BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_050469371.1 histone-lysine N-methyltransferase SETD1 [Bombus
huntii]

Length=1502
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SET1_DROME  unnamed protein product                                   468     9e-139
SET2_CAEEL  unnamed protein product                                   256     6e-69 
SET1_DICDI  unnamed protein product                                   233     2e-61 


>SET1_DROME unnamed protein product
Length=1641

 Score = 468 bits (1203),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 253/440 (58%), Positives = 300/440 (68%), Gaps = 45/440 (10%)

Query  1087  SPKNSQASQVFMEHSYSLPPTQSEI----------TKSVIRTPS---------TPMKPVK  1127
             S + SQASQV +EH YSLPP    +          TK++++  +         T   P +
Sbjct  1223  SSQASQASQVALEHCYSLPPHSVSLGDYPSGKVNETKNILKREAENIAIVSQMTRTGPGR  1282

Query  1128  LKSSKIMKLSKSKDKIHKVEKRKYNKYTKIHAHQNHEGEKENIENEYVYEKYPKKVEEPL  1187
              +   I    K +D    +  R  N  +K+  + +   +  +    +V          P 
Sbjct  1283  PRKDPICIQKKKRD----LAPRMSNVKSKMTPNGDEWPDLAHKNVHFV----------PC  1328

Query  1188  VTYKERDLMSEMAILYEFLTRGIDAEDVEYLRRSYEALLADDSQGYWLNDTHWVDHPPTD  1247
               YK RD   EM ILY FLT+GIDAED+ +++ SY   L  +    +LN+THWVDH  TD
Sbjct  1329  DMYKTRDQNEEMVILYTFLTKGIDAEDINFIKMSYLDHLHKEPYAMFLNNTHWVDHCTTD  1388

Query  1248  I----PSPAKRRKRDELRLHTSGSARTEGYYKVDVREKAKHKHHYAQSIQRSNDVED-SN  1302
                  P   KRRK DEL  H +G ARTEG+YK+DVREKAKHK+HYA++    +  ED S+
Sbjct  1389  RAFWPPPSKKRRKDDELIRHKTGCARTEGFYKLDVREKAKHKYHYAKANTEDSFNEDRSD  1448

Query  1303  GPYAGSDGIMNGPKNNTKALTGKMQALSREARSNQRRLLTAFGIDTDSDLLKFNQLKFRK  1362
              P A ++   N        L  KMQ +SREARSNQRRLLTAFG   +S+LLKFNQLKFRK
Sbjct  1449  EPTALTNHHHN-------KLISKMQGISREARSNQRRLLTAFGSMGESELLKFNQLKFRK  1501

Query  1363  KQLKFAKSGIHDWGLFAMEPIAADEMVIEYVGQMIRPVVADLRESQYEATGIGSSYLFRI  1422
             KQLKFAKS IHDWGLFAMEPIAADEMVIEYVGQMIRPVVADLRE++YEA GIGSSYLFRI
Sbjct  1502  KQLKFAKSAIHDWGLFAMEPIAADEMVIEYVGQMIRPVVADLRETKYEAIGIGSSYLFRI  1561

Query  1423  DLDTIIDATKCGNLARFINHSCNPNCYAKVITIESQKKIVIYSKQPIGVNEEITYDYKFP  1482
             D++TIIDATKCGNLARFINHSCNPNCYAKVITIES+KKIVIYSKQPIG+NEEITYDYKFP
Sbjct  1562  DMETIIDATKCGNLARFINHSCNPNCYAKVITIESEKKIVIYSKQPIGINEEITYDYKFP  1621

Query  1483  LEDDKIPCLCGAPQCRGTLN  1502
             LED+KIPCLCGA  CRGTLN
Sbjct  1622  LEDEKIPCLCGAQGCRGTLN  1641


 Score = 212 bits (539),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 124/165 (75%), Gaps = 1/165 (1%)

Query  62   PRNYKLLVDPFLVKGATKLYRYDGMVPGDPTYPEVQPRDPRSQLTRIWTR-LEQLDLPVP  120
            PRN+KLL DP LVK  T+LYRYDG++PGDP+YP + PRDPR+ L RI  R +E L L +P
Sbjct  27   PRNFKLLSDPQLVKCGTRLYRYDGLMPGDPSYPTITPRDPRNPLIRIRARAVEPLMLLIP  86

Query  121  RFKIDSNYCGEPPPLEVTFCHLNDNIDKTFLSDMVQKFGAVEELIVYYHPVTNKHLGIAR  180
            RF IDS+Y G+PP +EVT  +LNDNIDK FL+ M+ K G  +E+ +Y+HP+TNKHLGIAR
Sbjct  87   RFVIDSDYVGQPPAVEVTIVNLNDNIDKQFLASMLDKCGTSDEINIYHHPITNKHLGIAR  146

Query  181  VVFETTKASKACVEKLNNTSVMGKVLKVFLDAFGEECKKIYDELT  225
            +VF++TK ++  VEK N  SVMGK+L VF D FG   KK  + LT
Sbjct  147  IVFDSTKGARQFVEKYNQKSVMGKILDVFCDPFGATLKKSLESLT  191


 Score = 119 bits (297),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 139/432 (32%), Positives = 193/432 (45%), Gaps = 82/432 (19%)

Query  431  TLDLDTRIAMLLKDKAGGMAPPFLQF-GSDSEDEKKSITADNEMLSEPPSPFLSHETYKS  489
            T+DLDTRIA++ K K  G APPFLQ   SDSE ++       E+ S+  S   + E  K 
Sbjct  518  TVDLDTRIALIFKGKTFGNAPPFLQMDSSDSETDQ----GKPEVFSDVNSDSNNSENKKR  573

Query  490  CFEKMRERNKERWKVHENSINQISVDEDLGSVISSSEDEALLGSYSPAPDEIEPEPPKEP  549
              EK                N++    +  S ISS  DE L+G    +   +  E  KE 
Sbjct  574  SCEKN---------------NKVLHQPNEASDISS--DEELIGKKDKSKLSLICE--KEV  614

Query  550  PPPPPPDDDRMSLSPLSSGDEKIEEVIAQTEPTSQLYPGAGYPGHLTHYSTSDMYHWPRP  609
                  +DD MSLS LSS ++ I           Q   GA Y   ++ Y    MY     
Sbjct  615  ------NDDNMSLSSLSSQEDPI-----------QTKEGAEYKSIMSSY----MY--SHS  651

Query  610  AQYPYPYGTTYLQSHYQPNTTSFSGTVGNHQGANYYPSFQSRLHAMANHNITK-----DN  664
             Q P+ Y  +    HY     S S +     GA  +  +   L A+A+ N        D 
Sbjct  652  NQNPFYYHASGY-GHYLSGIPSESASRLFSNGAYVHSEY---LKAVASFNFDSFSKPYDY  707

Query  665  PQGPT----------INGVLNRVVNELKQILKRDFNKKMIENTAFKLFEVWWDEKKSEKI  714
             +G            +  V+  +V ELKQILKRD NK+MIE TAFK FE WWDE  S+  
Sbjct  708  NKGALSDQNDGIRQKVKQVIGYIVEELKQILKRDVNKRMIEITAFKHFETWWDEHTSKAR  767

Query  715  QNQGGE------NTIINN-SNKEEGQKPQGLSLLLEQGTPLGFNYDGFGLGIRASMPKMP  767
                 E      NT +N   +    +K   ++LL+     +        +G+RA+MPK+P
Sbjct  768  SKPLFEKADSTVNTPLNCIKDTSYNEKNPDINLLINAHREVADFQSYSSIGLRAAMPKLP  827

Query  768  SFRRKIKAPSPLPQDEDSRQSDHGDTE--LIGSDSDLDLASVQ-------KVKRPVTSLP  818
            SFRR  K PSP+P   +  + D  D E  +  SDSD + ++V+       K+K PV    
Sbjct  828  SFRRIRKHPSPIPTKRNFLERDLSDQEEMVQRSDSDKEDSNVEISDTARSKIKGPVPIQE  887

Query  819  SVSSSSSSSSSS  830
            S S S +S  +S
Sbjct  888  SDSKSHTSGLNS  899


>SET2_CAEEL unnamed protein product
Length=1507

 Score = 256 bits (655),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 118/173 (68%), Positives = 137/173 (79%), Gaps = 1/173 (1%)

Query  1330  SREARSNQRRLLTAFGIDTDSDLLKFNQLKFRKKQLKFAKSGIHDWGLFAMEPIAADEMV  1389
             S++ R  QRRLLT+ G D ++D  K NQLKFRKK +KFA+S IH WGL+AME IA DEM+
Sbjct  1336  SKDMRLLQRRLLTSLG-DANNDFFKINQLKFRKKMIKFARSRIHGWGLYAMESIAPDEMI  1394

Query  1390  IEYVGQMIRPVVADLRESQYEATGIGSSYLFRIDLDTIIDATKCGNLARFINHSCNPNCY  1449
             +EY+GQ IR +VA+ RE  YE  GIGSSYLFRIDL  +IDATK GN ARFINHSC PNCY
Sbjct  1395  VEYIGQTIRSLVAEEREKAYERRGIGSSYLFRIDLHHVIDATKRGNFARFINHSCQPNCY  1454

Query  1450  AKVITIESQKKIVIYSKQPIGVNEEITYDYKFPLEDDKIPCLCGAPQCRGTLN  1502
             AKV+TIE +K+IVIYS+  I   EEITYDYKFP+EDDKI CLCGA  CRG LN
Sbjct  1455  AKVLTIEGEKRIVIYSRTIIKKGEEITYDYKFPIEDDKIDCLCGAKTCRGYLN  1507


 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/68 (37%), Positives = 38/68 (56%), Gaps = 0/68 (0%)

