Y TNVGPIL+ INPY DV NPLTLT
Sbjct  274   GNSSPKDMQDLIHLSGPLTEHAVMRTLQARFNERRYFTNVGPILLSINPYLDVGNPLTLT  333

Query  361   STRAVPLAPQLNKVVQEAVRQQSETGYPQAIILSGTSGSGKTYASMLLLRQLFDVAGGGP  420
             STRA+PLAPQL K+VQEAVRQQSETGYPQAIILSGTSG+GKT  +ML+LRQLF +AGGGP
Sbjct  334   STRAMPLAPQLQKIVQEAVRQQSETGYPQAIILSGTSGAGKTANAMLMLRQLFAIAGGGP  393

Query  421   ETDAFKHLAAAFTVLRSLGSAKTATNSESSRIGHFIEVQVTDGALYRTKIHCYFLDQTRV  480
             ETDAFKHLAAAFTVLRSLGSAKT TNSESSRIG FIEVQVTDGALYRTKIHCYFLDQTRV
Sbjct  394   ETDAFKHLAAAFTVLRSLGSAKTTTNSESSRIGQFIEVQVTDGALYRTKIHCYFLDQTRV  453

Query  481   IRPLPDEKNYHIFYQMLAGLSHEERVKLNLEGYNLKNLRYLQHGDTRQDEAEDAIRFQAW  540
             IRPLP EKNYHIFYQ+LAGLS EER KL+L+GY+  NLRYL+ GD  Q+E EDA RFQAW
Sbjct  454   IRPLPKEKNYHIFYQLLAGLSREERQKLHLDGYSPANLRYLR-GDIGQNEQEDAARFQAW  512

Query  541   KACLGVLGIPFLDVVRVLAAVLILGNVGFTDRPGVEVGVIGENELASVAALLGVPPPALL  600
             K CLG+LGIPFLDVVRVLAAVL+LGNV F D  G+EV V GE EL SVA+LLGVPP AL 
Sbjct  513   KTCLGILGIPFLDVVRVLAAVLLLGNVQFIDGGGLEVDVKGETELNSVASLLGVPPAALF  572

Query  601   RGLTSRTHNARGQLVKSVCDANMSNMTRDSLAKALYCRTVATIVRRANSLKRLGSTLGTL  660
             RGLT+RTHN RGQLVKSVC    +NMTRD LAKALYCRTVATIVRRANSLKRLGSTLGTL
Sbjct  573   RGLTTRTHNVRGQLVKSVCGDGDANMTRDCLAKALYCRTVATIVRRANSLKRLGSTLGTL  632

Query  661   SSDSNESVHNQAEVTSQHASTIGSSAGGTGSRSMTALNNAVRHAT-DGFIGILDMFGFED  719
             SSDSNESVHNQA+V SQHASTIG   G  GS+SM ALNNAVRHAT DGFIGILDMFGFE+
Sbjct  633   SSDSNESVHNQADVASQHASTIG--GGNAGSKSMAALNNAVRHATSDGFIGILDMFGFEE  690

Query  720   PKP-SQLEHLCINLCAETMQHFYNTHIFKSSIESCRDEGIRCDVEVDYVDNVPCIDLISS  778
             P P + LEHLCINLCAETMQHFYNTHIFKSS+ESCRDEGI CD EVDYVDNVPCIDLISS
Sbjct  691   PSPHAHLEHLCINLCAETMQHFYNTHIFKSSVESCRDEGIVCDTEVDYVDNVPCIDLISS  750

Query  779   LRTGLLSMLDVECSIRGTAESYVAKVKVQHKQNPRLFEPRTV---DCRSFGIQHFAGRVT  835
             LRTGLLSMLD ECS+RGTAESYV K+KVQH+ + RL    T    D R F I+HFAGRV 
Sbjct  751   LRTGLLSMLDAECSVRGTAESYVTKLKVQHRSSTRLETKPTAEPHDPRMFLIRHFAGRVE  810

Query  836   YDASDFLDTNKDVVPDDLVAVFYKHTCSFGFATHLFGSELKALYASDTVPRGVSFRISPT  895
             YD +DFLDTN+DVVPDDLV VFYKHTC+FGFATHLFGSELKALYA    PRG+SFRISPT
Sbjct  811   YDTTDFLDTNRDVVPDDLVGVFYKHTCNFGFATHLFGSELKALYAQQQAPRGLSFRISPT  870

Query  896   SHTDLLNGDEPISTLTQDFHTRLDNLLRTLVHARPHFVRCIRSNGTETPLHLDRGVTMRQ  955
             SH+DLLNGDEP+STLTQDFHTRLDNLLRTLVHARPHFVRCIRSNGTE     DR   +RQ
Sbjct  871   SHSDLLNGDEPVSTLTQDFHTRLDNLLRTLVHARPHFVRCIRSNGTEAARSFDRATVVRQ  930

Query  956   IRSLQVLETVNLMAGGYPHRMRFKAFNARYRLIAPFKQLRRAEEQAVEDTKLILQNAQQL  1015
             IRSLQVLETVNLMA G+PHRMRFK FNARYR++APF+ LRR+E++A+ED +LIL+ A + 
Sbjct  931   IRSLQVLETVNLMASGFPHRMRFKQFNARYRMLAPFRLLRRSEDKALEDCQLILKYAMEQ  990

Query  1016  KSKFGASTS--WALGKRHIFLSEGIRQQLENLRSETRRKAATVIQSTWRGWRVRRRWPLR  1073
                   S +  WA GKRH+FLSEGIRQ LE+LR+E R K+AT++Q+TWRGW  R++    
Sbjct  991   PPVLDGSVTLAWAPGKRHVFLSEGIRQHLEHLRTEIRHKSATLMQATWRGWWWRKKMGNG  1050

Query  1074  KTTIGVTSGIGQKK-PQQPTSANTGTVQRNV------------------------TTATG  1108
                     G+ Q   P   T+ N+    +                          TT+ G
Sbjct  1051  GAKRSKIPGLQQAPLPNNKTTPNSAAQNKAASSTMAALAAVAAAAPISVPRLSAKTTSLG  1110

Query  1109  T-GTGTRPRPQPIAGTPPPDPSEKCADQKMIQQTCTLFGLDLERPPPVPPSRSYTVTGNT  1167
               GT  RPRPQPIAGTPPPDP EKC DQK+IQQTC LFGLDLERPPPVPPSRSYT+TGN+
Sbjct  1111  IGGTVARPRPQPIAGTPPPDPQEKC-DQKIIQQTCNLFGLDLERPPPVPPSRSYTITGNS  1169

Query  1168  KLGYPQTRIMKMPFPEEGEGEV-VLLKGETVLVVGASPRRGHLLVEHNNTTLHVPYQFME  1226
             K+ YPQ R+MKM FPEEG+ E   L KGE V VVGAS  RGHL+VEH   + HVP+QFM 
Sbjct  1170  KISYPQNRVMKMNFPEEGQSEAPQLKKGEAVTVVGASTVRGHLMVEHKGQSFHVPFQFMT  1229

Query  1227  L  1227
             L
Sbjct  1230  L  1230


 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 39/55 (71%), Gaps = 0/55 (0%)

Query  123  DASSSNEAVHLQQRLRSLSTELVTLRNRLHVNQPPNNSGPNSGASAPLSKSPEKG  177
            DASSSNEAVHLQQRL+SLSTELVTLRNRLHV   P         + P++ +P  G
Sbjct  19   DASSSNEAVHLQQRLKSLSTELVTLRNRLHVGHGPGQGQSQGNGAQPVAPAPNAG  73



Lambda      K        H
   0.318    0.133    0.398 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 16027285120


Query= XP_050573081.1 unconventional myosin-IXb isoform X2 [Bombus affinis]

Length=1233
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

B5RJR1_DROME  unnamed protein product                                 1368    0.0  
M9MRE4_DROME  unnamed protein product                                 1367    0.0  
Q95VU9_DROME  unnamed protein product                                 1366    0.0  


>B5RJR1_DROME unnamed protein product
Length=1244

 Score = 1368 bits (3541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 695/961 (72%), Positives = 773/961 (80%), Gaps = 39/961 (4%)

Query  301   GPATSTALDDLIHLPGPLTEDAVLKCLQARFCAKQYHTNVGPILVCINPYTDVRNPLTLT  360
             G ++   + DLIHL GPLTE AV++ LQARF  ++Y TNVGPIL+ INPY DV NPLTLT
Sbjct  286   GNSSPKDMQDLIHLSGPLTEHAVMRTLQARFNERRYFTNVGPILLSINPYLDVGNPLTLT  345

Query  361   STRAVPLAPQLNKVVQEAVRQQSETGYPQAIILSGTSGSGKTYASMLLLRQLFDVAGGGP  420
             STRA+PLAPQL K+VQEAVRQQSETGYPQAIILSGTSG+GKT  +ML+LRQLF +AGGGP
Sbjct  346   STRAMPLAPQLQKIVQEAVRQQSETGYPQAIILSGTSGAGKTANAMLMLRQLFAIAGGGP  405

Query  421   ETDAFKHLAAAFTVLRSLGSAKTATNSESSRIGHFIEVQVTDGALYRTKIHCYFLDQTRV  480
             ETDAFKHLAAAFTVLRSLGSAKT TNSESSRIG FIEVQVTDGALYRTKIHCYFLDQTRV
Sbjct  406   ETDAFKHLAAAFTVLRSLGSAKTTTNSESSRIGQFIEVQVTDGALYRTKIHCYFLDQTRV  465

Query  481   IRPLPDEKNYHIFYQMLAGLSHEERVKLNLEGYNLKNLRYLQHGDTRQDEAEDAIRFQAW  540
             IRPLP EKNYHIFYQ+LAGLS EER KL+L+GY+  NLRYL+ GD  Q+E EDA RFQAW
Sbjct  466   IRPLPKEKNYHIFYQLLAGLSREERQKLHLDGYSPANLRYLR-GDIGQNEQEDAARFQAW  524

Query  541   KACLGVLGIPFLDVVRVLAAVLILGNVGFTDRPGVEVGVIGENELASVAALLGVPPPALL  600
             K CLG+LGIPFLDVVRVLAAVL+LGNV F D  G+EV V GE EL SVA+LLGVPP AL 
Sbjct  525   KTCLGILGIPFLDVVRVLAAVLLLGNVQFIDGGGLEVDVKGETELNSVASLLGVPPAALF  584

Query  601   RGLTSRTHNARGQLVKSVCDANMSNMTRDSLAKALYCRTVATIVRRANSLKRLGSTLGTL  660
             RGLT+RTHN RGQLVKSVC    +NMTRD LAKALYCRTVATIVRRANSLKRLGSTLGTL
Sbjct  585   RGLTTRTHNVRGQLVKSVCGDGDANMTRDCLAKALYCRTVATIVRRANSLKRLGSTLGTL  644

Query  661   SSDSNESVHNQAEVTSQHASTIGSSAGGTGSRSMTALNNAVRHAT-DGFIGILDMFGFED  719
             SSDSNESVHNQA+V SQHASTIG   G  GS+SM ALNNAVRHAT DGFIGILDMFGFE+
Sbjct  645   SSDSNESVHNQADVASQHASTIG--GGNAGSKSMAALNNAVRHATSDGFIGILDMFGFEE  702

Query  720   PKP-SQLEHLCINLCAETMQHFYNTHIFKSSIESCRDEGIRCDVEVDYVDNVPCIDLISS  778
             P P + LEHLCINLCAETMQHFYNTHIFKSS+ESCRDEGI CD EVDYVDNVPCIDLISS
Sbjct  703   PSPHAHLEHLCINLCAETMQHFYNTHIFKSSVESCRDEGIVCDTEVDYVDNVPCIDLISS  762

Query  779   LRTGLLSMLDVECSIRGTAESYVAKVKVQHKQNPRLFEPRTV---DCRSFGIQHFAGRVT  835
             LRTGLLSMLD ECS+RGTAESYV K+KVQH+ + RL    T    D R F I+HFAGRV 
Sbjct  763   LRTGLLSMLDAECSVRGTAESYVTKLKVQHRSSTRLETKPTAEPHDPRMFLIRHFAGRVE  822

Query  836   YDASDFLDTNKDVVPDDLVAVFYKHTCSFGFATHLFGSELKALYASDTVPRGVSFRISPT  895
             YD +DFLDTN+DVVPDDLV VFYKHTC+FGFATHLFGSELKALYA    PRG+SFRISPT
Sbjct  823   YDTTDFLDTNRDVVPDDLVGVFYKHTCNFGFATHLFGSELKALYAQQQAPRGLSFRISPT  882

Query  896   SHTDLLNGDEPISTLTQDFHTRLDNLLRTLVHARPHFVRCIRSNGTETPLHLDRGVTMRQ  955
             SH+DLLNGDEP+STLTQDFHTRLDNLLRTLVHARPHFVRCIRSNGTE     DR   +RQ
Sbjct  883   SHSDLLNGDEPVSTLTQDFHTRLDNLLRTLVHARPHFVRCIRSNGTEAARSFDRATVVRQ  942

Query  956   IRSLQVLETVNLMAGGYPHRMRFKAFNARYRLIAPFKQLRRAEEQAVEDTKLILQNAQQL  1015
             IRSLQVLETVNLMA G+PHRMRFK FNARYR++APF+ LRR+E++A+ED +LIL+ A + 
Sbjct  943   IRSLQVLETVNLMASGFPHRMRFKQFNARYRMLAPFRLLRRSEDKALEDCQLILKYAMEQ  1002

Query  1016  KSKFGASTS--WALGKRHIFLSEGIRQQLENLRSETRRKAATVIQSTWRGWRVRRRWPLR  1073
                   S +  WA GKRH+FLSEGIRQ LE+LR+E R K+AT++Q+TWRGW  R++    
Sbjct  1003  PPVLDGSVTLAWAPGKRHVFLSEGIRQHLEHLRTEIRHKSATLMQATWRGWWWRKKMGNG  1062

Query  1074  KTTIGVTSGIGQKK-PQQPTSANTGTVQRNV------------------------TTATG  1108
                     G+ Q   P   T+ N+    +                          TT+ G
Sbjct  1063  GAKRSKIPGLQQAPLPNNKTTPNSAAQNKAASSTMAALAAVAAAAPISVPRLSAKTTSLG  1122

Query  1109  T-GTGTRPRPQPIAGTPPPDPSEKCADQKMIQQTCTLFGLDLERPPPVPPSRSYTVTGNT  1167
               GT  RPRPQPIAGTPPPDP EKC DQK+IQQTC LFGLDLERPPPVPPSRSYT+TGN+
Sbjct  1123  IGGTVARPRPQPIAGTPPPDPQEKC-DQKIIQQTCNLFGLDLERPPPVPPSRSYTITGNS  1181

Query  1168  KLGYPQTRIMKMPFP-EGEGEV-VLLKGETVLVVGASPRRGHLLVEHNNTTLHVPYQFME  1225
             K+ YPQ R+MKM FP EG+ E   L KGE V VVGAS  RGHL+VEH   + HVP+QFM 
Sbjct  1182  KISYPQNRVMKMNFPEEGQSEAPQLKKGEAVTVVGASTVRGHLMVEHKGQSFHVPFQFMT  1241

Query  1226  L  1226
             L
Sbjct  1242  L  1242


 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 44/68 (65%), Gaps = 1/68 (1%)

Query  110  LQTWLLQRSKLSSDASSSNEAVHLQQRLRSLSTELVTLRNRLHVNQPPNNSGPNSGASAP  169
            LQ +     KL  DASSSNEAVHLQQRL+SLSTELVTLRNRLHV   P         + P
Sbjct  19   LQKFWETEKKLQ-DASSSNEAVHLQQRLKSLSTELVTLRNRLHVGHGPGQGQSQGNGAQP  77

Query  170  LSKSPEKG  177
            ++ +P  G
Sbjct  78   VAPAPNAG  85


>M9MRE4_DROME unnamed protein product
Length=1426

 Score = 1367 bits (3539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 695/961 (72%), Positives = 773/961 (80%), Gaps = 39/961 (4%)

Query  301   GPATSTALDDLIHLPGPLTEDAVLKCLQARFCAKQYHTNVGPILVCINPYTDVRNPLTLT  360
             G ++   + DLIHL GPLTE AV++ LQARF  ++Y TNVGPIL+ INPY DV NPLTLT
Sbjct  468   GNSSPKDMQDLIHLSGPLTEHAVMRTLQARFNERRYFTNVGPILLSINPYLDVGNPLTLT  527

Query  361   STRAVPLAPQLNKVVQEAVRQQSETGYPQAIILSGTSGSGKTYASMLLLRQLFDVAGGGP  420
             STRA+PLAPQL K+VQEAVRQQSETGYPQAIILSGTSG+GKT  +ML+LRQLF +AGGGP
Sbjct  528   STRAMPLAPQLQKIVQEAVRQQSETGYPQAIILSGTSGAGKTANAMLMLRQLFAIAGGGP  587

Query  421   ETDAFKHLAAAFTVLRSLGSAKTATNSESSRIGHFIEVQVTDGALYRTKIHCYFLDQTRV  480
             ETDAFKHLAAAFTVLRSLGSAKT TNSESSRIG FIEVQVTDGALYRTKIHCYFLDQTRV
Sbjct  588   ETDAFKHLAAAFTVLRSLGSAKTTTNSESSRIGQFIEVQVTDGALYRTKIHCYFLDQTRV  647

Query  481   IRPLPDEKNYHIFYQMLAGLSHEERVKLNLEGYNLKNLRYLQHGDTRQDEAEDAIRFQAW  540
             IRPLP EKNYHIFYQ+LAGLS EER KL+L+GY+  NLRYL+ GD  Q+E EDA RFQAW
Sbjct  648   IRPLPKEKNYHIFYQLLAGLSREERQKLHLDGYSPANLRYLR-GDIGQNEQEDAARFQAW  706

Query  541   KACLGVLGIPFLDVVRVLAAVLILGNVGFTDRPGVEVGVIGENELASVAALLGVPPPALL  600
             K CLG+LGIPFLDVVRVLAAVL+LGNV F D  G+EV V GE EL SVA+LLGVPP AL 
Sbjct  707   KTCLGILGIPFLDVVRVLAAVLLLGNVQFIDGGGLEVDVKGETELNSVASLLGVPPAALF  766

Query  601   RGLTSRTHNARGQLVKSVCDANMSNMTRDSLAKALYCRTVATIVRRANSLKRLGSTLGTL  660
             RGLT+RTHN RGQLVKSVC    +NMTRD LAKALYCRTVATIVRRANSLKRLGSTLGTL
Sbjct  767   RGLTTRTHNVRGQLVKSVCGDGDANMTRDCLAKALYCRTVATIVRRANSLKRLGSTLGTL  826

Query  661   SSDSNESVHNQAEVTSQHASTIGSSAGGTGSRSMTALNNAVRHAT-DGFIGILDMFGFED  719
             SSDSNESVHNQA+V SQHASTIG   G  GS+SM ALNNAVRHAT DGFIGILDMFGFE+
Sbjct  827   SSDSNESVHNQADVASQHASTIG--GGNAGSKSMAALNNAVRHATSDGFIGILDMFGFEE  884

Query  720   PKP-SQLEHLCINLCAETMQHFYNTHIFKSSIESCRDEGIRCDVEVDYVDNVPCIDLISS  778
             P P + LEHLCINLCAETMQHFYNTHIFKSS+ESCRDEGI CD EVDYVDNVPCIDLISS
Sbjct  885   PSPHAHLEHLCINLCAETMQHFYNTHIFKSSVESCRDEGIVCDTEVDYVDNVPCIDLISS  944

Query  779   LRTGLLSMLDVECSIRGTAESYVAKVKVQHKQNPRLFEPRTV---DCRSFGIQHFAGRVT  835
             LRTGLLSMLD ECS+RGTAESYV K+KVQH+ + RL    T    D R F I+HFAGRV 
Sbjct  945   LRTGLLSMLDAECSVRGTAESYVTKLKVQHRSSTRLETKPTAEPHDPRMFLIRHFAGRVE  1004

Query  836   YDASDFLDTNKDVVPDDLVAVFYKHTCSFGFATHLFGSELKALYASDTVPRGVSFRISPT  895
             YD +DFLDTN+DVVPDDLV VFYKHTC+FGFATHLFGSELKALYA    PRG+SFRISPT
Sbjct  1005  YDTTDFLDTNRDVVPDDLVGVFYKHTCNFGFATHLFGSELKALYAQQQAPRGLSFRISPT  1064

Query  896   SHTDLLNGDEPISTLTQDFHTRLDNLLRTLVHARPHFVRCIRSNGTETPLHLDRGVTMRQ  955
             SH+DLLNGDEP+STLTQDFHTRLDNLLRTLVHARPHFVRCIRSNGTE     DR   +RQ
Sbjct  1065  SHSDLLNGDEPVSTLTQDFHTRLDNLLRTLVHARPHFVRCIRSNGTEAARSFDRATVVRQ  1124

Query  956   IRSLQVLETVNLMAGGYPHRMRFKAFNARYRLIAPFKQLRRAEEQAVEDTKLILQNAQQL  1015
             IRSLQVLETVNLMA G+PHRMRFK FNARYR++APF+ LRR+E++A+ED +LIL+ A + 
Sbjct  1125  IRSLQVLETVNLMASGFPHRMRFKQFNARYRMLAPFRLLRRSEDKALEDCQLILKYAMEQ  1184

Query  1016  KSKFGASTS--WALGKRHIFLSEGIRQQLENLRSETRRKAATVIQSTWRGWRVRRRWPLR  1073
                   S +  WA GKRH+FLSEGIRQ LE+LR+E R K+AT++Q+TWRGW  R++    
Sbjct  1185  PPVLDGSVTLAWAPGKRHVFLSEGIRQHLEHLRTEIRHKSATLMQATWRGWWWRKKMGNG  1244

Query  1074  KTTIGVTSGIGQKK-PQQPTSANTGTVQRNV------------------------TTATG  1108
                     G+ Q   P   T+ N+    +                          TT+ G
Sbjct  1245  GAKRSKIPGLQQAPLPNNKTTPNSAAQNKAASSTMAALAAVAAAAPISVPRLSAKTTSLG  1304

Query  1109  T-GTGTRPRPQPIAGTPPPDPSEKCADQKMIQQTCTLFGLDLERPPPVPPSRSYTVTGNT  1167
               GT  RPRPQPIAGTPPPDP EKC DQK+IQQTC LFGLDLERPPPVPPSRSYT+TGN+
Sbjct  1305  IGGTVARPRPQPIAGTPPPDPQEKC-DQKIIQQTCNLFGLDLERPPPVPPSRSYTITGNS  1363

Query  1168  KLGYPQTRIMKMPFP-EGEGEV-VLLKGETVLVVGASPRRGHLLVEHNNTTLHVPYQFME  1225
             K+ YPQ R+MKM FP EG+ E   L KGE V VVGAS  RGHL+VEH   + HVP+QFM 
Sbjct  1364  KISYPQNRVMKMNFPEEGQSEAPQLKKGEAVTVVGASTVRGHLMVEHKGQSFHVPFQFMT  1423

Query  1226  L  1226
             L
Sbjct  1424  L  1424


 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 40/56 (71%), Gaps = 0/56 (0%)

Query  122  SDASSSNEAVHLQQRLRSLSTELVTLRNRLHVNQPPNNSGPNSGASAPLSKSPEKG  177
            +DASSSNEAVHLQQRL+SLSTELVTLRNRLHV   P         + P++ +P  G
Sbjct  212  TDASSSNEAVHLQQRLKSLSTELVTLRNRLHVGHGPGQGQSQGNGAQPVAPAPNAG  267


 Score = 36.2 bits (82),  Expect = 0.22, Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 36/62 (58%), Gaps = 3/62 (5%)

Query  84   FRKCDEFLKRHGIRPEFFCRHRERLALQTWLLQRSKLSS---DASSSNEAVHLQQRLRSL  140
             R C++FL RH +RP+FFC++ + ++  T   +++K S+      S++  V +Q  L+  
Sbjct  115  LRLCEDFLCRHRMRPDFFCQYHKAVSSTTPSPKQTKTSTPIVQCKSASPPVKVQSDLKDF  174

Query  141  ST  142
             +
Sbjct  175  KS  176


>Q95VU9_DROME unnamed protein product
Length=1232

 Score = 1366 bits (3536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 695/961 (72%), Positives = 773/961 (80%), Gaps = 39/961 (4%)

Query  301   GPATSTALDDLIHLPGPLTEDAVLKCLQARFCAKQYHTNVGPILVCINPYTDVRNPLTLT  360
             G ++   + DLIHL GPLTE AV++ LQARF  ++Y TNVGPIL+ INPY DV NPLTLT
Sbjct  274   GNSSPKDMQDLIHLSGPLTEHAVMRTLQARFNERRYFTNVGPILLSINPYLDVGNPLTLT  333

Query  361   STRAVPLAPQLNKVVQEAVRQQSETGYPQAIILSGTSGSGKTYASMLLLRQLFDVAGGGP  420
             STRA+PLAPQL K+VQEAVRQQSETGYPQAIILSGTSG+GKT  +ML+LRQLF +AGGGP
Sbjct  334   STRAMPLAPQLQKIVQEAVRQQSETGYPQAIILSGTSGAGKTANAMLMLRQLFAIAGGGP  393

Query  421   ETDAFKHLAAAFTVLRSLGSAKTATNSESSRIGHFIEVQVTDGALYRTKIHCYFLDQTRV  480
             ETDAFKHLAAAFTVLRSLGSAKT TNSESSRIG FIEVQVTDGALYRTKIHCYFLDQTRV
Sbjct  394   ETDAFKHLAAAFTVLRSLGSAKTTTNSESSRIGQFIEVQVTDGALYRTKIHCYFLDQTRV  453

Query  481   IRPLPDEKNYHIFYQMLAGLSHEERVKLNLEGYNLKNLRYLQHGDTRQDEAEDAIRFQAW  540
             IRPLP EKNYHIFYQ+LAGLS EER KL+L+GY+  NLRYL+ GD  Q+E EDA RFQAW
Sbjct  454   IRPLPKEKNYHIFYQLLAGLSREERQKLHLDGYSPANLRYLR-GDIGQNEQEDAARFQAW  512

Query  541   KACLGVLGIPFLDVVRVLAAVLILGNVGFTDRPGVEVGVIGENELASVAALLGVPPPALL  600
             K CLG+LGIPFLDVVRVLAAVL+LGNV F D  G+EV V GE EL SVA+LLGVPP AL 
Sbjct  513   KTCLGILGIPFLDVVRVLAAVLLLGNVQFIDGGGLEVDVKGETELNSVASLLGVPPAALF  572

Query  601   RGLTSRTHNARGQLVKSVCDANMSNMTRDSLAKALYCRTVATIVRRANSLKRLGSTLGTL  660
             RGLT+RTHN RGQLVKSVC    +NMTRD LAKALYCRTVATIVRRANSLKRLGSTLGTL
Sbjct  573   RGLTTRTHNVRGQLVKSVCGDGDANMTRDCLAKALYCRTVATIVRRANSLKRLGSTLGTL  632

Query  661   SSDSNESVHNQAEVTSQHASTIGSSAGGTGSRSMTALNNAVRHAT-DGFIGILDMFGFED  719
             SSDSNESVHNQA+V SQHASTIG   G  GS+SM ALNNAVRHAT DGFIGILDMFGFE+
Sbjct  633   SSDSNESVHNQADVASQHASTIG--GGNAGSKSMAALNNAVRHATSDGFIGILDMFGFEE  690

Query  720   PKP-SQLEHLCINLCAETMQHFYNTHIFKSSIESCRDEGIRCDVEVDYVDNVPCIDLISS  778
             P P + LEHLCINLCAETMQHFYNTHIFKSS+ESCRDEGI CD EVDYVDNVPCIDLISS
Sbjct  691   PSPHAHLEHLCINLCAETMQHFYNTHIFKSSVESCRDEGIVCDTEVDYVDNVPCIDLISS  750

Query  779   LRTGLLSMLDVECSIRGTAESYVAKVKVQHKQNPRLFEPRTV---DCRSFGIQHFAGRVT  835
             LRTGLLSMLD ECS+RGTAESYV K+KVQH+ + RL    T    D R F I+HFAGRV 
Sbjct  751   LRTGLLSMLDAECSVRGTAESYVTKLKVQHRSSTRLETKPTAEPHDPRMFLIRHFAGRVE  810

Query  836   YDASDFLDTNKDVVPDDLVAVFYKHTCSFGFATHLFGSELKALYASDTVPRGVSFRISPT  895
             YD +DFLDTN+DVVPDDLV VFYKHTC+FGFATHLFGSELKALYA    PRG+SFRISPT
Sbjct  811   YDTTDFLDTNRDVVPDDLVGVFYKHTCNFGFATHLFGSELKALYAQQQAPRGLSFRISPT  870

Query  896   SHTDLLNGDEPISTLTQDFHTRLDNLLRTLVHARPHFVRCIRSNGTETPLHLDRGVTMRQ  955
             SH+DLLNGDEP+STLTQDFHTRLDNLLRTLVHARPHFVRCIRSNGTE     DR   +RQ
Sbjct  871   SHSDLLNGDEPVSTLTQDFHTRLDNLLRTLVHARPHFVRCIRSNGTEAARSFDRATVVRQ  930

Query  956   IRSLQVLETVNLMAGGYPHRMRFKAFNARYRLIAPFKQLRRAEEQAVEDTKLILQNAQQL  1015
             IRSLQVLETVNLMA G+PHRMRFK FNARYR++APF+ LRR+E++A+ED +LIL+ A + 
Sbjct  931   IRSLQVLETVNLMASGFPHRMRFKQFNARYRMLAPFRLLRRSEDKALEDCQLILKYAMEQ  990

Query  1016  KSKFGASTS--WALGKRHIFLSEGIRQQLENLRSETRRKAATVIQSTWRGWRVRRRWPLR  1073
                   S +  WA GKRH+FLSEGIRQ LE+LR+E R K+AT++Q+TWRGW  R++    
Sbjct  991   PPVLDGSVTLAWAPGKRHVFLSEGIRQHLEHLRTEIRHKSATLMQATWRGWWWRKKMGNG  1050

Query  1074  KTTIGVTSGIGQKK-PQQPTSANTGTVQRNV------------------------TTATG  1108
                     G+ Q   P   T+ N+    +                          TT+ G
Sbjct  1051  GAKRSKIPGLQQAPLPNNKTTPNSAAQNKAASSTMAALAAVAAAAPISVPRLSAKTTSLG  1110

Query  1109  T-GTGTRPRPQPIAGTPPPDPSEKCADQKMIQQTCTLFGLDLERPPPVPPSRSYTVTGNT  1167
               GT  RPRPQPIAGTPPPDP EKC DQK+IQQTC LFGLDLERPPPVPPSRSYT+TGN+
Sbjct  1111  IGGTVARPRPQPIAGTPPPDPQEKC-DQKIIQQTCNLFGLDLERPPPVPPSRSYTITGNS  1169

Query  1168  KLGYPQTRIMKMPFP-EGEGEV-VLLKGETVLVVGASPRRGHLLVEHNNTTLHVPYQFME  1225
             K+ YPQ R+MKM FP EG+ E   L KGE V VVGAS  RGHL+VEH   + HVP+QFM 
Sbjct  1170  KISYPQNRVMKMNFPEEGQSEAPQLKKGEAVTVVGASTVRGHLMVEHKGQSFHVPFQFMT  1229

Query  1226  L  1226
             L
Sbjct  1230  L  1230


 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 39/55 (71%), Gaps = 0/55 (0%)

Query  123  DASSSNEAVHLQQRLRSLSTELVTLRNRLHVNQPPNNSGPNSGASAPLSKSPEKG  177
            DASSSNEAVHLQQRL+SLSTELVTLRNRLHV   P         + P++ +P  G
Sbjct  19   DASSSNEAVHLQQRLKSLSTELVTLRNRLHVGHGPGQGQSQGNGAQPVAPAPNAG  73



Lambda      K        H
   0.318    0.133    0.398 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 16027285120


Query= XP_050573082.1 unconventional myosin-IXb isoform X3 [Bombus affinis]

Length=1142
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

B5RJR1_DROME  unnamed protein product                                 1378    0.0  
Q95VU9_DROME  unnamed protein product                                 1376    0.0  
M9MRE4_DROME  unnamed protein product                                 1375    0.0  


>B5RJR1_DROME unnamed protein product
Length=1244

 Score = 1378 bits (3567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 696/961 (72%), Positives = 774/961 (81%), Gaps = 38/961 (4%)

Query  209   GPATSTALDDLIHLPGPLTEDAVLKCLQARFCAKQYHTNVGPILVCINPYTDVRNPLTLT  268
             G ++   + DLIHL GPLTE AV++ LQARF  ++Y TNVGPIL+ INPY DV NPLTLT
Sbjct  286   GNSSPKDMQDLIHLSGPLTEHAVMRTLQARFNERRYFTNVGPILLSINPYLDVGNPLTLT  345

Query  269   STRAVPLAPQLNKVVQEAVRQQSETGYPQAIILSGTSGSGKTYASMLLLRQLFDVAGGGP  328
             STRA+PLAPQL K+VQEAVRQQSETGYPQAIILSGTSG+GKT  +ML+LRQLF +AGGGP
Sbjct  346   STRAMPLAPQLQKIVQEAVRQQSETGYPQAIILSGTSGAGKTANAMLMLRQLFAIAGGGP  405

Query  329   ETDAFKHLAAAFTVLRSLGSAKTATNSESSRIGHFIEVQVTDGALYRTKIHCYFLDQTRV  388
             ETDAFKHLAAAFTVLRSLGSAKT TNSESSRIG FIEVQVTDGALYRTKIHCYFLDQTRV
Sbjct  406   ETDAFKHLAAAFTVLRSLGSAKTTTNSESSRIGQFIEVQVTDGALYRTKIHCYFLDQTRV  465

Query  389   IRPLPDEKNYHIFYQMLAGLSHEERVKLNLEGYNLKNLRYLQHGDTRQDEAEDAIRFQAW  448
             IRPLP EKNYHIFYQ+LAGLS EER KL+L+GY+  NLRYL+ GD  Q+E EDA RFQAW
Sbjct  466   IRPLPKEKNYHIFYQLLAGLSREERQKLHLDGYSPANLRYLR-GDIGQNEQEDAARFQAW  524

Query  449   KACLGVLGIPFLDVVRVLAAVLILGNVGFTDRPGVEVGVIGENELASVAALLGVPPPALL  508
             K CLG+LGIPFLDVVRVLAAVL+LGNV F D  G+EV V GE EL SVA+LLGVPP AL 
Sbjct  525   KTCLGILGIPFLDVVRVLAAVLLLGNVQFIDGGGLEVDVKGETELNSVASLLGVPPAALF  584

Query  509   RGLTSRTHNARGQLVKSVCDANMSNMTRDSLAKALYCRTVATIVRRANSLKRLGSTLGTL  568
             RGLT+RTHN RGQLVKSVC    +NMTRD LAKALYCRTVATIVRRANSLKRLGSTLGTL
Sbjct  585   RGLTTRTHNVRGQLVKSVCGDGDANMTRDCLAKALYCRTVATIVRRANSLKRLGSTLGTL  644

Query  569   SSDSNESVHNQAEVTSQHASTIGSSAGGTGSRSMTALNNAVRHAT-DGFIGILDMFGFED  627
             SSDSNESVHNQA+V SQHASTIG   G  GS+SM ALNNAVRHAT DGFIGILDMFGFE+
Sbjct  645   SSDSNESVHNQADVASQHASTIG--GGNAGSKSMAALNNAVRHATSDGFIGILDMFGFEE  702

Query  628   PKP-SQLEHLCINLCAETMQHFYNTHIFKSSIESCRDEGIRCDVEVDYVDNVPCIDLISS  686
             P P + LEHLCINLCAETMQHFYNTHIFKSS+ESCRDEGI CD EVDYVDNVPCIDLISS
Sbjct  703   PSPHAHLEHLCINLCAETMQHFYNTHIFKSSVESCRDEGIVCDTEVDYVDNVPCIDLISS  762

Query  687   LRTGLLSMLDVECSIRGTAESYVAKVKVQHKQNPRLFEPRTV---DCRSFGIQHFAGRVT  743
             LRTGLLSMLD ECS+RGTAESYV K+KVQH+ + RL    T    D R F I+HFAGRV 
Sbjct  763   LRTGLLSMLDAECSVRGTAESYVTKLKVQHRSSTRLETKPTAEPHDPRMFLIRHFAGRVE  822

Query  744   YDASDFLDTNKDVVPDDLVAVFYKHTCSFGFATHLFGSELKALYASDTVPRGVSFRISPT  803
             YD +DFLDTN+DVVPDDLV VFYKHTC+FGFATHLFGSELKALYA    PRG+SFRISPT
Sbjct  823   YDTTDFLDTNRDVVPDDLVGVFYKHTCNFGFATHLFGSELKALYAQQQAPRGLSFRISPT  882

Query  804   SHTDLLNGDEPISTLTQDFHTRLDNLLRTLVHARPHFVRCIRSNGTETPLHLDRGVTMRQ  863
             SH+DLLNGDEP+STLTQDFHTRLDNLLRTLVHARPHFVRCIRSNGTE     DR   +RQ
Sbjct  883   SHSDLLNGDEPVSTLTQDFHTRLDNLLRTLVHARPHFVRCIRSNGTEAARSFDRATVVRQ  942

Query  864   IRSLQVLETVNLMAGGYPHRMRFKAFNARYRLIAPFKQLRRAEEQAVEDTKLILQNAQQL  923
             IRSLQVLETVNLMA G+PHRMRFK FNARYR++APF+ LRR+E++A+ED +LIL+ A + 
Sbjct  943   IRSLQVLETVNLMASGFPHRMRFKQFNARYRMLAPFRLLRRSEDKALEDCQLILKYAMEQ  1002

Query  924   KSKFGAST--SWALGKRHIFLSEGIRQQLENLRSETRRKAATVIQSTWRGWRVRRRWPLR  981
                   S   +WA GKRH+FLSEGIRQ LE+LR+E R K+AT++Q+TWRGW  R++    
Sbjct  1003  PPVLDGSVTLAWAPGKRHVFLSEGIRQHLEHLRTEIRHKSATLMQATWRGWWWRKKMGNG  1062

Query  982   KTTIGVTSGIGQKK-PQQPTSANTGTVQRNV------------------------TTATG  1016
                     G+ Q   P   T+ N+    +                          TT+ G
Sbjct  1063  GAKRSKIPGLQQAPLPNNKTTPNSAAQNKAASSTMAALAAVAAAAPISVPRLSAKTTSLG  1122

Query  1017  T-GTGTRPRPQPIAGTPPPDPSEKCADQKMIQQTCTLFGLDLERPPPVPPSRSYTVTGNT  1075
               GT  RPRPQPIAGTPPPDP EKC DQK+IQQTC LFGLDLERPPPVPPSRSYT+TGN+
Sbjct  1123  IGGTVARPRPQPIAGTPPPDPQEKC-DQKIIQQTCNLFGLDLERPPPVPPSRSYTITGNS  1181

Query  1076  KLGYPQTRIMKMPFPEEGEGEV-VLLKGETVLVVGASPRRGHLLVEHNNTTLHVPYQFME  1134
             K+ YPQ R+MKM FPEEG+ E   L KGE V VVGAS  RGHL+VEH   + HVP+QFM 
Sbjct  1182  KISYPQNRVMKMNFPEEGQSEAPQLKKGEAVTVVGASTVRGHLMVEHKGQSFHVPFQFMT  1241

Query  1135  L  1135
             L
Sbjct  1242  L  1242


 Score = 131 bits (330),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 69/85 (81%), Gaps = 0/85 (0%)

Query  1   MATLGLSKVFILDKYFTELQKFWETEKKLQDASSSNEAVHLQQRLRSLSTELVTLRNRLH  60
           MATLGLSKVFILDKYFTELQKFWETEKKLQDASSSNEAVHLQQRL+SLSTELVTLRNRLH
Sbjct  1   MATLGLSKVFILDKYFTELQKFWETEKKLQDASSSNEAVHLQQRLKSLSTELVTLRNRLH  60

Query  61  VNQPPNNSGPNSGASAPLSKSPEKG  85
           V   P         + P++ +P  G
Sbjct  61  VGHGPGQGQSQGNGAQPVAPAPNAG  85


>Q95VU9_DROME unnamed protein product
Length=1232

 Score = 1376 bits (3562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 696/961 (72%), Positives = 774/961 (81%), Gaps = 38/961 (4%)

Query  209   GPATSTALDDLIHLPGPLTEDAVLKCLQARFCAKQYHTNVGPILVCINPYTDVRNPLTLT  268
             G ++   + DLIHL GPLTE AV++ LQARF  ++Y TNVGPIL+ INPY DV NPLTLT
Sbjct  274   GNSSPKDMQDLIHLSGPLTEHAVMRTLQARFNERRYFTNVGPILLSINPYLDVGNPLTLT  333

Query  269   STRAVPLAPQLNKVVQEAVRQQSETGYPQAIILSGTSGSGKTYASMLLLRQLFDVAGGGP  328
             STRA+PLAPQL K+VQEAVRQQSETGYPQAIILSGTSG+GKT  +ML+LRQLF +AGGGP
Sbjct  334   STRAMPLAPQLQKIVQEAVRQQSETGYPQAIILSGTSGAGKTANAMLMLRQLFAIAGGGP  393

Query  329   ETDAFKHLAAAFTVLRSLGSAKTATNSESSRIGHFIEVQVTDGALYRTKIHCYFLDQTRV  388
             ETDAFKHLAAAFTVLRSLGSAKT TNSESSRIG FIEVQVTDGALYRTKIHCYFLDQTRV
Sbjct  394   ETDAFKHLAAAFTVLRSLGSAKTTTNSESSRIGQFIEVQVTDGALYRTKIHCYFLDQTRV  453

Query  389   IRPLPDEKNYHIFYQMLAGLSHEERVKLNLEGYNLKNLRYLQHGDTRQDEAEDAIRFQAW  448
             IRPLP EKNYHIFYQ+LAGLS EER KL+L+GY+  NLRYL+ GD  Q+E EDA RFQAW
Sbjct  454   IRPLPKEKNYHIFYQLLAGLSREERQKLHLDGYSPANLRYLR-GDIGQNEQEDAARFQAW  512

Query  449   KACLGVLGIPFLDVVRVLAAVLILGNVGFTDRPGVEVGVIGENELASVAALLGVPPPALL  508
             K CLG+LGIPFLDVVRVLAAVL+LGNV F D  G+EV V GE EL SVA+LLGVPP AL 
Sbjct  513   KTCLGILGIPFLDVVRVLAAVLLLGNVQFIDGGGLEVDVKGETELNSVASLLGVPPAALF  572

Query  509   RGLTSRTHNARGQLVKSVCDANMSNMTRDSLAKALYCRTVATIVRRANSLKRLGSTLGTL  568
             RGLT+RTHN RGQLVKSVC    +NMTRD LAKALYCRTVATIVRRANSLKRLGSTLGTL
Sbjct  573   RGLTTRTHNVRGQLVKSVCGDGDANMTRDCLAKALYCRTVATIVRRANSLKRLGSTLGTL  632

Query  569   SSDSNESVHNQAEVTSQHASTIGSSAGGTGSRSMTALNNAVRHAT-DGFIGILDMFGFED  627
             SSDSNESVHNQA+V SQHASTIG   G  GS+SM ALNNAVRHAT DGFIGILDMFGFE+
Sbjct  633   SSDSNESVHNQADVASQHASTIG--GGNAGSKSMAALNNAVRHATSDGFIGILDMFGFEE  690

Query  628   PKP-SQLEHLCINLCAETMQHFYNTHIFKSSIESCRDEGIRCDVEVDYVDNVPCIDLISS  686
             P P + LEHLCINLCAETMQHFYNTHIFKSS+ESCRDEGI CD EVDYVDNVPCIDLISS
Sbjct  691   PSPHAHLEHLCINLCAETMQHFYNTHIFKSSVESCRDEGIVCDTEVDYVDNVPCIDLISS  750

Query  687   LRTGLLSMLDVECSIRGTAESYVAKVKVQHKQNPRLFEPRTV---DCRSFGIQHFAGRVT  743
             LRTGLLSMLD ECS+RGTAESYV K+KVQH+ + RL    T    D R F I+HFAGRV 
Sbjct  751   LRTGLLSMLDAECSVRGTAESYVTKLKVQHRSSTRLETKPTAEPHDPRMFLIRHFAGRVE  810

Query  744   YDASDFLDTNKDVVPDDLVAVFYKHTCSFGFATHLFGSELKALYASDTVPRGVSFRISPT  803
             YD +DFLDTN+DVVPDDLV VFYKHTC+FGFATHLFGSELKALYA    PRG+SFRISPT
Sbjct  811   YDTTDFLDTNRDVVPDDLVGVFYKHTCNFGFATHLFGSELKALYAQQQAPRGLSFRISPT  870

Query  804   SHTDLLNGDEPISTLTQDFHTRLDNLLRTLVHARPHFVRCIRSNGTETPLHLDRGVTMRQ  863
             SH+DLLNGDEP+STLTQDFHTRLDNLLRTLVHARPHFVRCIRSNGTE     DR   +RQ
Sbjct  871   SHSDLLNGDEPVSTLTQDFHTRLDNLLRTLVHARPHFVRCIRSNGTEAARSFDRATVVRQ  930

Query  864   IRSLQVLETVNLMAGGYPHRMRFKAFNARYRLIAPFKQLRRAEEQAVEDTKLILQNAQQL  923
             IRSLQVLETVNLMA G+PHRMRFK FNARYR++APF+ LRR+E++A+ED +LIL+ A + 
Sbjct  931   IRSLQVLETVNLMASGFPHRMRFKQFNARYRMLAPFRLLRRSEDKALEDCQLILKYAMEQ  990

Query  924   KSKFGAST--SWALGKRHIFLSEGIRQQLENLRSETRRKAATVIQSTWRGWRVRRRWPLR  981
                   S   +WA GKRH+FLSEGIRQ LE+LR+E R K+AT++Q+TWRGW  R++    
Sbjct  991   PPVLDGSVTLAWAPGKRHVFLSEGIRQHLEHLRTEIRHKSATLMQATWRGWWWRKKMGNG  1050

Query  982   KTTIGVTSGIGQKK-PQQPTSANTGTVQRNV------------------------TTATG  1016
                     G+ Q   P   T+ N+    +                          TT+ G
Sbjct  1051  GAKRSKIPGLQQAPLPNNKTTPNSAAQNKAASSTMAALAAVAAAAPISVPRLSAKTTSLG  1110

Query  1017  T-GTGTRPRPQPIAGTPPPDPSEKCADQKMIQQTCTLFGLDLERPPPVPPSRSYTVTGNT  1075
               GT  RPRPQPIAGTPPPDP EKC DQK+IQQTC LFGLDLERPPPVPPSRSYT+TGN+
Sbjct  1111  IGGTVARPRPQPIAGTPPPDPQEKC-DQKIIQQTCNLFGLDLERPPPVPPSRSYTITGNS  1169

Query  1076  KLGYPQTRIMKMPFPEEGEGEV-VLLKGETVLVVGASPRRGHLLVEHNNTTLHVPYQFME  1134
             K+ YPQ R+MKM FPEEG+ E   L KGE V VVGAS  RGHL+VEH   + HVP+QFM 
Sbjct  1170  KISYPQNRVMKMNFPEEGQSEAPQLKKGEAVTVVGASTVRGHLMVEHKGQSFHVPFQFMT  1229

Query  1135  L  1135
             L
Sbjct  1230  L  1230


 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 40/56 (71%), Gaps = 0/56 (0%)

Query  30  QDASSSNEAVHLQQRLRSLSTELVTLRNRLHVNQPPNNSGPNSGASAPLSKSPEKG  85
           +DASSSNEAVHLQQRL+SLSTELVTLRNRLHV   P         + P++ +P  G
Sbjct  18  RDASSSNEAVHLQQRLKSLSTELVTLRNRLHVGHGPGQGQSQGNGAQPVAPAPNAG  73


>M9MRE4_DROME unnamed protein product
Length=1426

 Score = 1375 bits (3560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 696/961 (72%), Positives = 774/961 (81%), Gaps = 38/961 (4%)

Query  209   GPATSTALDDLIHLPGPLTEDAVLKCLQARFCAKQYHTNVGPILVCINPYTDVRNPLTLT  268
             G ++   + DLIHL GPLTE AV++ LQARF  ++Y TNVGPIL+ INPY DV NPLTLT
Sbjct  468   GNSSPKDMQDLIHLSGPLTEHAVMRTLQARFNERRYFTNVGPILLSINPYLDVGNPLTLT  527

Query  269   STRAVPLAPQLNKVVQEAVRQQSETGYPQAIILSGTSGSGKTYASMLLLRQLFDVAGGGP  328
             STRA+PLAPQL K+VQEAVRQQSETGYPQAIILSGTSG+GKT  +ML+LRQLF +AGGGP
Sbjct  528   STRAMPLAPQLQKIVQEAVRQQSETGYPQAIILSGTSGAGKTANAMLMLRQLFAIAGGGP  587

Query  329   ETDAFKHLAAAFTVLRSLGSAKTATNSESSRIGHFIEVQVTDGALYRTKIHCYFLDQTRV  388
             ETDAFKHLAAAFTVLRSLGSAKT TNSESSRIG FIEVQVTDGALYRTKIHCYFLDQTRV
Sbjct  588   ETDAFKHLAAAFTVLRSLGSAKTTTNSESSRIGQFIEVQVTDGALYRTKIHCYFLDQTRV  647

Query  389   IRPLPDEKNYHIFYQMLAGLSHEERVKLNLEGYNLKNLRYLQHGDTRQDEAEDAIRFQAW  448
             IRPLP EKNYHIFYQ+LAGLS EER KL+L+GY+  NLRYL+ GD  Q+E EDA RFQAW
Sbjct  648   IRPLPKEKNYHIFYQLLAGLSREERQKLHLDGYSPANLRYLR-GDIGQNEQEDAARFQAW  706

Query  449   KACLGVLGIPFLDVVRVLAAVLILGNVGFTDRPGVEVGVIGENELASVAALLGVPPPALL  508
             K CLG+LGIPFLDVVRVLAAVL+LGNV F D  G+EV V GE EL SVA+LLGVPP AL 
Sbjct  707   KTCLGILGIPFLDVVRVLAAVLLLGNVQFIDGGGLEVDVKGETELNSVASLLGVPPAALF  766

Query  509   RGLTSRTHNARGQLVKSVCDANMSNMTRDSLAKALYCRTVATIVRRANSLKRLGSTLGTL  568
             RGLT+RTHN RGQLVKSVC    +NMTRD LAKALYCRTVATIVRRANSLKRLGSTLGTL
Sbjct  767   RGLTTRTHNVRGQLVKSVCGDGDANMTRDCLAKALYCRTVATIVRRANSLKRLGSTLGTL  826

Query  569   SSDSNESVHNQAEVTSQHASTIGSSAGGTGSRSMTALNNAVRHAT-DGFIGILDMFGFED  627
             SSDSNESVHNQA+V SQHASTIG   G  GS+SM ALNNAVRHAT DGFIGILDMFGFE+
Sbjct  827   SSDSNESVHNQADVASQHASTIG--GGNAGSKSMAALNNAVRHATSDGFIGILDMFGFEE  884

Query  628   PKP-SQLEHLCINLCAETMQHFYNTHIFKSSIESCRDEGIRCDVEVDYVDNVPCIDLISS  686
             P P + LEHLCINLCAETMQHFYNTHIFKSS+ESCRDEGI CD EVDYVDNVPCIDLISS
Sbjct  885   PSPHAHLEHLCINLCAETMQHFYNTHIFKSSVESCRDEGIVCDTEVDYVDNVPCIDLISS  944

Query  687   LRTGLLSMLDVECSIRGTAESYVAKVKVQHKQNPRLFEPRTV---DCRSFGIQHFAGRVT  743
             LRTGLLSMLD ECS+RGTAESYV K+KVQH+ + RL    T    D R F I+HFAGRV 
Sbjct  945   LRTGLLSMLDAECSVRGTAESYVTKLKVQHRSSTRLETKPTAEPHDPRMFLIRHFAGRVE  1004

Query  744   YDASDFLDTNKDVVPDDLVAVFYKHTCSFGFATHLFGSELKALYASDTVPRGVSFRISPT  803
             YD +DFLDTN+DVVPDDLV VFYKHTC+FGFATHLFGSELKALYA    PRG+SFRISPT
Sbjct  1005  YDTTDFLDTNRDVVPDDLVGVFYKHTCNFGFATHLFGSELKALYAQQQAPRGLSFRISPT  1064

Query  804   SHTDLLNGDEPISTLTQDFHTRLDNLLRTLVHARPHFVRCIRSNGTETPLHLDRGVTMRQ  863
             SH+DLLNGDEP+STLTQDFHTRLDNLLRTLVHARPHFVRCIRSNGTE     DR   +RQ
Sbjct  1065  SHSDLLNGDEPVSTLTQDFHTRLDNLLRTLVHARPHFVRCIRSNGTEAARSFDRATVVRQ  1124

Query  864   IRSLQVLETVNLMAGGYPHRMRFKAFNARYRLIAPFKQLRRAEEQAVEDTKLILQNAQQL  923
             IRSLQVLETVNLMA G+PHRMRFK FNARYR++APF+ LRR+E++A+ED +LIL+ A + 
Sbjct  1125  IRSLQVLETVNLMASGFPHRMRFKQFNARYRMLAPFRLLRRSEDKALEDCQLILKYAMEQ  1184

Query  924   KSKFGAST--SWALGKRHIFLSEGIRQQLENLRSETRRKAATVIQSTWRGWRVRRRWPLR  981
                   S   +WA GKRH+FLSEGIRQ LE+LR+E R K+AT++Q+TWRGW  R++    
Sbjct  1185  PPVLDGSVTLAWAPGKRHVFLSEGIRQHLEHLRTEIRHKSATLMQATWRGWWWRKKMGNG  1244

Query  982   KTTIGVTSGIGQKK-PQQPTSANTGTVQRNV------------------------TTATG  1016
                     G+ Q   P   T+ N+    +                          TT+ G
Sbjct  1245  GAKRSKIPGLQQAPLPNNKTTPNSAAQNKAASSTMAALAAVAAAAPISVPRLSAKTTSLG  1304

Query  1017  T-GTGTRPRPQPIAGTPPPDPSEKCADQKMIQQTCTLFGLDLERPPPVPPSRSYTVTGNT  1075
               GT  RPRPQPIAGTPPPDP EKC DQK+IQQTC LFGLDLERPPPVPPSRSYT+TGN+
Sbjct  1305  IGGTVARPRPQPIAGTPPPDPQEKC-DQKIIQQTCNLFGLDLERPPPVPPSRSYTITGNS  1363

Query  1076  KLGYPQTRIMKMPFPEEGEGEV-VLLKGETVLVVGASPRRGHLLVEHNNTTLHVPYQFME  1134
             K+ YPQ R+MKM FPEEG+ E   L KGE V VVGAS  RGHL+VEH   + HVP+QFM 
Sbjct  1364  KISYPQNRVMKMNFPEEGQSEAPQLKKGEAVTVVGASTVRGHLMVEHKGQSFHVPFQFMT  1423

Query  1135  L  1135
             L
Sbjct  1424  L  1424


 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 42/62 (68%), Gaps = 0/62 (0%)

Query  24   ETEKKLQDASSSNEAVHLQQRLRSLSTELVTLRNRLHVNQPPNNSGPNSGASAPLSKSPE  83
            +T   + DASSSNEAVHLQQRL+SLSTELVTLRNRLHV   P         + P++ +P 
Sbjct  206  KTTGNITDASSSNEAVHLQQRLKSLSTELVTLRNRLHVGHGPGQGQSQGNGAQPVAPAPN  265

Query  84   KG  85
             G
Sbjct  266  AG  267



Lambda      K        H
   0.318    0.133    0.398 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 16027285120


Query= XP_050573083.1 uncharacterized protein LOC126913877 [Bombus affinis]

Length=1130
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

NUDEL_DROME  unnamed protein product                                  171     1e-42
Q17800_CAEEL  unnamed protein product                                 167     6e-42
STUB_DROME  unnamed protein product                                   154     3e-38


>NUDEL_DROME unnamed protein product
Length=2616

 Score = 171 bits (433),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 158/530 (30%), Positives = 234/530 (44%), Gaps = 95/530 (18%)

Query  646   PDE--CVGHQEVLEAARRAERPV-CTSGFQCDGTRC---IPVDWRCDGYLDCADHSDETE  699
             PD+  C G QE + AAR  +  V C+ G       C   +  +  CDGY DC    DE  
Sbjct  894   PDQFSCFGQQECIPAARWCDNVVDCSDGSDESACTCADRVDEERLCDGYEDCPMGEDELG  953

Query  700   CGECAASSSSSSSSVNSTKIMKKPILAMNTISKSALHCGERRCMSANHICNGEMDCPWGQ  759
             C  C + + S   +        +  ++M              C S    C+G M+C  G+
Sbjct  954   CFGCESLAYSCYENPQDFAKRNRSTISM--------------CYSRLERCDGFMNCLNGR  999

Query  760   DERYCLRLSQRNGD-------VGEGRLEVYHAEMGKFMPACI--PYW-------DSNSAK  803
             DE  C  L     D         EG L  YH   G + P C     W       D NS  
Sbjct  1000  DEEQCSMLVTDVADHMSHGASASEGYL--YHNYRGDWHPVCNNGEKWAALACQMDENSRM  1057

Query  804   TICSMLGYT-------APLSSRLMAQGMNLTQRESKAHRTNLLKEFQECITDQEAYPTAE  856
                + L  +        P     +  G++  Q     H  N      + + D  AY    
Sbjct  1058  DHSASLNVSFQTLTLPGPFIEPSLHAGVHFAQ---ACHGRN----SHDSLVDHVAY----  1106

Query  857   LTCSEYACG--RRNTVYGHVK-------------AKTRIVGGVESAPGDWPFLAALLGGP  901
             + C    CG   ++++  H K                RIVGG  ++   WPF+ A+    
Sbjct  1107  VKCPPMQCGLPSKSSMLEHSKRVRRAVSDSKEIVGDGRIVGGSYTSALQWPFVVAIYRNG  1166

Query  902   EQIFYCAGVLIADQWVLTASHCVGNYTDITGWTIQLGITRRHSHTYLGQKLKVKRVVPHP  961
             +  F+C G + +D+W+++A+HCV NY     + ++ G+ RR S++   Q   V  VV H 
Sbjct  1167  K--FHCGGTIYSDRWIISAAHCVINYGKYF-YEVRAGLLRRSSYSPATQIQPVSHVVVHQ  1223

Query  962   DYNVGVAQDNDVALFQLEKRVQFHEHLRPVCLP-----TADTHLIPG----TLCTVIGWG  1012
              Y    +  ND++L +L   +QF+  ++P+CLP     T     I G    TLCTV+GWG
Sbjct  1224  AYERR-SMRNDLSLLRLLNPLQFNRWVKPICLPDKGRTTVGDDWIWGPVEHTLCTVVGWG  1282

Query  1013  KKNDTDSSEYELAVNEVQVPVLNREVCNLWITYKELNVTDGMICAGYPDGGKDACQGDSG  1072
                +   S   +   +V VP+  R+ C    T  E   ++  ICAG PDGG+DACQGDSG
Sbjct  1283  AIREKGPSSDPM--RQVIVPI--RKKC----TDPEDQASED-ICAGDPDGGRDACQGDSG  1333

Query  1073  GPLLCQDEHDKEKWFVGGIVSWGIMCAHPKLPGVYAYVPKYVPWIRSEMA  1122
             GPL C+   + +++++ G+VS G  CA P+  GVY  V  Y+ W+  EMA
Sbjct  1334  GPLFCRSVSNPDEFYLAGVVSHGNGCARPQEFGVYTRVTLYLDWL--EMA  1381


 Score = 45.8 bits (107),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 50/107 (47%), Gaps = 12/107 (11%)

Query  891   WPFLAALLGGPEQIFYCAGVLIADQWVLTASHCVGNYTDITGWTIQL---GITRRHSHTY  947
             WP+LA +    +   +C GVLI   WV+    C+      T +   L   G T+R +H  
Sbjct  2041  WPWLADVYMNGD--LWCIGVLIDKHWVMVHESCLSGIDLETHYVSVLLGGGKTKRSAHR-  2097

Query  948   LGQKLKVKRVVPHPDYNVGVAQDNDVALFQLEKRVQFHEHLRPVCLP  994
                  +++RV    D   GV + N V L  LE+ V+F  H+ P  LP
Sbjct  2098  -SNHEQIRRV----DCFEGVPKSN-VLLLHLERPVRFTHHVLPTFLP  2138


 Score = 43.1 bits (100),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 51/222 (23%), Positives = 81/222 (36%), Gaps = 32/222 (14%)

Query  556   FPNYMGNFGQRDAQHELELYGAVIDVKCYELAALFLCSVF-VPKCGSRGHVVRPCRSLCF  614
             FP  + N+   D Q   + +G    ++  EL    L  +   P C     ++ P      
Sbjct  2261  FPTALFNYNNSDCQSFKQPFG----IRTLELVYKSLQDIIDKPSC----KMLLPAPDCST  2312

Query  615   HTKRRCGFFLEVFGLTLPEYLECDLFPENSNPDECVGHQEVLEAARRAERPVCTSG-FQC  673
             H   RC       G  LP+   C+         +C    +  E   R ++  C  G  +C
Sbjct  2313  H---RCPL-----GTCLPQAAMCN------GRSDCHDGSDEEETKCRQQKQQCAPGEMKC  2358

Query  674   DGT-RCIPVDWRCDGYLDCADHSDETECGECAASSSSSSSSVNST-------KIMKKPIL  725
               + +C+P    CD   DC D +DE     C     ++  S           K  +  +L
Sbjct  2359  RTSFKCVPKSKFCDHVPDCEDMTDEPTICSCFTYLQATDPSKICDGKRNCWDKSDESSVL  2418

Query  726   AMNTISKSALHCGERRCMSANHICNGEMDCPWGQDERYCLRL  767
                T            C+  + +C+ E DCP G+DERYC  +
Sbjct  2419  CNCTADHFQCSSSPEDCIPRDFVCDKEKDCPNGEDERYCFGI  2460


 Score = 35.0 bits (79),  Expect = 0.44, Method: Compositional matrix adjust.
 Identities = 46/239 (19%), Positives = 83/239 (35%), Gaps = 54/239 (23%)

Query  649   CVGHQEVLEAARRAERPV-CTSGFQCDGTRCIPVDWR--------CDGYLDCADHSDETE  699
             C    ++++   R +R V C  G   D   C   D+         CDG  DC D +DE  
Sbjct  1715  CKKMSQIVDIMMRCDRKVDCEDG--TDELDCTCKDYLKGSLKGLICDGKADCEDLTDEQN  1772

Query  700   CGECAASSSSSSSSVNSTKIMKKPILAMNTISKSALHCGERRCMSANHICNGEMDCPWGQ  759
             C EC ++              + P+               + C+  +  C+ ++DC + +
Sbjct  1773  CVECQSNE------------FRCPL--------------SKTCLPLSSRCDNKVDCKFKE  1806

Query  760   DERYCLRLSQRNGDVGEGRLEVYHAEMGKFMPACIPYW-------------DSNSAKTIC  806
             DE+ C  L+  +    +   +   +  G F       W              + +A  +C
Sbjct  1807  DEKDCFALTNGHDVHFDVHQQPKFSSTGIFSRNGHGVWRVVCAHETGYHEHQAKTADAVC  1866

Query  807   SMLGYTAPL---SSRLMAQG-MNLTQRESKAHRTNLLKEFQECITDQEAYPTAELTCSE  861
             ++LG+       SS  + Q  M     E K  R  +  +    + D   +   E+   E
Sbjct  1867  ALLGFNGAHYFNSSEFVTQHEMQPITPELKGGRNRMSAQIHSMVGDNVQFTENEVIIPE  1925


>Q17800_CAEEL unnamed protein product
Length=951

 Score = 167 bits (423),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 116/403 (29%), Positives = 192/403 (48%), Gaps = 44/403 (11%)

Query  737   CGERRCMSANHICNGEMDCPWGQDERYCLRLSQR--NGDVGEGRLEVYHAEMGKFMPACI  794
             CG+  C+  + +CNG++DC  G+DE YC   S R  NG    G LEV      ++ P C 
Sbjct  566   CGDGSCIRFDQLCNGQIDCQSGEDEDYCRANSFRLTNGSDTSGYLEVLF--RSRWEPICA  623

Query  795   PYWDSNSAKTICSMLGYTAPLSSRLMAQGMNLTQRESKAHRTNLLKEFQECITDQEAYPT  854
              + +   + +IC  +        RL   G  L+   + +   N+  +  +C   + +  T
Sbjct  624   DHLNGKISNSICDAM--------RLGEHGFILSTNATISSGYNVNCDV-DCSIRRSSSCT  674

Query  855   --AELTC-------SEYACGRRNTVYGHVKAK-------TRIVGGVESAPGDWPFLAALL  898
               A ++C       S   CG R   Y  V A+        R+VGG E+ PG +P+ AAL 
Sbjct  675   RHARISCISQNGMSSASQCGLR---YVEVNARDAAKSRIARVVGGFETVPGAFPWTAALR  731

Query  899   GGPEQIFYCAGVLIADQWVLTASHCVGNYTDITGWTIQLGITRRHSHTYLGQKLKVKRVV  958
                 +  +C   ++    ++TA+HC      ++ + + +G    +      Q   ++R+ 
Sbjct  732   NKATKAHHCGASILDKTHLITAAHCFEEDERVSSYEVVVGDWDNNQTDGNEQIFYLQRIH  791

Query  959   PHPDYNVGVAQDNDVALFQLEK-RVQFHEHLRPVCLPTADTHLIPGTLCTVIGWGKKNDT  1017
              +P Y    +  +D+A+ ++    ++F+E+ +P+CLP+ D    PG  C V GWG     
Sbjct  792   FYPLYKDIFS--HDIAILEIPYPGIEFNEYAQPICLPSKDFVYTPGRQCVVSGWGSMG--  847

Query  1018  DSSEYELAVNEVQVPVLNREVC-NLWITYKELNVTDGMICAGYPDGGKDACQGDSGGPLL  1076
                 Y   +    +P++NR  C N    Y  ++ +    CAGY +GG D+CQGDSGGP  
Sbjct  848   --LRYAERLQAALIPIINRFDCVNSSQIYSSMSRS--AFCAGYLEGGIDSCQGDSGGPFA  903

Query  1077  CQDEHDKEKWFVGGIVSWGIMCAHPKLPGVYAYVPKYVPWIRS  1119
             C+ E     + + G++SWG  CA  K PG+Y  V  Y+ WI +
Sbjct  904   CRREDG--AFVLAGVISWGDGCAQKKQPGIYTMVAPYLSWISA  944


>STUB_DROME unnamed protein product
Length=787

 Score = 154 bits (390),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 91/254 (36%), Positives = 142/254 (56%), Gaps = 21/254 (8%)

Query  875   KAKTRIVGGVESAPGDWPFLAAL----LGGPEQIFYCAGVLIADQWVLTASHCVGNYTDI  930
             + +TRIVGG  +A G WP+  ++      G      C G LI + W+ TA HCV +   I
Sbjct  539   RPETRIVGGKSAAFGRWPWQVSVRRTSFFGFSSTHRCGGALINENWIATAGHCVDDLL-I  597

Query  931   TGWTIQLGITRRHSHTYLGQKLK-----VKRVVPHPDYNVGVAQDNDVALFQLEKRVQFH  985
             +   I++G    +  +++ ++L      V + V HP Y+  +  + D+AL +LE+ ++F 
Sbjct  598   SQIRIRVG---EYDFSHVQEQLPYIERGVAKKVVHPKYSF-LTYEYDLALVKLEQPLEFA  653

Query  986   EHLRPVCLPTADTHLIPGTLCTVIGWGKKNDTDSSEYELAVNEVQVPVLNREVCNLWITY  1045
              H+ P+CLP  D+ LI G   TV GWG+ ++  +    L   EV VP+++ + C      
Sbjct  654   PHVSPICLPETDSLLI-GMNATVTGWGRLSEGGTLPSVL--QEVSVPIVSNDNCKSMFMR  710

Query  1046  --KELNVTDGMICAGYPDGGKDACQGDSGGPLLCQDEHDKEKWFVGGIVSWGIMCAHPKL  1103
               ++  + D  +CAGY  GG+D+CQGDSGGPL  Q +    ++F+ GI+SWGI CA   L
Sbjct  711   AGRQEFIPDIFLCAGYETGGQDSCQGDSGGPL--QAKSQDGRFFLAGIISWGIGCAEANL  768

Query  1104  PGVYAYVPKYVPWI  1117
             PGV   + K+ PWI
Sbjct  769   PGVCTRISKFTPWI  782



Lambda      K        H
   0.318    0.133    0.398 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 16027285120


Query= XP_050573084.1 integrator complex subunit 6 isoform X1 [Bombus
affinis]

Length=966
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

INT6_DROME  unnamed protein product                                   641     0.0  
Q9VJ14_DROME  unnamed protein product                                 32.7    1.9  
M9PC48_DROME  unnamed protein product                                 32.7    2.3  


>INT6_DROME unnamed protein product
Length=1284

 Score = 641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/683 (49%), Positives = 448/683 (66%), Gaps = 33/683 (5%)

Query  1    MTIIVFLIDTSASMNQRAYLGG-RPTLLDVAKSAVETFVKVRQRSPESRGDRYMLLTFED  59
            MTII+FL+DTS+SM Q+AY+ G + T LD+AK AVETF+K RQR+ +  GDRYMLLTFE+
Sbjct  1    MTIILFLVDTSSSMCQKAYVNGVQKTYLDIAKGAVETFLKYRQRTQDCLGDRYMLLTFEE  60

Query  60   PPQNIKAGWKENLATFMNELKNLQCVGLTTLGAALKHALDVLNINRMQTGIDTYGQGRCP  119
            PP N+KAGWKEN ATFMNELKNLQ  GLT++G +L++A D+LN+NRMQ+GIDTYGQGRCP
Sbjct  61   PPANVKAGWKENHATFMNELKNLQSHGLTSMGESLRNAFDLLNLNRMQSGIDTYGQGRCP  120

Query  120  FYLEPSVIVVITDGGKYTTNSGVNQELTLPMHSPIPGSELTKEPFRWDQRLFSLVLRLSG  179
            FYLEPSVI+VITDGG+Y+  +GV+QE+ LP+ + IPG++ TKEPFRWDQRLFSLVLR+ G
Sbjct  121  FYLEPSVIIVITDGGRYSYRNGVHQEIILPLSNQIPGTKFTKEPFRWDQRLFSLVLRMPG  180

Query  180  TPAVERDTGLVASDSSPIDAMCEVTGGRSYCITSFRMMMQCIDSLVQKVQSGVVINFEKI  239
                ER  G V  D SPI+ MCEVTGGRSY + S  ++ QCI+SLVQKVQ GVV+ FE  
Sbjct  181  NKIDERVDGKVPHDDSPIERMCEVTGGRSYRVRSHYVLNQCIESLVQKVQPGVVLQFE--  238

Query  240  GPDPPPLNNETQHADDDENEDENNTT----NGTRTYLPNPTVPGNTAWHSCRRLIYVPRS  295
                P L  E   A   E    +  +    + T    P P +     +   +++IYV + 
Sbjct  239  ----PMLPKEATSATAGEAAGASTISGMGISSTSGAGPAPDI----VFQPVKKMIYVQKH  290

Query  296  -AQKGFAVGFWPIPESFWPDLSASSLPARSAHPNVK-FTCTSQEPMVIENLPFDKYELEP  353
              QK F +G+WP+PE +WPD  A +LP R AHP +K  T    EP ++ + P DKYE+E 
Sbjct  291  ITQKTFPIGYWPLPEPYWPDSKAITLPPRDAHPKLKVLTPAVDEPQLVRSFPVDKYEIEG  350

Query  354  SPLTQYILARKQPTICWQVFVANSYKSSEVGHPFGYLKASTNLTCVNLFVMPYNYPVLLP  413
             PLT  IL +++   CWQV V N     E+  PFGYLKA+ N + V+L+V+ YNYP LLP
Sbjct  351  CPLTLQILNKREMNKCWQVIVTNGMHGFEL--PFGYLKAAPNFSQVHLYVLAYNYPALLP  408

Query  414  LLEELFKVHRLKPTNEWRTQFQNYMRTMPTYYAASLRRALTRMGAPTPLAQTLIPDNMDN  473
            +L +L   + + P ++   +F  Y+R++P YY   LR+AL  +  P  L Q L+P+N+DN
Sbjct  409  ILHDLIHKYNMSPPSDLMYKFNAYVRSIPPYYCPFLRKALVNINVPYQLLQFLLPENVDN  468

Query  474  SLSYSVLNYLKRLKNQAKIEFDRLCNEVLSKQLATANMTKNLVNGSTTVTEGVRVIPRTP  533
             LS ++ N LK +KN AK + + LC +V  KQL         V       E  ++    P
Sbjct  469  YLSPTIANQLKHIKNTAKQDQENLCMKVY-KQLKQPKPPYRQV-------ETGKLFTGAP  520

Query  534  LKKDLVSHPLLQDKFTGLRDQLNEFGGFVVGLVR-NQQRGAHSYRNAFDVPRKSLLDQVV  592
            L++DLV HPLL+D F+ L  +++    + + + +   Q  A S+RN FD+PR+ L++++ 
Sbjct  521  LRRDLVRHPLLRDIFSKLHGEIDPVENYTIVVPQPTHQSSAKSHRNPFDIPRRDLVEEIA  580

Query  593  RMRANFLQPGLLHTKLLDDDYVHSMPLAQMGNYQEYLKRMTPPLREIESAPVRQHMFGNP  652
            +MR   L+P      L+  D  H +P+A+MGNYQEYLK    PLREIE   VRQHMFGNP
Sbjct  581  KMRETLLRP----VSLVAKDSGHCLPIAEMGNYQEYLKNKDNPLREIEPTNVRQHMFGNP  636

Query  653  FKIDKRM-MVDEADIDMVGATSS  674
            +K DK M MVDEAD+  V    S
Sbjct  637  YKKDKHMVMVDEADLSDVAPMKS  659


 Score = 60.1 bits (144),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 48/74 (65%), Gaps = 0/74 (0%)

Query  868   VLTKKELEDIRRHNLSVRELVYKEVRRRGTNYETLFSHLHQIQGTLDIRLAFLRDIVKES  927
             + T+++ E  R HN+ +R  +++++RR G +Y  L  HL+ ++G  D++  F+   + ES
Sbjct  1184  IFTEEQREAARLHNVELRLQIFRDIRRPGRDYSQLLEHLNLVKGDQDMQSDFVDMCIVES  1243

Query  928   LRFKRRNLASLLED  941
             LRF+R  +AS +++
Sbjct  1244  LRFRRHRMASSIQE  1257


>Q9VJ14_DROME unnamed protein product
Length=1049

 Score = 32.7 bits (73),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 46/159 (29%), Positives = 63/159 (40%), Gaps = 28/159 (18%)

Query  644  VRQHMFGNPFKID------KRMMVDEADIDMVGATSSTSKGGLKRSLPASDGGGSLASKP  697
            +RQ +FG   + +      + + V     D  G  SS S G          G GS+A+ P
Sbjct  777  IRQLIFGQQGEAESLPRNLQALEVSAGSAD--GEESSASAGAESNGA----GPGSVAAPP  830

Query  698  PPNKR------KPGPIPKDVVVRRPSYTPTNTPPSSPVPWVDDTKNQVTPTADSNQVSSN  751
            PP ++      KP  IP   V   PS     TP +S  P V    +  TP   S QV+  
Sbjct  831  PPQRQTFELMPKPNDIPAIGVGASPS-----TPSAS--PGVKKLNSDATPQNVSPQVAPR  883

Query  752  ITNSTPSVSNAPCINSPEKLVNGLAEMPTIPIFEPIPVE  790
                 P V+ +   +S   L  G A   T P+  P P E
Sbjct  884  KKAPKPPVTTS---SSSTALEAGAAGPSTSPVIVPGPHE  919


>M9PC48_DROME unnamed protein product
Length=18095

 Score = 32.7 bits (73),  Expect = 2.3, Method: Composition-based stats.
 Identities = 25/94 (27%), Positives = 44/94 (47%), Gaps = 19/94 (20%)

Query  724    PPSSPVPWVDDTKNQVTPTADSNQVSSNITNSTPSVSNAPCI--NSPEKLVNGLAEMPTI  781
              P S+P   V +  +Q +P          I+  TP + N P I   +P++   G+  +P++
Sbjct  14436  PVSTPTSGVINIPSQASPP---------ISVPTPGIVNIPSIPQPTPQRPSPGIINVPSV  14486

Query  782    PIFEPIPVEHTNNHMDAP------PTLTPVVNNV  809
              P  +PIP   +   ++ P      P+ TP V N+
Sbjct  14487  P--QPIPTAPSPGIINIPSVPQPLPSPTPGVINI  14518



Lambda      K        H
   0.318    0.133    0.398 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 16027285120


Query= XP_050573085.1 integrator complex subunit 6 isoform X2 [Bombus
affinis]

Length=914
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

INT6_DROME  unnamed protein product                                   575     0.0  
Q9VJ14_DROME  unnamed protein product                                 32.7    2.0  
M9PC48_DROME  unnamed protein product                                 32.3    2.8  


>INT6_DROME unnamed protein product
Length=1284

 Score = 575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/630 (48%), Positives = 405/630 (64%), Gaps = 32/630 (5%)

Query  1    MLLTFEDPPQNIKAGWKENLATFMNELKNLQCVGLTTLGAALKHALDVLNINRMQTGIDT  60
            MLLTFE+PP N+KAGWKEN ATFMNELKNLQ  GLT++G +L++A D+LN+NRMQ+GIDT
Sbjct  54   MLLTFEEPPANVKAGWKENHATFMNELKNLQSHGLTSMGESLRNAFDLLNLNRMQSGIDT  113

Query  61   YGQGRCPFYLEPSVIVVITDGGKYTTNSGVNQELTLPMHSPIPGSELTKEPFRWDQRLFS  120
            YGQGRCPFYLEPSVI+VITDGG+Y+  +GV+QE+ LP+ + IPG++ TKEPFRWDQRLFS
Sbjct  114  YGQGRCPFYLEPSVIIVITDGGRYSYRNGVHQEIILPLSNQIPGTKFTKEPFRWDQRLFS  173