Query  122  FKIDSNYCGEPPPLEVTFCHLNDNIDKTFLSDMVQKFGAVEELIVYYHPVTNKHLGIARV  181
             ++DS YC  PP  EV+  +++DN  +  L D  +  G VE+  V  HP T +H+ +A V
Sbjct  113  LRVDSYYCTIPPKREVSLFNMDDNCTEVLLRDFAKDCGKVEKAYVCIHPETKRHMKMAYV  172

Query  182  VFETTKAS  189
             F T K +
Sbjct  173  KFATVKEA  180


>SET1_DICDI unnamed protein product
Length=1486

 Score = 233 bits (593),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 123/242 (51%), Positives = 160/242 (66%), Gaps = 14/242 (6%)

Query  1261  RLHTSGSARTEGYYKVDVREKAKHKHHYAQSIQRSNDVEDSNGPYAGSDGIMNGPKNNTK  1320
             R   +G AR+EGY + D+++  K K   A + +R      S+G  + S       +    
Sbjct  1259  RRSITGCARSEGYTRSDIQKLFKRKQ-VAPTGKRGAASSASSGSNSSSSSTAESFETG--  1315

Query  1321  ALTGKMQALSREARSNQRRLLTAFGIDTDSDLLKFNQLKFRKKQLKFAKSGIHDWGLFAM  1380
                G +   +R +R + R     FG    SD +    LK R+K++KF +S IHDWGLFAM
Sbjct  1316  ---GNLSKSARSSRFDNR----GFG----SDPITLASLKSRRKRIKFERSDIHDWGLFAM  1364

Query  1381  EPIAADEMVIEYVGQMIRPVVADLRESQYEATGIGSSYLFRIDLDTIIDATKCGNLARFI  1440
             E I+A +MVIEY+G++IR  VAD RE +Y   GIGSSYLFR+D DTIIDAT  GNLARFI
Sbjct  1365  ETISAKDMVIEYIGEVIRQKVADEREKRYVKKGIGSSYLFRVDDDTIIDATFKGNLARFI  1424

Query  1441  NHSCNPNCYAKVITIESQKKIVIYSKQPIGVNEEITYDYKFPLEDDKIPCLCGAPQCRGT  1500
             NH C+PNC AKV+TI +QKKI+IY+K+ I + EEITYDYKFP+ED KIPCLC +P+CR T
Sbjct  1425  NHCCDPNCIAKVLTIGNQKKIIIYAKRDINIGEEITYDYKFPIEDVKIPCLCKSPKCRQT  1484

Query  1501  LN  1502
             LN
Sbjct  1485  LN  1486



Lambda      K        H
   0.310    0.129    0.371 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 19813125786


Query= XP_050469372.1 histone-lysine N-methyltransferase SETD1 [Bombus
huntii]

Length=1502
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SET1_DROME  unnamed protein product                                   468     9e-139
SET2_CAEEL  unnamed protein product                                   256     6e-69 
SET1_DICDI  unnamed protein product                                   233     2e-61 


>SET1_DROME unnamed protein product
Length=1641

 Score = 468 bits (1203),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 253/440 (58%), Positives = 300/440 (68%), Gaps = 45/440 (10%)

Query  1087  SPKNSQASQVFMEHSYSLPPTQSEI----------TKSVIRTPS---------TPMKPVK  1127
             S + SQASQV +EH YSLPP    +          TK++++  +         T   P +
Sbjct  1223  SSQASQASQVALEHCYSLPPHSVSLGDYPSGKVNETKNILKREAENIAIVSQMTRTGPGR  1282

Query  1128  LKSSKIMKLSKSKDKIHKVEKRKYNKYTKIHAHQNHEGEKENIENEYVYEKYPKKVEEPL  1187
              +   I    K +D    +  R  N  +K+  + +   +  +    +V          P 
Sbjct  1283  PRKDPICIQKKKRD----LAPRMSNVKSKMTPNGDEWPDLAHKNVHFV----------PC  1328

Query  1188  VTYKERDLMSEMAILYEFLTRGIDAEDVEYLRRSYEALLADDSQGYWLNDTHWVDHPPTD  1247
               YK RD   EM ILY FLT+GIDAED+ +++ SY   L  +    +LN+THWVDH  TD
Sbjct  1329  DMYKTRDQNEEMVILYTFLTKGIDAEDINFIKMSYLDHLHKEPYAMFLNNTHWVDHCTTD  1388

Query  1248  I----PSPAKRRKRDELRLHTSGSARTEGYYKVDVREKAKHKHHYAQSIQRSNDVED-SN  1302
                  P   KRRK DEL  H +G ARTEG+YK+DVREKAKHK+HYA++    +  ED S+
Sbjct  1389  RAFWPPPSKKRRKDDELIRHKTGCARTEGFYKLDVREKAKHKYHYAKANTEDSFNEDRSD  1448

Query  1303  GPYAGSDGIMNGPKNNTKALTGKMQALSREARSNQRRLLTAFGIDTDSDLLKFNQLKFRK  1362
              P A ++   N        L  KMQ +SREARSNQRRLLTAFG   +S+LLKFNQLKFRK
Sbjct  1449  EPTALTNHHHN-------KLISKMQGISREARSNQRRLLTAFGSMGESELLKFNQLKFRK  1501

Query  1363  KQLKFAKSGIHDWGLFAMEPIAADEMVIEYVGQMIRPVVADLRESQYEATGIGSSYLFRI  1422
             KQLKFAKS IHDWGLFAMEPIAADEMVIEYVGQMIRPVVADLRE++YEA GIGSSYLFRI
Sbjct  1502  KQLKFAKSAIHDWGLFAMEPIAADEMVIEYVGQMIRPVVADLRETKYEAIGIGSSYLFRI  1561

Query  1423  DLDTIIDATKCGNLARFINHSCNPNCYAKVITIESQKKIVIYSKQPIGVNEEITYDYKFP  1482
             D++TIIDATKCGNLARFINHSCNPNCYAKVITIES+KKIVIYSKQPIG+NEEITYDYKFP
Sbjct  1562  DMETIIDATKCGNLARFINHSCNPNCYAKVITIESEKKIVIYSKQPIGINEEITYDYKFP  1621

Query  1483  LEDDKIPCLCGAPQCRGTLN  1502
             LED+KIPCLCGA  CRGTLN
Sbjct  1622  LEDEKIPCLCGAQGCRGTLN  1641


 Score = 212 bits (539),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 124/165 (75%), Gaps = 1/165 (1%)

Query  62   PRNYKLLVDPFLVKGATKLYRYDGMVPGDPTYPEVQPRDPRSQLTRIWTR-LEQLDLPVP  120
            PRN+KLL DP LVK  T+LYRYDG++PGDP+YP + PRDPR+ L RI  R +E L L +P
Sbjct  27   PRNFKLLSDPQLVKCGTRLYRYDGLMPGDPSYPTITPRDPRNPLIRIRARAVEPLMLLIP  86

Query  121  RFKIDSNYCGEPPPLEVTFCHLNDNIDKTFLSDMVQKFGAVEELIVYYHPVTNKHLGIAR  180
            RF IDS+Y G+PP +EVT  +LNDNIDK FL+ M+ K G  +E+ +Y+HP+TNKHLGIAR
Sbjct  87   RFVIDSDYVGQPPAVEVTIVNLNDNIDKQFLASMLDKCGTSDEINIYHHPITNKHLGIAR  146

Query  181  VVFETTKASKACVEKLNNTSVMGKVLKVFLDAFGEECKKIYDELT  225
            +VF++TK ++  VEK N  SVMGK+L VF D FG   KK  + LT
Sbjct  147  IVFDSTKGARQFVEKYNQKSVMGKILDVFCDPFGATLKKSLESLT  191


 Score = 119 bits (297),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 139/432 (32%), Positives = 193/432 (45%), Gaps = 82/432 (19%)

Query  431  TLDLDTRIAMLLKDKAGGMAPPFLQF-GSDSEDEKKSITADNEMLSEPPSPFLSHETYKS  489
            T+DLDTRIA++ K K  G APPFLQ   SDSE ++       E+ S+  S   + E  K 
Sbjct  518  TVDLDTRIALIFKGKTFGNAPPFLQMDSSDSETDQ----GKPEVFSDVNSDSNNSENKKR  573

Query  490  CFEKMRERNKERWKVHENSINQISVDEDLGSVISSSEDEALLGSYSPAPDEIEPEPPKEP  549
              EK                N++    +  S ISS  DE L+G    +   +  E  KE 
Sbjct  574  SCEKN---------------NKVLHQPNEASDISS--DEELIGKKDKSKLSLICE--KEV  614

Query  550  PPPPPPDDDRMSLSPLSSGDEKIEEVIAQTEPTSQLYPGAGYPGHLTHYSTSDMYHWPRP  609
                  +DD MSLS LSS ++ I           Q   GA Y   ++ Y    MY     
Sbjct  615  ------NDDNMSLSSLSSQEDPI-----------QTKEGAEYKSIMSSY----MY--SHS  651

Query  610  AQYPYPYGTTYLQSHYQPNTTSFSGTVGNHQGANYYPSFQSRLHAMANHNITK-----DN  664
             Q P+ Y  +    HY     S S +     GA  +  +   L A+A+ N        D 
Sbjct  652  NQNPFYYHASGY-GHYLSGIPSESASRLFSNGAYVHSEY---LKAVASFNFDSFSKPYDY  707

Query  665  PQGPT----------INGVLNRVVNELKQILKRDFNKKMIENTAFKLFEVWWDEKKSEKI  714
             +G            +  V+  +V ELKQILKRD NK+MIE TAFK FE WWDE  S+  
Sbjct  708  NKGALSDQNDGIRQKVKQVIGYIVEELKQILKRDVNKRMIEITAFKHFETWWDEHTSKAR  767