Query  121  LVLRLSGTPAVERDTGLVASDSSPIDAMCEVTGGRSYCITSFRMMMQCIDSLVQKVQSGV  180
            LVLR+ G    ER  G V  D SPI+ MCEVTGGRSY + S  ++ QCI+SLVQKVQ GV
Sbjct  174  LVLRMPGNKIDERVDGKVPHDDSPIERMCEVTGGRSYRVRSHYVLNQCIESLVQKVQPGV  233

Query  181  VINFEKIGPDPPPLNNETQHADDDENEDENNTT----NGTRTYLPNPTVPGNTAWHSCRR  236
            V+ FE      P L  E   A   E    +  +    + T    P P +     +   ++
Sbjct  234  VLQFE------PMLPKEATSATAGEAAGASTISGMGISSTSGAGPAPDI----VFQPVKK  283

Query  237  LIYVPRS-AQKGFAVGFWPIPESFWPDLSASSLPARSAHPNVK-FTCTSQEPMVIENLPF  294
            +IYV +   QK F +G+WP+PE +WPD  A +LP R AHP +K  T    EP ++ + P 
Sbjct  284  MIYVQKHITQKTFPIGYWPLPEPYWPDSKAITLPPRDAHPKLKVLTPAVDEPQLVRSFPV  343

Query  295  DKYELEPSPLTQYILARKQPTICWQVFVANSYKSSEVGHPFGYLKASTNLTCVNLFVMPY  354
            DKYE+E  PLT  IL +++   CWQV V N     E+  PFGYLKA+ N + V+L+V+ Y
Sbjct  344  DKYEIEGCPLTLQILNKREMNKCWQVIVTNGMHGFEL--PFGYLKAAPNFSQVHLYVLAY  401

Query  355  NYPVLLPLLEELFKVHRLKPTNEWRTQFQNYMRTMPTYYAASLRRALTRMGAPTPLAQTL  414
            NYP LLP+L +L   + + P ++   +F  Y+R++P YY   LR+AL  +  P  L Q L
Sbjct  402  NYPALLPILHDLIHKYNMSPPSDLMYKFNAYVRSIPPYYCPFLRKALVNINVPYQLLQFL  461

Query  415  IPDNMDNSLSYSVLNYLKRLKNQAKIEFDRLCNEVLSKQLATANMTKNLVNGSTTVTEGV  474
            +P+N+DN LS ++ N LK +KN AK + + LC +V  KQL         V       E  
Sbjct  462  LPENVDNYLSPTIANQLKHIKNTAKQDQENLCMKVY-KQLKQPKPPYRQV-------ETG  513

Query  475  RVIPRTPLKKDLVSHPLLQDKFTGLRDQLNEFGGFVVGLVR-NQQRGAHSYRNAFDVPRK  533
            ++    PL++DLV HPLL+D F+ L  +++    + + + +   Q  A S+RN FD+PR+
Sbjct  514  KLFTGAPLRRDLVRHPLLRDIFSKLHGEIDPVENYTIVVPQPTHQSSAKSHRNPFDIPRR  573

Query  534  SLLDQVVRMRANFLQPGLLHTKLLDDDYVHSMPLAQMGNYQEYLKRMTPPLREIESAPVR  593
             L++++ +MR   L+P      L+  D  H +P+A+MGNYQEYLK    PLREIE   VR
Sbjct  574  DLVEEIAKMRETLLRP----VSLVAKDSGHCLPIAEMGNYQEYLKNKDNPLREIEPTNVR  629

Query  594  QHMFGNPFKIDKRM-MVDEADIDMVGATSS  622
            QHMFGNP+K DK M MVDEAD+  V    S
Sbjct  630  QHMFGNPYKKDKHMVMVDEADLSDVAPMKS  659


 Score = 60.5 bits (145),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 48/74 (65%), Gaps = 0/74 (0%)

Query  816   VLTKKELEDIRRHNLSVRELVYKEVRRRGTNYETLFSHLHQIQGTLDIRLAFLRDIVKES  875
             + T+++ E  R HN+ +R  +++++RR G +Y  L  HL+ ++G  D++  F+   + ES
Sbjct  1184  IFTEEQREAARLHNVELRLQIFRDIRRPGRDYSQLLEHLNLVKGDQDMQSDFVDMCIVES  1243

Query  876   LRFKRRNLASLLED  889
             LRF+R  +AS +++
Sbjct  1244  LRFRRHRMASSIQE  1257


>Q9VJ14_DROME unnamed protein product
Length=1049

 Score = 32.7 bits (73),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 46/159 (29%), Positives = 63/159 (40%), Gaps = 28/159 (18%)

Query  592  VRQHMFGNPFKID------KRMMVDEADIDMVGATSSTSKGGLKRSLPASDGGGSLASKP  645
            +RQ +FG   + +      + + V     D  G  SS S G          G GS+A+ P
Sbjct  777  IRQLIFGQQGEAESLPRNLQALEVSAGSAD--GEESSASAGAESNGA----GPGSVAAPP  830

Query  646  PPNKR------KPGPIPKDVVVRRPSYTPTNTPPSSPVPWVDDTKNQVTPTADSNQVSSN  699
            PP ++      KP  IP   V   PS     TP +S  P V    +  TP   S QV+  
Sbjct  831  PPQRQTFELMPKPNDIPAIGVGASPS-----TPSAS--PGVKKLNSDATPQNVSPQVAPR  883

Query  700  ITNSTPSVSNAPCINSPEKLVNGLAEMPTIPIFEPIPVE  738
                 P V+ +   +S   L  G A   T P+  P P E
Sbjct  884  KKAPKPPVTTS---SSSTALEAGAAGPSTSPVIVPGPHE  919


>M9PC48_DROME unnamed protein product
Length=18095

 Score = 32.3 bits (72),  Expect = 2.8, Method: Composition-based stats.
 Identities = 26/93 (28%), Positives = 43/93 (46%), Gaps = 13/93 (14%)

Query  673    PSSPVPWVDDTKNQVTPTADSNQVSSNITNSTPSVSNAPCI--NSPEKLVNGLAEMPTIP  730
              PS P P    T   +   +   Q S  I+  TP + N P I   +P++   G+  +P++P
Sbjct  14431  PSLPQPVSTPTSGVINIPS---QASPPISVPTPGIVNIPSIPQPTPQRPSPGIINVPSVP  14487

Query  731    IFEPIPVEHTNNHMDAP------PTLTPVVNNV  757
                +PIP   +   ++ P      P+ TP V N+
Sbjct  14488  --QPIPTAPSPGIINIPSVPQPLPSPTPGVINI  14518



Lambda      K        H
   0.318    0.133    0.398 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 16027285120


Query= XP_050573086.1 integrator complex subunit 6 isoform X3 [Bombus
affinis]

Length=891
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

INT6_DROME  unnamed protein product                                   533     6e-172
Q9VJ14_DROME  unnamed protein product                                 32.3    2.1   
M9PC48_DROME  unnamed protein product                                 32.0    2.8   


>INT6_DROME unnamed protein product
Length=1284

 Score = 533 bits (1373),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 282/607 (46%), Positives = 384/607 (63%), Gaps = 32/607 (5%)

Query  1    MNELKNLQCVGLTTLGAALKHALDVLNINRMQTGIDTYGQGRCPFYLEPSVIVVITDGGK  60
            MNELKNLQ  GLT++G +L++A D+LN+NRMQ+GIDTYGQGRCPFYLEPSVI+VITDGG+
Sbjct  77   MNELKNLQSHGLTSMGESLRNAFDLLNLNRMQSGIDTYGQGRCPFYLEPSVIIVITDGGR  136

Query  61   YTTNSGVNQELTLPMHSPIPGSELTKEPFRWDQRLFSLVLRLSGTPAVERDTGLVASDSS  120
            Y+  +GV+QE+ LP+ + IPG++ TKEPFRWDQRLFSLVLR+ G    ER  G V  D S
Sbjct  137  YSYRNGVHQEIILPLSNQIPGTKFTKEPFRWDQRLFSLVLRMPGNKIDERVDGKVPHDDS  196

Query  121  PIDAMCEVTGGRSYCITSFRMMMQCIDSLVQKVQSGVVINFEKIGPDPPPLNNETQHADD  180
            PI+ MCEVTGGRSY + S  ++ QCI+SLVQKVQ GVV+ FE      P L  E   A  
Sbjct  197  PIERMCEVTGGRSYRVRSHYVLNQCIESLVQKVQPGVVLQFE------PMLPKEATSATA  250

Query  181  DENEDENNTT----NGTRTYLPNPTVPGNTAWHSCRRLIYVPRS-AQKGFAVGFWPIPES  235
             E    +  +    + T    P P +     +   +++IYV +   QK F +G+WP+PE 
Sbjct  251  GEAAGASTISGMGISSTSGAGPAPDI----VFQPVKKMIYVQKHITQKTFPIGYWPLPEP  306

Query  236  FWPDLSASSLPARSAHPNVK-FTCTSQEPMVIENLPFDKYELEPSPLTQYILARKQPTIC  294
            +WPD  A +LP R AHP +K  T    EP ++ + P DKYE+E  PLT  IL +++   C
Sbjct  307  YWPDSKAITLPPRDAHPKLKVLTPAVDEPQLVRSFPVDKYEIEGCPLTLQILNKREMNKC  366

Query  295  WQVFVANSYKSSEVGHPFGYLKASTNLTCVNLFVMPYNYPVLLPLLEELFKVHRLKPTNE  354
            WQV V N     E+  PFGYLKA+ N + V+L+V+ YNYP LLP+L +L   + + P ++
Sbjct  367  WQVIVTNGMHGFEL--PFGYLKAAPNFSQVHLYVLAYNYPALLPILHDLIHKYNMSPPSD  424

Query  355  WRTQFQNYMRTMPTYYAASLRRALTRMGAPTPLAQTLIPDNMDNSLSYSVLNYLKRLKNQ  414
               +F  Y+R++P YY   LR+AL  +  P  L Q L+P+N+DN LS ++ N LK +KN 
Sbjct  425  LMYKFNAYVRSIPPYYCPFLRKALVNINVPYQLLQFLLPENVDNYLSPTIANQLKHIKNT  484

Query  415  AKIEFDRLCNEVLSKQLATANMTKNLVNGSTTVTEGVRVIPRTPLKKDLVSHPLLQDKFT  474
            AK + + LC +V  KQL         V       E  ++    PL++DLV HPLL+D F+
Sbjct  485  AKQDQENLCMKVY-KQLKQPKPPYRQV-------ETGKLFTGAPLRRDLVRHPLLRDIFS  536

Query  475  GLRDQLNEFGGFVVGLVR-NQQRGAHSYRNAFDVPRKSLLDQVVRMRANFLQPGLLHTKL  533
             L  +++    + + + +   Q  A S+RN FD+PR+ L++++ +MR   L+P      L
Sbjct  537  KLHGEIDPVENYTIVVPQPTHQSSAKSHRNPFDIPRRDLVEEIAKMRETLLRP----VSL  592

Query  534  LDDDYVHSMPLAQMGNYQEYLKRMTPPLREIESAPVRQHMFGNPFKIDKRM-MVDEADID  592
            +  D  H +P+A+MGNYQEYLK    PLREIE   VRQHMFGNP+K DK M MVDEAD+ 
Sbjct  593  VAKDSGHCLPIAEMGNYQEYLKNKDNPLREIEPTNVRQHMFGNPYKKDKHMVMVDEADLS  652

Query  593  MVGATSS  599
             V    S
Sbjct  653  DVAPMKS  659


 Score = 60.5 bits (145),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 25/81 (31%), Positives = 50/81 (62%), Gaps = 0/81 (0%)

Query  793   VLTKKELEDIRRHNLSVRELVYKEVRRRGTNYETLFSHLHQIQGTLDIRLAFLRDIVKES  852
             + T+++ E  R HN+ +R  +++++RR G +Y  L  HL+ ++G  D++  F+   + ES
Sbjct  1184  IFTEEQREAARLHNVELRLQIFRDIRRPGRDYSQLLEHLNLVKGDQDMQSDFVDMCIVES  1243

Query  853   LRFKRRNLASLLEDHLKNLQE  873
             LRF+R  +AS +++     Q+
Sbjct  1244  LRFRRHRMASSIQEWWDRKQQ  1264


>Q9VJ14_DROME unnamed protein product
Length=1049

 Score = 32.3 bits (72),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 46/159 (29%), Positives = 63/159 (40%), Gaps = 28/159 (18%)

Query  569  VRQHMFGNPFKID------KRMMVDEADIDMVGATSSTSKGGLKRSLPASDGGGSLASKP  622
            +RQ +FG   + +      + + V     D  G  SS S G          G GS+A+ P
Sbjct  777  IRQLIFGQQGEAESLPRNLQALEVSAGSAD--GEESSASAGAESNGA----GPGSVAAPP  830

Query  623  PPNKR------KPGPIPKDVVVRRPSYTPTNTPPSSPVPWVDDTKNQVTPTADSNQVSSN  676
            PP ++      KP  IP   V   PS     TP +S  P V    +  TP   S QV+  
Sbjct  831  PPQRQTFELMPKPNDIPAIGVGASPS-----TPSAS--PGVKKLNSDATPQNVSPQVAPR  883

Query  677  ITNSTPSVSNAPCINSPEKLVNGLAEMPTIPIFEPIPVE  715
                 P V+ +   +S   L  G A   T P+  P P E
Sbjct  884  KKAPKPPVTTS---SSSTALEAGAAGPSTSPVIVPGPHE  919


>M9PC48_DROME unnamed protein product
Length=18095

 Score = 32.0 bits (71),  Expect = 2.8, Method: Composition-based stats.
 Identities = 26/93 (28%), Positives = 43/93 (46%), Gaps = 13/93 (14%)

Query  650    PSSPVPWVDDTKNQVTPTADSNQVSSNITNSTPSVSNAPCI--NSPEKLVNGLAEMPTIP  707
              PS P P    T   +   +   Q S  I+  TP + N P I   +P++   G+  +P++P
Sbjct  14431  PSLPQPVSTPTSGVINIPS---QASPPISVPTPGIVNIPSIPQPTPQRPSPGIINVPSVP  14487

Query  708    IFEPIPVEHTNNHMDAP------PTLTPVVNNV  734
                +PIP   +   ++ P      P+ TP V N+
Sbjct  14488  --QPIPTAPSPGIINIPSVPQPLPSPTPGVINI  14518



Lambda      K        H
   0.318    0.133    0.398 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 16027285120


Query= XP_050573087.1 hypoxia up-regulated protein 1 isoform X1 [Bombus
affinis]

Length=953
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O46067_DROME  unnamed protein product                                 876     0.0   
Q22515_CAEEL  unnamed protein product                                 411     1e-128
HSP74_DROME  unnamed protein product                                  217     4e-60 


>O46067_DROME unnamed protein product
Length=923

 Score = 876 bits (2263),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/916 (49%), Positives = 618/916 (67%), Gaps = 36/916 (4%)

Query  25   SNGVAVMSIDMGSESMKVAIVSPGVPMEIALNKESKRKTPVTIAFRNGERSFGEDAQVVG  84
            S G AVMS+D+GSE MKV +VSPGVPMEIALN+ESKRKTP  +AFR+G R+ GEDAQ +G
Sbjct  17   SQGAAVMSVDLGSEWMKVGVVSPGVPMEIALNRESKRKTPAILAFRDGTRTIGEDAQTIG  76

Query  85   IRSPQNSFSYILDLLGKSIDNPMVELYKKRFPYYHIISDAERKTIAFRLDENNTYTPEEL  144
            I+ P +++ Y+LDLLGK+IDNP+V+LY+KRFPYY+I+ D ER T+ FR  + + ++ EEL
Sbjct  77   IKDPNSAYGYLLDLLGKTIDNPIVDLYRKRFPYYNIVGDPERNTVVFRKSDTDEFSVEEL  136

Query  145  LAQILHKGKEFAENSAGQKITEAVITVPGFFNQIERRALMQAADLAGIKVLQLINDYTAV  204
            +AQ+L K K+FA+ S  Q ITE V+TVPG+F Q ER AL+ AA LA +KVLQLINDY AV
Sbjct  137  VAQLLVKAKQFAQESVQQPITECVLTVPGYFGQAEREALLSAAQLANLKVLQLINDYAAV  196

Query  205  ALNYGIFRSKEINDTAHYVMFYDMGASSTTATIVSYQNVKTKEKGFVETNPHVTILGVGY  264
            ALNYG+F   EIN+TA Y +FYDMGA  T+A +VSYQ VK K+    E NP V +LGVGY
Sbjct  197  ALNYGVFHRGEINETAQYFLFYDMGAYKTSAAVVSYQLVKDKQTR--EINPVVQVLGVGY  254

Query  265  DRILGGLEVQIRLQHHLAKEFDALNKTTSSVFSNSRAMAKLFKEAGRVKNVLSANTDHFA  324
            DR LGGLE+Q+RL+ +LA+EF+AL KT + V ++ RA+AKLFKEAGR+KNVLSANT+ FA
Sbjct  255  DRTLGGLEIQLRLRDYLAQEFNALKKTKTDVTTSPRALAKLFKEAGRLKNVLSANTEFFA  314

Query  325  QIEGLIEEHDFRLQVTRDKLEELCADLFERVANPIKIALKTSGLTMDVISQVVLVGAATR  384
            QIE LIE+ DF+L VTR+KLE+LC DL+ R   P++ AL +S L++DVI+QV+L G  TR
Sbjct  315  QIENLIEDIDFKLPVTREKLEQLCEDLWPRATKPLEEALASSHLSLDVINQVILFGGGTR  374

Query  385  MPKIQEHLSQYLTVELSKNINTDEAAALGAVYKAADLSKGFKVKKFVTKDAVLFPIHIVF  444
            +P++QE +   +  EL KN+N DE+A +GAVYKAADLS GFKVKKFV KDA LFP+ + F
Sbjct  375  VPRVQETIKAVIKQELGKNLNADESATMGAVYKAADLSAGFKVKKFVVKDATLFPLQVSF  434

Query  445  DRTVDN--RVKQVKKSLFSKMNPYPQKKIITFNKYTENFQFHINYAELDYLSPNEIAVIG  502
            +R   +   VKQVK++LF+ MNPYPQKK+ITFNK+T++F+F++NYA+LD  S  EIA +G
Sbjct  435  ERDPGDGAAVKQVKRALFALMNPYPQKKVITFNKHTDDFEFYVNYADLDRYSKEEIAALG  494

Query  503  NFNLSTITLSGINEALDKHAKDGAESKGIKAHFAMDESGILNLVNVELVSEKSSSAPD-E  561
            + N++ + L  + E L+K  K+  ++KGIKA+F +D+SGI     VE V EK     D +
Sbjct  495  SLNVTKVQLKQVKELLEKSKKELVDNKGIKAYFYLDDSGIFRCTGVEYVYEKQKPEDDAD  554

Query  562  EEGTFSILGSTISKLFA--GSEDKDGKTEESLKEDTKPVHEEPEYSDLKKEPEDKTKKKN  619
            E+ T S  GST+SKLF   G E KD     S +E+     EEP  S      ED  K K 
Sbjct  555  EDSTLSKFGSTLSKLFTKEGEEKKDN----SEQEEAANAGEEPSKS------EDNEKAKE  604

Query  620  ESTVTEDKTVNKTEKVEKEKEKKPTIITIKEPIKADEIKLGSQILSGDKLVESREKLHRL  679
            E    E K+   T++  + K +   ++T+K P+  +        L G    +S  KL  +
Sbjct  605  EDASKEQKSEESTKQDTEAKNETIKLVTVKSPVTYESQTQFVVPLVGSAYDQSVAKLAAI  664

Query  680  DVYDFEKTKRETALNNLETFIIDAQQKLESEEYAAAATSQEAENILKACSEISEWLYEDG  739
            +  + ++ + E+A N LE  II+ QQKL+ E YA  AT++E E +L  CS + EWLYED 
Sbjct  665  NKAEEQRVRLESAFNALEAHIIEVQQKLDEESYAKCATAEEKEKLLAECSTLGEWLYEDL  724

Query  740  FSVTAEIYEEKLSQLQKLTNDVYERVYEHRERPEVLKGMTSMLNGSTTFLNNMRNLSLSS  799
                AEIYEEKL+QL+KL+N    R +EH ERPE +K +  M++G+  FL   RNL+  +
Sbjct  725  EDPKAEIYEEKLAQLKKLSNVFLARHWEHEERPEAIKALKGMIDGAEKFLVTGRNLTKDT  784

Query  800  ----EIFTQVEIETLEKVINETQEYYDTIIKSFAETALYETVKYKVRDIANKMALLDREV  855
                ++FTQVEI+TL+KVI ET  +  T   +  + A    ++  V+DI +KM+LLDREV
Sbjct  785  NPEKDVFTQVEIDTLDKVITETNAWLKTETAAQKKLAKNADIRLTVKDITDKMSLLDREV  844

Query  856  KYLINKAKIWRPKQESATNHTESTNENATNTKEGPESEPVLKSTADSETENFQSEDASEN  915
            KYL+NK KIW+PK + A    +   E    +  G ++               +SEDA + 
Sbjct  845  KYLVNKIKIWKPKVKPAAEKEKKKEEEVVASGSGDDT---------------KSEDAEQQ  889

Query  916  RKVQNEKSLHPEEPTD  931
            ++   ++    +EP D
Sbjct  890  QEQATKEEQQEQEPVD  905


>Q22515_CAEEL unnamed protein product
Length=921

 Score = 411 bits (1056),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 231/554 (42%), Positives = 349/554 (63%), Gaps = 21/554 (4%)

Query  14   LLITIASFIEYSNG-VAVMSIDMGSESMKVAIVSPGVPMEIALNKESKRKTPVTIAFRNG  72
            LL+ I    + ++  +A MSID+GS+ +K+ +V PGVPM+I LNKES+RKTP  I+F+N 
Sbjct  11   LLVAICCLYQPADAALAAMSIDLGSQFIKIGLVKPGVPMDIVLNKESRRKTPNVISFKND  70

Query  73   ERSFGEDAQVVGIRSPQNSFSYILDLLGKSIDNPMVELYKKRFPYYHIISDAERKTIAFR  132
            ER F E A  +    PQ+S++++L ++ +   +     ++K FP+     D  RKT+ F 
Sbjct  71   ERFFAEAAAAMSSSHPQSSYNFLLSMIARKEGDDAFVTFQKTFPFTAFEFDEVRKTVVFP  130

Query  133  LDENNTYTPEELLAQILHKGKEFAENSAGQKITEAVITVPGFFNQIERRALMQAADLAGI  192
              E   Y  E LLA IL   K+  E  A Q + + VITVP F NQ ERRA+  AA++AG+
Sbjct  131  YKEEK-YNVETLLAMILWNAKKVTEAYADQTVKDVVITVPIFLNQAERRAIASAAEIAGL  189

Query  193  KVLQLINDYTAVALNYGIFRSKEINDTAHYVMFYDMGASSTTATIVSYQNVKTKEKGFVE  252
             +LQL+ND +A ALNYG+FR KEI +   +++ YDMGA  TTATIV Y    T++ G  +
Sbjct  190  NLLQLLNDGSAAALNYGVFRRKEITEKPTHMLIYDMGAVKTTATIVQYVLESTRKDG-KD  248

Query  253  TNPHVTILGVGYDRILGGLEVQIRLQHHLAKEFDALNKTTSSVFSNSRAMAKLFKEAGRV  312
              P +  +GVG+D+ LGGLE+  RL+ HL K F    KT+  + +N+RA+ KL KEA RV
Sbjct  249  KQPTLRTVGVGFDKTLGGLEITNRLRDHLEKVFRDTVKTSKDISTNARAIGKLHKEAERV  308

Query  313  KNVLSANTDHFAQIEGLIEEHDFRLQVTRDKLEELCADLFERVANPIKIALKTSGLTMDV  372
            K VLSAN D +AQ+E L EE +FR +VTR++LE++  DL  R+A PI  A+  + ++ + 
Sbjct  309  KQVLSANKDTYAQVESLFEEQNFRAKVTREELEKMIEDLEPRIAAPILDAIGMAQISTND  368

Query  373  ISQVVLVGAATRMPKIQEHLSQYLT-VELSKNINTDEAAALGAVYKAADLSKGFKVKKFV  431
            I  VVL+GA TR+PK++E L   L   E+S  +NTDEA A+GAVY+AA LSK FKV  F 
Sbjct  369  IDLVVLMGAGTRVPKVKEILKTILKDKEISNFLNTDEAIAMGAVYQAAHLSKSFKVLPFN  428

Query  432  TKDAVLFPIHIVF-DRTVDNRVKQVKKSLFSKMNPYPQKKIITFNKYTENFQFHINYAEL  490
              + +L+P+ + F  +T +  +K ++KSLF +  P P  +++ F+ Y+++F+  I  A+ 
Sbjct  429  VHEKILYPVFVNFLTKTEEGTMKPIRKSLFGENYPVPN-RVMHFSSYSDDFKIDIQDADK  487

Query  491  DYLSPNEIAVIGNFNLSTITLSGINEALDKHAKD-GAESKGIKAHFAMDESGILNLVNVE  549
            +              LST+ +SG+ +A++K   D  +  KG+K  F++D SGI+++    
Sbjct  488  N-------------PLSTVEISGVKDAIEKEVTDENSVLKGVKTTFSIDLSGIVSVEKAS  534

Query  550  LVSEKSSSAPDEEE  563
            +V EK  + P+E++
Sbjct  535  VVVEKVPT-PEEKD  547


>HSP74_DROME unnamed protein product
Length=641

 Score = 217 bits (553),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 163/535 (30%), Positives = 265/535 (50%), Gaps = 46/535 (9%)

Query  28   VAVMSIDMGSESMKVAIVSPGVPMEIALNKESKRKTPVTIAFRNGERSFGEDAQVVGIRS  87
            +  + ID+G+    V +   G  +EI  N +  R TP  +AF + ER  G+ A+     +
Sbjct  1    MPAIGIDLGTTYSCVGVYQHG-KVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMN  59

Query  88   PQNSFSYILDLLGKSIDNPMVELYKKRFPYYHIISDAERKTIAFRL-DENNTYTPEELLA  146
            P+N+      L+G+  D+P +    K +P+  ++SD  +  I      E+  + PEE+ +
Sbjct  60   PRNTVFDAKRLIGRKYDDPKIAEDMKHWPF-KVVSDGGKPKIGVEYKGESKRFAPEEISS  118

Query  147  QILHKGKEFAENSAGQKITEAVITVPGFFNQIERRALMQAADLAGIKVLQLINDYTAVAL  206
             +L K KE AE   G+ IT+AVITVP +FN  +R+A   A  +AG+ VL++IN+ TA AL
Sbjct  119  MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL  178

Query  207  NYGIFRSKEINDTAHYVMFYDMGASSTTATIVSYQNVKTKEKGFVETNPHVTILGVGYDR  266
             YG+   K + D  + V+ +D+G  +   +I++           ++      +     D 
Sbjct  179  AYGL--DKNLKDERN-VLIFDLGGGTFDVSILT-----------IDEGSLFEVRSTAGDT  224

Query  267  ILGGLEVQIRLQHHLAKEFDALNKTTSSVFSNSRAMAKLFKEAGRVKNVLSANTDHFAQI  326
             LGG +   RL  HLA+EF    K    + SN RA+ +L   A R K  LS++T+   +I
Sbjct  225  HLGGEDFDNRLVTHLAEEFK--RKYKKDLRSNPRALRRLRTAAERAKRTLSSSTEATIEI  282

Query  327  EGLIEEHDFRLQVTRDKLEELCADLFERVANPIKIALKTSGLTMDVISQVVLVGAATRMP  386
            + L E  DF  +V+R + EELCADLF     P++ AL  + +    I  +VLVG +TR+P
Sbjct  283  DALFEGQDFYTKVSRARFEELCADLFRNTLQPVEKALNDAKMDKGQIHDIVLVGGSTRIP  342

Query  387  KIQEHLSQYLTVE-LSKNINTDEAAALGAVYKAADLS--KGFKVKKFVTKDAVLFPIHIV  443
            K+Q  L ++   + L+ +IN DEA A GA  +AA LS  +  K++  +  D     + I 
Sbjct  343  KVQSLLQEFFHGKNLNLSINPDEAVAYGAAVQAAILSGDQSGKIQDVLLVDVAPLSLGI-  401

Query  444  FDRTVDNRVKQVKKSLFSKMNPYPQKKIITFNKYTEN-FQFHINYAELDYLSPNEIAVIG  502
                       V   L  +    P K+  TF+ Y++N     I   E +     +   +G
Sbjct  402  ------ETAGGVMTKLIERNCRIPCKQTKTFSTYSDNQPGVSIQVYEGERAMTKDNNALG  455

Query  503  NFNLSTITLS--GINEALDKHAKDGAESKGIKAHFAMDESGILNLVNVELVSEKS  555
             F+LS I  +  G+ +              I+  F +D +GILN+   E+ + K+
Sbjct  456  TFDLSGIPPAPRGVPQ--------------IEVTFDLDANGILNVSAKEMSTGKA  496



Lambda      K        H
   0.318    0.133    0.398 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 16027285120


Query= XP_050573088.1 hypoxia up-regulated protein 1 isoform X2 [Bombus
affinis]

Length=938
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O46067_DROME  unnamed protein product                                 861     0.0   
Q22515_CAEEL  unnamed protein product                                 412     5e-129
HSP74_DROME  unnamed protein product                                  217     3e-60 


>O46067_DROME unnamed protein product
Length=923

 Score = 861 bits (2225),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/906 (49%), Positives = 611/906 (67%), Gaps = 31/906 (3%)

Query  25   SNGVAVMSIDMGSESMKVAIVSPGVPMEIALNKESKRKTPVTIAFRNGERSFGEDAQVVG  84
            S G AVMS+D+GSE MKV +VSPGVPMEIALN+ESKRKTP  +AFR+G R+ GEDAQ +G
Sbjct  17   SQGAAVMSVDLGSEWMKVGVVSPGVPMEIALNRESKRKTPAILAFRDGTRTIGEDAQTIG  76

Query  85   IRSPQNSFSYILDLLGKSIDNPMVELYKKRFPYYHIISDAERKTIAFRLDENNTYTPEEL  144
            I+ P +++ Y+LDLLGK+IDNP+V+LY+KRFPYY+I+ D ER T+ FR  + + ++ EEL
Sbjct  77   IKDPNSAYGYLLDLLGKTIDNPIVDLYRKRFPYYNIVGDPERNTVVFRKSDTDEFSVEEL  136

Query  145  LAQILHKGKEFAENSAGQKITEAVITVPGFFNQIERRALMQAADLAGIKVLQLINDYTAV  204
            +AQ+L K K+FA+ S  Q ITE V+TVPG+F Q ER AL+ AA LA +KVLQLINDY AV
Sbjct  137  VAQLLVKAKQFAQESVQQPITECVLTVPGYFGQAEREALLSAAQLANLKVLQLINDYAAV  196

Query  205  ALNYGIFRSKEINDTAHYVMFYDMGASSTTATIVSYQNVKTKEKGFVETNPHVTILGVGY  264
            ALNYG+F   EIN+TA Y +FYDMGA  T+A +VSYQ VK K+    E NP V +LGVGY
Sbjct  197  ALNYGVFHRGEINETAQYFLFYDMGAYKTSAAVVSYQLVKDKQTR--EINPVVQVLGVGY  254

Query  265  DRILGGLEVQIRLQHHLAKEFDALNKTTSSVFSNSRAMAKLFKEAGRVKNVLSANTDHFA  324
            DR LGGLE+Q+RL+ +LA+EF+AL KT + V ++ RA+AKLFKEAGR+KNVLSANT+ FA
Sbjct  255  DRTLGGLEIQLRLRDYLAQEFNALKKTKTDVTTSPRALAKLFKEAGRLKNVLSANTEFFA  314

Query  325  QIEGLIEEHDFRLQVTRDKLEELCADLFERVANPIKIALKTSGLTMDVISQVVLVGAATR  384
            QIE LIE+ DF+L VTR+KLE+LC DL+ R   P++ AL +S L++DVI+QV+L G  TR
Sbjct  315  QIENLIEDIDFKLPVTREKLEQLCEDLWPRATKPLEEALASSHLSLDVINQVILFGGGTR  374

Query  385  MPKIQEHLSQYLTVELSKNINTDEAAALGAVYKAADLSKGFKVKKFVTKDAVLFPIHIVF  444
            +P++QE +   +  EL KN+N DE+A +GAVYKAADLS GFKVKKFV KDA LFP+ + F
Sbjct  375  VPRVQETIKAVIKQELGKNLNADESATMGAVYKAADLSAGFKVKKFVVKDATLFPLQVSF  434

Query  445  DRTVDN--RVKQVKKSLFSKMNPYPQKKIITFNKYTENFQFHINYAELDYLSPNEIAVIG  502
            +R   +   VKQVK++LF+ MNPYPQKK+ITFNK+T++F+F++NYA+LD  S  EIA +G
Sbjct  435  ERDPGDGAAVKQVKRALFALMNPYPQKKVITFNKHTDDFEFYVNYADLDRYSKEEIAALG  494

Query  503  NFNLSTITLSGINEALDKHAKDGAESKGIKAHFAMDESGILNLVNVELVSEKSSSAPDEE  562
            + N++ + L  + E L+K  K+  ++KGIKA+F +D+SGI     VE V EK     D +
Sbjct  495  SLNVTKVQLKQVKELLEKSKKELVDNKGIKAYFYLDDSGIFRCTGVEYVYEKQKPEDDAD  554

Query  563  EGSE-DKDGKTEESL----KEDTKPVHEEPEYSDLKKEP---EDKTKKKNESTVTEDKTV  614
            E S   K G T   L     E+ K   E+ E ++  +EP   ED  K K E    E K+ 
Sbjct  555  EDSTLSKFGSTLSKLFTKEGEEKKDNSEQEEAANAGEEPSKSEDNEKAKEEDASKEQKSE  614

Query  615  NKTEKVEKEKEKKPTIITIKEPIKADEIKLGSQILSGDKLVESREKLHRLDVYDFEKTKR  674
              T++  + K +   ++T+K P+  +        L G    +S  KL  ++  + ++ + 
Sbjct  615  ESTKQDTEAKNETIKLVTVKSPVTYESQTQFVVPLVGSAYDQSVAKLAAINKAEEQRVRL  674

Query  675  ETALNNLETFIIDAQQKLESEEYAAAATSQEAENILKACSEISEWLYEDGFSVTAEIYEE  734
            E+A N LE  II+ QQKL+ E YA  AT++E E +L  CS + EWLYED     AEIYEE
Sbjct  675  ESAFNALEAHIIEVQQKLDEESYAKCATAEEKEKLLAECSTLGEWLYEDLEDPKAEIYEE  734

Query  735  KLSQLQKLTNDVYERVYEHRERPEVLKGMTSMLNGSTTFLNNMRNLSLSS----EIFTQV  790
            KL+QL+KL+N    R +EH ERPE +K +  M++G+  FL   RNL+  +    ++FTQV
Sbjct  735  KLAQLKKLSNVFLARHWEHEERPEAIKALKGMIDGAEKFLVTGRNLTKDTNPEKDVFTQV  794

Query  791  EIETLEKVINETQEYYDTIIKSFAETALYETVKYKVRDIANKMALLDREVKYLINKAKIW  850
            EI+TL+KVI ET  +  T   +  + A    ++  V+DI +KM+LLDREVKYL+NK KIW
Sbjct  795  EIDTLDKVITETNAWLKTETAAQKKLAKNADIRLTVKDITDKMSLLDREVKYLVNKIKIW  854

Query  851  RPKQESATNHTESTNENATNTKEGPESEPVLKSTADSETENFQSEDASENRKVQNEKSLH  910
            +PK + A    +   E    +  G ++               +SEDA + ++   ++   
Sbjct  855  KPKVKPAAEKEKKKEEEVVASGSGDDT---------------KSEDAEQQQEQATKEEQQ  899

Query  911  PEEPTD  916
             +EP D
Sbjct  900  EQEPVD  905


>Q22515_CAEEL unnamed protein product
Length=921

 Score = 412 bits (1058),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 232/557 (42%), Positives = 350/557 (63%), Gaps = 21/557 (4%)

Query  14   LLITIASFIEYSNG-VAVMSIDMGSESMKVAIVSPGVPMEIALNKESKRKTPVTIAFRNG  72
            LL+ I    + ++  +A MSID+GS+ +K+ +V PGVPM+I LNKES+RKTP  I+F+N 
Sbjct  11   LLVAICCLYQPADAALAAMSIDLGSQFIKIGLVKPGVPMDIVLNKESRRKTPNVISFKND  70

Query  73   ERSFGEDAQVVGIRSPQNSFSYILDLLGKSIDNPMVELYKKRFPYYHIISDAERKTIAFR  132
            ER F E A  +    PQ+S++++L ++ +   +     ++K FP+     D  RKT+ F 
Sbjct  71   ERFFAEAAAAMSSSHPQSSYNFLLSMIARKEGDDAFVTFQKTFPFTAFEFDEVRKTVVFP  130

Query  133  LDENNTYTPEELLAQILHKGKEFAENSAGQKITEAVITVPGFFNQIERRALMQAADLAGI  192
              E   Y  E LLA IL   K+  E  A Q + + VITVP F NQ ERRA+  AA++AG+
Sbjct  131  YKEEK-YNVETLLAMILWNAKKVTEAYADQTVKDVVITVPIFLNQAERRAIASAAEIAGL  189

Query  193  KVLQLINDYTAVALNYGIFRSKEINDTAHYVMFYDMGASSTTATIVSYQNVKTKEKGFVE  252
             +LQL+ND +A ALNYG+FR KEI +   +++ YDMGA  TTATIV Y    T++ G  +
Sbjct  190  NLLQLLNDGSAAALNYGVFRRKEITEKPTHMLIYDMGAVKTTATIVQYVLESTRKDG-KD  248

Query  253  TNPHVTILGVGYDRILGGLEVQIRLQHHLAKEFDALNKTTSSVFSNSRAMAKLFKEAGRV  312
              P +  +GVG+D+ LGGLE+  RL+ HL K F    KT+  + +N+RA+ KL KEA RV
Sbjct  249  KQPTLRTVGVGFDKTLGGLEITNRLRDHLEKVFRDTVKTSKDISTNARAIGKLHKEAERV  308

Query  313  KNVLSANTDHFAQIEGLIEEHDFRLQVTRDKLEELCADLFERVANPIKIALKTSGLTMDV  372
            K VLSAN D +AQ+E L EE +FR +VTR++LE++  DL  R+A PI  A+  + ++ + 
Sbjct  309  KQVLSANKDTYAQVESLFEEQNFRAKVTREELEKMIEDLEPRIAAPILDAIGMAQISTND  368

Query  373  ISQVVLVGAATRMPKIQEHLSQYLT-VELSKNINTDEAAALGAVYKAADLSKGFKVKKFV  431
            I  VVL+GA TR+PK++E L   L   E+S  +NTDEA A+GAVY+AA LSK FKV  F 
Sbjct  369  IDLVVLMGAGTRVPKVKEILKTILKDKEISNFLNTDEAIAMGAVYQAAHLSKSFKVLPFN  428

Query  432  TKDAVLFPIHIVF-DRTVDNRVKQVKKSLFSKMNPYPQKKIITFNKYTENFQFHINYAEL  490
              + +L+P+ + F  +T +  +K ++KSLF +  P P  +++ F+ Y+++F+  I  A+ 
Sbjct  429  VHEKILYPVFVNFLTKTEEGTMKPIRKSLFGENYPVPN-RVMHFSSYSDDFKIDIQDADK  487

Query  491  DYLSPNEIAVIGNFNLSTITLSGINEALDKHAKD-GAESKGIKAHFAMDESGILNLVNVE  549
            +              LST+ +SG+ +A++K   D  +  KG+K  F++D SGI+++    
Sbjct  488  N-------------PLSTVEISGVKDAIEKEVTDENSVLKGVKTTFSIDLSGIVSVEKAS  534

Query  550  LVSEKSSSAPDEEEGSE  566
            +V EK  + P+E++  E
Sbjct  535  VVVEKVPT-PEEKDKYE  550


>HSP74_DROME unnamed protein product
Length=641

 Score = 217 bits (553),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 163/535 (30%), Positives = 265/535 (50%), Gaps = 46/535 (9%)

Query  28   VAVMSIDMGSESMKVAIVSPGVPMEIALNKESKRKTPVTIAFRNGERSFGEDAQVVGIRS  87
            +  + ID+G+    V +   G  +EI  N +  R TP  +AF + ER  G+ A+     +
Sbjct  1    MPAIGIDLGTTYSCVGVYQHG-KVEIIANDQGNRTTPSYVAFTDSERLIGDPAKNQVAMN  59

Query  88   PQNSFSYILDLLGKSIDNPMVELYKKRFPYYHIISDAERKTIAFRL-DENNTYTPEELLA  146
            P+N+      L+G+  D+P +    K +P+  ++SD  +  I      E+  + PEE+ +
Sbjct  60   PRNTVFDAKRLIGRKYDDPKIAEDMKHWPF-KVVSDGGKPKIGVEYKGESKRFAPEEISS  118

Query  147  QILHKGKEFAENSAGQKITEAVITVPGFFNQIERRALMQAADLAGIKVLQLINDYTAVAL  206
             +L K KE AE   G+ IT+AVITVP +FN  +R+A   A  +AG+ VL++IN+ TA AL
Sbjct  119  MVLTKMKETAEAYLGESITDAVITVPAYFNDSQRQATKDAGHIAGLNVLRIINEPTAAAL  178

Query  207  NYGIFRSKEINDTAHYVMFYDMGASSTTATIVSYQNVKTKEKGFVETNPHVTILGVGYDR  266
             YG+   K + D  + V+ +D+G  +   +I++           ++      +     D 
Sbjct  179  AYGL--DKNLKDERN-VLIFDLGGGTFDVSILT-----------IDEGSLFEVRSTAGDT  224

Query  267  ILGGLEVQIRLQHHLAKEFDALNKTTSSVFSNSRAMAKLFKEAGRVKNVLSANTDHFAQI  326
             LGG +   RL  HLA+EF    K    + SN RA+ +L   A R K  LS++T+   +I
Sbjct  225  HLGGEDFDNRLVTHLAEEFK--RKYKKDLRSNPRALRRLRTAAERAKRTLSSSTEATIEI  282

Query  327  EGLIEEHDFRLQVTRDKLEELCADLFERVANPIKIALKTSGLTMDVISQVVLVGAATRMP  386
            + L E  DF  +V+R + EELCADLF     P++ AL  + +    I  +VLVG +TR+P
Sbjct  283  DALFEGQDFYTKVSRARFEELCADLFRNTLQPVEKALNDAKMDKGQIHDIVLVGGSTRIP  342

Query  387  KIQEHLSQYLTVE-LSKNINTDEAAALGAVYKAADLS--KGFKVKKFVTKDAVLFPIHIV  443
            K+Q  L ++   + L+ +IN DEA A GA  +AA LS  +  K++  +  D     + I 
Sbjct  343  KVQSLLQEFFHGKNLNLSINPDEAVAYGAAVQAAILSGDQSGKIQDVLLVDVAPLSLGI-  401

Query  444  FDRTVDNRVKQVKKSLFSKMNPYPQKKIITFNKYTEN-FQFHINYAELDYLSPNEIAVIG  502
                       V   L  +    P K+  TF+ Y++N     I   E +     +   +G
Sbjct  402  ------ETAGGVMTKLIERNCRIPCKQTKTFSTYSDNQPGVSIQVYEGERAMTKDNNALG  455

Query  503  NFNLSTITLS--GINEALDKHAKDGAESKGIKAHFAMDESGILNLVNVELVSEKS  555
             F+LS I  +  G+ +              I+  F +D +GILN+   E+ + K+
Sbjct  456  TFDLSGIPPAPRGVPQ--------------IEVTFDLDANGILNVSAKEMSTGKA  496



Lambda      K        H
   0.318    0.133    0.398 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 16027285120


Query= XP_050573089.1 2-oxoadipate dehydrogenase complex component E1
isoform X1 [Bombus affinis]

Length=934
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ODO1_CAEEL  unnamed protein product                                   555     0.0   
Q383T1_TRYB2  unnamed protein product                                 533     2e-174
Q387A7_TRYB2  unnamed protein product                                 487     1e-156


>ODO1_CAEEL unnamed protein product
Length=1029

 Score = 555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/894 (37%), Positives = 497/894 (56%), Gaps = 53/894 (6%)

Query  75    LISAYREYGHKQAEINPV----ASKKPAPLAELKLERFGLSLDDK-----VPFRGILSMG  125
             LI +Y+  GH  A+++P+    A        EL+L  +GL   D      +P    +S  
Sbjct  144   LIRSYQTRGHNIADLDPLGINSADLDDTIPPELELSFYGLGERDLDREFLLPPTTFISE-  202

Query  126   KDEGTVEEALKFLNETYTGHIGVEFSYLETEEEREWFAETVEKSSREPVTDETRIGIATE  185
             K   T+ E L+ L + Y    GVE+ +L   E+++W     E      ++ + +  +   
Sbjct  203   KKSLTLREILQRLKDIYCTSTGVEYMHLNNLEQQDWIRRRFEAPRVTELSHDQKKVLFKR  262

Query  186   MLKSQTFDQFLAIKFVNFKRYSGEGAESMMAFYYEFFKLCANDDLKYIVICMAHRGRLNF  245
             +++S  F++FLA K+ + KR+  EG E ++    +     +   +   VI M HRGRLN 
Sbjct  263   LIRSTKFEEFLAKKWPSEKRFGLEGCEVLIPAMKQVIDSSSTLGVDSFVIGMPHRGRLNV  322

Query  246   LTGMLNFPPEKLFRQLRGYSEFPDNVNATGDVISHF-VSSTNLD-INRKSLHVTVLRNPS  303
             L  +   P   +  Q   +S        +GDV  H  V    L+  ++K++ + V+ NPS
Sbjct  323   LANVCRQPLATILSQ---FSTLEPADEGSGDVKYHLGVCIERLNRQSQKNVKIAVVANPS  379

Query  304   HLEAVNPVSMGKTRGMMQANKDGAYSEHANAQWSDKVLNIQVHGDAAYAAQGVDQECLAL  363
             HLEAV+PV MGK R         A + +A  +  D+ + I +HGDAA+A QGV  E   L
Sbjct  380   HLEAVDPVVMGKVR---------AEAFYAGDEKCDRTMAILLHGDAAFAGQGVVLETFNL  430

Query  364   SAVPHFEIGGTVHLMINNQLGFTTPASRGRSSRYCTDLAKMISAPVIHVNGDDPEMVIRA  423
               +P +   G +H+++NNQ+GFTT     RSS YCTD+ +++  P+ HVN DDPE V+  
Sbjct  431   DDLPSYTTHGAIHIVVNNQIGFTTDPRSSRSSPYCTDVGRVVGCPIFHVNVDDPEAVMHV  490

Query  424   ARIAFKYQRKFRKDIFLDLNCFRRWGHNELDDPVFTNPVIYKIIHSRPSVPDRYLDKLVK  483
               +A  +++ F+KD+ +DL C+RR GHNELD+P+FT P++Y+ I    +  ++Y +K++ 
Sbjct  491   CNVAADWRKTFKKDVIVDLVCYRRHGHNELDEPMFTQPLMYQRIKQTKTALEKYQEKILN  550

Query  484   NNVLPMEKVKNIIEDHKAKLNQGLNEAD--NYVPQPTYFAGLWSEIQQADASVTQWDTGV  541
               V   + VK  +  + + L      A    YV    +    W +  +    +    TG+
Sbjct  551   EGVANEQYVKEELTKYGSILEDAYENAQKVTYVRNRDWLDSPWDDFFKKRDPLKLPSTGI  610

Query  542   DLSLLRFIAEKSVHIDDDSIIHPKLLKSHVQSRLNKIASGKHLNWATAEALAIGTLLYQG  601
             +   +  I  K     +   +H + L+  ++ R  ++     L+WA  EALA G+LL +G
Sbjct  611   EQENIEQIIGKFSQYPEGFNLH-RGLERTLKGR-QQMLKDNSLDWACGEALAFGSLLKEG  668

Query  602   YNVRVSGQDIGRGTFSHRHAMLVDQSTGD-IHIPLNSMIEGQTGKLELANSILSEEAILG  660
              +VR+SGQD+ RGTFSHRH +L DQ     I+ PLN + EGQ G+  + NS LSE A+LG
Sbjct  669   IHVRLSGQDVQRGTFSHRHHVLHDQKVDQKIYNPLNDLSEGQ-GEYTVCNSSLSEYAVLG  727

Query  661   YEYGMSIAMPTTLTIWEAQFGDFFNGAQIMIDTFITSGEAKWMLSSGLTILLPHGYDGAG  720
             +E G S+  P +L IWEAQFGDF N AQ +ID FI+SG++KW+  SGL +LLPHGY+G G
Sbjct  728   FELGYSMVDPNSLVIWEAQFGDFSNTAQCIIDQFISSGQSKWIRQSGLVMLLPHGYEGMG  787

Query  721   PEHSSSRLERFLQLTDSNEDKPDGDNV--------------NICVTNPTTPAQYFHLLRR  766
             PEHSS+R ERFLQ+ +  +D+ D + +              N  V N TTPA  +HLLRR
Sbjct  788   PEHSSARPERFLQMCN-EDDEIDLEKIAFEGTFEAQQLHDTNWIVANCTTPANIYHLLRR  846

Query  767   QMVRNFRKPLIIMAPKILLRHIAATSPITDMQPQTRFKTVI---GDEKVEESKVTKVILV  823
             Q+   FRKP ++ +PK LLRH  A SP+ D Q  + F+ VI   G        V +V+  
Sbjct  847   QVTMPFRKPAVVFSPKSLLRHPMARSPVEDFQSGSNFQRVIPETGAPSQNPPDVKRVVFC  906

Query  824   SGKHYYALDNFRESTNQKN-VAIIRVESLCPFPVQELLQEIDRYKYAKTFIWSQEEPQNM  882
             +GK YY +   R+   ++N VA++RVE L PFP   + QE  +Y+ A+  +W+QEE +NM
Sbjct  907   TGKVYYDMVAARKHVGKENDVALVRVEQLSPFPYDLVQQECRKYQGAE-ILWAQEEHKNM  965

Query  883   GAWNFVKPRFENLC---GRLIKYSGRKPMAATAVGAGKLHQQEAQEVTVKPFNM  933
             GAW+FV+PR  +L    GR  KY+GR P ++ A G    H QE +E+  K F +
Sbjct  966   GAWSFVQPRINSLLSIDGRATKYAGRLPSSSPATGNKFTHMQEQKEMMSKVFGV  1019


>Q383T1_TRYB2 unnamed protein product
Length=1005

 Score = 533 bits (1374),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 318/891 (36%), Positives = 479/891 (54%), Gaps = 59/891 (7%)

Query  75   LISAYREYGHKQAEINPVASK----------KPAPLAELKLERFGLSLDD-----KVPFR  119
            +I A+ +YGH  A  +P+ ++          KP     L LE FG S +D     +V F 
Sbjct  121  MIQAFEDYGHLAARTDPLDAEDDSLHRSPQVKPRERVHLGLESFGFSKEDHDRVVRVGFM  180

Query  120  ----GILSMGKDEGTVEEALKFLNETYTGHIGVEFSYLETEEEREWFAETVEKSS-----  170
                G +S      T++E    L + + G +G E  +++      +  E VE  +     
Sbjct  181  DQLGGAMSSSSRAMTIKELHDHLTKCFCGRVGCELGHVDDANVVCFVREVVEGYNTEHNP  240

Query  171  -REPVTDETRIGIATEMLKSQTFDQFLAIKFVNFKRYSGEGAESMMAFYYEFFKLCANDD  229
             R P++ E ++ +   +  +  F+ F   K+   KR+  +GAES++       +  ++  
Sbjct  241  LRRPLSKEEKLWVWDLVASAVHFEDFFKRKYTTQKRFGCDGAESLIVGLRSLMESASDHG  300

Query  230  LKYIVICMAHRGRLNFLTGMLNFPPEKLFRQLRGYSEFP-DNVNATGDVISHFVSSTNLD  288
            ++ +   MAHRGRLN L  ++      + ++  G +    +      DV  H  + + + 
Sbjct  301  VEKVNFGMAHRGRLNTLYNVIGKSFPVILKEFVGITAPELEPFKVQSDVKYHLGAKSTVK  360

Query  289  I-NRKSLHVTVLRNPSHLEAVNPVSMGKTRGMMQANKDGAYSEHANAQWSDKVLNIQVHG  347
            + N K +   +L NPSHLEAVNPV  G TR     + D   S         KVL +++HG
Sbjct  361  MRNGKLMFTELLANPSHLEAVNPVLQGYTRAAQLKHGDAGQS---------KVLPVEIHG  411

Query  348  DAAYAAQGVDQECLALSAVPHFEIGGTVHLMINNQLGFTTPASRGRSSRYCTDLAKMISA  407
            DAA+A QGV  E + +S VP F  GGT+H+++NNQ+GFTT     RSS YC+DL +    
Sbjct  412  DAAFAGQGVTFETMCISEVPKFTTGGTIHVVVNNQIGFTTDPRCSRSSPYCSDLGRAFQC  471

Query  408  PVIHVNGDDPEMVIRAARIAFKYQRKFRKDIFLDLNCFRRWGHNELDDPVFTNPVIYKII  467
            P+ HVNGD PE V R    A   + +F K + +DL C+RR+GHNE DDP  T P++YK +
Sbjct  472  PIFHVNGDCPEDVARVFAFAVDLRSRFNKSVVIDLVCYRRYGHNENDDPTITQPLLYKRV  531

Query  468  HSRPSVPDRYLDKLVKNNVLPMEKVKNIIEDHKAKLNQGLNEADNYVPQPTYFAG---LW  524
            H+ P V  RY +KLV+  V+  E+     ++ K    +  +E  N        +G   LW
Sbjct  532  HATPDVFARYSEKLVEEGVVTKEQQTAKAKEQKDHYGKYQSEVGNIRYSDYLKSGIPELW  591

Query  525  SEIQQAD--ASVTQWDTGVDLSLLRFIAEKSVHIDDDSIIHPKLLKSHVQSRLNKIASGK  582
              ++ +D    VT   T V    L+ + +    + +  +++ K LK+ ++ R+  +  G+
Sbjct  592  RGMKYSDELGEVTLEPTAVARESLQPVIDSLKKVPEGFVVNSK-LKAVLEQRVQSLEKGE  650

Query  583  HLNWATAEALAIGTLLYQGYNVRVSGQDIGRGTFSHRHAMLVDQSTGDIHIPLNSMIEGQ  642
             ++W  AEALA G+LL +G +VRV GQD+ RGTFSHRHA+L DQ+  D + PL + I   
Sbjct  651  KIDWGAAEALAFGSLLLEGTHVRVMGQDVERGTFSHRHAVLHDQNKVDTYTPL-AHIRKD  709

Query  643  TGKLELANSILSEEAILGYEYGMSIAMPTTLTIWEAQFGDFFNGAQIMIDTFITSGEAKW  702
                 + NS L+E  +LGY  G +I  P  L +WEAQFGDF NGA I+ D F++SGE KW
Sbjct  710  QAPFIITNSPLNEYGVLGYASGYAIYDPNALVLWEAQFGDFANGAAIIFDQFLSSGETKW  769

Query  703  MLSSGLTILLPHGYDGAGPEHSSSRLERFLQLTDSNEDKP------DGDNVNICVTNPTT  756
                 + + LPHG+DG G EHSS R+ERFLQ    + D P          VN+ V  P+T
Sbjct  770  NQQQAVVVSLPHGFDGRGAEHSSGRIERFLQAVAEDVDTPAYSPEERAHRVNMEVVFPST  829

Query  757  PAQYFHLLRRQMVRNFRKPLIIMAPKILLRHIAATSPITDMQPQTR--FKTVIGDEKVEE  814
            PAQYFHLLRR + RNFRKPL++   K  LR    T   + M+  T   F+ VIGD  V  
Sbjct  830  PAQYFHLLRRHVRRNFRKPLMLFFSKQFLR----TPNESSMEQITSGGFQPVIGDPSVPP  885

Query  815  SKVTKVILVSGKHYYALDNFRESTN-QKNVAIIRVESLCPFPVQELLQEIDRYKYAKTFI  873
             K  ++++ +G+ Y+ L+ +RES N  ++VA++R+E L PFPV E+ + +  Y   +  +
Sbjct  886  EKARRLVMCTGQIYHILNRYRESNNCGRDVALVRIEELSPFPVAEVQKLLADYSGVE-LM  944

Query  874  WSQEEPQNMGAWNFVKPRFENLCG--RLIKYSGRKPMAATAVGAGKLHQQE  922
            W+QEEP+N GA+  V+ R E   G  R ++Y+GR   AA +      H  E
Sbjct  945  WAQEEPRNQGAFYHVESRVEYYTGGARELRYAGRAISAAPSTAYKSTHDAE  995


>Q387A7_TRYB2 unnamed protein product
Length=1008

 Score = 487 bits (1253),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 310/919 (34%), Positives = 488/919 (53%), Gaps = 72/919 (8%)

Query  66    RSKNSNFYRLISAYREYGHKQAEINPVASKKPAP-----LAELKLERFGLSLDD-----K  115
             R ++     +++AY  YGH  A++NP+ S++        L  L    FG +  D      
Sbjct  98    RRQSMGITWMVTAYERYGHHYAKVNPLRSEQDVESDRRDLLNLHYSNFGFTDQDLTKVFP  157

Query  116   VPFRGIL--SMGKD--EGTVEEALKFLNETYTGHIGVEFSYLETEEEREWFAETVEKSSR  171
             V   G L  + G++  E T+++ ++ L   Y G IG EF   E ++ R WF + + K+  
Sbjct  158   VDIGGGLKEAFGENVKEATLQQIVEKLQMMYCGSIGFEFLLTEGDDVRHWFHKEILKTF-  216

Query  172   EPVTDETRIGIATEMLKSQTFDQFLAIKFVNFKRYSGEGAESMMAFYYEFFKLCANDDLK  231
             EP++ E RI I  +++KS  F+ F+ +K+    R+  +GAE+++       +  ++  + 
Sbjct  217   EPLSKEERIHILDDVVKSCGFETFIQLKYGTQLRFGLDGAEALVPAVIALMQEASDLGVT  276

Query  232   YIVICMAHRGRLNFLTGMLNFPPEKLFRQLRGYSEFPDNVNATGDVISHFVSSTNLDI-N  290
               V  M HRGRLN L  +   P   +  +  G +   + +   GD   H  +   +++ N
Sbjct  277   SFVQGMPHRGRLNLLANVKVKPLTDILAEFEGKTH-RNAIARLGDNKYHLGADRQIELRN  335

Query  291   RKSLHVTVLRNPSHLEAVNPVSMGKTRGMMQANKDGAYSEHANAQWSDKVLNIQVHGDAA  350
              K ++  +L NPSHLEA+NP+ +GK R  M   KD             + L I  HGDAA
Sbjct  336   GKVINFDLLCNPSHLEAMNPLVLGKARARMVVEKDSECV---------RTLPIIAHGDAA  386

Query  351   YAAQGVDQECLALSAVPHFEIGGTVHLMINNQLGFTTPASRGRSSRYCTDLAKMISAPVI  410
              +  G+  E + L  + ++ +GGTVH++ NNQ+GFTT +   R ++YC+D++K+ + PV+
Sbjct  387   ISGLGMGHETMGLWDLDNYRVGGTVHIITNNQVGFTTDSVDARRAKYCSDISKIHATPVL  446

Query  411   HVNGDDPEMVIRAARIAFKYQRKFRKDIFLDLNCFRRWGHNELDDPVFTNPVIYKIIHSR  470
             HVN +D E  +RAARIA ++++ F +DI +DL  +RR GHNE D P FT P +Y+I+ S 
Sbjct  447   HVNSNDVEACVRAARIAARFRQTFHRDIIIDLIGYRRNGHNEADFPDFTQPQMYQIVRSL  506

Query  471   PSVPDRYLDKLVKNNVLPMEKVKNIIEDHKAKLN------QGLNEADNYVPQPTYFAGLW  524
               + D Y D LV+  VL  E VK   ++++++L       Q   E    +P     AG  
Sbjct  507   RPLVDLYSDTLVEEGVLTKEDVKAKKKEYESRLREAYETAQSCPEYTKVIPNLREDAGNA  566

Query  525   SE----IQQADASVTQW-DTGVDLSLLRFIAEKSVHIDDD-SIIHPKLLKSHVQSRLNKI  578
             SE      + +A++ +  +TGVD+ +LR +      I  +   +HP + +++  +R   I
Sbjct  567   SEGYDLAAEKEANLPKAVETGVDIEVLRRVGLHVTTIPSEVKKVHPVVERTYA-ARKKAI  625

Query  579   ASGKHLNWATAEALAIGTLLYQGYNVRVSGQDIGRGTFSHRHAMLVDQSTGDIHIPLNSM  638
              SG+   W  AE LA G    +G +VR++G+D+ RGTF+ RHA + D  T   +IPL S+
Sbjct  626   ESGEGAEWCLAEMLAFGATALEGTHVRLAGEDVERGTFTQRHAAVTDLETNKKYIPLCSL  685

Query  639   IEGQTGKLELANSILSEEAILGYEYGMSIAMPTTLTIWEAQFGDFFNGAQIMIDTFITSG  698
              E Q   + + NS LSE  + G+E G +   P TL +WEAQFGDF NGAQ++ D F+  G
Sbjct  686   SEDQ-ALVTICNSSLSEFGVSGFELGYNAVNPHTLGMWEAQFGDFANGAQVIFDQFLCCG  744

Query  699   EAKWMLSSGLTILLPHGYDGAGPEHSSSRLERFLQLTDSNEDKPDG--------------  744
             E KW     L + LPHGY GAGPEHSS+R+ER+LQL    +  P                
Sbjct  745   EEKWNAKYSLVLSLPHGYSGAGPEHSSARIERYLQLCSDTDVVPHNFRRGCPLQLLEVRI  804

Query  745   DNVNICVTNPTTPAQYFHLLRRQMVRNFRKPLIIMAPKILLRHIAATSPITDMQPQTRFK  804
                N  V  P+TPA YFH+LRRQ+ R   KPL++   K  LR     S +++M   T FK
Sbjct  805   QRFNWQVCYPSTPANYFHVLRRQVRRGDPKPLVVFFSKARLR-APNVSSLSEMSTGTSFK  863

Query  805   TVIGDEKVEESKVTKVILVSGKHYYALDNFRESTNQK------NVAIIRVESLCPFPVQE  858
              VI     +E    KV+  +G+    +D+ R+    +      +V ++++E L PFP ++
Sbjct  864   PVIDTAVNDEVIARKVLFCTGQIESIVDDRRKKLQAEKPGVHDDVVLVKLEQLSPFPWEQ  923

Query  859   LLQEIDRYKYAK---TFIWSQEEPQNMGAWNFVKPRFENLCGRL--------IKYSGRKP  907
             +   +++Y        F W QEEP+NMG+W +V+PR + L   L        + Y GR  
Sbjct  924   VADVLEKYHSRNPNVQFAWLQEEPKNMGSWAYVRPRLQRLLRHLGMAGSSDFLPYVGRVT  983

Query  908   MAATAVGAGKLHQQEAQEV  926
              A+ + G   +H +E  E+
Sbjct  984   AASPSTGYATVHAEEEAEI  1002



Lambda      K        H
   0.318    0.133    0.398 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 16027285120


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Nov 7, 2022  4:57 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_050573090.1 DNA-binding protein D-ETS-3-like isoform X1 [Bombus
affinis]

Length=350
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q22355_CAEEL  unnamed protein product                                 206     2e-63
ETS6_DROME  unnamed protein product                                   198     3e-59
ELG_DROME  unnamed protein product                                    140     2e-37


>Q22355_CAEEL unnamed protein product
Length=377

 Score = 206 bits (525),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 99/124 (80%), Gaps = 0/124 (0%)

Query  150  LDTHTHLRQPDPYQMFGATSSRLASSGSGQIQLWQFLLELLSDSSNAACITWEGTNGEFK  209
            L   T    PDPYQ+ G TS  LA SGSGQ QLWQFLLELLSD   +  ITWEGT GEFK
Sbjct  184  LSNSTSFANPDPYQILGPTSKNLAHSGSGQTQLWQFLLELLSDKRYSEVITWEGTQGEFK  243

Query  210  LTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFQGLAAATQ  269
            L DPDEVAR+WGERKSKPNMNYDK+SRALRYYYDKNIM KVHGKRYAYKFDFQG+A A Q
Sbjct  244  LVDPDEVARKWGERKSKPNMNYDKMSRALRYYYDKNIMAKVHGKRYAYKFDFQGIAQALQ  303

Query  270  PAAA  273
            P  A
Sbjct  304  PPTA  307


>ETS6_DROME unnamed protein product
Length=475

 Score = 198 bits (504),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 104/123 (85%), Gaps = 3/123 (2%)

Query  158  QPDPYQMFGATSSRLASSGSG-QIQLWQFLLELLSDSSNAACITWEGTNGEFKLTDPDEV  216
            +P+PYQ+  A S RL + GSG QIQLWQFLLELL+DSSNA  I+WEG +GEF+L DPDEV
Sbjct  232  EPNPYQLLNAASHRLVAQGSGGQIQLWQFLLELLADSSNANAISWEGQSGEFRLIDPDEV  291

Query  217  ARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFQGLAAATQPAA--AD  274
            ARRWGERK+KPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF GL AA Q  A   D
Sbjct  292  ARRWGERKAKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGLMAACQAQAQGGD  351

Query  275  PAA  277
            PA+
Sbjct  352  PAS  354


>ELG_DROME unnamed protein product
Length=464

 Score = 140 bits (352),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 84/122 (69%), Gaps = 7/122 (6%)

Query  139  QGYGSSLSKSALDTHTHLRQPDPYQMFGATSSRLASSGSGQIQLWQFLLELLSDSSNAAC  198
            + Y S  S  ++++ T    P  Y   G       S  +GQ+QLWQFLLE+L+D  +   
Sbjct  312  KSYQSVKSSDSVESTTSSMNPSNYTTIG-------SGNNGQVQLWQFLLEILTDCEHTDV  364

Query  199  ITWEGTNGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYK  258
            I W GT GEFKLTDPD VAR WGE+K+KP MNY+KLSRALRYYYD ++++KV GKR+AYK
Sbjct  365  IEWVGTEGEFKLTDPDRVARLWGEKKNKPAMNYEKLSRALRYYYDGDMISKVSGKRFAYK  424

Query  259  FD  260
            FD
Sbjct  425  FD  426



Lambda      K        H
   0.313    0.128    0.386 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3603051738


Query= XP_050573091.1 2-oxoadipate dehydrogenase complex component E1
isoform X2 [Bombus affinis]

Length=749
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ODO1_CAEEL  unnamed protein product                                   529     4e-175
Q383T1_TRYB2  unnamed protein product                                 504     1e-165
Q387A7_TRYB2  unnamed protein product                                 440     4e-141


>ODO1_CAEEL unnamed protein product
Length=1029

 Score = 529 bits (1363),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 300/774 (39%), Positives = 445/774 (57%), Gaps = 43/774 (6%)

Query  1     MLKSQTFDQFLAIKFVNFKRYSGEGAESMMAFYYEFFKLCANDDLKYIVICMAHRGRLNF  60
             +++S  F++FLA K+ + KR+  EG E ++    +     +   +   VI M HRGRLN 
Sbjct  263   LIRSTKFEEFLAKKWPSEKRFGLEGCEVLIPAMKQVIDSSSTLGVDSFVIGMPHRGRLNV  322

Query  61    LTGMLNFPPEKLFRQLRGYSEFPDNVNATGDVISHF-VSSTNLD-INRKSLHVTVLRNPS  118
             L  +   P   +  Q   +S        +GDV  H  V    L+  ++K++ + V+ NPS
Sbjct  323   LANVCRQPLATILSQ---FSTLEPADEGSGDVKYHLGVCIERLNRQSQKNVKIAVVANPS  379

Query  119   HLEAVNPVSMGKTRGMMQANKDGAYSEHANAQWSDKVLNIQVHGDAAYAAQGVDQECLAL  178
             HLEAV+PV MGK R         A + +A  +  D+ + I +HGDAA+A QGV  E   L
Sbjct  380   HLEAVDPVVMGKVR---------AEAFYAGDEKCDRTMAILLHGDAAFAGQGVVLETFNL  430

Query  179   SAVPHFEIGGTVHLMINNQLGFTTPASRGRSSRYCTDLAKMISAPVIHVNGDDPEMVIRA  238
               +P +   G +H+++NNQ+GFTT     RSS YCTD+ +++  P+ HVN DDPE V+  
Sbjct  431   DDLPSYTTHGAIHIVVNNQIGFTTDPRSSRSSPYCTDVGRVVGCPIFHVNVDDPEAVMHV  490

Query  239   ARIAFKYQRKFRKDIFLDLNCFRRWGHNELDDPVFTNPVIYKIIHSRPSVPDRYLDKLVK  298
               +A  +++ F+KD+ +DL C+RR GHNELD+P+FT P++Y+ I    +  ++Y +K++ 
Sbjct  491   CNVAADWRKTFKKDVIVDLVCYRRHGHNELDEPMFTQPLMYQRIKQTKTALEKYQEKILN  550

Query  299   NNVLPMEKVKNIIEDHKAKLNQGLNEAD--NYVPQPTYFAGLWSEIQQADASVTQWDTGV  356
               V   + VK  +  + + L      A    YV    +    W +  +    +    TG+
Sbjct  551   EGVANEQYVKEELTKYGSILEDAYENAQKVTYVRNRDWLDSPWDDFFKKRDPLKLPSTGI  610

Query  357   DLSLLRFIAEKSVHIDDDSIIHPKLLKSHVQSRLNKIASGKHLNWATAEALAIGTLLYQG  416
             +   +  I  K     +   +H + L+  ++ R  ++     L+WA  EALA G+LL +G
Sbjct  611   EQENIEQIIGKFSQYPEGFNLH-RGLERTLKGR-QQMLKDNSLDWACGEALAFGSLLKEG  668

Query  417   YNVRVSGQDIGRGTFSHRHAMLVDQSTGD-IHIPLNSMIEGQTGKLELANSILSEEAILG  475
              +VR+SGQD+ RGTFSHRH +L DQ     I+ PLN + EGQ G+  + NS LSE A+LG
Sbjct  669   IHVRLSGQDVQRGTFSHRHHVLHDQKVDQKIYNPLNDLSEGQ-GEYTVCNSSLSEYAVLG  727

Query  476   YEYGMSIAMPTTLTIWEAQFGDFFNGAQIMIDTFITSGEAKWMLSSGLTILLPHGYDGAG  535
             +E G S+  P +L IWEAQFGDF N AQ +ID FI+SG++KW+  SGL +LLPHGY+G G
Sbjct  728   FELGYSMVDPNSLVIWEAQFGDFSNTAQCIIDQFISSGQSKWIRQSGLVMLLPHGYEGMG  787

Query  536   PEHSSSRLERFLQLTDSNEDKPDGDNV--------------NICVTNPTTPAQYFHLLRR  581
             PEHSS+R ERFLQ+ +  +D+ D + +              N  V N TTPA  +HLLRR
Sbjct  788   PEHSSARPERFLQMCN-EDDEIDLEKIAFEGTFEAQQLHDTNWIVANCTTPANIYHLLRR  846

Query  582   QMVRNFRKPLIIMAPKILLRHIAATSPITDMQPQTRFKTVI---GDEKVEESKVTKVILV  638
             Q+   FRKP ++ +PK LLRH  A SP+ D Q  + F+ VI   G        V +V+  
Sbjct  847   QVTMPFRKPAVVFSPKSLLRHPMARSPVEDFQSGSNFQRVIPETGAPSQNPPDVKRVVFC  906

Query  639   SGKHYYALDNFRESTNQKN-VAIIRVESLCPFPVQELLQEIDRYKYAKTFIWSQEEPQNM  697
             +GK YY +   R+   ++N VA++RVE L PFP   + QE  +Y+ A+  +W+QEE +NM
Sbjct  907   TGKVYYDMVAARKHVGKENDVALVRVEQLSPFPYDLVQQECRKYQGAE-ILWAQEEHKNM  965

Query  698   GAWNFVKPRFENLC---GRLIKYSGRKPMAATAVGAGKLHQQEAQEVTVKPFNM  748
             GAW+FV+PR  +L    GR  KY+GR P ++ A G    H QE +E+  K F +
Sbjct  966   GAWSFVQPRINSLLSIDGRATKYAGRLPSSSPATGNKFTHMQEQKEMMSKVFGV  1019


>Q383T1_TRYB2 unnamed protein product
Length=1005

 Score = 504 bits (1298),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 286/754 (38%), Positives = 422/754 (56%), Gaps = 34/754 (5%)

Query  7    FDQFLAIKFVNFKRYSGEGAESMMAFYYEFFKLCANDDLKYIVICMAHRGRLNFLTGMLN  66
            F+ F   K+   KR+  +GAES++       +  ++  ++ +   MAHRGRLN L  ++ 
Sbjct  263  FEDFFKRKYTTQKRFGCDGAESLIVGLRSLMESASDHGVEKVNFGMAHRGRLNTLYNVIG  322

Query  67   FPPEKLFRQLRGYSEFP-DNVNATGDVISHFVSSTNLDI-NRKSLHVTVLRNPSHLEAVN  124
                 + ++  G +    +      DV  H  + + + + N K +   +L NPSHLEAVN
Sbjct  323  KSFPVILKEFVGITAPELEPFKVQSDVKYHLGAKSTVKMRNGKLMFTELLANPSHLEAVN  382

Query  125  PVSMGKTRGMMQANKDGAYSEHANAQWSDKVLNIQVHGDAAYAAQGVDQECLALSAVPHF  184
            PV  G TR     + D   S         KVL +++HGDAA+A QGV  E + +S VP F
Sbjct  383  PVLQGYTRAAQLKHGDAGQS---------KVLPVEIHGDAAFAGQGVTFETMCISEVPKF  433

Query  185  EIGGTVHLMINNQLGFTTPASRGRSSRYCTDLAKMISAPVIHVNGDDPEMVIRAARIAFK  244
              GGT+H+++NNQ+GFTT     RSS YC+DL +    P+ HVNGD PE V R    A  
Sbjct  434  TTGGTIHVVVNNQIGFTTDPRCSRSSPYCSDLGRAFQCPIFHVNGDCPEDVARVFAFAVD  493

Query  245  YQRKFRKDIFLDLNCFRRWGHNELDDPVFTNPVIYKIIHSRPSVPDRYLDKLVKNNVLPM  304
             + +F K + +DL C+RR+GHNE DDP  T P++YK +H+ P V  RY +KLV+  V+  
Sbjct  494  LRSRFNKSVVIDLVCYRRYGHNENDDPTITQPLLYKRVHATPDVFARYSEKLVEEGVVTK  553

Query  305  EKVKNIIEDHKAKLNQGLNEADNYVPQPTYFAG---LWSEIQQAD--ASVTQWDTGVDLS  359
            E+     ++ K    +  +E  N        +G   LW  ++ +D    VT   T V   
Sbjct  554  EQQTAKAKEQKDHYGKYQSEVGNIRYSDYLKSGIPELWRGMKYSDELGEVTLEPTAVARE  613

Query  360  LLRFIAEKSVHIDDDSIIHPKLLKSHVQSRLNKIASGKHLNWATAEALAIGTLLYQGYNV  419
             L+ + +    + +  +++ K LK+ ++ R+  +  G+ ++W  AEALA G+LL +G +V
Sbjct  614  SLQPVIDSLKKVPEGFVVNSK-LKAVLEQRVQSLEKGEKIDWGAAEALAFGSLLLEGTHV  672

Query  420  RVSGQDIGRGTFSHRHAMLVDQSTGDIHIPLNSMIEGQTGKLELANSILSEEAILGYEYG  479
            RV GQD+ RGTFSHRHA+L DQ+  D + PL + I        + NS L+E  +LGY  G
Sbjct  673  RVMGQDVERGTFSHRHAVLHDQNKVDTYTPL-AHIRKDQAPFIITNSPLNEYGVLGYASG  731

Query  480  MSIAMPTTLTIWEAQFGDFFNGAQIMIDTFITSGEAKWMLSSGLTILLPHGYDGAGPEHS  539
             +I  P  L +WEAQFGDF NGA I+ D F++SGE KW     + + LPHG+DG G EHS
Sbjct  732  YAIYDPNALVLWEAQFGDFANGAAIIFDQFLSSGETKWNQQQAVVVSLPHGFDGRGAEHS  791

Query  540  SSRLERFLQLTDSNEDKP------DGDNVNICVTNPTTPAQYFHLLRRQMVRNFRKPLII  593
            S R+ERFLQ    + D P          VN+ V  P+TPAQYFHLLRR + RNFRKPL++
Sbjct  792  SGRIERFLQAVAEDVDTPAYSPEERAHRVNMEVVFPSTPAQYFHLLRRHVRRNFRKPLML  851

Query  594  MAPKILLRHIAATSPITDMQPQTR--FKTVIGDEKVEESKVTKVILVSGKHYYALDNFRE  651
               K  LR    T   + M+  T   F+ VIGD  V   K  ++++ +G+ Y+ L+ +RE
Sbjct  852  FFSKQFLR----TPNESSMEQITSGGFQPVIGDPSVPPEKARRLVMCTGQIYHILNRYRE  907

Query  652  STN-QKNVAIIRVESLCPFPVQELLQEIDRYKYAKTFIWSQEEPQNMGAWNFVKPRFENL  710
            S N  ++VA++R+E L PFPV E+ + +  Y   +  +W+QEEP+N GA+  V+ R E  
Sbjct  908  SNNCGRDVALVRIEELSPFPVAEVQKLLADYSGVE-LMWAQEEPRNQGAFYHVESRVEYY  966

Query  711  CG--RLIKYSGRKPMAATAVGAGKLHQQEAQEVT  742
             G  R ++Y+GR   AA +      H  E + + 
Sbjct  967  TGGARELRYAGRAISAAPSTAYKSTHDAEERYIC  1000


>Q387A7_TRYB2 unnamed protein product
Length=1008

 Score = 440 bits (1132),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 271/785 (35%), Positives = 422/785 (54%), Gaps = 57/785 (7%)