Query  715  QNQGGE------NTIINN-SNKEEGQKPQGLSLLLEQGTPLGFNYDGFGLGIRASMPKMP  767
                 E      NT +N   +    +K   ++LL+     +        +G+RA+MPK+P
Sbjct  768  SKPLFEKADSTVNTPLNCIKDTSYNEKNPDINLLINAHREVADFQSYSSIGLRAAMPKLP  827

Query  768  SFRRKIKAPSPLPQDEDSRQSDHGDTE--LIGSDSDLDLASVQ-------KVKRPVTSLP  818
            SFRR  K PSP+P   +  + D  D E  +  SDSD + ++V+       K+K PV    
Sbjct  828  SFRRIRKHPSPIPTKRNFLERDLSDQEEMVQRSDSDKEDSNVEISDTARSKIKGPVPIQE  887

Query  819  SVSSSSSSSSSS  830
            S S S +S  +S
Sbjct  888  SDSKSHTSGLNS  899


>SET2_CAEEL unnamed protein product
Length=1507

 Score = 256 bits (655),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 118/173 (68%), Positives = 137/173 (79%), Gaps = 1/173 (1%)

Query  1330  SREARSNQRRLLTAFGIDTDSDLLKFNQLKFRKKQLKFAKSGIHDWGLFAMEPIAADEMV  1389
             S++ R  QRRLLT+ G D ++D  K NQLKFRKK +KFA+S IH WGL+AME IA DEM+
Sbjct  1336  SKDMRLLQRRLLTSLG-DANNDFFKINQLKFRKKMIKFARSRIHGWGLYAMESIAPDEMI  1394

Query  1390  IEYVGQMIRPVVADLRESQYEATGIGSSYLFRIDLDTIIDATKCGNLARFINHSCNPNCY  1449
             +EY+GQ IR +VA+ RE  YE  GIGSSYLFRIDL  +IDATK GN ARFINHSC PNCY
Sbjct  1395  VEYIGQTIRSLVAEEREKAYERRGIGSSYLFRIDLHHVIDATKRGNFARFINHSCQPNCY  1454

Query  1450  AKVITIESQKKIVIYSKQPIGVNEEITYDYKFPLEDDKIPCLCGAPQCRGTLN  1502
             AKV+TIE +K+IVIYS+  I   EEITYDYKFP+EDDKI CLCGA  CRG LN
Sbjct  1455  AKVLTIEGEKRIVIYSRTIIKKGEEITYDYKFPIEDDKIDCLCGAKTCRGYLN  1507


 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/68 (37%), Positives = 38/68 (56%), Gaps = 0/68 (0%)

Query  122  FKIDSNYCGEPPPLEVTFCHLNDNIDKTFLSDMVQKFGAVEELIVYYHPVTNKHLGIARV  181
             ++DS YC  PP  EV+  +++DN  +  L D  +  G VE+  V  HP T +H+ +A V
Sbjct  113  LRVDSYYCTIPPKREVSLFNMDDNCTEVLLRDFAKDCGKVEKAYVCIHPETKRHMKMAYV  172

Query  182  VFETTKAS  189
             F T K +
Sbjct  173  KFATVKEA  180


>SET1_DICDI unnamed protein product
Length=1486

 Score = 233 bits (593),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 123/242 (51%), Positives = 160/242 (66%), Gaps = 14/242 (6%)

Query  1261  RLHTSGSARTEGYYKVDVREKAKHKHHYAQSIQRSNDVEDSNGPYAGSDGIMNGPKNNTK  1320
             R   +G AR+EGY + D+++  K K   A + +R      S+G  + S       +    
Sbjct  1259  RRSITGCARSEGYTRSDIQKLFKRKQ-VAPTGKRGAASSASSGSNSSSSSTAESFETG--  1315

Query  1321  ALTGKMQALSREARSNQRRLLTAFGIDTDSDLLKFNQLKFRKKQLKFAKSGIHDWGLFAM  1380
                G +   +R +R + R     FG    SD +    LK R+K++KF +S IHDWGLFAM
Sbjct  1316  ---GNLSKSARSSRFDNR----GFG----SDPITLASLKSRRKRIKFERSDIHDWGLFAM  1364

Query  1381  EPIAADEMVIEYVGQMIRPVVADLRESQYEATGIGSSYLFRIDLDTIIDATKCGNLARFI  1440
             E I+A +MVIEY+G++IR  VAD RE +Y   GIGSSYLFR+D DTIIDAT  GNLARFI
Sbjct  1365  ETISAKDMVIEYIGEVIRQKVADEREKRYVKKGIGSSYLFRVDDDTIIDATFKGNLARFI  1424

Query  1441  NHSCNPNCYAKVITIESQKKIVIYSKQPIGVNEEITYDYKFPLEDDKIPCLCGAPQCRGT  1500
             NH C+PNC AKV+TI +QKKI+IY+K+ I + EEITYDYKFP+ED KIPCLC +P+CR T
Sbjct  1425  NHCCDPNCIAKVLTIGNQKKIIIYAKRDINIGEEITYDYKFPIEDVKIPCLCKSPKCRQT  1484

Query  1501  LN  1502
             LN
Sbjct  1485  LN  1486



Lambda      K        H
   0.310    0.129    0.371 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 19813125786


Query= XP_050469373.1 histone-lysine N-methyltransferase SETD1 [Bombus
huntii]

Length=1502
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SET1_DROME  unnamed protein product                                   468     9e-139
SET2_CAEEL  unnamed protein product                                   256     6e-69 
SET1_DICDI  unnamed protein product                                   233     2e-61 


>SET1_DROME unnamed protein product
Length=1641

 Score = 468 bits (1203),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 253/440 (58%), Positives = 300/440 (68%), Gaps = 45/440 (10%)

Query  1087  SPKNSQASQVFMEHSYSLPPTQSEI----------TKSVIRTPS---------TPMKPVK  1127
             S + SQASQV +EH YSLPP    +          TK++++  +         T   P +
Sbjct  1223  SSQASQASQVALEHCYSLPPHSVSLGDYPSGKVNETKNILKREAENIAIVSQMTRTGPGR  1282

Query  1128  LKSSKIMKLSKSKDKIHKVEKRKYNKYTKIHAHQNHEGEKENIENEYVYEKYPKKVEEPL  1187
              +   I    K +D    +  R  N  +K+  + +   +  +    +V          P 
Sbjct  1283  PRKDPICIQKKKRD----LAPRMSNVKSKMTPNGDEWPDLAHKNVHFV----------PC  1328

Query  1188  VTYKERDLMSEMAILYEFLTRGIDAEDVEYLRRSYEALLADDSQGYWLNDTHWVDHPPTD  1247
               YK RD   EM ILY FLT+GIDAED+ +++ SY   L  +    +LN+THWVDH  TD
Sbjct  1329  DMYKTRDQNEEMVILYTFLTKGIDAEDINFIKMSYLDHLHKEPYAMFLNNTHWVDHCTTD  1388

Query  1248  I----PSPAKRRKRDELRLHTSGSARTEGYYKVDVREKAKHKHHYAQSIQRSNDVED-SN  1302
                  P   KRRK DEL  H +G ARTEG+YK+DVREKAKHK+HYA++    +  ED S+
Sbjct  1389  RAFWPPPSKKRRKDDELIRHKTGCARTEGFYKLDVREKAKHKYHYAKANTEDSFNEDRSD  1448

Query  1303  GPYAGSDGIMNGPKNNTKALTGKMQALSREARSNQRRLLTAFGIDTDSDLLKFNQLKFRK  1362
              P A ++   N        L  KMQ +SREARSNQRRLLTAFG   +S+LLKFNQLKFRK
Sbjct  1449  EPTALTNHHHN-------KLISKMQGISREARSNQRRLLTAFGSMGESELLKFNQLKFRK  1501

Query  1363  KQLKFAKSGIHDWGLFAMEPIAADEMVIEYVGQMIRPVVADLRESQYEATGIGSSYLFRI  1422
             KQLKFAKS IHDWGLFAMEPIAADEMVIEYVGQMIRPVVADLRE++YEA GIGSSYLFRI
Sbjct  1502  KQLKFAKSAIHDWGLFAMEPIAADEMVIEYVGQMIRPVVADLRETKYEAIGIGSSYLFRI  1561

Query  1423  DLDTIIDATKCGNLARFINHSCNPNCYAKVITIESQKKIVIYSKQPIGVNEEITYDYKFP  1482
             D++TIIDATKCGNLARFINHSCNPNCYAKVITIES+KKIVIYSKQPIG+NEEITYDYKFP
Sbjct  1562  DMETIIDATKCGNLARFINHSCNPNCYAKVITIESEKKIVIYSKQPIGINEEITYDYKFP  1621

Query  1483  LEDDKIPCLCGAPQCRGTLN  1502
             LED+KIPCLCGA  CRGTLN
Sbjct  1622  LEDEKIPCLCGAQGCRGTLN  1641


 Score = 212 bits (539),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 124/165 (75%), Gaps = 1/165 (1%)

Query  62   PRNYKLLVDPFLVKGATKLYRYDGMVPGDPTYPEVQPRDPRSQLTRIWTR-LEQLDLPVP  120
            PRN+KLL DP LVK  T+LYRYDG++PGDP+YP + PRDPR+ L RI  R +E L L +P
Sbjct  27   PRNFKLLSDPQLVKCGTRLYRYDGLMPGDPSYPTITPRDPRNPLIRIRARAVEPLMLLIP  86

Query  121  RFKIDSNYCGEPPPLEVTFCHLNDNIDKTFLSDMVQKFGAVEELIVYYHPVTNKHLGIAR  180
            RF IDS+Y G+PP +EVT  +LNDNIDK FL+ M+ K G  +E+ +Y+HP+TNKHLGIAR
Sbjct  87   RFVIDSDYVGQPPAVEVTIVNLNDNIDKQFLASMLDKCGTSDEINIYHHPITNKHLGIAR  146