Query  1     MLKSQTFDQFLAIKFVNFKRYSGEGAESMMAFYYEFFKLCANDDLKYIVICMAHRGRLNF  60
             ++KS  F+ F+ +K+    R+  +GAE+++       +  ++  +   V  M HRGRLN 
Sbjct  231   VVKSCGFETFIQLKYGTQLRFGLDGAEALVPAVIALMQEASDLGVTSFVQGMPHRGRLNL  290

Query  61    LTGMLNFPPEKLFRQLRGYSEFPDNVNATGDVISHFVSSTNLDI-NRKSLHVTVLRNPSH  119
             L  +   P   +  +  G +   + +   GD   H  +   +++ N K ++  +L NPSH
Sbjct  291   LANVKVKPLTDILAEFEGKTH-RNAIARLGDNKYHLGADRQIELRNGKVINFDLLCNPSH  349

Query  120   LEAVNPVSMGKTRGMMQANKDGAYSEHANAQWSDKVLNIQVHGDAAYAAQGVDQECLALS  179
             LEA+NP+ +GK R  M   KD             + L I  HGDAA +  G+  E + L 
Sbjct  350   LEAMNPLVLGKARARMVVEKDSECV---------RTLPIIAHGDAAISGLGMGHETMGLW  400

Query  180   AVPHFEIGGTVHLMINNQLGFTTPASRGRSSRYCTDLAKMISAPVIHVNGDDPEMVIRAA  239
              + ++ +GGTVH++ NNQ+GFTT +   R ++YC+D++K+ + PV+HVN +D E  +RAA
Sbjct  401   DLDNYRVGGTVHIITNNQVGFTTDSVDARRAKYCSDISKIHATPVLHVNSNDVEACVRAA  460

Query  240   RIAFKYQRKFRKDIFLDLNCFRRWGHNELDDPVFTNPVIYKIIHSRPSVPDRYLDKLVKN  299
             RIA ++++ F +DI +DL  +RR GHNE D P FT P +Y+I+ S   + D Y D LV+ 
Sbjct  461   RIAARFRQTFHRDIIIDLIGYRRNGHNEADFPDFTQPQMYQIVRSLRPLVDLYSDTLVEE  520

Query  300   NVLPMEKVKNIIEDHKAKLN------QGLNEADNYVPQPTYFAGLWSE----IQQADASV  349
              VL  E VK   ++++++L       Q   E    +P     AG  SE      + +A++
Sbjct  521   GVLTKEDVKAKKKEYESRLREAYETAQSCPEYTKVIPNLREDAGNASEGYDLAAEKEANL  580

Query  350   TQW-DTGVDLSLLRFIAEKSVHIDDD-SIIHPKLLKSHVQSRLNKIASGKHLNWATAEAL  407
              +  +TGVD+ +LR +      I  +   +HP + +++  +R   I SG+   W  AE L
Sbjct  581   PKAVETGVDIEVLRRVGLHVTTIPSEVKKVHPVVERTYA-ARKKAIESGEGAEWCLAEML  639

Query  408   AIGTLLYQGYNVRVSGQDIGRGTFSHRHAMLVDQSTGDIHIPLNSMIEGQTGKLELANSI  467
             A G    +G +VR++G+D+ RGTF+ RHA + D  T   +IPL S+ E Q   + + NS 
Sbjct  640   AFGATALEGTHVRLAGEDVERGTFTQRHAAVTDLETNKKYIPLCSLSEDQ-ALVTICNSS  698

Query  468   LSEEAILGYEYGMSIAMPTTLTIWEAQFGDFFNGAQIMIDTFITSGEAKWMLSSGLTILL  527
             LSE  + G+E G +   P TL +WEAQFGDF NGAQ++ D F+  GE KW     L + L
Sbjct  699   LSEFGVSGFELGYNAVNPHTLGMWEAQFGDFANGAQVIFDQFLCCGEEKWNAKYSLVLSL  758

Query  528   PHGYDGAGPEHSSSRLERFLQLTDSNEDKPDG--------------DNVNICVTNPTTPA  573
             PHGY GAGPEHSS+R+ER+LQL    +  P                   N  V  P+TPA
Sbjct  759   PHGYSGAGPEHSSARIERYLQLCSDTDVVPHNFRRGCPLQLLEVRIQRFNWQVCYPSTPA  818

Query  574   QYFHLLRRQMVRNFRKPLIIMAPKILLRHIAATSPITDMQPQTRFKTVIGDEKVEESKVT  633
              YFH+LRRQ+ R   KPL++   K  LR     S +++M   T FK VI     +E    
Sbjct  819   NYFHVLRRQVRRGDPKPLVVFFSKARLR-APNVSSLSEMSTGTSFKPVIDTAVNDEVIAR  877

Query  634   KVILVSGKHYYALDNFRESTNQK------NVAIIRVESLCPFPVQELLQEIDRYKYAK--  685
             KV+  +G+    +D+ R+    +      +V ++++E L PFP +++   +++Y      
Sbjct  878   KVLFCTGQIESIVDDRRKKLQAEKPGVHDDVVLVKLEQLSPFPWEQVADVLEKYHSRNPN  937

Query  686   -TFIWSQEEPQNMGAWNFVKPRFENLCGRL--------IKYSGRKPMAATAVGAGKLHQQ  736
               F W QEEP+NMG+W +V+PR + L   L        + Y GR   A+ + G   +H +
Sbjct  938   VQFAWLQEEPKNMGSWAYVRPRLQRLLRHLGMAGSSDFLPYVGRVTAASPSTGYATVHAE  997

Query  737   EAQEV  741
             E  E+
Sbjct  998   EEAEI  1002



Lambda      K        H
   0.313    0.128    0.386 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3603051738


Query= XP_050573092.1 2-oxoadipate dehydrogenase complex component E1
isoform X2 [Bombus affinis]

Length=749
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ODO1_CAEEL  unnamed protein product                                   529     4e-175
Q383T1_TRYB2  unnamed protein product                                 504     1e-165
Q387A7_TRYB2  unnamed protein product                                 440     4e-141


>ODO1_CAEEL unnamed protein product
Length=1029

 Score = 529 bits (1363),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 300/774 (39%), Positives = 445/774 (57%), Gaps = 43/774 (6%)

Query  1     MLKSQTFDQFLAIKFVNFKRYSGEGAESMMAFYYEFFKLCANDDLKYIVICMAHRGRLNF  60
             +++S  F++FLA K+ + KR+  EG E ++    +     +   +   VI M HRGRLN 
Sbjct  263   LIRSTKFEEFLAKKWPSEKRFGLEGCEVLIPAMKQVIDSSSTLGVDSFVIGMPHRGRLNV  322

Query  61    LTGMLNFPPEKLFRQLRGYSEFPDNVNATGDVISHF-VSSTNLD-INRKSLHVTVLRNPS  118
             L  +   P   +  Q   +S        +GDV  H  V    L+  ++K++ + V+ NPS
Sbjct  323   LANVCRQPLATILSQ---FSTLEPADEGSGDVKYHLGVCIERLNRQSQKNVKIAVVANPS  379

Query  119   HLEAVNPVSMGKTRGMMQANKDGAYSEHANAQWSDKVLNIQVHGDAAYAAQGVDQECLAL  178
             HLEAV+PV MGK R         A + +A  +  D+ + I +HGDAA+A QGV  E   L
Sbjct  380   HLEAVDPVVMGKVR---------AEAFYAGDEKCDRTMAILLHGDAAFAGQGVVLETFNL  430

Query  179   SAVPHFEIGGTVHLMINNQLGFTTPASRGRSSRYCTDLAKMISAPVIHVNGDDPEMVIRA  238
               +P +   G +H+++NNQ+GFTT     RSS YCTD+ +++  P+ HVN DDPE V+  
Sbjct  431   DDLPSYTTHGAIHIVVNNQIGFTTDPRSSRSSPYCTDVGRVVGCPIFHVNVDDPEAVMHV  490

Query  239   ARIAFKYQRKFRKDIFLDLNCFRRWGHNELDDPVFTNPVIYKIIHSRPSVPDRYLDKLVK  298
               +A  +++ F+KD+ +DL C+RR GHNELD+P+FT P++Y+ I    +  ++Y +K++ 
Sbjct  491   CNVAADWRKTFKKDVIVDLVCYRRHGHNELDEPMFTQPLMYQRIKQTKTALEKYQEKILN  550

Query  299   NNVLPMEKVKNIIEDHKAKLNQGLNEAD--NYVPQPTYFAGLWSEIQQADASVTQWDTGV  356
               V   + VK  +  + + L      A    YV    +    W +  +    +    TG+
Sbjct  551   EGVANEQYVKEELTKYGSILEDAYENAQKVTYVRNRDWLDSPWDDFFKKRDPLKLPSTGI  610

Query  357   DLSLLRFIAEKSVHIDDDSIIHPKLLKSHVQSRLNKIASGKHLNWATAEALAIGTLLYQG  416
             +   +  I  K     +   +H + L+  ++ R  ++     L+WA  EALA G+LL +G
Sbjct  611   EQENIEQIIGKFSQYPEGFNLH-RGLERTLKGR-QQMLKDNSLDWACGEALAFGSLLKEG  668

Query  417   YNVRVSGQDIGRGTFSHRHAMLVDQSTGD-IHIPLNSMIEGQTGKLELANSILSEEAILG  475
              +VR+SGQD+ RGTFSHRH +L DQ     I+ PLN + EGQ G+  + NS LSE A+LG
Sbjct  669   IHVRLSGQDVQRGTFSHRHHVLHDQKVDQKIYNPLNDLSEGQ-GEYTVCNSSLSEYAVLG  727

Query  476   YEYGMSIAMPTTLTIWEAQFGDFFNGAQIMIDTFITSGEAKWMLSSGLTILLPHGYDGAG  535
             +E G S+  P +L IWEAQFGDF N AQ +ID FI+SG++KW+  SGL +LLPHGY+G G
Sbjct  728   FELGYSMVDPNSLVIWEAQFGDFSNTAQCIIDQFISSGQSKWIRQSGLVMLLPHGYEGMG  787

Query  536   PEHSSSRLERFLQLTDSNEDKPDGDNV--------------NICVTNPTTPAQYFHLLRR  581
             PEHSS+R ERFLQ+ +  +D+ D + +              N  V N TTPA  +HLLRR
Sbjct  788   PEHSSARPERFLQMCN-EDDEIDLEKIAFEGTFEAQQLHDTNWIVANCTTPANIYHLLRR  846

Query  582   QMVRNFRKPLIIMAPKILLRHIAATSPITDMQPQTRFKTVI---GDEKVEESKVTKVILV  638
             Q+   FRKP ++ +PK LLRH  A SP+ D Q  + F+ VI   G        V +V+  
Sbjct  847   QVTMPFRKPAVVFSPKSLLRHPMARSPVEDFQSGSNFQRVIPETGAPSQNPPDVKRVVFC  906

Query  639   SGKHYYALDNFRESTNQKN-VAIIRVESLCPFPVQELLQEIDRYKYAKTFIWSQEEPQNM  697
             +GK YY +   R+   ++N VA++RVE L PFP   + QE  +Y+ A+  +W+QEE +NM
Sbjct  907   TGKVYYDMVAARKHVGKENDVALVRVEQLSPFPYDLVQQECRKYQGAE-ILWAQEEHKNM  965

Query  698   GAWNFVKPRFENLC---GRLIKYSGRKPMAATAVGAGKLHQQEAQEVTVKPFNM  748
             GAW+FV+PR  +L    GR  KY+GR P ++ A G    H QE +E+  K F +
Sbjct  966   GAWSFVQPRINSLLSIDGRATKYAGRLPSSSPATGNKFTHMQEQKEMMSKVFGV  1019


>Q383T1_TRYB2 unnamed protein product
Length=1005

 Score = 504 bits (1298),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 286/754 (38%), Positives = 422/754 (56%), Gaps = 34/754 (5%)

Query  7    FDQFLAIKFVNFKRYSGEGAESMMAFYYEFFKLCANDDLKYIVICMAHRGRLNFLTGMLN  66
            F+ F   K+   KR+  +GAES++       +  ++  ++ +   MAHRGRLN L  ++ 
Sbjct  263  FEDFFKRKYTTQKRFGCDGAESLIVGLRSLMESASDHGVEKVNFGMAHRGRLNTLYNVIG  322

Query  67   FPPEKLFRQLRGYSEFP-DNVNATGDVISHFVSSTNLDI-NRKSLHVTVLRNPSHLEAVN  124
                 + ++  G +    +      DV  H  + + + + N K +   +L NPSHLEAVN
Sbjct  323  KSFPVILKEFVGITAPELEPFKVQSDVKYHLGAKSTVKMRNGKLMFTELLANPSHLEAVN  382

Query  125  PVSMGKTRGMMQANKDGAYSEHANAQWSDKVLNIQVHGDAAYAAQGVDQECLALSAVPHF  184
            PV  G TR     + D   S         KVL +++HGDAA+A QGV  E + +S VP F
Sbjct  383  PVLQGYTRAAQLKHGDAGQS---------KVLPVEIHGDAAFAGQGVTFETMCISEVPKF  433

Query  185  EIGGTVHLMINNQLGFTTPASRGRSSRYCTDLAKMISAPVIHVNGDDPEMVIRAARIAFK  244
              GGT+H+++NNQ+GFTT     RSS YC+DL +    P+ HVNGD PE V R    A  
Sbjct  434  TTGGTIHVVVNNQIGFTTDPRCSRSSPYCSDLGRAFQCPIFHVNGDCPEDVARVFAFAVD  493

Query  245  YQRKFRKDIFLDLNCFRRWGHNELDDPVFTNPVIYKIIHSRPSVPDRYLDKLVKNNVLPM  304
             + +F K + +DL C+RR+GHNE DDP  T P++YK +H+ P V  RY +KLV+  V+  
Sbjct  494  LRSRFNKSVVIDLVCYRRYGHNENDDPTITQPLLYKRVHATPDVFARYSEKLVEEGVVTK  553

Query  305  EKVKNIIEDHKAKLNQGLNEADNYVPQPTYFAG---LWSEIQQAD--ASVTQWDTGVDLS  359
            E+     ++ K    +  +E  N        +G   LW  ++ +D    VT   T V   
Sbjct  554  EQQTAKAKEQKDHYGKYQSEVGNIRYSDYLKSGIPELWRGMKYSDELGEVTLEPTAVARE  613

Query  360  LLRFIAEKSVHIDDDSIIHPKLLKSHVQSRLNKIASGKHLNWATAEALAIGTLLYQGYNV  419
             L+ + +    + +  +++ K LK+ ++ R+  +  G+ ++W  AEALA G+LL +G +V
Sbjct  614  SLQPVIDSLKKVPEGFVVNSK-LKAVLEQRVQSLEKGEKIDWGAAEALAFGSLLLEGTHV  672

Query  420  RVSGQDIGRGTFSHRHAMLVDQSTGDIHIPLNSMIEGQTGKLELANSILSEEAILGYEYG  479
            RV GQD+ RGTFSHRHA+L DQ+  D + PL + I        + NS L+E  +LGY  G
Sbjct  673  RVMGQDVERGTFSHRHAVLHDQNKVDTYTPL-AHIRKDQAPFIITNSPLNEYGVLGYASG  731

Query  480  MSIAMPTTLTIWEAQFGDFFNGAQIMIDTFITSGEAKWMLSSGLTILLPHGYDGAGPEHS  539
             +I  P  L +WEAQFGDF NGA I+ D F++SGE KW     + + LPHG+DG G EHS
Sbjct  732  YAIYDPNALVLWEAQFGDFANGAAIIFDQFLSSGETKWNQQQAVVVSLPHGFDGRGAEHS  791

Query  540  SSRLERFLQLTDSNEDKP------DGDNVNICVTNPTTPAQYFHLLRRQMVRNFRKPLII  593
            S R+ERFLQ    + D P          VN+ V  P+TPAQYFHLLRR + RNFRKPL++
Sbjct  792  SGRIERFLQAVAEDVDTPAYSPEERAHRVNMEVVFPSTPAQYFHLLRRHVRRNFRKPLML  851

Query  594  MAPKILLRHIAATSPITDMQPQTR--FKTVIGDEKVEESKVTKVILVSGKHYYALDNFRE  651
               K  LR    T   + M+  T   F+ VIGD  V   K  ++++ +G+ Y+ L+ +RE
Sbjct  852  FFSKQFLR----TPNESSMEQITSGGFQPVIGDPSVPPEKARRLVMCTGQIYHILNRYRE  907

Query  652  STN-QKNVAIIRVESLCPFPVQELLQEIDRYKYAKTFIWSQEEPQNMGAWNFVKPRFENL  710
            S N  ++VA++R+E L PFPV E+ + +  Y   +  +W+QEEP+N GA+  V+ R E  
Sbjct  908  SNNCGRDVALVRIEELSPFPVAEVQKLLADYSGVE-LMWAQEEPRNQGAFYHVESRVEYY  966

Query  711  CG--RLIKYSGRKPMAATAVGAGKLHQQEAQEVT  742
             G  R ++Y+GR   AA +      H  E + + 
Sbjct  967  TGGARELRYAGRAISAAPSTAYKSTHDAEERYIC  1000


>Q387A7_TRYB2 unnamed protein product
Length=1008

 Score = 440 bits (1132),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 271/785 (35%), Positives = 422/785 (54%), Gaps = 57/785 (7%)

Query  1     MLKSQTFDQFLAIKFVNFKRYSGEGAESMMAFYYEFFKLCANDDLKYIVICMAHRGRLNF  60
             ++KS  F+ F+ +K+    R+  +GAE+++       +  ++  +   V  M HRGRLN 
Sbjct  231   VVKSCGFETFIQLKYGTQLRFGLDGAEALVPAVIALMQEASDLGVTSFVQGMPHRGRLNL  290

Query  61    LTGMLNFPPEKLFRQLRGYSEFPDNVNATGDVISHFVSSTNLDI-NRKSLHVTVLRNPSH  119
             L  +   P   +  +  G +   + +   GD   H  +   +++ N K ++  +L NPSH
Sbjct  291   LANVKVKPLTDILAEFEGKTH-RNAIARLGDNKYHLGADRQIELRNGKVINFDLLCNPSH  349

Query  120   LEAVNPVSMGKTRGMMQANKDGAYSEHANAQWSDKVLNIQVHGDAAYAAQGVDQECLALS  179
             LEA+NP+ +GK R  M   KD             + L I  HGDAA +  G+  E + L 
Sbjct  350   LEAMNPLVLGKARARMVVEKDSECV---------RTLPIIAHGDAAISGLGMGHETMGLW  400

Query  180   AVPHFEIGGTVHLMINNQLGFTTPASRGRSSRYCTDLAKMISAPVIHVNGDDPEMVIRAA  239
              + ++ +GGTVH++ NNQ+GFTT +   R ++YC+D++K+ + PV+HVN +D E  +RAA
Sbjct  401   DLDNYRVGGTVHIITNNQVGFTTDSVDARRAKYCSDISKIHATPVLHVNSNDVEACVRAA  460

Query  240   RIAFKYQRKFRKDIFLDLNCFRRWGHNELDDPVFTNPVIYKIIHSRPSVPDRYLDKLVKN  299
             RIA ++++ F +DI +DL  +RR GHNE D P FT P +Y+I+ S   + D Y D LV+ 
Sbjct  461   RIAARFRQTFHRDIIIDLIGYRRNGHNEADFPDFTQPQMYQIVRSLRPLVDLYSDTLVEE  520

Query  300   NVLPMEKVKNIIEDHKAKLN------QGLNEADNYVPQPTYFAGLWSE----IQQADASV  349
              VL  E VK   ++++++L       Q   E    +P     AG  SE      + +A++
Sbjct  521   GVLTKEDVKAKKKEYESRLREAYETAQSCPEYTKVIPNLREDAGNASEGYDLAAEKEANL  580

Query  350   TQW-DTGVDLSLLRFIAEKSVHIDDD-SIIHPKLLKSHVQSRLNKIASGKHLNWATAEAL  407
              +  +TGVD+ +LR +      I  +   +HP + +++  +R   I SG+   W  AE L
Sbjct  581   PKAVETGVDIEVLRRVGLHVTTIPSEVKKVHPVVERTYA-ARKKAIESGEGAEWCLAEML  639

Query  408   AIGTLLYQGYNVRVSGQDIGRGTFSHRHAMLVDQSTGDIHIPLNSMIEGQTGKLELANSI  467
             A G    +G +VR++G+D+ RGTF+ RHA + D  T   +IPL S+ E Q   + + NS 
Sbjct  640   AFGATALEGTHVRLAGEDVERGTFTQRHAAVTDLETNKKYIPLCSLSEDQ-ALVTICNSS  698

Query  468   LSEEAILGYEYGMSIAMPTTLTIWEAQFGDFFNGAQIMIDTFITSGEAKWMLSSGLTILL  527
             LSE  + G+E G +   P TL +WEAQFGDF NGAQ++ D F+  GE KW     L + L
Sbjct  699   LSEFGVSGFELGYNAVNPHTLGMWEAQFGDFANGAQVIFDQFLCCGEEKWNAKYSLVLSL  758

Query  528   PHGYDGAGPEHSSSRLERFLQLTDSNEDKPDG--------------DNVNICVTNPTTPA  573
             PHGY GAGPEHSS+R+ER+LQL    +  P                   N  V  P+TPA
Sbjct  759   PHGYSGAGPEHSSARIERYLQLCSDTDVVPHNFRRGCPLQLLEVRIQRFNWQVCYPSTPA  818

Query  574   QYFHLLRRQMVRNFRKPLIIMAPKILLRHIAATSPITDMQPQTRFKTVIGDEKVEESKVT  633
              YFH+LRRQ+ R   KPL++   K  LR     S +++M   T FK VI     +E    
Sbjct  819   NYFHVLRRQVRRGDPKPLVVFFSKARLR-APNVSSLSEMSTGTSFKPVIDTAVNDEVIAR  877

Query  634   KVILVSGKHYYALDNFRESTNQK------NVAIIRVESLCPFPVQELLQEIDRYKYAK--  685
             KV+  +G+    +D+ R+    +      +V ++++E L PFP +++   +++Y      
Sbjct  878   KVLFCTGQIESIVDDRRKKLQAEKPGVHDDVVLVKLEQLSPFPWEQVADVLEKYHSRNPN  937

Query  686   -TFIWSQEEPQNMGAWNFVKPRFENLCGRL--------IKYSGRKPMAATAVGAGKLHQQ  736
               F W QEEP+NMG+W +V+PR + L   L        + Y GR   A+ + G   +H +
Sbjct  938   VQFAWLQEEPKNMGSWAYVRPRLQRLLRHLGMAGSSDFLPYVGRVTAASPSTGYATVHAE  997

Query  737   EAQEV  741
             E  E+
Sbjct  998   EEAEI  1002



Lambda      K        H
   0.313    0.128    0.386 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3603051738


Query= XP_050573093.1 kinesin-associated protein 3 [Bombus affinis]

Length=849
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

KIFA3_STRPU  unnamed protein product                                  726     0.0  
Q9VZ07_DROME  unnamed protein product                                 612     0.0  
A8JUR4_DROME  unnamed protein product                                 612     0.0  


>KIFA3_STRPU unnamed protein product
Length=828

 Score = 726 bits (1874),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/851 (48%), Positives = 564/851 (66%), Gaps = 74/851 (9%)

Query  2    DEAKFLKRKVRSGTLDVHPTERALVVNYDVEALILGELGDPMLGDRKECQKIIRLKSLNS  61
            ++A++LKRKV+ G++DVHPTE+ALVVNY++EA ILGE+GDPMLG+RKECQKIIRL+SLNS
Sbjct  4    EDARYLKRKVKGGSIDVHPTEKALVVNYELEATILGEMGDPMLGERKECQKIIRLRSLNS  63

Query  62   DTNVSLLAKEVIEKCSLIHESKLHEVEQLIYYLQNRKTNDTINSDNNSQLSRPTSSNSVS  121
             T+++ LA+EV+EKC LIH SKL EVEQL+YYLQNRK           +L+         
Sbjct  64   TTDIAALAREVVEKCKLIHPSKLPEVEQLLYYLQNRKETTQKAGAKKGELTGKLKDPPPY  123

Query  122  TDNGETERAIISNVDNYIELLYEEIPGKIKGSSLILQLARVPDNLHELTKNESLLSALAR  181
                  E A I+++++YIELLYE+ P K++G++LILQLAR PDNL EL  NE++L ALAR
Sbjct  124  EGTELNEVANINDIEDYIELLYEDNPEKVRGTALILQLARNPDNLEELQSNETVLGALAR  183

Query  182  VLREDWRRSIELSTNIVYIFFCFSTYSQFHNIVLEYRIGSLCMDIIDFELRRYDQWKEDM  241
            VLRE+W+ S+EL+TNIVYIFFCFS++SQFH+IV  ++IG+L M +++ EL+++  W E++
Sbjct  184  VLREEWKHSVELATNIVYIFFCFSSFSQFHSIVAHFKIGALVMGVVEHELKKHLSWNEEL  243

Query  242  EKRRRHFENTTGLTFFSTGNDNCDKKTKIVDDIWNTDGPLDYEIKKRSNEVTVTVTENDI  301
             K+++                                                T  EN  
Sbjct  244  LKKKK------------------------------------------------TAEENPA  255

Query  302  KKLKEELEKSRKKFKNLIKKQEQLLRVAFYLLLNIAENMEVERKMRKKNVIGMLIKTLDR  361
             K   + EKS KK+  L+KKQEQLLRV+FYLLLN++E+ +VE KM+ KN+I +LIKTL+R
Sbjct  256  SK--RDFEKSTKKYHGLLKKQEQLLRVSFYLLLNLSEDPKVELKMKNKNIIRLLIKTLER  313

Query  362  TNIDLLILVIAFLKKLSIFRENKDLMAEKNIIEKIPRLLQSNNADLVLSTLKLLFNLSFD  421
             N +LLILV++FLKKL I+ ENK+ MAE+ IIE++ +L+  ++ DL+  TL+LL NLSFD
Sbjct  314  DNAELLILVVSFLKKLGIYVENKNEMAEQQIIERLAKLVPCDHEDLLNITLRLLLNLSFD  373

Query  422  AKLRAKMIRVGILPKLIKLLGQSDIKNKTTILGLLYHASMDDKVKAMFTNTECIQMITNM  481
              LR KMI++G+LPK ++LL   +  ++  +L +LYH S DDK K+MFT T+CI MI  M
Sbjct  374  TDLRGKMIKLGMLPKFVELLANDN--HRLVVLCVLYHVSQDDKAKSMFTYTDCIPMIMKM  431

Query  482  ILNSEDDQPKLELIALGINLAINGKNAQLMVENNRLQGLIKKAFRTQDPLIMKMIRNISQ  541
            +L S  ++ ++EL+ALGINLA N  NAQL+ E N L+ L+++A + +DPL++KMIRNISQ
Sbjct  432  MLESPTERLEIELVALGINLACNKHNAQLICEGNGLRLLMRRALKFRDPLLLKMIRNISQ  491

Query  542  HDS-TKENFVEFVGDFAMALNQSDSQDFVLEVIGVLGNLELPDLDYSQILHRCDLIPWIR  600
            HD  +K  F+E++ D A  + +S+ ++ V+E +G++ NL +PDLDY  I++   L+PWI+
Sbjct  492  HDGPSKAQFIEYISDVARIIKESNDEELVVEALGIMANLTIPDLDYEMIINEFGLVPWIK  551

Query  601  NNLVPGKAPDDLVLEIVIFLGTAAFDEDCARLLCKADILLSLIELLKAKQEDDEMVLQII  660
              L PG A DDLVLE+V+ +GT A D+ CA +L K+ I+ SLIELL AKQEDDE+V QI+
Sbjct  552  EKLEPGAAEDDLVLEVVMLVGTVATDDSCAAMLAKSGIIQSLIELLNAKQEDDEIVCQIV  611

Query  661  YVFYQISKHDSTRDYLIRETGNEAPGYLIDLMHDKNPAIRKVCDACLDVIAMCDKNWAAR  720
            YVFYQ+  H++TR+ +I+ T  +AP YLIDLMHDKN  IRKVCD  LD+I+  D+ WA +
Sbjct  612  YVFYQMVFHEATREVIIKLT--QAPAYLIDLMHDKNSEIRKVCDNTLDIISEFDEEWARK  669

Query  721  ITVEKFRSHNQQWLEMVESITNDSSNHLLPEEDDSLSPFMN-GDLLKHTMLFPSGNVASF  779
            I +EKFR HN QWLEMVES   D     L   D+S SP++   D+L    LF        
Sbjct  670  IKLEKFRWHNSQWLEMVESQQIDDGEGGLMYGDESYSPYIQESDILDRPDLF----YGQT  725

Query  780  NTDDRFSIMKNSSESSENQSRP--VSRYKDFDELGELMARSKSRM---SVSSGMDDLYYN  834
              +D         E  + Q  P  V  Y +    GE + R  S M      S  + L   
Sbjct  726  GYED--------GEMYDGQVTPEYVDEYGNVQN-GEYLGRPASAMYGNRYQSEYESLRPG  776

Query  835  SKVKFPESDGS  845
            S+V +   DG 
Sbjct  777  SRVAYLTEDGQ  787


>Q9VZ07_DROME unnamed protein product
Length=1038

 Score = 612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/920 (39%), Positives = 542/920 (59%), Gaps = 123/920 (13%)

Query  2     DEAKFLKRKVRSGTLDVHPTERALVVNYDVEALILGELGDPMLGDRKECQKIIRLKSLNS  61
             D+AKF+K++ + G+++ HPT++AL+VNY +EA + GE  +PM+ ++K CQKIIRL+SLN+
Sbjct  98    DDAKFIKKRWKGGSIEPHPTDKALIVNYQLEATVFGEPNNPMIEEKKHCQKIIRLRSLNA  157

Query  62    DTNVSLLAKEVIEKCSLIHESKLHEVEQLIYYLQNRKTNDTIN-SDNNSQLSRPTSSNSV  120
              T+ + LA+EV+EKC LIH+S+L++VEQ+I+YL+NRK N + +  DNN+   R  + ++ 
Sbjct  158   KTDPAALAREVVEKCDLIHKSQLNDVEQIIFYLKNRKDNASNDIPDNNTHSRRSAALHTS  217

Query  121   ST--------------------------DNG---------ETERAIISNVDNYIELLYEE  145
              T                           NG          T    I+N+D Y+ELLYEE
Sbjct  218   HTRSSARSHSSVAAMTSSTGSGGGSTGASNGVSNALSAATPTADVSINNIDEYVELLYEE  277

Query  146   IPGKIKGSSLILQLARVPDNLHELTKNESLLSALARVLREDWRRSIELSTNIVYIFFCFS  205
             +  +I+GS++ILQ+AR PDNL EL KNE+ LSAL+RVLREDWR+S++LSTNI+YIFFCFS
Sbjct  278   LGERIRGSAMILQMARNPDNLEELEKNEACLSALSRVLREDWRKSLDLSTNIIYIFFCFS  337

Query  206   TYSQFHNIVLEYRIGSLCMDIIDFELRRYDQWKEDMEKRRRHFENTTGLTFFSTGNDNCD  265
             TY++FH ++++Y+IGSLCMD+ID+ELRRY+  + +++ R++   ++T  +      +  +
Sbjct  338   TYTKFHPLIVQYKIGSLCMDVIDYELRRYETMRNELDVRKQPNGSSTPHS-AKASKEKLN  396

Query  266   KKTKIVDDIWNTDGPLDYEIKKRSNEVTVTVTENDIKKLKEELEKSR------KKFKNLI  319
             + T    DI N + P + E  +R            I +LK+  +             +LI
Sbjct  397   RSTDDFLDIMNEEKPKEMEPPRRR-----------IPELKQRPKSGNWSSFHGSMSSSLI  445

Query  320   KKQEQLLRVAFYLLLNIAEN-------MEVERKMRK-----KNVIGMLIKTLDRTNIDLL  367
             K   Q+L  +++  L    +       +  E+K +      +N   +  + +DR N  L 
Sbjct  446   KS--QILNSSYHESLCAGGSPGGDTPAVPAEQKAQSNESLDRNDPKVKKEEIDRLNKQLK  503

Query  368   I--------LVIAFLKKLSIFRENK--DLMAEKNIIEKIPRLLQSNNADLVLSTLKLLFN  417
             I        L +AF   L++    K  + M  K+I++ + + L   N DL++     L  
Sbjct  504   IFAKKQEQLLRVAFYLLLNMAENVKLEEKMRRKHIVKMLVKALDRQNIDLLMLVSTFLKK  563

Query  418   LSFDAKLRAKMIRVGILPKLIKLLGQS-------------------DIKNKTTILGLL--  456
             LS     + +M  + I+ KL +L   +                    ++ K    G L  
Sbjct  564   LSIVGDNKDEMGALNIVAKLPRLFQSTHTDLVQVTLKLVFNLSFDGGLRRKMIAAGYLPM  623

Query  457   ------------------YHASMDDKVKAMFTNTECIQMITNMILNSEDDQPKLELIALG  498
                               YH S+DDKVK MFT TEC+QM T+ I+ + + +  L+LIAL 
Sbjct  624   LVMFINDEKHHGIAVKILYHMSLDDKVKGMFTQTECVQMATDAIILNLNVKVDLDLIALC  683

Query  499   INLAINGKNAQLMVENNRLQGLIKKAFRTQDPLIMKMIRNISQHDSTKENFVEFVGDFAM  558
             INL++N +NAQ+MVE  RL  L+ +AF+ QD L+MK++RN+SQH+S +  F+++VGD A 
Sbjct  684   INLSLNRRNAQIMVEGQRLHSLMDRAFKYQDALLMKLLRNLSQHESLQLQFIDYVGDLAR  743

Query  559   ALNQSDSQDFVLEVIGVLGNLELPDLDYSQILHRCDLIPWIRNNLVPGKAPDDLVLEIVI  618
              L   D + F++E +G+LGNL L DLDYSQIL    LIPWIR  L+P    DDLVL+ ++
Sbjct  744   ILTICDDEAFIVECLGILGNLALTDLDYSQILQNFQLIPWIRQILLPCARMDDLVLDTIV  803

Query  619   FLGTAAFDEDCARLLCKADILLSLIELLKAKQEDDEMVLQIIYVFYQISKHDSTRDYLIR  678
             +LGT A DE CA L C+A +++SLIELLKAKQEDDE+VLQII+VF QI +H+STR+Y+I+
Sbjct  804   YLGTCACDELCALLFCRAKVVISLIELLKAKQEDDEIVLQIIFVFQQILRHESTREYMIK  863

Query  679   ETGNEAPGYLIDLMHDKNPAIRKVCDACLDVIAMCDKNWAARITVEKFRSHNQQWLEMVE  738
             ET  E+  YLIDLMHDKN  IRKVCD CLD+IA+ D  WA RI +EKFR+HN QWL MVE
Sbjct  864   ET--ESAAYLIDLMHDKNEEIRKVCDYCLDIIAISDSEWAKRIKLEKFRNHNSQWLCMVE  921

Query  739   SITNDSSNHLLPEEDDS----LSPFMNGDLLKHTMLFPSGNVASFNTDDRFSIMKNSSES  794
             S  +  +     +++D     L  ++  + L +  L+        N++   S    +S +
Sbjct  922   SQQDQDNEQDYADQEDECDNDLDTYLRSEYLDNCDLYNDNADNDSNSNSNHSNNNPASPA  981

Query  795   SENQSRPVSRYKDFDELGEL  814
                 SRP+S Y+   +L +L
Sbjct  982   MSTYSRPLSTYRRSQDLDDL  1001


>A8JUR4_DROME unnamed protein product
Length=945

 Score = 612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/920 (39%), Positives = 542/920 (59%), Gaps = 123/920 (13%)

Query  2    DEAKFLKRKVRSGTLDVHPTERALVVNYDVEALILGELGDPMLGDRKECQKIIRLKSLNS  61
            D+AKF+K++ + G+++ HPT++AL+VNY +EA + GE  +PM+ ++K CQKIIRL+SLN+
Sbjct  5    DDAKFIKKRWKGGSIEPHPTDKALIVNYQLEATVFGEPNNPMIEEKKHCQKIIRLRSLNA  64

Query  62   DTNVSLLAKEVIEKCSLIHESKLHEVEQLIYYLQNRKTNDTIN-SDNNSQLSRPTSSNSV  120
             T+ + LA+EV+EKC LIH+S+L++VEQ+I+YL+NRK N + +  DNN+   R  + ++ 
Sbjct  65   KTDPAALAREVVEKCDLIHKSQLNDVEQIIFYLKNRKDNASNDIPDNNTHSRRSAALHTS  124

Query  121  ST--------------------------DNG---------ETERAIISNVDNYIELLYEE  145
             T                           NG          T    I+N+D Y+ELLYEE
Sbjct  125  HTRSSARSHSSVAAMTSSTGSGGGSTGASNGVSNALSAATPTADVSINNIDEYVELLYEE  184

Query  146  IPGKIKGSSLILQLARVPDNLHELTKNESLLSALARVLREDWRRSIELSTNIVYIFFCFS  205
            +  +I+GS++ILQ+AR PDNL EL KNE+ LSAL+RVLREDWR+S++LSTNI+YIFFCFS
Sbjct  185  LGERIRGSAMILQMARNPDNLEELEKNEACLSALSRVLREDWRKSLDLSTNIIYIFFCFS  244

Query  206  TYSQFHNIVLEYRIGSLCMDIIDFELRRYDQWKEDMEKRRRHFENTTGLTFFSTGNDNCD  265
            TY++FH ++++Y+IGSLCMD+ID+ELRRY+  + +++ R++   ++T  +      +  +
Sbjct  245  TYTKFHPLIVQYKIGSLCMDVIDYELRRYETMRNELDVRKQPNGSSTPHS-AKASKEKLN  303

Query  266  KKTKIVDDIWNTDGPLDYEIKKRSNEVTVTVTENDIKKLKEELEKSR------KKFKNLI  319
            + T    DI N + P + E  +R            I +LK+  +             +LI
Sbjct  304  RSTDDFLDIMNEEKPKEMEPPRRR-----------IPELKQRPKSGNWSSFHGSMSSSLI  352

Query  320  KKQEQLLRVAFYLLLNIAEN-------MEVERKMRK-----KNVIGMLIKTLDRTNIDLL  367
            K   Q+L  +++  L    +       +  E+K +      +N   +  + +DR N  L 
Sbjct  353  KS--QILNSSYHESLCAGGSPGGDTPAVPAEQKAQSNESLDRNDPKVKKEEIDRLNKQLK  410

Query  368  I--------LVIAFLKKLSIFRENK--DLMAEKNIIEKIPRLLQSNNADLVLSTLKLLFN  417
            I        L +AF   L++    K  + M  K+I++ + + L   N DL++     L  
Sbjct  411  IFAKKQEQLLRVAFYLLLNMAENVKLEEKMRRKHIVKMLVKALDRQNIDLLMLVSTFLKK  470

Query  418  LSFDAKLRAKMIRVGILPKLIKLLGQS-------------------DIKNKTTILGLL--  456
            LS     + +M  + I+ KL +L   +                    ++ K    G L  
Sbjct  471  LSIVGDNKDEMGALNIVAKLPRLFQSTHTDLVQVTLKLVFNLSFDGGLRRKMIAAGYLPM  530

Query  457  ------------------YHASMDDKVKAMFTNTECIQMITNMILNSEDDQPKLELIALG  498
                              YH S+DDKVK MFT TEC+QM T+ I+ + + +  L+LIAL 
Sbjct  531  LVMFINDEKHHGIAVKILYHMSLDDKVKGMFTQTECVQMATDAIILNLNVKVDLDLIALC  590

Query  499  INLAINGKNAQLMVENNRLQGLIKKAFRTQDPLIMKMIRNISQHDSTKENFVEFVGDFAM  558
            INL++N +NAQ+MVE  RL  L+ +AF+ QD L+MK++RN+SQH+S +  F+++VGD A 
Sbjct  591  INLSLNRRNAQIMVEGQRLHSLMDRAFKYQDALLMKLLRNLSQHESLQLQFIDYVGDLAR  650

Query  559  ALNQSDSQDFVLEVIGVLGNLELPDLDYSQILHRCDLIPWIRNNLVPGKAPDDLVLEIVI  618
             L   D + F++E +G+LGNL L DLDYSQIL    LIPWIR  L+P    DDLVL+ ++
Sbjct  651  ILTICDDEAFIVECLGILGNLALTDLDYSQILQNFQLIPWIRQILLPCARMDDLVLDTIV  710

Query  619  FLGTAAFDEDCARLLCKADILLSLIELLKAKQEDDEMVLQIIYVFYQISKHDSTRDYLIR  678
            +LGT A DE CA L C+A +++SLIELLKAKQEDDE+VLQII+VF QI +H+STR+Y+I+
Sbjct  711  YLGTCACDELCALLFCRAKVVISLIELLKAKQEDDEIVLQIIFVFQQILRHESTREYMIK  770

Query  679  ETGNEAPGYLIDLMHDKNPAIRKVCDACLDVIAMCDKNWAARITVEKFRSHNQQWLEMVE  738
            ET  E+  YLIDLMHDKN  IRKVCD CLD+IA+ D  WA RI +EKFR+HN QWL MVE
Sbjct  771  ET--ESAAYLIDLMHDKNEEIRKVCDYCLDIIAISDSEWAKRIKLEKFRNHNSQWLCMVE  828

Query  739  SITNDSSNHLLPEEDDS----LSPFMNGDLLKHTMLFPSGNVASFNTDDRFSIMKNSSES  794
            S  +  +     +++D     L  ++  + L +  L+        N++   S    +S +
Sbjct  829  SQQDQDNEQDYADQEDECDNDLDTYLRSEYLDNCDLYNDNADNDSNSNSNHSNNNPASPA  888

Query  795  SENQSRPVSRYKDFDELGEL  814
                SRP+S Y+   +L +L
Sbjct  889  MSTYSRPLSTYRRSQDLDDL  908



Lambda      K        H
   0.313    0.128    0.386 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3603051738


Query= XP_050573094.1 kinesin-associated protein 3 [Bombus affinis]

Length=849
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

KIFA3_STRPU  unnamed protein product                                  726     0.0  
Q9VZ07_DROME  unnamed protein product                                 612     0.0  
A8JUR4_DROME  unnamed protein product                                 612     0.0  


>KIFA3_STRPU unnamed protein product
Length=828

 Score = 726 bits (1874),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/851 (48%), Positives = 564/851 (66%), Gaps = 74/851 (9%)

Query  2    DEAKFLKRKVRSGTLDVHPTERALVVNYDVEALILGELGDPMLGDRKECQKIIRLKSLNS  61
            ++A++LKRKV+ G++DVHPTE+ALVVNY++EA ILGE+GDPMLG+RKECQKIIRL+SLNS
Sbjct  4    EDARYLKRKVKGGSIDVHPTEKALVVNYELEATILGEMGDPMLGERKECQKIIRLRSLNS  63

Query  62   DTNVSLLAKEVIEKCSLIHESKLHEVEQLIYYLQNRKTNDTINSDNNSQLSRPTSSNSVS  121
             T+++ LA+EV+EKC LIH SKL EVEQL+YYLQNRK           +L+         
Sbjct  64   TTDIAALAREVVEKCKLIHPSKLPEVEQLLYYLQNRKETTQKAGAKKGELTGKLKDPPPY  123

Query  122  TDNGETERAIISNVDNYIELLYEEIPGKIKGSSLILQLARVPDNLHELTKNESLLSALAR  181
                  E A I+++++YIELLYE+ P K++G++LILQLAR PDNL EL  NE++L ALAR
Sbjct  124  EGTELNEVANINDIEDYIELLYEDNPEKVRGTALILQLARNPDNLEELQSNETVLGALAR  183

Query  182  VLREDWRRSIELSTNIVYIFFCFSTYSQFHNIVLEYRIGSLCMDIIDFELRRYDQWKEDM  241
            VLRE+W+ S+EL+TNIVYIFFCFS++SQFH+IV  ++IG+L M +++ EL+++  W E++
Sbjct  184  VLREEWKHSVELATNIVYIFFCFSSFSQFHSIVAHFKIGALVMGVVEHELKKHLSWNEEL  243

Query  242  EKRRRHFENTTGLTFFSTGNDNCDKKTKIVDDIWNTDGPLDYEIKKRSNEVTVTVTENDI  301
             K+++                                                T  EN  
Sbjct  244  LKKKK------------------------------------------------TAEENPA  255

Query  302  KKLKEELEKSRKKFKNLIKKQEQLLRVAFYLLLNIAENMEVERKMRKKNVIGMLIKTLDR  361
             K   + EKS KK+  L+KKQEQLLRV+FYLLLN++E+ +VE KM+ KN+I +LIKTL+R
Sbjct  256  SK--RDFEKSTKKYHGLLKKQEQLLRVSFYLLLNLSEDPKVELKMKNKNIIRLLIKTLER  313

Query  362  TNIDLLILVIAFLKKLSIFRENKDLMAEKNIIEKIPRLLQSNNADLVLSTLKLLFNLSFD  421
             N +LLILV++FLKKL I+ ENK+ MAE+ IIE++ +L+  ++ DL+  TL+LL NLSFD
Sbjct  314  DNAELLILVVSFLKKLGIYVENKNEMAEQQIIERLAKLVPCDHEDLLNITLRLLLNLSFD  373

Query  422  AKLRAKMIRVGILPKLIKLLGQSDIKNKTTILGLLYHASMDDKVKAMFTNTECIQMITNM  481
              LR KMI++G+LPK ++LL   +  ++  +L +LYH S DDK K+MFT T+CI MI  M
Sbjct  374  TDLRGKMIKLGMLPKFVELLANDN--HRLVVLCVLYHVSQDDKAKSMFTYTDCIPMIMKM  431

Query  482  ILNSEDDQPKLELIALGINLAINGKNAQLMVENNRLQGLIKKAFRTQDPLIMKMIRNISQ  541
            +L S  ++ ++EL+ALGINLA N  NAQL+ E N L+ L+++A + +DPL++KMIRNISQ
Sbjct  432  MLESPTERLEIELVALGINLACNKHNAQLICEGNGLRLLMRRALKFRDPLLLKMIRNISQ  491

Query  542  HDS-TKENFVEFVGDFAMALNQSDSQDFVLEVIGVLGNLELPDLDYSQILHRCDLIPWIR  600
            HD  +K  F+E++ D A  + +S+ ++ V+E +G++ NL +PDLDY  I++   L+PWI+
Sbjct  492  HDGPSKAQFIEYISDVARIIKESNDEELVVEALGIMANLTIPDLDYEMIINEFGLVPWIK  551

Query  601  NNLVPGKAPDDLVLEIVIFLGTAAFDEDCARLLCKADILLSLIELLKAKQEDDEMVLQII  660
              L PG A DDLVLE+V+ +GT A D+ CA +L K+ I+ SLIELL AKQEDDE+V QI+
Sbjct  552  EKLEPGAAEDDLVLEVVMLVGTVATDDSCAAMLAKSGIIQSLIELLNAKQEDDEIVCQIV  611

Query  661  YVFYQISKHDSTRDYLIRETGNEAPGYLIDLMHDKNPAIRKVCDACLDVIAMCDKNWAAR  720
            YVFYQ+  H++TR+ +I+ T  +AP YLIDLMHDKN  IRKVCD  LD+I+  D+ WA +
Sbjct  612  YVFYQMVFHEATREVIIKLT--QAPAYLIDLMHDKNSEIRKVCDNTLDIISEFDEEWARK  669

Query  721  ITVEKFRSHNQQWLEMVESITNDSSNHLLPEEDDSLSPFMN-GDLLKHTMLFPSGNVASF  779
            I +EKFR HN QWLEMVES   D     L   D+S SP++   D+L    LF        
Sbjct  670  IKLEKFRWHNSQWLEMVESQQIDDGEGGLMYGDESYSPYIQESDILDRPDLF----YGQT  725

Query  780  NTDDRFSIMKNSSESSENQSRP--VSRYKDFDELGELMARSKSRM---SVSSGMDDLYYN  834
              +D         E  + Q  P  V  Y +    GE + R  S M      S  + L   
Sbjct  726  GYED--------GEMYDGQVTPEYVDEYGNVQN-GEYLGRPASAMYGNRYQSEYESLRPG  776

Query  835  SKVKFPESDGS  845
            S+V +   DG 
Sbjct  777  SRVAYLTEDGQ  787


>Q9VZ07_DROME unnamed protein product
Length=1038

 Score = 612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/920 (39%), Positives = 542/920 (59%), Gaps = 123/920 (13%)

Query  2     DEAKFLKRKVRSGTLDVHPTERALVVNYDVEALILGELGDPMLGDRKECQKIIRLKSLNS  61
             D+AKF+K++ + G+++ HPT++AL+VNY +EA + GE  +PM+ ++K CQKIIRL+SLN+
Sbjct  98    DDAKFIKKRWKGGSIEPHPTDKALIVNYQLEATVFGEPNNPMIEEKKHCQKIIRLRSLNA  157

Query  62    DTNVSLLAKEVIEKCSLIHESKLHEVEQLIYYLQNRKTNDTIN-SDNNSQLSRPTSSNSV  120
              T+ + LA+EV+EKC LIH+S+L++VEQ+I+YL+NRK N + +  DNN+   R  + ++ 
Sbjct  158   KTDPAALAREVVEKCDLIHKSQLNDVEQIIFYLKNRKDNASNDIPDNNTHSRRSAALHTS  217

Query  121   ST--------------------------DNG---------ETERAIISNVDNYIELLYEE  145
              T                           NG          T    I+N+D Y+ELLYEE
Sbjct  218   HTRSSARSHSSVAAMTSSTGSGGGSTGASNGVSNALSAATPTADVSINNIDEYVELLYEE  277

Query  146   IPGKIKGSSLILQLARVPDNLHELTKNESLLSALARVLREDWRRSIELSTNIVYIFFCFS  205
             +  +I+GS++ILQ+AR PDNL EL KNE+ LSAL+RVLREDWR+S++LSTNI+YIFFCFS
Sbjct  278   LGERIRGSAMILQMARNPDNLEELEKNEACLSALSRVLREDWRKSLDLSTNIIYIFFCFS  337

Query  206   TYSQFHNIVLEYRIGSLCMDIIDFELRRYDQWKEDMEKRRRHFENTTGLTFFSTGNDNCD  265
             TY++FH ++++Y+IGSLCMD+ID+ELRRY+  + +++ R++   ++T  +      +  +
Sbjct  338   TYTKFHPLIVQYKIGSLCMDVIDYELRRYETMRNELDVRKQPNGSSTPHS-AKASKEKLN  396

Query  266   KKTKIVDDIWNTDGPLDYEIKKRSNEVTVTVTENDIKKLKEELEKSR------KKFKNLI  319
             + T    DI N + P + E  +R            I +LK+  +             +LI
Sbjct  397   RSTDDFLDIMNEEKPKEMEPPRRR-----------IPELKQRPKSGNWSSFHGSMSSSLI  445

Query  320   KKQEQLLRVAFYLLLNIAEN-------MEVERKMRK-----KNVIGMLIKTLDRTNIDLL  367
             K   Q+L  +++  L    +       +  E+K +      +N   +  + +DR N  L 
Sbjct  446   KS--QILNSSYHESLCAGGSPGGDTPAVPAEQKAQSNESLDRNDPKVKKEEIDRLNKQLK  503

Query  368   I--------LVIAFLKKLSIFRENK--DLMAEKNIIEKIPRLLQSNNADLVLSTLKLLFN  417
             I        L +AF   L++    K  + M  K+I++ + + L   N DL++     L  
Sbjct  504   IFAKKQEQLLRVAFYLLLNMAENVKLEEKMRRKHIVKMLVKALDRQNIDLLMLVSTFLKK  563

Query  418   LSFDAKLRAKMIRVGILPKLIKLLGQS-------------------DIKNKTTILGLL--  456
             LS     + +M  + I+ KL +L   +                    ++ K    G L  
Sbjct  564   LSIVGDNKDEMGALNIVAKLPRLFQSTHTDLVQVTLKLVFNLSFDGGLRRKMIAAGYLPM  623

Query  457   ------------------YHASMDDKVKAMFTNTECIQMITNMILNSEDDQPKLELIALG  498
                               YH S+DDKVK MFT TEC+QM T+ I+ + + +  L+LIAL 
Sbjct  624   LVMFINDEKHHGIAVKILYHMSLDDKVKGMFTQTECVQMATDAIILNLNVKVDLDLIALC  683

Query  499   INLAINGKNAQLMVENNRLQGLIKKAFRTQDPLIMKMIRNISQHDSTKENFVEFVGDFAM  558
             INL++N +NAQ+MVE  RL  L+ +AF+ QD L+MK++RN+SQH+S +  F+++VGD A 
Sbjct  684   INLSLNRRNAQIMVEGQRLHSLMDRAFKYQDALLMKLLRNLSQHESLQLQFIDYVGDLAR  743

Query  559   ALNQSDSQDFVLEVIGVLGNLELPDLDYSQILHRCDLIPWIRNNLVPGKAPDDLVLEIVI  618
              L   D + F++E +G+LGNL L DLDYSQIL    LIPWIR  L+P    DDLVL+ ++
Sbjct  744   ILTICDDEAFIVECLGILGNLALTDLDYSQILQNFQLIPWIRQILLPCARMDDLVLDTIV  803

Query  619   FLGTAAFDEDCARLLCKADILLSLIELLKAKQEDDEMVLQIIYVFYQISKHDSTRDYLIR  678
             +LGT A DE CA L C+A +++SLIELLKAKQEDDE+VLQII+VF QI +H+STR+Y+I+
Sbjct  804   YLGTCACDELCALLFCRAKVVISLIELLKAKQEDDEIVLQIIFVFQQILRHESTREYMIK  863

Query  679   ETGNEAPGYLIDLMHDKNPAIRKVCDACLDVIAMCDKNWAARITVEKFRSHNQQWLEMVE  738
             ET  E+  YLIDLMHDKN  IRKVCD CLD+IA+ D  WA RI +EKFR+HN QWL MVE
Sbjct  864   ET--ESAAYLIDLMHDKNEEIRKVCDYCLDIIAISDSEWAKRIKLEKFRNHNSQWLCMVE  921

Query  739   SITNDSSNHLLPEEDDS----LSPFMNGDLLKHTMLFPSGNVASFNTDDRFSIMKNSSES  794
             S  +  +     +++D     L  ++  + L +  L+        N++   S    +S +
Sbjct  922   SQQDQDNEQDYADQEDECDNDLDTYLRSEYLDNCDLYNDNADNDSNSNSNHSNNNPASPA  981

Query  795   SENQSRPVSRYKDFDELGEL  814
                 SRP+S Y+   +L +L
Sbjct  982   MSTYSRPLSTYRRSQDLDDL  1001


>A8JUR4_DROME unnamed protein product
Length=945

 Score = 612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/920 (39%), Positives = 542/920 (59%), Gaps = 123/920 (13%)

Query  2    DEAKFLKRKVRSGTLDVHPTERALVVNYDVEALILGELGDPMLGDRKECQKIIRLKSLNS  61
            D+AKF+K++ + G+++ HPT++AL+VNY +EA + GE  +PM+ ++K CQKIIRL+SLN+
Sbjct  5    DDAKFIKKRWKGGSIEPHPTDKALIVNYQLEATVFGEPNNPMIEEKKHCQKIIRLRSLNA  64

Query  62   DTNVSLLAKEVIEKCSLIHESKLHEVEQLIYYLQNRKTNDTIN-SDNNSQLSRPTSSNSV  120
             T+ + LA+EV+EKC LIH+S+L++VEQ+I+YL+NRK N + +  DNN+   R  + ++ 
Sbjct  65   KTDPAALAREVVEKCDLIHKSQLNDVEQIIFYLKNRKDNASNDIPDNNTHSRRSAALHTS  124

Query  121  ST--------------------------DNG---------ETERAIISNVDNYIELLYEE  145
             T                           NG          T    I+N+D Y+ELLYEE
Sbjct  125  HTRSSARSHSSVAAMTSSTGSGGGSTGASNGVSNALSAATPTADVSINNIDEYVELLYEE  184

Query  146  IPGKIKGSSLILQLARVPDNLHELTKNESLLSALARVLREDWRRSIELSTNIVYIFFCFS  205
            +  +I+GS++ILQ+AR PDNL EL KNE+ LSAL+RVLREDWR+S++LSTNI+YIFFCFS
Sbjct  185  LGERIRGSAMILQMARNPDNLEELEKNEACLSALSRVLREDWRKSLDLSTNIIYIFFCFS  244

Query  206  TYSQFHNIVLEYRIGSLCMDIIDFELRRYDQWKEDMEKRRRHFENTTGLTFFSTGNDNCD  265
            TY++FH ++++Y+IGSLCMD+ID+ELRRY+  + +++ R++   ++T  +      +  +
Sbjct  245  TYTKFHPLIVQYKIGSLCMDVIDYELRRYETMRNELDVRKQPNGSSTPHS-AKASKEKLN  303

Query  266  KKTKIVDDIWNTDGPLDYEIKKRSNEVTVTVTENDIKKLKEELEKSR------KKFKNLI  319
            + T    DI N + P + E  +R            I +LK+  +             +LI
Sbjct  304  RSTDDFLDIMNEEKPKEMEPPRRR-----------IPELKQRPKSGNWSSFHGSMSSSLI  352

Query  320  KKQEQLLRVAFYLLLNIAEN-------MEVERKMRK-----KNVIGMLIKTLDRTNIDLL  367
            K   Q+L  +++  L    +       +  E+K +      +N   +  + +DR N  L 
Sbjct  353  KS--QILNSSYHESLCAGGSPGGDTPAVPAEQKAQSNESLDRNDPKVKKEEIDRLNKQLK  410

Query  368  I--------LVIAFLKKLSIFRENK--DLMAEKNIIEKIPRLLQSNNADLVLSTLKLLFN  417
            I        L +AF   L++    K  + M  K+I++ + + L   N DL++     L  
Sbjct  411  IFAKKQEQLLRVAFYLLLNMAENVKLEEKMRRKHIVKMLVKALDRQNIDLLMLVSTFLKK  470

Query  418  LSFDAKLRAKMIRVGILPKLIKLLGQS-------------------DIKNKTTILGLL--  456
            LS     + +M  + I+ KL +L   +                    ++ K    G L  
Sbjct  471  LSIVGDNKDEMGALNIVAKLPRLFQSTHTDLVQVTLKLVFNLSFDGGLRRKMIAAGYLPM  530

Query  457  ------------------YHASMDDKVKAMFTNTECIQMITNMILNSEDDQPKLELIALG  498
                              YH S+DDKVK MFT TEC+QM T+ I+ + + +  L+LIAL 
Sbjct  531  LVMFINDEKHHGIAVKILYHMSLDDKVKGMFTQTECVQMATDAIILNLNVKVDLDLIALC  590

Query  499  INLAINGKNAQLMVENNRLQGLIKKAFRTQDPLIMKMIRNISQHDSTKENFVEFVGDFAM  558
            INL++N +NAQ+MVE  RL  L+ +AF+ QD L+MK++RN+SQH+S +  F+++VGD A 
Sbjct  591  INLSLNRRNAQIMVEGQRLHSLMDRAFKYQDALLMKLLRNLSQHESLQLQFIDYVGDLAR  650

Query  559  ALNQSDSQDFVLEVIGVLGNLELPDLDYSQILHRCDLIPWIRNNLVPGKAPDDLVLEIVI  618
             L   D + F++E +G+LGNL L DLDYSQIL    LIPWIR  L+P    DDLVL+ ++
Sbjct  651  ILTICDDEAFIVECLGILGNLALTDLDYSQILQNFQLIPWIRQILLPCARMDDLVLDTIV  710

Query  619  FLGTAAFDEDCARLLCKADILLSLIELLKAKQEDDEMVLQIIYVFYQISKHDSTRDYLIR  678
            +LGT A DE CA L C+A +++SLIELLKAKQEDDE+VLQII+VF QI +H+STR+Y+I+
Sbjct  711  YLGTCACDELCALLFCRAKVVISLIELLKAKQEDDEIVLQIIFVFQQILRHESTREYMIK  770

Query  679  ETGNEAPGYLIDLMHDKNPAIRKVCDACLDVIAMCDKNWAARITVEKFRSHNQQWLEMVE  738
            ET  E+  YLIDLMHDKN  IRKVCD CLD+IA+ D  WA RI +EKFR+HN QWL MVE
Sbjct  771  ET--ESAAYLIDLMHDKNEEIRKVCDYCLDIIAISDSEWAKRIKLEKFRNHNSQWLCMVE  828

Query  739  SITNDSSNHLLPEEDDS----LSPFMNGDLLKHTMLFPSGNVASFNTDDRFSIMKNSSES  794
            S  +  +     +++D     L  ++  + L +  L+        N++   S    +S +
Sbjct  829  SQQDQDNEQDYADQEDECDNDLDTYLRSEYLDNCDLYNDNADNDSNSNSNHSNNNPASPA  888

Query  795  SENQSRPVSRYKDFDELGEL  814
                SRP+S Y+   +L +L
Sbjct  889  MSTYSRPLSTYRRSQDLDDL  908



Lambda      K        H
   0.313    0.128    0.386 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3603051738


Query= XP_050573095.1 hillarin isoform X1 [Bombus affinis]

Length=833
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

HIL_DROME  unnamed protein product                                    1269    0.0  
G5EF51_CAEEL  unnamed protein product                                 768     0.0  
LIMD_DICDI  unnamed protein product                                   64.3    2e-11


>HIL_DROME unnamed protein product
Length=818

 Score = 1269 bits (3284),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 624/850 (73%), Positives = 703/850 (83%), Gaps = 49/850 (6%)

Query  1    MYRPNFYESTCLRCAQTVYQVDRVGPLKDFTFFHAGCFKCAICGTKLTLKTYYNNQHTIN  60
            MYRPNFYESTCLRC++TVYQVDRVGPLKDFTFFH+GCFKC  CGTKLTLKTY+NNQH  +
Sbjct  1    MYRPNFYESTCLRCSETVYQVDRVGPLKDFTFFHSGCFKCVHCGTKLTLKTYFNNQHKQD  60

Query  61   DKEVYCSSHVPKPGPGTLDGSSVGIRSALNVPRSG-YVNEQIRAGGASPRGVYPPCYDNV  119
            DKEVYCSSHVPK GPG LD +SVGIR ALN PR+  +VNEQIR   +   G  P      
Sbjct  61   DKEVYCSSHVPKSGPGHLDQTSVGIRQALNAPRTNKFVNEQIRGTRSEVDGG-PLGGSRQ  119

Query  120  DSPNCARHLNGHGSPPATNSSQRDLHGNAGGGTSSPYNHNYSGDGSYQYGRFDASALHIA  179
             +PN      G+GS   ++ SQ                     D  Y+YGRFDASALHIA
Sbjct  120  STPN------GYGSREISSPSQ--------------------NDSDYKYGRFDASALHIA  153

Query  180  HALKQTELQKGYSKAREKPIDYYLDRDEQTRLEMKHRKEEDDLYRKFAHHREEEDRRIRE  239
            HALKQTE+QK Y+KAREKPID+YL R+EQ  LEMKHRKEEDDLYRKFA  R EEDR+I++
Sbjct  154  HALKQTEIQKAYNKAREKPIDFYLAREEQAHLEMKHRKEEDDLYRKFASKRAEEDRKIQD  213

Query  240  EFRDEWEKELEELSARWEREKGGRARAQ--------QFQQEKEDLEKNMTLRRDKKKESL  291
            EF+DEWE+EL+ L+ ++E+E     R++        + +Q+KEDLEKNMTLRR KKKES+
Sbjct  214  EFQDEWERELQRLTHKFEKELATSRRSRDEANILTMRHEQQKEDLEKNMTLRRSKKKESI  273

Query  292  TRKMLEHERAATAALVEKQSSEMLELINEARSEYMRQESLYLDEGDGYAQEAPPLPYPSR  351
            TRKMLEHER  TAALV++QSSEMLELI+  RSEYM+ ES++LD  D +++ A P+ YP  
Sbjct  274  TRKMLEHERYETAALVDRQSSEMLELISARRSEYMQSESIFLD--DEFSEGAVPVEYPLN  331

Query  352  APPPQPPALAKYHIYNDPLEFADMDQIAISVAQEDQKTFTDLVRQLVSRCGSDIEKARTI  411
            AP P PPA++K+ IY DP+EF D+D+IAISVAQEDQKTFTDLVRQLV RC +DIEKARTI
Sbjct  332  APIPAPPAVSKFQIYTDPIEFEDVDRIAISVAQEDQKTFTDLVRQLVGRCTTDIEKARTI  391

Query  412  FRWITVKNLNTMQFDENLRGDTPMGLLRGIKHGTESYHVLFKRLCSYAGLHCVVIKGYSK  471
            FRWITVKNLN M FD++LRGDTPMGLLRGIK+GTESYHVLFKRLCSYAGLHCVVIKGYSK
Sbjct  392  FRWITVKNLNAMHFDDDLRGDTPMGLLRGIKYGTESYHVLFKRLCSYAGLHCVVIKGYSK  451

Query  472  SAGYQPGVCFEDNRFRNSWNAVYVAGAWRFVQCNWGARHLVNAKEVPRPGQPKAKNDSLR  531
            SAGYQPGV F+D+RFRNSWNAVYVAGAWRFVQCNWGARHLVNAKE P+ G  + KNDSLR
Sbjct  452  SAGYQPGVKFQDSRFRNSWNAVYVAGAWRFVQCNWGARHLVNAKEAPKQG--RGKNDSLR  509

Query  532  YEYDDHYFLTDPREFIYEFFPLQEEWQLLKQPISLKDFEELPFVRSLFFRYGLYFPDTNT  591
            YEYDDHYFLTDPREFIYEF+PLQEEWQLLK+PI+L++FE LPFVRSLFFRYGL+F D   
Sbjct  510  YEYDDHYFLTDPREFIYEFYPLQEEWQLLKRPITLREFENLPFVRSLFFRYGLHFADEGY  569

Query  592  NAVMYTDSTGAATVRIAMPAHMQSSLIFHYNLKFYDNDGD-GYDGVSLKRFVMQSVVGNI  650
             AV++TD TGAATVRIAMP  MQS LIFHYNLKFYD+D +  YDGVSLKRFVMQSV+GNI
Sbjct  570  GAVVFTDDTGAATVRIAMPTDMQSCLIFHYNLKFYDSDEELSYDGVSLKRFVMQSVIGNI  629

Query  651  VAFRVHAPCSGAFLLDIFANAVTPKEYLTGEPMKFKSVCKFKIACEELQTVMVPLPDCAS  710
            VAFRVHAPCSGAFLLDIFANAVTP+EYLTGEPMKFKSVCKFKI CEELQTVMVPLPDCAS
Sbjct  630  VAFRVHAPCSGAFLLDIFANAVTPQEYLTGEPMKFKSVCKFKICCEELQTVMVPLPDCAS  689

Query  711  GEWGPTKATRLFGLIPITHQEALVFAGRELEIQFRMSRPLTDFMATLHKNGIEEKRLSKY  770
            GEWGPTKATRLFGLIPITHQ+ L+FAGR L++QFRMSRPLTDFMATLHKNGIEEK+L+KY
Sbjct  690  GEWGPTKATRLFGLIPITHQDPLIFAGRSLDLQFRMSRPLTDFMATLHKNGIEEKKLAKY  749

Query  771  VTHSIADDDVVTFSISFPEEGQYGLDIYTRESTSP-------TNVPHDITGEKHLLTHCC  823
            VTHS   DD+VTF I+FPEEGQYGLDIYTRE   P        N     +GEKHLLTHCC
Sbjct  750  VTHSTL-DDIVTFIINFPEEGQYGLDIYTRELGGPQHHHHHNNNNSSSSSGEKHLLTHCC  808

Query  824  KYLINSSKRN  833
            KYLINSSKRN
Sbjct  809  KYLINSSKRN  818


>G5EF51_CAEEL unnamed protein product
Length=723

 Score = 768 bits (1982),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/823 (50%), Positives = 531/823 (65%), Gaps = 113/823 (14%)

Query  11   CLRCAQTVYQVDRVGPLKDFTFFHAGCFKCAICGTKLTLKTYYNNQHTINDKEVYCSSHV  70
            C RC + VY  D+VGPLKD TFFH GCFKC ICGT+L LKTY NN++ INDKEVYCS+H 
Sbjct  7    CNRCGKQVYPTDKVGPLKDSTFFHQGCFKCYICGTRLALKTYCNNRNDINDKEVYCSNH-  65

Query  71   PKPGPGTLDGSSVGIRSALNVPRSGYVNEQIRAGGASPRGVYPPCYDNVDSPNCARHLNG  130
                                VP +G                                   
Sbjct  66   --------------------VPIAG----------------------------------P  71

Query  131  HGSPPA-TNSSQRDLHGNAGGGTSSPYNHNYSGDGSYQYGRFDA--SALHIAHALKQTEL  187
            H  P A TN S ++L            N+N+  +G++     DA  S + IAHA+K T++
Sbjct  72   HDLPMASTNGSGKNLE-----------NNNHVKNGNW----IDAGLSDMKIAHAMKATQV  116

Query  188  QKGYSKAREKPIDYYLDRDEQTRLEMKHRKEEDDLYRKFAHHREEEDRRIREEFRDEWEK  247
             + Y K   +   Y +D D QTRLE+ HRK+EDDLY  F   R  E     +E  +EWEK
Sbjct  117  ARPYPKISHEGAKYVVDYDTQTRLELLHRKDEDDLYESFQDKRVREAEEFEKENTEEWEK  176

Query  248  ELEELSARWEREKGGRARAQQFQQEKEDLEKNMTLRRDKKKESLTRKMLEHERAATAALV  307
             L E + ++E+         Q   +K+DL + +T++R+KK E+L  K  E ER  TA LV
Sbjct  177  ALAEFAKKYEK--------GQSNMKKDDLIRQLTIKREKKLETLHTKRKERERHQTAELV  228

Query  308  EKQSSEMLELINEARSEYMRQESLYLDEGDGYAQEAPPLPYPSRAPPPQPPALAKYHIYN  367
            ++Q+ EMLEL   +RSEY                    L YPS  PPP PP+ +K  IY 
Sbjct  229  DRQAKEMLELFKASRSEY------------------SNLQYPSTPPPPVPPSCSKREIYT  270

Query  368  DPLEFADMDQIAISVAQEDQKTFTDLVRQLVSRCGSDIEKARTIFRWITVKNLNTMQFDE  427
                F+ +D++AI  A+ +  +FTDL+R L S   SD++ AR I+RWIT+KNLNTM FD+
Sbjct  271  TTDYFSSIDEVAIHCARNEVASFTDLIRTLSSGARSDVDVARAIYRWITIKNLNTMIFDD  330

Query  428  NLRGDTPMGLLRGIKHGTESYHVLFKRLCSYAGLHCVVIKGYSKSAGYQPGVCFEDNRFR  487
            +++ DTPMGLLRGIK+GTESYHVLFKRLCSYAGLHCVVIKG+SKSAGYQPG  F+D+RFR
Sbjct  331  SIQNDTPMGLLRGIKYGTESYHVLFKRLCSYAGLHCVVIKGFSKSAGYQPGYSFDDHRFR  390

Query  488  NSWNAVYVAGAWRFVQCNWGARHLVNAKEVPRPGQPKAKND-SLRYEYDDHYFLTDPREF  546
            N+WNAV++ G+WRFVQCNWGARHLVNAK+    G  +AK D +LRYEYDDHYF+TD  EF
Sbjct  391  NTWNAVFLDGSWRFVQCNWGARHLVNAKD----GSHEAKTDGNLRYEYDDHYFMTDSEEF  446

Query  547  IYEFFPLQEEWQLLKQPISLKDFEELPFVRSLFFRYGLYFPDTNTNAVMYTDSTGAATVR  606
            IYEFFP    WQLL +P+SL  FE +PFVRSLFF+Y L F D    + +YTD +GAA++ 
Sbjct  447  IYEFFPSDHAWQLLPRPLSLLQFERIPFVRSLFFKYNLSFIDNKLESTVYTDKSGAASIS  506

Query  607  IAMPAHMQSSLIFHYNLKFYDNDGDGYDGVSLKRFVMQSVVGNIVAFRVHAPCSGAFLLD  666
            I +P     SLIFHYNLKF+D++ +   G+SLKRFVMQSV  ++V FRVHAP +   LLD
Sbjct  507  IRLPPK-GDSLIFHYNLKFFDSEENTISGMSLKRFVMQSVTEDVVTFRVHAPSTRPLLLD  565

Query  667  IFANAVTPKEYLTGEPMKFKSVCKFKIACEELQTVMVPLPDCASGEWGPTKATRLFGLIP  726
            IFAN+V+   YLTG+P+KFKSVCKFK+ CE LQ +MVPLP+CASGEWGP KATRLFGL+P
Sbjct  566  IFANSVSSGAYLTGQPIKFKSVCKFKVVCESLQVIMVPLPECASGEWGPAKATRLFGLLP  625

Query  727  ITHQEALVFAGRELEIQFRMSRPLTDFMATLHKNGIEEKRLSKYVTHSIADDDVVTFSIS  786
            I+H +A++  GR +EI+FRM+RPL++F+A+LH+N  +++ L +  T S    D+V   I 
Sbjct  626  ISHPDAIINTGRYVEIRFRMTRPLSEFVASLHRNRTDDRAL-QACTRSALKGDMVYIQIE  684

Query  787  FPEEGQYGLDIYTRESTSPTNVPHDITGEKHLLTHCCKYLINS  829
            FP EGQYGLDIYTR+     N        K LLTHCCKYLI+S
Sbjct  685  FPGEGQYGLDIYTRQDDQLIN-------GKQLLTHCCKYLIHS  720


>LIMD_DICDI unnamed protein product
Length=198

 Score = 64.3 bits (155),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 38/105 (36%), Positives = 52/105 (50%), Gaps = 13/105 (12%)

Query  11   CLRCAQTVYQVDRVGPLKDFTFFHAGCFKCAICGTKLTLKTYYNNQHTINDKEVYCSSHV  70
            C RC +TVY  +    +K    FH  CFKC +C  +L L  Y     +IN K VYC++H 
Sbjct  7    CTRCQKTVYSQEGFIAVK--VPFHRSCFKCEVCNWQLVLTNY----KSINGK-VYCANHY  59

Query  71   P------KPGPGTLDGSSVGIRSALNVPRSGYVNEQIRAGGASPR  109
            P       P         + +++ALN PR   VNEQ+R G   P+
Sbjct  60   PVGGLSVTPEKTHTTSDDLVMKNALNAPRVETVNEQLRGGNEKPQ  104



Lambda      K        H
   0.313    0.128    0.386 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3603051738


Query= XP_050573096.1 hillarin isoform X1 [Bombus affinis]

Length=833
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

HIL_DROME  unnamed protein product                                    1269    0.0  
G5EF51_CAEEL  unnamed protein product                                 768     0.0  
LIMD_DICDI  unnamed protein product                                   64.3    2e-11


>HIL_DROME unnamed protein product
Length=818

 Score = 1269 bits (3284),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 624/850 (73%), Positives = 703/850 (83%), Gaps = 49/850 (6%)

Query  1    MYRPNFYESTCLRCAQTVYQVDRVGPLKDFTFFHAGCFKCAICGTKLTLKTYYNNQHTIN  60
            MYRPNFYESTCLRC++TVYQVDRVGPLKDFTFFH+GCFKC  CGTKLTLKTY+NNQH  +
Sbjct  1    MYRPNFYESTCLRCSETVYQVDRVGPLKDFTFFHSGCFKCVHCGTKLTLKTYFNNQHKQD  60

Query  61   DKEVYCSSHVPKPGPGTLDGSSVGIRSALNVPRSG-YVNEQIRAGGASPRGVYPPCYDNV  119
            DKEVYCSSHVPK GPG LD +SVGIR ALN PR+  +VNEQIR   +   G  P      
Sbjct  61   DKEVYCSSHVPKSGPGHLDQTSVGIRQALNAPRTNKFVNEQIRGTRSEVDGG-PLGGSRQ  119

Query  120  DSPNCARHLNGHGSPPATNSSQRDLHGNAGGGTSSPYNHNYSGDGSYQYGRFDASALHIA  179
             +PN      G+GS   ++ SQ                     D  Y+YGRFDASALHIA
Sbjct  120  STPN------GYGSREISSPSQ--------------------NDSDYKYGRFDASALHIA  153

Query  180  HALKQTELQKGYSKAREKPIDYYLDRDEQTRLEMKHRKEEDDLYRKFAHHREEEDRRIRE  239
            HALKQTE+QK Y+KAREKPID+YL R+EQ  LEMKHRKEEDDLYRKFA  R EEDR+I++
Sbjct  154  HALKQTEIQKAYNKAREKPIDFYLAREEQAHLEMKHRKEEDDLYRKFASKRAEEDRKIQD  213

Query  240  EFRDEWEKELEELSARWEREKGGRARAQ--------QFQQEKEDLEKNMTLRRDKKKESL  291
            EF+DEWE+EL+ L+ ++E+E     R++        + +Q+KEDLEKNMTLRR KKKES+
Sbjct  214  EFQDEWERELQRLTHKFEKELATSRRSRDEANILTMRHEQQKEDLEKNMTLRRSKKKESI  273

Query  292  TRKMLEHERAATAALVEKQSSEMLELINEARSEYMRQESLYLDEGDGYAQEAPPLPYPSR  351
            TRKMLEHER  TAALV++QSSEMLELI+  RSEYM+ ES++LD  D +++ A P+ YP  
Sbjct  274  TRKMLEHERYETAALVDRQSSEMLELISARRSEYMQSESIFLD--DEFSEGAVPVEYPLN  331

Query  352  APPPQPPALAKYHIYNDPLEFADMDQIAISVAQEDQKTFTDLVRQLVSRCGSDIEKARTI  411
            AP P PPA++K+ IY DP+EF D+D+IAISVAQEDQKTFTDLVRQLV RC +DIEKARTI
Sbjct  332  APIPAPPAVSKFQIYTDPIEFEDVDRIAISVAQEDQKTFTDLVRQLVGRCTTDIEKARTI  391

Query  412  FRWITVKNLNTMQFDENLRGDTPMGLLRGIKHGTESYHVLFKRLCSYAGLHCVVIKGYSK  471
            FRWITVKNLN M FD++LRGDTPMGLLRGIK+GTESYHVLFKRLCSYAGLHCVVIKGYSK
Sbjct  392  FRWITVKNLNAMHFDDDLRGDTPMGLLRGIKYGTESYHVLFKRLCSYAGLHCVVIKGYSK  451

Query  472  SAGYQPGVCFEDNRFRNSWNAVYVAGAWRFVQCNWGARHLVNAKEVPRPGQPKAKNDSLR  531
            SAGYQPGV F+D+RFRNSWNAVYVAGAWRFVQCNWGARHLVNAKE P+ G  + KNDSLR
Sbjct  452  SAGYQPGVKFQDSRFRNSWNAVYVAGAWRFVQCNWGARHLVNAKEAPKQG--RGKNDSLR  509

Query  532  YEYDDHYFLTDPREFIYEFFPLQEEWQLLKQPISLKDFEELPFVRSLFFRYGLYFPDTNT  591
            YEYDDHYFLTDPREFIYEF+PLQEEWQLLK+PI+L++FE LPFVRSLFFRYGL+F D   
Sbjct  510  YEYDDHYFLTDPREFIYEFYPLQEEWQLLKRPITLREFENLPFVRSLFFRYGLHFADEGY  569

Query  592  NAVMYTDSTGAATVRIAMPAHMQSSLIFHYNLKFYDNDGD-GYDGVSLKRFVMQSVVGNI  650
             AV++TD TGAATVRIAMP  MQS LIFHYNLKFYD+D +  YDGVSLKRFVMQSV+GNI
Sbjct  570  GAVVFTDDTGAATVRIAMPTDMQSCLIFHYNLKFYDSDEELSYDGVSLKRFVMQSVIGNI  629

Query  651  VAFRVHAPCSGAFLLDIFANAVTPKEYLTGEPMKFKSVCKFKIACEELQTVMVPLPDCAS  710
            VAFRVHAPCSGAFLLDIFANAVTP+EYLTGEPMKFKSVCKFKI CEELQTVMVPLPDCAS
Sbjct  630  VAFRVHAPCSGAFLLDIFANAVTPQEYLTGEPMKFKSVCKFKICCEELQTVMVPLPDCAS  689

Query  711  GEWGPTKATRLFGLIPITHQEALVFAGRELEIQFRMSRPLTDFMATLHKNGIEEKRLSKY  770
            GEWGPTKATRLFGLIPITHQ+ L+FAGR L++QFRMSRPLTDFMATLHKNGIEEK+L+KY
Sbjct  690  GEWGPTKATRLFGLIPITHQDPLIFAGRSLDLQFRMSRPLTDFMATLHKNGIEEKKLAKY  749

Query  771  VTHSIADDDVVTFSISFPEEGQYGLDIYTRESTSP-------TNVPHDITGEKHLLTHCC  823
            VTHS   DD+VTF I+FPEEGQYGLDIYTRE   P        N     +GEKHLLTHCC
Sbjct  750  VTHSTL-DDIVTFIINFPEEGQYGLDIYTRELGGPQHHHHHNNNNSSSSSGEKHLLTHCC  808

Query  824  KYLINSSKRN  833
            KYLINSSKRN
Sbjct  809  KYLINSSKRN  818


>G5EF51_CAEEL unnamed protein product
Length=723

 Score = 768 bits (1982),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/823 (50%), Positives = 531/823 (65%), Gaps = 113/823 (14%)

Query  11   CLRCAQTVYQVDRVGPLKDFTFFHAGCFKCAICGTKLTLKTYYNNQHTINDKEVYCSSHV  70
            C RC + VY  D+VGPLKD TFFH GCFKC ICGT+L LKTY NN++ INDKEVYCS+H 
Sbjct  7    CNRCGKQVYPTDKVGPLKDSTFFHQGCFKCYICGTRLALKTYCNNRNDINDKEVYCSNH-  65

Query  71   PKPGPGTLDGSSVGIRSALNVPRSGYVNEQIRAGGASPRGVYPPCYDNVDSPNCARHLNG  130
                                VP +G                                   
Sbjct  66   --------------------VPIAG----------------------------------P  71

Query  131  HGSPPA-TNSSQRDLHGNAGGGTSSPYNHNYSGDGSYQYGRFDA--SALHIAHALKQTEL  187
            H  P A TN S ++L            N+N+  +G++     DA  S + IAHA+K T++
Sbjct  72   HDLPMASTNGSGKNLE-----------NNNHVKNGNW----IDAGLSDMKIAHAMKATQV  116

Query  188  QKGYSKAREKPIDYYLDRDEQTRLEMKHRKEEDDLYRKFAHHREEEDRRIREEFRDEWEK  247
             + Y K   +   Y +D D QTRLE+ HRK+EDDLY  F   R  E     +E  +EWEK
Sbjct  117  ARPYPKISHEGAKYVVDYDTQTRLELLHRKDEDDLYESFQDKRVREAEEFEKENTEEWEK  176

Query  248  ELEELSARWEREKGGRARAQQFQQEKEDLEKNMTLRRDKKKESLTRKMLEHERAATAALV  307
             L E + ++E+         Q   +K+DL + +T++R+KK E+L  K  E ER  TA LV
Sbjct  177  ALAEFAKKYEK--------GQSNMKKDDLIRQLTIKREKKLETLHTKRKERERHQTAELV  228

Query  308  EKQSSEMLELINEARSEYMRQESLYLDEGDGYAQEAPPLPYPSRAPPPQPPALAKYHIYN  367
            ++Q+ EMLEL   +RSEY                    L YPS  PPP PP+ +K  IY 
Sbjct  229  DRQAKEMLELFKASRSEY------------------SNLQYPSTPPPPVPPSCSKREIYT  270

Query  368  DPLEFADMDQIAISVAQEDQKTFTDLVRQLVSRCGSDIEKARTIFRWITVKNLNTMQFDE  427
                F+ +D++AI  A+ +  +FTDL+R L S   SD++ AR I+RWIT+KNLNTM FD+
Sbjct  271  TTDYFSSIDEVAIHCARNEVASFTDLIRTLSSGARSDVDVARAIYRWITIKNLNTMIFDD  330

Query  428  NLRGDTPMGLLRGIKHGTESYHVLFKRLCSYAGLHCVVIKGYSKSAGYQPGVCFEDNRFR  487
            +++ DTPMGLLRGIK+GTESYHVLFKRLCSYAGLHCVVIKG+SKSAGYQPG  F+D+RFR
Sbjct  331  SIQNDTPMGLLRGIKYGTESYHVLFKRLCSYAGLHCVVIKGFSKSAGYQPGYSFDDHRFR  390

Query  488  NSWNAVYVAGAWRFVQCNWGARHLVNAKEVPRPGQPKAKND-SLRYEYDDHYFLTDPREF  546
            N+WNAV++ G+WRFVQCNWGARHLVNAK+    G  +AK D +LRYEYDDHYF+TD  EF
Sbjct  391  NTWNAVFLDGSWRFVQCNWGARHLVNAKD----GSHEAKTDGNLRYEYDDHYFMTDSEEF  446

Query  547  IYEFFPLQEEWQLLKQPISLKDFEELPFVRSLFFRYGLYFPDTNTNAVMYTDSTGAATVR  606
            IYEFFP    WQLL +P+SL  FE +PFVRSLFF+Y L F D    + +YTD +GAA++ 
Sbjct  447  IYEFFPSDHAWQLLPRPLSLLQFERIPFVRSLFFKYNLSFIDNKLESTVYTDKSGAASIS  506

Query  607  IAMPAHMQSSLIFHYNLKFYDNDGDGYDGVSLKRFVMQSVVGNIVAFRVHAPCSGAFLLD  666
            I +P     SLIFHYNLKF+D++ +   G+SLKRFVMQSV  ++V FRVHAP +   LLD
Sbjct  507  IRLPPK-GDSLIFHYNLKFFDSEENTISGMSLKRFVMQSVTEDVVTFRVHAPSTRPLLLD  565

Query  667  IFANAVTPKEYLTGEPMKFKSVCKFKIACEELQTVMVPLPDCASGEWGPTKATRLFGLIP  726
            IFAN+V+   YLTG+P+KFKSVCKFK+ CE LQ +MVPLP+CASGEWGP KATRLFGL+P
Sbjct  566  IFANSVSSGAYLTGQPIKFKSVCKFKVVCESLQVIMVPLPECASGEWGPAKATRLFGLLP  625

Query  727  ITHQEALVFAGRELEIQFRMSRPLTDFMATLHKNGIEEKRLSKYVTHSIADDDVVTFSIS  786
            I+H +A++  GR +EI+FRM+RPL++F+A+LH+N  +++ L +  T S    D+V   I 
Sbjct  626  ISHPDAIINTGRYVEIRFRMTRPLSEFVASLHRNRTDDRAL-QACTRSALKGDMVYIQIE  684

Query  787  FPEEGQYGLDIYTRESTSPTNVPHDITGEKHLLTHCCKYLINS  829
            FP EGQYGLDIYTR+     N        K LLTHCCKYLI+S
Sbjct  685  FPGEGQYGLDIYTRQDDQLIN-------GKQLLTHCCKYLIHS  720


>LIMD_DICDI unnamed protein product
Length=198

 Score = 64.3 bits (155),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 38/105 (36%), Positives = 52/105 (50%), Gaps = 13/105 (12%)

Query  11   CLRCAQTVYQVDRVGPLKDFTFFHAGCFKCAICGTKLTLKTYYNNQHTINDKEVYCSSHV  70
            C RC +TVY  +    +K    FH  CFKC +C  +L L  Y     +IN K VYC++H 
Sbjct  7    CTRCQKTVYSQEGFIAVK--VPFHRSCFKCEVCNWQLVLTNY----KSINGK-VYCANHY  59

Query  71   P------KPGPGTLDGSSVGIRSALNVPRSGYVNEQIRAGGASPR  109
            P       P         + +++ALN PR   VNEQ+R G   P+
Sbjct  60   PVGGLSVTPEKTHTTSDDLVMKNALNAPRVETVNEQLRGGNEKPQ  104



Lambda      K        H
   0.313    0.128    0.386 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3603051738


Query= XP_050573097.1 hillarin isoform X2 [Bombus affinis]

Length=822
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

HIL_DROME  unnamed protein product                                    1273    0.0  
G5EF51_CAEEL  unnamed protein product                                 780     0.0  
LIMD_DICDI  unnamed protein product                                   64.7    2e-11


>HIL_DROME unnamed protein product
Length=818

 Score = 1273 bits (3294),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 623/839 (74%), Positives = 700/839 (83%), Gaps = 38/839 (5%)

Query  1    MYRPNFYESTCLRCAQTVYQVDRVGPLKDFTFFHAGCFKCAICGTKLTLKTYYNNQHTIN  60
            MYRPNFYESTCLRC++TVYQVDRVGPLKDFTFFH+GCFKC  CGTKLTLKTY+NNQH  +
Sbjct  1    MYRPNFYESTCLRCSETVYQVDRVGPLKDFTFFHSGCFKCVHCGTKLTLKTYFNNQHKQD  60

Query  61   DKEVYCSSHVPKPGPGTLDGSSVGIRSALNVPRSG-YVNEQIRAGGASPRGVYPPWHLNG  119
            DKEVYCSSHVPK GPG LD +SVGIR ALN PR+  +VNEQIR   +   G         
Sbjct  61   DKEVYCSSHVPKSGPGHLDQTSVGIRQALNAPRTNKFVNEQIRGTRSEVDG---------  111

Query  120  HGSPPATNSSQRDLHGNAGGGTSSPYNHNYSGDGSYQYGRFDASALHIAHALKQTELQKG  179
                P   S Q   +G      SSP  +    D  Y+YGRFDASALHIAHALKQTE+QK 
Sbjct  112  ---GPLGGSRQSTPNGYGSREISSPSQN----DSDYKYGRFDASALHIAHALKQTEIQKA  164

Query  180  YSKAREKPIDYYLDRDEQTRLEMKHRKEEDDLYRKFAHHREEEDRRIREEFRDEWEKELE  239
            Y+KAREKPID+YL R+EQ  LEMKHRKEEDDLYRKFA  R EEDR+I++EF+DEWE+EL+
Sbjct  165  YNKAREKPIDFYLAREEQAHLEMKHRKEEDDLYRKFASKRAEEDRKIQDEFQDEWERELQ  224

Query  240  ELSARWEREKGGRARAQ--------QFQQEKEDLEKNMTLRRDKKKESLTRKMLEHERAA  291
             L+ ++E+E     R++        + +Q+KEDLEKNMTLRR KKKES+TRKMLEHER  
Sbjct  225  RLTHKFEKELATSRRSRDEANILTMRHEQQKEDLEKNMTLRRSKKKESITRKMLEHERYE  284

Query  292  TAALVEKQSSEMLELINEARSEYMRQESLYLDEGDGYAQEAPPLPYPSRAPPPQPPALAK  351
            TAALV++QSSEMLELI+  RSEYM+ ES++LD  D +++ A P+ YP  AP P PPA++K
Sbjct  285  TAALVDRQSSEMLELISARRSEYMQSESIFLD--DEFSEGAVPVEYPLNAPIPAPPAVSK  342

Query  352  YHIYNDPLEFADMDQIAISVAQEDQKTFTDLVRQLVSRCGSDIEKARTIFRWITVKNLNT  411
            + IY DP+EF D+D+IAISVAQEDQKTFTDLVRQLV RC +DIEKARTIFRWITVKNLN 
Sbjct  343  FQIYTDPIEFEDVDRIAISVAQEDQKTFTDLVRQLVGRCTTDIEKARTIFRWITVKNLNA  402

Query  412  MQFDENLRGDTPMGLLRGIKHGTESYHVLFKRLCSYAGLHCVVIKGYSKSAGYQPGVCFE  471
            M FD++LRGDTPMGLLRGIK+GTESYHVLFKRLCSYAGLHCVVIKGYSKSAGYQPGV F+
Sbjct  403  MHFDDDLRGDTPMGLLRGIKYGTESYHVLFKRLCSYAGLHCVVIKGYSKSAGYQPGVKFQ  462

Query  472  DNRFRNSWNAVYVAGAWRFVQCNWGARHLVNAKEVPRPGQPKAKNDSLRYEYDDHYFLTD  531
            D+RFRNSWNAVYVAGAWRFVQCNWGARHLVNAKE P+ G  + KNDSLRYEYDDHYFLTD
Sbjct  463  DSRFRNSWNAVYVAGAWRFVQCNWGARHLVNAKEAPKQG--RGKNDSLRYEYDDHYFLTD  520

Query  532  PREFIYEFFPLQEEWQLLKQPISLKDFEELPFVRSLFFRYGLYFPDTNTNAVMYTDSTGA  591
            PREFIYEF+PLQEEWQLLK+PI+L++FE LPFVRSLFFRYGL+F D    AV++TD TGA
Sbjct  521  PREFIYEFYPLQEEWQLLKRPITLREFENLPFVRSLFFRYGLHFADEGYGAVVFTDDTGA  580

Query  592  ATVRIAMPAHMQSSLIFHYNLKFYDNDGD-GYDGVSLKRFVMQSVVGNIVAFRVHAPCSG  650
            ATVRIAMP  MQS LIFHYNLKFYD+D +  YDGVSLKRFVMQSV+GNIVAFRVHAPCSG
Sbjct  581  ATVRIAMPTDMQSCLIFHYNLKFYDSDEELSYDGVSLKRFVMQSVIGNIVAFRVHAPCSG  640

Query  651  AFLLDIFANAVTPKEYLTGEPMKFKSVCKFKIACEELQTVMVPLPDCASGEWGPTKATRL  710
            AFLLDIFANAVTP+EYLTGEPMKFKSVCKFKI CEELQTVMVPLPDCASGEWGPTKATRL
Sbjct  641  AFLLDIFANAVTPQEYLTGEPMKFKSVCKFKICCEELQTVMVPLPDCASGEWGPTKATRL  700

Query  711  FGLIPITHQEALVFAGRELEIQFRMSRPLTDFMATLHKNGIEEKRLSKYVTHSIADDDVV  770
            FGLIPITHQ+ L+FAGR L++QFRMSRPLTDFMATLHKNGIEEK+L+KYVTHS   DD+V
Sbjct  701  FGLIPITHQDPLIFAGRSLDLQFRMSRPLTDFMATLHKNGIEEKKLAKYVTHSTL-DDIV  759

Query  771  TFSISFPEEGQYGLDIYTRESTSP-------TNVPHDITGEKHLLTHCCKYLINSSKRN  822
            TF I+FPEEGQYGLDIYTRE   P        N     +GEKHLLTHCCKYLINSSKRN
Sbjct  760  TFIINFPEEGQYGLDIYTRELGGPQHHHHHNNNNSSSSSGEKHLLTHCCKYLINSSKRN  818


>G5EF51_CAEEL unnamed protein product
Length=723

 Score = 780 bits (2013),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/811 (51%), Positives = 531/811 (65%), Gaps = 100/811 (12%)

Query  11   CLRCAQTVYQVDRVGPLKDFTFFHAGCFKCAICGTKLTLKTYYNNQHTINDKEVYCSSHV  70
            C RC + VY  D+VGPLKD TFFH GCFKC ICGT+L LKTY NN++ INDKEVYCS+HV
Sbjct  7    CNRCGKQVYPTDKVGPLKDSTFFHQGCFKCYICGTRLALKTYCNNRNDINDKEVYCSNHV  66

Query  71   PKPGPGTLDGSSVGIRSALNVPRSGYVNEQIRAGGASPRGVYPPWHLNGHGSPPATNSSQ  130
            P  GP  L  +S                                           TN S 
Sbjct  67   PIAGPHDLPMAS-------------------------------------------TNGSG  83

Query  131  RDLHGNAGGGTSSPYNHNYSGDGSYQYGRFDA--SALHIAHALKQTELQKGYSKAREKPI  188
            ++L            N+N+  +G++     DA  S + IAHA+K T++ + Y K   +  
Sbjct  84   KNLE-----------NNNHVKNGNW----IDAGLSDMKIAHAMKATQVARPYPKISHEGA  128

Query  189  DYYLDRDEQTRLEMKHRKEEDDLYRKFAHHREEEDRRIREEFRDEWEKELEELSARWERE  248
             Y +D D QTRLE+ HRK+EDDLY  F   R  E     +E  +EWEK L E + ++E+ 
Sbjct  129  KYVVDYDTQTRLELLHRKDEDDLYESFQDKRVREAEEFEKENTEEWEKALAEFAKKYEK-  187

Query  249  KGGRARAQQFQQEKEDLEKNMTLRRDKKKESLTRKMLEHERAATAALVEKQSSEMLELIN  308
                    Q   +K+DL + +T++R+KK E+L  K  E ER  TA LV++Q+ EMLEL  
Sbjct  188  -------GQSNMKKDDLIRQLTIKREKKLETLHTKRKERERHQTAELVDRQAKEMLELFK  240

Query  309  EARSEYMRQESLYLDEGDGYAQEAPPLPYPSRAPPPQPPALAKYHIYNDPLEFADMDQIA  368
             +RSEY                    L YPS  PPP PP+ +K  IY     F+ +D++A
Sbjct  241  ASRSEY------------------SNLQYPSTPPPPVPPSCSKREIYTTTDYFSSIDEVA  282

Query  369  ISVAQEDQKTFTDLVRQLVSRCGSDIEKARTIFRWITVKNLNTMQFDENLRGDTPMGLLR  428
            I  A+ +  +FTDL+R L S   SD++ AR I+RWIT+KNLNTM FD++++ DTPMGLLR
Sbjct  283  IHCARNEVASFTDLIRTLSSGARSDVDVARAIYRWITIKNLNTMIFDDSIQNDTPMGLLR  342

Query  429  GIKHGTESYHVLFKRLCSYAGLHCVVIKGYSKSAGYQPGVCFEDNRFRNSWNAVYVAGAW  488
            GIK+GTESYHVLFKRLCSYAGLHCVVIKG+SKSAGYQPG  F+D+RFRN+WNAV++ G+W
Sbjct  343  GIKYGTESYHVLFKRLCSYAGLHCVVIKGFSKSAGYQPGYSFDDHRFRNTWNAVFLDGSW  402

Query  489  RFVQCNWGARHLVNAKEVPRPGQPKAKND-SLRYEYDDHYFLTDPREFIYEFFPLQEEWQ  547
            RFVQCNWGARHLVNAK+    G  +AK D +LRYEYDDHYF+TD  EFIYEFFP    WQ
Sbjct  403  RFVQCNWGARHLVNAKD----GSHEAKTDGNLRYEYDDHYFMTDSEEFIYEFFPSDHAWQ  458

Query  548  LLKQPISLKDFEELPFVRSLFFRYGLYFPDTNTNAVMYTDSTGAATVRIAMPAHMQSSLI  607
            LL +P+SL  FE +PFVRSLFF+Y L F D    + +YTD +GAA++ I +P     SLI
Sbjct  459  LLPRPLSLLQFERIPFVRSLFFKYNLSFIDNKLESTVYTDKSGAASISIRLPPK-GDSLI  517

Query  608  FHYNLKFYDNDGDGYDGVSLKRFVMQSVVGNIVAFRVHAPCSGAFLLDIFANAVTPKEYL  667
            FHYNLKF+D++ +   G+SLKRFVMQSV  ++V FRVHAP +   LLDIFAN+V+   YL
Sbjct  518  FHYNLKFFDSEENTISGMSLKRFVMQSVTEDVVTFRVHAPSTRPLLLDIFANSVSSGAYL  577

Query  668  TGEPMKFKSVCKFKIACEELQTVMVPLPDCASGEWGPTKATRLFGLIPITHQEALVFAGR  727
            TG+P+KFKSVCKFK+ CE LQ +MVPLP+CASGEWGP KATRLFGL+PI+H +A++  GR
Sbjct  578  TGQPIKFKSVCKFKVVCESLQVIMVPLPECASGEWGPAKATRLFGLLPISHPDAIINTGR  637

Query  728  ELEIQFRMSRPLTDFMATLHKNGIEEKRLSKYVTHSIADDDVVTFSISFPEEGQYGLDIY  787
             +EI+FRM+RPL++F+A+LH+N  +++ L +  T S    D+V   I FP EGQYGLDIY
Sbjct  638  YVEIRFRMTRPLSEFVASLHRNRTDDRAL-QACTRSALKGDMVYIQIEFPGEGQYGLDIY  696

Query  788  TRESTSPTNVPHDITGEKHLLTHCCKYLINS  818
            TR+     N        K LLTHCCKYLI+S
Sbjct  697  TRQDDQLIN-------GKQLLTHCCKYLIHS  720


>LIMD_DICDI unnamed protein product
Length=198

 Score = 64.7 bits (156),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 38/105 (36%), Positives = 52/105 (50%), Gaps = 13/105 (12%)

Query  11   CLRCAQTVYQVDRVGPLKDFTFFHAGCFKCAICGTKLTLKTYYNNQHTINDKEVYCSSHV  70
            C RC +TVY  +    +K    FH  CFKC +C  +L L  Y     +IN K VYC++H 
Sbjct  7    CTRCQKTVYSQEGFIAVK--VPFHRSCFKCEVCNWQLVLTNY----KSINGK-VYCANHY  59

Query  71   P------KPGPGTLDGSSVGIRSALNVPRSGYVNEQIRAGGASPR  109
            P       P         + +++ALN PR   VNEQ+R G   P+
Sbjct  60   PVGGLSVTPEKTHTTSDDLVMKNALNAPRVETVNEQLRGGNEKPQ  104



Lambda      K        H
   0.313    0.128    0.386 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3603051738


Query= XP_050573098.1 hillarin isoform X3 [Bombus affinis]

Length=728
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

HIL_DROME  unnamed protein product                                    1102    0.0  
G5EF51_CAEEL  unnamed protein product                                 700     0.0  
RBP2A_PLAF7  unnamed protein product                                  48.1    3e-05


>HIL_DROME unnamed protein product
Length=818

 Score = 1102 bits (2851),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 538/715 (75%), Positives = 606/715 (85%), Gaps = 25/715 (3%)

Query  30   PATNSSQRDLHGNAGGGTSSPYNHNYSGDGSYQYGRFDASALHIAHALKQTELQKGYSKA  89
            P   S Q   +G      SSP  +    D  Y+YGRFDASALHIAHALKQTE+QK Y+KA
Sbjct  113  PLGGSRQSTPNGYGSREISSPSQN----DSDYKYGRFDASALHIAHALKQTEIQKAYNKA  168

Query  90   REKPIDYYLDRDEQTRLEMKHRKEEDDLYRKFAHHREEEDRRIREEFRDEWEKELEELSA  149
            REKPID+YL R+EQ  LEMKHRKEEDDLYRKFA  R EEDR+I++EF+DEWE+EL+ L+ 
Sbjct  169  REKPIDFYLAREEQAHLEMKHRKEEDDLYRKFASKRAEEDRKIQDEFQDEWERELQRLTH  228

Query  150  RWEREKGGRARAQ--------QFQQEKEDLEKNMTLRRDKKKESLTRKMLEHERAATAAL  201
            ++E+E     R++        + +Q+KEDLEKNMTLRR KKKES+TRKMLEHER  TAAL
Sbjct  229  KFEKELATSRRSRDEANILTMRHEQQKEDLEKNMTLRRSKKKESITRKMLEHERYETAAL  288

Query  202  VEKQSSEMLELINEARSEYMRQESLYLDEGDGYAQEAPPLPYPSRAPPPQPPALAKYHIY  261
            V++QSSEMLELI+  RSEYM+ ES++LD  D +++ A P+ YP  AP P PPA++K+ IY
Sbjct  289  VDRQSSEMLELISARRSEYMQSESIFLD--DEFSEGAVPVEYPLNAPIPAPPAVSKFQIY  346

Query  262  NDPLEFADMDQIAISVAQEDQKTFTDLVRQLVSRCGSDIEKARTIFRWITVKNLNTMQFD  321
             DP+EF D+D+IAISVAQEDQKTFTDLVRQLV RC +DIEKARTIFRWITVKNLN M FD
Sbjct  347  TDPIEFEDVDRIAISVAQEDQKTFTDLVRQLVGRCTTDIEKARTIFRWITVKNLNAMHFD  406

Query  322  ENLRGDTPMGLLRGIKHGTESYHVLFKRLCSYAGLHCVVIKGYSKSAGYQPGVCFEDNRF  381
            ++LRGDTPMGLLRGIK+GTESYHVLFKRLCSYAGLHCVVIKGYSKSAGYQPGV F+D+RF
Sbjct  407  DDLRGDTPMGLLRGIKYGTESYHVLFKRLCSYAGLHCVVIKGYSKSAGYQPGVKFQDSRF  466

Query  382  RNSWNAVYVAGAWRFVQCNWGARHLVNAKEVPRPGQPKAKNDSLRYEYDDHYFLTDPREF  441
            RNSWNAVYVAGAWRFVQCNWGARHLVNAKE P+ G  + KNDSLRYEYDDHYFLTDPREF
Sbjct  467  RNSWNAVYVAGAWRFVQCNWGARHLVNAKEAPKQG--RGKNDSLRYEYDDHYFLTDPREF  524

Query  442  IYEFFPLQEEWQLLKQPISLKDFEELPFVRSLFFRYGLYFPDTNTNAVMYTDSTGAATVR  501
            IYEF+PLQEEWQLLK+PI+L++FE LPFVRSLFFRYGL+F D    AV++TD TGAATVR
Sbjct  525  IYEFYPLQEEWQLLKRPITLREFENLPFVRSLFFRYGLHFADEGYGAVVFTDDTGAATVR  584

Query  502  IAMPAHMQSSLIFHYNLKFYDNDGD-GYDGVSLKRFVMQSVVGNIVAFRVHAPCSGAFLL  560
            IAMP  MQS LIFHYNLKFYD+D +  YDGVSLKRFVMQSV+GNIVAFRVHAPCSGAFLL
Sbjct  585  IAMPTDMQSCLIFHYNLKFYDSDEELSYDGVSLKRFVMQSVIGNIVAFRVHAPCSGAFLL  644

Query  561  DIFANAVTPKEYLTGEPMKFKSVCKFKIACEELQTVMVPLPDCASGEWGPTKATRLFGLI  620
            DIFANAVTP+EYLTGEPMKFKSVCKFKI CEELQTVMVPLPDCASGEWGPTKATRLFGLI
Sbjct  645  DIFANAVTPQEYLTGEPMKFKSVCKFKICCEELQTVMVPLPDCASGEWGPTKATRLFGLI  704

Query  621  PITHQEALVFAGRELEIQFRMSRPLTDFMATLHKNGIEEKRLSKYVTHSIADDDVVTFSI  680
            PITHQ+ L+FAGR L++QFRMSRPLTDFMATLHKNGIEEK+L+KYVTHS   DD+VTF I
Sbjct  705  PITHQDPLIFAGRSLDLQFRMSRPLTDFMATLHKNGIEEKKLAKYVTHSTL-DDIVTFII  763

Query  681  SFPEEGQYGLDIYTRESTSP-------TNVPHDITGEKHLLTHCCKYLINSSKRN  728
            +FPEEGQYGLDIYTRE   P        N     +GEKHLLTHCCKYLINSSKRN
Sbjct  764  NFPEEGQYGLDIYTRELGGPQHHHHHNNNNSSSSSGEKHLLTHCCKYLINSSKRN  818


>G5EF51_CAEEL unnamed protein product
Length=723

 Score = 700 bits (1806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/713 (52%), Positives = 483/713 (68%), Gaps = 61/713 (9%)

Query  19   CARHL---NGHGSPPA-TNSSQRDLHGNAGGGTSSPYNHNYSGDGSYQYGRFDA--SALH  72
            C+ H+     H  P A TN S ++L            N+N+  +G++     DA  S + 
Sbjct  62   CSNHVPIAGPHDLPMASTNGSGKNLE-----------NNNHVKNGNW----IDAGLSDMK  106

Query  73   IAHALKQTELQKGYSKAREKPIDYYLDRDEQTRLEMKHRKEEDDLYRKFAHHREEEDRRI  132
            IAHA+K T++ + Y K   +   Y +D D QTRLE+ HRK+EDDLY  F   R  E    
Sbjct  107  IAHAMKATQVARPYPKISHEGAKYVVDYDTQTRLELLHRKDEDDLYESFQDKRVREAEEF  166

Query  133  REEFRDEWEKELEELSARWEREKGGRARAQQFQQEKEDLEKNMTLRRDKKKESLTRKMLE  192
             +E  +EWEK L E + ++E+         Q   +K+DL + +T++R+KK E+L  K  E
Sbjct  167  EKENTEEWEKALAEFAKKYEK--------GQSNMKKDDLIRQLTIKREKKLETLHTKRKE  218

Query  193  HERAATAALVEKQSSEMLELINEARSEYMRQESLYLDEGDGYAQEAPPLPYPSRAPPPQP  252
             ER  TA LV++Q+ EMLEL   +RSEY                    L YPS  PPP P
Sbjct  219  RERHQTAELVDRQAKEMLELFKASRSEYSN------------------LQYPSTPPPPVP  260

Query  253  PALAKYHIYNDPLEFADMDQIAISVAQEDQKTFTDLVRQLVSRCGSDIEKARTIFRWITV  312
            P+ +K  IY     F+ +D++AI  A+ +  +FTDL+R L S   SD++ AR I+RWIT+
Sbjct  261  PSCSKREIYTTTDYFSSIDEVAIHCARNEVASFTDLIRTLSSGARSDVDVARAIYRWITI  320

Query  313  KNLNTMQFDENLRGDTPMGLLRGIKHGTESYHVLFKRLCSYAGLHCVVIKGYSKSAGYQP  372
            KNLNTM FD++++ DTPMGLLRGIK+GTESYHVLFKRLCSYAGLHCVVIKG+SKSAGYQP
Sbjct  321  KNLNTMIFDDSIQNDTPMGLLRGIKYGTESYHVLFKRLCSYAGLHCVVIKGFSKSAGYQP  380

Query  373  GVCFEDNRFRNSWNAVYVAGAWRFVQCNWGARHLVNAKEVPRPGQPKAKND-SLRYEYDD  431
            G  F+D+RFRN+WNAV++ G+WRFVQCNWGARHLVNAK+    G  +AK D +LRYEYDD
Sbjct  381  GYSFDDHRFRNTWNAVFLDGSWRFVQCNWGARHLVNAKD----GSHEAKTDGNLRYEYDD  436

Query  432  HYFLTDPREFIYEFFPLQEEWQLLKQPISLKDFEELPFVRSLFFRYGLYFPDTNTNAVMY  491
            HYF+TD  EFIYEFFP    WQLL +P+SL  FE +PFVRSLFF+Y L F D    + +Y
Sbjct  437  HYFMTDSEEFIYEFFPSDHAWQLLPRPLSLLQFERIPFVRSLFFKYNLSFIDNKLESTVY  496

Query  492  TDSTGAATVRIAMPAHMQSSLIFHYNLKFYDNDGDGYDGVSLKRFVMQSVVGNIVAFRVH  551
            TD +GAA++ I +P     SLIFHYNLKF+D++ +   G+SLKRFVMQSV  ++V FRVH
Sbjct  497  TDKSGAASISIRLPPK-GDSLIFHYNLKFFDSEENTISGMSLKRFVMQSVTEDVVTFRVH  555

Query  552  APCSGAFLLDIFANAVTPKEYLTGEPMKFKSVCKFKIACEELQTVMVPLPDCASGEWGPT  611
            AP +   LLDIFAN+V+   YLTG+P+KFKSVCKFK+ CE LQ +MVPLP+CASGEWGP 
Sbjct  556  APSTRPLLLDIFANSVSSGAYLTGQPIKFKSVCKFKVVCESLQVIMVPLPECASGEWGPA  615

Query  612  KATRLFGLIPITHQEALVFAGRELEIQFRMSRPLTDFMATLHKNGIEEKRLSKYVTHSIA  671
            KATRLFGL+PI+H +A++  GR +EI+FRM+RPL++F+A+LH+N  +++ L +  T S  
Sbjct  616  KATRLFGLLPISHPDAIINTGRYVEIRFRMTRPLSEFVASLHRNRTDDRAL-QACTRSAL  674

Query  672  DDDVVTFSISFPEEGQYGLDIYTRESTSPTNVPHDITGEKHLLTHCCKYLINS  724
              D+V   I FP EGQYGLDIYTR+     N        K LLTHCCKYLI+S
Sbjct  675  KGDMVYIQIEFPGEGQYGLDIYTRQDDQLIN-------GKQLLTHCCKYLIHS  720


>RBP2A_PLAF7 unnamed protein product
Length=3130

 Score = 48.1 bits (113),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 43/137 (31%), Positives = 70/137 (51%), Gaps = 13/137 (9%)

Query  76    ALKQTELQKGYSKAREKPIDYYLDRDEQTRLEMKHRKEEDDLYRKFAHHREEEDRRIREE  135
             ALK+ E Q+   K  E      L R EQ RLE   R++++ L ++    R+E++R  +EE
Sbjct  2738  ALKRQE-QERLQKEEE------LKRQEQERLE---REKQEQLQKEEELKRQEQERLQKEE  2787

Query  136   FRDEWEKELEELSARWEREKGGR-ARAQQFQQEKEDLEKNMTLRRDKKKESLTRKMLEHE  194
                  E+E  +     +R++  R  R +Q Q +KE+  K     R +K+E+L R+  E E
Sbjct  2788  ALKRQEQERLQKEEELKRQEQERLEREKQEQLQKEEELKRQEQERLQKEEALKRQ--EQE  2845

Query  195   RAATAALVEKQSSEMLE  211
             R      +++Q  E LE
Sbjct  2846  RLQKEEELKRQEQERLE  2862


 Score = 40.4 bits (93),  Expect = 0.006, Method: Composition-based stats.
 Identities = 34/119 (29%), Positives = 65/119 (55%), Gaps = 19/119 (16%)

Query  78    KQTELQKGYSKAREKPIDYYLDRDEQTRLEMKH---RKEEDDLYRKFAHHREEEDRRIRE  134
             KQ +LQK          +  L R EQ RL+ +    R+E++ L ++    R+E++R  RE
Sbjct  2765  KQEQLQK----------EEELKRQEQERLQKEEALKRQEQERLQKEEELKRQEQERLERE  2814

Query  135   EFRDEWEKELEEL----SARWEREKGGRARAQQFQQEKEDLEKNMTLRRDKKKESLTRK  189
             + +++ +KE EEL      R ++E+  + + Q+  Q++E+L++    R ++KK  L  +
Sbjct  2815  K-QEQLQKE-EELKRQEQERLQKEEALKRQEQERLQKEEELKRQEQERLERKKIELAER  2871


 Score = 37.4 bits (85),  Expect = 0.060, Method: Composition-based stats.
 Identities = 31/102 (30%), Positives = 52/102 (51%), Gaps = 7/102 (7%)

Query  137   RDEWEK-ELEELSARWEREKGGRARAQQFQQEKEDLEKNMTLRRDKKKESLTRKMLEHER  195
             R E E+ + EE   R E+E+  R + +Q Q+E+E   K     R +K+E+L R+  E ER
Sbjct  2741  RQEQERLQKEEELKRQEQERLEREKQEQLQKEEE--LKRQEQERLQKEEALKRQ--EQER  2796

Query  196   AATAALVEKQSSEMLELINEARSEYMRQESLYLDEGDGYAQE  237
                   +++Q  E LE   E + +  ++E L   E +   +E
Sbjct  2797  LQKEEELKRQEQERLE--REKQEQLQKEEELKRQEQERLQKE  2836



Lambda      K        H
   0.313    0.128    0.386 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3603051738


Query= XP_050573099.1 hillarin isoform X3 [Bombus affinis]

Length=728
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

HIL_DROME  unnamed protein product                                    1102    0.0  
G5EF51_CAEEL  unnamed protein product                                 700     0.0  
RBP2A_PLAF7  unnamed protein product                                  48.1    3e-05


>HIL_DROME unnamed protein product
Length=818

 Score = 1102 bits (2851),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 538/715 (75%), Positives = 606/715 (85%), Gaps = 25/715 (3%)

Query  30   PATNSSQRDLHGNAGGGTSSPYNHNYSGDGSYQYGRFDASALHIAHALKQTELQKGYSKA  89
            P   S Q   +G      SSP  +    D  Y+YGRFDASALHIAHALKQTE+QK Y+KA
Sbjct  113  PLGGSRQSTPNGYGSREISSPSQN----DSDYKYGRFDASALHIAHALKQTEIQKAYNKA  168

Query  90   REKPIDYYLDRDEQTRLEMKHRKEEDDLYRKFAHHREEEDRRIREEFRDEWEKELEELSA  149
            REKPID+YL R+EQ  LEMKHRKEEDDLYRKFA  R EEDR+I++EF+DEWE+EL+ L+ 
Sbjct  169  REKPIDFYLAREEQAHLEMKHRKEEDDLYRKFASKRAEEDRKIQDEFQDEWERELQRLTH  228

Query  150  RWEREKGGRARAQ--------QFQQEKEDLEKNMTLRRDKKKESLTRKMLEHERAATAAL  201
            ++E+E     R++        + +Q+KEDLEKNMTLRR KKKES+TRKMLEHER  TAAL
Sbjct  229  KFEKELATSRRSRDEANILTMRHEQQKEDLEKNMTLRRSKKKESITRKMLEHERYETAAL  288

Query  202  VEKQSSEMLELINEARSEYMRQESLYLDEGDGYAQEAPPLPYPSRAPPPQPPALAKYHIY  261
            V++QSSEMLELI+  RSEYM+ ES++LD  D +++ A P+ YP  AP P PPA++K+ IY
Sbjct  289  VDRQSSEMLELISARRSEYMQSESIFLD--DEFSEGAVPVEYPLNAPIPAPPAVSKFQIY  346

Query  262  NDPLEFADMDQIAISVAQEDQKTFTDLVRQLVSRCGSDIEKARTIFRWITVKNLNTMQFD  321
             DP+EF D+D+IAISVAQEDQKTFTDLVRQLV RC +DIEKARTIFRWITVKNLN M FD
Sbjct  347  TDPIEFEDVDRIAISVAQEDQKTFTDLVRQLVGRCTTDIEKARTIFRWITVKNLNAMHFD  406

Query  322  ENLRGDTPMGLLRGIKHGTESYHVLFKRLCSYAGLHCVVIKGYSKSAGYQPGVCFEDNRF  381
            ++LRGDTPMGLLRGIK+GTESYHVLFKRLCSYAGLHCVVIKGYSKSAGYQPGV F+D+RF
Sbjct  407  DDLRGDTPMGLLRGIKYGTESYHVLFKRLCSYAGLHCVVIKGYSKSAGYQPGVKFQDSRF  466

Query  382  RNSWNAVYVAGAWRFVQCNWGARHLVNAKEVPRPGQPKAKNDSLRYEYDDHYFLTDPREF  441
            RNSWNAVYVAGAWRFVQCNWGARHLVNAKE P+ G  + KNDSLRYEYDDHYFLTDPREF
Sbjct  467  RNSWNAVYVAGAWRFVQCNWGARHLVNAKEAPKQG--RGKNDSLRYEYDDHYFLTDPREF  524

Query  442  IYEFFPLQEEWQLLKQPISLKDFEELPFVRSLFFRYGLYFPDTNTNAVMYTDSTGAATVR  501
            IYEF+PLQEEWQLLK+PI+L++FE LPFVRSLFFRYGL+F D    AV++TD TGAATVR
Sbjct  525  IYEFYPLQEEWQLLKRPITLREFENLPFVRSLFFRYGLHFADEGYGAVVFTDDTGAATVR  584

Query  502  IAMPAHMQSSLIFHYNLKFYDNDGD-GYDGVSLKRFVMQSVVGNIVAFRVHAPCSGAFLL  560
            IAMP  MQS LIFHYNLKFYD+D +  YDGVSLKRFVMQSV+GNIVAFRVHAPCSGAFLL
Sbjct  585  IAMPTDMQSCLIFHYNLKFYDSDEELSYDGVSLKRFVMQSVIGNIVAFRVHAPCSGAFLL  644

Query  561  DIFANAVTPKEYLTGEPMKFKSVCKFKIACEELQTVMVPLPDCASGEWGPTKATRLFGLI  620
            DIFANAVTP+EYLTGEPMKFKSVCKFKI CEELQTVMVPLPDCASGEWGPTKATRLFGLI
Sbjct  645  DIFANAVTPQEYLTGEPMKFKSVCKFKICCEELQTVMVPLPDCASGEWGPTKATRLFGLI  704

Query  621  PITHQEALVFAGRELEIQFRMSRPLTDFMATLHKNGIEEKRLSKYVTHSIADDDVVTFSI  680
            PITHQ+ L+FAGR L++QFRMSRPLTDFMATLHKNGIEEK+L+KYVTHS   DD+VTF I
Sbjct  705  PITHQDPLIFAGRSLDLQFRMSRPLTDFMATLHKNGIEEKKLAKYVTHSTL-DDIVTFII  763

Query  681  SFPEEGQYGLDIYTRESTSP-------TNVPHDITGEKHLLTHCCKYLINSSKRN  728
            +FPEEGQYGLDIYTRE   P        N     +GEKHLLTHCCKYLINSSKRN
Sbjct  764  NFPEEGQYGLDIYTRELGGPQHHHHHNNNNSSSSSGEKHLLTHCCKYLINSSKRN  818


>G5EF51_CAEEL unnamed protein product
Length=723

 Score = 700 bits (1806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/713 (52%), Positives = 483/713 (68%), Gaps = 61/713 (9%)

Query  19   CARHL---NGHGSPPA-TNSSQRDLHGNAGGGTSSPYNHNYSGDGSYQYGRFDA--SALH  72
            C+ H+     H  P A TN S ++L            N+N+  +G++     DA  S + 
Sbjct  62   CSNHVPIAGPHDLPMASTNGSGKNLE-----------NNNHVKNGNW----IDAGLSDMK  106

Query  73   IAHALKQTELQKGYSKAREKPIDYYLDRDEQTRLEMKHRKEEDDLYRKFAHHREEEDRRI  132
            IAHA+K T++ + Y K   +   Y +D D QTRLE+ HRK+EDDLY  F   R  E    
Sbjct  107  IAHAMKATQVARPYPKISHEGAKYVVDYDTQTRLELLHRKDEDDLYESFQDKRVREAEEF  166

Query  133  REEFRDEWEKELEELSARWEREKGGRARAQQFQQEKEDLEKNMTLRRDKKKESLTRKMLE  192
             +E  +EWEK L E + ++E+         Q   +K+DL + +T++R+KK E+L  K  E
Sbjct  167  EKENTEEWEKALAEFAKKYEK--------GQSNMKKDDLIRQLTIKREKKLETLHTKRKE  218

Query  193  HERAATAALVEKQSSEMLELINEARSEYMRQESLYLDEGDGYAQEAPPLPYPSRAPPPQP  252
             ER  TA LV++Q+ EMLEL   +RSEY                    L YPS  PPP P
Sbjct  219  RERHQTAELVDRQAKEMLELFKASRSEYSN------------------LQYPSTPPPPVP  260

Query  253  PALAKYHIYNDPLEFADMDQIAISVAQEDQKTFTDLVRQLVSRCGSDIEKARTIFRWITV  312
            P+ +K  IY     F+ +D++AI  A+ +  +FTDL+R L S   SD++ AR I+RWIT+
Sbjct  261  PSCSKREIYTTTDYFSSIDEVAIHCARNEVASFTDLIRTLSSGARSDVDVARAIYRWITI  320

Query  313  KNLNTMQFDENLRGDTPMGLLRGIKHGTESYHVLFKRLCSYAGLHCVVIKGYSKSAGYQP  372
            KNLNTM FD++++ DTPMGLLRGIK+GTESYHVLFKRLCSYAGLHCVVIKG+SKSAGYQP
Sbjct  321  KNLNTMIFDDSIQNDTPMGLLRGIKYGTESYHVLFKRLCSYAGLHCVVIKGFSKSAGYQP  380

Query  373  GVCFEDNRFRNSWNAVYVAGAWRFVQCNWGARHLVNAKEVPRPGQPKAKND-SLRYEYDD  431
            G  F+D+RFRN+WNAV++ G+WRFVQCNWGARHLVNAK+    G  +AK D +LRYEYDD
Sbjct  381  GYSFDDHRFRNTWNAVFLDGSWRFVQCNWGARHLVNAKD----GSHEAKTDGNLRYEYDD  436

Query  432  HYFLTDPREFIYEFFPLQEEWQLLKQPISLKDFEELPFVRSLFFRYGLYFPDTNTNAVMY  491
            HYF+TD  EFIYEFFP    WQLL +P+SL  FE +PFVRSLFF+Y L F D    + +Y
Sbjct  437  HYFMTDSEEFIYEFFPSDHAWQLLPRPLSLLQFERIPFVRSLFFKYNLSFIDNKLESTVY  496

Query  492  TDSTGAATVRIAMPAHMQSSLIFHYNLKFYDNDGDGYDGVSLKRFVMQSVVGNIVAFRVH  551
            TD +GAA++ I +P     SLIFHYNLKF+D++ +   G+SLKRFVMQSV  ++V FRVH
Sbjct  497  TDKSGAASISIRLPPK-GDSLIFHYNLKFFDSEENTISGMSLKRFVMQSVTEDVVTFRVH  555

Query  552  APCSGAFLLDIFANAVTPKEYLTGEPMKFKSVCKFKIACEELQTVMVPLPDCASGEWGPT  611
            AP +   LLDIFAN+V+   YLTG+P+KFKSVCKFK+ CE LQ +MVPLP+CASGEWGP 
Sbjct  556  APSTRPLLLDIFANSVSSGAYLTGQPIKFKSVCKFKVVCESLQVIMVPLPECASGEWGPA  615

Query  612  KATRLFGLIPITHQEALVFAGRELEIQFRMSRPLTDFMATLHKNGIEEKRLSKYVTHSIA  671
            KATRLFGL+PI+H +A++  GR +EI+FRM+RPL++F+A+LH+N  +++ L +  T S  
Sbjct  616  KATRLFGLLPISHPDAIINTGRYVEIRFRMTRPLSEFVASLHRNRTDDRAL-QACTRSAL  674

Query  672  DDDVVTFSISFPEEGQYGLDIYTRESTSPTNVPHDITGEKHLLTHCCKYLINS  724
              D+V   I FP EGQYGLDIYTR+     N        K LLTHCCKYLI+S
Sbjct  675  KGDMVYIQIEFPGEGQYGLDIYTRQDDQLIN-------GKQLLTHCCKYLIHS  720


>RBP2A_PLAF7 unnamed protein product
Length=3130

 Score = 48.1 bits (113),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 43/137 (31%), Positives = 70/137 (51%), Gaps = 13/137 (9%)

Query  76    ALKQTELQKGYSKAREKPIDYYLDRDEQTRLEMKHRKEEDDLYRKFAHHREEEDRRIREE  135
             ALK+ E Q+   K  E      L R EQ RLE   R++++ L ++    R+E++R  +EE
Sbjct  2738  ALKRQE-QERLQKEEE------LKRQEQERLE---REKQEQLQKEEELKRQEQERLQKEE  2787

Query  136   FRDEWEKELEELSARWEREKGGR-ARAQQFQQEKEDLEKNMTLRRDKKKESLTRKMLEHE  194
                  E+E  +     +R++  R  R +Q Q +KE+  K     R +K+E+L R+  E E
Sbjct  2788  ALKRQEQERLQKEEELKRQEQERLEREKQEQLQKEEELKRQEQERLQKEEALKRQ--EQE  2845

Query  195   RAATAALVEKQSSEMLE  211
             R      +++Q  E LE
Sbjct  2846  RLQKEEELKRQEQERLE  2862


 Score = 40.4 bits (93),  Expect = 0.006, Method: Composition-based stats.
 Identities = 34/119 (29%), Positives = 65/119 (55%), Gaps = 19/119 (16%)

Query  78    KQTELQKGYSKAREKPIDYYLDRDEQTRLEMKH---RKEEDDLYRKFAHHREEEDRRIRE  134
             KQ +LQK          +  L R EQ RL+ +    R+E++ L ++    R+E++R  RE
Sbjct  2765  KQEQLQK----------EEELKRQEQERLQKEEALKRQEQERLQKEEELKRQEQERLERE  2814

Query  135   EFRDEWEKELEEL----SARWEREKGGRARAQQFQQEKEDLEKNMTLRRDKKKESLTRK  189
             + +++ +KE EEL      R ++E+  + + Q+  Q++E+L++    R ++KK  L  +
Sbjct  2815  K-QEQLQKE-EELKRQEQERLQKEEALKRQEQERLQKEEELKRQEQERLERKKIELAER  2871


 Score = 37.4 bits (85),  Expect = 0.060, Method: Composition-based stats.
 Identities = 31/102 (30%), Positives = 52/102 (51%), Gaps = 7/102 (7%)

Query  137   RDEWEK-ELEELSARWEREKGGRARAQQFQQEKEDLEKNMTLRRDKKKESLTRKMLEHER  195
             R E E+ + EE   R E+E+  R + +Q Q+E+E   K     R +K+E+L R+  E ER
Sbjct  2741  RQEQERLQKEEELKRQEQERLEREKQEQLQKEEE--LKRQEQERLQKEEALKRQ--EQER  2796

Query  196   AATAALVEKQSSEMLELINEARSEYMRQESLYLDEGDGYAQE  237
                   +++Q  E LE   E + +  ++E L   E +   +E
Sbjct  2797  LQKEEELKRQEQERLE--REKQEQLQKEEELKRQEQERLQKE  2836



Lambda      K        H
   0.313    0.128    0.386 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3603051738


Query= XP_050573100.1 transcriptional regulator ERG homolog isoform X2
[Bombus affinis]

Length=325
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q22355_CAEEL  unnamed protein product                                 206     8e-64
ETS6_DROME  unnamed protein product                                   198     1e-59
ELG_DROME  unnamed protein product                                    140     9e-38


>Q22355_CAEEL unnamed protein product
Length=377

 Score = 206 bits (525),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 99/124 (80%), Gaps = 0/124 (0%)

Query  125  LDTHTHLRQPDPYQMFGATSSRLASSGSGQIQLWQFLLELLSDSSNAACITWEGTNGEFK  184
            L   T    PDPYQ+ G TS  LA SGSGQ QLWQFLLELLSD   +  ITWEGT GEFK
Sbjct  184  LSNSTSFANPDPYQILGPTSKNLAHSGSGQTQLWQFLLELLSDKRYSEVITWEGTQGEFK  243

Query  185  LTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFQGLAAATQ  244
            L DPDEVAR+WGERKSKPNMNYDK+SRALRYYYDKNIM KVHGKRYAYKFDFQG+A A Q
Sbjct  244  LVDPDEVARKWGERKSKPNMNYDKMSRALRYYYDKNIMAKVHGKRYAYKFDFQGIAQALQ  303

Query  245  PAAA  248
            P  A
Sbjct  304  PPTA  307


>ETS6_DROME unnamed protein product
Length=475

 Score = 198 bits (504),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 104/123 (85%), Gaps = 3/123 (2%)

Query  133  QPDPYQMFGATSSRLASSGSG-QIQLWQFLLELLSDSSNAACITWEGTNGEFKLTDPDEV  191
            +P+PYQ+  A S RL + GSG QIQLWQFLLELL+DSSNA  I+WEG +GEF+L DPDEV
Sbjct  232  EPNPYQLLNAASHRLVAQGSGGQIQLWQFLLELLADSSNANAISWEGQSGEFRLIDPDEV  291

Query  192  ARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFQGLAAATQPAA--AD  249
            ARRWGERK+KPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF GL AA Q  A   D
Sbjct  292  ARRWGERKAKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGLMAACQAQAQGGD  351

Query  250  PAA  252
            PA+
Sbjct  352  PAS  354


>ELG_DROME unnamed protein product
Length=464

 Score = 140 bits (352),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 84/122 (69%), Gaps = 7/122 (6%)

Query  114  QGYGSSLSKSALDTHTHLRQPDPYQMFGATSSRLASSGSGQIQLWQFLLELLSDSSNAAC  173
            + Y S  S  ++++ T    P  Y   G       S  +GQ+QLWQFLLE+L+D  +   
Sbjct  312  KSYQSVKSSDSVESTTSSMNPSNYTTIG-------SGNNGQVQLWQFLLEILTDCEHTDV  364

Query  174  ITWEGTNGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYK  233
            I W GT GEFKLTDPD VAR WGE+K+KP MNY+KLSRALRYYYD ++++KV GKR+AYK
Sbjct  365  IEWVGTEGEFKLTDPDRVARLWGEKKNKPAMNYEKLSRALRYYYDGDMISKVSGKRFAYK  424

Query  234  FD  235
            FD
Sbjct  425  FD  426



Lambda      K        H
   0.313    0.128    0.386 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3603051738


Query= XP_050573101.1 ribonucleases P/MRP protein subunit POP1 [Bombus
affinis]

Length=832
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9BIF4_CAEEL  unnamed protein product                                 33.5    0.90 
Q582N2_TRYB2  unnamed protein product                                 32.0    2.2  
G4S7C7_CAEEL  unnamed protein product                                 32.0    2.5  


>Q9BIF4_CAEEL unnamed protein product
Length=796

 Score = 33.5 bits (75),  Expect = 0.90, Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 41/87 (47%), Gaps = 7/87 (8%)

Query  346  KLWHIEYYDNQENIESLKIQEQLWQMLKTLQS---PSQLPPNIVFGFTVL----DPRFHL  398
            ++W +   D   N++ +++   L  + ++LQS   P+QLPPN++     +     P F  
Sbjct  201  RIWELSDQDKDGNLDRIEMSVALHLVYRSLQSDPVPAQLPPNLIHPSKAMYAHSSPNFAA  260

Query  399  PDKRTRPQRETQTIEMVSVPPTNANSS  425
            P    RP   ++   + S+   N + S
Sbjct  261  PPHPPRPMMGSRAGSVTSLDDVNMSQS  287


>Q582N2_TRYB2 unnamed protein product
Length=374

 Score = 32.0 bits (71),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 23/83 (28%), Positives = 36/83 (43%), Gaps = 7/83 (8%)

Query  599  RNRKLLNFLQKSLVQEDNTRRYNTPNDHVSSLTMQSAFEDRNCL-----IRVKVDIMKKG  653
            R  K+ N  +  LV ED  R Y    + ++ L    A +D N +     IR     M+  
Sbjct  139  RGHKIENVAEVPLVVEDGVRAYEKTKEAMTFLKTVGAIDDVNRVNDSRQIRAGRGKMRNR  198

Query  654  R--PKRFAIICMPTNEDIEKFKN  674
            R   +R  ++ MP N+    F+N
Sbjct  199  RYVARRGPMLVMPDNKGTRAFRN  221


>G4S7C7_CAEEL unnamed protein product
Length=397

 Score = 32.0 bits (71),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 25/79 (32%), Positives = 38/79 (48%), Gaps = 7/79 (9%)

Query  462  KYFNENIMAKIPVL-LIQKPSI-SKTGLGSGVDVILP-----SNWGMPFWLACIFRCVRV  514
            +Y + NI+  I V  LI   S+ S  GLG  +   L      +NW   FWLA +  CV V
Sbjct  219  RYGHSNILVYISVCSLIGSLSVLSVKGLGLAIKETLAGNQQFTNWLTYFWLASVAMCVSV  278

Query  515  GALRESKSIPFEFENMQSP  533
              +  +K++     +M +P
Sbjct  279  QLIYLNKALDIFNTSMVTP  297



Lambda      K        H
   0.313    0.128    0.386 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3603051738


Query= XP_050573102.1 double-stranded RNA-binding protein Staufen homolog 2
isoform X1 [Bombus affinis]

Length=781
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

STAUH_APLCA  unnamed protein product                                  392     6e-123
STAU_DROME  unnamed protein product                                   282     8e-82 
Q94239_CAEEL  unnamed protein product                                 212     2e-58 


>STAUH_APLCA unnamed protein product
Length=950

 Score = 392 bits (1006),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 294/684 (43%), Positives = 386/684 (56%), Gaps = 92/684 (13%)

Query  144  PTTNESNSGESRD-----QSPPT--QNHVNVTDS------------ALANMKEKTPMCLL  184
            P TN  ++GE        Q+P T  ++ V+V+D+            +LAN KEKTPMCL+
Sbjct  290  PVTNGESAGEDTSPKDSPQAPKTSGRDSVHVSDNEESASNASEMQQSLANTKEKTPMCLI  349

Query  185  NELARFNKIQHQYRLTNEQGPAHKKRFTVTLKLGEEEYVAEGPSIKKAQHSAATEALTKT  244
            NELARFNK+ HQY L +EQGPAHKK F V LKLG+EEY A G SIKKAQH+AA  AL +T
Sbjct  350  NELARFNKMSHQYTLVDEQGPAHKKTFYVKLKLGDEEYSASGESIKKAQHAAAAIALVET  409

Query  245  WYQRPPPKPTKTMRVGHPGKCFGGPGNLPPTVELNALAMKRGEATVYTFR--QAPPAGLQ  302
                PPPKP    R+G         GN+ PTVELNALAMKRGE  +Y     Q PP    
Sbjct  410  KCPHPPPKPA---RLGCCDLEKSADGNITPTVELNALAMKRGEPALYKSIEPQQPP----  462

Query  303  QYVTNGLGHFPRIFNPRFPTYNRG----------------FHAEPQL---YLVSLKVGER  343
             Y       F  ++N R+  Y R                 +H  P++   + VSL+VG R
Sbjct  463  -YYHQPNMDFRGLYNQRYHQYMRASRDPRYRGNGVLWPLRYHY-PRMNRAFYVSLRVGHR  520

Query  344  EFIGRGLTGQAARHDAASKALEQLRQLPL------PEEIANTCNSGENGTLGEAKDPIAE  397
            EFIG G T QAARH+AA KAL  L+ LP+       EE A+   + E+    +  D    
Sbjct  521  EFIGDGPTRQAARHNAAQKALRILKNLPVQSGEKKSEEQAD--EAAEDACEEDVDD---S  575

Query  398  LKSPVSLVHEKALKRGLPVSFEVVSEIGKPHIRTFRTKCTVGDKVTLGEGPSKKVSKKHA  457
            LKS +SLVHE AL+R + V FEV+ E G PH++ F T+CTV D VT GEG SKK SKK A
Sbjct  576  LKSEISLVHEIALRRNMVVQFEVIRETGPPHMKNFLTRCTVADMVTEGEGNSKKTSKKKA  635

Query  458  AEFMLEELNRLPPLPETIQNRLVRVKRKPPATKKKSRNLIKV-YQEPRSDSDSAEEVNPV  516
            AE MLEEL +LPPL         R K K    KKK+RNLIK   Q+ ++D +    +NP+
Sbjct  636  AELMLEELRKLPPLATPA---FPRPKSKIQMNKKKNRNLIKSELQQQKADPNYGVGINPI  692

Query  517  SRLDQIQQAKREKEPVYNLIEEKGAPRRKEFVMEVTMGQYSAQGIGPNKKLAKRAAAEAL  576
            SRL QI QA+++KEPVY L+ E+G PRR+EF+++V +   +  G GPNKKLAKRAAAEA+
Sbjct  693  SRLIQIMQAQKKKEPVYTLVTERGLPRRREFIVQVEVEDKTCPGSGPNKKLAKRAAAEAM  752

Query  577  LTQLGYTKPQPQPTKPSIK---TGESENVEQKPRKVTFLEDEQINETQSHPPVGGTIGRQ  633
            L  LGYTKP PQPTK S K   TGE+       +KVTF+  +   +       G    +Q
Sbjct  753  LQLLGYTKPSPQPTKSSFKNPSTGEAGQTNGD-KKVTFVGGDSPGDGDDKVSSGSN--QQ  809

Query  634  LVPGLLLV--------DGGQESKLGSGPSVQIVAEELRGQQQQNPPTVSPKDQLKYLSQL  685
             VPGLL +         G Q +   S  S+  +A  L+       P + P+ QL+ L + 
Sbjct  810  RVPGLLHLPSKSSASSSGNQHT--ASKESLVNLASILK-------PNLRPEIQLRELCKA  860

Query  686  FNFSVEFNDFPKGAVN-KEYLSLVTLSTDPPQVCHGNGPTRTASRNQAALKALCTLSKLG  744
             +  +E +DF K   +  E+++ +T+ ++ PQ  HG+  +  +SR+ AAL AL  L    
Sbjct  861  MDCQLEIDDFTKKRTSGTEHITRITIGSENPQSFHGSNTSLESSRDMAALDALKVLVARA  920

Query  745  LD---NASNSQTKKEKGA-SGDGI  764
             D        Q KK+  A SG G+
Sbjct  921  KDIHPGGDGPQVKKDVLARSGSGM  944


>STAU_DROME unnamed protein product
Length=1026

 Score = 282 bits (722),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 203/541 (38%), Positives = 278/541 (51%), Gaps = 122/541 (23%)

Query  130  PQHIQQPQSIESNKPTTNESNSGESRDQSPPTQNHVNVTDSALANMKEKTPMCLLNELAR  189
            P+  Q+P S + +  T N   +G   ++          T S+    K+KTPMCL+NELAR
Sbjct  271  PETRQEPASADDHVSTGNIDATGALSNED---------TSSSGRGGKDKTPMCLVNELAR  321

Query  190  FNKIQHQYRLTNEQGPAHKKRFTVTLKLGEEEYVAEGPSIKKAQHSAATEALTKTWYQRP  249
            +NKI HQYRLT E+GPAH K FTVTL LG+EEY A+G  IKKAQH AA++A+ +T Y+ P
Sbjct  322  YNKITHQYRLTEERGPAHCKTFTVTLMLGDEEYSADGFKIKKAQHLAASKAIEETMYKHP  381

Query  250  PPKPTKTMRVGHPGKCFGGP--GNLPPTVELNALAMKRGEATVYTF--RQAPPA------  299
            PPK  ++          GGP   ++ PTVELNALAMK G+ T Y     Q PP       
Sbjct  382  PPKIRRSEE--------GGPMRTHITPTVELNALAMKLGQRTFYLLDPTQIPPTDSIVPP  433

Query  300  ------------------------GLQQYVTNGLGHFP--------------RIFNPRFP  321
                                     L+Q + NG    P              R F P+FP
Sbjct  434  EFAGGHLLTAPGPGMPQPPPPPAYALRQRLGNGFVPIPSQPMHPHFFHGPGQRPFPPKFP  493

Query  322  TYNR-----GFHAE-------PQL----YLVSLKVGEREFIGRGLTGQAARHDAASKALE  365
            +        G H         P +      ++L VG+++F+G G T Q A+HDAA++AL+
Sbjct  494  SRFALPPPLGAHVHHGPNGPFPSVPTPPSKITLFVGKQKFVGIGRTLQQAKHDAAARALQ  553

Query  366  QLRQLPLP---EEIANTCNSGENGTLGEAKDPIAELKSPVSLVHEKALKRGLPVSFEVVS  422
             L+   +    E + ++ + G+              KSP+S VHE  +KR + V F+V+ 
Sbjct  554  VLKTQAISASEEALEDSMDEGDK-------------KSPISQVHEIGIKRNMTVHFKVLR  600

Query  423  EIGKPHIRTFRTKCTVGDKVTLGEGPSKKVSKKHAAEFMLEELNRLPPLPETIQNRLVRV  482
            E G  H++ F T C VG  VT GEG  KKVSKK AAE ML EL +LPPL  T Q  L R+
Sbjct  601  EEGPAHMKNFITACIVGSIVTEGEGNGKKVSKKRAAEKMLVELQKLPPLTPTKQTPLKRI  660

Query  483  KRKPPAT---------------------KKKSRNLIKVYQEPRSDSDSAEEVNPVSRLDQ  521
            K K P                       K + R  +   ++   D D A+  NP+++L Q
Sbjct  661  KVKTPGKSGAAAREGSVVSGTDGPTQTGKPERRKRLNPPKDKLIDMDDAD--NPITKLIQ  718

Query  522  IQQAKREKEPVYNLIEEKG--APRRKEFVMEVTMGQYSAQGIGPNKKLAKRAAAEALLTQ  579
            +QQ ++EKEP++ LI + G    RR+EFVMEV+    +A+G G +KKLAKR AA+AL   
Sbjct  719  LQQTRKEKEPIFELIAKNGNETARRREFVMEVSASGSTARGTGNSKKLAKRNAAQALFEL  778

Query  580  L  580
            L
Sbjct  779  L  779


 Score = 89.0 bits (219),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 56/76 (74%), Gaps = 1/76 (1%)

Query  673   VSPKDQLKYLSQLFNFSVEFNDFPKGAVNKEYLSLVTLSTDPPQVCHGNGPTRTASRNQA  732
             V  K+QL YLS+L +F V F+D+PKG  N E+L++VTLST PPQ+CHG G +   S+N A
Sbjct  950   VHMKEQLLYLSKLLDFEVNFSDYPKGNHN-EFLTIVTLSTHPPQICHGVGKSSEESQNDA  1008

Query  733   ALKALCTLSKLGLDNA  748
             A  AL  LSKLGL+NA
Sbjct  1009  ASNALKILSKLGLNNA  1024


>Q94239_CAEEL unnamed protein product
Length=705

 Score = 212 bits (539),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 197/652 (30%), Positives = 300/652 (46%), Gaps = 88/652 (13%)

Query  166  NVTDSALANMKEKTPMCLLNELARFNKIQHQYRLTNEQGPAHKKRFTVTLKLGEEE-YVA  224
            N  D   A  KEK+ MC + E+ARFNK++H Y L +E GPAHKK FTV L L E E +  
Sbjct  65   NFYDYTNAKEKEKSAMCRVAEIARFNKLRHVYNLQDESGPAHKKLFTVKLVLTEAETFEG  124

Query  225  EGPSIKKAQHSAATEALTKTWYQRPPPKPTKTMRVGHPGKCFGGPGNLPPTVELNALAMK  284
             G SIK+AQ ++A  AL  T    P  KPTK  R+    K      N+  T++       
Sbjct  125  SGTSIKRAQQASAEAALKGTKLPLPTEKPTKK-RINDTTKPHRVLQNVCRTLQYQMPNYI  183

Query  285  RGEATVYTFRQAPPAGLQQYVTNGLGHFPRIFNPRFPTY--NRGFHAEPQLYLVSLKV-G  341
                 VY     P   L +++   L     ++ P FPT   +      P+L  V + + G
Sbjct  184  SCNPPVYP---DPGCPLPEHILLPLESMA-LYAPPFPTLPIDPARPQGPKLQAVIVNING  239

Query  342  EREFIGRGLTGQAARHDAASKALEQLRQLPLPEEIANTCNSGENGTLGEAKDPIAELKSP  401
            +    G G T   A+ DAA+KAL  L   PL  E  N    G +   G+   P+ + KS 
Sbjct  240  KSIATGIGETYPLAKQDAAAKALAVLS--PLLREHQN----GSDNGFGKENIPVHKQKSV  293

Query  402  VSLVHEKALKRGLPVSFEVVSEIGKPHIRTFRTKC---TVGDKV---TLGEGPSKKVSKK  455
            +S +HEKA +  + V FEV+ E G PH R +  +C   T G+ V    +G+G  KK +++
Sbjct  294  ISDIHEKAYQLKVNVVFEVLKEEGPPHDRQYVVRCAFVTSGNVVKAEAVGKGKKKKSAQQ  353

Query  456  HAAEFMLEELNRLPPL--PETIQNRLVRVKRKPPATKK--KSRNLIKVYQEPRSDSDSAE  511
             A   +L  +  L P   P  +   + + ++K  A  +  K + ++K   + + D     
Sbjct  354  EACTQLLATVEHLTPENNPVALATNVCKTQKKLAAMNREPKRKTIVK---DKKMDPLYGH  410

Query  512  EVNPVSRLDQIQQAKREKEPVYNLIEEKGAPRRKEFVMEVTMGQYSAQGIGPNKKLAKRA  571
            ++NPVSRL Q+ QAK ++ P + L+ E G  + KEF+++V  G    +G GPNK+LAKRA
Sbjct  411  QINPVSRLIQVTQAKSKEHPTFELVAEHGVSKYKEFIIQVKYGDDVQEGKGPNKRLAKRA  470

Query  572  AAEALLTQLGYTKPQ--------------------------PQPTKPSIKTGE---SENV  602
            AAEA+L  +G+ KP                           P PT  S+ T E   SE  
Sbjct  471  AAEAMLESIGFVKPLPPPGKSLLKKMIDCDPSLPEISHWTGPPPTAVSVSTSEPDTSEAA  530

Query  603  EQKPRKVTFLEDEQIN------------ETQSHPPVGGTIGRQLVPGLLLVDGGQESKLG  650
            +  P +    E  +++            +  + PP G       +   L  D   E K+ 
Sbjct  531  QLSPEQTDISEKRELSPDTEKRRVTFNSQVHACPPPGDQDYPNSIVQSLKKDAIVEGKIR  590

Query  651  ----------SGPSVQIVAEELRGQQ--QQNPPTVSPKD------QLKYLSQLFNFSVEF  692
                      +  + QIV    R Q   Q    T+           L+ LS  F FS+++
Sbjct  591  RLKRSKENRRALTAEQIVELSERAQSYLQTKNTTIQSSQSSSAHHHLEQLSDFFKFSLQY  650

Query  693  NDFPKGAVNKEYLSLVTLSTDPPQVCHGNGPTRTASRNQAALKALCTLSKLG  744
              FP+  ++ ++ ++V++  + P V HG G + T +   AAL A+  L +L 
Sbjct  651  TSFPQVGID-QHFTIVSIGLEAPLVGHGTGCSTTEADENAALDAIAKLKELS  701



Lambda      K        H
   0.313    0.128    0.386 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3603051738


Query= XP_050573103.1 double-stranded RNA-binding protein Staufen homolog 2
isoform X2 [Bombus affinis]

Length=762
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

STAUH_APLCA  unnamed protein product                                  391     6e-123
STAU_DROME  unnamed protein product                                   281     1e-81 
Q94239_CAEEL  unnamed protein product                                 212     1e-58 


>STAUH_APLCA unnamed protein product
Length=950

 Score = 391 bits (1005),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 294/684 (43%), Positives = 386/684 (56%), Gaps = 92/684 (13%)

Query  125  PTTNESNSGESRD-----QSPPT--QNHVNVTDS------------ALANMKEKTPMCLL  165
            P TN  ++GE        Q+P T  ++ V+V+D+            +LAN KEKTPMCL+
Sbjct  290  PVTNGESAGEDTSPKDSPQAPKTSGRDSVHVSDNEESASNASEMQQSLANTKEKTPMCLI  349

Query  166  NELARFNKIQHQYRLTNEQGPAHKKRFTVTLKLGEEEYVAEGPSIKKAQHSAATEALTKT  225
            NELARFNK+ HQY L +EQGPAHKK F V LKLG+EEY A G SIKKAQH+AA  AL +T
Sbjct  350  NELARFNKMSHQYTLVDEQGPAHKKTFYVKLKLGDEEYSASGESIKKAQHAAAAIALVET  409

Query  226  WYQRPPPKPTKTMRVGHPGKCFGGPGNLPPTVELNALAMKRGEATVYTFR--QAPPAGLQ  283
                PPPKP    R+G         GN+ PTVELNALAMKRGE  +Y     Q PP    
Sbjct  410  KCPHPPPKPA---RLGCCDLEKSADGNITPTVELNALAMKRGEPALYKSIEPQQPP----  462

Query  284  QYVTNGLGHFPRIFNPRFPTYNRG----------------FHAEPQL---YLVSLKVGER  324
             Y       F  ++N R+  Y R                 +H  P++   + VSL+VG R
Sbjct  463  -YYHQPNMDFRGLYNQRYHQYMRASRDPRYRGNGVLWPLRYHY-PRMNRAFYVSLRVGHR  520

Query  325  EFIGRGLTGQAARHDAASKALEQLRQLPL------PEEIANTCNSGENGTLGEAKDPIAE  378
            EFIG G T QAARH+AA KAL  L+ LP+       EE A+   + E+    +  D    
Sbjct  521  EFIGDGPTRQAARHNAAQKALRILKNLPVQSGEKKSEEQAD--EAAEDACEEDVDD---S  575

Query  379  LKSPVSLVHEKALKRGLPVSFEVVSEIGKPHIRTFRTKCTVGDKVTLGEGPSKKVSKKHA  438
            LKS +SLVHE AL+R + V FEV+ E G PH++ F T+CTV D VT GEG SKK SKK A
Sbjct  576  LKSEISLVHEIALRRNMVVQFEVIRETGPPHMKNFLTRCTVADMVTEGEGNSKKTSKKKA  635

Query  439  AEFMLEELNRLPPLPETIQNRLVRVKRKPPATKKKSRNLIKV-YQEPRSDSDSAEEVNPV  497
            AE MLEEL +LPPL         R K K    KKK+RNLIK   Q+ ++D +    +NP+
Sbjct  636  AELMLEELRKLPPLATPA---FPRPKSKIQMNKKKNRNLIKSELQQQKADPNYGVGINPI  692

Query  498  SRLDQIQQAKREKEPVYNLIEEKGAPRRKEFVMEVTMGQYSAQGIGPNKKLAKRAAAEAL  557
            SRL QI QA+++KEPVY L+ E+G PRR+EF+++V +   +  G GPNKKLAKRAAAEA+
Sbjct  693  SRLIQIMQAQKKKEPVYTLVTERGLPRRREFIVQVEVEDKTCPGSGPNKKLAKRAAAEAM  752

Query  558  LTQLGYTKPQPQPTKPSIK---TGESENVEQKPRKVTFLEDEQINETQSHPPVGGTIGRQ  614
            L  LGYTKP PQPTK S K   TGE+       +KVTF+  +   +       G    +Q
Sbjct  753  LQLLGYTKPSPQPTKSSFKNPSTGEAGQTNGD-KKVTFVGGDSPGDGDDKVSSGSN--QQ  809

Query  615  LVPGLLLV--------DGGQESKLGSGPSVQIVAEELRGQQQQNPPTVSPKDQLKYLSQL  666
             VPGLL +         G Q +   S  S+  +A  L+       P + P+ QL+ L + 
Sbjct  810  RVPGLLHLPSKSSASSSGNQHT--ASKESLVNLASILK-------PNLRPEIQLRELCKA  860

Query  667  FNFSVEFNDFPKGAVN-KEYLSLVTLSTDPPQVCHGNGPTRTASRNQAALKALCTLSKLG  725
             +  +E +DF K   +  E+++ +T+ ++ PQ  HG+  +  +SR+ AAL AL  L    
Sbjct  861  MDCQLEIDDFTKKRTSGTEHITRITIGSENPQSFHGSNTSLESSRDMAALDALKVLVARA  920

Query  726  LD---NASNSQTKKEKGA-SGDGI  745
             D        Q KK+  A SG G+
Sbjct  921  KDIHPGGDGPQVKKDVLARSGSGM  944


>STAU_DROME unnamed protein product
Length=1026

 Score = 281 bits (720),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 203/541 (38%), Positives = 278/541 (51%), Gaps = 122/541 (23%)

Query  111  PQHIQQPQSIESNKPTTNESNSGESRDQSPPTQNHVNVTDSALANMKEKTPMCLLNELAR  170
            P+  Q+P S + +  T N   +G   ++          T S+    K+KTPMCL+NELAR
Sbjct  271  PETRQEPASADDHVSTGNIDATGALSNED---------TSSSGRGGKDKTPMCLVNELAR  321

Query  171  FNKIQHQYRLTNEQGPAHKKRFTVTLKLGEEEYVAEGPSIKKAQHSAATEALTKTWYQRP  230
            +NKI HQYRLT E+GPAH K FTVTL LG+EEY A+G  IKKAQH AA++A+ +T Y+ P
Sbjct  322  YNKITHQYRLTEERGPAHCKTFTVTLMLGDEEYSADGFKIKKAQHLAASKAIEETMYKHP  381

Query  231  PPKPTKTMRVGHPGKCFGGP--GNLPPTVELNALAMKRGEATVYTF--RQAPPA------  280
            PPK  ++          GGP   ++ PTVELNALAMK G+ T Y     Q PP       
Sbjct  382  PPKIRRSEE--------GGPMRTHITPTVELNALAMKLGQRTFYLLDPTQIPPTDSIVPP  433

Query  281  ------------------------GLQQYVTNGLGHFP--------------RIFNPRFP  302
                                     L+Q + NG    P              R F P+FP
Sbjct  434  EFAGGHLLTAPGPGMPQPPPPPAYALRQRLGNGFVPIPSQPMHPHFFHGPGQRPFPPKFP  493

Query  303  TYNR-----GFHAE-------PQL----YLVSLKVGEREFIGRGLTGQAARHDAASKALE  346
            +        G H         P +      ++L VG+++F+G G T Q A+HDAA++AL+
Sbjct  494  SRFALPPPLGAHVHHGPNGPFPSVPTPPSKITLFVGKQKFVGIGRTLQQAKHDAAARALQ  553