Query  181  VVFETTKASKACVEKLNNTSVMGKVLKVFLDAFGEECKKIYDELT  225
            +VF++TK ++  VEK N  SVMGK+L VF D FG   KK  + LT
Sbjct  147  IVFDSTKGARQFVEKYNQKSVMGKILDVFCDPFGATLKKSLESLT  191


 Score = 119 bits (297),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 139/432 (32%), Positives = 193/432 (45%), Gaps = 82/432 (19%)

Query  431  TLDLDTRIAMLLKDKAGGMAPPFLQF-GSDSEDEKKSITADNEMLSEPPSPFLSHETYKS  489
            T+DLDTRIA++ K K  G APPFLQ   SDSE ++       E+ S+  S   + E  K 
Sbjct  518  TVDLDTRIALIFKGKTFGNAPPFLQMDSSDSETDQ----GKPEVFSDVNSDSNNSENKKR  573

Query  490  CFEKMRERNKERWKVHENSINQISVDEDLGSVISSSEDEALLGSYSPAPDEIEPEPPKEP  549
              EK                N++    +  S ISS  DE L+G    +   +  E  KE 
Sbjct  574  SCEKN---------------NKVLHQPNEASDISS--DEELIGKKDKSKLSLICE--KEV  614

Query  550  PPPPPPDDDRMSLSPLSSGDEKIEEVIAQTEPTSQLYPGAGYPGHLTHYSTSDMYHWPRP  609
                  +DD MSLS LSS ++ I           Q   GA Y   ++ Y    MY     
Sbjct  615  ------NDDNMSLSSLSSQEDPI-----------QTKEGAEYKSIMSSY----MY--SHS  651

Query  610  AQYPYPYGTTYLQSHYQPNTTSFSGTVGNHQGANYYPSFQSRLHAMANHNITK-----DN  664
             Q P+ Y  +    HY     S S +     GA  +  +   L A+A+ N        D 
Sbjct  652  NQNPFYYHASGY-GHYLSGIPSESASRLFSNGAYVHSEY---LKAVASFNFDSFSKPYDY  707

Query  665  PQGPT----------INGVLNRVVNELKQILKRDFNKKMIENTAFKLFEVWWDEKKSEKI  714
             +G            +  V+  +V ELKQILKRD NK+MIE TAFK FE WWDE  S+  
Sbjct  708  NKGALSDQNDGIRQKVKQVIGYIVEELKQILKRDVNKRMIEITAFKHFETWWDEHTSKAR  767

Query  715  QNQGGE------NTIINN-SNKEEGQKPQGLSLLLEQGTPLGFNYDGFGLGIRASMPKMP  767
                 E      NT +N   +    +K   ++LL+     +        +G+RA+MPK+P
Sbjct  768  SKPLFEKADSTVNTPLNCIKDTSYNEKNPDINLLINAHREVADFQSYSSIGLRAAMPKLP  827

Query  768  SFRRKIKAPSPLPQDEDSRQSDHGDTE--LIGSDSDLDLASVQ-------KVKRPVTSLP  818
            SFRR  K PSP+P   +  + D  D E  +  SDSD + ++V+       K+K PV    
Sbjct  828  SFRRIRKHPSPIPTKRNFLERDLSDQEEMVQRSDSDKEDSNVEISDTARSKIKGPVPIQE  887

Query  819  SVSSSSSSSSSS  830
            S S S +S  +S
Sbjct  888  SDSKSHTSGLNS  899


>SET2_CAEEL unnamed protein product
Length=1507

 Score = 256 bits (655),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 118/173 (68%), Positives = 137/173 (79%), Gaps = 1/173 (1%)

Query  1330  SREARSNQRRLLTAFGIDTDSDLLKFNQLKFRKKQLKFAKSGIHDWGLFAMEPIAADEMV  1389
             S++ R  QRRLLT+ G D ++D  K NQLKFRKK +KFA+S IH WGL+AME IA DEM+
Sbjct  1336  SKDMRLLQRRLLTSLG-DANNDFFKINQLKFRKKMIKFARSRIHGWGLYAMESIAPDEMI  1394

Query  1390  IEYVGQMIRPVVADLRESQYEATGIGSSYLFRIDLDTIIDATKCGNLARFINHSCNPNCY  1449
             +EY+GQ IR +VA+ RE  YE  GIGSSYLFRIDL  +IDATK GN ARFINHSC PNCY
Sbjct  1395  VEYIGQTIRSLVAEEREKAYERRGIGSSYLFRIDLHHVIDATKRGNFARFINHSCQPNCY  1454

Query  1450  AKVITIESQKKIVIYSKQPIGVNEEITYDYKFPLEDDKIPCLCGAPQCRGTLN  1502
             AKV+TIE +K+IVIYS+  I   EEITYDYKFP+EDDKI CLCGA  CRG LN
Sbjct  1455  AKVLTIEGEKRIVIYSRTIIKKGEEITYDYKFPIEDDKIDCLCGAKTCRGYLN  1507


 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/68 (37%), Positives = 38/68 (56%), Gaps = 0/68 (0%)

Query  122  FKIDSNYCGEPPPLEVTFCHLNDNIDKTFLSDMVQKFGAVEELIVYYHPVTNKHLGIARV  181
             ++DS YC  PP  EV+  +++DN  +  L D  +  G VE+  V  HP T +H+ +A V
Sbjct  113  LRVDSYYCTIPPKREVSLFNMDDNCTEVLLRDFAKDCGKVEKAYVCIHPETKRHMKMAYV  172

Query  182  VFETTKAS  189
             F T K +
Sbjct  173  KFATVKEA  180


>SET1_DICDI unnamed protein product
Length=1486

 Score = 233 bits (593),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 123/242 (51%), Positives = 160/242 (66%), Gaps = 14/242 (6%)

Query  1261  RLHTSGSARTEGYYKVDVREKAKHKHHYAQSIQRSNDVEDSNGPYAGSDGIMNGPKNNTK  1320
             R   +G AR+EGY + D+++  K K   A + +R      S+G  + S       +    
Sbjct  1259  RRSITGCARSEGYTRSDIQKLFKRKQ-VAPTGKRGAASSASSGSNSSSSSTAESFETG--  1315

Query  1321  ALTGKMQALSREARSNQRRLLTAFGIDTDSDLLKFNQLKFRKKQLKFAKSGIHDWGLFAM  1380
                G +   +R +R + R     FG    SD +    LK R+K++KF +S IHDWGLFAM
Sbjct  1316  ---GNLSKSARSSRFDNR----GFG----SDPITLASLKSRRKRIKFERSDIHDWGLFAM  1364

Query  1381  EPIAADEMVIEYVGQMIRPVVADLRESQYEATGIGSSYLFRIDLDTIIDATKCGNLARFI  1440
             E I+A +MVIEY+G++IR  VAD RE +Y   GIGSSYLFR+D DTIIDAT  GNLARFI
Sbjct  1365  ETISAKDMVIEYIGEVIRQKVADEREKRYVKKGIGSSYLFRVDDDTIIDATFKGNLARFI  1424

Query  1441  NHSCNPNCYAKVITIESQKKIVIYSKQPIGVNEEITYDYKFPLEDDKIPCLCGAPQCRGT  1500
             NH C+PNC AKV+TI +QKKI+IY+K+ I + EEITYDYKFP+ED KIPCLC +P+CR T
Sbjct  1425  NHCCDPNCIAKVLTIGNQKKIIIYAKRDINIGEEITYDYKFPIEDVKIPCLCKSPKCRQT  1484

Query  1501  LN  1502
             LN
Sbjct  1485  LN  1486



Lambda      K        H
   0.310    0.129    0.371 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 19813125786


Query= XP_050469374.1 rabankyrin-5 isoform X1 [Bombus huntii]

Length=1123
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A8Y582_DROME  unnamed protein product                                 998     0.0  
Q7PLP5_DROME  unnamed protein product                                 998     0.0  
Q7PLP4_DROME  unnamed protein product                                 996     0.0  


>A8Y582_DROME unnamed protein product
Length=1122

 Score = 998 bits (2580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 533/1134 (47%), Positives = 747/1134 (66%), Gaps = 48/1134 (4%)

Query  9     KWQQHLSLLREQYVNLYNTNTELQREYAIVTANKQD-----TGFIGRLLTTIGSLYSQQR  63
             K ++ L++  ++Y  L     ELQR+Y    A+ ++     + F+ RL  T+ SL+ +  
Sbjct  11    KMEKILAVQSDEYTKLQRCYVELQRKYNENIASSENEESGLSSFLSRLSLTVASLFDKNT  70

Query  64    YSDVIIKLKNQEIPAHKFILSARTDFFSEATLSEVTILDWTYLEPKIGLILLKWIYTGKV  123
             Y+D+ I+ + +  PAHK +L AR++ +    LS +  LDW+ L   + L LL+WIYT  +
Sbjct  71    YADIYIRSQTRVFPAHKIVLHARSEKWGNDLLSNIQQLDWSDLNEDVVLSLLRWIYTDLI  130

Query  124   PQEN--LTLELMKAASNFQLTELVEQCEKYLIGIVGFKDCVQLYAAAEELGAQKLKEHCS  181
               +N  L L+L+KAA  F L  L+  CE+ L+  VG + C++ Y  AEE+GA  L E+CS
Sbjct  131   DLQNDGLALDLLKAAHRFGLPSLLGICERALVTSVGVRSCIRFYCVAEEVGASTLLEYCS  190

Query  182   SLISAHWEDLTGEDFKEMPGSLLYKLLQTKSKYPLHAAVRLMREDVVFLYLVENNSGLTK  241
             S+IS HW+DLT +DF+ M G LL+++L+TK+K+PLHAAVRL+REDVV L + +  + L  
Sbjct  191   SIISTHWDDLTTDDFQHMSGPLLFEMLKTKTKHPLHAAVRLLREDVVSLCIQKYGNSL--  248

Query  242   AINALDHKGEMPLEVALKTRQPSLARTLVEHG-ADLSAKDSRGLSLLQAAIFKGDSYSAE  300
              +N     G +PLE+AL ++   +A++LV++G A+++A +  G SLL++A+  GD++SA 
Sbjct  249   -VNTFSENGILPLEMALSSKNAKIAKSLVDNGMANINAVNMEGFSLLKSALKNGDAFSAN  307

Query  301   FVIEQLENNGNMKELCEPMKLTRNVKDIKNPEELEGCTALHLITKHNSEN---MLTVASR  357
             F+++Q                   + D+  P +    TALH+I  +  +N   ++ V  +
Sbjct  308   FLLDQ-----------------NCLLDL--PSKPSSDTALHIICNYGPDNTPEIMEVVKK  348

Query  358   LLHAGIDPNLQNHRGWTALHNCIQERNEPLFDVLLECQSIDLDKSTNENDTPLCIAMKTD  417
             +L   ++ N+QN +G T LH  I  RN  +  +LL+  +ID++  T +    L +++   
Sbjct  349   ILQRQLNINIQNIKGETPLHIAIARRNVEMVKLLLKVPNIDINLRTYDEKCALELSLSMG  408

Query  418   PFSGFFAKKLLIKGATPNPVYKNTGDTLLHV--LIREYKEEAALFLIDYCKDNLMQKNND  475
                   A  LL  GA  +     TGD+LL V  L R   E++A+FL D+   +L   N  
Sbjct  409   DHEFLIASILLSMGARTDRTNSKTGDSLLQVFALDRHRGEKSAIFLADFA--DLDHINFR  466

Query  476   GYLVLHEACKVGSKNLTRALLKTGFPVNEVALSTG-DAPIHIAVSNLYFDIVMELLHAPN  534
             G   LH A      NL + L+  G   N   +  G  + +HIAV     D +   +   N
Sbjct  467   GLTALHIAALNNMPNLVKKLIVNGASSNLKHIDCGLKSALHIAVEANAIDALEAFVELKN  526

Query  535   SNSQLNLK-NNVN-ETPLSLAIKAPFKKGKDIVLALIKAGANINQCNNDGLTLLHQAILK  592
              +  ++    ++N ++PLSL +     K   +V  LI+ G+++N  N + L+ LHQ+I  
Sbjct  527   KSHDIDFNCQDINGDSPLSLCLSL---KRTTLVPTLIRGGSDVNGKNKNNLSPLHQSIKN  583

Query  593   EDSATAIFLLENGADMNTRTADGETPLQLSIHCRLGEVVEALCKRGVDTSIG----CPLW  648
             EDS  ++FLLE GAD+   T + ++ L LSI   L EVV+ALC+RG+  SI      PLW
Sbjct  584   EDSDISLFLLEQGADITALTENLDSALDLSIKHDLSEVVDALCRRGIALSINKNGESPLW  643

Query  649   DALDSDQEDVASILVKYGADTDCWGPGPDDCQQTLLHRAIDHNKEDIAQFLIRSGCDLNI  708
              AL+   EDVA ILV++G DTDCW  GP+ C+QTLLHRAID NKE +A FLI+S CDL+ 
Sbjct  644   SALEKGYEDVAKILVRHGIDTDCWDEGPEGCRQTLLHRAIDENKESVAIFLIQSQCDLDS  703

Query  709   PRKPGPDGIGGDEARDECTPLHLCCQWGLEQVVQTLIEHGADVNARDVEGKTPVHVAIQN  768
              R+PGP+G GGDEA+D+ +PLHLCC WG  +V+QTLI+HGA+VN  D E K+P+HVAI++
Sbjct  704   SRQPGPNGEGGDEAQDKASPLHLCCHWGQTKVLQTLIDHGANVNLIDAESKSPLHVAIES  763

Query  769   QHSQIISLLLCHPNIDLNKRDKKGLTPFATALTFRNNKAAQAILERLPKAAEQYDNKGRN  828
             Q+ +IIS+LLCHP+IDL  RDK G TPFATAL FRN+ AAQ IL+R P AAEQ D +GRN
Sbjct  764   QYDEIISILLCHPDIDLKLRDKSGNTPFATALDFRNHNAAQRILDRFPTAAEQMDIRGRN  823

Query  829   FLHTAIQKNDMESILFLLSIQVDVNSRVHDVTQTPPLHLAAVSGNEMLVRSLILAGARVN  888
             FLH AI K+D+ES+LFLL+IQVDVNSRVHD  Q+ PLHLAA S NEM+ R+LILAGAR+N
Sbjct  824   FLHLAILKDDLESVLFLLAIQVDVNSRVHDANQSSPLHLAAASQNEMITRNLILAGARMN  883

Query  889   DTDANRNTALHAAAKAGHAAIVSALLQNNINFDAVNADGDNALHVAVREGHVSVVRALLT  948
             + DA +   LH A + G+   VSAL+QNN ++DA +ADG+NALH+AVR     +VR LLT
Sbjct  884   ERDAVQKLPLHIAIERGNLPAVSALIQNNADYDATDADGNNALHIAVRCAQFFIVRELLT  943

Query  949   ECTLDAEAVNLKGRNPLHELARCGKDN-AATICELFLECMSQYPVNNADLDGNTPLLIAY  1007
             E  ++AEA NLKGRNPLHEL R  +D+ A  ICELFLE M +YP+N  D+DGNTPLL+++
Sbjct  944   ESRVNAEATNLKGRNPLHELCRVVEDSTAGLICELFLESMPKYPINIPDMDGNTPLLLSF  1003

Query  1008  MKGNGQLCRTLVKAGACLGSMNKEGITIFNYQVATKQLLYRLLDSLTQEAPWADKDLCLE  1067
             M+G   LC+ LVKAGACLG+ NK+GI IFN+++AT QLL+ LLD L QE+PWA+ D C  
Sbjct  1004  MRGQSPLCKILVKAGACLGTENKDGINIFNFKLATDQLLHNLLDQLPQESPWAESDYCQH  1063

Query  1068  CGTKFSLTMRKHHCRHCGRILCNKCSDQDVPIVKFGLNKPVRVCAVCFDVLQLG  1121
             C  +F++TMRKHHCRHCGR+LC+KCS  DVPI+KFG+NKPVRVC VCF+VLQ G
Sbjct  1064  CTNRFTITMRKHHCRHCGRVLCSKCSCNDVPILKFGINKPVRVCTVCFNVLQCG  1117


>Q7PLP5_DROME unnamed protein product
Length=1124

 Score = 998 bits (2579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 533/1134 (47%), Positives = 747/1134 (66%), Gaps = 48/1134 (4%)

Query  9     KWQQHLSLLREQYVNLYNTNTELQREYAIVTANKQD-----TGFIGRLLTTIGSLYSQQR  63
             K ++ L++  ++Y  L     ELQR+Y    A+ ++     + F+ RL  T+ SL+ +  
Sbjct  13    KMEKILAVQSDEYTKLQRCYVELQRKYNENIASSENEESGLSSFLSRLSLTVASLFDKNT  72

Query  64    YSDVIIKLKNQEIPAHKFILSARTDFFSEATLSEVTILDWTYLEPKIGLILLKWIYTGKV  123
             Y+D+ I+ + +  PAHK +L AR++ +    LS +  LDW+ L   + L LL+WIYT  +
Sbjct  73    YADIYIRSQTRVFPAHKIVLHARSEKWGNDLLSNIQQLDWSDLNEDVVLSLLRWIYTDLI  132

Query  124   PQEN--LTLELMKAASNFQLTELVEQCEKYLIGIVGFKDCVQLYAAAEELGAQKLKEHCS  181
               +N  L L+L+KAA  F L  L+  CE+ L+  VG + C++ Y  AEE+GA  L E+CS
Sbjct  133   DLQNDGLALDLLKAAHRFGLPSLLGICERALVTSVGVRSCIRFYCVAEEVGASTLLEYCS  192

Query  182   SLISAHWEDLTGEDFKEMPGSLLYKLLQTKSKYPLHAAVRLMREDVVFLYLVENNSGLTK  241
             S+IS HW+DLT +DF+ M G LL+++L+TK+K+PLHAAVRL+REDVV L + +  + L  
Sbjct  193   SIISTHWDDLTTDDFQHMSGPLLFEMLKTKTKHPLHAAVRLLREDVVSLCIQKYGNSL--  250

Query  242   AINALDHKGEMPLEVALKTRQPSLARTLVEHG-ADLSAKDSRGLSLLQAAIFKGDSYSAE  300
              +N     G +PLE+AL ++   +A++LV++G A+++A +  G SLL++A+  GD++SA 
Sbjct  251   -VNTFSENGILPLEMALSSKNAKIAKSLVDNGMANINAVNMEGFSLLKSALKNGDAFSAN  309

Query  301   FVIEQLENNGNMKELCEPMKLTRNVKDIKNPEELEGCTALHLITKHNSEN---MLTVASR  357
             F+++Q                   + D+  P +    TALH+I  +  +N   ++ V  +
Sbjct  310   FLLDQ-----------------NCLLDL--PSKPSSDTALHIICNYGPDNTPEIMEVVKK  350

Query  358   LLHAGIDPNLQNHRGWTALHNCIQERNEPLFDVLLECQSIDLDKSTNENDTPLCIAMKTD  417
             +L   ++ N+QN +G T LH  I  RN  +  +LL+  +ID++  T +    L +++   
Sbjct  351   ILQRQLNINIQNIKGETPLHIAIARRNVEMVKLLLKVPNIDINLRTYDEKCALELSLSMG  410

Query  418   PFSGFFAKKLLIKGATPNPVYKNTGDTLLHV--LIREYKEEAALFLIDYCKDNLMQKNND  475
                   A  LL  GA  +     TGD+LL V  L R   E++A+FL D+   +L   N  
Sbjct  411   DHEFLIASILLSMGARTDRTNSKTGDSLLQVFALDRHRGEKSAIFLADFA--DLDHINFR  468