Query  347  QLRQLPLP---EEIANTCNSGENGTLGEAKDPIAELKSPVSLVHEKALKRGLPVSFEVVS  403
             L+   +    E + ++ + G+              KSP+S VHE  +KR + V F+V+ 
Sbjct  554  VLKTQAISASEEALEDSMDEGDK-------------KSPISQVHEIGIKRNMTVHFKVLR  600

Query  404  EIGKPHIRTFRTKCTVGDKVTLGEGPSKKVSKKHAAEFMLEELNRLPPLPETIQNRLVRV  463
            E G  H++ F T C VG  VT GEG  KKVSKK AAE ML EL +LPPL  T Q  L R+
Sbjct  601  EEGPAHMKNFITACIVGSIVTEGEGNGKKVSKKRAAEKMLVELQKLPPLTPTKQTPLKRI  660

Query  464  KRKPPAT---------------------KKKSRNLIKVYQEPRSDSDSAEEVNPVSRLDQ  502
            K K P                       K + R  +   ++   D D A+  NP+++L Q
Sbjct  661  KVKTPGKSGAAAREGSVVSGTDGPTQTGKPERRKRLNPPKDKLIDMDDAD--NPITKLIQ  718

Query  503  IQQAKREKEPVYNLIEEKG--APRRKEFVMEVTMGQYSAQGIGPNKKLAKRAAAEALLTQ  560
            +QQ ++EKEP++ LI + G    RR+EFVMEV+    +A+G G +KKLAKR AA+AL   
Sbjct  719  LQQTRKEKEPIFELIAKNGNETARRREFVMEVSASGSTARGTGNSKKLAKRNAAQALFEL  778

Query  561  L  561
            L
Sbjct  779  L  779


 Score = 89.0 bits (219),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 56/76 (74%), Gaps = 1/76 (1%)

Query  654   VSPKDQLKYLSQLFNFSVEFNDFPKGAVNKEYLSLVTLSTDPPQVCHGNGPTRTASRNQA  713
             V  K+QL YLS+L +F V F+D+PKG  N E+L++VTLST PPQ+CHG G +   S+N A
Sbjct  950   VHMKEQLLYLSKLLDFEVNFSDYPKGNHN-EFLTIVTLSTHPPQICHGVGKSSEESQNDA  1008

Query  714   ALKALCTLSKLGLDNA  729
             A  AL  LSKLGL+NA
Sbjct  1009  ASNALKILSKLGLNNA  1024


>Q94239_CAEEL unnamed protein product
Length=705

 Score = 212 bits (539),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 197/652 (30%), Positives = 300/652 (46%), Gaps = 88/652 (13%)

Query  147  NVTDSALANMKEKTPMCLLNELARFNKIQHQYRLTNEQGPAHKKRFTVTLKLGEEE-YVA  205
            N  D   A  KEK+ MC + E+ARFNK++H Y L +E GPAHKK FTV L L E E +  
Sbjct  65   NFYDYTNAKEKEKSAMCRVAEIARFNKLRHVYNLQDESGPAHKKLFTVKLVLTEAETFEG  124

Query  206  EGPSIKKAQHSAATEALTKTWYQRPPPKPTKTMRVGHPGKCFGGPGNLPPTVELNALAMK  265
             G SIK+AQ ++A  AL  T    P  KPTK  R+    K      N+  T++       
Sbjct  125  SGTSIKRAQQASAEAALKGTKLPLPTEKPTKK-RINDTTKPHRVLQNVCRTLQYQMPNYI  183

Query  266  RGEATVYTFRQAPPAGLQQYVTNGLGHFPRIFNPRFPTY--NRGFHAEPQLYLVSLKV-G  322
                 VY     P   L +++   L     ++ P FPT   +      P+L  V + + G
Sbjct  184  SCNPPVYP---DPGCPLPEHILLPLESMA-LYAPPFPTLPIDPARPQGPKLQAVIVNING  239

Query  323  EREFIGRGLTGQAARHDAASKALEQLRQLPLPEEIANTCNSGENGTLGEAKDPIAELKSP  382
            +    G G T   A+ DAA+KAL  L   PL  E  N    G +   G+   P+ + KS 
Sbjct  240  KSIATGIGETYPLAKQDAAAKALAVLS--PLLREHQN----GSDNGFGKENIPVHKQKSV  293

Query  383  VSLVHEKALKRGLPVSFEVVSEIGKPHIRTFRTKC---TVGDKV---TLGEGPSKKVSKK  436
            +S +HEKA +  + V FEV+ E G PH R +  +C   T G+ V    +G+G  KK +++
Sbjct  294  ISDIHEKAYQLKVNVVFEVLKEEGPPHDRQYVVRCAFVTSGNVVKAEAVGKGKKKKSAQQ  353

Query  437  HAAEFMLEELNRLPPL--PETIQNRLVRVKRKPPATKK--KSRNLIKVYQEPRSDSDSAE  492
             A   +L  +  L P   P  +   + + ++K  A  +  K + ++K   + + D     
Sbjct  354  EACTQLLATVEHLTPENNPVALATNVCKTQKKLAAMNREPKRKTIVK---DKKMDPLYGH  410

Query  493  EVNPVSRLDQIQQAKREKEPVYNLIEEKGAPRRKEFVMEVTMGQYSAQGIGPNKKLAKRA  552
            ++NPVSRL Q+ QAK ++ P + L+ E G  + KEF+++V  G    +G GPNK+LAKRA
Sbjct  411  QINPVSRLIQVTQAKSKEHPTFELVAEHGVSKYKEFIIQVKYGDDVQEGKGPNKRLAKRA  470

Query  553  AAEALLTQLGYTKPQ--------------------------PQPTKPSIKTGE---SENV  583
            AAEA+L  +G+ KP                           P PT  S+ T E   SE  
Sbjct  471  AAEAMLESIGFVKPLPPPGKSLLKKMIDCDPSLPEISHWTGPPPTAVSVSTSEPDTSEAA  530

Query  584  EQKPRKVTFLEDEQIN------------ETQSHPPVGGTIGRQLVPGLLLVDGGQESKLG  631
            +  P +    E  +++            +  + PP G       +   L  D   E K+ 
Sbjct  531  QLSPEQTDISEKRELSPDTEKRRVTFNSQVHACPPPGDQDYPNSIVQSLKKDAIVEGKIR  590

Query  632  ----------SGPSVQIVAEELRGQQ--QQNPPTVSPKD------QLKYLSQLFNFSVEF  673
                      +  + QIV    R Q   Q    T+           L+ LS  F FS+++
Sbjct  591  RLKRSKENRRALTAEQIVELSERAQSYLQTKNTTIQSSQSSSAHHHLEQLSDFFKFSLQY  650

Query  674  NDFPKGAVNKEYLSLVTLSTDPPQVCHGNGPTRTASRNQAALKALCTLSKLG  725
              FP+  ++ ++ ++V++  + P V HG G + T +   AAL A+  L +L 
Sbjct  651  TSFPQVGID-QHFTIVSIGLEAPLVGHGTGCSTTEADENAALDAIAKLKELS  701



Lambda      K        H
   0.313    0.128    0.386 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3603051738


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Nov 7, 2022  4:57 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_050573104.1 double-stranded RNA-binding protein Staufen homolog 2
isoform X3 [Bombus affinis]

Length=760
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

STAUH_APLCA  unnamed protein product                                  390     1e-122
STAU_DROME  unnamed protein product                                   282     7e-82 
Q94239_CAEEL  unnamed protein product                                 212     9e-59 


>STAUH_APLCA unnamed protein product
Length=950

 Score = 390 bits (1003),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 286/656 (44%), Positives = 376/656 (57%), Gaps = 88/656 (13%)

Query  144  PTTNESNSGESRD-----QSPPT--QNHVNVTDS------------ALANMKEKTPMCLL  184
            P TN  ++GE        Q+P T  ++ V+V+D+            +LAN KEKTPMCL+
Sbjct  290  PVTNGESAGEDTSPKDSPQAPKTSGRDSVHVSDNEESASNASEMQQSLANTKEKTPMCLI  349

Query  185  NELARFNKIQHQYRLTNEQGPAHKKRFTVTLKLGEEEYVAEGPSIKKAQHSAATEALTKT  244
            NELARFNK+ HQY L +EQGPAHKK F V LKLG+EEY A G SIKKAQH+AA  AL +T
Sbjct  350  NELARFNKMSHQYTLVDEQGPAHKKTFYVKLKLGDEEYSASGESIKKAQHAAAAIALVET  409

Query  245  WYQRPPPKPTKTMRVGHPGKCFGGPGNLPPTVELNALAMKRGEATVYTFR--QAPPAGLQ  302
                PPPKP    R+G         GN+ PTVELNALAMKRGE  +Y     Q PP    
Sbjct  410  KCPHPPPKPA---RLGCCDLEKSADGNITPTVELNALAMKRGEPALYKSIEPQQPP----  462

Query  303  QYVTNGLGHFPRIFNPRFPTYNRG----------------FHAEPQL---YLVSLKVGER  343
             Y       F  ++N R+  Y R                 +H  P++   + VSL+VG R
Sbjct  463  -YYHQPNMDFRGLYNQRYHQYMRASRDPRYRGNGVLWPLRYHY-PRMNRAFYVSLRVGHR  520

Query  344  EFIGRGLTGQAARHDAASKALEQLRQLPL------PEEIANTCNSGENGTLGEAKDPIAE  397
            EFIG G T QAARH+AA KAL  L+ LP+       EE A+   + E+    +  D    
Sbjct  521  EFIGDGPTRQAARHNAAQKALRILKNLPVQSGEKKSEEQAD--EAAEDACEEDVDD---S  575

Query  398  LKSPVSLVHEKALKRGLPVSFEVVSEIGKPHIRTFRTKCTVGDKVTLGEGPSKKVSKKHA  457
            LKS +SLVHE AL+R + V FEV+ E G PH++ F T+CTV D VT GEG SKK SKK A
Sbjct  576  LKSEISLVHEIALRRNMVVQFEVIRETGPPHMKNFLTRCTVADMVTEGEGNSKKTSKKKA  635

Query  458  AEFMLEELNRLPPLPETIQNRLVRVKRKPPATKKKSRNLIKV-YQEPRSDSDSAEEVNPV  516
            AE MLEEL +LPPL         R K K    KKK+RNLIK   Q+ ++D +    +NP+
Sbjct  636  AELMLEELRKLPPLATPA---FPRPKSKIQMNKKKNRNLIKSELQQQKADPNYGVGINPI  692

Query  517  SRLDQIQQAKREKEPVYNLIEEKGAPRRKEFVMEVTMGQYSAQGIGPNKKLAKRAAAEAL  576
            SRL QI QA+++KEPVY L+ E+G PRR+EF+++V +   +  G GPNKKLAKRAAAEA+
Sbjct  693  SRLIQIMQAQKKKEPVYTLVTERGLPRRREFIVQVEVEDKTCPGSGPNKKLAKRAAAEAM  752

Query  577  LTQLGYTKPQPQPTKPSIK---TGESENVEQKPRKVTFLEDEQINETQSHPPVGGTIGRQ  633
            L  LGYTKP PQPTK S K   TGE+       +KVTF+  +   +       G    +Q
Sbjct  753  LQLLGYTKPSPQPTKSSFKNPSTGEAGQTNGD-KKVTFVGGDSPGDGDDKVSSGSN--QQ  809

Query  634  LVPGLLLV--------DGGQESKLGSGPSVQIVAEELRGQQQQNPPTVSPKDQLKYLSQL  685
             VPGLL +         G Q +   S  S+  +A  L+       P + P+ QL+ L + 
Sbjct  810  RVPGLLHLPSKSSASSSGNQHT--ASKESLVNLASILK-------PNLRPEIQLRELCKA  860

Query  686  FNFSVEFNDFPKGAVN-KEYLSLVTLSTDPPQVCHGNGPTRTASRNQAALKALCTL  740
             +  +E +DF K   +  E+++ +T+ ++ PQ  HG+  +  +SR+ AAL AL  L
Sbjct  861  MDCQLEIDDFTKKRTSGTEHITRITIGSENPQSFHGSNTSLESSRDMAALDALKVL  916


>STAU_DROME unnamed protein product
Length=1026

 Score = 282 bits (721),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 203/541 (38%), Positives = 278/541 (51%), Gaps = 122/541 (23%)

Query  130  PQHIQQPQSIESNKPTTNESNSGESRDQSPPTQNHVNVTDSALANMKEKTPMCLLNELAR  189
            P+  Q+P S + +  T N   +G   ++          T S+    K+KTPMCL+NELAR
Sbjct  271  PETRQEPASADDHVSTGNIDATGALSNED---------TSSSGRGGKDKTPMCLVNELAR  321

Query  190  FNKIQHQYRLTNEQGPAHKKRFTVTLKLGEEEYVAEGPSIKKAQHSAATEALTKTWYQRP  249
            +NKI HQYRLT E+GPAH K FTVTL LG+EEY A+G  IKKAQH AA++A+ +T Y+ P
Sbjct  322  YNKITHQYRLTEERGPAHCKTFTVTLMLGDEEYSADGFKIKKAQHLAASKAIEETMYKHP  381

Query  250  PPKPTKTMRVGHPGKCFGGP--GNLPPTVELNALAMKRGEATVYTFR--QAPPA------  299
            PPK  ++          GGP   ++ PTVELNALAMK G+ T Y     Q PP       
Sbjct  382  PPKIRRSEE--------GGPMRTHITPTVELNALAMKLGQRTFYLLDPTQIPPTDSIVPP  433

Query  300  ------------------------GLQQYVTNGLGHFP--------------RIFNPRFP  321
                                     L+Q + NG    P              R F P+FP
Sbjct  434  EFAGGHLLTAPGPGMPQPPPPPAYALRQRLGNGFVPIPSQPMHPHFFHGPGQRPFPPKFP  493

Query  322  TYNR-----GFHAE-------PQL----YLVSLKVGEREFIGRGLTGQAARHDAASKALE  365
            +        G H         P +      ++L VG+++F+G G T Q A+HDAA++AL+
Sbjct  494  SRFALPPPLGAHVHHGPNGPFPSVPTPPSKITLFVGKQKFVGIGRTLQQAKHDAAARALQ  553

Query  366  QLRQLPLP---EEIANTCNSGENGTLGEAKDPIAELKSPVSLVHEKALKRGLPVSFEVVS  422
             L+   +    E + ++ + G+              KSP+S VHE  +KR + V F+V+ 
Sbjct  554  VLKTQAISASEEALEDSMDEGDK-------------KSPISQVHEIGIKRNMTVHFKVLR  600

Query  423  EIGKPHIRTFRTKCTVGDKVTLGEGPSKKVSKKHAAEFMLEELNRLPPLPETIQNRLVRV  482
            E G  H++ F T C VG  VT GEG  KKVSKK AAE ML EL +LPPL  T Q  L R+
Sbjct  601  EEGPAHMKNFITACIVGSIVTEGEGNGKKVSKKRAAEKMLVELQKLPPLTPTKQTPLKRI  660

Query  483  KRKPPAT---------------------KKKSRNLIKVYQEPRSDSDSAEEVNPVSRLDQ  521
            K K P                       K + R  +   ++   D D A+  NP+++L Q
Sbjct  661  KVKTPGKSGAAAREGSVVSGTDGPTQTGKPERRKRLNPPKDKLIDMDDAD--NPITKLIQ  718

Query  522  IQQAKREKEPVYNLIEEKG--APRRKEFVMEVTMGQYSAQGIGPNKKLAKRAAAEALLTQ  579
            +QQ ++EKEP++ LI + G    RR+EFVMEV+    +A+G G +KKLAKR AA+AL   
Sbjct  719  LQQTRKEKEPIFELIAKNGNETARRREFVMEVSASGSTARGTGNSKKLAKRNAAQALFEL  778

Query  580  L  580
            L
Sbjct  779  L  779


 Score = 89.0 bits (219),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 56/76 (74%), Gaps = 1/76 (1%)

Query  673   VSPKDQLKYLSQLFNFSVEFNDFPKGAVNKEYLSLVTLSTDPPQVCHGNGPTRTASRNQA  732
             V  K+QL YLS+L +F V F+D+PKG  N E+L++VTLST PPQ+CHG G +   S+N A
Sbjct  950   VHMKEQLLYLSKLLDFEVNFSDYPKGNHN-EFLTIVTLSTHPPQICHGVGKSSEESQNDA  1008

Query  733   ALKALCTLSKLGLDNA  748
             A  AL  LSKLGL+NA
Sbjct  1009  ASNALKILSKLGLNNA  1024


>Q94239_CAEEL unnamed protein product
Length=705

 Score = 212 bits (540),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 197/652 (30%), Positives = 300/652 (46%), Gaps = 88/652 (13%)

Query  166  NVTDSALANMKEKTPMCLLNELARFNKIQHQYRLTNEQGPAHKKRFTVTLKLGEEE-YVA  224
            N  D   A  KEK+ MC + E+ARFNK++H Y L +E GPAHKK FTV L L E E +  
Sbjct  65   NFYDYTNAKEKEKSAMCRVAEIARFNKLRHVYNLQDESGPAHKKLFTVKLVLTEAETFEG  124

Query  225  EGPSIKKAQHSAATEALTKTWYQRPPPKPTKTMRVGHPGKCFGGPGNLPPTVELNALAMK  284
             G SIK+AQ ++A  AL  T    P  KPTK  R+    K      N+  T++       
Sbjct  125  SGTSIKRAQQASAEAALKGTKLPLPTEKPTKK-RINDTTKPHRVLQNVCRTLQYQMPNYI  183

Query  285  RGEATVYTFRQAPPAGLQQYVTNGLGHFPRIFNPRFPT--YNRGFHAEPQLYLVSLKV-G  341
                 VY     P   L +++   L     ++ P FPT   +      P+L  V + + G
Sbjct  184  SCNPPVYP---DPGCPLPEHILLPLESMA-LYAPPFPTLPIDPARPQGPKLQAVIVNING  239

Query  342  EREFIGRGLTGQAARHDAASKALEQLRQLPLPEEIANTCNSGENGTLGEAKDPIAELKSP  401
            +    G G T   A+ DAA+KAL  L   PL  E  N    G +   G+   P+ + KS 
Sbjct  240  KSIATGIGETYPLAKQDAAAKALAVLS--PLLREHQN----GSDNGFGKENIPVHKQKSV  293

Query  402  VSLVHEKALKRGLPVSFEVVSEIGKPHIRTFRTKC---TVGDKV---TLGEGPSKKVSKK  455
            +S +HEKA +  + V FEV+ E G PH R +  +C   T G+ V    +G+G  KK +++
Sbjct  294  ISDIHEKAYQLKVNVVFEVLKEEGPPHDRQYVVRCAFVTSGNVVKAEAVGKGKKKKSAQQ  353

Query  456  HAAEFMLEELNRLPPL--PETIQNRLVRVKRKPPATKK--KSRNLIKVYQEPRSDSDSAE  511
             A   +L  +  L P   P  +   + + ++K  A  +  K + ++K   + + D     
Sbjct  354  EACTQLLATVEHLTPENNPVALATNVCKTQKKLAAMNREPKRKTIVK---DKKMDPLYGH  410

Query  512  EVNPVSRLDQIQQAKREKEPVYNLIEEKGAPRRKEFVMEVTMGQYSAQGIGPNKKLAKRA  571
            ++NPVSRL Q+ QAK ++ P + L+ E G  + KEF+++V  G    +G GPNK+LAKRA
Sbjct  411  QINPVSRLIQVTQAKSKEHPTFELVAEHGVSKYKEFIIQVKYGDDVQEGKGPNKRLAKRA  470

Query  572  AAEALLTQLGYTKPQ--------------------------PQPTKPSIKTGE---SENV  602
            AAEA+L  +G+ KP                           P PT  S+ T E   SE  
Sbjct  471  AAEAMLESIGFVKPLPPPGKSLLKKMIDCDPSLPEISHWTGPPPTAVSVSTSEPDTSEAA  530

Query  603  EQKPRKVTFLEDEQIN------------ETQSHPPVGGTIGRQLVPGLLLVDGGQESKLG  650
            +  P +    E  +++            +  + PP G       +   L  D   E K+ 
Sbjct  531  QLSPEQTDISEKRELSPDTEKRRVTFNSQVHACPPPGDQDYPNSIVQSLKKDAIVEGKIR  590

Query  651  ----------SGPSVQIVAEELRGQQ--QQNPPTVSPKD------QLKYLSQLFNFSVEF  692
                      +  + QIV    R Q   Q    T+           L+ LS  F FS+++
Sbjct  591  RLKRSKENRRALTAEQIVELSERAQSYLQTKNTTIQSSQSSSAHHHLEQLSDFFKFSLQY  650

Query  693  NDFPKGAVNKEYLSLVTLSTDPPQVCHGNGPTRTASRNQAALKALCTLSKLG  744
              FP+  ++ ++ ++V++  + P V HG G + T +   AAL A+  L +L 
Sbjct  651  TSFPQVGID-QHFTIVSIGLEAPLVGHGTGCSTTEADENAALDAIAKLKELS  701



Lambda      K        H
   0.312    0.130    0.379 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9367064200


Query= XP_050573105.1 uncharacterized protein LOC126913886 isoform X1
[Bombus affinis]

Length=746
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TUTT_DROME  unnamed protein product                                   139     1e-34
Q09409_CAEEL  unnamed protein product                                 84.0    3e-16
PAPD1_DROME  unnamed protein product                                  75.1    1e-13


>TUTT_DROME unnamed protein product
Length=560

 Score = 139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 94/319 (29%), Positives = 165/319 (52%), Gaps = 26/319 (8%)

Query  435  VKQSLENSVKLYFP--TVKGFIFGSRVTGLGFPNSDIDIYLDCENTYGQDTLHDNQDNDT  492
            ++Q L   +   FP   ++ + FGSR+TG+G  +SD+D+++D  NT+   T      N T
Sbjct  243  IEQDLCKLLSPGFPKQPLRVYKFGSRITGIGNRSSDLDLFVDIGNTF--HTFEHRASNAT  300

Query  493  SAQTHFMLIKKILQEQKGEWEIKQIVEKAKVPIIKLIYKRNGLHCDVSITNGLPVENSKL  552
             A+   M  +K   + + +W +   +E+A+VPIIK  +   G+ CD+ + N +   N+ L
Sbjct  301  VAKLRAM--RKFFCDSE-DWRLINFIEQARVPIIKTCHLPTGIECDICL-NSMGFCNTNL  356

Query  553  IRSFNNAYLPCRKLILVIKKWFSYINLPEKHGLTNYALAWLVIFYLQRKSYLESVAELIQ  612
            ++    +    + + + +K W     L E+  ++ Y++  +VI++LQ ++ L  +A L  
Sbjct  357  LKYIFESQPLTQYMCIYVKNWLERCKLTEQ--ISTYSITLMVIYFLQLQALLPPIAMLQI  414

Query  613  E--KNESQLICGWETGVAQPKNNNKSEQS-------ILTLLMGFFQFYTNFDYQHYIICP  663
            E   N++ L+  W    AQ   +    Q        I   L  FF ++  FDY+H+++CP
Sbjct  415  EDAANQAVLVGPWVVNFAQKSFSELGLQQLKATVPVIKGFLRNFFAYFAKFDYEHFLVCP  474

Query  664  LMGQPIAKRAFVETNVLPKEMKHYTKHLRTSKNPE-YFRIDSPLCVQDPFELSYNLTKAV  722
             +GQ   + A +E       M H       S NPE   ++  P+ VQDP +L++N+TKAV
Sbjct  475  YIGQANVEIAKIE------RMLHARYSAYVSDNPECSIQLKKPMVVQDPIQLNHNVTKAV  528

Query  723  TNITLRYFKQYCQESLCIL  741
            T   L+ F  YCQ++  +L
Sbjct  529  TKYGLQTFVDYCQQTAELL  547


>Q09409_CAEEL unnamed protein product
Length=1425

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 97/340 (29%), Positives = 162/340 (48%), Gaps = 59/340 (17%)

Query  402   PDDMKRMLTQIDEV--SDILFQQTQALLNDNISQEVKQSLENSVKLYFPTVKGFIFGSRV  459
             P+D+K +   ID+    +IL ++   +L+  I  E++  L    K Y   V    FGS +
Sbjct  1003  PEDLKDIDDMIDKYYHENILDERRLKMLDHKID-ELQSFLR---KNYREDVTLTTFGSVM  1058

Query  460   TGLGFPNSDIDIYLDCENTYGQDTLHDNQDNDTSAQTHFMLIKKILQEQKGEWEIKQIVE  519
             TGL    SDIDI L     +G     D    D +A+      + +L++      ++ IV 
Sbjct  1059  TGLSVNCSDIDICL----RFGDG---DVPPKDLTAKEVIQKTESVLRKCHLVKRVQAIV-  1110

Query  520   KAKVPIIKLIYK-RNGLHCDVSIT--NGLPVENSKLIRSFNNAYLPCR---KLILVIKKW  573
              AKVPI+K   K  NG   DV I+  N L + N+ L++ ++  + P +   KL L +K W
Sbjct  1111  TAKVPIVKFQVKLSNGAIIDVDISYYNILAIYNTALLKEYS-LWTPDKRFAKLALFVKTW  1169

Query  574   FS--YINLPEKHGLTNYALAWLVIFYLQR--KSYLESVAELIQEKN-ESQLICGWETGVA  628
                  I    +  L++Y    ++I YLQ      L  + E  +  N E +L+  W+T  A
Sbjct  1170  AKNCEIGDASRGSLSSYCHVIMLISYLQNCDPPVLPRLQEDFRSDNRERRLVDNWDTSFA  1229

Query  629   QPKNN-----NKSEQSILTLLMGFFQFYTNFDYQHYII-CPLMGQPIAKRAFVETNVLPK  682
             Q + +      K+++S   LL+G+F +Y+ FD++++++ C        +R      +L K
Sbjct  1230  QVETSLLQRWPKNKESCAQLLIGYFDYYSRFDFRNFVVQC--------RREM----ILSK  1277

Query  683   EMKHYTKHLRTSKNPEYFRIDSPLCVQDPFELSYNLTKAV  722
               K + +               PLCV+DPF+LS+NL+  V
Sbjct  1278  MEKEWPR---------------PLCVEDPFDLSHNLSSGV  1302


>PAPD1_DROME unnamed protein product
Length=612

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 63/260 (24%), Positives = 119/260 (46%), Gaps = 28/260 (11%)

Query  439  LENSVKLYFPTVKGFIFGSRVTGLGFPNSDIDIYLDCENTYGQD--------------TL  484
            ++ ++   FP  +   FGS V G G    D+D+ L  ++  G                T 
Sbjct  201  VQQAIAGMFPAAQAQPFGSSVNGFGRMGCDLDLILRFDSDMGAKIPLEAAVPSRLVYHTK  260

Query  485  HDNQDNDTSAQTHFMLIKKILQE-QKGEWEIKQIVEKAKVPIIKLIYKRNGLHCDVSITN  543
             +  +  +  Q H      +L     G   +++I++ A+VPIIK  ++   L  D+S++N
Sbjct  261  ENLSNGRSQTQRHMECFGDMLHLFLPGVCHVRRILQ-ARVPIIKYHHEHLDLEVDLSMSN  319

Query  544  GLPVENSKLIRSFNNAYLPCRKLILVIKKWF---SYINLPEKHGLTNYALAWLVIFYLQ-  599
                  S+L+  F       R L   I++W       N      ++N++L  LV+F+LQ 
Sbjct  320  LTGFYMSELLYMFGEMDPRVRPLTFTIRRWAQTCGLTNPSPGRWISNFSLTCLVMFFLQQ  379

Query  600  -RKSYLESVAELIQ--EKNESQLI-----CGWETGVAQPKNNNKSEQSILTLLMGFFQFY  651
             R+  L ++  L +  E  +S++      C +   V +    ++++ S+  LL+ FF+FY
Sbjct  380  LRQPILPTIGALAKAAEPGDSRVTEDGINCTFTRNVDRLGFRSRNQSSLSELLLQFFEFY  439

Query  652  TNFDYQHYIICPLMGQPIAK  671
            + FD+ +  I    G+P++K
Sbjct  440  SQFDFHNRAISLNEGKPLSK  459



Lambda      K        H
   0.312    0.130    0.379 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9367064200


Query= XP_050573106.1 uncharacterized protein LOC126913886 isoform X2
[Bombus affinis]

Length=730
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TUTT_DROME  unnamed protein product                                   139     1e-34
Q09409_CAEEL  unnamed protein product                                 83.6    3e-16
PAPD1_DROME  unnamed protein product                                  74.7    1e-13


>TUTT_DROME unnamed protein product
Length=560

 Score = 139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 94/319 (29%), Positives = 165/319 (52%), Gaps = 26/319 (8%)

Query  419  VKQSLENSVKLYFP--TVKGFIFGSRVTGLGFPNSDIDIYLDCENTYGQDTLHDNQDNDT  476
            ++Q L   +   FP   ++ + FGSR+TG+G  +SD+D+++D  NT+   T      N T
Sbjct  243  IEQDLCKLLSPGFPKQPLRVYKFGSRITGIGNRSSDLDLFVDIGNTF--HTFEHRASNAT  300

Query  477  SAQTHFMLIKKILQEQKGEWEIKQIVEKAKVPIIKLIYKRNGLHCDVSITNGLPVENSKL  536
             A+   M  +K   + + +W +   +E+A+VPIIK  +   G+ CD+ + N +   N+ L
Sbjct  301  VAKLRAM--RKFFCDSE-DWRLINFIEQARVPIIKTCHLPTGIECDICL-NSMGFCNTNL  356

Query  537  IRSFNNAYLPCRKLILVIKKWFSYINLPEKHGLTNYALAWLVIFYLQRKSYLESVAELIQ  596
            ++    +    + + + +K W     L E+  ++ Y++  +VI++LQ ++ L  +A L  
Sbjct  357  LKYIFESQPLTQYMCIYVKNWLERCKLTEQ--ISTYSITLMVIYFLQLQALLPPIAMLQI  414

Query  597  E--KNESQLICGWETGVAQPKNNNKSEQS-------ILTLLMGFFQFYTNFDYQHYIICP  647
            E   N++ L+  W    AQ   +    Q        I   L  FF ++  FDY+H+++CP
Sbjct  415  EDAANQAVLVGPWVVNFAQKSFSELGLQQLKATVPVIKGFLRNFFAYFAKFDYEHFLVCP  474

Query  648  LMGQPIAKRAFVETNVLPKEMKHYTKHLRTSKNPE-YFRIDSPLCVQDPFELSYNLTKAV  706
             +GQ   + A +E       M H       S NPE   ++  P+ VQDP +L++N+TKAV
Sbjct  475  YIGQANVEIAKIE------RMLHARYSAYVSDNPECSIQLKKPMVVQDPIQLNHNVTKAV  528

Query  707  TNITLRYFKQYCQESLCIL  725
            T   L+ F  YCQ++  +L
Sbjct  529  TKYGLQTFVDYCQQTAELL  547


>Q09409_CAEEL unnamed protein product
Length=1425

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 97/340 (29%), Positives = 162/340 (48%), Gaps = 59/340 (17%)

Query  386   PDDMKRMLTQIDEV--SDILFQQTQALLNDNISQEVKQSLENSVKLYFPTVKGFIFGSRV  443
             P+D+K +   ID+    +IL ++   +L+  I  E++  L    K Y   V    FGS +
Sbjct  1003  PEDLKDIDDMIDKYYHENILDERRLKMLDHKID-ELQSFLR---KNYREDVTLTTFGSVM  1058

Query  444   TGLGFPNSDIDIYLDCENTYGQDTLHDNQDNDTSAQTHFMLIKKILQEQKGEWEIKQIVE  503
             TGL    SDIDI L     +G     D    D +A+      + +L++      ++ IV 
Sbjct  1059  TGLSVNCSDIDICL----RFGDG---DVPPKDLTAKEVIQKTESVLRKCHLVKRVQAIV-  1110

Query  504   KAKVPIIKLIYK-RNGLHCDVSIT--NGLPVENSKLIRSFNNAYLPCR---KLILVIKKW  557
              AKVPI+K   K  NG   DV I+  N L + N+ L++ ++  + P +   KL L +K W
Sbjct  1111  TAKVPIVKFQVKLSNGAIIDVDISYYNILAIYNTALLKEYS-LWTPDKRFAKLALFVKTW  1169

Query  558   FS--YINLPEKHGLTNYALAWLVIFYLQR--KSYLESVAELIQEKN-ESQLICGWETGVA  612
                  I    +  L++Y    ++I YLQ      L  + E  +  N E +L+  W+T  A
Sbjct  1170  AKNCEIGDASRGSLSSYCHVIMLISYLQNCDPPVLPRLQEDFRSDNRERRLVDNWDTSFA  1229

Query  613   QPKNN-----NKSEQSILTLLMGFFQFYTNFDYQHYII-CPLMGQPIAKRAFVETNVLPK  666
             Q + +      K+++S   LL+G+F +Y+ FD++++++ C        +R      +L K
Sbjct  1230  QVETSLLQRWPKNKESCAQLLIGYFDYYSRFDFRNFVVQC--------RREM----ILSK  1277

Query  667   EMKHYTKHLRTSKNPEYFRIDSPLCVQDPFELSYNLTKAV  706
               K + +               PLCV+DPF+LS+NL+  V
Sbjct  1278  MEKEWPR---------------PLCVEDPFDLSHNLSSGV  1302


>PAPD1_DROME unnamed protein product
Length=612

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 63/260 (24%), Positives = 119/260 (46%), Gaps = 28/260 (11%)

Query  423  LENSVKLYFPTVKGFIFGSRVTGLGFPNSDIDIYLDCENTYGQD--------------TL  468
            ++ ++   FP  +   FGS V G G    D+D+ L  ++  G                T 
Sbjct  201  VQQAIAGMFPAAQAQPFGSSVNGFGRMGCDLDLILRFDSDMGAKIPLEAAVPSRLVYHTK  260

Query  469  HDNQDNDTSAQTHFMLIKKILQE-QKGEWEIKQIVEKAKVPIIKLIYKRNGLHCDVSITN  527
             +  +  +  Q H      +L     G   +++I++ A+VPIIK  ++   L  D+S++N
Sbjct  261  ENLSNGRSQTQRHMECFGDMLHLFLPGVCHVRRILQ-ARVPIIKYHHEHLDLEVDLSMSN  319

Query  528  GLPVENSKLIRSFNNAYLPCRKLILVIKKWF---SYINLPEKHGLTNYALAWLVIFYLQ-  583
                  S+L+  F       R L   I++W       N      ++N++L  LV+F+LQ 
Sbjct  320  LTGFYMSELLYMFGEMDPRVRPLTFTIRRWAQTCGLTNPSPGRWISNFSLTCLVMFFLQQ  379

Query  584  -RKSYLESVAELIQ--EKNESQLI-----CGWETGVAQPKNNNKSEQSILTLLMGFFQFY  635
             R+  L ++  L +  E  +S++      C +   V +    ++++ S+  LL+ FF+FY
Sbjct  380  LRQPILPTIGALAKAAEPGDSRVTEDGINCTFTRNVDRLGFRSRNQSSLSELLLQFFEFY  439

Query  636  TNFDYQHYIICPLMGQPIAK  655
            + FD+ +  I    G+P++K
Sbjct  440  SQFDFHNRAISLNEGKPLSK  459



Lambda      K        H
   0.312    0.130    0.379 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9367064200


Query= XP_050573107.1 uncharacterized protein LOC126913886 isoform X3
[Bombus affinis]

Length=726
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TUTT_DROME  unnamed protein product                                   139     1e-34
Q09409_CAEEL  unnamed protein product                                 83.6    3e-16
PAPD1_DROME  unnamed protein product                                  74.7    1e-13


>TUTT_DROME unnamed protein product
Length=560

 Score = 139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 94/319 (29%), Positives = 165/319 (52%), Gaps = 26/319 (8%)

Query  415  VKQSLENSVKLYFP--TVKGFIFGSRVTGLGFPNSDIDIYLDCENTYGQDTLHDNQDNDT  472
            ++Q L   +   FP   ++ + FGSR+TG+G  +SD+D+++D  NT+   T      N T
Sbjct  243  IEQDLCKLLSPGFPKQPLRVYKFGSRITGIGNRSSDLDLFVDIGNTF--HTFEHRASNAT  300

Query  473  SAQTHFMLIKKILQEQKGEWEIKQIVEKAKVPIIKLIYKRNGLHCDVSITNGLPVENSKL  532
             A+   M  +K   + + +W +   +E+A+VPIIK  +   G+ CD+ + N +   N+ L
Sbjct  301  VAKLRAM--RKFFCDSE-DWRLINFIEQARVPIIKTCHLPTGIECDICL-NSMGFCNTNL  356

Query  533  IRSFNNAYLPCRKLILVIKKWFSYINLPEKHGLTNYALAWLVIFYLQRKSYLESVAELIQ  592
            ++    +    + + + +K W     L E+  ++ Y++  +VI++LQ ++ L  +A L  
Sbjct  357  LKYIFESQPLTQYMCIYVKNWLERCKLTEQ--ISTYSITLMVIYFLQLQALLPPIAMLQI  414

Query  593  E--KNESQLICGWETGVAQPKNNNKSEQS-------ILTLLMGFFQFYTNFDYQHYIICP  643
            E   N++ L+  W    AQ   +    Q        I   L  FF ++  FDY+H+++CP
Sbjct  415  EDAANQAVLVGPWVVNFAQKSFSELGLQQLKATVPVIKGFLRNFFAYFAKFDYEHFLVCP  474

Query  644  LMGQPIAKRAFVETNVLPKEMKHYTKHLRTSKNPE-YFRIDSPLCVQDPFELSYNLTKAV  702
             +GQ   + A +E       M H       S NPE   ++  P+ VQDP +L++N+TKAV
Sbjct  475  YIGQANVEIAKIE------RMLHARYSAYVSDNPECSIQLKKPMVVQDPIQLNHNVTKAV  528

Query  703  TNITLRYFKQYCQESLCIL  721
            T   L+ F  YCQ++  +L
Sbjct  529  TKYGLQTFVDYCQQTAELL  547


>Q09409_CAEEL unnamed protein product
Length=1425

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 97/340 (29%), Positives = 162/340 (48%), Gaps = 59/340 (17%)

Query  382   PDDMKRMLTQIDEV--SDILFQQTQALLNDNISQEVKQSLENSVKLYFPTVKGFIFGSRV  439
             P+D+K +   ID+    +IL ++   +L+  I  E++  L    K Y   V    FGS +
Sbjct  1003  PEDLKDIDDMIDKYYHENILDERRLKMLDHKID-ELQSFLR---KNYREDVTLTTFGSVM  1058

Query  440   TGLGFPNSDIDIYLDCENTYGQDTLHDNQDNDTSAQTHFMLIKKILQEQKGEWEIKQIVE  499
             TGL    SDIDI L     +G     D    D +A+      + +L++      ++ IV 
Sbjct  1059  TGLSVNCSDIDICL----RFGDG---DVPPKDLTAKEVIQKTESVLRKCHLVKRVQAIV-  1110

Query  500   KAKVPIIKLIYK-RNGLHCDVSIT--NGLPVENSKLIRSFNNAYLPCR---KLILVIKKW  553
              AKVPI+K   K  NG   DV I+  N L + N+ L++ ++  + P +   KL L +K W
Sbjct  1111  TAKVPIVKFQVKLSNGAIIDVDISYYNILAIYNTALLKEYS-LWTPDKRFAKLALFVKTW  1169

Query  554   FS--YINLPEKHGLTNYALAWLVIFYLQR--KSYLESVAELIQEKN-ESQLICGWETGVA  608
                  I    +  L++Y    ++I YLQ      L  + E  +  N E +L+  W+T  A
Sbjct  1170  AKNCEIGDASRGSLSSYCHVIMLISYLQNCDPPVLPRLQEDFRSDNRERRLVDNWDTSFA  1229

Query  609   QPKNN-----NKSEQSILTLLMGFFQFYTNFDYQHYII-CPLMGQPIAKRAFVETNVLPK  662
             Q + +      K+++S   LL+G+F +Y+ FD++++++ C        +R      +L K
Sbjct  1230  QVETSLLQRWPKNKESCAQLLIGYFDYYSRFDFRNFVVQC--------RREM----ILSK  1277

Query  663   EMKHYTKHLRTSKNPEYFRIDSPLCVQDPFELSYNLTKAV  702
               K + +               PLCV+DPF+LS+NL+  V
Sbjct  1278  MEKEWPR---------------PLCVEDPFDLSHNLSSGV  1302


>PAPD1_DROME unnamed protein product
Length=612

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 63/260 (24%), Positives = 119/260 (46%), Gaps = 28/260 (11%)

Query  419  LENSVKLYFPTVKGFIFGSRVTGLGFPNSDIDIYLDCENTYGQD--------------TL  464
            ++ ++   FP  +   FGS V G G    D+D+ L  ++  G                T 
Sbjct  201  VQQAIAGMFPAAQAQPFGSSVNGFGRMGCDLDLILRFDSDMGAKIPLEAAVPSRLVYHTK  260

Query  465  HDNQDNDTSAQTHFMLIKKILQE-QKGEWEIKQIVEKAKVPIIKLIYKRNGLHCDVSITN  523
             +  +  +  Q H      +L     G   +++I++ A+VPIIK  ++   L  D+S++N
Sbjct  261  ENLSNGRSQTQRHMECFGDMLHLFLPGVCHVRRILQ-ARVPIIKYHHEHLDLEVDLSMSN  319

Query  524  GLPVENSKLIRSFNNAYLPCRKLILVIKKWF---SYINLPEKHGLTNYALAWLVIFYLQ-  579
                  S+L+  F       R L   I++W       N      ++N++L  LV+F+LQ 
Sbjct  320  LTGFYMSELLYMFGEMDPRVRPLTFTIRRWAQTCGLTNPSPGRWISNFSLTCLVMFFLQQ  379

Query  580  -RKSYLESVAELIQ--EKNESQLI-----CGWETGVAQPKNNNKSEQSILTLLMGFFQFY  631
             R+  L ++  L +  E  +S++      C +   V +    ++++ S+  LL+ FF+FY
Sbjct  380  LRQPILPTIGALAKAAEPGDSRVTEDGINCTFTRNVDRLGFRSRNQSSLSELLLQFFEFY  439

Query  632  TNFDYQHYIICPLMGQPIAK  651
            + FD+ +  I    G+P++K
Sbjct  440  SQFDFHNRAISLNEGKPLSK  459



Lambda      K        H
   0.312    0.130    0.379 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9367064200


Query= XP_050573108.1 uncharacterized protein LOC126913886 isoform X4
[Bombus affinis]

Length=682
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TUTT_DROME  unnamed protein product                                   139     9e-35
Q09409_CAEEL  unnamed protein product                                 83.6    3e-16
PAPD1_DROME  unnamed protein product                                  74.7    9e-14


>TUTT_DROME unnamed protein product
Length=560

 Score = 139 bits (351),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 94/319 (29%), Positives = 165/319 (52%), Gaps = 26/319 (8%)

Query  371  VKQSLENSVKLYFP--TVKGFIFGSRVTGLGFPNSDIDIYLDCENTYGQDTLHDNQDNDT  428
            ++Q L   +   FP   ++ + FGSR+TG+G  +SD+D+++D  NT+   T      N T
Sbjct  243  IEQDLCKLLSPGFPKQPLRVYKFGSRITGIGNRSSDLDLFVDIGNTF--HTFEHRASNAT  300

Query  429  SAQTHFMLIKKILQEQKGEWEIKQIVEKAKVPIIKLIYKRNGLHCDVSITNGLPVENSKL  488
             A+   M  +K   + + +W +   +E+A+VPIIK  +   G+ CD+ + N +   N+ L
Sbjct  301  VAKLRAM--RKFFCDSE-DWRLINFIEQARVPIIKTCHLPTGIECDICL-NSMGFCNTNL  356

Query  489  IRSFNNAYLPCRKLILVIKKWFSYINLPEKHGLTNYALAWLVIFYLQRKSYLESVAELIQ  548
            ++    +    + + + +K W     L E+  ++ Y++  +VI++LQ ++ L  +A L  
Sbjct  357  LKYIFESQPLTQYMCIYVKNWLERCKLTEQ--ISTYSITLMVIYFLQLQALLPPIAMLQI  414

Query  549  E--KNESQLICGWETGVAQPKNNNKSEQS-------ILTLLMGFFQFYTNFDYQHYIICP  599
            E   N++ L+  W    AQ   +    Q        I   L  FF ++  FDY+H+++CP
Sbjct  415  EDAANQAVLVGPWVVNFAQKSFSELGLQQLKATVPVIKGFLRNFFAYFAKFDYEHFLVCP  474

Query  600  LMGQPIAKRAFVETNVLPKEMKHYTKHLRTSKNPE-YFRIDSPLCVQDPFELSYNLTKAV  658
             +GQ   + A +E       M H       S NPE   ++  P+ VQDP +L++N+TKAV
Sbjct  475  YIGQANVEIAKIE------RMLHARYSAYVSDNPECSIQLKKPMVVQDPIQLNHNVTKAV  528

Query  659  TNITLRYFKQYCQESLCIL  677
            T   L+ F  YCQ++  +L
Sbjct  529  TKYGLQTFVDYCQQTAELL  547


>Q09409_CAEEL unnamed protein product
Length=1425

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 97/340 (29%), Positives = 162/340 (48%), Gaps = 59/340 (17%)

Query  338   PDDMKRMLTQIDEV--SDILFQQTQALLNDNISQEVKQSLENSVKLYFPTVKGFIFGSRV  395
             P+D+K +   ID+    +IL ++   +L+  I  E++  L    K Y   V    FGS +
Sbjct  1003  PEDLKDIDDMIDKYYHENILDERRLKMLDHKID-ELQSFLR---KNYREDVTLTTFGSVM  1058

Query  396   TGLGFPNSDIDIYLDCENTYGQDTLHDNQDNDTSAQTHFMLIKKILQEQKGEWEIKQIVE  455
             TGL    SDIDI L     +G     D    D +A+      + +L++      ++ IV 
Sbjct  1059  TGLSVNCSDIDICL----RFGDG---DVPPKDLTAKEVIQKTESVLRKCHLVKRVQAIV-  1110

Query  456   KAKVPIIKLIYK-RNGLHCDVSIT--NGLPVENSKLIRSFNNAYLPCR---KLILVIKKW  509
              AKVPI+K   K  NG   DV I+  N L + N+ L++ ++  + P +   KL L +K W
Sbjct  1111  TAKVPIVKFQVKLSNGAIIDVDISYYNILAIYNTALLKEYS-LWTPDKRFAKLALFVKTW  1169

Query  510   FS--YINLPEKHGLTNYALAWLVIFYLQR--KSYLESVAELIQEKN-ESQLICGWETGVA  564
                  I    +  L++Y    ++I YLQ      L  + E  +  N E +L+  W+T  A
Sbjct  1170  AKNCEIGDASRGSLSSYCHVIMLISYLQNCDPPVLPRLQEDFRSDNRERRLVDNWDTSFA  1229

Query  565   QPKNN-----NKSEQSILTLLMGFFQFYTNFDYQHYII-CPLMGQPIAKRAFVETNVLPK  618
             Q + +      K+++S   LL+G+F +Y+ FD++++++ C        +R      +L K
Sbjct  1230  QVETSLLQRWPKNKESCAQLLIGYFDYYSRFDFRNFVVQC--------RREM----ILSK  1277

Query  619   EMKHYTKHLRTSKNPEYFRIDSPLCVQDPFELSYNLTKAV  658
               K + +               PLCV+DPF+LS+NL+  V
Sbjct  1278  MEKEWPR---------------PLCVEDPFDLSHNLSSGV  1302


>PAPD1_DROME unnamed protein product
Length=612

 Score = 74.7 bits (182),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 63/260 (24%), Positives = 119/260 (46%), Gaps = 28/260 (11%)

Query  375  LENSVKLYFPTVKGFIFGSRVTGLGFPNSDIDIYLDCENTYGQD--------------TL  420
            ++ ++   FP  +   FGS V G G    D+D+ L  ++  G                T 
Sbjct  201  VQQAIAGMFPAAQAQPFGSSVNGFGRMGCDLDLILRFDSDMGAKIPLEAAVPSRLVYHTK  260

Query  421  HDNQDNDTSAQTHFMLIKKILQE-QKGEWEIKQIVEKAKVPIIKLIYKRNGLHCDVSITN  479
             +  +  +  Q H      +L     G   +++I++ A+VPIIK  ++   L  D+S++N
Sbjct  261  ENLSNGRSQTQRHMECFGDMLHLFLPGVCHVRRILQ-ARVPIIKYHHEHLDLEVDLSMSN  319

Query  480  GLPVENSKLIRSFNNAYLPCRKLILVIKKWF---SYINLPEKHGLTNYALAWLVIFYLQ-  535
                  S+L+  F       R L   I++W       N      ++N++L  LV+F+LQ 
Sbjct  320  LTGFYMSELLYMFGEMDPRVRPLTFTIRRWAQTCGLTNPSPGRWISNFSLTCLVMFFLQQ  379

Query  536  -RKSYLESVAELIQ--EKNESQLI-----CGWETGVAQPKNNNKSEQSILTLLMGFFQFY  587
             R+  L ++  L +  E  +S++      C +   V +    ++++ S+  LL+ FF+FY
Sbjct  380  LRQPILPTIGALAKAAEPGDSRVTEDGINCTFTRNVDRLGFRSRNQSSLSELLLQFFEFY  439

Query  588  TNFDYQHYIICPLMGQPIAK  607
            + FD+ +  I    G+P++K
Sbjct  440  SQFDFHNRAISLNEGKPLSK  459



Lambda      K        H
   0.312    0.130    0.379 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9367064200


Query= XP_050573109.1 myeloid zinc finger 1-like isoform X1 [Bombus
affinis]

Length=740
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9PGG2_DROME  unnamed protein product                                 587     0.0  
Q7KAH0_DROME  unnamed protein product                                 585     0.0  
M9NFP1_DROME  unnamed protein product                                 577     0.0  


>M9PGG2_DROME unnamed protein product
Length=938

 Score = 587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/399 (72%), Positives = 313/399 (78%), Gaps = 47/399 (12%)

Query  282  VQQSGKSGKGA--------NSDLRLFKCLTCGKDFKQKSTLLQHERIHTDSRPYGCPECG  333
            V   G++G G         +SDLRLFKCLTCGKDFKQKSTLLQH+RIHTD+RP+ C ECG
Sbjct  304  VTSGGRTGNGPGRPHKNKPHSDLRLFKCLTCGKDFKQKSTLLQHDRIHTDARPFPCSECG  363

Query  334  KRFRQQSHLTQHLRIHANEKPYACVYCERTFRQRAILNQHLRIHSGEKPYQCPECGKHFR  393
            KRFRQQSHLTQHLRIHANEKP+ C YC R+FRQRAILNQH+RIHSGEKP+ CPECGKHFR
Sbjct  364  KRFRQQSHLTQHLRIHANEKPFTCPYCSRSFRQRAILNQHIRIHSGEKPFACPECGKHFR  423

Query  394  QKAILNQHVRTHQDVSPHLIFKNGMTPTLWPQDVPFPPEEG--KEEVASTFG---DTDTQ  448
            QKAILNQHVRTHQDVSPHLIFKNG  PTLWP DVPFP E+   K ++A T G   D D+Q
Sbjct  424  QKAILNQHVRTHQDVSPHLIFKNGPHPTLWPSDVPFPGEDNDTKGDIAGTGGGYHDEDSQ  483

Query  449  SGAFSPAPDANS-IQYPAYFKDPKGGNHAVFGAGGAGSFGALQYIKQQGGSKSCLPDVIQ  507
                   PD +  + YP+YFKD KG                          +  LP+V+Q
Sbjct  484  G-----TPDGSGGMHYPSYFKDGKG--------------------------QKILPEVLQ  512

Query  508  H--GRSAGMPLYVRCPICQKEFKQKSTLLQHGCIHIESRPYPCPECGKRFRQQSHLTQHL  565
            H   R A MPLYVRCPIC KEFKQK+TLLQHGCIHIESRPYPCPECGKRFRQQSHLTQHL
Sbjct  513  HIGVRPANMPLYVRCPICDKEFKQKTTLLQHGCIHIESRPYPCPECGKRFRQQSHLTQHL  572

Query  566  RIHTNEKPYGCVYCGRNFRQRTILNQHLRIHTGEKPYKCQQCGKDFRQKAILDQHTRTHQ  625
            RIHTNEKP+GC+YC R FRQRTILNQHLRIHTGEKPYKC QCGKDFRQKAILDQHTRTHQ
Sbjct  573  RIHTNEKPFGCMYCPRFFRQRTILNQHLRIHTGEKPYKCGQCGKDFRQKAILDQHTRTHQ  632

Query  626  GDRPFCCPMPNCRRRFATEPEVKKHIDNHMNPHAAKVRR  664
            GDRPFCCPMPNCRRRFATE EV KHIDNHMNP+  KVRR
Sbjct  633  GDRPFCCPMPNCRRRFATENEVTKHIDNHMNPNTTKVRR  671


>Q7KAH0_DROME unnamed protein product
Length=820

 Score = 585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/399 (72%), Positives = 313/399 (78%), Gaps = 47/399 (12%)

Query  282  VQQSGKSGKGA--------NSDLRLFKCLTCGKDFKQKSTLLQHERIHTDSRPYGCPECG  333
            V   G++G G         +SDLRLFKCLTCGKDFKQKSTLLQH+RIHTD+RP+ C ECG
Sbjct  304  VTSGGRTGNGPGRPHKNKPHSDLRLFKCLTCGKDFKQKSTLLQHDRIHTDARPFPCSECG  363

Query  334  KRFRQQSHLTQHLRIHANEKPYACVYCERTFRQRAILNQHLRIHSGEKPYQCPECGKHFR  393
            KRFRQQSHLTQHLRIHANEKP+ C YC R+FRQRAILNQH+RIHSGEKP+ CPECGKHFR
Sbjct  364  KRFRQQSHLTQHLRIHANEKPFTCPYCSRSFRQRAILNQHIRIHSGEKPFACPECGKHFR  423

Query  394  QKAILNQHVRTHQDVSPHLIFKNGMTPTLWPQDVPFPPEEG--KEEVASTFG---DTDTQ  448
            QKAILNQHVRTHQDVSPHLIFKNG  PTLWP DVPFP E+   K ++A T G   D D+Q
Sbjct  424  QKAILNQHVRTHQDVSPHLIFKNGPHPTLWPSDVPFPGEDNDTKGDIAGTGGGYHDEDSQ  483

Query  449  SGAFSPAPDANS-IQYPAYFKDPKGGNHAVFGAGGAGSFGALQYIKQQGGSKSCLPDVIQ  507
                   PD +  + YP+YFKD KG                          +  LP+V+Q
Sbjct  484  G-----TPDGSGGMHYPSYFKDGKG--------------------------QKILPEVLQ  512

Query  508  H--GRSAGMPLYVRCPICQKEFKQKSTLLQHGCIHIESRPYPCPECGKRFRQQSHLTQHL  565
            H   R A MPLYVRCPIC KEFKQK+TLLQHGCIHIESRPYPCPECGKRFRQQSHLTQHL
Sbjct  513  HIGVRPANMPLYVRCPICDKEFKQKTTLLQHGCIHIESRPYPCPECGKRFRQQSHLTQHL  572

Query  566  RIHTNEKPYGCVYCGRNFRQRTILNQHLRIHTGEKPYKCQQCGKDFRQKAILDQHTRTHQ  625
            RIHTNEKP+GC+YC R FRQRTILNQHLRIHTGEKPYKC QCGKDFRQKAILDQHTRTHQ
Sbjct  573  RIHTNEKPFGCMYCPRFFRQRTILNQHLRIHTGEKPYKCGQCGKDFRQKAILDQHTRTHQ  632

Query  626  GDRPFCCPMPNCRRRFATEPEVKKHIDNHMNPHAAKVRR  664
            GDRPFCCPMPNCRRRFATE EV KHIDNHMNP+  KVRR
Sbjct  633  GDRPFCCPMPNCRRRFATENEVTKHIDNHMNPNTTKVRR  671


>M9NFP1_DROME unnamed protein product
Length=825

 Score = 577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/400 (73%), Positives = 314/400 (79%), Gaps = 44/400 (11%)

Query  282  VQQSGKSGKGA--------NSDLRLFKCLTCGKDFKQKSTLLQHERIHTDSRPYGCPECG  333
            V   G++G G         +SDLRLFKCLTCGKDFKQKSTLLQH+RIHTD+RP+ C ECG
Sbjct  304  VTSGGRTGNGPGRPHKNKPHSDLRLFKCLTCGKDFKQKSTLLQHDRIHTDARPFPCSECG  363

Query  334  KRFRQQSHLTQHLRIHANEKPYACVYCERTFRQRAILNQHLRIHSGEKPYQCPECGKHFR  393
            KRFRQQSHLTQHLRIHANEKP+ C YC R+FRQRAILNQH+RIHSGEKP+ CPECGKHFR
Sbjct  364  KRFRQQSHLTQHLRIHANEKPFTCPYCSRSFRQRAILNQHIRIHSGEKPFACPECGKHFR  423

Query  394  QKAILNQHVRTHQDVSPHLIFKNGMTPTLWPQDVPFPPEEG--KEEVASTFG---DTDTQ  448
            QKAILNQHVRTHQDVSPHLIFKNG  PTLWP DVPFP E+   K ++A T G   D D+Q
Sbjct  424  QKAILNQHVRTHQDVSPHLIFKNGPHPTLWPSDVPFPGEDNDTKGDIAGTGGGYHDEDSQ  483

Query  449  SGAFSPAPDAN-SIQYPAYFKDPKGGNHAVFGAGGAGSFGALQYIKQQGGSKSCLPDVIQ  507
                   PD +  + YP+YFKD K                       + G K  LP+V+Q
Sbjct  484  G-----TPDGSGGMHYPSYFKDGK---------------------DPRTGQK-ILPEVLQ  516

Query  508  H--GRSAGMPLYVRCPICQKEFKQKSTLLQHGCIHIESRPYPCPECGKRFRQQSHLTQHL  565
            H   R A MPLYVRCPIC KEFKQK+TLLQHGCIHIESRPYPCPECGKRFRQQSHLTQHL
Sbjct  517  HIGVRPANMPLYVRCPICDKEFKQKTTLLQHGCIHIESRPYPCPECGKRFRQQSHLTQHL  576

Query  566  RIHTNEKPYGCVYCGRNFRQRTILNQHLRIHTGEKPYKCQQCGKDFRQKAILDQHTRTHQ  625
            RIHTNEKP+GC+YC R FRQRTILNQHLRIHTGEKPYKC QCGKDFRQKAILDQHTRTHQ
Sbjct  577  RIHTNEKPFGCMYCPRFFRQRTILNQHLRIHTGEKPYKCGQCGKDFRQKAILDQHTRTHQ  636

Query  626  -GDRPFCCPMPNCRRRFATEPEVKKHIDNHMNPHAAKVRR  664
             GDRPFCCPMPNCRRRFATE EV KHIDNHMNP+  KVRR
Sbjct  637  VGDRPFCCPMPNCRRRFATENEVTKHIDNHMNPNTTKVRR  676



Lambda      K        H
   0.312    0.130    0.379 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9367064200


Query= XP_050573110.1 myeloid zinc finger 1-like isoform X2 [Bombus
affinis]

Length=717
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9PGG2_DROME  unnamed protein product                                 585     0.0  
Q7KAH0_DROME  unnamed protein product                                 583     0.0  
M9NFP1_DROME  unnamed protein product                                 575     0.0  


>M9PGG2_DROME unnamed protein product
Length=938

 Score = 585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/399 (72%), Positives = 313/399 (78%), Gaps = 47/399 (12%)

Query  259  VQQSGKSGKGA--------NSDLRLFKCLTCGKDFKQKSTLLQHERIHTDSRPYGCPECG  310
            V   G++G G         +SDLRLFKCLTCGKDFKQKSTLLQH+RIHTD+RP+ C ECG
Sbjct  304  VTSGGRTGNGPGRPHKNKPHSDLRLFKCLTCGKDFKQKSTLLQHDRIHTDARPFPCSECG  363

Query  311  KRFRQQSHLTQHLRIHANEKPYACVYCERTFRQRAILNQHLRIHSGEKPYQCPECGKHFR  370
            KRFRQQSHLTQHLRIHANEKP+ C YC R+FRQRAILNQH+RIHSGEKP+ CPECGKHFR
Sbjct  364  KRFRQQSHLTQHLRIHANEKPFTCPYCSRSFRQRAILNQHIRIHSGEKPFACPECGKHFR  423

Query  371  QKAILNQHVRTHQDVSPHLIFKNGMTPTLWPQDVPFPPEEG--KEEVASTFG---DTDTQ  425
            QKAILNQHVRTHQDVSPHLIFKNG  PTLWP DVPFP E+   K ++A T G   D D+Q
Sbjct  424  QKAILNQHVRTHQDVSPHLIFKNGPHPTLWPSDVPFPGEDNDTKGDIAGTGGGYHDEDSQ  483

Query  426  SGAFSPAPDANS-IQYPAYFKDPKGGNHAVFGAGGAGSFGALQYIKQQGGSKSCLPDVIQ  484
                   PD +  + YP+YFKD KG                          +  LP+V+Q
Sbjct  484  G-----TPDGSGGMHYPSYFKDGKG--------------------------QKILPEVLQ  512

Query  485  H--GRSAGMPLYVRCPICQKEFKQKSTLLQHGCIHIESRPYPCPECGKRFRQQSHLTQHL  542
            H   R A MPLYVRCPIC KEFKQK+TLLQHGCIHIESRPYPCPECGKRFRQQSHLTQHL
Sbjct  513  HIGVRPANMPLYVRCPICDKEFKQKTTLLQHGCIHIESRPYPCPECGKRFRQQSHLTQHL  572

Query  543  RIHTNEKPYGCVYCGRNFRQRTILNQHLRIHTGEKPYKCQQCGKDFRQKAILDQHTRTHQ  602
            RIHTNEKP+GC+YC R FRQRTILNQHLRIHTGEKPYKC QCGKDFRQKAILDQHTRTHQ
Sbjct  573  RIHTNEKPFGCMYCPRFFRQRTILNQHLRIHTGEKPYKCGQCGKDFRQKAILDQHTRTHQ  632

Query  603  GDRPFCCPMPNCRRRFATEPEVKKHIDNHMNPHAAKVRR  641
            GDRPFCCPMPNCRRRFATE EV KHIDNHMNP+  KVRR
Sbjct  633  GDRPFCCPMPNCRRRFATENEVTKHIDNHMNPNTTKVRR  671


>Q7KAH0_DROME unnamed protein product
Length=820

 Score = 583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/399 (72%), Positives = 313/399 (78%), Gaps = 47/399 (12%)

Query  259  VQQSGKSGKGA--------NSDLRLFKCLTCGKDFKQKSTLLQHERIHTDSRPYGCPECG  310
            V   G++G G         +SDLRLFKCLTCGKDFKQKSTLLQH+RIHTD+RP+ C ECG
Sbjct  304  VTSGGRTGNGPGRPHKNKPHSDLRLFKCLTCGKDFKQKSTLLQHDRIHTDARPFPCSECG  363

Query  311  KRFRQQSHLTQHLRIHANEKPYACVYCERTFRQRAILNQHLRIHSGEKPYQCPECGKHFR  370
            KRFRQQSHLTQHLRIHANEKP+ C YC R+FRQRAILNQH+RIHSGEKP+ CPECGKHFR
Sbjct  364  KRFRQQSHLTQHLRIHANEKPFTCPYCSRSFRQRAILNQHIRIHSGEKPFACPECGKHFR  423

Query  371  QKAILNQHVRTHQDVSPHLIFKNGMTPTLWPQDVPFPPEEG--KEEVASTFG---DTDTQ  425
            QKAILNQHVRTHQDVSPHLIFKNG  PTLWP DVPFP E+   K ++A T G   D D+Q
Sbjct  424  QKAILNQHVRTHQDVSPHLIFKNGPHPTLWPSDVPFPGEDNDTKGDIAGTGGGYHDEDSQ  483

Query  426  SGAFSPAPDANS-IQYPAYFKDPKGGNHAVFGAGGAGSFGALQYIKQQGGSKSCLPDVIQ  484
                   PD +  + YP+YFKD KG                          +  LP+V+Q
Sbjct  484  G-----TPDGSGGMHYPSYFKDGKG--------------------------QKILPEVLQ  512

Query  485  H--GRSAGMPLYVRCPICQKEFKQKSTLLQHGCIHIESRPYPCPECGKRFRQQSHLTQHL  542
            H   R A MPLYVRCPIC KEFKQK+TLLQHGCIHIESRPYPCPECGKRFRQQSHLTQHL
Sbjct  513  HIGVRPANMPLYVRCPICDKEFKQKTTLLQHGCIHIESRPYPCPECGKRFRQQSHLTQHL  572

Query  543  RIHTNEKPYGCVYCGRNFRQRTILNQHLRIHTGEKPYKCQQCGKDFRQKAILDQHTRTHQ  602
            RIHTNEKP+GC+YC R FRQRTILNQHLRIHTGEKPYKC QCGKDFRQKAILDQHTRTHQ
Sbjct  573  RIHTNEKPFGCMYCPRFFRQRTILNQHLRIHTGEKPYKCGQCGKDFRQKAILDQHTRTHQ  632

Query  603  GDRPFCCPMPNCRRRFATEPEVKKHIDNHMNPHAAKVRR  641
            GDRPFCCPMPNCRRRFATE EV KHIDNHMNP+  KVRR
Sbjct  633  GDRPFCCPMPNCRRRFATENEVTKHIDNHMNPNTTKVRR  671


>M9NFP1_DROME unnamed protein product
Length=825

 Score = 575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/400 (73%), Positives = 314/400 (79%), Gaps = 44/400 (11%)

Query  259  VQQSGKSGKGA--------NSDLRLFKCLTCGKDFKQKSTLLQHERIHTDSRPYGCPECG  310
            V   G++G G         +SDLRLFKCLTCGKDFKQKSTLLQH+RIHTD+RP+ C ECG
Sbjct  304  VTSGGRTGNGPGRPHKNKPHSDLRLFKCLTCGKDFKQKSTLLQHDRIHTDARPFPCSECG  363

Query  311  KRFRQQSHLTQHLRIHANEKPYACVYCERTFRQRAILNQHLRIHSGEKPYQCPECGKHFR  370
            KRFRQQSHLTQHLRIHANEKP+ C YC R+FRQRAILNQH+RIHSGEKP+ CPECGKHFR
Sbjct  364  KRFRQQSHLTQHLRIHANEKPFTCPYCSRSFRQRAILNQHIRIHSGEKPFACPECGKHFR  423

Query  371  QKAILNQHVRTHQDVSPHLIFKNGMTPTLWPQDVPFPPEEG--KEEVASTFG---DTDTQ  425
            QKAILNQHVRTHQDVSPHLIFKNG  PTLWP DVPFP E+   K ++A T G   D D+Q
Sbjct  424  QKAILNQHVRTHQDVSPHLIFKNGPHPTLWPSDVPFPGEDNDTKGDIAGTGGGYHDEDSQ  483

Query  426  SGAFSPAPDAN-SIQYPAYFKDPKGGNHAVFGAGGAGSFGALQYIKQQGGSKSCLPDVIQ  484
                   PD +  + YP+YFKD K                       + G K  LP+V+Q
Sbjct  484  G-----TPDGSGGMHYPSYFKDGK---------------------DPRTGQK-ILPEVLQ  516

Query  485  H--GRSAGMPLYVRCPICQKEFKQKSTLLQHGCIHIESRPYPCPECGKRFRQQSHLTQHL  542
            H   R A MPLYVRCPIC KEFKQK+TLLQHGCIHIESRPYPCPECGKRFRQQSHLTQHL
Sbjct  517  HIGVRPANMPLYVRCPICDKEFKQKTTLLQHGCIHIESRPYPCPECGKRFRQQSHLTQHL  576

Query  543  RIHTNEKPYGCVYCGRNFRQRTILNQHLRIHTGEKPYKCQQCGKDFRQKAILDQHTRTHQ  602
            RIHTNEKP+GC+YC R FRQRTILNQHLRIHTGEKPYKC QCGKDFRQKAILDQHTRTHQ
Sbjct  577  RIHTNEKPFGCMYCPRFFRQRTILNQHLRIHTGEKPYKCGQCGKDFRQKAILDQHTRTHQ  636

Query  603  -GDRPFCCPMPNCRRRFATEPEVKKHIDNHMNPHAAKVRR  641
             GDRPFCCPMPNCRRRFATE EV KHIDNHMNP+  KVRR
Sbjct  637  VGDRPFCCPMPNCRRRFATENEVTKHIDNHMNPNTTKVRR  676



Lambda      K        H
   0.312    0.130    0.379 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9367064200


Query= XP_050573111.1 myeloid zinc finger 1-like isoform X2 [Bombus
affinis]

Length=717
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9PGG2_DROME  unnamed protein product                                 585     0.0  
Q7KAH0_DROME  unnamed protein product                                 583     0.0  
M9NFP1_DROME  unnamed protein product                                 575     0.0  


>M9PGG2_DROME unnamed protein product
Length=938

 Score = 585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/399 (72%), Positives = 313/399 (78%), Gaps = 47/399 (12%)

Query  259  VQQSGKSGKGA--------NSDLRLFKCLTCGKDFKQKSTLLQHERIHTDSRPYGCPECG  310
            V   G++G G         +SDLRLFKCLTCGKDFKQKSTLLQH+RIHTD+RP+ C ECG
Sbjct  304  VTSGGRTGNGPGRPHKNKPHSDLRLFKCLTCGKDFKQKSTLLQHDRIHTDARPFPCSECG  363

Query  311  KRFRQQSHLTQHLRIHANEKPYACVYCERTFRQRAILNQHLRIHSGEKPYQCPECGKHFR  370
            KRFRQQSHLTQHLRIHANEKP+ C YC R+FRQRAILNQH+RIHSGEKP+ CPECGKHFR
Sbjct  364  KRFRQQSHLTQHLRIHANEKPFTCPYCSRSFRQRAILNQHIRIHSGEKPFACPECGKHFR  423

Query  371  QKAILNQHVRTHQDVSPHLIFKNGMTPTLWPQDVPFPPEEG--KEEVASTFG---DTDTQ  425
            QKAILNQHVRTHQDVSPHLIFKNG  PTLWP DVPFP E+   K ++A T G   D D+Q
Sbjct  424  QKAILNQHVRTHQDVSPHLIFKNGPHPTLWPSDVPFPGEDNDTKGDIAGTGGGYHDEDSQ  483

Query  426  SGAFSPAPDANS-IQYPAYFKDPKGGNHAVFGAGGAGSFGALQYIKQQGGSKSCLPDVIQ  484
                   PD +  + YP+YFKD KG                          +  LP+V+Q
Sbjct  484  G-----TPDGSGGMHYPSYFKDGKG--------------------------QKILPEVLQ  512

Query  485  H--GRSAGMPLYVRCPICQKEFKQKSTLLQHGCIHIESRPYPCPECGKRFRQQSHLTQHL  542
            H   R A MPLYVRCPIC KEFKQK+TLLQHGCIHIESRPYPCPECGKRFRQQSHLTQHL
Sbjct  513  HIGVRPANMPLYVRCPICDKEFKQKTTLLQHGCIHIESRPYPCPECGKRFRQQSHLTQHL  572

Query  543  RIHTNEKPYGCVYCGRNFRQRTILNQHLRIHTGEKPYKCQQCGKDFRQKAILDQHTRTHQ  602
            RIHTNEKP+GC+YC R FRQRTILNQHLRIHTGEKPYKC QCGKDFRQKAILDQHTRTHQ
Sbjct  573  RIHTNEKPFGCMYCPRFFRQRTILNQHLRIHTGEKPYKCGQCGKDFRQKAILDQHTRTHQ  632

Query  603  GDRPFCCPMPNCRRRFATEPEVKKHIDNHMNPHAAKVRR  641
            GDRPFCCPMPNCRRRFATE EV KHIDNHMNP+  KVRR
Sbjct  633  GDRPFCCPMPNCRRRFATENEVTKHIDNHMNPNTTKVRR  671


>Q7KAH0_DROME unnamed protein product
Length=820

 Score = 583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/399 (72%), Positives = 313/399 (78%), Gaps = 47/399 (12%)

Query  259  VQQSGKSGKGA--------NSDLRLFKCLTCGKDFKQKSTLLQHERIHTDSRPYGCPECG  310
            V   G++G G         +SDLRLFKCLTCGKDFKQKSTLLQH+RIHTD+RP+ C ECG
Sbjct  304  VTSGGRTGNGPGRPHKNKPHSDLRLFKCLTCGKDFKQKSTLLQHDRIHTDARPFPCSECG  363

Query  311  KRFRQQSHLTQHLRIHANEKPYACVYCERTFRQRAILNQHLRIHSGEKPYQCPECGKHFR  370
            KRFRQQSHLTQHLRIHANEKP+ C YC R+FRQRAILNQH+RIHSGEKP+ CPECGKHFR
Sbjct  364  KRFRQQSHLTQHLRIHANEKPFTCPYCSRSFRQRAILNQHIRIHSGEKPFACPECGKHFR  423

Query  371  QKAILNQHVRTHQDVSPHLIFKNGMTPTLWPQDVPFPPEEG--KEEVASTFG---DTDTQ  425
            QKAILNQHVRTHQDVSPHLIFKNG  PTLWP DVPFP E+   K ++A T G   D D+Q
Sbjct  424  QKAILNQHVRTHQDVSPHLIFKNGPHPTLWPSDVPFPGEDNDTKGDIAGTGGGYHDEDSQ  483

Query  426  SGAFSPAPDANS-IQYPAYFKDPKGGNHAVFGAGGAGSFGALQYIKQQGGSKSCLPDVIQ  484
                   PD +  + YP+YFKD KG                          +  LP+V+Q
Sbjct  484  G-----TPDGSGGMHYPSYFKDGKG--------------------------QKILPEVLQ  512

Query  485  H--GRSAGMPLYVRCPICQKEFKQKSTLLQHGCIHIESRPYPCPECGKRFRQQSHLTQHL  542
            H   R A MPLYVRCPIC KEFKQK+TLLQHGCIHIESRPYPCPECGKRFRQQSHLTQHL
Sbjct  513  HIGVRPANMPLYVRCPICDKEFKQKTTLLQHGCIHIESRPYPCPECGKRFRQQSHLTQHL  572

Query  543  RIHTNEKPYGCVYCGRNFRQRTILNQHLRIHTGEKPYKCQQCGKDFRQKAILDQHTRTHQ  602
            RIHTNEKP+GC+YC R FRQRTILNQHLRIHTGEKPYKC QCGKDFRQKAILDQHTRTHQ
Sbjct  573  RIHTNEKPFGCMYCPRFFRQRTILNQHLRIHTGEKPYKCGQCGKDFRQKAILDQHTRTHQ  632

Query  603  GDRPFCCPMPNCRRRFATEPEVKKHIDNHMNPHAAKVRR  641
            GDRPFCCPMPNCRRRFATE EV KHIDNHMNP+  KVRR
Sbjct  633  GDRPFCCPMPNCRRRFATENEVTKHIDNHMNPNTTKVRR  671


>M9NFP1_DROME unnamed protein product
Length=825

 Score = 575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/400 (73%), Positives = 314/400 (79%), Gaps = 44/400 (11%)

Query  259  VQQSGKSGKGA--------NSDLRLFKCLTCGKDFKQKSTLLQHERIHTDSRPYGCPECG  310
            V   G++G G         +SDLRLFKCLTCGKDFKQKSTLLQH+RIHTD+RP+ C ECG
Sbjct  304  VTSGGRTGNGPGRPHKNKPHSDLRLFKCLTCGKDFKQKSTLLQHDRIHTDARPFPCSECG  363

Query  311  KRFRQQSHLTQHLRIHANEKPYACVYCERTFRQRAILNQHLRIHSGEKPYQCPECGKHFR  370
            KRFRQQSHLTQHLRIHANEKP+ C YC R+FRQRAILNQH+RIHSGEKP+ CPECGKHFR
Sbjct  364  KRFRQQSHLTQHLRIHANEKPFTCPYCSRSFRQRAILNQHIRIHSGEKPFACPECGKHFR  423

Query  371  QKAILNQHVRTHQDVSPHLIFKNGMTPTLWPQDVPFPPEEG--KEEVASTFG---DTDTQ  425
            QKAILNQHVRTHQDVSPHLIFKNG  PTLWP DVPFP E+   K ++A T G   D D+Q
Sbjct  424  QKAILNQHVRTHQDVSPHLIFKNGPHPTLWPSDVPFPGEDNDTKGDIAGTGGGYHDEDSQ  483

Query  426  SGAFSPAPDAN-SIQYPAYFKDPKGGNHAVFGAGGAGSFGALQYIKQQGGSKSCLPDVIQ  484
                   PD +  + YP+YFKD K                       + G K  LP+V+Q
Sbjct  484  G-----TPDGSGGMHYPSYFKDGK---------------------DPRTGQK-ILPEVLQ  516

Query  485  H--GRSAGMPLYVRCPICQKEFKQKSTLLQHGCIHIESRPYPCPECGKRFRQQSHLTQHL  542
            H   R A MPLYVRCPIC KEFKQK+TLLQHGCIHIESRPYPCPECGKRFRQQSHLTQHL
Sbjct  517  HIGVRPANMPLYVRCPICDKEFKQKTTLLQHGCIHIESRPYPCPECGKRFRQQSHLTQHL  576

Query  543  RIHTNEKPYGCVYCGRNFRQRTILNQHLRIHTGEKPYKCQQCGKDFRQKAILDQHTRTHQ  602
            RIHTNEKP+GC+YC R FRQRTILNQHLRIHTGEKPYKC QCGKDFRQKAILDQHTRTHQ
Sbjct  577  RIHTNEKPFGCMYCPRFFRQRTILNQHLRIHTGEKPYKCGQCGKDFRQKAILDQHTRTHQ  636

Query  603  -GDRPFCCPMPNCRRRFATEPEVKKHIDNHMNPHAAKVRR  641
             GDRPFCCPMPNCRRRFATE EV KHIDNHMNP+  KVRR
Sbjct  637  VGDRPFCCPMPNCRRRFATENEVTKHIDNHMNPNTTKVRR  676



Lambda      K        H
   0.312    0.130    0.379 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9367064200


Query= XP_050573112.1 zinc finger protein 768-like isoform X3 [Bombus
affinis]

Length=712
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9PIL6_DROME  unnamed protein product                                 530     6e-179
M9PG92_DROME  unnamed protein product                                 526     4e-177
Q7KAH0_DROME  unnamed protein product                                 514     3e-172