Query  476   GYLVLHEACKVGSKNLTRALLKTGFPVNEVALSTG-DAPIHIAVSNLYFDIVMELLHAPN  534
             G   LH A      NL + L+  G   N   +  G  + +HIAV     D +   +   N
Sbjct  469   GLTALHIAALNNMPNLVKKLIVNGASSNLKHIDCGLKSALHIAVEANAIDALEAFVELKN  528

Query  535   SNSQLNLK-NNVN-ETPLSLAIKAPFKKGKDIVLALIKAGANINQCNNDGLTLLHQAILK  592
              +  ++    ++N ++PLSL +     K   +V  LI+ G+++N  N + L+ LHQ+I  
Sbjct  529   KSHDIDFNCQDINGDSPLSLCLSL---KRTTLVPTLIRGGSDVNGKNKNNLSPLHQSIKN  585

Query  593   EDSATAIFLLENGADMNTRTADGETPLQLSIHCRLGEVVEALCKRGVDTSIG----CPLW  648
             EDS  ++FLLE GAD+   T + ++ L LSI   L EVV+ALC+RG+  SI      PLW
Sbjct  586   EDSDISLFLLEQGADITALTENLDSALDLSIKHDLSEVVDALCRRGIALSINKNGESPLW  645

Query  649   DALDSDQEDVASILVKYGADTDCWGPGPDDCQQTLLHRAIDHNKEDIAQFLIRSGCDLNI  708
              AL+   EDVA ILV++G DTDCW  GP+ C+QTLLHRAID NKE +A FLI+S CDL+ 
Sbjct  646   SALEKGYEDVAKILVRHGIDTDCWDEGPEGCRQTLLHRAIDENKESVAIFLIQSQCDLDS  705

Query  709   PRKPGPDGIGGDEARDECTPLHLCCQWGLEQVVQTLIEHGADVNARDVEGKTPVHVAIQN  768
              R+PGP+G GGDEA+D+ +PLHLCC WG  +V+QTLI+HGA+VN  D E K+P+HVAI++
Sbjct  706   SRQPGPNGEGGDEAQDKASPLHLCCHWGQTKVLQTLIDHGANVNLIDAESKSPLHVAIES  765

Query  769   QHSQIISLLLCHPNIDLNKRDKKGLTPFATALTFRNNKAAQAILERLPKAAEQYDNKGRN  828
             Q+ +IIS+LLCHP+IDL  RDK G TPFATAL FRN+ AAQ IL+R P AAEQ D +GRN
Sbjct  766   QYDEIISILLCHPDIDLKLRDKSGNTPFATALDFRNHNAAQRILDRFPTAAEQMDIRGRN  825

Query  829   FLHTAIQKNDMESILFLLSIQVDVNSRVHDVTQTPPLHLAAVSGNEMLVRSLILAGARVN  888
             FLH AI K+D+ES+LFLL+IQVDVNSRVHD  Q+ PLHLAA S NEM+ R+LILAGAR+N
Sbjct  826   FLHLAILKDDLESVLFLLAIQVDVNSRVHDANQSSPLHLAAASQNEMITRNLILAGARMN  885

Query  889   DTDANRNTALHAAAKAGHAAIVSALLQNNINFDAVNADGDNALHVAVREGHVSVVRALLT  948
             + DA +   LH A + G+   VSAL+QNN ++DA +ADG+NALH+AVR     +VR LLT
Sbjct  886   ERDAVQKLPLHIAIERGNLPAVSALIQNNADYDATDADGNNALHIAVRCAQFFIVRELLT  945

Query  949   ECTLDAEAVNLKGRNPLHELARCGKDN-AATICELFLECMSQYPVNNADLDGNTPLLIAY  1007
             E  ++AEA NLKGRNPLHEL R  +D+ A  ICELFLE M +YP+N  D+DGNTPLL+++
Sbjct  946   ESRVNAEATNLKGRNPLHELCRVVEDSTAGLICELFLESMPKYPINIPDMDGNTPLLLSF  1005

Query  1008  MKGNGQLCRTLVKAGACLGSMNKEGITIFNYQVATKQLLYRLLDSLTQEAPWADKDLCLE  1067
             M+G   LC+ LVKAGACLG+ NK+GI IFN+++AT QLL+ LLD L QE+PWA+ D C  
Sbjct  1006  MRGQSPLCKILVKAGACLGTENKDGINIFNFKLATDQLLHNLLDQLPQESPWAESDYCQH  1065

Query  1068  CGTKFSLTMRKHHCRHCGRILCNKCSDQDVPIVKFGLNKPVRVCAVCFDVLQLG  1121
             C  +F++TMRKHHCRHCGR+LC+KCS  DVPI+KFG+NKPVRVC VCF+VLQ G
Sbjct  1066  CTNRFTITMRKHHCRHCGRVLCSKCSCNDVPILKFGINKPVRVCTVCFNVLQCG  1119


>Q7PLP4_DROME unnamed protein product
Length=1111

 Score = 996 bits (2575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 532/1129 (47%), Positives = 744/1129 (66%), Gaps = 48/1129 (4%)

Query  14    LSLLREQYVNLYNTNTELQREYAIVTANKQD-----TGFIGRLLTTIGSLYSQQRYSDVI  68
             L++  ++Y  L     ELQR+Y    A+ ++     + F+ RL  T+ SL+ +  Y+D+ 
Sbjct  5     LAVQSDEYTKLQRCYVELQRKYNENIASSENEESGLSSFLSRLSLTVASLFDKNTYADIY  64

Query  69    IKLKNQEIPAHKFILSARTDFFSEATLSEVTILDWTYLEPKIGLILLKWIYTGKVPQEN-  127
             I+ + +  PAHK +L AR++ +    LS +  LDW+ L   + L LL+WIYT  +  +N 
Sbjct  65    IRSQTRVFPAHKIVLHARSEKWGNDLLSNIQQLDWSDLNEDVVLSLLRWIYTDLIDLQND  124

Query  128   -LTLELMKAASNFQLTELVEQCEKYLIGIVGFKDCVQLYAAAEELGAQKLKEHCSSLISA  186
              L L+L+KAA  F L  L+  CE+ L+  VG + C++ Y  AEE+GA  L E+CSS+IS 
Sbjct  125   GLALDLLKAAHRFGLPSLLGICERALVTSVGVRSCIRFYCVAEEVGASTLLEYCSSIIST  184

Query  187   HWEDLTGEDFKEMPGSLLYKLLQTKSKYPLHAAVRLMREDVVFLYLVENNSGLTKAINAL  246
             HW+DLT +DF+ M G LL+++L+TK+K+PLHAAVRL+REDVV L + +  + L   +N  
Sbjct  185   HWDDLTTDDFQHMSGPLLFEMLKTKTKHPLHAAVRLLREDVVSLCIQKYGNSL---VNTF  241

Query  247   DHKGEMPLEVALKTRQPSLARTLVEHG-ADLSAKDSRGLSLLQAAIFKGDSYSAEFVIEQ  305
                G +PLE+AL ++   +A++LV++G A+++A +  G SLL++A+  GD++SA F+++Q
Sbjct  242   SENGILPLEMALSSKNAKIAKSLVDNGMANINAVNMEGFSLLKSALKNGDAFSANFLLDQ  301

Query  306   LENNGNMKELCEPMKLTRNVKDIKNPEELEGCTALHLITKHNSEN---MLTVASRLLHAG  362
                                + D+  P +    TALH+I  +  +N   ++ V  ++L   
Sbjct  302   -----------------NCLLDL--PSKPSSDTALHIICNYGPDNTPEIMEVVKKILQRQ  342

Query  363   IDPNLQNHRGWTALHNCIQERNEPLFDVLLECQSIDLDKSTNENDTPLCIAMKTDPFSGF  422
             ++ N+QN +G T LH  I  RN  +  +LL+  +ID++  T +    L +++        
Sbjct  343   LNINIQNIKGETPLHIAIARRNVEMVKLLLKVPNIDINLRTYDEKCALELSLSMGDHEFL  402

Query  423   FAKKLLIKGATPNPVYKNTGDTLLHV--LIREYKEEAALFLIDYCKDNLMQKNNDGYLVL  480
              A  LL  GA  +     TGD+LL V  L R   E++A+FL D+   +L   N  G   L
Sbjct  403   IASILLSMGARTDRTNSKTGDSLLQVFALDRHRGEKSAIFLADFA--DLDHINFRGLTAL  460

Query  481   HEACKVGSKNLTRALLKTGFPVNEVALSTG-DAPIHIAVSNLYFDIVMELLHAPNSNSQL  539
             H A      NL + L+  G   N   +  G  + +HIAV     D +   +   N +  +
Sbjct  461   HIAALNNMPNLVKKLIVNGASSNLKHIDCGLKSALHIAVEANAIDALEAFVELKNKSHDI  520

Query  540   NLK-NNVN-ETPLSLAIKAPFKKGKDIVLALIKAGANINQCNNDGLTLLHQAILKEDSAT  597
             +    ++N ++PLSL +     K   +V  LI+ G+++N  N + L+ LHQ+I  EDS  
Sbjct  521   DFNCQDINGDSPLSLCLSL---KRTTLVPTLIRGGSDVNGKNKNNLSPLHQSIKNEDSDI  577

Query  598   AIFLLENGADMNTRTADGETPLQLSIHCRLGEVVEALCKRGVDTSIG----CPLWDALDS  653
             ++FLLE GAD+   T + ++ L LSI   L EVV+ALC+RG+  SI      PLW AL+ 
Sbjct  578   SLFLLEQGADITALTENLDSALDLSIKHDLSEVVDALCRRGIALSINKNGESPLWSALEK  637