>M9PIL6_DROME unnamed protein product
Length=792

 Score = 530 bits (1366),  Expect = 6e-179, Method: Compositional matrix adjust.
 Identities = 263/371 (71%), Positives = 286/371 (77%), Gaps = 47/371 (13%)

Query  282  VQQSGKSGKGA--------NSDLRLFKCLTCGKDFKQKSTLLQHERIHTDSRPYGCPECG  333
            V   G++G G         +SDLRLFKCLTCGKDFKQKSTLLQH+RIHTD+RP+ C ECG
Sbjct  304  VTSGGRTGNGPGRPHKNKPHSDLRLFKCLTCGKDFKQKSTLLQHDRIHTDARPFPCSECG  363

Query  334  KRFRQQSHLTQHLRIHANEKPYACVYCERTFRQRAILNQHLRIHSDVSPHLIFKNGMTPT  393
            KRFRQQSHLTQHLRIHANEKP+ C YC R+FRQRAILNQH+RIHSDVSPHLIFKNG  PT
Sbjct  364  KRFRQQSHLTQHLRIHANEKPFTCPYCSRSFRQRAILNQHIRIHSDVSPHLIFKNGPHPT  423

Query  394  LWPQDVPFPPEEG--KEEVASTFG---DTDTQSGAFSPAPDANS-IQYPAYFKDPKGGNH  447
            LWP DVPFP E+   K ++A T G   D D+Q       PD +  + YP+YFKD KG   
Sbjct  424  LWPSDVPFPGEDNDTKGDIAGTGGGYHDEDSQG-----TPDGSGGMHYPSYFKDGKG---  475

Query  448  AVFGAGGAGSFGALQYIKQQGGSKSCLPDVIQH--GRSAGMPLYVRCPICQKEFKQKSTL  505
                                   +  LP+V+QH   R A MPLYVRCPIC KEFKQK+TL
Sbjct  476  -----------------------QKILPEVLQHIGVRPANMPLYVRCPICDKEFKQKTTL  512

Query  506  LQHGCIHIESRPYPCPECGKRFRQQSHLTQHLRIHTNEKPYGCVYCGRNFRQRTILNQHL  565
            LQHGCIHIESRPYPCPECGKRFRQQSHLTQHLRIHTNEKP+GC+YC R FRQRTILNQHL
Sbjct  513  LQHGCIHIESRPYPCPECGKRFRQQSHLTQHLRIHTNEKPFGCMYCPRFFRQRTILNQHL  572

Query  566  RIHTGEKPYKCQQCGKDFRQKAILDQHTRTHQGDRPFCCPMPNCRRRFATEPEVKKHIDN  625
            RIHTGEKPYKC QCGKDFRQKAILDQHTRTHQGDRPFCCPMPNCRRRFATE EV KHIDN
Sbjct  573  RIHTGEKPYKCGQCGKDFRQKAILDQHTRTHQGDRPFCCPMPNCRRRFATENEVTKHIDN  632

Query  626  HMNPHAAKVRR  636
            HMNP+  KVRR
Sbjct  633  HMNPNTTKVRR  643


>M9PG92_DROME unnamed protein product
Length=794

 Score = 526 bits (1354),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 263/373 (71%), Positives = 286/373 (77%), Gaps = 49/373 (13%)

Query  282  VQQSGKSGKGA--------NSDLRLFKCLTCGKDFKQKSTLLQHERIHTDSRPYGCPECG  333
            V   G++G G         +SDLRLFKCLTCGKDFKQKSTLLQH+RIHTD+RP+ C ECG
Sbjct  304  VTSGGRTGNGPGRPHKNKPHSDLRLFKCLTCGKDFKQKSTLLQHDRIHTDARPFPCSECG  363

Query  334  KRFRQQSHLTQHLRIHANEKPYACVYCERTFRQRAILNQHLRIHSDVSPHLIFKNGMTPT  393
            KRFRQQSHLTQHLRIHANEKP+ C YC R+FRQRAILNQH+RIHSDVSPHLIFKNG  PT
Sbjct  364  KRFRQQSHLTQHLRIHANEKPFTCPYCSRSFRQRAILNQHIRIHSDVSPHLIFKNGPHPT  423

Query  394  LWPQDVPFPPEEG--KEEVASTFG---DTDTQSGAFSPAPDANS-IQYPAYFKDPKGGNH  447
            LWP DVPFP E+   K ++A T G   D D+Q       PD +  + YP+YFKD KG   
Sbjct  424  LWPSDVPFPGEDNDTKGDIAGTGGGYHDEDSQG-----TPDGSGGMHYPSYFKDGKG---  475

Query  448  AVFGAGGAGSFGALQYIKQQGGSKSCLPDVIQH--GRSAGMPLYVRCPICQKEFKQKSTL  505
                                   +  LP+V+QH   R A MPLYVRCPIC KEFKQK+TL
Sbjct  476  -----------------------QKILPEVLQHIGVRPANMPLYVRCPICDKEFKQKTTL  512

Query  506  LQHGCIHIESRPYPCPECGKRFRQQSHLTQHLRIHTNEKPYGCVYCGRNFRQRTILNQHL  565
            LQHGCIHIESRPYPCPECGKRFRQQSHLTQHLRIHTNEKP+GC+YC R FRQRTILNQHL
Sbjct  513  LQHGCIHIESRPYPCPECGKRFRQQSHLTQHLRIHTNEKPFGCMYCPRFFRQRTILNQHL  572

Query  566  RIHTGEKPYKCQQCGKDFRQKAILDQHTRTH--QGDRPFCCPMPNCRRRFATEPEVKKHI  623
            RIHTGEKPYKC QCGKDFRQKAILDQHTRTH  QGDRPFCCPMPNCRRRFATE EV KHI
Sbjct  573  RIHTGEKPYKCGQCGKDFRQKAILDQHTRTHQVQGDRPFCCPMPNCRRRFATENEVTKHI  632

Query  624  DNHMNPHAAKVRR  636
            DNHMNP+  KVRR
Sbjct  633  DNHMNPNTTKVRR  645


>Q7KAH0_DROME unnamed protein product
Length=820

 Score = 514 bits (1324),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 263/399 (66%), Positives = 286/399 (72%), Gaps = 75/399 (19%)

Query  282  VQQSGKSGKGA--------NSDLRLFKCLTCGKDFKQKSTLLQHERIHTDSRPYGCPECG  333
            V   G++G G         +SDLRLFKCLTCGKDFKQKSTLLQH+RIHTD+RP+ C ECG
Sbjct  304  VTSGGRTGNGPGRPHKNKPHSDLRLFKCLTCGKDFKQKSTLLQHDRIHTDARPFPCSECG  363

Query  334  KRFRQQSHLTQHLRIHANEKPYACVYCERTFRQRAILNQHLRIHS---------------  378
            KRFRQQSHLTQHLRIHANEKP+ C YC R+FRQRAILNQH+RIHS               
Sbjct  364  KRFRQQSHLTQHLRIHANEKPFTCPYCSRSFRQRAILNQHIRIHSGEKPFACPECGKHFR  423

Query  379  -------------DVSPHLIFKNGMTPTLWPQDVPFPPEEG--KEEVASTFG---DTDTQ  420
                         DVSPHLIFKNG  PTLWP DVPFP E+   K ++A T G   D D+Q
Sbjct  424  QKAILNQHVRTHQDVSPHLIFKNGPHPTLWPSDVPFPGEDNDTKGDIAGTGGGYHDEDSQ  483

Query  421  SGAFSPAPDAN-SIQYPAYFKDPKGGNHAVFGAGGAGSFGALQYIKQQGGSKSCLPDVIQ  479
                   PD +  + YP+YFKD KG                          +  LP+V+Q
Sbjct  484  G-----TPDGSGGMHYPSYFKDGKG--------------------------QKILPEVLQ  512

Query  480  H--GRSAGMPLYVRCPICQKEFKQKSTLLQHGCIHIESRPYPCPECGKRFRQQSHLTQHL  537
            H   R A MPLYVRCPIC KEFKQK+TLLQHGCIHIESRPYPCPECGKRFRQQSHLTQHL
Sbjct  513  HIGVRPANMPLYVRCPICDKEFKQKTTLLQHGCIHIESRPYPCPECGKRFRQQSHLTQHL  572

Query  538  RIHTNEKPYGCVYCGRNFRQRTILNQHLRIHTGEKPYKCQQCGKDFRQKAILDQHTRTHQ  597
            RIHTNEKP+GC+YC R FRQRTILNQHLRIHTGEKPYKC QCGKDFRQKAILDQHTRTHQ
Sbjct  573  RIHTNEKPFGCMYCPRFFRQRTILNQHLRIHTGEKPYKCGQCGKDFRQKAILDQHTRTHQ  632

Query  598  GDRPFCCPMPNCRRRFATEPEVKKHIDNHMNPHAAKVRR  636
            GDRPFCCPMPNCRRRFATE EV KHIDNHMNP+  KVRR
Sbjct  633  GDRPFCCPMPNCRRRFATENEVTKHIDNHMNPNTTKVRR  671



Lambda      K        H
   0.312    0.130    0.379 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9367064200


Query= XP_050573113.1 telomere length and silencing protein 1 homolog
[Bombus affinis]

Length=296


***** No hits found *****



Lambda      K        H
   0.312    0.130    0.379 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9367064200


Query= XP_050573114.1 uncharacterized protein LOC126913889 [Bombus affinis]

Length=691
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RBSK_LEIMA  unnamed protein product                                   32.0    1.8  
SIAS_DROME  unnamed protein product                                   32.0    1.9  


>RBSK_LEIMA unnamed protein product
Length=329

 Score = 32.0 bits (71),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 72/331 (22%), Positives = 127/331 (38%), Gaps = 51/331 (15%)

Query  355  IVIGGAIMDTTLQVKESEIKDDGRT-HAGRSRENCGGVGRNIANALINLGLNATRLISVV  413
            +V+G   +D    V    +   G T H+    +  GG G N A A   LG     ++S+V
Sbjct  19   LVVGSCFLDYVGYV--DHMPQVGETMHSESFHKGFGGKGANQAVAAGRLGAKVA-MVSMV  75

Query  414  GNDQPGKAIIKSL-GDGAQTVEQL--SNMNTARCTVIIDYKGECRFAVGEMEVFSSISPH  470
            G D  G   IK L  +G  T   L     +T    +++D K      V      +  +P 
Sbjct  76   GTDGDGSDYIKELERNGVHTAYMLRTGKSSTGLAMILVDTKSSNNEIVICPNATNYFTPE  135

Query  471  LVKKYQSYVE-----NSSFIVLDGNLPLDTIRYVLDLATCSKIPVWYEPTDVNKATKVFK  525
            L++   S  E        +++    +PL T    +  A    +   +      K  +V  
Sbjct  136  LLRAQTSNYEKILHTGLKYLICQNEIPLPTTLDTIKEAHSRGVYTVFNSAPAPKPAEV--  193

Query  526  AKSQWQNVLHFIS---PNRNELSAIGKYLGISVPDNKLSIDLEEVKTIAEQVAEFIPVVI  582
               Q +  L ++S   PN  E + I    G+ V D + +     +K + +Q+   +  V+
Sbjct  194  --EQIKPFLPYVSLFCPNEVEAALI---TGMKVTDTESA--FRAIKAL-QQLG--VRDVV  243

Query  583  STLGSQGVLVVRKALGSDPFYDKEGKLVAHTMVTSRLYPPLSFISDDPKETYNVSGCGDC  642
             TLG+ G  +     G++P +   GK V                     +  + +G GDC
Sbjct  244  ITLGAAGFALSEN--GAEPVH-VTGKHV---------------------KAVDTTGAGDC  279

Query  643  LTAGIIYGIHKNLDETSCLSLALKAAALSLT  673
                ++Y + +  +       A + AA+S+T
Sbjct  280  FVGSMVYFMSRGRNLLEACKRANECAAISVT  310


>SIAS_DROME unnamed protein product
Length=372

 Score = 32.0 bits (71),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 45/95 (47%), Gaps = 13/95 (14%)

Query  192  EKTLEYLETQGVPIIKI--GETNYFPAFYCTESLQKTKVPHRVSNS----EEATKILKAQ  245
            E++LE+L    VP IKI  G+ N FP      +L    +P  +S      +   +I++  
Sbjct  112  ERSLEFLSALNVPFIKIGSGDANNFPLLKKAANLN---LPLVISTGMQTMQTVERIVQTM  168

Query  246  RELGLQT-GLLFAVPIPTEYALDPKEMELAICNAL  279
            RE G +   L+  V   + Y  DPK+  L + + L
Sbjct  169  RESGKEDYALMHCV---SSYPTDPKDCSLQLISVL  200



Lambda      K        H
   0.312    0.130    0.379 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9367064200


Query= XP_050573115.1 endoribonuclease CG2145-like isoform X1 [Bombus
affinis]

Length=675
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ENDOU_DROME  unnamed protein product                                  294     1e-90
Q9VF14_DROME  unnamed protein product                                 188     4e-54
Q9GYM9_CAEEL  unnamed protein product                                 79.7    3e-15


>ENDOU_DROME unnamed protein product
Length=592

 Score = 294 bits (752),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 133/275 (48%), Positives = 199/275 (72%), Gaps = 5/275 (2%)

Query  402  SKGNAI-TDEDLEKLSEALFIKDNNNANRYITLNLQKQTSSSSTTDDAPQPLFTVNAEAY  460
            S GN++ TD+++ +L+E L+ K++N+    I +NLQ +T S  + D+AP PL TV+++A 
Sbjct  322  SSGNSVATDDEIRQLTELLYTKESNSQIGNIQVNLQGRTRSIDSADEAPNPLLTVDSKAL  381

Query  461  QGPTIQRVISIYDNYKPETNVNEHISPLQRQEESLLVDTFLSTNVMSYAMRFLADKGQIR  520
            + PTI ++  +++NY+ +T+VNEH++P +R+EE+  +D  ++T VM  AM FL  KG + 
Sbjct  382  ESPTIVKMRLLFNNYEHDTHVNEHVTPNERKEENDFLDAVMATPVMRQAMLFLQQKGVVS  441

Query  521  KDYYEYKDTLRKIWFNLFSRGQGKIGSSGFEHVFMAELKSVPSGTEVVGLHNWIFYSKEE  580
             D   ++D ++++WF  +SRGQGKIGSSGFEHVF+ E+K    GT ++G HNW++   EE
Sbjct  442  PDPKTHRDLVKELWFTQYSRGQGKIGSSGFEHVFVYEVK---DGT-IIGFHNWVYIGDEE  497

Query  581  SSGKANYAGYLNKIDLGDKASIVKIRTKYNGYDKPVTALFVGTSPELEMALYTVCFYARP  640
              G+ +Y GY+ + D+G K  IVKIR  + G +KPV  +FVGTSPELE+ALYTVCF  RP
Sbjct  498  KDGRFDYKGYMKEQDIGTKGKIVKIRFSHQGLNKPVNTVFVGTSPELELALYTVCFQLRP  557

Query  641  EGNCPVSLGGTKFNIVTYKFKYRGNDLVGTAYPDI  675
            +  CPVSLG +KF IVTY ++YRG +L+G+AYP+I
Sbjct  558  DRTCPVSLGNSKFGIVTYSWRYRGKNLIGSAYPEI  592


>Q9VF14_DROME unnamed protein product
Length=322

 Score = 188 bits (478),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 97/270 (36%), Positives = 158/270 (59%), Gaps = 9/270 (3%)

Query  410  EDLEKLSEALFIKDNNNANRYITLNLQKQTSSSSTTDDAPQPLFTVNAEAYQ---GPTIQ  466
            +D+  LS+ L+ ++   +     +NLQ +T+S +  D AP+ LF ++ +        T  
Sbjct  55   DDVLTLSKNLYAEETEVSPYLYKVNLQGKTTSGAHDDRAPRNLFELHQDLLARDANSTTA  114

Query  467  RVISIYDNYKPETNVNEHISPLQRQEESLLVDTFLSTNVMSYAMRFLADKGQIRKDYYEY  526
             ++ ++DNY+ +  V EH +P   QE+   +   + T VM   MRFL  K  +  +Y + 
Sbjct  115  LLMRLFDNYELDVAVQEHPTPEHVQEQYDFLRAVMGTRVMKLTMRFLVHKDIVSVEYDDQ  174

Query  527  KDTLRKIWFNLFSRGQGKIGSSGFEHVFMAELKSVPSGTEVVGLHNWIFYSKEESSGKAN  586
               L+++WF  +SRG+G +GSS FEHVFMAE++      +V+GLHNW++++ +E  G  +
Sbjct  175  LRLLQELWFTPYSRGRGIVGSSSFEHVFMAEIRD----QKVLGLHNWLYFADQEQRGNVD  230

Query  587  YAGYLNKIDLGDKASIV-KIRTKYNGYDKPVTALFVGTSPELEMALYTVCFYARPEGN-C  644
            Y G+LN  ++G    +V  +R  ++  +KPV   FVG SPEL+MALYT CF A  +   C
Sbjct  231  YKGWLNHKEMGKHNQMVLSVRYTFHNINKPVNGFFVGISPELDMALYTACFLATAKEEPC  290

Query  645  PVSLGGTKFNIVTYKFKYRGNDLVGTAYPD  674
             + LG     IV++++K+ G  L+GT YPD
Sbjct  291  HIQLGHASATIVSHEWKWNGMRLIGTVYPD  320


>Q9GYM9_CAEEL unnamed protein product
Length=572

 Score = 79.7 bits (195),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 66/127 (52%), Gaps = 9/127 (7%)

Query  533  IWFNLFSRGQGKIGSSGFEHVFMAELKSVPSGTEVVGLHNWIFYSKEESSGKANYAGYLN  592
            +WF  ++R +G +GSSG+EHVF  E+KS     EV G H+W+ Y  E+ + K  Y GY  
Sbjct  436  LWFGTYTRCKGPLGSSGWEHVFSGEIKS----NEVDGQHDWVRYYTEQKADKMVYDGYYT  491

Query  593  KIDLGDKASIVKIRTKYNGYDKPVTALFVGTSPELEMALYTVCFYARPE-GNCPVSLGGT  651
                 D+  I   + K+NG  KP    F GTSP  + ++ +VC  A    GNC   +   
Sbjct  492  H----DENLIGTFQYKWNGALKPKGGFFTGTSPAFDFSILSVCALAHGNGGNCHFKVTNY  547

Query  652  KFNIVTY  658
               + +Y
Sbjct  548  PITVTSY  554


 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 63/214 (29%), Positives = 108/214 (50%), Gaps = 27/214 (13%)

Query  431  ITLNLQKQTSSSS-TTDDAPQPLFTVNAEAYQGP----TIQRVISIYDNYKPETNV---N  482
            +TLN Q   S  S   D+A  PLFT   ++  G     TI  ++  + NY  +T V    
Sbjct  48   VTLNYQNMASKKSPDHDNAKDPLFTTVDKSVLGSNAYITIANLMPFF-NYDSDTAVPTSA  106

Query  483  EHISPLQRQEESLLVDTFLSTNVMSYAMRFLADKGQIRKDYYEYKDTLRKIWFNLFSRGQ  542
            ++ S ++       +D F++++ +  A  FL  +G    D  +++  L  +WF  ++R Q
Sbjct  107  DYASAVKD-----FLDNFIASDAVKQAWTFLQAQGVSTSDPIDFRQQLYNLWFLPYARNQ  161

Query  543  GKIGSSGFEHVFMAELKSVPSGTEVVGLHNWIFYSKEESSGKANYAGYLNKIDLGDKASI  602
              +GS GF+ VF+ E     +GT V    NW+ +  +E++GK NY G+  K++ G     
Sbjct  162  A-LGSCGFKSVFVGE----ATGTVVNRFANWVGFYIQENAGKFNYHGWFTKLN-G-----  210

Query  603  VKIRTKY-NGYDKPV-TALFVGTSPELEMALYTV  634
            + I  ++  G D+ + T+  + +SP  E A YTV
Sbjct  211  IAIDLQFVAGSDEDLETSFLLNSSPTFEFAAYTV  244



Lambda      K        H
   0.312    0.130    0.379 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9367064200


Query= XP_050573116.1 endoribonuclease CG2145-like isoform X2 [Bombus
affinis]

Length=637
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ENDOU_DROME  unnamed protein product                                  293     7e-91
Q9VF14_DROME  unnamed protein product                                 189     2e-54
Q9GYM9_CAEEL  unnamed protein product                                 79.7    2e-15


>ENDOU_DROME unnamed protein product
Length=592

 Score = 293 bits (750),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 133/275 (48%), Positives = 199/275 (72%), Gaps = 5/275 (2%)

Query  364  SKGNAI-TDEDLEKLSEALFIKDNNNANRYITLNLQKQTSSSSTTDDAPQPLFTVNAEAY  422
            S GN++ TD+++ +L+E L+ K++N+    I +NLQ +T S  + D+AP PL TV+++A 
Sbjct  322  SSGNSVATDDEIRQLTELLYTKESNSQIGNIQVNLQGRTRSIDSADEAPNPLLTVDSKAL  381

Query  423  QGPTIQRVISIYDNYKPETNVNEHISPLQRQEESLLVDTFLSTNVMSYAMRFLADKGQIR  482
            + PTI ++  +++NY+ +T+VNEH++P +R+EE+  +D  ++T VM  AM FL  KG + 
Sbjct  382  ESPTIVKMRLLFNNYEHDTHVNEHVTPNERKEENDFLDAVMATPVMRQAMLFLQQKGVVS  441

Query  483  KDYYEYKDTLRKIWFNLFSRGQGKIGSSGFEHVFMAELKSVPSGTEVVGLHNWIFYSKEE  542
             D   ++D ++++WF  +SRGQGKIGSSGFEHVF+ E+K    GT ++G HNW++   EE
Sbjct  442  PDPKTHRDLVKELWFTQYSRGQGKIGSSGFEHVFVYEVK---DGT-IIGFHNWVYIGDEE  497

Query  543  SSGKANYAGYLNKIDLGDKASIVKIRTKYNGYDKPVTALFVGTSPELEMALYTVCFYARP  602
              G+ +Y GY+ + D+G K  IVKIR  + G +KPV  +FVGTSPELE+ALYTVCF  RP
Sbjct  498  KDGRFDYKGYMKEQDIGTKGKIVKIRFSHQGLNKPVNTVFVGTSPELELALYTVCFQLRP  557

Query  603  EGNCPVSLGGTKFNIVTYKFKYRGNDLVGTAYPDI  637
            +  CPVSLG +KF IVTY ++YRG +L+G+AYP+I
Sbjct  558  DRTCPVSLGNSKFGIVTYSWRYRGKNLIGSAYPEI  592


>Q9VF14_DROME unnamed protein product
Length=322

 Score = 189 bits (479),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 97/270 (36%), Positives = 158/270 (59%), Gaps = 9/270 (3%)

Query  372  EDLEKLSEALFIKDNNNANRYITLNLQKQTSSSSTTDDAPQPLFTVNAEAYQ---GPTIQ  428
            +D+  LS+ L+ ++   +     +NLQ +T+S +  D AP+ LF ++ +        T  
Sbjct  55   DDVLTLSKNLYAEETEVSPYLYKVNLQGKTTSGAHDDRAPRNLFELHQDLLARDANSTTA  114

Query  429  RVISIYDNYKPETNVNEHISPLQRQEESLLVDTFLSTNVMSYAMRFLADKGQIRKDYYEY  488
             ++ ++DNY+ +  V EH +P   QE+   +   + T VM   MRFL  K  +  +Y + 
Sbjct  115  LLMRLFDNYELDVAVQEHPTPEHVQEQYDFLRAVMGTRVMKLTMRFLVHKDIVSVEYDDQ  174

Query  489  KDTLRKIWFNLFSRGQGKIGSSGFEHVFMAELKSVPSGTEVVGLHNWIFYSKEESSGKAN  548
               L+++WF  +SRG+G +GSS FEHVFMAE++      +V+GLHNW++++ +E  G  +
Sbjct  175  LRLLQELWFTPYSRGRGIVGSSSFEHVFMAEIRD----QKVLGLHNWLYFADQEQRGNVD  230

Query  549  YAGYLNKIDLGDKASIV-KIRTKYNGYDKPVTALFVGTSPELEMALYTVCFYARPEGN-C  606
            Y G+LN  ++G    +V  +R  ++  +KPV   FVG SPEL+MALYT CF A  +   C
Sbjct  231  YKGWLNHKEMGKHNQMVLSVRYTFHNINKPVNGFFVGISPELDMALYTACFLATAKEEPC  290

Query  607  PVSLGGTKFNIVTYKFKYRGNDLVGTAYPD  636
             + LG     IV++++K+ G  L+GT YPD
Sbjct  291  HIQLGHASATIVSHEWKWNGMRLIGTVYPD  320


>Q9GYM9_CAEEL unnamed protein product
Length=572

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 66/127 (52%), Gaps = 9/127 (7%)

Query  495  IWFNLFSRGQGKIGSSGFEHVFMAELKSVPSGTEVVGLHNWIFYSKEESSGKANYAGYLN  554
            +WF  ++R +G +GSSG+EHVF  E+KS     EV G H+W+ Y  E+ + K  Y GY  
Sbjct  436  LWFGTYTRCKGPLGSSGWEHVFSGEIKS----NEVDGQHDWVRYYTEQKADKMVYDGYYT  491

Query  555  KIDLGDKASIVKIRTKYNGYDKPVTALFVGTSPELEMALYTVCFYARPE-GNCPVSLGGT  613
                 D+  I   + K+NG  KP    F GTSP  + ++ +VC  A    GNC   +   
Sbjct  492  H----DENLIGTFQYKWNGALKPKGGFFTGTSPAFDFSILSVCALAHGNGGNCHFKVTNY  547

Query  614  KFNIVTY  620
               + +Y
Sbjct  548  PITVTSY  554


 Score = 74.7 bits (182),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 62/214 (29%), Positives = 107/214 (50%), Gaps = 27/214 (13%)

Query  393  ITLNLQKQTSSSS-TTDDAPQPLFTVNAEAYQGP----TIQRVISIYDNYKPETNV---N  444
            +TLN Q   S  S   D+A  PLFT   ++  G     TI  ++  + NY  +T V    
Sbjct  48   VTLNYQNMASKKSPDHDNAKDPLFTTVDKSVLGSNAYITIANLMPFF-NYDSDTAVPTSA  106

Query  445  EHISPLQRQEESLLVDTFLSTNVMSYAMRFLADKGQIRKDYYEYKDTLRKIWFNLFSRGQ  504
            ++ S ++       +D F++++ +  A  FL  +G    D  +++  L  +WF  ++R Q
Sbjct  107  DYASAVKD-----FLDNFIASDAVKQAWTFLQAQGVSTSDPIDFRQQLYNLWFLPYARNQ  161

Query  505  GKIGSSGFEHVFMAELKSVPSGTEVVGLHNWIFYSKEESSGKANYAGYLNKIDLGDKASI  564
              +GS GF+ VF+ E     +GT V    NW+ +  +E++GK NY G+  K++       
Sbjct  162  A-LGSCGFKSVFVGE----ATGTVVNRFANWVGFYIQENAGKFNYHGWFTKLN------G  210

Query  565  VKIRTKY-NGYDKPV-TALFVGTSPELEMALYTV  596
            + I  ++  G D+ + T+  + +SP  E A YTV
Sbjct  211  IAIDLQFVAGSDEDLETSFLLNSSPTFEFAAYTV  244



Lambda      K        H
   0.312    0.130    0.379 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9367064200


Query= XP_050573117.1 SUMO-activating enzyme subunit 2 [Bombus affinis]

Length=666
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7KUA4_DROME  unnamed protein product                                 694     0.0  
Q7KJV6_DROME  unnamed protein product                                 691     0.0  
Q9VSD9_DROME  unnamed protein product                                 686     0.0  


>Q7KUA4_DROME unnamed protein product
Length=700

 Score = 694 bits (1792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/682 (53%), Positives = 460/682 (67%), Gaps = 65/682 (10%)

Query  1    MAANINGVFTENLQNAILQSKVLIVGAGGIGCEILKNLVMTGFVNIDIIDLDTIDVSNLN  60
            MAA INGVF   LQ  + +SKVL+VGAGGIGCE+LKNLV++GF +I+IIDLDTID+SNLN
Sbjct  1    MAAAINGVFPPTLQELVKKSKVLVVGAGGIGCEVLKNLVLSGFTDIEIIDLDTIDLSNLN  60

Query  61   RQFLFQKKHVGKSKADVARETALTFNPDAKIVHYHDSITSSDYGVSFFKKFTLVMNALDN  120
            RQFLF ++HVGKSKA VARE+AL+FNPDAKI  YHDS+TS+DYGV+FFKKF LV++ALDN
Sbjct  61   RQFLFHREHVGKSKARVARESALSFNPDAKITAYHDSVTSTDYGVNFFKKFDLVLSALDN  120

Query  121  RAARNHVNRMCLAADVPLIESGTAGYEGQVELIKKELSQCYECTPKAAQKTFPGCTIRNT  180
            RAARNHVNRMCL ADVPLIESGTAGY GQVELIK+ L+QCYECTPK  Q++FPGCTIRNT
Sbjct  121  RAARNHVNRMCLNADVPLIESGTAGYNGQVELIKRGLTQCYECTPKDKQRSFPGCTIRNT  180

Query  181  PSEPIHCIVWAKHLFNQLFGEEDPDQDVSPDTADPEAADSAGQGALNSE-----------  229
            PSEPIHCIVWAKHLFNQLFGE   D+D+SPD ADP+A +  G G  N E           
Sbjct  181  PSEPIHCIVWAKHLFNQLFGESLEDEDISPDAADPDAKEKDG-GDGNGEPKGDGKEKGEE  239

Query  230  ---------SNEKGNVDRISTKVWAQSCNYDSEKLFTKLFHDDIKYLLSMDNLWKKRRPP  280
                         GN+ RI+T+ WA+ CNYD+ KLF K F++DI YLL M NLWK R+ P
Sbjct  240  SKEEKEAKEDTANGNIMRINTRQWAKDCNYDAGKLFNKFFNEDITYLLRMSNLWKTRKAP  299

Query  281  TPLSWKE-LPDGVPGCSKEVNEPGLKDQQRWSISKCGAVFAESVKNLSSNLKNLQEKSPN  339
             P+ W   LP+G  G  K+V +   +  + WSI +C  VFA S+K LS+N   L+    +
Sbjct  300  VPVQWDTLLPEGSSGDQKDVAK---QHHKVWSIEECAQVFANSLKELSANFLKLE---GD  353

Query  340  NHLVWDKDDQSSMDFVAACANIRAYIFGIPQKTRFDIKSMAGNIIPAIATTNAIVAGLVV  399
            + L WDKDDQ +MDFVAACAN+R++IF I +K+RF+IKSMAGNIIPAIATTNAI AG+ V
Sbjct  354  DTLAWDKDDQPAMDFVAACANVRSHIFDIERKSRFEIKSMAGNIIPAIATTNAITAGISV  413

Query  400  LHAFRILENNLKACKSVYLRSKMNHRNQLLVPEKNVNPPNPKCYVCAPTPQAILAIDTSK  459
            + AF++LE   + CK+VY R + N RN  LVP+ ++  PNP C+VCA  P   L IDT +
Sbjct  414  MRAFKVLEAKWEQCKAVYARLRPNARNHFLVPDASLPGPNPNCHVCASDPAITLKIDTKR  473

Query  460  TTIKELDEVVLKNRLNMIAPDVIIDGTGTVVISSEEGETEDNNNKFLEELGIKDGTILKI  519
              IKEL + VL   LNM+ PDV +   G+++ISSEEGETE N+ K L EL I DG ILK 
Sbjct  474  MRIKELRDEVLVKTLNMLNPDVTVQSNGSILISSEEGETECNDGKLLSELNIVDGVILKC  533

Query  520  DDFQQNYSLTVTILYRERPSLKGDSPDFVILAKEQDLKPKEDN--DLVK-----------  566
            DDF QNY L++ I + +    + D   F ++A    LKPK+++  + VK           
Sbjct  534  DDFFQNYELSIIISHFD---AERDENLFEVVADASQLKPKDEDQKEAVKDKEDEPKSAKK  590

Query  567  -------------PSTS-----NGQVETSDDNVMLVETEAVSSD---TAKKRKTATPEEN  605
                         PSTS     N  VE  DD+ +++E +   +D    A  + +      
Sbjct  591  RSTNGEGDSKDDGPSTSKRSRPNEVVEEDDDDCLVIEEDEDQADVVVVATDKLSVQSPPK  650

Query  606  VSSKKRKLEVNDMDDDISIIES  627
              SK++  EV + +D   I+ES
Sbjct  651  SGSKRKPCEVIEDEDITEILES  672


>Q7KJV6_DROME unnamed protein product
Length=700

 Score = 691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/682 (53%), Positives = 459/682 (67%), Gaps = 65/682 (10%)

Query  1    MAANINGVFTENLQNAILQSKVLIVGAGGIGCEILKNLVMTGFVNIDIIDLDTIDVSNLN  60
            MAA INGVF   LQ  + +SKVL+VGAGGIGCE+LKNLV++GF +I+IIDLDTID+SNLN
Sbjct  1    MAAAINGVFPPTLQELVKKSKVLVVGAGGIGCEVLKNLVLSGFTDIEIIDLDTIDLSNLN  60

Query  61   RQFLFQKKHVGKSKADVARETALTFNPDAKIVHYHDSITSSDYGVSFFKKFTLVMNALDN  120
            RQFLF ++HVGKSKA VARE+AL+FNPDAKI  YHDS+TS+DYGV+FFKKF LV++ALDN
Sbjct  61   RQFLFHREHVGKSKARVARESALSFNPDAKITAYHDSVTSTDYGVNFFKKFDLVLSALDN  120

Query  121  RAARNHVNRMCLAADVPLIESGTAGYEGQVELIKKELSQCYECTPKAAQKTFPGCTIRNT  180
            RAARNHVNRMCL ADVPLIESGTAGY GQVELIK+ L+QCYECTPK  Q++FPGCTIRNT
Sbjct  121  RAARNHVNRMCLNADVPLIESGTAGYNGQVELIKRGLTQCYECTPKDKQRSFPGCTIRNT  180

Query  181  PSEPIHCIVWAKHLFNQLFGEEDPDQDVSPDTADPEAADSAGQGALNSE-----------  229
            PSEPIHCIVWAKHLFNQLFGE   D+D+SPD ADP+A +  G G  N E           
Sbjct  181  PSEPIHCIVWAKHLFNQLFGESLEDEDISPDAADPDAKEKDG-GDGNGEPKGDGKEKGEE  239

Query  230  ---------SNEKGNVDRISTKVWAQSCNYDSEKLFTKLFHDDIKYLLSMDNLWKKRRPP  280
                         GN+ RI+T+ WA+  NYD+ KLF K F++DI YLL M NLWK R+ P
Sbjct  240  SKEEKEAKEDTANGNIMRINTRQWAKDSNYDAGKLFNKFFNEDITYLLRMSNLWKTRKAP  299

Query  281  TPLSWKE-LPDGVPGCSKEVNEPGLKDQQRWSISKCGAVFAESVKNLSSNLKNLQEKSPN  339
             P+ W   LP+G  G  K+V +   +  + WSI +C  VFA S+K LS+N   L+    +
Sbjct  300  VPVQWDTLLPEGSSGDQKDVAK---QHHKVWSIEECAQVFANSLKELSANFLKLE---GD  353

Query  340  NHLVWDKDDQSSMDFVAACANIRAYIFGIPQKTRFDIKSMAGNIIPAIATTNAIVAGLVV  399
            + L WDKDDQ +MDFVAACAN+R++IF I +K+RF+IKSMAGNIIPAIATTNAI AG+ V
Sbjct  354  DTLAWDKDDQPAMDFVAACANVRSHIFDIERKSRFEIKSMAGNIIPAIATTNAITAGISV  413

Query  400  LHAFRILENNLKACKSVYLRSKMNHRNQLLVPEKNVNPPNPKCYVCAPTPQAILAIDTSK  459
            + AF++LE   + CK+VY R + N RN  LVP+ ++  PNP C+VCA  P   L IDT +
Sbjct  414  MRAFKVLEAKWEQCKAVYARLRPNARNHFLVPDASLPGPNPNCHVCASDPAITLKIDTKR  473

Query  460  TTIKELDEVVLKNRLNMIAPDVIIDGTGTVVISSEEGETEDNNNKFLEELGIKDGTILKI  519
              IKEL + VL   LNM+ PDV +   G+++ISSEEGETE N+ K L EL I DG ILK 
Sbjct  474  MRIKELRDEVLVKTLNMLNPDVTVQSNGSILISSEEGETECNDGKLLSELNIVDGVILKC  533

Query  520  DDFQQNYSLTVTILYRERPSLKGDSPDFVILAKEQDLKPKEDN--DLVK-----------  566
            DDF QNY L++ I + +    + D   F ++A    LKPK+++  + VK           
Sbjct  534  DDFFQNYELSIIISHFD---AERDENLFEVVADASQLKPKDEDQKEAVKDKEDEPKSAKK  590

Query  567  -------------PSTS-----NGQVETSDDNVMLVETEAVSSD---TAKKRKTATPEEN  605
                         PSTS     N  VE  DD+ +++E +   +D    A  + +      
Sbjct  591  RSTNGEGDSKDDGPSTSKRSRPNEVVEEDDDDCLVIEEDEDQADVVVVATDKLSVQSPPK  650

Query  606  VSSKKRKLEVNDMDDDISIIES  627
              SK++  EV + +D   I+ES
Sbjct  651  SGSKRKPCEVIEDEDITEILES  672


>Q9VSD9_DROME unnamed protein product
Length=700

 Score = 686 bits (1769),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/682 (53%), Positives = 456/682 (67%), Gaps = 65/682 (10%)

Query  1    MAANINGVFTENLQNAILQSKVLIVGAGGIGCEILKNLVMTGFVNIDIIDLDTIDVSNLN  60
            MAA INGVF   L   + +SKVL+VGAGGIGCE+LKNLV++GF +I+IIDLDTID+SNLN
Sbjct  1    MAAAINGVFPPTLHELVKKSKVLVVGAGGIGCEVLKNLVLSGFTDIEIIDLDTIDLSNLN  60

Query  61   RQFLFQKKHVGKSKADVARETALTFNPDAKIVHYHDSITSSDYGVSFFKKFTLVMNALDN  120
            RQFLF ++HVGKSKA VARE+AL+FNPDAKI  YHDS+TS+DYGV+FFKKF LV+NALDN
Sbjct  61   RQFLFHREHVGKSKARVARESALSFNPDAKITAYHDSVTSTDYGVNFFKKFDLVLNALDN  120

Query  121  RAARNHVNRMCLAADVPLIESGTAGYEGQVELIKKELSQCYECTPKAAQKTFPGCTIRNT  180
            RA RNHVNRMCL ADVPLIESGTAGY GQVELIK+ L+QCYECTPK  Q++FPGCTIRNT
Sbjct  121  RADRNHVNRMCLNADVPLIESGTAGYNGQVELIKRGLTQCYECTPKDKQRSFPGCTIRNT  180

Query  181  PSEPIHCIVWAKHLFNQLFGEEDPDQDVSPDTADPEAADSAGQGALNSE-----------  229
            PSEPIHCIVWAKHLFNQLFGE   D+D+SPD ADP+A +  G G  N E           
Sbjct  181  PSEPIHCIVWAKHLFNQLFGESLEDEDISPDAADPDAKEKDG-GDGNGEPKGDGKEKGEE  239

Query  230  ---------SNEKGNVDRISTKVWAQSCNYDSEKLFTKLFHDDIKYLLSMDNLWKKRRPP  280
                         GN+ RI+T+ WA+ CNYD+ KLF K F++DI YLL M NLWK R+ P
Sbjct  240  SKEEKEAKEDTANGNIMRINTRQWAKDCNYDAGKLFNKFFNEDITYLLRMSNLWKTRKAP  299

Query  281  TPLSWKE-LPDGVPGCSKEVNEPGLKDQQRWSISKCGAVFAESVKNLSSNLKNLQEKSPN  339
             P+ W   LP+G  G  K+V +   +  + WSI +C  VFA S+K LS+N   L+    +
Sbjct  300  VPVQWDTLLPEGSSGDQKDVAK---QHHKVWSIEECAQVFANSLKELSANFLKLE---GD  353

Query  340  NHLVWDKDDQSSMDFVAACANIRAYIFGIPQKTRFDIKSMAGNIIPAIATTNAIVAGLVV  399
            + L WDKDDQ +MDFVAACAN+R++IF I  K+RF+ KSMAGNIIPAIATTNAI AG+ V
Sbjct  354  DTLAWDKDDQPAMDFVAACANVRSHIFYIEPKSRFENKSMAGNIIPAIATTNAITAGISV  413

Query  400  LHAFRILENNLKACKSVYLRSKMNHRNQLLVPEKNVNPPNPKCYVCAPTPQAILAIDTSK  459
            + AF++LE   + C++VY R + N RN  LVP+ ++  PNP C+VCA  P   L IDT +
Sbjct  414  MRAFKVLEAKWEQCQAVYARLRPNARNHFLVPDASLPGPNPNCHVCASDPAITLKIDTKR  473

Query  460  TTIKELDEVVLKNRLNMIAPDVIIDGTGTVVISSEEGETEDNNNKFLEELGIKDGTILKI  519
              IKEL + VL   LNM+ PDV +   G+++ISSEEGETE N+ K L EL I DG ILK 
Sbjct  474  MRIKELRDEVLVKTLNMLNPDVTVQSNGSILISSEEGETECNDGKLLSELNIVDGVILKC  533

Query  520  DDFQQNYSLTVTILYRERPSLKGDSPDFVILAKEQDLKPKEDN--DLVK-----------  566
            DDF QNY L++ I + +    + D   F ++A    LKPK+++  + VK           
Sbjct  534  DDFFQNYELSIIISHFD---AERDENLFEVVADASQLKPKDEDQKEAVKDKEDEPKSAKK  590

Query  567  -------------PSTS-----NGQVETSDDNVMLVETEAVSSD---TAKKRKTATPEEN  605
                         PSTS     N  VE  DD+ +++E +   +D    A  + +      
Sbjct  591  RSTNGEGDSKDDGPSTSKRSRPNEVVEEDDDDCLVIEEDEDQADVVVVATDKLSVQSPPK  650

Query  606  VSSKKRKLEVNDMDDDISIIES  627
              SK++  EV + +D   I+ES
Sbjct  651  SGSKRKPCEVIEDEDITEILES  672



Lambda      K        H
   0.312    0.130    0.379 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9367064200


Query= XP_050573118.1 uncharacterized protein LOC126913892 [Bombus affinis]

Length=661
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

POF_DROME  unnamed protein product                                    138     9e-35


>POF_DROME unnamed protein product
Length=495

 Score = 138 bits (348),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 63/193 (33%), Positives = 111/193 (58%), Gaps = 6/193 (3%)

Query  250  WNREDAERALKIENEY----NKTVKAQSLIIKFPDPDLNKDIVREFHPGIQNIHFQSPSG  305
              RE   RAL +E E      +T  ++ L+++FPDP++   ++      I+++       
Sbjct  106  MRREHTLRALALERELTNKPGQTPASEVLLVRFPDPEITAPMLAGLSKDIRDVVLPISVA  165

Query  306  PRYCFIQMAESVDIDEAIKELEKIPFGVGHLKVERKSLRDEDNPMPEEIDPYTLYIGNLP  365
            PRYC + +    D++  I ++ ++ FG GHL+ E K   DE+    E IDP +LY+GN+P
Sbjct  166  PRYCLVHLKAGADVEATICDINRVRFGTGHLRAELKPFSDEEQA--EFIDPCSLYVGNIP  223

Query  366  ESVNVNEVKSKFPTAARVDVGYAQKMRNTRYAFIRYNSVDESISAYKQAHDLMWDTRSII  425
             ++  + +K+ F  A RVD+G  ++ +  RYAF+RY S D+++ A+K+  D   ++R++ 
Sbjct  224  FNMTTSAIKAYFANAMRVDIGVLKREKRARYAFVRYASPDQTMEAFKELVDSPLNSRTLT  283

Query  426  VRFRRQRGNTCLP  438
            VR+RR R    +P
Sbjct  284  VRYRRLRKRAGMP  296



Lambda      K        H
   0.312    0.130    0.379 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9367064200


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Nov 7, 2022  4:57 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_050573119.1 pentatricopeptide repeat-containing protein 1,
mitochondrial [Bombus affinis]

Length=629
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q95NR4_DROME  unnamed protein product                                 47.4    4e-05
Q9VJ86_DROME  unnamed protein product                                 46.2    1e-04
Q381Z3_TRYB2  unnamed protein product                                 43.5    6e-04


>Q95NR4_DROME unnamed protein product
Length=1412

 Score = 47.4 bits (111),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/144 (22%), Positives = 70/144 (49%), Gaps = 6/144 (4%)

Query  131  LSHRDYCTLIKSHLYKKNLQLALNVLDLMKENGDKPNLYIYRLLLSSFSRQGDVEQCFKL  190
            +SH  Y  L++ +L  ++     + L  ++  G +PN   Y+ L++ + +QGD+E   ++
Sbjct  140  ISH--YNALLRVYLENEHGFAPTDFLAEIEAKGIEPNRVTYQRLIARYCQQGDIEGATRI  197

Query  191  FKNLKERGLTPSASIYTSLLNACATTNDTQKALDHLLFLREYFYKRNIDLTDINYATLIR  250
             + ++ + L  + +++ SL+   +  ND + A   L  +++   + + D     Y TL+ 
Sbjct  198  LEFMRAKSLPVNENVFNSLILGHSQANDLESAKGILGVMKQAGLEPSAD----TYTTLLC  253

Query  251  AYSCHNQILIAFEIADEARDKNIF  274
            A++ H  +    E   E   K I 
Sbjct  254  AFARHGDLAAVKETLAECEQKEII  277


>Q9VJ86_DROME unnamed protein product
Length=1412

 Score = 46.2 bits (108),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/144 (22%), Positives = 69/144 (48%), Gaps = 6/144 (4%)

Query  131  LSHRDYCTLIKSHLYKKNLQLALNVLDLMKENGDKPNLYIYRLLLSSFSRQGDVEQCFKL  190
            +SH  Y  L++ +L  ++     + L  ++  G +PN   Y+ L++ + +QGD+E   ++
Sbjct  140  ISH--YNALLRVYLENEHGFAPTDFLAEIEAKGIEPNRVTYQRLIARYCQQGDIEGATRI  197

Query  191  FKNLKERGLTPSASIYTSLLNACATTNDTQKALDHLLFLREYFYKRNIDLTDINYATLIR  250
             + ++ + L  + +++ SL+   +  ND + A   L  + +   + + D     Y TL+ 
Sbjct  198  LEFMRAKSLPVNENVFNSLILGHSQANDLESAKGILGVMMQAGLEPSAD----TYTTLLC  253

Query  251  AYSCHNQILIAFEIADEARDKNIF  274
            A++ H  +    E   E   K I 
Sbjct  254  AFARHGDLAAVKETLAECEQKEII  277


>Q381Z3_TRYB2 unnamed protein product
Length=822

 Score = 43.5 bits (101),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 45/168 (27%), Positives = 75/168 (45%), Gaps = 20/168 (12%)

Query  165  KPNLYIYRLLLSSFSRQGDVEQCFKLFKNLKERG-LTPSASIYTSLLNACATTNDTQKAL  223
            +P+L  Y+LL  +  R+    + F L+  ++E   + P  + Y +LL  CA   D  +A 
Sbjct  133  QPDLTTYQLLFRACERKSQYHRAFHLYMQMREMPHIVPDTTTYDTLLGFCAAVKDVPQA-  191

Query  224  DHLLFLREYFYKRNIDLTDIN-YATL---IRAYSCHNQILIAFEIADEARDK-NIFTQNV  278
              L F+ E   K+N     +N Y  L   +R  + + + L  +    E   K  + T N 
Sbjct  192  --LFFMEE--MKKNCVAPSVNTYNCLMGALREKAPYEETLRVYNGMTEWGVKPTVRTFNT  247

Query  279  I--AALFHAIIGDKENGLKYGLILWHKMRISKIRPTIFHYNLLLRTIR  324
            +  AAL H    D E   +    L+ +M+   + P +  YN LL  +R
Sbjct  248  VTGAALIH---DDYEMAFQ----LFEEMKKQGVLPNVVSYNTLLCLVR  288


 Score = 38.1 bits (87),  Expect = 0.022, Method: Compositional matrix adjust.
 Identities = 37/191 (19%), Positives = 77/191 (40%), Gaps = 21/191 (11%)

Query  136  YCTLIKSHLYKKNLQLALNVLDLMKENGDKPNLYIYRLLLSSFSRQGDVEQCFKLFKNLK  195
            Y TL+      K++  AL  ++ MK+N   P++  Y  L+ +   +   E+  +++  + 
Sbjct  175  YDTLLGFCAAVKDVPQALFFMEEMKKNCVAPSVNTYNCLMGALREKAPYEETLRVYNGMT  234

Query  196  ERGLTPSASIYTSLLNACATTNDTQKALDHLLFLREYFYKRNIDLTDINYAT---LIRAY  252
            E G+ P+   + ++  A    +D + A      L E   K+ +    ++Y T   L+R  
Sbjct  235  EWGVKPTVRTFNTVTGAALIHDDYEMAFQ----LFEEMKKQGVLPNVVSYNTLLCLVRQR  290

Query  253  SCHNQILIAFEIADEARDKNIFTQNVIAALFHAIIGDKENGLKYGLILWHKMRISKIRPT  312
              +     A+      R++       I+ L                 L+H+M    + P 
Sbjct  291  LDYVMGRNAYASVKRTREQQAHGMKAISEL--------------TTTLFHEMGSMVVEPN  336

Query  313  IFHYNLLLRTI  323
             F +NL++  +
Sbjct  337  TFTFNLVMEIL  347


 Score = 32.3 bits (72),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 40/201 (20%), Positives = 78/201 (39%), Gaps = 20/201 (10%)

Query  424  LKRMKHDNVQPDKKTLTLMLDLLPPTVESEKS--FCRYIVKNELKFDITFFNILIKRRCL  481
            ++ M H  + PD  T   +L       +  ++  F   + KN +   +  +N L+     
Sbjct  162  MREMPH--IVPDTTTYDTLLGFCAAVKDVPQALFFMEEMKKNCVAPSVNTYNCLMGALRE  219

Query  482  RKEYQAAKDVLNDIQIHHLIPNIVTFGALAIGCRMHKD---GRELLEQMDTIGYVPNYVI  538
            +  Y+    V N +    + P + TF  +     +H D     +L E+M   G +PN V 
Sbjct  220  KAPYEETLRVYNGMTEWGVKPTVRTFNTVTGAALIHDDYEMAFQLFEEMKKQGVLPNVVS  279

Query  539  LETLMFNACSFKN-FAYVLYLMNYILKNRIEPSQGILNTLEKFEELVLEIIKNKGN----  593
              TL+   C  +    YV+    Y    R    Q   + ++   EL   +    G+    
Sbjct  280  YNTLL---CLVRQRLDYVMGRNAYASVKRTREQQA--HGMKAISELTTTLFHEMGSMVVE  334

Query  594  ---YKYKAINEIMKDYNNFKI  611
               + +  + EI+ + ++F +
Sbjct  335  PNTFTFNLVMEILIECDDFGV  355



Lambda      K        H
   0.322    0.139    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7506754320


Query= XP_050573120.1 pentatricopeptide repeat-containing protein 1,
mitochondrial [Bombus affinis]

Length=629
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q95NR4_DROME  unnamed protein product                                 47.4    4e-05
Q9VJ86_DROME  unnamed protein product                                 46.2    1e-04
Q381Z3_TRYB2  unnamed protein product                                 43.5    6e-04


>Q95NR4_DROME unnamed protein product
Length=1412

 Score = 47.4 bits (111),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/144 (22%), Positives = 70/144 (49%), Gaps = 6/144 (4%)

Query  131  LSHRDYCTLIKSHLYKKNLQLALNVLDLMKENGDKPNLYIYRLLLSSFSRQGDVEQCFKL  190
            +SH  Y  L++ +L  ++     + L  ++  G +PN   Y+ L++ + +QGD+E   ++
Sbjct  140  ISH--YNALLRVYLENEHGFAPTDFLAEIEAKGIEPNRVTYQRLIARYCQQGDIEGATRI  197

Query  191  FKNLKERGLTPSASIYTSLLNACATTNDTQKALDHLLFLREYFYKRNIDLTDINYATLIR  250
             + ++ + L  + +++ SL+   +  ND + A   L  +++   + + D     Y TL+ 
Sbjct  198  LEFMRAKSLPVNENVFNSLILGHSQANDLESAKGILGVMKQAGLEPSAD----TYTTLLC  253

Query  251  AYSCHNQILIAFEIADEARDKNIF  274
            A++ H  +    E   E   K I 
Sbjct  254  AFARHGDLAAVKETLAECEQKEII  277


>Q9VJ86_DROME unnamed protein product
Length=1412

 Score = 46.2 bits (108),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/144 (22%), Positives = 69/144 (48%), Gaps = 6/144 (4%)

Query  131  LSHRDYCTLIKSHLYKKNLQLALNVLDLMKENGDKPNLYIYRLLLSSFSRQGDVEQCFKL  190
            +SH  Y  L++ +L  ++     + L  ++  G +PN   Y+ L++ + +QGD+E   ++
Sbjct  140  ISH--YNALLRVYLENEHGFAPTDFLAEIEAKGIEPNRVTYQRLIARYCQQGDIEGATRI  197

Query  191  FKNLKERGLTPSASIYTSLLNACATTNDTQKALDHLLFLREYFYKRNIDLTDINYATLIR  250
             + ++ + L  + +++ SL+   +  ND + A   L  + +   + + D     Y TL+ 
Sbjct  198  LEFMRAKSLPVNENVFNSLILGHSQANDLESAKGILGVMMQAGLEPSAD----TYTTLLC  253

Query  251  AYSCHNQILIAFEIADEARDKNIF  274
            A++ H  +    E   E   K I 
Sbjct  254  AFARHGDLAAVKETLAECEQKEII  277


>Q381Z3_TRYB2 unnamed protein product
Length=822

 Score = 43.5 bits (101),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 45/168 (27%), Positives = 75/168 (45%), Gaps = 20/168 (12%)

Query  165  KPNLYIYRLLLSSFSRQGDVEQCFKLFKNLKERG-LTPSASIYTSLLNACATTNDTQKAL  223
            +P+L  Y+LL  +  R+    + F L+  ++E   + P  + Y +LL  CA   D  +A 
Sbjct  133  QPDLTTYQLLFRACERKSQYHRAFHLYMQMREMPHIVPDTTTYDTLLGFCAAVKDVPQA-  191

Query  224  DHLLFLREYFYKRNIDLTDIN-YATL---IRAYSCHNQILIAFEIADEARDK-NIFTQNV  278
              L F+ E   K+N     +N Y  L   +R  + + + L  +    E   K  + T N 
Sbjct  192  --LFFMEE--MKKNCVAPSVNTYNCLMGALREKAPYEETLRVYNGMTEWGVKPTVRTFNT  247

Query  279  I--AALFHAIIGDKENGLKYGLILWHKMRISKIRPTIFHYNLLLRTIR  324
            +  AAL H    D E   +    L+ +M+   + P +  YN LL  +R
Sbjct  248  VTGAALIH---DDYEMAFQ----LFEEMKKQGVLPNVVSYNTLLCLVR  288


 Score = 38.1 bits (87),  Expect = 0.022, Method: Compositional matrix adjust.
 Identities = 37/191 (19%), Positives = 77/191 (40%), Gaps = 21/191 (11%)

Query  136  YCTLIKSHLYKKNLQLALNVLDLMKENGDKPNLYIYRLLLSSFSRQGDVEQCFKLFKNLK  195
            Y TL+      K++  AL  ++ MK+N   P++  Y  L+ +   +   E+  +++  + 
Sbjct  175  YDTLLGFCAAVKDVPQALFFMEEMKKNCVAPSVNTYNCLMGALREKAPYEETLRVYNGMT  234

Query  196  ERGLTPSASIYTSLLNACATTNDTQKALDHLLFLREYFYKRNIDLTDINYAT---LIRAY  252
            E G+ P+   + ++  A    +D + A      L E   K+ +    ++Y T   L+R  
Sbjct  235  EWGVKPTVRTFNTVTGAALIHDDYEMAFQ----LFEEMKKQGVLPNVVSYNTLLCLVRQR  290

Query  253  SCHNQILIAFEIADEARDKNIFTQNVIAALFHAIIGDKENGLKYGLILWHKMRISKIRPT  312
              +     A+      R++       I+ L                 L+H+M    + P 
Sbjct  291  LDYVMGRNAYASVKRTREQQAHGMKAISEL--------------TTTLFHEMGSMVVEPN  336

Query  313  IFHYNLLLRTI  323
             F +NL++  +
Sbjct  337  TFTFNLVMEIL  347


 Score = 32.3 bits (72),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 40/201 (20%), Positives = 78/201 (39%), Gaps = 20/201 (10%)

Query  424  LKRMKHDNVQPDKKTLTLMLDLLPPTVESEKS--FCRYIVKNELKFDITFFNILIKRRCL  481
            ++ M H  + PD  T   +L       +  ++  F   + KN +   +  +N L+     
Sbjct  162  MREMPH--IVPDTTTYDTLLGFCAAVKDVPQALFFMEEMKKNCVAPSVNTYNCLMGALRE  219

Query  482  RKEYQAAKDVLNDIQIHHLIPNIVTFGALAIGCRMHKD---GRELLEQMDTIGYVPNYVI  538
            +  Y+    V N +    + P + TF  +     +H D     +L E+M   G +PN V 
Sbjct  220  KAPYEETLRVYNGMTEWGVKPTVRTFNTVTGAALIHDDYEMAFQLFEEMKKQGVLPNVVS  279

Query  539  LETLMFNACSFKN-FAYVLYLMNYILKNRIEPSQGILNTLEKFEELVLEIIKNKGN----  593
              TL+   C  +    YV+    Y    R    Q   + ++   EL   +    G+    
Sbjct  280  YNTLL---CLVRQRLDYVMGRNAYASVKRTREQQA--HGMKAISELTTTLFHEMGSMVVE  334

Query  594  ---YKYKAINEIMKDYNNFKI  611
               + +  + EI+ + ++F +
Sbjct  335  PNTFTFNLVMEILIECDDFGV  355



Lambda      K        H
   0.322    0.139    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7506754320


Query= XP_050573121.1 telomere length and silencing protein 1 homolog
[Bombus affinis]

Length=296


***** No hits found *****



Lambda      K        H
   0.322    0.139    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7506754320


Query= XP_050573122.1 palmitoyltransferase app [Bombus affinis]

Length=485
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

APP_DROME  unnamed protein product                                    486     2e-166
A1Z833_DROME  unnamed protein product                                 101     5e-23 
Q7K2V5_DROME  unnamed protein product                                 99.8    6e-23 


>APP_DROME unnamed protein product
Length=693

 Score = 486 bits (1251),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 218/308 (71%), Positives = 255/308 (83%), Gaps = 0/308 (0%)

Query  23   ITRKWELFPGRNRFCCDGRVMMAPQTGVFYVTVCLIAGTSGLFFAFDCPFLAVHITPAIP  82
            +TRKWELF GRN+F CDG +M AP TGVFY+T  LI GTS LFFAFDCPFLA  I PAIP
Sbjct  18   VTRKWELFAGRNKFYCDGLLMSAPHTGVFYLTCILITGTSALFFAFDCPFLADSINPAIP  77

Query  83   VIGGLLFIFVMSALFRTSFSDPGVIPRATLDEAAYIEKQIEVPNNGNSKMYRPPPRTKEV  142
            ++G +L+ F MS+L RT+F+DPGVIPRA+ DEAAYIEKQIEVPN+ NS  YRPPPRTKEV
Sbjct  78   IVGAVLYFFTMSSLLRTTFTDPGVIPRASNDEAAYIEKQIEVPNSLNSPTYRPPPRTKEV  137

Query  143  LVKGQPVKLKYCFTCKIFRPPRASHCSLCDNCVERFDHHCPWVGNCVGRRNYRYFYAFIV  202
            LVKGQ VKLKYCFTCKIFRPPRASHCSLCDNCV+RFDHHCPWVGNCVG+RNYR+FY F+V
Sbjct  138  LVKGQTVKLKYCFTCKIFRPPRASHCSLCDNCVDRFDHHCPWVGNCVGKRNYRFFYLFLV  197

Query  203  SLAFLCVFIFVCAVTHLVMLTKDVRPFLDAVRISPGSVVVAVICFFSVWSILGLAGFHTY  262
            SLAFL VFIF C+VTHLV+L K      + ++ +P +V+V  ICFFS+WS++GLAGFHTY
Sbjct  198  SLAFLAVFIFSCSVTHLVLLMKKEHEVFNVIKAAPFTVIVVFICFFSIWSVIGLAGFHTY  257

Query  263  LTTSNQTTNEDIKGSFSIKTGQESFNLYSQGNICGNCFYVLCGPAPPSLIDRRGIVTPEY  322
            LTTS+QTTNED+KGSFS K G  + N YS+GNIC NC ++LCGP  PSLIDRRGI T E+
Sbjct  258  LTTSDQTTNEDLKGSFSSKGGPRTQNPYSRGNICLNCCHILCGPMTPSLIDRRGIATDEF  317

Query  323  RAEQERVS  330
              + +  S
Sbjct  318  IQQMQHQS  325


 Score = 53.1 bits (126),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 32/40 (80%), Gaps = 0/40 (0%)

Query  444  SASRLRLLQDTTMIESALDLDSLEDASVGRGSQAGLIKMG  483
            SA RLR+L D TMI++ALDLDSL+ +S+G  SQ+ L+K G
Sbjct  640  SAERLRMLHDNTMIDTALDLDSLDGSSMGNNSQSCLVKSG  679


>A1Z833_DROME unnamed protein product
Length=443

 Score = 101 bits (252),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 89/335 (27%), Positives = 142/335 (42%), Gaps = 34/335 (10%)

Query  86   GLLFIFVMSALFRTSFSDPGVIPRATLDEAAYIEKQIEVPNNGNSKMYRP--PPRTKEVL  143
            G++F+ +   LF T F       R  +     I  Q  +P+   S+++R   P   K +L
Sbjct  53   GMIFMLLFYHLFLTLFM--WSYWRTIMTSVGRIPDQWRIPDEEVSRLFRADSPDTQKRIL  110

Query  144  ---VKGQPV-------KLKYCFTCKIFRPPRASHCSLCDNCVERFDHHCPWVGNCVGRRN  193
                +  PV        +++C  CKI +P RA HCS+C  CV + DHHCPWV NCV   N
Sbjct  111  NNFARDLPVTNRTMNGSVRFCEKCKIIKPDRAHHCSVCSCCVLKMDHHCPWVNNCVNFYN  170

Query  194  YRYFYAFIVSLAFLCVFIFVCAVTHLVMLTKDVRPFLDAVRISPGSVVVAVICFFSVW--  251
            Y+YF  F+      C+++   ++   V   K     L+A  +  G   +  + F ++   
Sbjct  171  YKYFVLFLGYALVYCLYVAFTSLHDFVEFWKVGAGQLNASGM--GRFHILFLFFIAIMFA  228

Query  252  -SILGLAGFHTYLTTSNQTTNEDIKGSFSIKTG--QESFNLYSQGNIC---GNCFYVLCG  305
             S++ L G+H YL   N+TT E  +       G  +  +NL    N C   G+ +     
Sbjct  229  ISLVSLFGYHIYLVLVNRTTLESFRAPIFRVGGPDKNGYNLGRYANFCEVFGDDWQYWFL  288

Query  306  PAPPSLIDRRGIVTPEYRAEQERVSGDNVITNNKTYGTVKIVQPQSNGTTVQTNPSPDLT  365
            P   S  D  G   P   ++Q RVS  +        G        +  + +  NP+  L 
Sbjct  289  PVFSSRGD--GYSYPT-SSDQSRVSTSSPTQRYDAMG-------DTTTSRLDGNPTDKLI  338

Query  366  GSMNNLVSGQHSPQIESINGSTTNSVSQLVTNEVP  400
            G+     +  H  Q      ST+   +QL+  + P
Sbjct  339  GASPLDTTNHHHNQSPHQVRSTSVLPTQLLQIQPP  373


>Q7K2V5_DROME unnamed protein product
Length=338

 Score = 99.8 bits (247),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 66/227 (29%), Positives = 105/227 (46%), Gaps = 19/227 (8%)

Query  86   GLLFIFVMSALFRTSFSDPGVIPRATLDEAAYIEKQIEVPNNGNSKMYRP--PPRTKEVL  143
            G++F+ +   LF T F       R  +     I  Q  +P+   S+++R   P   K +L
Sbjct  53   GMIFMLLFYHLFLTLFM--WSYWRTIMTSVGRIPDQWRIPDEEVSRLFRADSPDTQKRIL  110

Query  144  ---VKGQPV-------KLKYCFTCKIFRPPRASHCSLCDNCVERFDHHCPWVGNCVGRRN  193
                +  PV        +++C  CKI +P RA HCS+C  CV + DHHCPWV NCV   N
Sbjct  111  NNFARDLPVTNRTMNGSVRFCEKCKIIKPDRAHHCSVCSCCVLKMDHHCPWVNNCVNFYN  170

Query  194  YRYFYAFIVSLAFLCVFIFVCAVTHLVMLTKDVRPFLDAVRISPGSVVVA--VICFFSVW  251
            Y+YF  F+      C+++   ++   V   K     L+A  +    ++    +   F++ 
Sbjct  171  YKYFVLFLGYALVYCLYVAFTSLHDFVEFWKVGAGQLNASGMGRFHILFLFFIAIMFAI-  229

Query  252  SILGLAGFHTYLTTSNQTTNEDIKGSFSIKTG--QESFNLYSQGNIC  296
            S++ L G+H YL   N+TT E  +       G  +  +NL    N C
Sbjct  230  SLVSLFGYHIYLVLVNRTTLESFRAPIFRVGGPDKNGYNLGRYANFC  276



Lambda      K        H
   0.322    0.139    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7506754320


Query= XP_050573123.1 TBC1 domain family member 14-like [Bombus affinis]

Length=618
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q54UM5_DICDI  unnamed protein product                                 241     2e-70
TBC12_DICDI  unnamed protein product                                  211     1e-61
Q54SA3_DICDI  unnamed protein product                                 187     6e-50


>Q54UM5_DICDI unnamed protein product
Length=733

 Score = 241 bits (616),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 122/295 (41%), Positives = 179/295 (61%), Gaps = 9/295 (3%)

Query  312  EKERKHQRELQLKEEERLAEDSHTWNVHILPKFESVKNTKKVRELWWRGLPPSVRGKVWK  371
            EKE+K + + + + E R+ E    WN  ++P ++  K TKK RE+  +G+P  VR KVW 
Sbjct  424  EKEQKKKDKNRKERERRMEESLKIWNEDMIPNWDKRKGTKKCREMVLQGIPSLVRSKVWP  483

Query  372  LAIPNNLNITTHLYNICLDRA---------ISSPISETLAAIKLDVSRTFPTLCVFQEGG  422
            L I N+LNIT  L++I   RA          S    +T++ I LD+ RTFP L +FQ+ G
Sbjct  484  LLIGNDLNITPELFSIFGARAERAKQKSEARSLGREKTVSLIHLDLPRTFPMLSIFQDEG  543

Query  423  PLSNSLQGILAAYAVYRPDVGYVQGMSFVGAVLSLNMEPPDAFTCFANLLNHPCHRSAFT  482
            PL  SL  +L AY  YRPDVGYVQGMS++ AV  L ++  ++F C +N LN+PC+ + +T
Sbjct  544  PLHQSLANVLEAYVCYRPDVGYVQGMSYLAAVFLLILDEFNSFVCLSNFLNNPCYMTFYT  603

Query  483  LNQKQMDIYYKVYSSALAHKLPKIFSHFTVAGLSPDLYLLDWLYTIYAKAMPLDVACRVW  542
            +N  QM +Y       +A  LPKI  H    G+ PD++++DW+ T+++KA+PLDVA  VW
Sbjct  604  MNLDQMAVYMNTMDQLMAQNLPKIQKHLKELGIQPDIFMIDWVLTVFSKALPLDVASHVW  663

Query  543  DVFLRDGDEFLFRTALGVLHLYQEELLKMDFVHGAQFLTRLPETLQAEALFNSIS  597
            D    DG+  +F+TALG+L +Y ++L   DF      LT LP  +  + LF  I+
Sbjct  664  DTIFLDGEVVIFQTALGILKMYSKDLEFGDFDVCMTLLTHLPTDIDEDELFQHIN  718


>TBC12_DICDI unnamed protein product
Length=438

 Score = 211 bits (536),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 125/391 (32%), Positives = 199/391 (51%), Gaps = 58/391 (15%)

Query  278  RPANLPAKNAVEEERHRKQYSAILEAARKRELREEKERKHQRELQLKEEERLAEDSHTWN  337
            RP  LP K+  E  +H+++Y  I   A+K   RE KE++    ++ ++E  L +    W 
Sbjct  48   RPKTLPPKSQEEVLKHQREYEEIQRKAKKTLEREAKEKEKLDAIRKEKERSLIDARKVWE  107

Query  338  VHILPKFES---VKNTKKVRELWWRGLPPSVRGKVWKLAIPNNLNITTHLY---------  385
              I+P +E     ++ KK+++L WRGLPP+VRGK+W+L I N+L +T  L+         
Sbjct  108  EDIIPVWEKNSKKRDIKKIKDLSWRGLPPAVRGKIWRLCIGNDLRVTDELFNIFLGHANN  167

Query  386  -----------------------NICLDRAISS------PISET--------------LA  402
                                   NI L +A +S      P++ +              +A
Sbjct  168  AYNKTTSPPLKSSLSSSSKSPNINIDLRQANNSIHHSRSPMNTSTDGEDDVLDLETTNMA  227

Query  403  AIKLDVSRTFPTLCVFQEGGPLSNSLQGILAAYAVYRPDVGYVQGMSFVGAVLSLNMEPP  462
             I  D+  TFP+L +FQ+GGPL + L  +L AY  YRPD+GYV GM+F+ A+  LNME  
Sbjct  228  LILQDIQDTFPSLMIFQKGGPLHSDLIDVLGAYICYRPDIGYVPGMTFLAAMFLLNMEKC  287

Query  463  DAFTCFANLLNHPCHRSAFTLNQKQMDIYYKVYSSALAHKLPKIFSHFTVAGLSPDLYLL  522
            DAF   +N +N  C    F  +Q  +  Y     S +    P +  HF   G+S   YL+
Sbjct  288  DAFLSLSNHINSVCFLPFFRQDQSGIPKYLAAMDSTVEALTPPLHKHFKEIGISAKNYLV  347

Query  523  DWLYTIYAKAMPLDVACRVWDVFLRDGDEFLFRTALGVLHLYQEELLKMDFVHGAQFLTR  582
            DW+ T+++KA+PLDVA R+WD+   +G+ F++RTAL +L  +  +L++  +        +
Sbjct  348  DWITTLFSKALPLDVATRIWDLVFIEGEIFIYRTALSILRYFISDLIQATYDECIDLFNK  407

Query  583  LPE-TLQAEALFNSISQMSTTVGTTTFQQML  612
            LP+  +  + LF  I   S  +    F ++L
Sbjct  408  LPQRKISEDKLFEEIQ--SIVLDQRKFDKLL  436


>Q54SA3_DICDI unnamed protein product
Length=1194

 Score = 187 bits (475),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 96/289 (33%), Positives = 155/289 (54%), Gaps = 29/289 (10%)

Query  340   ILPKFESVK-NTKKVRELWWRGLPPSVRGKVWKLAIPNNLNITTHLYNICLDRAIS----  394
              LP F+ +K N K+ R+LW RG PP++RG +WK AI N L I   LY+  LD+       
Sbjct  888   FLPDFDKMKTNKKEWRDLWRRGFPPTIRGIIWKRAIGNKLEINGTLYHGLLDQLSDLQDR  947

Query  395   ------------------------SPISETLAAIKLDVSRTFPTLCVFQEGGPLSNSLQG  430
                                     S   +T   IK+D+ RTFP L +F   G L   L+ 
Sbjct  948   YNRDLVLLGEGFEANLPPNLPKEYSTFIKTFNMIKVDLPRTFPQLRLFNPAGALHEQLRT  1007

Query  431   ILAAYAVYRPDVGYVQGMSFVGAVLSLNMEPPDAFTCFANLLNHPCHRSAFTLNQKQMDI  490
              L  +A+Y P +GYVQGMS++ AV  L M+P ++F  F NLLN+    S F ++ + +  
Sbjct  1008  TLLLFALYTPQIGYVQGMSYLAAVFCLFMDPFESFVYFTNLLNNHFFNSLFKMDIRGIVN  1067

Query  491   YYKVYSSALAHKLPKIFSHFTVAGLSPDLYLLDWLYTIYAKAMPLDVACRVWDVFLRDGD  550
             + K++     + +PK++  F    LS + +LL+W+ T++ K +PL++  R+WD +  +G+
Sbjct  1068  HVKIFDLLFKNHVPKLYDKFQQLELSTEHFLLEWMMTLFTKQLPLNIVFRIWDSYFMEGE  1127

Query  551   EFLFRTALGVLHLYQEELLKMDFVHGAQFLTRLPETLQAEALFNSISQM  599
              F++ TA+G+L L +  ++  +F      +   P  L+ E LF+SIS +
Sbjct  1128  AFIYSTAIGILKLCRNFIIASNFEDSLAIIKSTPHNLKEEDLFDSISAV  1176



Lambda      K        H
   0.322    0.139    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7506754320


Query= XP_050573124.1 nicotinate phosphoribosyltransferase isoform X1
[Bombus affinis]

Length=610
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

C6KTC6_PLAF7  unnamed protein product                                 230     7e-67
Q389I2_TRYB2  unnamed protein product                                 39.3    0.008
NCKX_DROME  unnamed protein product                                   30.8    4.2  


>C6KTC6_PLAF7 unnamed protein product
Length=665

 Score = 230 bits (587),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 117/283 (41%), Positives = 175/283 (62%), Gaps = 11/283 (4%)

Query  14   QNCVVQPLLTDLYQITMAYAYWKSQKMNDHAVFDLYFRKNPFQGEFTIFAGLEECMKFLE  73
             N  +  L  D Y + MAY Y+K  K  D ++F++YFRK PF G+F I AG+ E +K++ 
Sbjct  143  HNNTINALFMDYYHLVMAYTYFKQNKHEDKSIFEVYFRKCPFNGQFAILAGVYEVIKYIN  202

Query  74   KFRYSSSDIKYLKSTMPSSVD-QKFFEYLKDLTPKDVTIYAMEEGSVVFPRIPLLRVEGP  132
             FR++ + + +++  M S  D   F +YL+ ++  D+ IY MEEGSVVFP  PL+ +EGP
Sbjct  203  CFRFTKAQLDFIRKKMSSYNDIDSFVQYLEKISGNDLCIYGMEEGSVVFPNEPLMVIEGP  262

Query  133  LIMVQLLETTLLTLVNYASLMATNAARYRMVAGKNITLLEFGLRRAQGPDGGLSASKYSY  192
            L++ Q+LE+ +L L+NY +L++TN+  Y+  +  N TL EFG RRAQGPDG LS SKYS+
Sbjct  263  LLICQILESVILNLMNYPTLISTNSIMYKF-SINNKTLAEFGCRRAQGPDGALSGSKYSF  321

Query  193  IGGFDGTSNVLAGKLYNIPVSGTHAHSYITSFTGIDDLQEKTLAHKGTGQVYDLLELAYK  252
             G  D TSNV A  LY+IP+ GT +HS+I+SF   + L    L +      +D + +  K
Sbjct  322  CGC-DFTSNVYASYLYDIPILGTMSHSFISSFHNTEKLISNLLDN------HDFVSIINK  374

Query  253  HRNSIAADVGTLVSEASSGELAALISYAIAYPQRFVALVDTYD  295
            ++N +        +  S  EL A  ++A   P+ F+ L+DTYD
Sbjct  375  NKNIVHKLYDCKYTNES--ELIAFSAFAQINPKNFICLIDTYD  415


 Score = 197 bits (502),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 96/250 (38%), Positives = 152/250 (61%), Gaps = 1/250 (0%)

Query  359  VRSGLLNFCAVALALNDLGYKAVGIRIDSGDLAYLSNTARNIFERIAIKYNIPWFAKLTI  418
            ++SG+ NF  VAL+L ++ YK +GIRIDSGDL  L+N  +NIF  I+ K N+P F +L I
Sbjct  417  LKSGIYNFLIVALSLYEINYKPIGIRIDSGDLRSLTNECKNIFNDISQKLNVP-FNQLKI  475

Query  419  CASNDINEETILSLNEQNHKIDCFGIGTHLVTCQRQPALGCVYKMVEINGQPRIKLSQEV  478
            C SNDIN++ I  LNE+ + ID F IGT+L+TCQ QP+LG VYK+V+IN  P  K++ E 
Sbjct  476  CVSNDINQKIINYLNEEQNHIDIFAIGTNLITCQSQPSLGLVYKLVQINNAPCFKMTNEN  535

Query  479  GKVTIPGKKDAFRLYGADGYALIDLLQRSTEEVPQVKHKVLCRHPFQESKRAYVIPSRVE  538
             K  +P +K+ +R+Y    +A +D +Q   E+ P +  + +  +   E K+  +IP ++E
Sbjct  536  KKSNLPYQKNVYRIYTDQQFATLDYIQLYNEQPPILNQQTISINIHDEWKQTIIIPKKIE  595

Query  539  SLHKVYWKNGKLCQPLPTLQEIRNRVQESLKTLRNDHKRNLNPTPYKVAVSDDLYNFIHD  598
                + WK GK       + +++   Q  +   +N+H + ++P PY V  SD  +    D
Sbjct  596  QKLCLIWKYGKSLITFKNIYDLKKYTQSEINNFKNEHFKTVSPVPYPVLFSDTYHKVYKD  655

Query  599  LWLQNAPIGE  608
            L ++N+ I +
Sbjct  656  LLIKNSHINQ  665


>Q389I2_TRYB2 unnamed protein product
Length=428

 Score = 39.3 bits (90),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 48/113 (42%), Gaps = 10/113 (9%)