Query  654   DQEDVASILVKYGADTDCWGPGPDDCQQTLLHRAIDHNKEDIAQFLIRSGCDLNIPRKPG  713
               EDVA ILV++G DTDCW  GP+ C+QTLLHRAID NKE +A FLI+S CDL+  R+PG
Sbjct  638   GYEDVAKILVRHGIDTDCWDEGPEGCRQTLLHRAIDENKESVAIFLIQSQCDLDSSRQPG  697

Query  714   PDGIGGDEARDECTPLHLCCQWGLEQVVQTLIEHGADVNARDVEGKTPVHVAIQNQHSQI  773
             P+G GGDEA+D+ +PLHLCC WG  +V+QTLI+HGA+VN  D E K+P+HVAI++Q+ +I
Sbjct  698   PNGEGGDEAQDKASPLHLCCHWGQTKVLQTLIDHGANVNLIDAESKSPLHVAIESQYDEI  757

Query  774   ISLLLCHPNIDLNKRDKKGLTPFATALTFRNNKAAQAILERLPKAAEQYDNKGRNFLHTA  833
             IS+LLCHP+IDL  RDK G TPFATAL FRN+ AAQ IL+R P AAEQ D +GRNFLH A
Sbjct  758   ISILLCHPDIDLKLRDKSGNTPFATALDFRNHNAAQRILDRFPTAAEQMDIRGRNFLHLA  817

Query  834   IQKNDMESILFLLSIQVDVNSRVHDVTQTPPLHLAAVSGNEMLVRSLILAGARVNDTDAN  893
             I K+D+ES+LFLL+IQVDVNSRVHD  Q+ PLHLAA S NEM+ R+LILAGAR+N+ DA 
Sbjct  818   ILKDDLESVLFLLAIQVDVNSRVHDANQSSPLHLAAASQNEMITRNLILAGARMNERDAV  877

Query  894   RNTALHAAAKAGHAAIVSALLQNNINFDAVNADGDNALHVAVREGHVSVVRALLTECTLD  953
             +   LH A + G+   VSAL+QNN ++DA +ADG+NALH+AVR     +VR LLTE  ++
Sbjct  878   QKLPLHIAIERGNLPAVSALIQNNADYDATDADGNNALHIAVRCAQFFIVRELLTESRVN  937

Query  954   AEAVNLKGRNPLHELARCGKDN-AATICELFLECMSQYPVNNADLDGNTPLLIAYMKGNG  1012
             AEA NLKGRNPLHEL R  +D+ A  ICELFLE M +YP+N  D+DGNTPLL+++M+G  
Sbjct  938   AEATNLKGRNPLHELCRVVEDSTAGLICELFLESMPKYPINIPDMDGNTPLLLSFMRGQS  997

Query  1013  QLCRTLVKAGACLGSMNKEGITIFNYQVATKQLLYRLLDSLTQEAPWADKDLCLECGTKF  1072
              LC+ LVKAGACLG+ NK+GI IFN+++AT QLL+ LLD L QE+PWA+ D C  C  +F
Sbjct  998   PLCKILVKAGACLGTENKDGINIFNFKLATDQLLHNLLDQLPQESPWAESDYCQHCTNRF  1057

Query  1073  SLTMRKHHCRHCGRILCNKCSDQDVPIVKFGLNKPVRVCAVCFDVLQLG  1121
             ++TMRKHHCRHCGR+LC+KCS  DVPI+KFG+NKPVRVC VCF+VLQ G
Sbjct  1058  TITMRKHHCRHCGRVLCSKCSCNDVPILKFGINKPVRVCTVCFNVLQCG  1106



Lambda      K        H
   0.310    0.129    0.371 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 19813125786


Query= XP_050469375.1 zinc finger protein with KRAB and SCAN domains 3-like
isoform X2 [Bombus huntii]

Length=524
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

G5ECN8_CAEEL  unnamed protein product                                 224     1e-69
Q9W0P9_DROME  unnamed protein product                                 196     5e-57
Q8SXL3_DROME  unnamed protein product                                 179     2e-49


>G5ECN8_CAEEL unnamed protein product
Length=270

 Score = 224 bits (571),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 126/176 (72%), Gaps = 16/176 (9%)

Query  332  SYTYDTLLVTDGRSKNKKVLPIQKTQEAEPVEGLETSKIGRYVCCECGKQYATSSNLSRH  391
             YT D+L   D RS NKK                  S   R VC +CGK YAT+SNLSRH
Sbjct  109  GYTLDSLQNLDRRSLNKK----------------GPSSHNRCVCDKCGKSYATTSNLSRH  152

Query  392  KQTHRSIDSQSAKKCIHCGKAYVSMPALAMHVLTHKLTHSCGVCGKMFSRPWLLQGHLRS  451
            KQTHR++DS  AK+C HC + YVSMPAL+MH+LTH  +H C VCGK FSR WLLQGHLRS
Sbjct  153  KQTHRALDSPHAKQCPHCDRVYVSMPALSMHILTHNASHECNVCGKRFSRLWLLQGHLRS  212

Query  452  HTGEKPYGCAHCGKAFADRSNLRAHMQTHSADKNYECHKCHKSFALKSYLNKHLES  507
            HTG +P+ CAHCGK+FADRSNLRAHM TH+ DK +EC KC + FAL++YLN+HLE+
Sbjct  213  HTGLRPFSCAHCGKSFADRSNLRAHMLTHTGDKRFECDKCGRRFALRAYLNRHLET  268


>Q9W0P9_DROME unnamed protein product
Length=442

 Score = 196 bits (499),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 108/139 (78%), Gaps = 0/139 (0%)

Query  373  YVCCECGKQYATSSNLSRHKQTHRSIDSQSAKKCIHCGKAYVSMPALAMHVLTHKLTHSC  432
            ++C ECGK+Y+TSSNL+RH+QTHRSI  + A+ C +C K YVSMPA +MHV TH     C
Sbjct  119  HICPECGKKYSTSSNLARHRQTHRSIMDKKARHCPYCEKVYVSMPAYSMHVRTHNQGCEC  178

Query  433  GVCGKMFSRPWLLQGHLRSHTGEKPYGCAHCGKAFADRSNLRAHMQTHSADKNYECHKCH  492
              CGK FSRPWLLQGH+R+HTGEKP+ C  C KAFAD+SNLRAH+QTHS  K + C +C 
Sbjct  179  QFCGKRFSRPWLLQGHIRTHTGEKPFKCGVCEKAFADKSNLRAHIQTHSNTKPHTCARCG  238

Query  493  KSFALKSYLNKHLESACQR  511
            K+FALKSYL KH ES+C +
Sbjct  239  KAFALKSYLYKHEESSCMK  257


 Score = 43.5 bits (101),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/98 (32%), Positives = 42/98 (43%), Gaps = 5/98 (5%)

Query  375  CCECGKQYATSSNLSRHKQTHRSIDSQSAKKCIHCGKAYVSMPALAMHVLTHKLT--HSC  432
            C  CGK+++    L  H +TH     +   KC  C KA+     L  H+ TH  T  H+C
Sbjct  178  CQFCGKRFSRPWLLQGHIRTH---TGEKPFKCGVCEKAFADKSNLRAHIQTHSNTKPHTC  234

Query  433  GVCGKMFSRPWLLQGHLRSHTGEKPYGCAHCGKAFADR  470
              CGK F+    L  H  S   +   G    G A  +R
Sbjct  235  ARCGKAFALKSYLYKHEESSCMKNRGGVPGSGAASGNR  272


>Q8SXL3_DROME unnamed protein product
Length=548

 Score = 179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 102/147 (69%), Gaps = 4/147 (3%)

Query  370  IGRYVCCECGKQYATSSNLSRHKQTH-RSIDSQSAKK---CIHCGKAYVSMPALAMHVLT  425
            + RY C +CGK Y+T S LS+H+Q H  S +    KK   C +C K YVS+ AL MH+ T
Sbjct  342  VPRYHCQDCGKSYSTYSGLSKHQQFHCPSAEGNQVKKVFSCKNCDKTYVSLGALKMHIRT  401

Query  426  HKLTHSCGVCGKMFSRPWLLQGHLRSHTGEKPYGCAHCGKAFADRSNLRAHMQTHSADKN  485
            H L   C +CGK FSRPWLLQGH+R+HTGEKP+ C HC +AFADRSNLRAHMQTHS  K 
Sbjct  402  HTLPCKCPICGKAFSRPWLLQGHIRTHTGEKPFSCQHCNRAFADRSNLRAHMQTHSDVKK  461

Query  486  YECHKCHKSFALKSYLNKHLESACQRE  512
            Y C  C KSF+  S L KHL+S CQ E
Sbjct  462  YSCPTCTKSFSRMSLLAKHLQSGCQTE  488


 Score = 38.5 bits (88),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 41/169 (24%), Positives = 70/169 (41%), Gaps = 25/169 (15%)

Query  351  LPIQKTQEAEPVEGLE--TSKIGRYVCCECGKQYATSSNLSRHKQTH--RSIDSQSAKKC  406
            + +++ QE + +  L+  +S    Y C +C K YAT + L +H+QTH   S + +  +  
Sbjct  244  IDMEEDQENQDINQLKIKSSNDLYYQCQQCNKCYATYAGLVKHQQTHAYESTEYKIIRSQ  303

Query  407  IHCGKAYVSMPALAMHVLTHKLTHSCGVCGKMFSRPWLLQGHLRSHTGEKPYGCAHCGKA  466
                 A V          +  +  +     +   +P           G   Y C  CGK+
Sbjct  304  PGGSGAIVDQTEFCTDQASALIQAANVASAQSMQKP----------VGVPRYHCQDCGKS  353

Query  467  FADRSNLRAHMQTH--SADKN-----YECHKCHKSF----ALKSYLNKH  504
            ++  S L  H Q H  SA+ N     + C  C K++    ALK ++  H
Sbjct  354  YSTYSGLSKHQQFHCPSAEGNQVKKVFSCKNCDKTYVSLGALKMHIRTH  402