Query  375  DLGYKAVGIRIDSGDLAYLSNTARNIFERIAIKYNIPWFAKLTICASNDINEETILSLN-  433
            DL    VG+R DSG+       A   ++R  I    P    L    S D+     L    
Sbjct  285  DLAQAYVGLRHDSGNPYVWGRKAIEHYKRFNID---PKLKTLVFSDSLDLERAAKLHCTF  341

Query  434  EQNHKIDCFGIGTHLVTCQ---RQPALGCVYKMVEINGQPRIKLSQEVGKVTI  483
             Q   + C GIGT L TC     QP L  V KM E +G+P  K+S E  K T 
Sbjct  342  AQESNVMC-GIGTQL-TCSIPGVQP-LSIVIKMTECDGKPVAKISDEPEKTTF  391


>NCKX_DROME unnamed protein product
Length=881

 Score = 30.8 bits (68),  Expect = 4.2, Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 1/50 (2%)

Query  364  LNFCAVALALNDLGYKAVGIRIDSGDLAYLSNTARNIFERIAIKYNIPWF  413
            L F A   ++ DL    +  R   GD+A  S+   NIF+ + +   IPW 
Sbjct  760  LTFLAAGTSIPDLITSVIVARKGFGDMAVSSSVGSNIFD-VTVGLPIPWL  808



Lambda      K        H
   0.322    0.139    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7506754320


Query= XP_050573125.1 nicotinate phosphoribosyltransferase isoform X2
[Bombus affinis]

Length=548
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

C6KTC6_PLAF7  unnamed protein product                                 421     1e-140
Q389I2_TRYB2  unnamed protein product                                 44.3    2e-04 
NCKX_DROME  unnamed protein product                                   30.8    3.9   


>C6KTC6_PLAF7 unnamed protein product
Length=665

 Score = 421 bits (1083),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 213/534 (40%), Positives = 326/534 (61%), Gaps = 12/534 (2%)

Query  14   QNCVVQPLLTDLYQITMAYAYWKSQKMNDHAVFDLYFRKNPFQGEFTIFAGLEECMKFLE  73
             N  +  L  D Y + MAY Y+K  K  D ++F++YFRK PF G+F I AG+ E +K++ 
Sbjct  143  HNNTINALFMDYYHLVMAYTYFKQNKHEDKSIFEVYFRKCPFNGQFAILAGVYEVIKYIN  202

Query  74   KFRYSSSDIKYLKSTMPSSVD-QKFFEYLKDLTPKDVTIYAMEEGSVVFPRIPLLRVEGP  132
             FR++ + + +++  M S  D   F +YL+ ++  D+ IY MEEGSVVFP  PL+ +EGP
Sbjct  203  CFRFTKAQLDFIRKKMSSYNDIDSFVQYLEKISGNDLCIYGMEEGSVVFPNEPLMVIEGP  262

Query  133  LIMVQLLETTLLTLVNYASLMATNAARYRMVAGKNITLLEFGLRRAQGPDGGLSASKYSY  192
            L++ Q+LE+ +L L+NY +L++TN+  Y+  +  N TL EFG RRAQGPDG LS SKYS+
Sbjct  263  LLICQILESVILNLMNYPTLISTNSIMYKF-SINNKTLAEFGCRRAQGPDGALSGSKYSF  321

Query  193  IGGFDGTSNVLAGKLYNIPVSGTHAHSYITSFTGIDDLQEKTLAHKGTGQVYDLLELAYK  252
             G  D TSNV A  LY+IP+ GT +HS+I+SF   + L    L +      +D + +  K
Sbjct  322  CGC-DFTSNVYASYLYDIPILGTMSHSFISSFHNTEKLISNLLDN------HDFVSIINK  374

Query  253  HRNSIAADVGTLVSEASSGELAALISYAIAYPQRFVALVDTYDVKRSGLLNFCAVALALN  312
            ++N +        +  S  EL A  ++A   P+ F+ L+DTYD  +SG+ NF  VAL+L 
Sbjct  375  NKNIVHKLYDCKYTNES--ELIAFSAFAQINPKNFICLIDTYDTLKSGIYNFLIVALSLY  432

Query  313  DLGYKAVGIRIDSGDLAYLSNTARNIFERIAIKYNIPWFAKLTICASNDINEETILSLNE  372
            ++ YK +GIRIDSGDL  L+N  +NIF  I+ K N+P F +L IC SNDIN++ I  LNE
Sbjct  433  EINYKPIGIRIDSGDLRSLTNECKNIFNDISQKLNVP-FNQLKICVSNDINQKIINYLNE  491

Query  373  QNHKIDCFGIGTHLVTCQRQPALGCVYKMVEINGQPRIKLSQEVGKVTIPGKKDAFRLYG  432
            + + ID F IGT+L+TCQ QP+LG VYK+V+IN  P  K++ E  K  +P +K+ +R+Y 
Sbjct  492  EQNHIDIFAIGTNLITCQSQPSLGLVYKLVQINNAPCFKMTNENKKSNLPYQKNVYRIYT  551

Query  433  ADGYALIDLLQRSTEEVPQVKHKVLCRHPFQESKRAYVIPSRVESLHKVYWKNGKLCQPL  492
               +A +D +Q   E+ P +  + +  +   E K+  +IP ++E    + WK GK     
Sbjct  552  DQQFATLDYIQLYNEQPPILNQQTISINIHDEWKQTIIIPKKIEQKLCLIWKYGKSLITF  611

Query  493  PTLQEIRNRVQESLKTLRNDHKRNLNPTPYKVAVSDDLYNFIHDLWLQNAPIGE  546
              + +++   Q  +   +N+H + ++P PY V  SD  +    DL ++N+ I +
Sbjct  612  KNIYDLKKYTQSEINNFKNEHFKTVSPVPYPVLFSDTYHKVYKDLLIKNSHINQ  665


>Q389I2_TRYB2 unnamed protein product
Length=428

 Score = 44.3 bits (103),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 70/261 (27%), Positives = 94/261 (36%), Gaps = 62/261 (24%)

Query  172  EFGLRRAQGPDGGLS-----ASKYSYIGGFDGTSNVLAGKLYNIPVSGTHAHSYITSFTG  226
            +FG RR    D   +      S  S+   F GTSN        +P  GT AH +      
Sbjct  182  DFGTRRRYSFDVQEAIVRTLQSHPSFGRNFSGTSNYHLAMKLGLPAVGTQAHEWFQ----  237

Query  227  IDDLQEKTLAHKGTGQVYDLLELAYKHRNSIAADVGTLVSEASSGELAALISYAIAYPQR  286
                                   A++  + +  D           +  AL  + + YPQ 
Sbjct  238  -----------------------AHQQLSPVLRDF----------QRVALKQWLLEYPQD  264

Query  287  F-VALVDTYDVKRSGLL-NFCAVALALNDLGYKAVGIRIDSGDLAYLSNTARNIFERIAI  344
              +AL D   +   G L +F A      DL    VG+R DSG+       A   ++R  I
Sbjct  265  LHIALTDC--ISMDGFLGDFDA------DLAQAYVGLRHDSGNPYVWGRKAIEHYKRFNI  316

Query  345  KYNIPWFAKLTICASNDINEETILSLN-EQNHKIDCFGIGTHLVTCQ---RQPALGCVYK  400
                P    L    S D+     L     Q   + C GIGT L TC     QP L  V K
Sbjct  317  D---PKLKTLVFSDSLDLERAAKLHCTFAQESNVMC-GIGTQL-TCSIPGVQP-LSIVIK  370

Query  401  MVEINGQPRIKLSQEVGKVTI  421
            M E +G+P  K+S E  K T 
Sbjct  371  MTECDGKPVAKISDEPEKTTF  391


>NCKX_DROME unnamed protein product
Length=881

 Score = 30.8 bits (68),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 1/50 (2%)

Query  302  LNFCAVALALNDLGYKAVGIRIDSGDLAYLSNTARNIFERIAIKYNIPWF  351
            L F A   ++ DL    +  R   GD+A  S+   NIF+ + +   IPW 
Sbjct  760  LTFLAAGTSIPDLITSVIVARKGFGDMAVSSSVGSNIFD-VTVGLPIPWL  808



Lambda      K        H
   0.322    0.139    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7506754320


Query= XP_050573126.1 nicotinate phosphoribosyltransferase isoform X3
[Bombus affinis]

Length=491
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

C6KTC6_PLAF7  unnamed protein product                                 198     3e-56
Q389I2_TRYB2  unnamed protein product                                 39.3    0.006
NCKX_DROME  unnamed protein product                                   30.4    4.3  


>C6KTC6_PLAF7 unnamed protein product
Length=665

 Score = 198 bits (504),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 96/250 (38%), Positives = 152/250 (61%), Gaps = 1/250 (0%)

Query  240  VRSGLLNFCAVALALNDLGYKAVGIRIDSGDLAYLSNTARNIFERIAIKYNIPWFAKLTI  299
            ++SG+ NF  VAL+L ++ YK +GIRIDSGDL  L+N  +NIF  I+ K N+P F +L I
Sbjct  417  LKSGIYNFLIVALSLYEINYKPIGIRIDSGDLRSLTNECKNIFNDISQKLNVP-FNQLKI  475

Query  300  CASNDINEETILSLNEQNHKIDCFGIGTHLVTCQRQPALGCVYKMVEINGQPRIKLSQEV  359
            C SNDIN++ I  LNE+ + ID F IGT+L+TCQ QP+LG VYK+V+IN  P  K++ E 
Sbjct  476  CVSNDINQKIINYLNEEQNHIDIFAIGTNLITCQSQPSLGLVYKLVQINNAPCFKMTNEN  535

Query  360  GKVTIPGKKDAFRLYGADGYALIDLLQRSTEEVPQVKHKVLCRHPFQESKRAYVIPSRVE  419
             K  +P +K+ +R+Y    +A +D +Q   E+ P +  + +  +   E K+  +IP ++E
Sbjct  536  KKSNLPYQKNVYRIYTDQQFATLDYIQLYNEQPPILNQQTISINIHDEWKQTIIIPKKIE  595

Query  420  SLHKVYWKNGKLCQPLPTLQEIRNRVQESLKTLRNDHKRNLNPTPYKVAVSDDLYNFIHD  479
                + WK GK       + +++   Q  +   +N+H + ++P PY V  SD  +    D
Sbjct  596  QKLCLIWKYGKSLITFKNIYDLKKYTQSEINNFKNEHFKTVSPVPYPVLFSDTYHKVYKD  655

Query  480  LWLQNAPIGE  489
            L ++N+ I +
Sbjct  656  LLIKNSHINQ  665


 Score = 134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/171 (42%), Positives = 106/171 (62%), Gaps = 10/171 (6%)

Query  6    PLLRVEGPLIMVQLLETTLLTLVNYASLMATNAARYRMVAGKNITLLEFGLRRAQGPDGG  65
            PL+ +EGPL++ Q+LE+ +L L+NY +L++TN+  Y+  +  N TL EFG RRAQGPDG 
Sbjct  255  PLMVIEGPLLICQILESVILNLMNYPTLISTNSIMYKF-SINNKTLAEFGCRRAQGPDGA  313

Query  66   LSASKYSYIGGFDGTSNVLAGKLYNIPVSGTHAHSYITSFTGIDDLQEKTLAHKGTGQVY  125
            LS SKYS+ G  D TSNV A  LY+IP+ GT +HS+I+SF   + L    L +      +
Sbjct  314  LSGSKYSFCGC-DFTSNVYASYLYDIPILGTMSHSFISSFHNTEKLISNLLDN------H  366

Query  126  DLLELAYKHRNSIAADVGTLVSEASSGELAALISYAIAYPQRFVALVDTYD  176
            D + +  K++N +        +  S  EL A  ++A   P+ F+ L+DTYD
Sbjct  367  DFVSIINKNKNIVHKLYDCKYTNES--ELIAFSAFAQINPKNFICLIDTYD  415


>Q389I2_TRYB2 unnamed protein product
Length=428

 Score = 39.3 bits (90),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 48/113 (42%), Gaps = 10/113 (9%)

Query  256  DLGYKAVGIRIDSGDLAYLSNTARNIFERIAIKYNIPWFAKLTICASNDINEETILSLN-  314
            DL    VG+R DSG+       A   ++R  I    P    L    S D+     L    
Sbjct  285  DLAQAYVGLRHDSGNPYVWGRKAIEHYKRFNID---PKLKTLVFSDSLDLERAAKLHCTF  341

Query  315  EQNHKIDCFGIGTHLVTCQ---RQPALGCVYKMVEINGQPRIKLSQEVGKVTI  364
             Q   + C GIGT L TC     QP L  V KM E +G+P  K+S E  K T 
Sbjct  342  AQESNVMC-GIGTQL-TCSIPGVQP-LSIVIKMTECDGKPVAKISDEPEKTTF  391


>NCKX_DROME unnamed protein product
Length=881

 Score = 30.4 bits (67),  Expect = 4.3, Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 1/50 (2%)

Query  245  LNFCAVALALNDLGYKAVGIRIDSGDLAYLSNTARNIFERIAIKYNIPWF  294
            L F A   ++ DL    +  R   GD+A  S+   NIF+ + +   IPW 
Sbjct  760  LTFLAAGTSIPDLITSVIVARKGFGDMAVSSSVGSNIFD-VTVGLPIPWL  808



Lambda      K        H
   0.322    0.139    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7506754320


Query= XP_050573127.1 beta-1-syntrophin isoform X1 [Bombus affinis]

Length=589
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VNY4_DROME  unnamed protein product                                 538     0.0   
Q9VNY2_DROME  unnamed protein product                                 512     7e-176
M9PGE3_DROME  unnamed protein product                                 511     2e-175


>Q9VNY4_DROME unnamed protein product
Length=624

 Score = 538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/613 (51%), Positives = 379/613 (62%), Gaps = 95/613 (15%)

Query  56   SSSASG-RAGVLETQVRGQWYRVFVSLEDDYLSISLDESCE-----------TSNNALNN  103
            S S SG R G +ET+VRG WYRV V+LE D+L++SLDESCE           T N  L N
Sbjct  23   SPSPSGLRCGNMETRVRGAWYRVLVTLETDFLAVSLDESCEAAQPSNDGQSTTLNGTLGN  82

Query  104  ----------------------------------------GNINNNNVDSLNDP------  117
                                                    G+ +N+N D   DP      
Sbjct  83   HSGGGGGGAGGGGTGGGGQNGTLPNSASLQGMNIQDTELDGSASNDNGD--RDPCLNNNN  140

Query  118  -----------DVPDSVANQKRIVRVVKSDNNGLGISIKGGKENKMPILISKIFKGMAAD  166
                       DVPD VANQKR VR++KSDNNGLGISIKGG+EN+MPILISKIF+GMAAD
Sbjct  141  NAGDGGGMDMCDVPDHVANQKRHVRIIKSDNNGLGISIKGGRENRMPILISKIFRGMAAD  200

Query  167  ATEQLYVGDAILAVNGEDLREATHDEAVKALKRAGKVVELEVKYLREVTPYFRKASIIQE  226
              + LYVGDAIL VNGE+LR+ATHDEAV+ALKR+G+VV+LEVK+LREVTPYFRKASII E
Sbjct  201  QAKGLYVGDAILTVNGEELRDATHDEAVRALKRSGRVVDLEVKFLREVTPYFRKASIISE  260

Query  227  VGWELQRGFLS-------ATPPPPKSPPRADTRYLPLQLCRLTRAHPSSDPEGRILELHS  279
            VGWELQR FL         +PP PK+ PRADTRY+PLQL  L R     DPE R  ELHS
Sbjct  261  VGWELQRAFLCPLGPGVPTSPPAPKTTPRADTRYIPLQLTHLARNLKYIDPENRCFELHS  320

Query  280  PDGVHECWLRAADNAEASVWFNALHSALAALTLKALRLAS-ALPD-PPQLQHIGWLARRH  337
            PDGVH C LRAAD+AEA VWFNALHSA+   T +AL  A+ AL +   +L+HIGWL++R 
Sbjct  321  PDGVHSCILRAADSAEALVWFNALHSAMGTSTQRALAEANRALTNLIGELKHIGWLSKRM  380

Query  338  CLQNGRASSESSEDGAGSSASTSRGAGS-----GFALGGGCTGGWRSVFGAVSGRELRLY  392
                   S+       GS  S S  AG        +     +  W  +F AV+ RE R+Y
Sbjct  381  SGGGSSGSAGGGAASGGSGTSNSVVAGELPSGRSSSESSDESDKWLPIFVAVTEREFRIY  440

Query  393  ECAPWSPEAWASPSITCPLIATRLVSSPARQNEAGSSSSGATQHAATFAVRVGTIDGVVT  452
            E APWS EAW+ P     L  TRL         AG++SS   Q    F VR GT  GV+ 
Sbjct  441  ESAPWSVEAWSRPLEIYALATTRLAG-------AGNNSSLNGQQTTVFCVRCGTARGVLV  493

Query  453  HHLRAETRRDLAAWARAIVQGCHAAAHSLREYTVRCTWQGKACQLVVNHEDGFALFAAGT  512
            + LR+ET RD+AAWAR++VQG H A +  RE++ RC +QG+ CQLVV+   GF L+  G 
Sbjct  494  YWLRSETHRDMAAWARSLVQGSHQAVNYQREFSFRCLFQGRQCQLVVHINRGFFLYDCG-  552

Query  513  RGVGGNGVSPNSSPTPLWRRSFDKLKMSADDGARLLWLDFGGEDGEIELDLESCPKPIVF  572
             G      +  ++ T LW+ +FDKLK SADDGAR+L+LDF GEDGEIELD+E CPKP+VF
Sbjct  553  -GFAPTTPTVATAKTQLWQFAFDKLKGSADDGARMLYLDF-GEDGEIELDMECCPKPVVF  610

Query  573  VLHNFLSAKIHRL  585
            V+HN LSAK+H +
Sbjct  611  VVHNCLSAKVHNI  623


>Q9VNY2_DROME unnamed protein product
Length=627

 Score = 512 bits (1318),  Expect = 7e-176, Method: Compositional matrix adjust.
 Identities = 275/484 (57%), Positives = 334/484 (69%), Gaps = 26/484 (5%)

Query  118  DVPDSVANQKRIVRVVKSDNNGLGISIKGGKENKMPILISKIFKGMAADATEQLYVGDAI  177
            DVPD VANQKR VR++KSDNNGLGISIKGG+EN+MPILISKIF+GMAAD  + LYVGDAI
Sbjct  153  DVPDHVANQKRHVRIIKSDNNGLGISIKGGRENRMPILISKIFRGMAADQAKGLYVGDAI  212

Query  178  LAVNGEDLREATHDEAVKALKRAGKVVELEVKYLREVTPYFRKASIIQEVGWELQRGFLS  237
            L VNGE+LR+ATHDEAV+ALKR+G+VV+LEVK+LREVTPYFRKASII EVGWELQR FL 
Sbjct  213  LTVNGEELRDATHDEAVRALKRSGRVVDLEVKFLREVTPYFRKASIISEVGWELQRAFLC  272

Query  238  -------ATPPPPKSPPRADTRYLPLQLCRLTRAHPSSDPEGRILELHSPDGVHECWLRA  290
                    +PP PK+ PRADTRY+PLQL  L R     DPE R  ELHSPDGVH C LRA
Sbjct  273  PLGPGVPTSPPAPKTTPRADTRYIPLQLTHLARNLKYIDPENRCFELHSPDGVHSCILRA  332

Query  291  ADNAEASVWFNALHSALAALTLKALRLAS-ALPD-PPQLQHIGWLARRHCLQNGRASSES  348
            AD+AEA VWFNALHSA+   T +AL  A+ AL +   +L+HIGWL++R        S+  
Sbjct  333  ADSAEALVWFNALHSAMGTSTQRALAEANRALTNLIGELKHIGWLSKRMSGGGSSGSAGG  392

Query  349  SEDGAGSSASTSRGAGSGFALGG-------GCTGGWRSVFGAVSGRELRLYECAPWSPEA  401
                 GS  S S  AG   +  G         +  W  +F AV+ RE R+YE APWS EA
Sbjct  393  GAASGGSGTSNSVVAGELVSPSGRSSSESSDESDKWLPIFVAVTEREFRIYESAPWSVEA  452

Query  402  WASPSITCPLIATRLVSSPARQNEAGSSSSGATQHAATFAVRVGTIDGVVTHHLRAETRR  461
            W+ P     L  TRL         AG++SS   Q    F VR GT  GV+ + LR+ET R
Sbjct  453  WSRPLEIYALATTRLAG-------AGNNSSLNGQQTTVFCVRCGTARGVLVYWLRSETHR  505

Query  462  DLAAWARAIVQGCHAAAHSLREYTVRCTWQGKACQLVVNHEDGFALFAAGTRGVGGNGVS  521
            D+AAWAR++VQG H A +  RE++ RC +QG+ CQLVV+   GF L+  G  G      +
Sbjct  506  DMAAWARSLVQGSHQAVNYQREFSFRCLFQGRQCQLVVHINRGFFLYDCG--GFAPTTPT  563

Query  522  PNSSPTPLWRRSFDKLKMSADDGARLLWLDFGGEDGEIELDLESCPKPIVFVLHNFLSAK  581
              ++ T LW+ +FDKLK SADDGAR+L+LDF GEDGEIELD+E CPKP+VFV+HN LSAK
Sbjct  564  VATAKTQLWQFAFDKLKGSADDGARMLYLDF-GEDGEIELDMECCPKPVVFVVHNCLSAK  622

Query  582  IHRL  585
            +H +
Sbjct  623  VHNI  626


 Score = 57.0 bits (136),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 34/44 (77%), Gaps = 1/44 (2%)

Query  56  SSSASG-RAGVLETQVRGQWYRVFVSLEDDYLSISLDESCETSN  98
           S S SG R G +ET+VRG WYRV V+LE D+L++SLDESCE + 
Sbjct  23  SPSPSGLRCGNMETRVRGAWYRVLVTLETDFLAVSLDESCEAAQ  66


>M9PGE3_DROME unnamed protein product
Length=625

 Score = 511 bits (1315),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 274/482 (57%), Positives = 333/482 (69%), Gaps = 24/482 (5%)

Query  118  DVPDSVANQKRIVRVVKSDNNGLGISIKGGKENKMPILISKIFKGMAADATEQLYVGDAI  177
            DVPD VANQKR VR++KSDNNGLGISIKGG+EN+MPILISKIF+GMAAD  + LYVGDAI
Sbjct  153  DVPDHVANQKRHVRIIKSDNNGLGISIKGGRENRMPILISKIFRGMAADQAKGLYVGDAI  212

Query  178  LAVNGEDLREATHDEAVKALKRAGKVVELEVKYLREVTPYFRKASIIQEVGWELQRGFLS  237
            L VNGE+LR+ATHDEAV+ALKR+G+VV+LEVK+LREVTPYFRKASII EVGWELQR FL 
Sbjct  213  LTVNGEELRDATHDEAVRALKRSGRVVDLEVKFLREVTPYFRKASIISEVGWELQRAFLC  272

Query  238  -------ATPPPPKSPPRADTRYLPLQLCRLTRAHPSSDPEGRILELHSPDGVHECWLRA  290
                    +PP PK+ PRADTRY+PLQL  L R     DPE R  ELHSPDGVH C LRA
Sbjct  273  PLGPGVPTSPPAPKTTPRADTRYIPLQLTHLARNLKYIDPENRCFELHSPDGVHSCILRA  332

Query  291  ADNAEASVWFNALHSALAALTLKALRLAS-ALPD-PPQLQHIGWLARRHCLQNGRASSES  348
            AD+AEA VWFNALHSA+   T +AL  A+ AL +   +L+HIGWL++R        S+  
Sbjct  333  ADSAEALVWFNALHSAMGTSTQRALAEANRALTNLIGELKHIGWLSKRMSGGGSSGSAGG  392

Query  349  SEDGAGSSASTSRGAGS-----GFALGGGCTGGWRSVFGAVSGRELRLYECAPWSPEAWA  403
                 GS  S S  AG        +     +  W  +F AV+ RE R+YE APWS EAW+
Sbjct  393  GAASGGSGTSNSVVAGELPSGRSSSESSDESDKWLPIFVAVTEREFRIYESAPWSVEAWS  452

Query  404  SPSITCPLIATRLVSSPARQNEAGSSSSGATQHAATFAVRVGTIDGVVTHHLRAETRRDL  463
             P     L  TRL         AG++SS   Q    F VR GT  GV+ + LR+ET RD+
Sbjct  453  RPLEIYALATTRLAG-------AGNNSSLNGQQTTVFCVRCGTARGVLVYWLRSETHRDM  505

Query  464  AAWARAIVQGCHAAAHSLREYTVRCTWQGKACQLVVNHEDGFALFAAGTRGVGGNGVSPN  523
            AAWAR++VQG H A +  RE++ RC +QG+ CQLVV+   GF L+  G  G      +  
Sbjct  506  AAWARSLVQGSHQAVNYQREFSFRCLFQGRQCQLVVHINRGFFLYDCG--GFAPTTPTVA  563

Query  524  SSPTPLWRRSFDKLKMSADDGARLLWLDFGGEDGEIELDLESCPKPIVFVLHNFLSAKIH  583
            ++ T LW+ +FDKLK SADDGAR+L+LDF GEDGEIELD+E CPKP+VFV+HN LSAK+H
Sbjct  564  TAKTQLWQFAFDKLKGSADDGARMLYLDF-GEDGEIELDMECCPKPVVFVVHNCLSAKVH  622

Query  584  RL  585
             +
Sbjct  623  NI  624


 Score = 57.0 bits (136),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 34/44 (77%), Gaps = 1/44 (2%)

Query  56  SSSASG-RAGVLETQVRGQWYRVFVSLEDDYLSISLDESCETSN  98
           S S SG R G +ET+VRG WYRV V+LE D+L++SLDESCE + 
Sbjct  23  SPSPSGLRCGNMETRVRGAWYRVLVTLETDFLAVSLDESCEAAQ  66



Lambda      K        H
   0.322    0.139    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7506754320


Query= XP_050573128.1 beta-1-syntrophin isoform X2 [Bombus affinis]

Length=573
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VNY4_DROME  unnamed protein product                                 538     0.0   
Q9VNY2_DROME  unnamed protein product                                 512     3e-176
M9PGE3_DROME  unnamed protein product                                 511     1e-175


>Q9VNY4_DROME unnamed protein product
Length=624

 Score = 538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/613 (51%), Positives = 379/613 (62%), Gaps = 95/613 (15%)

Query  40   SSSASG-RAGVLETQVRGQWYRVFVSLEDDYLSISLDESCE-----------TSNNALNN  87
            S S SG R G +ET+VRG WYRV V+LE D+L++SLDESCE           T N  L N
Sbjct  23   SPSPSGLRCGNMETRVRGAWYRVLVTLETDFLAVSLDESCEAAQPSNDGQSTTLNGTLGN  82

Query  88   ----------------------------------------GNINNNNVDSLNDP------  101
                                                    G+ +N+N D   DP      
Sbjct  83   HSGGGGGGAGGGGTGGGGQNGTLPNSASLQGMNIQDTELDGSASNDNGD--RDPCLNNNN  140

Query  102  -----------DVPDSVANQKRIVRVVKSDNNGLGISIKGGKENKMPILISKIFKGMAAD  150
                       DVPD VANQKR VR++KSDNNGLGISIKGG+EN+MPILISKIF+GMAAD
Sbjct  141  NAGDGGGMDMCDVPDHVANQKRHVRIIKSDNNGLGISIKGGRENRMPILISKIFRGMAAD  200

Query  151  ATEQLYVGDAILAVNGEDLREATHDEAVKALKRAGKVVELEVKYLREVTPYFRKASIIQE  210
              + LYVGDAIL VNGE+LR+ATHDEAV+ALKR+G+VV+LEVK+LREVTPYFRKASII E
Sbjct  201  QAKGLYVGDAILTVNGEELRDATHDEAVRALKRSGRVVDLEVKFLREVTPYFRKASIISE  260

Query  211  VGWELQRGFLS-------ATPPPPKSPPRADTRYLPLQLCRLTRAHPSSDPEGRILELHS  263
            VGWELQR FL         +PP PK+ PRADTRY+PLQL  L R     DPE R  ELHS
Sbjct  261  VGWELQRAFLCPLGPGVPTSPPAPKTTPRADTRYIPLQLTHLARNLKYIDPENRCFELHS  320

Query  264  PDGVHECWLRAADNAEASVWFNALHSALAALTLKALRLAS-ALPD-PPQLQHIGWLARRH  321
            PDGVH C LRAAD+AEA VWFNALHSA+   T +AL  A+ AL +   +L+HIGWL++R 
Sbjct  321  PDGVHSCILRAADSAEALVWFNALHSAMGTSTQRALAEANRALTNLIGELKHIGWLSKRM  380

Query  322  CLQNGRASSESSEDGAGSSASTSRGAGS-----GFALGGGCTGGWRSVFGAVSGRELRLY  376
                   S+       GS  S S  AG        +     +  W  +F AV+ RE R+Y
Sbjct  381  SGGGSSGSAGGGAASGGSGTSNSVVAGELPSGRSSSESSDESDKWLPIFVAVTEREFRIY  440

Query  377  ECAPWSPEAWASPSITCPLIATRLVSSPARQNEAGSSSSGATQHAATFAVRVGTIDGVVT  436
            E APWS EAW+ P     L  TRL         AG++SS   Q    F VR GT  GV+ 
Sbjct  441  ESAPWSVEAWSRPLEIYALATTRLAG-------AGNNSSLNGQQTTVFCVRCGTARGVLV  493

Query  437  HHLRAETRRDLAAWARAIVQGCHAAAHSLREYTVRCTWQGKACQLVVNHEDGFALFAAGT  496
            + LR+ET RD+AAWAR++VQG H A +  RE++ RC +QG+ CQLVV+   GF L+  G 
Sbjct  494  YWLRSETHRDMAAWARSLVQGSHQAVNYQREFSFRCLFQGRQCQLVVHINRGFFLYDCG-  552

Query  497  RGVGGNGVSPNSSPTPLWRRSFDKLKMSADDGARLLWLDFGGEDGEIELDLESCPKPIVF  556
             G      +  ++ T LW+ +FDKLK SADDGAR+L+LDF GEDGEIELD+E CPKP+VF
Sbjct  553  -GFAPTTPTVATAKTQLWQFAFDKLKGSADDGARMLYLDF-GEDGEIELDMECCPKPVVF  610

Query  557  VLHNFLSAKIHRL  569
            V+HN LSAK+H +
Sbjct  611  VVHNCLSAKVHNI  623


>Q9VNY2_DROME unnamed protein product
Length=627

 Score = 512 bits (1319),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 275/484 (57%), Positives = 334/484 (69%), Gaps = 26/484 (5%)

Query  102  DVPDSVANQKRIVRVVKSDNNGLGISIKGGKENKMPILISKIFKGMAADATEQLYVGDAI  161
            DVPD VANQKR VR++KSDNNGLGISIKGG+EN+MPILISKIF+GMAAD  + LYVGDAI
Sbjct  153  DVPDHVANQKRHVRIIKSDNNGLGISIKGGRENRMPILISKIFRGMAADQAKGLYVGDAI  212

Query  162  LAVNGEDLREATHDEAVKALKRAGKVVELEVKYLREVTPYFRKASIIQEVGWELQRGFLS  221
            L VNGE+LR+ATHDEAV+ALKR+G+VV+LEVK+LREVTPYFRKASII EVGWELQR FL 
Sbjct  213  LTVNGEELRDATHDEAVRALKRSGRVVDLEVKFLREVTPYFRKASIISEVGWELQRAFLC  272

Query  222  -------ATPPPPKSPPRADTRYLPLQLCRLTRAHPSSDPEGRILELHSPDGVHECWLRA  274
                    +PP PK+ PRADTRY+PLQL  L R     DPE R  ELHSPDGVH C LRA
Sbjct  273  PLGPGVPTSPPAPKTTPRADTRYIPLQLTHLARNLKYIDPENRCFELHSPDGVHSCILRA  332

Query  275  ADNAEASVWFNALHSALAALTLKALRLAS-ALPD-PPQLQHIGWLARRHCLQNGRASSES  332
            AD+AEA VWFNALHSA+   T +AL  A+ AL +   +L+HIGWL++R        S+  
Sbjct  333  ADSAEALVWFNALHSAMGTSTQRALAEANRALTNLIGELKHIGWLSKRMSGGGSSGSAGG  392

Query  333  SEDGAGSSASTSRGAGSGFALGG-------GCTGGWRSVFGAVSGRELRLYECAPWSPEA  385
                 GS  S S  AG   +  G         +  W  +F AV+ RE R+YE APWS EA
Sbjct  393  GAASGGSGTSNSVVAGELVSPSGRSSSESSDESDKWLPIFVAVTEREFRIYESAPWSVEA  452

Query  386  WASPSITCPLIATRLVSSPARQNEAGSSSSGATQHAATFAVRVGTIDGVVTHHLRAETRR  445
            W+ P     L  TRL         AG++SS   Q    F VR GT  GV+ + LR+ET R
Sbjct  453  WSRPLEIYALATTRLAG-------AGNNSSLNGQQTTVFCVRCGTARGVLVYWLRSETHR  505

Query  446  DLAAWARAIVQGCHAAAHSLREYTVRCTWQGKACQLVVNHEDGFALFAAGTRGVGGNGVS  505
            D+AAWAR++VQG H A +  RE++ RC +QG+ CQLVV+   GF L+  G  G      +
Sbjct  506  DMAAWARSLVQGSHQAVNYQREFSFRCLFQGRQCQLVVHINRGFFLYDCG--GFAPTTPT  563

Query  506  PNSSPTPLWRRSFDKLKMSADDGARLLWLDFGGEDGEIELDLESCPKPIVFVLHNFLSAK  565
              ++ T LW+ +FDKLK SADDGAR+L+LDF GEDGEIELD+E CPKP+VFV+HN LSAK
Sbjct  564  VATAKTQLWQFAFDKLKGSADDGARMLYLDF-GEDGEIELDMECCPKPVVFVVHNCLSAK  622

Query  566  IHRL  569
            +H +
Sbjct  623  VHNI  626


 Score = 57.0 bits (136),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 34/44 (77%), Gaps = 1/44 (2%)

Query  40  SSSASG-RAGVLETQVRGQWYRVFVSLEDDYLSISLDESCETSN  82
           S S SG R G +ET+VRG WYRV V+LE D+L++SLDESCE + 
Sbjct  23  SPSPSGLRCGNMETRVRGAWYRVLVTLETDFLAVSLDESCEAAQ  66


>M9PGE3_DROME unnamed protein product
Length=625

 Score = 511 bits (1316),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 274/482 (57%), Positives = 333/482 (69%), Gaps = 24/482 (5%)

Query  102  DVPDSVANQKRIVRVVKSDNNGLGISIKGGKENKMPILISKIFKGMAADATEQLYVGDAI  161
            DVPD VANQKR VR++KSDNNGLGISIKGG+EN+MPILISKIF+GMAAD  + LYVGDAI
Sbjct  153  DVPDHVANQKRHVRIIKSDNNGLGISIKGGRENRMPILISKIFRGMAADQAKGLYVGDAI  212

Query  162  LAVNGEDLREATHDEAVKALKRAGKVVELEVKYLREVTPYFRKASIIQEVGWELQRGFLS  221
            L VNGE+LR+ATHDEAV+ALKR+G+VV+LEVK+LREVTPYFRKASII EVGWELQR FL 
Sbjct  213  LTVNGEELRDATHDEAVRALKRSGRVVDLEVKFLREVTPYFRKASIISEVGWELQRAFLC  272

Query  222  -------ATPPPPKSPPRADTRYLPLQLCRLTRAHPSSDPEGRILELHSPDGVHECWLRA  274
                    +PP PK+ PRADTRY+PLQL  L R     DPE R  ELHSPDGVH C LRA
Sbjct  273  PLGPGVPTSPPAPKTTPRADTRYIPLQLTHLARNLKYIDPENRCFELHSPDGVHSCILRA  332

Query  275  ADNAEASVWFNALHSALAALTLKALRLAS-ALPD-PPQLQHIGWLARRHCLQNGRASSES  332
            AD+AEA VWFNALHSA+   T +AL  A+ AL +   +L+HIGWL++R        S+  
Sbjct  333  ADSAEALVWFNALHSAMGTSTQRALAEANRALTNLIGELKHIGWLSKRMSGGGSSGSAGG  392

Query  333  SEDGAGSSASTSRGAGS-----GFALGGGCTGGWRSVFGAVSGRELRLYECAPWSPEAWA  387
                 GS  S S  AG        +     +  W  +F AV+ RE R+YE APWS EAW+
Sbjct  393  GAASGGSGTSNSVVAGELPSGRSSSESSDESDKWLPIFVAVTEREFRIYESAPWSVEAWS  452

Query  388  SPSITCPLIATRLVSSPARQNEAGSSSSGATQHAATFAVRVGTIDGVVTHHLRAETRRDL  447
             P     L  TRL         AG++SS   Q    F VR GT  GV+ + LR+ET RD+
Sbjct  453  RPLEIYALATTRLAG-------AGNNSSLNGQQTTVFCVRCGTARGVLVYWLRSETHRDM  505

Query  448  AAWARAIVQGCHAAAHSLREYTVRCTWQGKACQLVVNHEDGFALFAAGTRGVGGNGVSPN  507
            AAWAR++VQG H A +  RE++ RC +QG+ CQLVV+   GF L+  G  G      +  
Sbjct  506  AAWARSLVQGSHQAVNYQREFSFRCLFQGRQCQLVVHINRGFFLYDCG--GFAPTTPTVA  563

Query  508  SSPTPLWRRSFDKLKMSADDGARLLWLDFGGEDGEIELDLESCPKPIVFVLHNFLSAKIH  567
            ++ T LW+ +FDKLK SADDGAR+L+LDF GEDGEIELD+E CPKP+VFV+HN LSAK+H
Sbjct  564  TAKTQLWQFAFDKLKGSADDGARMLYLDF-GEDGEIELDMECCPKPVVFVVHNCLSAKVH  622

Query  568  RL  569
             +
Sbjct  623  NI  624


 Score = 57.0 bits (136),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 34/44 (77%), Gaps = 1/44 (2%)

Query  40  SSSASG-RAGVLETQVRGQWYRVFVSLEDDYLSISLDESCETSN  82
           S S SG R G +ET+VRG WYRV V+LE D+L++SLDESCE + 
Sbjct  23  SPSPSGLRCGNMETRVRGAWYRVLVTLETDFLAVSLDESCEAAQ  66



Lambda      K        H
   0.322    0.139    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7506754320


Query= XP_050573129.1 ribonuclease P protein subunit p40-like isoform X1
[Bombus affinis]

Length=360
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q54W23_DICDI  unnamed protein product                                 80.9    1e-16
AIFM1_DROME  unnamed protein product                                  30.4    2.6  
Q387Z8_TRYB2  unnamed protein product                                 29.6    3.8  


>Q54W23_DICDI unnamed protein product
Length=424

 Score = 80.9 bits (198),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 74/289 (26%), Positives = 128/289 (44%), Gaps = 41/289 (14%)

Query  76   LINKEFIEAFVKKGQLTLLTIGNRIDVDNSVAVTPTGHLILSLLTEDFQKLGLEGKASFF  135
            L++ EFI+ ++K G    ++  N ID  N VA  P   +IL++  E +Q+LGL GK+S F
Sbjct  136  LLSHEFIDKYIKNGGFYAISQLNFIDSGNVVAFLPNSKIILNVDKETYQELGLLGKSSVF  195

Query  136  DRKVQTRYVVTIDLKSENFTPGKKNYEHVQTSLKERLNT---------------------  174
              K   RY++T+D+ S+ +  G K+Y  +  SLK+RL++                     
Sbjct  196  --KNLQRYIITLDMTSKEYQRGSKSYTRLIWSLKDRLSSINLICFYQKLNSTQLQSIDFP  253

Query  175  -KFDVIVSWNPPDENLCPSSVAAWFHKCKYSVSLCQQTFLQRIEYSLPIPIISNEFDNEK  233
                V+ S+N P + +    +       +          ++         +I N+F NE 
Sbjct  254  QGVKVLPSYNQPTQEILNLRLPTLNIINENLNINNSNNDIK---------MIYNDFINE-  303

Query  234  FFEWLGVFSICGNLESNIENNYVNTYKYPLPVINVGQVWYLQWTGFFTTKQIETFYSIVE  293
            + E LG  S+  NL    +    N+     P+    +       G  +   I     ++E
Sbjct  304  WVEVLGFASLGINLNQVKDFEIGNSLLSQCPI--ATKCLKATQKGLVSNSFI---LELIE  358

Query  294  EYVLM--KNSLPWVALHVQGFLDSPVSWGLKEHTFYTDGDNSYTIVFRP  340
            +  LM  K  + +  L++ GF D+P+SW   EH F   G+N  +++  P
Sbjct  359  KIKLMLSKGLIEYGVLNIYGFADTPISWNSIEHNFLYGGENDQSLLILP  407


>AIFM1_DROME unnamed protein product
Length=739

 Score = 30.4 bits (67),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 27/80 (34%), Positives = 40/80 (50%), Gaps = 13/80 (16%)

Query  92   TLLTIGNRIDVDNSVAVTPTGHLILSLLTEDFQKLGLEGKAS-FFD-----RKVQ--TRY  143
            T L   +R++VD S+     G  +++   E  + L + G AS FFD     R+V+     
Sbjct  530  TDLAGPSRLEVDRSL-----GGFVVNAELEARRNLYVAGDASCFFDPLLGRRRVEHHDHS  584

Query  144  VVTIDLKSENFTPGKKNYEH  163
            VV+  L  EN T  KK Y+H
Sbjct  585  VVSGRLAGENMTGAKKPYQH  604


>Q387Z8_TRYB2 unnamed protein product
Length=255

 Score = 29.6 bits (65),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 23/37 (62%), Gaps = 1/37 (3%)

Query  84   AFVKKGQ-LTLLTIGNRIDVDNSVAVTPTGHLILSLL  119
            AF   G  LT++T+ N++ + NS  VT T HL  SLL
Sbjct  75   AFQDAGTGLTIITVLNKLLLRNSSDVTSTNHLACSLL  111



Lambda      K        H
   0.322    0.139    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7506754320


Query= XP_050573130.1 ribonuclease P protein subunit p40-like isoform X2
[Bombus affinis]

Length=295
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q54W23_DICDI  unnamed protein product                                 68.9    5e-13
AIFM1_DROME  unnamed protein product                                  30.8    1.6  
Q387Z8_TRYB2  unnamed protein product                                 29.6    3.1  


>Q54W23_DICDI unnamed protein product
Length=424

 Score = 68.9 bits (167),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 62/99 (63%), Gaps = 2/99 (2%)

Query  76   LINKEFIEAFVKKGQLTLLTIGNRIDVDNSVAVTPTGHLILSLLTEDFQKLGLEGKASFF  135
            L++ EFI+ ++K G    ++  N ID  N VA  P   +IL++  E +Q+LGL GK+S F
Sbjct  136  LLSHEFIDKYIKNGGFYAISQLNFIDSGNVVAFLPNSKIILNVDKETYQELGLLGKSSVF  195

Query  136  DRKVQTRYVVTIDLKSENFTPGKKNYEHVQTSLKERLNT  174
              K   RY++T+D+ S+ +  G K+Y  +  SLK+RL++
Sbjct  196  --KNLQRYIITLDMTSKEYQRGSKSYTRLIWSLKDRLSS  232


>AIFM1_DROME unnamed protein product
Length=739

 Score = 30.8 bits (68),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 27/80 (34%), Positives = 40/80 (50%), Gaps = 13/80 (16%)

Query  92   TLLTIGNRIDVDNSVAVTPTGHLILSLLTEDFQKLGLEGKAS-FFD-----RKVQ--TRY  143
            T L   +R++VD S+     G  +++   E  + L + G AS FFD     R+V+     
Sbjct  530  TDLAGPSRLEVDRSL-----GGFVVNAELEARRNLYVAGDASCFFDPLLGRRRVEHHDHS  584

Query  144  VVTIDLKSENFTPGKKNYEH  163
            VV+  L  EN T  KK Y+H
Sbjct  585  VVSGRLAGENMTGAKKPYQH  604


>Q387Z8_TRYB2 unnamed protein product
Length=255

 Score = 29.6 bits (65),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 23/37 (62%), Gaps = 1/37 (3%)

Query  84   AFVKKGQ-LTLLTIGNRIDVDNSVAVTPTGHLILSLL  119
            AF   G  LT++T+ N++ + NS  VT T HL  SLL
Sbjct  75   AFQDAGTGLTIITVLNKLLLRNSSDVTSTNHLACSLL  111



Lambda      K        H
   0.322    0.139    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7506754320


Query= XP_050573131.1 succinate-semialdehyde dehydrogenase [NADP(+)] GabD
[Bombus affinis]

Length=511
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VBP6_DROME  unnamed protein product                                 591     0.0  
Q9VLC5_DROME  unnamed protein product                                 263     9e-82
AL7A1_DICDI  unnamed protein product                                  181     1e-50


>Q9VBP6_DROME unnamed protein product
Length=509

 Score = 591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/486 (58%), Positives = 371/486 (76%), Gaps = 6/486 (1%)

Query  28   LLRDQAYVNGKWI-GGRKNETFPIYNPADQSVINNVPDMDVEDTKLAINAASKAFQS--F  84
            L++D+A V+G W+       TF + NPA+ +VI  VP+M V D + AI+AA +A++S  +
Sbjct  26   LVQDKALVDGAWVDSSNAKATFEVRNPANGAVIGKVPNMTVADAQKAIDAAKQAYESKEW  85

Query  85   NKTTAKERSDLLRNWYNLMVEHSEDLAKILTKENGKSITESKAEIKYGNSFVEWFSEEAR  144
               TAK+RS+LL+ W+ L+ +HS+++A+I+T E+GK I ESK E+ YGN+FVEWF+EEAR
Sbjct  86   RSLTAKDRSNLLKKWHKLIEQHSQEIAEIMTAESGKPINESKGEVAYGNAFVEWFAEEAR  145

Query  145  RIDGEILQTPIANRKLFLYKEPIGVAALITPWNFPHAMITRKAAAALAVGCTCVIKPSEE  204
            RI GEI+ +   NR++ + K+PIGVAALITPWNFP AMITRKA AALA GCT V+KPSE+
Sbjct  146  RIYGEIVPSASPNREIIVMKQPIGVAALITPWNFPMAMITRKAGAALAAGCTVVVKPSED  205

Query  205  TPLTALALADLAEKAGFPQGTINVITTGLKNSPAVGKELCENFDVKVLSFTGSTNVGKIL  264
            TPLTALA+A LA  AG P+G INV+TT  K +P +G   C++ DV+ +SFTGST VGK+L
Sbjct  206  TPLTALAVAKLAVDAGIPKGVINVVTTN-KAAP-IGDLFCKSPDVRGISFTGSTEVGKLL  263

Query  265  YKNSASTVKRLSLELGGNASFIVFDSADLDIAVHGAMASKFRNSGQTCVSANRFFVHSSK  324
            ++NSA  +KR+ LELGGNA FIVFDSAD++ AV GAMASKFRN GQTCVSANRFFV  S 
Sbjct  264  FRNSADGIKRICLELGGNAPFIVFDSADIEKAVDGAMASKFRNCGQTCVSANRFFVQDSV  323

Query  325  FDQFIEMFLSRIKSEIKMGDGSKKGVTHGPLIKESQLNMVHALVTDAVEKGAKVHCGGTP  384
            +D+F+     R+++ +K+GDG    V  GPLI E Q N V   V DA  K A +  GG P
Sbjct  324  YDKFVGQLKKRVEA-LKIGDGQGCDVQIGPLINEMQFNKVSGFVEDARSKKANIILGGQP  382

Query  385  LPELGPLFYAPTLMTDVTKDMQIYNKEIFGPVAVIHKFETENEVIQSSNDTSVGLAGYFY  444
            LP+ G LFYAPT++TDV    Q+Y++E+FGPV  I +F  E E ++ +NDT  GLAGYFY
Sbjct  383  LPDKGSLFYAPTIVTDVPPSAQLYSEEVFGPVVSIIRFRDEEEAVKKANDTRRGLAGYFY  442

Query  445  SQDISQIFRVAKQLEVGMIGVNEGIISTAEAAFGGVKESGLGREGSKHGVDDFLQIKYLC  504
            S+++ Q+FRVAK+LEVGM+GVNEGIIS AEA FGGVKESG+GREGSKHG+DD++ IKY+C
Sbjct  443  SENLQQVFRVAKRLEVGMVGVNEGIISAAEAPFGGVKESGVGREGSKHGIDDYVDIKYIC  502

Query  505  LGNIKY  510
            +GN+KY
Sbjct  503  MGNLKY  508


>Q9VLC5_DROME unnamed protein product
Length=520

 Score = 263 bits (673),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 162/481 (34%), Positives = 255/481 (53%), Gaps = 15/481 (3%)

Query  28   LLRDQAYVNGKWIGGRKNETFPIYNPADQSVINNVPDMDVEDTKLAINAASKAFQ---SF  84
            +L    ++N +W   +  + F   NP    VI  +   D ED  +A+ AA  AF+    +
Sbjct  37   ILYTGVFINNEWHKSKSGKIFETINPTTAEVIAEIQCADKEDIDIAVQAARNAFKLGSPW  96

Query  85   NKTTAKERSDLLRNWYNLMVEHSEDLAKILTKENGKSITES-KAEIKYGNSFVEWFSEEA  143
             +  A ER  LL    +LM      LA + T +NGK  + S   ++      + +F+  A
Sbjct  97   RRMDASERGRLLYRLADLMERDQVYLASLETLDNGKPYSMSYNVDLPTAIKNLRYFAGWA  156

Query  144  RRIDGEILQTPIANRKLFLYK--EPIGVAALITPWNFPHAMITRKAAAALAVGCTCVIKP  201
             +  G+ +  P+ +   F Y   EP+GV   I PWNFP  M+  K   ALA G T V+KP
Sbjct  157  DKNHGKTI--PM-DGDFFTYTRHEPVGVCGQIIPWNFPILMMAWKLGPALATGNTIVLKP  213

Query  202  SEETPLTALALADLAEKAGFPQGTINVITTGLKNSPAVGKELCENFDVKVLSFTGSTNVG  261
            +E+T LTAL +A L ++AGFP+G +NV+  G   +   G  L  + DV  ++FTGST+VG
Sbjct  214  AEQTSLTALYIAQLVKEAGFPEGVVNVVP-GFGTA---GAALANHCDVDKVAFTGSTDVG  269

Query  262  KILYKNSAST-VKRLSLELGGNASFIVFDSADLDIAVHGAMASKFRNSGQTCVSANRFFV  320
            K++   S +T +KR++LELGG +  I+    D+D AV  A    F N GQ C + +R FV
Sbjct  270  KLIQLASGNTNLKRVTLELGGKSPNIILSDTDMDYAVETAHFGLFFNMGQCCCAGSRTFV  329

Query  321  HSSKFDQFIEMFLSRIKSEIKMGDGSKKGVTHGPLIKESQLNMVHALVTDAVEKGAKVHC  380
                +D+F+E    R K    +G+        GP + E Q+  +  ++    ++GAK+  
Sbjct  330  EDKIYDEFVERSAERAKKRT-VGNPFDLNTEQGPQVNEEQMEKILGMIKTGKKQGAKLVA  388

Query  381  GGTPLPELGPLFYAPTLMTDVTKDMQIYNKEIFGPVAVIHKFETENEVIQSSNDTSVGLA  440
            GG+    L   F  PT+  DV  DM I  +EIFGPV  + +F+  +EVI+ +N++  GLA
Sbjct  389  GGSRPEGLPGYFVQPTVFADVQDDMTIAREEIFGPVQQLIRFKKLDEVIERANNSEYGLA  448

Query  441  GYFYSQDISQIFRVAKQLEVGMIGVNEGIISTAEAAFGGVKESGLGREGSKHGVDDFLQI  500
               +++D+ +   +   L  G + VN   +  A+A FGG K SG GRE  ++ + ++ ++
Sbjct  449  AAVFTKDLDKANYIVGGLRAGTVWVNTYNVLAAQAPFGGYKMSGHGRENGEYALSNYTEV  508

Query  501  K  501
            K
Sbjct  509  K  509


>AL7A1_DICDI unnamed protein product
Length=509

 Score = 181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 134/474 (28%), Positives = 230/474 (49%), Gaps = 23/474 (5%)

Query  36   NGKWIGGRKNETFPIYNPADQSVINNVPDMDVEDTKLAINAASKAFQSFNKTTAKERSDL  95
            NGKW  G   E     NP +  VI  V     E+ +  I A   A   +  T A  R ++
Sbjct  25   NGKW--GGAGEIIKCLNPTNNKVIATVRGAAPEEYETCIQAMLAAKVKWALTPAPRRGEI  82

Query  96   LRNWYNLMVEHSEDLAKILTKENGKSITESKAEIKYGNSFVEWFSEEARRIDGEILQTPI  155
            +R     M E  E L+K+++ E GK   E+K E++      ++ +  +R I+G+++ +  
Sbjct  83   VRLIGQAMREKIEPLSKLISLEMGKIYIEAKGEVQEFIDVCDYATGLSRSINGQVMPSER  142

Query  156  ANRKLFLYKEPIGVAALITPWNFPHAMITRKAAAALAVGCTCVIKPSEETPLTALALADL  215
             N  L     P+G+  +IT +NFP A++   AA ++  G   + K +  T L  LA++ +
Sbjct  143  PNHILMETWNPLGLVGIITAFNFPCAVLGWNAAISMICGNVQLWKGASTTSLITLAVSKI  202

Query  216  AEKAGFPQGTINVITTGLKNSPA--VGKELCENFDVKVLSFTGSTNVGKILYKNSASTVK  273
             EK    +  ++     +   P   VG+++ ++    ++SFTGST VG+ +         
Sbjct  203  IEKV-LVENDVDPAVCCVLIGPGRTVGEQMIQDKRFGLISFTGSTEVGRRISSTVHGYFG  261

Query  274  RLSLELGGNASFIVFDSADLDIAVHGAMASKFRNSGQTCVSANRFFVHSSKFDQFIEMFL  333
            +  LELGGN + +V + AD+++ +   + +    +GQ C +  R FVH S +D  +E  L
Sbjct  262  KTILELGGNNAIVVAEDADIELVLRAVLFASVGTTGQRCTTCRRLFVHESLYDTILER-L  320

Query  334  SRIKSEIKMGDGSKKGVTHGPLIKESQLNMVHALVTDAVEKGAKVHCGGTPLPELGPLFY  393
            ++    IK+G+  ++GV  GPL  +S +      + +  ++G KV  GG  L   G  F 
Sbjct  321  TKAYKTIKIGNPLEEGVLVGPLHTQSAVKEFTEGLEEIKKQGGKVVIGGNKLDISGGNFV  380

Query  394  APTLMTDVTKDMQIYNKEIFGPVAVIHKFETENEVIQSSNDTSVGLAGYFYSQDISQIFR  453
             PT++  +  D  I   E+F P+  I KF+  ++    +N+   GL+   ++ +   IF+
Sbjct  381  EPTVVA-IEHDAPIVKTELFVPILYIMKFKNLDDAFAWNNEVPQGLSSSLFTNNQKNIFK  439

Query  454  VAKQLEVGMIGVNEGIISTAEA--------AFGGVKESGLGREGSKHGVDDFLQ  499
                  +G  G + GI++   A        AFGG KE+G GRE    G D + Q
Sbjct  440  -----WLGPTGSDCGIVNVNVATNGAEIGGAFGGEKETGGGRE---SGSDSWKQ  485



Lambda      K        H
   0.322    0.139    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7506754320


Query= XP_050573132.1 dynein axonemal assembly factor 4-like [Bombus
affinis]

Length=507
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q584G5_TRYB2  unnamed protein product                                 58.2    1e-08
STIP1_CAEEL  unnamed protein product                                  56.6    2e-08
Q585Z8_TRYB2  unnamed protein product                                 55.8    4e-08


>Q584G5_TRYB2 unnamed protein product
Length=705

 Score = 58.2 bits (139),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/122 (28%), Positives = 64/122 (52%), Gaps = 12/122 (10%)

Query  384  KDKGDDFFKVGNYLAAISAYTCGIKIS----DKMASLYVNRSAAHYALGNYYRCVEDCSK  439
            K KG+ +F+   ++AA+  YT  I  +      +  LY NR+A++  +G Y   +EDC++
Sbjct  474  KQKGNQYFQQKKFVAAMEHYTTAIGAAVNNNQILRILYCNRAASYKEVGKYREAIEDCTR  533

Query  440  ALELMEPKCESNRESRAKCHARRGAALCKLSAPQHGIPELEAALELTPNNESIKRDVLAA  499
             ++L +P        RA+CH         LS     I + +AA++  PN++ + R++ + 
Sbjct  534  TIQL-DPAFSKAYARRARCHQ-------ALSDFASAIRDFKAAIKYDPNDQELPRELRSC  585

Query  500  KQ  501
            +Q
Sbjct  586  EQ  587


 Score = 41.6 bits (96),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/66 (32%), Positives = 34/66 (52%), Gaps = 5/66 (8%)

Query  383  LKDKGDDFFKVGNYLAAISAYTCGIKIS-----DKMASLYVNRSAAHYALGNYYRCVEDC  437
            LK   D  ++   Y  A+  YT  I++       ++ +LY NRS+A++    Y  C+ DC
Sbjct  246  LKTDADQKYEQAEYTLALELYTKAIELQPRDRLTRLTALYGNRSSAYFMAMRYAECIADC  305

Query  438  SKALEL  443
             K +EL
Sbjct  306  MKVVEL  311


>STIP1_CAEEL unnamed protein product
Length=320

 Score = 56.6 bits (135),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 76/153 (50%), Gaps = 16/153 (10%)

Query  345  RESSHVEEQEWLQKQVEARRKIGFNTEDLRQEERDPQWLKDKGDDFFKVGNYLAAISAYT  404
            R+   V++ + L+KQ++A  ++ +   +L QEE      K+KG+++FK G+Y  A+  Y 
Sbjct  111  RDPELVKKVKELEKQLKAAERLAYINPELAQEE------KNKGNEYFKKGDYPTAMRHYN  164

Query  405  CGIKISDKMASLYVNRSAAHYALGNYYRCVEDCSKALELMEPKCESNRESR-AKCHARRG  463
              +K   + A LY NR+A    L  + R ++DC   + L         +S+  K + R+ 
Sbjct  165  EAVKRDPENAILYSNRAACLTKLMEFQRALDDCDTCIRL---------DSKFIKGYIRKA  215

Query  464  AALCKLSAPQHGIPELEAALELTPNNESIKRDV  496
            A L  +          E AL++ P+NE  +  V
Sbjct  216  ACLVAMREWSKAQRAYEDALQVDPSNEEAREGV  248


 Score = 32.3 bits (72),  Expect = 0.77, Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 42/91 (46%), Gaps = 13/91 (14%)

Query  384  KDKGDDFFKVGNYLAAISAYTCGIKISDKMASLYVNRSAAHYALGNYYRCVEDCSKALEL  443
            KD G+  +K  ++  A   Y   I++     + Y N++A ++    +  CV+ C KA+E+
Sbjct  9    KDLGNAAYKQKDFEKAHVHYDKAIELDPSNITFYNNKAAVYFEEKKFAECVQFCEKAVEV  68

Query  444  MEPKCESNRESR------AKCHARRGAALCK  468
                    RE+R      AK  +R G A  K
Sbjct  69   -------GRETRADYKLIAKAMSRAGNAFQK  92


>Q585Z8_TRYB2 unnamed protein product
Length=416

 Score = 55.8 bits (133),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 56/114 (49%), Gaps = 8/114 (7%)

Query  383  LKDKGDDFFKVGNYLAAISAYTCGIKISDKMASLYVNRSAAHYALGNYYRCVEDCSKALE  442
            +K+KG++   + NY  A++ YT  I++  +    + NR+AAH  L +Y   + DC +++ 
Sbjct  141  IKNKGNELMGLANYKQAVAYYTKAIEMEPENHVFFANRAAAHTHLKDYRSAIIDCERSIS  200

Query  443  LMEPKCESNRESRAKCHARRGAALCKLSAPQHGIPELEAALELTPNNESIKRDV  496
            +    C     + AK ++R G  L      Q  +     A EL P NE  + D+
Sbjct  201  I----C----PTYAKAYSRLGTTLFYQENYQRAVDAFSKACELDPTNERYREDL  246



Lambda      K        H
   0.322    0.139    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7506754320


Query= XP_050573133.1 negative elongation factor E [Bombus affinis]

Length=275
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

NELFE_DROME  unnamed protein product                                  252     1e-83
Q7K797_CAEEL  unnamed protein product                                 55.1    2e-08
Q7K798_CAEEL  unnamed protein product                                 54.7    3e-08


>NELFE_DROME unnamed protein product
Length=280

 Score = 252 bits (644),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 157/281 (56%), Positives = 205/281 (73%), Gaps = 10/281 (4%)

Query  4    MVYLHFPSNLTEEELMLQAKYNKLKRKKKALQDLKAPKQETERIPQAPKRPTEARDAREV  63
            MVY+HFP+NLTEEE MLQAKY KLK+KKKALQ  KAPK E E      KRPT+ARDAREV
Sbjct  1    MVYIHFPNNLTEEEQMLQAKYQKLKKKKKALQAHKAPKPEPES-SLTLKRPTDARDAREV  59

Query  64   AKKLIKSGVITA-PKTPKRPEQSFKRPRGLVR-KLNSTEKTVSSYQPFSATQME-EEET-  119
            A+KLIKSG I A  K  K+ + SFKRP+G  R K +++E TV+SYQPFS+TQ +  +ET 
Sbjct  60   ARKLIKSGAIPAIQKQTKQDQTSFKRPKGQERAKRSTSETTVASYQPFSSTQNDVAQETI  119

Query  120  --ETVR--PRVKDLYDSFVSAQDPEDRT-SRDIQSPSKQEMKPRAGNTIFVCGYKISEDF  174
              E ++  PR ++LY  F + +D E+R     +   + Q  KPRAGNTIFV G K++EDF
Sbjct  120  ISEIIKEEPRRQNLYQHFATERDREERGMPEKVPMDTAQPEKPRAGNTIFVSGNKVTEDF  179

Query  175  LKKHFQTFGNIINISMETEKNRGFVTFDKTEAAERAISEMDGSMVSSIQLKVSLARRQPI  234
            LKK F  +G I+N+SME EK+RGFV+F K E+A+RAI+E+ G  V+ I L+V LARRQP 
Sbjct  180  LKKTFNDYGTIVNVSMEIEKSRGFVSFAKPESADRAIAEIHGKNVNGINLQVQLARRQPQ  239

Query  235  IEAMTDATSSSMWSPIAANYSQKSAHKDRRDLIVYEEDLFV  275
            IE + DA+SS++WS IAA+ SQK +HKD R+++ Y+ED  +
Sbjct  240  IEPINDASSSAVWSSIAASKSQKGSHKDHREMVQYDEDFLL  280


>Q7K797_CAEEL unnamed protein product
Length=586

 Score = 55.1 bits (131),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 68/135 (50%), Gaps = 23/135 (17%)

Query  117  EETETVRPRVKDLYDSFVSAQD-------PEDRTSRDIQSPSKQE------MKPRAGNTI  163
            EE ET    V+ L+DS +   D        + ++ R  +   K E      M+   G  +
Sbjct  203  EEAETA---VQALHDSTIEGTDLKLHVCRAQKKSERHAELKKKHEQHKAERMQKYQGVNL  259

Query  164  FVCGYK--ISEDFLKKHFQTFGNIINISMETEKNR-----GFVTFDKTEAAERAISEMDG  216
            +V      + +D LKK F+++GNI +  + T++N      GFV F+K E A  A++EM+ 
Sbjct  260  YVKNLDETVDDDGLKKQFESYGNITSAKVMTDENGRSKGFGFVCFEKPEEATSAVTEMNS  319

Query  217  SMVSSIQLKVSLARR  231
             MV S  L V++A+R
Sbjct  320  KMVCSKPLYVAIAQR  334


>Q7K798_CAEEL unnamed protein product
Length=583

 Score = 54.7 bits (130),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 68/135 (50%), Gaps = 23/135 (17%)

Query  117  EETETVRPRVKDLYDSFVSAQD-------PEDRTSRDIQSPSKQE------MKPRAGNTI  163
            EE ET    V+ L+DS +   D        + ++ R  +   K E      M+   G  +
Sbjct  200  EEAETA---VQALHDSTIEGTDLKLHVCRAQKKSERHAELKKKHEQHKAERMQKYQGVNL  256

Query  164  FVCGYK--ISEDFLKKHFQTFGNIINISMETEKNR-----GFVTFDKTEAAERAISEMDG  216
            +V      + +D LKK F+++GNI +  + T++N      GFV F+K E A  A++EM+ 
Sbjct  257  YVKNLDETVDDDGLKKQFESYGNITSAKVMTDENGRSKGFGFVCFEKPEEATSAVTEMNS  316

Query  217  SMVSSIQLKVSLARR  231
             MV S  L V++A+R
Sbjct  317  KMVCSKPLYVAIAQR  331


 Score = 36.6 bits (83),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 34/60 (57%), Gaps = 7/60 (12%)

Query  179  FQTFGNIINISMETE-----KNRGFVTFDKTEAAERAISEMDGSMVSSIQLKVSLARRQP  233
            F  FGNI++  +  +     K  GFV F+  EAA+ AI +++G +++    KV + + QP
Sbjct  77   FSLFGNILSCKVAIDEDGFSKGYGFVHFETEEAAQNAIQKVNGMLLAG--KKVFVGKFQP  134



Lambda      K        H
   0.322    0.139    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7506754320


Query= XP_050573134.1 RNA-binding protein NOB1 [Bombus affinis]

Length=494
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9N3D3_CAEEL  unnamed protein product                                 187     1e-54
Q383J3_TRYB2  unnamed protein product                                 125     4e-31


>Q9N3D3_CAEEL unnamed protein product
Length=364

 Score = 187 bits (475),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/203 (44%), Positives = 137/203 (67%), Gaps = 11/203 (5%)

Query  289  DDSGWITPGNIRNVKKELDSDFLEQKSVTVACLTMDFAMQNVLKQIGLNVISLDGRVIKQ  348
            D+ GWIT  NI    K+L + F  ++++ V CLT DFA+QNVL  + L+++SL G  I++
Sbjct  168  DEDGWITQDNIEETLKKLGA-FEIEENMLVGCLTTDFALQNVLLAMNLSLVSLSGYRIRK  226

Query  349  MRTYIFRCYACYKTTSIMTKVFCPSCGNKTLKRVAVTLDDEGKPKVHINFRKPISKKGKR  408
            +++++ RC  C+ TTS+MTK FCP+CG+KTL + AV++D++G  ++HIN+ +  +++G  
Sbjct  227  LKSFVLRCRTCFSTTSVMTKEFCPACGHKTLHKCAVSVDEDGNQQLHINWNRMANRRGLV  286

Query  409  FSLPLPKGGKHANNPILYEDQPLPHQRPSRLARTKNNPLEDDCIAEYSPFIMRDVHSKSA  468
            ++L  PKGGKHA N  L+EDQP+PH    R+A+   +PL D       PF + DV S+SA
Sbjct  287  YTLANPKGGKHATNERLFEDQPMPHM---RMAKIHMDPLAD------GPFSVHDVTSRSA  337

Query  469  MLGIRTKGPVKYWMQKNPNEVRR  491
            MLG+RT    +    +NPNE +R
Sbjct  338  MLGVRTINN-RAKQNRNPNESKR  359


 Score = 62.0 bits (149),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 74/141 (52%), Gaps = 7/141 (5%)

Query  2    NATQKVQYLVVDTSAFIRNASLQDVGVNIITEQDVVNEVTSKRQLRRLVVLPYDLKIQNA  61
            N  + +++LV+DT A I N +L  +  +      +++E+ S    +    LP+++ ++  
Sbjct  3    NKEKPIKHLVIDTCAIIANRNLHALADHYYAPPQILDELRSSAARKLWNTLPFEVTLREP  62

Query  62   YSENIKFVTEFAKKTGDYTSLSATDIKVIALTYQLEKEKIGTDHLRSKPTVAQTLDSNVE  121
                ++ V + +K TGD+ SLS  DIK+IALTY L ++ +  +       VA+T + + +
Sbjct  63   TQTALRAVIDASKTTGDFQSLSMVDIKMIALTYDLHRQYVAEN------DVAETTEDDEK  116

Query  122  K-AEDLRTPLAGFYVPEKNKD  141
            K  EDL   +    V E  +D
Sbjct  117  KNIEDLSAKVEQVTVGENTED  137


>Q383J3_TRYB2 unnamed protein product
Length=432

 Score = 125 bits (313),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 76/213 (36%), Positives = 119/213 (56%), Gaps = 20/213 (9%)

Query  257  DTDQHSEYKDDRNDDNNDNNYEYDDEGGNDNDDDSGWITPGNIR----NVKKELDSDFLE  312
            D  + ++ +DD+ND+    +++ D E G+D  DD GWITP NI     N      +   E
Sbjct  186  DESEEAQSEDDQNDEGV-ADHKNDTERGDD--DDEGWITPENIHLCKANEGSSAGAAAGE  242

Query  313  QKSVTVACLTMDFAMQNVLKQIGLNVISLDGRVIKQMRTYIFRCYACYKTTSIMTKVFCP  372
            +    VAC+T D+AMQN L  +G+ ++   G  I+++R ++ RC AC+   +  T+ FC 
Sbjct  243  RFECGVACVTSDYAMQNTLLHVGVPIVGPHGMRIREVRQWLLRCTACFTINADTTRQFCS  302

Query  373  SCGNK-TLKRVAVTLDDEGKPKVHINFRKPISKKGKRFSLPLPKGGKHANNP--ILYEDQ  429
             CG+  TL+RV   +  +G+ ++ INFRK IS +G  ++LP P+GG+   N   +L EDQ
Sbjct  303  ECGSGNTLRRVQYVVTTDGERQLFINFRKRISTRGTVYNLPKPRGGRRGTNRCLVLREDQ  362

Query  430  PLPH--------QRPSRLA-RTKNNPLEDDCIA  453
             L H        +   +LA R+ N  L+DD  A
Sbjct  363  -LAHLIRGTTSMKMKEKLATRSGNGGLDDDLAA  394


 Score = 53.9 bits (128),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 48/87 (55%), Gaps = 1/87 (1%)

Query  9    YLVVDTSAFIRNASLQDVGVN-IITEQDVVNEVTSKRQLRRLVVLPYDLKIQNAYSENIK  67
             LV+D +AFI+  +L D   + ++T   V++EV  +   + L  LP  L +     E++ 
Sbjct  64   LLVLDANAFIKGMNLLDGTADALVTTSQVISEVRDRAARQMLERLPTHLHVLEPSKESVT  123

Query  68   FVTEFAKKTGDYTSLSATDIKVIALTY  94
             +   A+KTGD  +LS TDI+V AL  
Sbjct  124  AIVNIAQKTGDLGTLSRTDIRVCALAL  150



Lambda      K        H
   0.322    0.139    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7506754320


Query= XP_050573135.1 deoxyribodipyrimidine photo-lyase-like isoform X1
[Bombus affinis]

Length=494
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q581T4_TRYB2  unnamed protein product                                 31.2    1.0  


>Q581T4_TRYB2 unnamed protein product
Length=143

 Score = 31.2 bits (69),  Expect = 1.0, Method: Composition-based stats.
 Identities = 21/86 (24%), Positives = 36/86 (42%), Gaps = 8/86 (9%)

Query  370  SLSQLENSKTHDDLWNACQNQMIITGKMHGFLRMYWAKKLLEWTETPEIALEWANYLNNK  429
            S +QL    +H  + N  + +M +  + H   R+         T  P+IA EW + LN  
Sbjct  14   SANQLRFKASHIRIANRKRVEMFVAKRFHLPTRLA--------TAAPDIAAEWHDELNPM  65

Query  430  YSIDGCDPNGYVGCMWSICGVHDHGW  455
            +        G+V  +W  C +  H +
Sbjct  66   HMYPAIIGIGHVQPVWWKCAICSHSY  91



Lambda      K        H
   0.322    0.139    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7506754320


Query= XP_050573136.1 deoxyribodipyrimidine photo-lyase-like isoform X2
[Bombus affinis]

Length=464
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q581T4_TRYB2  unnamed protein product                                 31.2    0.97 


>Q581T4_TRYB2 unnamed protein product
Length=143

 Score = 31.2 bits (69),  Expect = 0.97, Method: Composition-based stats.
 Identities = 21/86 (24%), Positives = 36/86 (42%), Gaps = 8/86 (9%)

Query  340  SLSQLENSKTHDDLWNACQNQMIITGKMHGFLRMYWAKKLLEWTETPEIALEWANYLNNK  399
            S +QL    +H  + N  + +M +  + H   R+         T  P+IA EW + LN  
Sbjct  14   SANQLRFKASHIRIANRKRVEMFVAKRFHLPTRLA--------TAAPDIAAEWHDELNPM  65

Query  400  YSIDGCDPNGYVGCMWSICGVHDHGW  425
            +        G+V  +W  C +  H +
Sbjct  66   HMYPAIIGIGHVQPVWWKCAICSHSY  91



Lambda      K        H
   0.322    0.139    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7506754320


Query= XP_050573137.1 zinc finger protein 271 isoform X1 [Bombus affinis]

Length=481
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

BAB2_DROME  unnamed protein product                                   88.2    4e-18
TTKA_DROME  unnamed protein product                                   84.7    4e-17
TTKB_DROME  unnamed protein product                                   82.8    1e-16


>BAB2_DROME unnamed protein product
Length=1067

 Score = 88.2 bits (217),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 76/133 (57%), Gaps = 13/133 (10%)

Query  21   IVP----SENYQLKWHSYGAHLHSSVATLLHSESFADVLLATSC-GRHVAAHRFVLAACS  75
            IVP     + + L+W++Y ++L +    LL SESF DV L  SC G  + AH+ VL+ACS
Sbjct  188  IVPPSGEGQQFCLRWNNYQSNLTNVFDELLQSESFVDVTL--SCEGHSIKAHKMVLSACS  245

Query  76   SYLSHIFQTCHFGANTNAPIIVVLPTEIGYRTLKILIQYMYSGEATVTNDQLEGVLKAGD  135
             Y    FQ   +      PII++   ++ +  LK L+++MY GE  V  DQ+  +LK  +
Sbjct  246  PY----FQALFYDNPCQHPIIIM--RDVSWSDLKALVEFMYKGEINVCQDQINPLLKVAE  299

Query  136  ILRVRGLWRSNSG  148
             L++RGL   ++G
Sbjct  300  TLKIRGLAEVSAG  312


>TTKA_DROME unnamed protein product
Length=813

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 72/123 (59%), Gaps = 7/123 (6%)

Query  24   SENYQLKWHSYGAHLHSSVATLLHSESFADVLLATSCGRHVAAHRFVLAACSSYLSHIFQ  83
            S+ + L+W+++ ++L S    LLH+E+F DV LA   G+H+ AH+ VL+ACS Y    F 
Sbjct  5    SQRFCLRWNNHQSNLLSVFDQLLHAETFTDVTLAVE-GQHLKAHKMVLSACSPY----FN  59

Query  84   TCHFGANTNAPIIVVLPTEIGYRTLKILIQYMYSGEATVTNDQLEGVLKAGDILRVRGLW  143
            T         PI+++   ++ Y  +K L+ +MY GE +V  ++L   L+  + LR++GL 
Sbjct  60   TLFVSHPEKHPIVIL--KDVPYSDMKSLLDFMYRGEVSVDQERLTAFLRVAESLRIKGLT  117

Query  144  RSN  146
              N
Sbjct  118  EVN  120


 Score = 32.0 bits (71),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 22/82 (27%), Positives = 33/82 (40%), Gaps = 18/82 (22%)

Query  318  LTCDMCSQTFHQPSDWVRHIELTHADIAEGRRRRRKGEVDDDSKDFPPLK----CDLCGD  373
              C +CS+ F +P     H+++TH +    +          D   F PLK        GD
Sbjct  646  FPCPVCSKEFSRPDKMKNHLKMTHENFTPPK----------DIGAFSPLKYLISAAAAGD  695

Query  374  MYITPQEWVRHIQTEHTEEQLA  395
            M+ T    +   Q +H   QLA
Sbjct  696  MHAT----IYQQQQDHYHRQLA  713


 Score = 29.3 bits (64),  Expect = 9.2, Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 28/72 (39%), Gaps = 14/72 (19%)

Query  415  CNICKKE-----------FPSHASMVIHQRTHTGERPFLCSYCQKGFNVKSNLLRHLRTL  463
            C  C KE           F  HA  + H+  H   + F C  C K F+    +  HL+  
Sbjct  612  CTECAKENMQKTFKNKYSFQRHA-FLYHEGKH--RKVFPCPVCSKEFSRPDKMKNHLKMT  668

Query  464  HDKYVHPSLYGS  475
            H+ +  P   G+
Sbjct  669  HENFTPPKDIGA  680


>TTKB_DROME unnamed protein product
Length=643

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 72/123 (59%), Gaps = 7/123 (6%)

Query  24   SENYQLKWHSYGAHLHSSVATLLHSESFADVLLATSCGRHVAAHRFVLAACSSYLSHIFQ  83
            S+ + L+W+++ ++L S    LLH+E+F DV LA   G+H+ AH+ VL+ACS Y    F 
Sbjct  5    SQRFCLRWNNHQSNLLSVFDQLLHAETFTDVTLAVE-GQHLKAHKMVLSACSPY----FN  59

Query  84   TCHFGANTNAPIIVVLPTEIGYRTLKILIQYMYSGEATVTNDQLEGVLKAGDILRVRGLW  143
            T         PI+++   ++ Y  +K L+ +MY GE +V  ++L   L+  + LR++GL 
Sbjct  60   TLFVSHPEKHPIVIL--KDVPYSDMKSLLDFMYRGEVSVDQERLTAFLRVAESLRIKGLT  117

Query  144  RSN  146
              N
Sbjct  118  EVN  120



Lambda      K        H
   0.322    0.139    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7506754320


Query= XP_050573138.1 zinc finger protein 271 isoform X2 [Bombus affinis]

Length=471
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

BAB2_DROME  unnamed protein product                                   88.2    3e-18
TTKA_DROME  unnamed protein product                                   85.1    3e-17
TTKB_DROME  unnamed protein product                                   83.2    9e-17


>BAB2_DROME unnamed protein product
Length=1067

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 76/133 (57%), Gaps = 13/133 (10%)

Query  11   IVP----SENYQLKWHSYGAHLHSSVATLLHSESFADVLLATSC-GRHVAAHRFVLAACS  65
            IVP     + + L+W++Y ++L +    LL SESF DV L  SC G  + AH+ VL+ACS
Sbjct  188  IVPPSGEGQQFCLRWNNYQSNLTNVFDELLQSESFVDVTL--SCEGHSIKAHKMVLSACS  245

Query  66   SYLSHIFQTCHFGANTNAPIIVVLPTEIGYRTLKILIQYMYSGEATVTNDQLEGVLKAGD  125
             Y    FQ   +      PII++   ++ +  LK L+++MY GE  V  DQ+  +LK  +
Sbjct  246  PY----FQALFYDNPCQHPIIIM--RDVSWSDLKALVEFMYKGEINVCQDQINPLLKVAE  299

Query  126  ILRVRGLWRSNSG  138
             L++RGL   ++G
Sbjct  300  TLKIRGLAEVSAG  312


>TTKA_DROME unnamed protein product
Length=813

 Score = 85.1 bits (209),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 72/123 (59%), Gaps = 7/123 (6%)

Query  14   SENYQLKWHSYGAHLHSSVATLLHSESFADVLLATSCGRHVAAHRFVLAACSSYLSHIFQ  73
            S+ + L+W+++ ++L S    LLH+E+F DV LA   G+H+ AH+ VL+ACS Y    F 
Sbjct  5    SQRFCLRWNNHQSNLLSVFDQLLHAETFTDVTLAVE-GQHLKAHKMVLSACSPY----FN  59

Query  74   TCHFGANTNAPIIVVLPTEIGYRTLKILIQYMYSGEATVTNDQLEGVLKAGDILRVRGLW  133
            T         PI+++   ++ Y  +K L+ +MY GE +V  ++L   L+  + LR++GL 
Sbjct  60   TLFVSHPEKHPIVIL--KDVPYSDMKSLLDFMYRGEVSVDQERLTAFLRVAESLRIKGLT  117

Query  134  RSN  136
              N
Sbjct  118  EVN  120


 Score = 32.0 bits (71),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 22/82 (27%), Positives = 33/82 (40%), Gaps = 18/82 (22%)

Query  308  LTCDMCSQTFHQPSDWVRHIELTHADIAEGRRRRRKGEVDDDSKDFPPLK----CDLCGD  363
              C +CS+ F +P     H+++TH +    +          D   F PLK        GD
Sbjct  646  FPCPVCSKEFSRPDKMKNHLKMTHENFTPPK----------DIGAFSPLKYLISAAAAGD  695

Query  364  MYITPQEWVRHIQTEHTEEQLA  385
            M+ T    +   Q +H   QLA
Sbjct  696  MHAT----IYQQQQDHYHRQLA  713


 Score = 29.3 bits (64),  Expect = 8.9, Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 28/72 (39%), Gaps = 14/72 (19%)

Query  405  CNICKKE-----------FPSHASMVIHQRTHTGERPFLCSYCQKGFNVKSNLLRHLRTL  453
            C  C KE           F  HA  + H+  H   + F C  C K F+    +  HL+  
Sbjct  612  CTECAKENMQKTFKNKYSFQRHA-FLYHEGKH--RKVFPCPVCSKEFSRPDKMKNHLKMT  668

Query  454  HDKYVHPSLYGS  465
            H+ +  P   G+
Sbjct  669  HENFTPPKDIGA  680


>TTKB_DROME unnamed protein product
Length=643

 Score = 83.2 bits (204),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 72/123 (59%), Gaps = 7/123 (6%)

Query  14   SENYQLKWHSYGAHLHSSVATLLHSESFADVLLATSCGRHVAAHRFVLAACSSYLSHIFQ  73
            S+ + L+W+++ ++L S    LLH+E+F DV LA   G+H+ AH+ VL+ACS Y    F 
Sbjct  5    SQRFCLRWNNHQSNLLSVFDQLLHAETFTDVTLAVE-GQHLKAHKMVLSACSPY----FN  59

Query  74   TCHFGANTNAPIIVVLPTEIGYRTLKILIQYMYSGEATVTNDQLEGVLKAGDILRVRGLW  133
            T         PI+++   ++ Y  +K L+ +MY GE +V  ++L   L+  + LR++GL 
Sbjct  60   TLFVSHPEKHPIVIL--KDVPYSDMKSLLDFMYRGEVSVDQERLTAFLRVAESLRIKGLT  117

Query  134  RSN  136
              N
Sbjct  118  EVN  120



Lambda      K        H
   0.322    0.139    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7506754320


Query= XP_050573139.1 zinc finger protein 271 isoform X3 [Bombus affinis]

Length=468
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

BAB2_DROME  unnamed protein product                                   88.2    3e-18
TTKA_DROME  unnamed protein product                                   85.1    3e-17
TTKB_DROME  unnamed protein product                                   83.2    8e-17


>BAB2_DROME unnamed protein product
Length=1067

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 76/133 (57%), Gaps = 13/133 (10%)

Query  8    IVP----SENYQLKWHSYGAHLHSSVATLLHSESFADVLLATSC-GRHVAAHRFVLAACS  62
            IVP     + + L+W++Y ++L +    LL SESF DV L  SC G  + AH+ VL+ACS
Sbjct  188  IVPPSGEGQQFCLRWNNYQSNLTNVFDELLQSESFVDVTL--SCEGHSIKAHKMVLSACS  245

Query  63   SYLSHIFQTCHFGANTNAPIIVVLPTEIGYRTLKILIQYMYSGEATVTNDQLEGVLKAGD  122
             Y    FQ   +      PII++   ++ +  LK L+++MY GE  V  DQ+  +LK  +
Sbjct  246  PY----FQALFYDNPCQHPIIIM--RDVSWSDLKALVEFMYKGEINVCQDQINPLLKVAE  299

Query  123  ILRVRGLWRSNSG  135
             L++RGL   ++G
Sbjct  300  TLKIRGLAEVSAG  312


>TTKA_DROME unnamed protein product
Length=813

 Score = 85.1 bits (209),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 72/123 (59%), Gaps = 7/123 (6%)

Query  11   SENYQLKWHSYGAHLHSSVATLLHSESFADVLLATSCGRHVAAHRFVLAACSSYLSHIFQ  70
            S+ + L+W+++ ++L S    LLH+E+F DV LA   G+H+ AH+ VL+ACS Y    F 
Sbjct  5    SQRFCLRWNNHQSNLLSVFDQLLHAETFTDVTLAVE-GQHLKAHKMVLSACSPY----FN  59

Query  71   TCHFGANTNAPIIVVLPTEIGYRTLKILIQYMYSGEATVTNDQLEGVLKAGDILRVRGLW  130
            T         PI+++   ++ Y  +K L+ +MY GE +V  ++L   L+  + LR++GL 
Sbjct  60   TLFVSHPEKHPIVIL--KDVPYSDMKSLLDFMYRGEVSVDQERLTAFLRVAESLRIKGLT  117

Query  131  RSN  133
              N
Sbjct  118  EVN  120


 Score = 32.0 bits (71),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 22/82 (27%), Positives = 33/82 (40%), Gaps = 18/82 (22%)

Query  305  LTCDMCSQTFHQPSDWVRHIELTHADIAEGRRRRRKGEVDDDSKDFPPLK----CDLCGD  360
              C +CS+ F +P     H+++TH +    +          D   F PLK        GD
Sbjct  646  FPCPVCSKEFSRPDKMKNHLKMTHENFTPPK----------DIGAFSPLKYLISAAAAGD  695

Query  361  MYITPQEWVRHIQTEHTEEQLA  382
            M+ T    +   Q +H   QLA
Sbjct  696  MHAT----IYQQQQDHYHRQLA  713


 Score = 29.3 bits (64),  Expect = 8.2, Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 28/72 (39%), Gaps = 14/72 (19%)

Query  402  CNICKKE-----------FPSHASMVIHQRTHTGERPFLCSYCQKGFNVKSNLLRHLRTL  450
            C  C KE           F  HA  + H+  H   + F C  C K F+    +  HL+  
Sbjct  612  CTECAKENMQKTFKNKYSFQRHA-FLYHEGKH--RKVFPCPVCSKEFSRPDKMKNHLKMT  668

Query  451  HDKYVHPSLYGS  462
            H+ +  P   G+
Sbjct  669  HENFTPPKDIGA  680


>TTKB_DROME unnamed protein product
Length=643

 Score = 83.2 bits (204),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 72/123 (59%), Gaps = 7/123 (6%)

Query  11   SENYQLKWHSYGAHLHSSVATLLHSESFADVLLATSCGRHVAAHRFVLAACSSYLSHIFQ  70
            S+ + L+W+++ ++L S    LLH+E+F DV LA   G+H+ AH+ VL+ACS Y    F 
Sbjct  5    SQRFCLRWNNHQSNLLSVFDQLLHAETFTDVTLAVE-GQHLKAHKMVLSACSPY----FN  59

Query  71   TCHFGANTNAPIIVVLPTEIGYRTLKILIQYMYSGEATVTNDQLEGVLKAGDILRVRGLW  130
            T         PI+++   ++ Y  +K L+ +MY GE +V  ++L   L+  + LR++GL 
Sbjct  60   TLFVSHPEKHPIVIL--KDVPYSDMKSLLDFMYRGEVSVDQERLTAFLRVAESLRIKGLT  117

Query  131  RSN  133
              N
Sbjct  118  EVN  120



Lambda      K        H
   0.322    0.139    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7506754320


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Nov 7, 2022  4:57 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_050573140.1 zinc finger protein 271 isoform X4 [Bombus affinis]

Length=463
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

BAB2_DROME  unnamed protein product                                   88.2    3e-18
TTKA_DROME  unnamed protein product                                   85.1    3e-17
TTKB_DROME  unnamed protein product                                   83.2    9e-17


>BAB2_DROME unnamed protein product
Length=1067

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 76/133 (57%), Gaps = 13/133 (10%)

Query  3    IVP----SENYQLKWHSYGAHLHSSVATLLHSESFADVLLATSC-GRHVAAHRFVLAACS  57
            IVP     + + L+W++Y ++L +    LL SESF DV L  SC G  + AH+ VL+ACS
Sbjct  188  IVPPSGEGQQFCLRWNNYQSNLTNVFDELLQSESFVDVTL--SCEGHSIKAHKMVLSACS  245

Query  58   SYLSHIFQTCHFGANTNAPIIVVLPTEIGYRTLKILIQYMYSGEATVTNDQLEGVLKAGD  117
             Y    FQ   +      PII++   ++ +  LK L+++MY GE  V  DQ+  +LK  +
Sbjct  246  PY----FQALFYDNPCQHPIIIM--RDVSWSDLKALVEFMYKGEINVCQDQINPLLKVAE  299

Query  118  ILRVRGLWRSNSG  130
             L++RGL   ++G
Sbjct  300  TLKIRGLAEVSAG  312


>TTKA_DROME unnamed protein product
Length=813

 Score = 85.1 bits (209),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 72/123 (59%), Gaps = 7/123 (6%)

Query  6    SENYQLKWHSYGAHLHSSVATLLHSESFADVLLATSCGRHVAAHRFVLAACSSYLSHIFQ  65
            S+ + L+W+++ ++L S    LLH+E+F DV LA   G+H+ AH+ VL+ACS Y    F 
Sbjct  5    SQRFCLRWNNHQSNLLSVFDQLLHAETFTDVTLAVE-GQHLKAHKMVLSACSPY----FN  59

Query  66   TCHFGANTNAPIIVVLPTEIGYRTLKILIQYMYSGEATVTNDQLEGVLKAGDILRVRGLW  125
            T         PI+++   ++ Y  +K L+ +MY GE +V  ++L   L+  + LR++GL 
Sbjct  60   TLFVSHPEKHPIVIL--KDVPYSDMKSLLDFMYRGEVSVDQERLTAFLRVAESLRIKGLT  117

Query  126  RSN  128
              N
Sbjct  118  EVN  120


 Score = 32.0 bits (71),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 22/82 (27%), Positives = 33/82 (40%), Gaps = 18/82 (22%)

Query  300  LTCDMCSQTFHQPSDWVRHIELTHADIAEGRRRRRKGEVDDDSKDFPPLK----CDLCGD  355
              C +CS+ F +P     H+++TH +    +          D   F PLK        GD
Sbjct  646  FPCPVCSKEFSRPDKMKNHLKMTHENFTPPK----------DIGAFSPLKYLISAAAAGD  695

Query  356  MYITPQEWVRHIQTEHTEEQLA  377
            M+ T    +   Q +H   QLA
Sbjct  696  MHAT----IYQQQQDHYHRQLA  713


 Score = 29.3 bits (64),  Expect = 8.4, Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 28/72 (39%), Gaps = 14/72 (19%)

Query  397  CNICKKE-----------FPSHASMVIHQRTHTGERPFLCSYCQKGFNVKSNLLRHLRTL  445
            C  C KE           F  HA  + H+  H   + F C  C K F+    +  HL+  
Sbjct  612  CTECAKENMQKTFKNKYSFQRHA-FLYHEGKH--RKVFPCPVCSKEFSRPDKMKNHLKMT  668

Query  446  HDKYVHPSLYGS  457
            H+ +  P   G+
Sbjct  669  HENFTPPKDIGA  680


>TTKB_DROME unnamed protein product
Length=643

 Score = 83.2 bits (204),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 72/123 (59%), Gaps = 7/123 (6%)

Query  6    SENYQLKWHSYGAHLHSSVATLLHSESFADVLLATSCGRHVAAHRFVLAACSSYLSHIFQ  65
            S+ + L+W+++ ++L S    LLH+E+F DV LA   G+H+ AH+ VL+ACS Y    F 
Sbjct  5    SQRFCLRWNNHQSNLLSVFDQLLHAETFTDVTLAVE-GQHLKAHKMVLSACSPY----FN  59

Query  66   TCHFGANTNAPIIVVLPTEIGYRTLKILIQYMYSGEATVTNDQLEGVLKAGDILRVRGLW  125
            T         PI+++   ++ Y  +K L+ +MY GE +V  ++L   L+  + LR++GL 
Sbjct  60   TLFVSHPEKHPIVIL--KDVPYSDMKSLLDFMYRGEVSVDQERLTAFLRVAESLRIKGLT  117

Query  126  RSN  128
              N
Sbjct  118  EVN  120



Lambda      K        H
   0.313    0.129    0.378 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5180662620


Query= XP_050573141.1 zinc finger protein 271 isoform X4 [Bombus affinis]

Length=463
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

BAB2_DROME  unnamed protein product                                   88.2    3e-18
TTKA_DROME  unnamed protein product                                   85.1    3e-17
TTKB_DROME  unnamed protein product                                   83.2    9e-17


>BAB2_DROME unnamed protein product
Length=1067

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 76/133 (57%), Gaps = 13/133 (10%)

Query  3    IVP----SENYQLKWHSYGAHLHSSVATLLHSESFADVLLATSC-GRHVAAHRFVLAACS  57
            IVP     + + L+W++Y ++L +    LL SESF DV L  SC G  + AH+ VL+ACS
Sbjct  188  IVPPSGEGQQFCLRWNNYQSNLTNVFDELLQSESFVDVTL--SCEGHSIKAHKMVLSACS  245

Query  58   SYLSHIFQTCHFGANTNAPIIVVLPTEIGYRTLKILIQYMYSGEATVTNDQLEGVLKAGD  117
             Y    FQ   +      PII++   ++ +  LK L+++MY GE  V  DQ+  +LK  +
Sbjct  246  PY----FQALFYDNPCQHPIIIM--RDVSWSDLKALVEFMYKGEINVCQDQINPLLKVAE  299

Query  118  ILRVRGLWRSNSG  130
             L++RGL   ++G
Sbjct  300  TLKIRGLAEVSAG  312


>TTKA_DROME unnamed protein product
Length=813

 Score = 85.1 bits (209),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 72/123 (59%), Gaps = 7/123 (6%)

Query  6    SENYQLKWHSYGAHLHSSVATLLHSESFADVLLATSCGRHVAAHRFVLAACSSYLSHIFQ  65
            S+ + L+W+++ ++L S    LLH+E+F DV LA   G+H+ AH+ VL+ACS Y    F 
Sbjct  5    SQRFCLRWNNHQSNLLSVFDQLLHAETFTDVTLAVE-GQHLKAHKMVLSACSPY----FN  59

Query  66   TCHFGANTNAPIIVVLPTEIGYRTLKILIQYMYSGEATVTNDQLEGVLKAGDILRVRGLW  125
            T         PI+++   ++ Y  +K L+ +MY GE +V  ++L   L+  + LR++GL 
Sbjct  60   TLFVSHPEKHPIVIL--KDVPYSDMKSLLDFMYRGEVSVDQERLTAFLRVAESLRIKGLT  117

Query  126  RSN  128
              N
Sbjct  118  EVN  120


 Score = 32.0 bits (71),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 22/82 (27%), Positives = 33/82 (40%), Gaps = 18/82 (22%)

Query  300  LTCDMCSQTFHQPSDWVRHIELTHADIAEGRRRRRKGEVDDDSKDFPPLK----CDLCGD  355
              C +CS+ F +P     H+++TH +    +          D   F PLK        GD
Sbjct  646  FPCPVCSKEFSRPDKMKNHLKMTHENFTPPK----------DIGAFSPLKYLISAAAAGD  695

Query  356  MYITPQEWVRHIQTEHTEEQLA  377
            M+ T    +   Q +H   QLA
Sbjct  696  MHAT----IYQQQQDHYHRQLA  713


 Score = 29.3 bits (64),  Expect = 8.4, Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 28/72 (39%), Gaps = 14/72 (19%)

Query  397  CNICKKE-----------FPSHASMVIHQRTHTGERPFLCSYCQKGFNVKSNLLRHLRTL  445
            C  C KE           F  HA  + H+  H   + F C  C K F+    +  HL+  
Sbjct  612  CTECAKENMQKTFKNKYSFQRHA-FLYHEGKH--RKVFPCPVCSKEFSRPDKMKNHLKMT  668

Query  446  HDKYVHPSLYGS  457
            H+ +  P   G+
Sbjct  669  HENFTPPKDIGA  680


>TTKB_DROME unnamed protein product
Length=643

 Score = 83.2 bits (204),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 72/123 (59%), Gaps = 7/123 (6%)

Query  6    SENYQLKWHSYGAHLHSSVATLLHSESFADVLLATSCGRHVAAHRFVLAACSSYLSHIFQ  65
            S+ + L+W+++ ++L S    LLH+E+F DV LA   G+H+ AH+ VL+ACS Y    F 
Sbjct  5    SQRFCLRWNNHQSNLLSVFDQLLHAETFTDVTLAVE-GQHLKAHKMVLSACSPY----FN  59

Query  66   TCHFGANTNAPIIVVLPTEIGYRTLKILIQYMYSGEATVTNDQLEGVLKAGDILRVRGLW  125
            T         PI+++   ++ Y  +K L+ +MY GE +V  ++L   L+  + LR++GL 
Sbjct  60   TLFVSHPEKHPIVIL--KDVPYSDMKSLLDFMYRGEVSVDQERLTAFLRVAESLRIKGLT  117

Query  126  RSN  128
              N
Sbjct  118  EVN  120



Lambda      K        H
   0.313    0.129    0.378 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5180662620


Query= XP_050573142.1 zinc finger protein ZIC 4-like [Bombus affinis]

Length=477
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

OPA_DROME  unnamed protein product                                    325     8e-105
Q94178_CAEEL  unnamed protein product                                 188     5e-56 
Q7JNM3_CAEEL  unnamed protein product                                 189     5e-56 


>OPA_DROME unnamed protein product
Length=609

 Score = 325 bits (832),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 153/194 (79%), Positives = 164/194 (85%), Gaps = 10/194 (5%)

Query  184  GAFLRYMRSNGSGGGGTSGVAGGQRQEMSCMWVDQDAPGP----GRKLCGKLFNSLHDIV  239
            GAFLRYMR         +  A   +QEM C+W+D D PG     GRK C K+F+S+H+IV
Sbjct  189  GAFLRYMRHQ------PASSASSVKQEMQCLWIDPDQPGLVPPGGRKTCNKVFHSMHEIV  242

Query  240  THLTVEHVGGPECTTHACFWQGCSRNGRAFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVF  299
            THLTVEHVGGPECTTHACFW GCSRNGR FKAKYKLVNHIRVHTGEKPF CP PGCGKVF
Sbjct  243  THLTVEHVGGPECTTHACFWVGCSRNGRPFKAKYKLVNHIRVHTGEKPFACPHPGCGKVF  302

Query  300  ARSENLKIHKRTHTGEKPFKCEYSGCERRFANSSDRKKHSHVHTSDKPYNCRVTGCDKSY  359
            ARSENLKIHKRTHTGEKPFKCE+ GC+RRFANSSDRKKHSHVHTSDKPYNCR+ GCDKSY
Sbjct  303  ARSENLKIHKRTHTGEKPFKCEHEGCDRRFANSSDRKKHSHVHTSDKPYNCRINGCDKSY  362

Query  360  THPSSLRKHMKVHG  373
            THPSSLRKHMKVHG
Sbjct  363  THPSSLRKHMKVHG  376


>Q94178_CAEEL unnamed protein product
Length=302

 Score = 188 bits (478),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 98/200 (49%), Positives = 127/200 (64%), Gaps = 16/200 (8%)

Query  199  GTSGVAGGQRQEMSCMWVDQDAPGPGRKLCGKLFNSLHDIVTHLTVEHVGGPECTTHACF  258
             T G  GG +Q + C+W          ++C  +  +  ++ TH++  H+     +   C 
Sbjct  59   NTLGSYGGDKQ-VQCLW------ETNGQVCMHVCQNSGELSTHISSNHITHD--SKFVCL  109

Query  259  WQGCSRNGRAFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPF  318
            W+GC R  + FKAKYKLVNH+RVHTGE+PF C    C KVFARSENLKIHKR H+GEKPF
Sbjct  110  WKGCDREFKMFKAKYKLVNHMRVHTGERPFLCDV--CNKVFARSENLKIHKRIHSGEKPF  167

Query  319  KCEYSGCERRFANSSDRKKHSHVHTSDKPYNCRVTGCDKSYTHPSSLRKHMKVHGMTLGE  378
            +C ++GC + FANSSDRKKH HVH+S KPY+C    C K+YTHPSSLRKH KVH     E
Sbjct  168  QCTHNGCTKLFANSSDRKKHMHVHSSHKPYSCMYPDCGKTYTHPSSLRKHTKVH-----E  222

Query  379  GKIGGGYESEGEESTSSGGS  398
             +       E +ES+ SG +
Sbjct  223  NEKKSQLSPEHDESSDSGNA  242


>Q7JNM3_CAEEL unnamed protein product
Length=315

 Score = 189 bits (479),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 98/200 (49%), Positives = 127/200 (64%), Gaps = 16/200 (8%)

Query  199  GTSGVAGGQRQEMSCMWVDQDAPGPGRKLCGKLFNSLHDIVTHLTVEHVGGPECTTHACF  258
             T G  GG +Q + C+W          ++C  +  +  ++ TH++  H+     +   C 
Sbjct  72   NTLGSYGGDKQ-VQCLW------ETNGQVCMHVCQNSGELSTHISSNHITHD--SKFVCL  122

Query  259  WQGCSRNGRAFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPF  318
            W+GC R  + FKAKYKLVNH+RVHTGE+PF C    C KVFARSENLKIHKR H+GEKPF
Sbjct  123  WKGCDREFKMFKAKYKLVNHMRVHTGERPFLCDV--CNKVFARSENLKIHKRIHSGEKPF  180

Query  319  KCEYSGCERRFANSSDRKKHSHVHTSDKPYNCRVTGCDKSYTHPSSLRKHMKVHGMTLGE  378
            +C ++GC + FANSSDRKKH HVH+S KPY+C    C K+YTHPSSLRKH KVH     E
Sbjct  181  QCTHNGCTKLFANSSDRKKHMHVHSSHKPYSCMYPDCGKTYTHPSSLRKHTKVH-----E  235

Query  379  GKIGGGYESEGEESTSSGGS  398
             +       E +ES+ SG +
Sbjct  236  NEKKSQLSPEHDESSDSGNA  255



Lambda      K        H
   0.313    0.129    0.378 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5180662620


Query= XP_050573143.1 drebrin-like protein [Bombus affinis]

Length=474
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DBNL_DROME  unnamed protein product                                   127     2e-31
O96046_DROME  unnamed protein product                                 96.3    4e-21
Q9VDF4_DROME  unnamed protein product                                 96.3    5e-21


>DBNL_DROME unnamed protein product
Length=531

 Score = 127 bits (318),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 51/58 (88%), Positives = 56/58 (97%), Gaps = 0/58 (0%)

Query  413  GMKARALYDYQAADDTEITFDPGDIITHIDAIDEGWWQGLGPDGTYGLFPANYVEVID  470
            G +ARALYDYQAAD+TEITFDPGD+ITHID IDEGWWQGLGPDGTYGLFPANYVE+I+
Sbjct  474  GQRARALYDYQAADETEITFDPGDVITHIDQIDEGWWQGLGPDGTYGLFPANYVEIIN  531


>O96046_DROME unnamed protein product
Length=559

 Score = 96.3 bits (238),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 58/83 (70%), Gaps = 3/83 (4%)

Query  391  ITENELYSQMDGQYLYFDPNNEGMKARALYDYQAADDTEITFDPGDIITHIDAIDEGWWQ  450
            + E  +Y+  D    Y +  + G+ A ALYDYQAADD EI+FDP D+ITHI+ ID+GWW+
Sbjct  480  VPEEAIYANSDNLADYLE--DTGIHAIALYDYQAADDDEISFDPDDVITHIEKIDDGWWR  537

Query  451  GLGPDGTYGLFPANYVEVIDYNT  473
            GL     YGLFPANYV+V+  N+
Sbjct  538  GLC-KNRYGLFPANYVQVVGQNS  559


>Q9VDF4_DROME unnamed protein product
Length=559

 Score = 96.3 bits (238),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 59/83 (71%), Gaps = 3/83 (4%)

Query  391  ITENELYSQMDGQYLYFDPNNEGMKARALYDYQAADDTEITFDPGDIITHIDAIDEGWWQ  450
            + E  +Y+  D    Y +  + G+ A ALYDYQAADD EI+FDP D+ITHI+ ID+GWW+
Sbjct  480  VPEEAIYANSDNLADYLE--DTGIHAIALYDYQAADDDEISFDPDDVITHIEKIDDGWWR  537

Query  451  GLGPDGTYGLFPANYVEVIDYNT  473
            GL  +  YGLFPANYV+V+  N+
Sbjct  538  GLCKN-RYGLFPANYVQVVGQNS  559



Lambda      K        H
   0.313    0.129    0.378 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5180662620


Query= XP_050573144.1 uncharacterized protein LOC126913908 [Bombus affinis]

Length=474
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A0A0B4KH03_DROME  unnamed protein product                             57.0    8e-09
Q9V3X2_DROME  unnamed protein product                                 56.2    1e-08
Q9V3E5_DROME  unnamed protein product                                 55.8    1e-08


>A0A0B4KH03_DROME unnamed protein product
Length=284

 Score = 57.0 bits (136),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 62/139 (45%), Gaps = 5/139 (4%)

Query  129  LGFAAAVSRTLLFTGDPRRYMVPGVPRAFDPTALYAYLALATQLGLVQLLGCIAARRLSA  188
            +G    V+   + T DP   +           ALY +LA+   + L    GC    R S 
Sbjct  24   IGLTIVVTSVWMLT-DPTFMLSMTQNYNHYHIALYVFLAIGILITLGAFFGCCGVCRESQ  82

Query  189  RLLNAYWVLLLALLFGDAVIGVAWVFR-FERMRVELRPTLKQRLQMEYGKDLRFSE--QW  245
             LL +++ ++L ++      G AW F   +++   +R  +K  +Q EYG+    S    +
Sbjct  83   CLLVSFFCVILIVMVAQIAAG-AWAFHNKDKLDDIVRAAVKSSVQEEYGQSTMSSRTVTF  141

Query  246  DRLQKEFSCCGVTGPRDFG  264
            D LQK   CCG  GP D+ 
Sbjct  142  DTLQKNLKCCGADGPGDWA  160


>Q9V3X2_DROME unnamed protein product
Length=268

 Score = 56.2 bits (134),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 62/139 (45%), Gaps = 5/139 (4%)

Query  129  LGFAAAVSRTLLFTGDPRRYMVPGVPRAFDPTALYAYLALATQLGLVQLLGCIAARRLSA  188
            +G    V+   + T DP   +           ALY +LA+   + L    GC    R S 
Sbjct  24   IGLTIVVTSVWMLT-DPTFMLSMTQNYNHYHIALYVFLAIGILITLGAFFGCCGVCRESQ  82

Query  189  RLLNAYWVLLLALLFGDAVIGVAWVFR-FERMRVELRPTLKQRLQMEYGKDLRFSE--QW  245
             LL +++ ++L ++      G AW F   +++   +R  +K  +Q EYG+    S    +
Sbjct  83   CLLVSFFCVILIVMVAQIAAG-AWAFHNKDKLDDIVRAAVKSSVQEEYGQSTMSSRTVTF  141

Query  246  DRLQKEFSCCGVTGPRDFG  264
            D LQK   CCG  GP D+ 
Sbjct  142  DTLQKNLKCCGADGPGDWA  160


>Q9V3E5_DROME unnamed protein product
Length=267

 Score = 55.8 bits (133),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 63/238 (26%), Positives = 96/238 (40%), Gaps = 37/238 (16%)

Query  103  DCGQDVAMRYYRLWIYTCNLVLLGSAL---GFAAAVSR----TLLFTGDPRRYMVPGVPR  155
            DCG  V    Y L I+     +LG+ +   G   AV +     LL   +  R      P+
Sbjct  4    DCG--VWCAKYLLCIFNFIFFVLGTIIFGVGLWLAVDKHSLIALLKLVESERIEQFTQPQ  61

Query  156  AFDPTALYAYLALATQLGLVQLLGCIAARRLSARLLNAYWVLLLALLFGDAVIGVAWVFR  215
            A +  A Y  L +   +  +  LG + A R S  LL+ Y   L+ LL  + V G    F 
Sbjct  62   AIEQLA-YVLLVIGAVMFFMSFLGYLGAMRESRCLLSTYGTFLILLLIAEIVAGGLGAFF  120

Query  216  FERMRVELRPTLKQRL-QMEYGKDL-RFSEQWDRLQKEFSCCGVTGPRDFGGR--W----  267
             +++R E +  L+  +     G+++   S  W++L   F CCG+    DF     W    
Sbjct  121  KDKVRAESKNFLQTTITSYSLGENVDATSLMWNQLMGNFGCCGINDYHDFDASPAWVNGK  180

Query  268  -----PQTCCVP-------------TGNVSDTCQQPYARGCEESLMRWLRKTADLLFV  307
                 P  CC+              T N SD+    Y +GC E    WL +  +L+ V
Sbjct  181  GNRTIPDACCILKDVAKLVPRDEDCTTNPSDS-NSFYKKGCYEVFTEWLIRQRELVIV  237



Lambda      K        H
   0.313    0.129    0.378 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5180662620


Query= XP_050573145.1 uncharacterized protein LOC126913908 [Bombus affinis]

Length=474
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A0A0B4KH03_DROME  unnamed protein product                             57.0    8e-09
Q9V3X2_DROME  unnamed protein product                                 56.2    1e-08
Q9V3E5_DROME  unnamed protein product                                 55.8    1e-08


>A0A0B4KH03_DROME unnamed protein product
Length=284

 Score = 57.0 bits (136),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 62/139 (45%), Gaps = 5/139 (4%)

Query  129  LGFAAAVSRTLLFTGDPRRYMVPGVPRAFDPTALYAYLALATQLGLVQLLGCIAARRLSA  188
            +G    V+   + T DP   +           ALY +LA+   + L    GC    R S 
Sbjct  24   IGLTIVVTSVWMLT-DPTFMLSMTQNYNHYHIALYVFLAIGILITLGAFFGCCGVCRESQ  82

Query  189  RLLNAYWVLLLALLFGDAVIGVAWVFR-FERMRVELRPTLKQRLQMEYGKDLRFSE--QW  245
             LL +++ ++L ++      G AW F   +++   +R  +K  +Q EYG+    S    +
Sbjct  83   CLLVSFFCVILIVMVAQIAAG-AWAFHNKDKLDDIVRAAVKSSVQEEYGQSTMSSRTVTF  141

Query  246  DRLQKEFSCCGVTGPRDFG  264
            D LQK   CCG  GP D+ 
Sbjct  142  DTLQKNLKCCGADGPGDWA  160


>Q9V3X2_DROME unnamed protein product
Length=268

 Score = 56.2 bits (134),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 62/139 (45%), Gaps = 5/139 (4%)

Query  129  LGFAAAVSRTLLFTGDPRRYMVPGVPRAFDPTALYAYLALATQLGLVQLLGCIAARRLSA  188
            +G    V+   + T DP   +           ALY +LA+   + L    GC    R S 
Sbjct  24   IGLTIVVTSVWMLT-DPTFMLSMTQNYNHYHIALYVFLAIGILITLGAFFGCCGVCRESQ  82

Query  189  RLLNAYWVLLLALLFGDAVIGVAWVFR-FERMRVELRPTLKQRLQMEYGKDLRFSE--QW  245
             LL +++ ++L ++      G AW F   +++   +R  +K  +Q EYG+    S    +
Sbjct  83   CLLVSFFCVILIVMVAQIAAG-AWAFHNKDKLDDIVRAAVKSSVQEEYGQSTMSSRTVTF  141

Query  246  DRLQKEFSCCGVTGPRDFG  264
            D LQK   CCG  GP D+ 
Sbjct  142  DTLQKNLKCCGADGPGDWA  160


>Q9V3E5_DROME unnamed protein product
Length=267

 Score = 55.8 bits (133),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 63/238 (26%), Positives = 96/238 (40%), Gaps = 37/238 (16%)

Query  103  DCGQDVAMRYYRLWIYTCNLVLLGSAL---GFAAAVSR----TLLFTGDPRRYMVPGVPR  155
            DCG  V    Y L I+     +LG+ +   G   AV +     LL   +  R      P+
Sbjct  4    DCG--VWCAKYLLCIFNFIFFVLGTIIFGVGLWLAVDKHSLIALLKLVESERIEQFTQPQ  61

Query  156  AFDPTALYAYLALATQLGLVQLLGCIAARRLSARLLNAYWVLLLALLFGDAVIGVAWVFR  215
            A +  A Y  L +   +  +  LG + A R S  LL+ Y   L+ LL  + V G    F 
Sbjct  62   AIEQLA-YVLLVIGAVMFFMSFLGYLGAMRESRCLLSTYGTFLILLLIAEIVAGGLGAFF  120

Query  216  FERMRVELRPTLKQRL-QMEYGKDL-RFSEQWDRLQKEFSCCGVTGPRDFGGR--W----  267
             +++R E +  L+  +     G+++   S  W++L   F CCG+    DF     W    
Sbjct  121  KDKVRAESKNFLQTTITSYSLGENVDATSLMWNQLMGNFGCCGINDYHDFDASPAWVNGK  180

Query  268  -----PQTCCVP-------------TGNVSDTCQQPYARGCEESLMRWLRKTADLLFV  307
                 P  CC+              T N SD+    Y +GC E    WL +  +L+ V
Sbjct  181  GNRTIPDACCILKDVAKLVPRDEDCTTNPSDS-NSFYKKGCYEVFTEWLIRQRELVIV  237



Lambda      K        H
   0.313    0.129    0.378 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5180662620


Query= XP_050573146.1 syntaxin-7 [Bombus affinis]

Length=271
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7K0X9_DROME  unnamed protein product                                 184     4e-57
Q9VU45_DROME  unnamed protein product                                 93.2    3e-22
STX7A_DICDI  unnamed protein product                                  89.0    3e-20


>Q7K0X9_DROME unnamed protein product
Length=282

 Score = 184 bits (468),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 118/270 (44%), Positives = 168/270 (62%), Gaps = 26/270 (10%)

Query  16   EQDFGRLSQTIGTSILKISQNVSSMQKMVNQLGSSTDSQELRNQLHQIQHYTQQLAKDTS  75
            E DF RL+Q I TSI K+ QNVS+MQ+MVNQL +  DS EL+ QLHQI  YT QL  DT+
Sbjct  20   EIDFQRLAQIIATSIQKVQQNVSTMQRMVNQLNTPQDSPELKKQLHQIMTYTNQLVTDTN  79

Query  76   VHLRDLAILANNSGSTSPGEQRQRKMQRERLQDEFTSALNSFQAVQRLAASKEKEMVRKA  135
                      N        ++R  K+QR+RL DEFT+AL +FQ+VQR  A  EK  +R+A
Sbjct  80   ----------NQINEVDKCKERHLKIQRDRLVDEFTAALTAFQSVQRKTADIEKTALRQA  129

Query  136  KA-SAGIT-PFG------------EKKQETLIE--LQDSRTQKQIQQQQLKEEQNLRMLE  179
            +  S  I  P G            ++   +  E    + ++ +Q  Q Q++E+ +L+ LE
Sbjct  130  RGDSYNIARPPGSSRTGSSNSSASQQDNNSFFEDNFFNRKSNQQQMQTQMEEQADLQALE  189

Query  180  EQEASIRQLENNISDINQIFKDLGALVYDQREVIDSIEASVERTEVSVHEASSHVRQATM  239
            EQE  IR+LENNI  +N+I+K LGALVY+Q   +DSIE+ VE+T + V + + ++R+A+ 
Sbjct  190  EQEQVIRELENNIVGVNEIYKKLGALVYEQGLTVDSIESQVEQTSIFVSQGTENLRKASS  249

Query  240  YKNKLRKKKCILVLIGAVVLSILIGIIAWQ  269
            Y+NK+RKKK ILV I + VL  +I I+ +Q
Sbjct  250  YRNKVRKKKLILVGILSAVLLAIILILVFQ  279


>Q9VU45_DROME unnamed protein product
Length=284

 Score = 93.2 bits (230),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 69/265 (26%), Positives = 136/265 (51%), Gaps = 16/265 (6%)

Query  2    DIGFSSYHNGGPAREQDFGRLSQTIGTSILKISQNVSSMQKMVNQLGSSTDSQELRNQLH  61
            ++ F++          +F  LS+ IG +I  I  +   ++K +  +G+S +   LR ++H
Sbjct  30   EVSFAAAGGSSGFSPTEFMSLSEDIGHNITAIHSSTKQLEKQLKLIGTSKEQPNLREKVH  89

Query  62   QIQHYTQQLAKDTSVHLRDLAILANNSGSTSPGEQRQRKMQRERLQDEFTSALNSFQAVQ  121
             I        + TS  L+ L  +  +         RQ+K+Q E+L  EF   +  +  +Q
Sbjct  90   TINTKCNARVQTTSQDLQRLQAVVRHGD-------RQQKLQLEKLTREFHGVVEKYSNLQ  142

Query  122  RLAASKEKEMVRKAKASAGITPFGEKKQETLIELQDSRTQKQIQQQQLKEEQNLRMLEEQ  181
            R  +S  ++ +++A+  A        + E L        Q++++Q  L++E +  ML+++
Sbjct  143  RRISSAMRQTLQQAQQFADQVVETNARAELL-------QQQRLEQAHLQQEHD--MLDDR  193

Query  182  EASIRQLENNISDINQIFKDLGALVYDQREVIDSIEASVERTEVSVHEASSHVRQATMYK  241
               + Q+E++I D+NQI   L  LV+DQ + +D IE S+E+T  +V + +S + +A   +
Sbjct  194  RRQVEQIESDIIDVNQIMTQLSGLVHDQGQQMDFIENSIEQTAANVEDGTSELAKAARSR  253

Query  242  NKLRKKKCILVLIGAVVLSILIGII  266
               R+K  IL++I  ++  I+ G+I
Sbjct  254  QSYRRKILILLVIAVIIGLIVTGVI  278


>STX7A_DICDI unnamed protein product
Length=356

 Score = 89.0 bits (219),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 77/273 (28%), Positives = 136/273 (50%), Gaps = 38/273 (14%)

Query  24   QTIGTSILKISQNVSSMQKMVNQLGSSTDSQELRNQLHQIQHYTQQLAKDTSVHLRDLAI  83
            Q+   +I +I   V  + K+V  LG+  DS + R ++      T  L    S  +++L  
Sbjct  89   QSTTRNIQQIQNAVQILTKLVQLLGTPKDSMDTREKIRNCVDSTTHLISSESGKVKNLTS  148

Query  84   LANNSGSTSPGEQRQRKMQRERLQDEFTSALNSFQAVQRLAASKEKEM-VRKAKASAGIT  142
            LA+ S  +      + K+  ++L  EF + L  F+ + ++A  KEK   +  A      T
Sbjct  149  LASRSRDS------KNKLLYQKLVKEFNNCLQQFKDIAQVATKKEKTTPLPVAPDHQQPT  202

Query  143  PFG---------------------------EKKQETLIELQDSRTQKQIQQQQLKEEQNL  175
             FG                           E + ++L+E   SR Q+  Q +  +E QN 
Sbjct  203  TFGRNNNSNNNNQNNHFLNNQQPYYDDDNREDEHQSLME--SSRRQQLAQIEAEREYQN-  259

Query  176  RMLEEQEASIRQLENNISDINQIFKDLGALVYDQREVIDSIEASVERTEVSVHEASSHVR  235
             +++E++  IR++E +I +IN+IF DL  LV +Q  +I++IEAS+E T ++  E  +H+R
Sbjct  260  SIIQERDEGIRKIEQSIVEINEIFVDLSGLVAEQGVMINTIEASLESTTINTKEGVNHLR  319

Query  236  QATMYKNKLRKKKCILVLIGAVVLSILIGIIAW  268
            +A+  +   R K C +VLI  +V ++L G+I +
Sbjct  320  EASKNQKSSRNKMCWIVLILLIVCAVL-GVILF  351



Lambda      K        H
   0.313    0.129    0.378 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5180662620


Query= XP_050573147.1 protein odr-4 homolog [Bombus affinis]

Length=462
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ODR4_DROME  unnamed protein product                                   95.5    6e-21
ODR4_CAEEL  unnamed protein product                                   75.9    1e-14
Q8IEG6_PLAF7  unnamed protein product                                 31.2    1.7  


>ODR4_DROME unnamed protein product
Length=492

 Score = 95.5 bits (236),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 104/472 (22%), Positives = 202/472 (43%), Gaps = 71/472 (15%)

Query  3    RTVYAEQRLHNYLTSLAKPDEYTIGLIVGQSAG-QKDYIVHLAKTPPPLGKNVVEESLLS  61
            RTV   +    YL   A+ ++++ G+IVG  A   K  +VHLA+                
Sbjct  2    RTVLLSKHDELYLEKCAQENQFSYGIIVGHQADLTKSVVVHLAR----------------  45

Query  62   STIKSEQNTATENHIKA---IKDIPESWVADHAKYVTRMLPGGMRVLGTFIVGPE-DI--  115
                +E++   E+  +    I DI    +A      ++M PG   V+G F+     D+  
Sbjct  46   ---NNEEDADLEDLSEVRLTISDINSQALASQWLSASKMCPGSFDVIGIFVSSVRSDVVN  102

Query  116  --SHNNNNVQKLKSVL--TTMQKNLSCNKYLCGDNNEEHLILYLNSVTQKYTCKSIEIRN  171
              S    N +KL S +    ++ N S   Y       + + L  +   +K  CK+    N
Sbjct  103  EQSAEFKNAKKLFSDIYDLLLKSNSSFGVYTTDIAQTDFVFLSYSLADKKVLCKNYSYGN  162

Query  172  E-ILKPVDWKFQAKATKWHQLEAFIDFDRLFLIAANKDPETLKKQLQDILKSVSDIIESS  230
                  ++++F  K  +W QLE   DFD +  I  +     ++ Q Q ++ SV   + +S
Sbjct  163  GGTFTNMEFRFVDKPFEWIQLECSYDFDDVLPILDSSRRVNIEDQFQSMIVSVRKNLLAS  222

Query  231  LIVIEGEVRSPDDRLEL-------------------------ISKNKKDERNCRNNEKN-  264
             + ++ EV   +D ++L                          S N  D      +E   
Sbjct  223  EVFLQNEVV--EDTIDLQAYIKKKKTKVDKLQPTSTTGGTATASSNTTDSLPRLASEGII  280

Query  265  NNDRSIQINLYIPCH-EKNLNSDVRITPCNASIRLIGQLVSRTFVHQKANVEEANAAIKQ  323
                +I+ ++ +P   + +  +D+++   + ++ + G + S+ F + + ++ +    ++ 
Sbjct  281  GGTETIRASIVLPMKCQLSKPTDIKVREFSGTLHMSGIITSKVFCNPRNSIADVKRFLRD  340

Query  324  DIIRSLASRLEMHWDSLIEEENGSPEENITLHEPPRRVLIALPE--------SKVTLSDY  375
            D++RSL +R++++ D L +       E + + EPPRRV  +LP         + V  S+Y
Sbjct  341  DVLRSLITRIQVYCDGLTDPY--VTNEALYISEPPRRVFFSLPSEGPSASVGAVVQFSEY  398

Query  376  LFPGEGPQEALLSLQELLDLEVQESNVQKDIEFEADPTEFYSQNKIDVKTVD  427
            LF GE P   +   +++LD+++    +  + E   D T F +  K+D   +D
Sbjct  399  LFRGEAPTVVVAQAKQILDVDLDPETISVEAEGLPDDTHF-NNCKMDADCID  449


>ODR4_CAEEL unnamed protein product
Length=475

 Score = 75.9 bits (185),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 83/358 (23%), Positives = 167/358 (47%), Gaps = 41/358 (11%)

Query  73   ENHIKAIKDIPESWVADHAKYVTRMLPGGMRVLG--------TFIVGPEDISHNNNNVQK  124
            EN  ++ K + + W++DHA+ + RMLPGG+ V+G        TF      I      +QK
Sbjct  94   ENATESSKMLEDEWMSDHAERLLRMLPGGIHVVGIAWFSDKKTFSDRKSHIHKTLGRIQK  153

Query  125  LKSVLTTMQKNLSCNKYLCG---DNNEEHLILYLNSVTQKYTCKSIEIRNEILKPVDWKF  181
            + + +TT   + S +  +     +      I  +  VT +    + +++ + L+ +    
Sbjct  154  MNNQITTANVDDSISDNMITVFFETPSTTPIGAIIDVTNRGNDSAQKVQFQKLEWISLVT  213

Query  182  QAKATKWHQLEAFIDFDRLFLIAANKDPETLKKQLQDILKS-VSDIIESSLIVIEGEVRS  240
             A A   H +   +D  R         P      L    K+ V+++ +    +++GE+R 
Sbjct  214  NASARIVHNVP--VDTGR---------PTDFYSDLVVATKNFVNNLFQCEFTLLDGEIR-  261

Query  241  PDDRLELISKNKKDERNCRNNEKNNNDRSIQINLYI-PCHEKNLNSDVRITPCNASIRLI  299
             DD+  LI   KK+++            +I+  L++ P + + L +   I   +    ++
Sbjct  262  -DDKEPLIKDIKKNKKT-----------TIEAQLFLNPLYNRELGAIDDI--ASNMHEVL  307

Query  300  GQLVSRTFVHQKANVEEANAAIKQDIIRSLASRLEMHWDSL-IEEENGSPEENITLHEPP  358
              +  R  V  ++ V++A  AIK  ++R+L +R+E+H++S+ + EE  SP+  IT+H+ P
Sbjct  308  FDIEVRAAVPIRSTVKDAIRAIKHHLVRNLFARVELHYESMEVVEEERSPKTGITVHQLP  367

Query  359  RRVLIAL-PESKVTLSDYLFPGEGPQEALLSLQELLDLEVQESNVQKDIEFEADPTEF  415
            R     L     + ++D+LF  +  ++A  +  +++DL+    +V +  E    P E 
Sbjct  368  RPATTVLYTHPAILINDFLFEADNVEDAQKNFDDMMDLQTSIEHVDEGWERALTPEEM  425


>Q8IEG6_PLAF7 unnamed protein product
Length=401

 Score = 31.2 bits (69),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 24/84 (29%), Positives = 39/84 (46%), Gaps = 6/84 (7%)

Query  84   ESWVADHAKYVTRMLPGGMRVLGTFIVGPEDISHNNNNVQKLKSVLTTMQKNLSCNKYLC  143
            +++V +     T  +P   +V G  ++   D+SH  NN+Q   S L    KN   N  +C
Sbjct  300  DTYVCNFCNSYTCKIPSKCKVCGIHLISMHDLSHITNNLQ--GSPLFIEIKNEQGNYKVC  357

Query  144  GDNNEEHLILYLNSVTQKYTCKSI  167
               N++   LY N + Q   C+ I
Sbjct  358  SSCNQQ---LY-NKIYQCTKCQHI  377



Lambda      K        H
   0.313    0.129    0.378 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5180662620


Query= XP_050573148.1 protein odr-4 homolog [Bombus affinis]

Length=462
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ODR4_DROME  unnamed protein product                                   95.5    6e-21
ODR4_CAEEL  unnamed protein product                                   75.9    1e-14
Q8IEG6_PLAF7  unnamed protein product                                 31.2    1.7  


>ODR4_DROME unnamed protein product
Length=492

 Score = 95.5 bits (236),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 104/472 (22%), Positives = 202/472 (43%), Gaps = 71/472 (15%)

Query  3    RTVYAEQRLHNYLTSLAKPDEYTIGLIVGQSAG-QKDYIVHLAKTPPPLGKNVVEESLLS  61
            RTV   +    YL   A+ ++++ G+IVG  A   K  +VHLA+                
Sbjct  2    RTVLLSKHDELYLEKCAQENQFSYGIIVGHQADLTKSVVVHLAR----------------  45

Query  62   STIKSEQNTATENHIKA---IKDIPESWVADHAKYVTRMLPGGMRVLGTFIVGPE-DI--  115
                +E++   E+  +    I DI    +A      ++M PG   V+G F+     D+  
Sbjct  46   ---NNEEDADLEDLSEVRLTISDINSQALASQWLSASKMCPGSFDVIGIFVSSVRSDVVN  102

Query  116  --SHNNNNVQKLKSVL--TTMQKNLSCNKYLCGDNNEEHLILYLNSVTQKYTCKSIEIRN  171
              S    N +KL S +    ++ N S   Y       + + L  +   +K  CK+    N
Sbjct  103  EQSAEFKNAKKLFSDIYDLLLKSNSSFGVYTTDIAQTDFVFLSYSLADKKVLCKNYSYGN  162

Query  172  E-ILKPVDWKFQAKATKWHQLEAFIDFDRLFLIAANKDPETLKKQLQDILKSVSDIIESS  230
                  ++++F  K  +W QLE   DFD +  I  +     ++ Q Q ++ SV   + +S
Sbjct  163  GGTFTNMEFRFVDKPFEWIQLECSYDFDDVLPILDSSRRVNIEDQFQSMIVSVRKNLLAS  222

Query  231  LIVIEGEVRSPDDRLEL-------------------------ISKNKKDERNCRNNEKN-  264
             + ++ EV   +D ++L                          S N  D      +E   
Sbjct  223  EVFLQNEVV--EDTIDLQAYIKKKKTKVDKLQPTSTTGGTATASSNTTDSLPRLASEGII  280

Query  265  NNDRSIQINLYIPCH-EKNLNSDVRITPCNASIRLIGQLVSRTFVHQKANVEEANAAIKQ  323
                +I+ ++ +P   + +  +D+++   + ++ + G + S+ F + + ++ +    ++ 
Sbjct  281  GGTETIRASIVLPMKCQLSKPTDIKVREFSGTLHMSGIITSKVFCNPRNSIADVKRFLRD  340

Query  324  DIIRSLASRLEMHWDSLIEEENGSPEENITLHEPPRRVLIALPE--------SKVTLSDY  375
            D++RSL +R++++ D L +       E + + EPPRRV  +LP         + V  S+Y
Sbjct  341  DVLRSLITRIQVYCDGLTDPY--VTNEALYISEPPRRVFFSLPSEGPSASVGAVVQFSEY  398

Query  376  LFPGEGPQEALLSLQELLDLEVQESNVQKDIEFEADPTEFYSQNKIDVKTVD  427
            LF GE P   +   +++LD+++    +  + E   D T F +  K+D   +D
Sbjct  399  LFRGEAPTVVVAQAKQILDVDLDPETISVEAEGLPDDTHF-NNCKMDADCID  449


>ODR4_CAEEL unnamed protein product
Length=475

 Score = 75.9 bits (185),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 83/358 (23%), Positives = 167/358 (47%), Gaps = 41/358 (11%)

Query  73   ENHIKAIKDIPESWVADHAKYVTRMLPGGMRVLG--------TFIVGPEDISHNNNNVQK  124
            EN  ++ K + + W++DHA+ + RMLPGG+ V+G        TF      I      +QK
Sbjct  94   ENATESSKMLEDEWMSDHAERLLRMLPGGIHVVGIAWFSDKKTFSDRKSHIHKTLGRIQK  153

Query  125  LKSVLTTMQKNLSCNKYLCG---DNNEEHLILYLNSVTQKYTCKSIEIRNEILKPVDWKF  181
            + + +TT   + S +  +     +      I  +  VT +    + +++ + L+ +    
Sbjct  154  MNNQITTANVDDSISDNMITVFFETPSTTPIGAIIDVTNRGNDSAQKVQFQKLEWISLVT  213

Query  182  QAKATKWHQLEAFIDFDRLFLIAANKDPETLKKQLQDILKS-VSDIIESSLIVIEGEVRS  240
             A A   H +   +D  R         P      L    K+ V+++ +    +++GE+R 
Sbjct  214  NASARIVHNVP--VDTGR---------PTDFYSDLVVATKNFVNNLFQCEFTLLDGEIR-  261

Query  241  PDDRLELISKNKKDERNCRNNEKNNNDRSIQINLYI-PCHEKNLNSDVRITPCNASIRLI  299
             DD+  LI   KK+++            +I+  L++ P + + L +   I   +    ++
Sbjct  262  -DDKEPLIKDIKKNKKT-----------TIEAQLFLNPLYNRELGAIDDI--ASNMHEVL  307

Query  300  GQLVSRTFVHQKANVEEANAAIKQDIIRSLASRLEMHWDSL-IEEENGSPEENITLHEPP  358
              +  R  V  ++ V++A  AIK  ++R+L +R+E+H++S+ + EE  SP+  IT+H+ P
Sbjct  308  FDIEVRAAVPIRSTVKDAIRAIKHHLVRNLFARVELHYESMEVVEEERSPKTGITVHQLP  367

Query  359  RRVLIAL-PESKVTLSDYLFPGEGPQEALLSLQELLDLEVQESNVQKDIEFEADPTEF  415
            R     L     + ++D+LF  +  ++A  +  +++DL+    +V +  E    P E 
Sbjct  368  RPATTVLYTHPAILINDFLFEADNVEDAQKNFDDMMDLQTSIEHVDEGWERALTPEEM  425


>Q8IEG6_PLAF7 unnamed protein product
Length=401

 Score = 31.2 bits (69),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 24/84 (29%), Positives = 39/84 (46%), Gaps = 6/84 (7%)

Query  84   ESWVADHAKYVTRMLPGGMRVLGTFIVGPEDISHNNNNVQKLKSVLTTMQKNLSCNKYLC  143
            +++V +     T  +P   +V G  ++   D+SH  NN+Q   S L    KN   N  +C
Sbjct  300  DTYVCNFCNSYTCKIPSKCKVCGIHLISMHDLSHITNNLQ--GSPLFIEIKNEQGNYKVC  357

Query  144  GDNNEEHLILYLNSVTQKYTCKSI  167
               N++   LY N + Q   C+ I
Sbjct  358  SSCNQQ---LY-NKIYQCTKCQHI  377



Lambda      K        H
   0.313    0.129    0.378 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5180662620


Query= XP_050573149.1 YTH domain-containing protein 1 isoform X1 [Bombus
affinis]

Length=458
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

YTDC1_DROME  unnamed protein product                                  291     8e-91
YTHDF_DROME  unnamed protein product                                  73.9    8e-14
Q8I531_PLAF7  unnamed protein product                                 32.7    0.84 


>YTDC1_DROME unnamed protein product
Length=721

 Score = 291 bits (744),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 135/199 (68%), Positives = 161/199 (81%), Gaps = 1/199 (1%)

Query  79   SKSSSPETKRARSKESKGVTKSYDYATKLNYLFRDARFFIIKSNNAENVTLSKAKGVWST  138
            SKSS+PE             K YDY TKLNYLFRD RFF+IKSNN++NV LSK K VW+T
Sbjct  219  SKSSTPEKDSVGGGTHSHSQKGYDYMTKLNYLFRDTRFFLIKSNNSDNVQLSKNKSVWAT  278

Query  139  LPQNEANLNQAYRESRNVLLIFSVKESGKFAGFARLSTESRRDGAPISWVLPPGLSAKAL  198
            LPQN+ANLNQA++E+RNVLLIFSV ESGKFAGFAR++  SRRD   ++WVLPP +S KAL
Sbjct  279  LPQNDANLNQAFKEARNVLLIFSVNESGKFAGFARMAAPSRRDIPQVAWVLPPSISPKAL  338

Query  199  GGVFKVDWICRKELPFTATLHLYNPWNDGKQVKIGRDGQEIEPRVAEELCRLFPEDEGIE  258
            GGV ++DWICRKEL F ATLHL+N WN+GK VKIGRDGQEIEP++  ELCRLFPEDE IE
Sbjct  339  GGVIELDWICRKELSFNATLHLHNTWNEGKPVKIGRDGQEIEPKIGGELCRLFPEDEQIE  398

Query  259  MTPILRKSKEAAKHIMKSR  277
            +TPIL+KSKE A+ +M+ +
Sbjct  399  LTPILKKSKETAR-VMREK  416


>YTHDF_DROME unnamed protein product
Length=700

 Score = 73.9 bits (180),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 70/154 (45%), Gaps = 22/154 (14%)

Query  114  ARFFIIKSNNAENVTLSKAKGVWSTLPQNEANLNQAYRESR----NVLLIFSVKESGKFA  169
            ARFF+IKS + +++  S    +W +       L+ A++E      N++L FSV  SG F 
Sbjct  382  ARFFVIKSYSEDDIHRSIKYEIWCSTDHGNKRLDDAFKERHEEGGNIMLFFSVNGSGHFC  441

Query  170  GFARLSTESRRDGAPISWVLPPGLSAKALGGVFKVDWICRKELPFTATLHLYNPWNDGKQ  229
            G A++ T    +     W      S     G FKV WI  K++P     H+    N+ K 
Sbjct  442  GMAQMMTPVDYNSTSSVW------SQDKWRGKFKVKWIYVKDVPNGTLRHIRLENNENKS  495

Query  230  VKIGRDGQEIEPRVAEELCRLFPEDEGIEMTPIL  263
            V   RD QE+            P D+GIE+  IL
Sbjct  496  VTNSRDTQEV------------PNDKGIEVLQIL  517


>Q8I531_PLAF7 unnamed protein product
Length=2577

 Score = 32.7 bits (73),  Expect = 0.84, Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 31/57 (54%), Gaps = 2/57 (4%)

Query  129   LSKAKGVW-STLPQNEANLNQAYRESRNVLLIFSVKESGKFAGFARLSTESRRDGAP  184
             + K +GVW ++ PQ    + QAY++ + +  IFSV + G F G  +L+   R    P
Sbjct  2287  MPKVRGVWFNSTPQRMGWVGQAYKKCKRIERIFSVNKYG-FEGARKLAIAFRNSQKP  2342



Lambda      K        H
   0.313    0.129    0.378 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5180662620


Query= XP_050573150.1 YTH domain-containing protein 1 isoform X1 [Bombus
affinis]

Length=458
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

YTDC1_DROME  unnamed protein product                                  291     8e-91
YTHDF_DROME  unnamed protein product                                  73.9    8e-14
Q8I531_PLAF7  unnamed protein product                                 32.7    0.84 


>YTDC1_DROME unnamed protein product
Length=721

 Score = 291 bits (744),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 135/199 (68%), Positives = 161/199 (81%), Gaps = 1/199 (1%)

Query  79   SKSSSPETKRARSKESKGVTKSYDYATKLNYLFRDARFFIIKSNNAENVTLSKAKGVWST  138
            SKSS+PE             K YDY TKLNYLFRD RFF+IKSNN++NV LSK K VW+T
Sbjct  219  SKSSTPEKDSVGGGTHSHSQKGYDYMTKLNYLFRDTRFFLIKSNNSDNVQLSKNKSVWAT  278

Query  139  LPQNEANLNQAYRESRNVLLIFSVKESGKFAGFARLSTESRRDGAPISWVLPPGLSAKAL  198
            LPQN+ANLNQA++E+RNVLLIFSV ESGKFAGFAR++  SRRD   ++WVLPP +S KAL
Sbjct  279  LPQNDANLNQAFKEARNVLLIFSVNESGKFAGFARMAAPSRRDIPQVAWVLPPSISPKAL  338

Query  199  GGVFKVDWICRKELPFTATLHLYNPWNDGKQVKIGRDGQEIEPRVAEELCRLFPEDEGIE  258
            GGV ++DWICRKEL F ATLHL+N WN+GK VKIGRDGQEIEP++  ELCRLFPEDE IE
Sbjct  339  GGVIELDWICRKELSFNATLHLHNTWNEGKPVKIGRDGQEIEPKIGGELCRLFPEDEQIE  398

Query  259  MTPILRKSKEAAKHIMKSR  277
            +TPIL+KSKE A+ +M+ +
Sbjct  399  LTPILKKSKETAR-VMREK  416


>YTHDF_DROME unnamed protein product
Length=700

 Score = 73.9 bits (180),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 70/154 (45%), Gaps = 22/154 (14%)

Query  114  ARFFIIKSNNAENVTLSKAKGVWSTLPQNEANLNQAYRESR----NVLLIFSVKESGKFA  169
            ARFF+IKS + +++  S    +W +       L+ A++E      N++L FSV  SG F 
Sbjct  382  ARFFVIKSYSEDDIHRSIKYEIWCSTDHGNKRLDDAFKERHEEGGNIMLFFSVNGSGHFC  441

Query  170  GFARLSTESRRDGAPISWVLPPGLSAKALGGVFKVDWICRKELPFTATLHLYNPWNDGKQ  229
            G A++ T    +     W      S     G FKV WI  K++P     H+    N+ K 
Sbjct  442  GMAQMMTPVDYNSTSSVW------SQDKWRGKFKVKWIYVKDVPNGTLRHIRLENNENKS  495

Query  230  VKIGRDGQEIEPRVAEELCRLFPEDEGIEMTPIL  263
            V   RD QE+            P D+GIE+  IL
Sbjct  496  VTNSRDTQEV------------PNDKGIEVLQIL  517


>Q8I531_PLAF7 unnamed protein product
Length=2577

 Score = 32.7 bits (73),  Expect = 0.84, Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 31/57 (54%), Gaps = 2/57 (4%)

Query  129   LSKAKGVW-STLPQNEANLNQAYRESRNVLLIFSVKESGKFAGFARLSTESRRDGAP  184
             + K +GVW ++ PQ    + QAY++ + +  IFSV + G F G  +L+   R    P
Sbjct  2287  MPKVRGVWFNSTPQRMGWVGQAYKKCKRIERIFSVNKYG-FEGARKLAIAFRNSQKP  2342



Lambda      K        H
   0.313    0.129    0.378 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5180662620


Query= XP_050573151.1 YTH domain-containing protein 1 isoform X2 [Bombus
affinis]

Length=449
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

YTDC1_DROME  unnamed protein product                                  291     4e-91
YTHDF_DROME  unnamed protein product                                  73.9    9e-14
Q8I531_PLAF7  unnamed protein product                                 32.7    0.89 


>YTDC1_DROME unnamed protein product
Length=721

 Score = 291 bits (745),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 135/199 (68%), Positives = 161/199 (81%), Gaps = 1/199 (1%)

Query  79   SKSSSPETKRARSKESKGVTKSYDYATKLNYLFRDARFFIIKSNNAENVTLSKAKGVWST  138
            SKSS+PE             K YDY TKLNYLFRD RFF+IKSNN++NV LSK K VW+T
Sbjct  219  SKSSTPEKDSVGGGTHSHSQKGYDYMTKLNYLFRDTRFFLIKSNNSDNVQLSKNKSVWAT  278

Query  139  LPQNEANLNQAYRESRNVLLIFSVKESGKFAGFARLSTESRRDGAPISWVLPPGLSAKAL  198
            LPQN+ANLNQA++E+RNVLLIFSV ESGKFAGFAR++  SRRD   ++WVLPP +S KAL
Sbjct  279  LPQNDANLNQAFKEARNVLLIFSVNESGKFAGFARMAAPSRRDIPQVAWVLPPSISPKAL  338

Query  199  GGVFKVDWICRKELPFTATLHLYNPWNDGKQVKIGRDGQEIEPRVAEELCRLFPEDEGIE  258
            GGV ++DWICRKEL F ATLHL+N WN+GK VKIGRDGQEIEP++  ELCRLFPEDE IE
Sbjct  339  GGVIELDWICRKELSFNATLHLHNTWNEGKPVKIGRDGQEIEPKIGGELCRLFPEDEQIE  398

Query  259  MTPILRKSKEAAKHIMKSR  277
            +TPIL+KSKE A+ +M+ +
Sbjct  399  LTPILKKSKETAR-VMREK  416


>YTHDF_DROME unnamed protein product
Length=700

 Score = 73.9 bits (180),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 70/154 (45%), Gaps = 22/154 (14%)

Query  114  ARFFIIKSNNAENVTLSKAKGVWSTLPQNEANLNQAYRESR----NVLLIFSVKESGKFA  169
            ARFF+IKS + +++  S    +W +       L+ A++E      N++L FSV  SG F 
Sbjct  382  ARFFVIKSYSEDDIHRSIKYEIWCSTDHGNKRLDDAFKERHEEGGNIMLFFSVNGSGHFC  441

Query  170  GFARLSTESRRDGAPISWVLPPGLSAKALGGVFKVDWICRKELPFTATLHLYNPWNDGKQ  229
            G A++ T    +     W      S     G FKV WI  K++P     H+    N+ K 
Sbjct  442  GMAQMMTPVDYNSTSSVW------SQDKWRGKFKVKWIYVKDVPNGTLRHIRLENNENKS  495

Query  230  VKIGRDGQEIEPRVAEELCRLFPEDEGIEMTPIL  263
            V   RD QE+            P D+GIE+  IL
Sbjct  496  VTNSRDTQEV------------PNDKGIEVLQIL  517


>Q8I531_PLAF7 unnamed protein product
Length=2577

 Score = 32.7 bits (73),  Expect = 0.89, Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 31/57 (54%), Gaps = 2/57 (4%)

Query  129   LSKAKGVW-STLPQNEANLNQAYRESRNVLLIFSVKESGKFAGFARLSTESRRDGAP  184
             + K +GVW ++ PQ    + QAY++ + +  IFSV + G F G  +L+   R    P
Sbjct  2287  MPKVRGVWFNSTPQRMGWVGQAYKKCKRIERIFSVNKYG-FEGARKLAIAFRNSQKP  2342



Lambda      K        H
   0.313    0.129    0.378 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5180662620


Query= XP_050573152.1 YTH domain-containing protein 1 isoform X3 [Bombus
affinis]

Length=444
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

YTDC1_DROME  unnamed protein product                                  291     3e-91
YTHDF_DROME  unnamed protein product                                  73.9    8e-14
Q8I531_PLAF7  unnamed protein product                                 32.7    0.80 


>YTDC1_DROME unnamed protein product
Length=721

 Score = 291 bits (745),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 135/199 (68%), Positives = 161/199 (81%), Gaps = 1/199 (1%)

Query  79   SKSSSPETKRARSKESKGVTKSYDYATKLNYLFRDARFFIIKSNNAENVTLSKAKGVWST  138
            SKSS+PE             K YDY TKLNYLFRD RFF+IKSNN++NV LSK K VW+T
Sbjct  219  SKSSTPEKDSVGGGTHSHSQKGYDYMTKLNYLFRDTRFFLIKSNNSDNVQLSKNKSVWAT  278

Query  139  LPQNEANLNQAYRESRNVLLIFSVKESGKFAGFARLSTESRRDGAPISWVLPPGLSAKAL  198
            LPQN+ANLNQA++E+RNVLLIFSV ESGKFAGFAR++  SRRD   ++WVLPP +S KAL
Sbjct  279  LPQNDANLNQAFKEARNVLLIFSVNESGKFAGFARMAAPSRRDIPQVAWVLPPSISPKAL  338

Query  199  GGVFKVDWICRKELPFTATLHLYNPWNDGKQVKIGRDGQEIEPRVAEELCRLFPEDEGIE  258
            GGV ++DWICRKEL F ATLHL+N WN+GK VKIGRDGQEIEP++  ELCRLFPEDE IE
Sbjct  339  GGVIELDWICRKELSFNATLHLHNTWNEGKPVKIGRDGQEIEPKIGGELCRLFPEDEQIE  398

Query  259  MTPILRKSKEAAKHIMKSR  277
            +TPIL+KSKE A+ +M+ +
Sbjct  399  LTPILKKSKETAR-VMREK  416


>YTHDF_DROME unnamed protein product
Length=700

 Score = 73.9 bits (180),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 70/154 (45%), Gaps = 22/154 (14%)

Query  114  ARFFIIKSNNAENVTLSKAKGVWSTLPQNEANLNQAYRESR----NVLLIFSVKESGKFA  169
            ARFF+IKS + +++  S    +W +       L+ A++E      N++L FSV  SG F 
Sbjct  382  ARFFVIKSYSEDDIHRSIKYEIWCSTDHGNKRLDDAFKERHEEGGNIMLFFSVNGSGHFC  441

Query  170  GFARLSTESRRDGAPISWVLPPGLSAKALGGVFKVDWICRKELPFTATLHLYNPWNDGKQ  229
            G A++ T    +     W      S     G FKV WI  K++P     H+    N+ K 
Sbjct  442  GMAQMMTPVDYNSTSSVW------SQDKWRGKFKVKWIYVKDVPNGTLRHIRLENNENKS  495

Query  230  VKIGRDGQEIEPRVAEELCRLFPEDEGIEMTPIL  263
            V   RD QE+            P D+GIE+  IL
Sbjct  496  VTNSRDTQEV------------PNDKGIEVLQIL  517


>Q8I531_PLAF7 unnamed protein product
Length=2577

 Score = 32.7 bits (73),  Expect = 0.80, Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 31/57 (54%), Gaps = 2/57 (4%)

Query  129   LSKAKGVW-STLPQNEANLNQAYRESRNVLLIFSVKESGKFAGFARLSTESRRDGAP  184
             + K +GVW ++ PQ    + QAY++ + +  IFSV + G F G  +L+   R    P
Sbjct  2287  MPKVRGVWFNSTPQRMGWVGQAYKKCKRIERIFSVNKYG-FEGARKLAIAFRNSQKP  2342



Lambda      K        H
   0.313    0.129    0.378 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5180662620


Query= XP_050573153.1 zinc finger protein 90-like isoform X1 [Bombus
affinis]

Length=450
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VIS9_DROME  unnamed protein product                                 121     1e-29
Q8MR68_DROME  unnamed protein product                                 121     2e-29
SRYC_DROME  unnamed protein product                                   119     1e-28


>Q9VIS9_DROME unnamed protein product
Length=578

 Score = 121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 114/465 (25%), Positives = 191/465 (41%), Gaps = 64/465 (14%)

Query  18   CRICA-SDIPRNDGVHIFAED---GRRHYLQTKIRKYLYILVSSEDKLSKMVCVTCIKRL  73
            CR+CA  D+  N  V +  ED        L T I KY ++ ++  ++L + +C  C+  +
Sbjct  29   CRLCAKDDVQGNLNVFLKNEDSGEAASMELATAIGKYFWVNITRGEELPETICSECLSLV  88

Query  74   ESIHRFAMMAYRTQEKLKSQLYSNSDDTNIQDVERESVKDVQNTRRI---EDRGLLHTIL  130
             S+  F+    R Q     +LY     T  Q  ER ++ ++++   +   E +  +H + 
Sbjct  89   TSLVNFSERITRVQ-----KLYCILQSTPSQ--ERPNLHELRSKFGLLDEETQTEVHYVD  141

Query  131  TKG----AIEILAE------GEPLGP---SELMSQEDKCHTPSMEEMEVKVDP-------  170
             K      +E L E        PL P    E + QE    T   +E +   +P       
Sbjct  142  KKPKLDEQLEFLPEESPYELANPLTPEEKQESVDQEQDQPTEEPDEQDADYEPNEDRVLM  201

Query  171  MLFLQYGMENSASETSEASDTEEIITKTNSPEPLPLTNKIDEIKKETKEESNDKLQE-DT  229
             L   YG++   S       +     K             D    E + + N+ L+   T
Sbjct  202  SLCDVYGIQEDNSSAGSLDGSSPSTEKAGE----------DAADSEKRHQCNECLRSYAT  251

Query  230  EELI----------SNVSTKPHECTICARSFISQIGLQNHLWSHLPKDKRLD------GK  273
             + +          +  +T+  +C  C + F     L+ H+  H+P  KR         K
Sbjct  252  SKTLQRHLRQDHGQTEPTTEQLQCPDCPKKFRLHYQLERHMKWHVPLPKRKQYACSSCDK  311

Query  274  PILRSQQVYSTNGVLHMNTDNNSSSNFICPICSKKISTKGNLKVHLETHRPKGKYGCDIC  333
                S         +H++         IC  C   + +   LK H+  H     + C++C
Sbjct  312  KFATSASAQQHEQYMHLD---ERPRPVICEQCGVGVHSMSALKEHVLKHTDYAPFECEVC  368

Query  334  GRIFKTQSNLFRHKEYHGGIQFPCNVCGRVYPTNSTLRAHSITHSDLRPHACPLCDKTFK  393
             + FK+ + L  HKE H   ++ C  CG    + +TL  H + H+D   H C  C + FK
Sbjct  369  KKCFKSANRLKHHKETHDPHKYICPECGMQLNSRTTLNRHRLVHTDQMQHKCDYCGREFK  428

Query  394  RNQDLKFHINQHTGARPYQCPYCPKAFASSGNCFSHRKRMHPREV  438
            R + LK H+  HTG +PY C +C + FA+  NC +H+K+ HP E+
Sbjct  429  RAKALKNHLILHTGLKPYSCDFCDRTFANGSNCRTHKKKSHPEEL  473


>Q8MR68_DROME unnamed protein product
Length=607

 Score = 121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 114/465 (25%), Positives = 191/465 (41%), Gaps = 64/465 (14%)

Query  18   CRICA-SDIPRNDGVHIFAED---GRRHYLQTKIRKYLYILVSSEDKLSKMVCVTCIKRL  73
            CR+CA  D+  N  V +  ED        L T I KY ++ ++  ++L + +C  C+  +
Sbjct  58   CRLCAKDDVQGNLNVFLKNEDSGEAASMELATAIGKYFWVNITRGEELPETICSECLSLV  117

Query  74   ESIHRFAMMAYRTQEKLKSQLYSNSDDTNIQDVERESVKDVQNTRRI---EDRGLLHTIL  130
             S+  F+    R Q     +LY     T  Q  ER ++ ++++   +   E +  +H + 
Sbjct  118  TSLVNFSERITRVQ-----KLYCILQSTPSQ--ERPNLHELRSKFGLLDEETQTEVHYVD  170

Query  131  TKG----AIEILAE------GEPLGP---SELMSQEDKCHTPSMEEMEVKVDP-------  170
             K      +E L E        PL P    E + QE    T   +E +   +P       
Sbjct  171  KKPKLDEQLEFLPEESPYELANPLTPEEKQESVDQEQDQPTEEPDEQDADYEPNEDRVLM  230

Query  171  MLFLQYGMENSASETSEASDTEEIITKTNSPEPLPLTNKIDEIKKETKEESNDKLQE-DT  229
             L   YG++   S       +     K             D    E + + N+ L+   T
Sbjct  231  SLCDVYGIQEDNSSAGSLDGSSPSTEKAGE----------DAADSEKRHQCNECLRSYAT  280

Query  230  EELI----------SNVSTKPHECTICARSFISQIGLQNHLWSHLPKDKRLD------GK  273
             + +          +  +T+  +C  C + F     L+ H+  H+P  KR         K
Sbjct  281  SKTLQRHLRQDHGQTEPTTEQLQCPDCPKKFRLHYQLERHMKWHVPLPKRKQYACSSCDK  340

Query  274  PILRSQQVYSTNGVLHMNTDNNSSSNFICPICSKKISTKGNLKVHLETHRPKGKYGCDIC  333
                S         +H++         IC  C   + +   LK H+  H     + C++C
Sbjct  341  KFATSASAQQHEQYMHLD---ERPRPVICEQCGVGVHSMSALKEHVLKHTDYAPFECEVC  397

Query  334  GRIFKTQSNLFRHKEYHGGIQFPCNVCGRVYPTNSTLRAHSITHSDLRPHACPLCDKTFK  393
             + FK+ + L  HKE H   ++ C  CG    + +TL  H + H+D   H C  C + FK
Sbjct  398  KKCFKSANRLKHHKETHDPHKYICPECGMQLNSRTTLNRHRLVHTDQMQHKCDYCGREFK  457

Query  394  RNQDLKFHINQHTGARPYQCPYCPKAFASSGNCFSHRKRMHPREV  438
            R + LK H+  HTG +PY C +C + FA+  NC +H+K+ HP E+
Sbjct  458  RAKALKNHLILHTGLKPYSCDFCDRTFANGSNCRTHKKKSHPEEL  502


>SRYC_DROME unnamed protein product
Length=869

 Score = 119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/195 (33%), Positives = 100/195 (51%), Gaps = 1/195 (1%)

Query  241  HECTICARSFISQIGLQNHLWSHLPKDKRLDGKPILRSQQVYSTNGVLHMNTDNNSSSNF  300
            + C+ C R F    GL+ HL +H  + ++   K      +      +      ++ +  +
Sbjct  299  YRCSECQREFELLAGLKKHLKTHRTEGRKDTWKKCPDCGKCLKLGSMWMHRKIHSDNKKY  358

Query  301  ICPICSKKISTKGNLKVHLETHRPKGKYGCDICGRIFKTQSNLFRHKEYHGGIQ-FPCNV  359
             C IC +K   K NL  H   H  +  Y C  C + F+ +S+L RH++YH   + + C  
Sbjct  359  QCDICGQKFVQKINLTHHARIHSSEKPYECPECQKRFQERSHLQRHQ