Lambda      K        H
   0.310    0.129    0.371 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 19813125786


Query= XP_050469376.1 rabankyrin-5 isoform X2 [Bombus huntii]

Length=1122
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7PLP5_DROME  unnamed protein product                                 998     0.0  
A8Y582_DROME  unnamed protein product                                 998     0.0  
Q7PLP4_DROME  unnamed protein product                                 996     0.0  


>Q7PLP5_DROME unnamed protein product
Length=1124

 Score = 998 bits (2579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 533/1134 (47%), Positives = 747/1134 (66%), Gaps = 48/1134 (4%)

Query  8     KWQQHLSLLREQYVNLYNTNTELQREYAIVTANKQD-----TGFIGRLLTTIGSLYSQQR  62
             K ++ L++  ++Y  L     ELQR+Y    A+ ++     + F+ RL  T+ SL+ +  
Sbjct  13    KMEKILAVQSDEYTKLQRCYVELQRKYNENIASSENEESGLSSFLSRLSLTVASLFDKNT  72

Query  63    YSDVIIKLKNQEIPAHKFILSARTDFFSEATLSEVTILDWTYLEPKIGLILLKWIYTGKV  122
             Y+D+ I+ + +  PAHK +L AR++ +    LS +  LDW+ L   + L LL+WIYT  +
Sbjct  73    YADIYIRSQTRVFPAHKIVLHARSEKWGNDLLSNIQQLDWSDLNEDVVLSLLRWIYTDLI  132

Query  123   PQEN--LTLELMKAASNFQLTELVEQCEKYLIGIVGFKDCVQLYAAAEELGAQKLKEHCS  180
               +N  L L+L+KAA  F L  L+  CE+ L+  VG + C++ Y  AEE+GA  L E+CS
Sbjct  133   DLQNDGLALDLLKAAHRFGLPSLLGICERALVTSVGVRSCIRFYCVAEEVGASTLLEYCS  192

Query  181   SLISAHWEDLTGEDFKEMPGSLLYKLLQTKSKYPLHAAVRLMREDVVFLYLVENNSGLTK  240
             S+IS HW+DLT +DF+ M G LL+++L+TK+K+PLHAAVRL+REDVV L + +  + L  
Sbjct  193   SIISTHWDDLTTDDFQHMSGPLLFEMLKTKTKHPLHAAVRLLREDVVSLCIQKYGNSL--  250

Query  241   AINALDHKGEMPLEVALKTRQPSLARTLVEHG-ADLSAKDSRGLSLLQAAIFKGDSYSAE  299
              +N     G +PLE+AL ++   +A++LV++G A+++A +  G SLL++A+  GD++SA 
Sbjct  251   -VNTFSENGILPLEMALSSKNAKIAKSLVDNGMANINAVNMEGFSLLKSALKNGDAFSAN  309

Query  300   FVIEQLENNGNMKELCEPMKLTRNVKDIKNPEELEGCTALHLITKHNSEN---MLTVASR  356
             F+++Q                   + D+  P +    TALH+I  +  +N   ++ V  +
Sbjct  310   FLLDQ-----------------NCLLDL--PSKPSSDTALHIICNYGPDNTPEIMEVVKK  350

Query  357   LLHAGIDPNLQNHRGWTALHNCIQERNEPLFDVLLECQSIDLDKSTNENDTPLCIAMKTD  416
             +L   ++ N+QN +G T LH  I  RN  +  +LL+  +ID++  T +    L +++   
Sbjct  351   ILQRQLNINIQNIKGETPLHIAIARRNVEMVKLLLKVPNIDINLRTYDEKCALELSLSMG  410

Query  417   PFSGFFAKKLLIKGATPNPVYKNTGDTLLHV--LIREYKEEAALFLIDYCKDNLMQKNND  474
                   A  LL  GA  +     TGD+LL V  L R   E++A+FL D+   +L   N  
Sbjct  411   DHEFLIASILLSMGARTDRTNSKTGDSLLQVFALDRHRGEKSAIFLADFA--DLDHINFR  468

Query  475   GYLVLHEACKVGSKNLTRALLKTGFPVNEVALSTG-DAPIHIAVSNLYFDIVMELLHAPN  533
             G   LH A      NL + L+  G   N   +  G  + +HIAV     D +   +   N
Sbjct  469   GLTALHIAALNNMPNLVKKLIVNGASSNLKHIDCGLKSALHIAVEANAIDALEAFVELKN  528

Query  534   SNSQLNLK-NNVN-ETPLSLAIKAPFKKGKDIVLALIKAGANINQCNNDGLTLLHQAILK  591
              +  ++    ++N ++PLSL +     K   +V  LI+ G+++N  N + L+ LHQ+I  
Sbjct  529   KSHDIDFNCQDINGDSPLSLCLSL---KRTTLVPTLIRGGSDVNGKNKNNLSPLHQSIKN  585

Query  592   EDSATAIFLLENGADMNTRTADGETPLQLSIHCRLGEVVEALCKRGVDTSIG----CPLW  647
             EDS  ++FLLE GAD+   T + ++ L LSI   L EVV+ALC+RG+  SI      PLW
Sbjct  586   EDSDISLFLLEQGADITALTENLDSALDLSIKHDLSEVVDALCRRGIALSINKNGESPLW  645

Query  648   DALDSDQEDVASILVKYGADTDCWGPGPDDCQQTLLHRAIDHNKEDIAQFLIRSGCDLNI  707
              AL+   EDVA ILV++G DTDCW  GP+ C+QTLLHRAID NKE +A FLI+S CDL+ 
Sbjct  646   SALEKGYEDVAKILVRHGIDTDCWDEGPEGCRQTLLHRAIDENKESVAIFLIQSQCDLDS  705

Query  708   PRKPGPDGIGGDEARDECTPLHLCCQWGLEQVVQTLIEHGADVNARDVEGKTPVHVAIQN  767
              R+PGP+G GGDEA+D+ +PLHLCC WG  +V+QTLI+HGA+VN  D E K+P+HVAI++
Sbjct  706   SRQPGPNGEGGDEAQDKASPLHLCCHWGQTKVLQTLIDHGANVNLIDAESKSPLHVAIES  765

Query  768   QHSQIISLLLCHPNIDLNKRDKKGLTPFATALTFRNNKAAQAILERLPKAAEQYDNKGRN  827
             Q+ +IIS+LLCHP+IDL  RDK G TPFATAL FRN+ AAQ IL+R P AAEQ D +GRN
Sbjct  766   QYDEIISILLCHPDIDLKLRDKSGNTPFATALDFRNHNAAQRILDRFPTAAEQMDIRGRN  825

Query  828   FLHTAIQKNDMESILFLLSIQVDVNSRVHDVTQTPPLHLAAVSGNEMLVRSLILAGARVN  887
             FLH AI K+D+ES+LFLL+IQVDVNSRVHD  Q+ PLHLAA S NEM+ R+LILAGAR+N
Sbjct  826   FLHLAILKDDLESVLFLLAIQVDVNSRVHDANQSSPLHLAAASQNEMITRNLILAGARMN  885

Query  888   DTDANRNTALHAAAKAGHAAIVSALLQNNINFDAVNADGDNALHVAVREGHVSVVRALLT  947
             + DA +   LH A + G+   VSAL+QNN ++DA +ADG+NALH+AVR     +VR LLT
Sbjct  886   ERDAVQKLPLHIAIERGNLPAVSALIQNNADYDATDADGNNALHIAVRCAQFFIVRELLT  945

Query  948   ECTLDAEAVNLKGRNPLHELARCGKDN-AATICELFLECMSQYPVNNADLDGNTPLLIAY  1006
             E  ++AEA NLKGRNPLHEL R  +D+ A  ICELFLE M +YP+N  D+DGNTPLL+++
Sbjct  946   ESRVNAEATNLKGRNPLHELCRVVEDSTAGLICELFLESMPKYPINIPDMDGNTPLLLSF  1005

Query  1007  MKGNGQLCRTLVKAGACLGSMNKEGITIFNYQVATKQLLYRLLDSLTQEAPWADKDLCLE  1066
             M+G   LC+ LVKAGACLG+ NK+GI IFN+++AT QLL+ LLD L QE+PWA+ D C  
Sbjct  1006  MRGQSPLCKILVKAGACLGTENKDGINIFNFKLATDQLLHNLLDQLPQESPWAESDYCQH  1065

Query  1067  CGTKFSLTMRKHHCRHCGRILCNKCSDQDVPIVKFGLNKPVRVCAVCFDVLQLG  1120
             C  +F++TMRKHHCRHCGR+LC+KCS  DVPI+KFG+NKPVRVC VCF+VLQ G
Sbjct  1066  CTNRFTITMRKHHCRHCGRVLCSKCSCNDVPILKFGINKPVRVCTVCFNVLQCG  1119


>A8Y582_DROME unnamed protein product
Length=1122

 Score = 998 bits (2579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 533/1134 (47%), Positives = 747/1134 (66%), Gaps = 48/1134 (4%)

Query  8     KWQQHLSLLREQYVNLYNTNTELQREYAIVTANKQD-----TGFIGRLLTTIGSLYSQQR  62
             K ++ L++  ++Y  L     ELQR+Y    A+ ++     + F+ RL  T+ SL+ +  
Sbjct  11    KMEKILAVQSDEYTKLQRCYVELQRKYNENIASSENEESGLSSFLSRLSLTVASLFDKNT  70

Query  63    YSDVIIKLKNQEIPAHKFILSARTDFFSEATLSEVTILDWTYLEPKIGLILLKWIYTGKV  122
             Y+D+ I+ + +  PAHK +L AR++ +    LS +  LDW+ L   + L LL+WIYT  +
Sbjct  71    YADIYIRSQTRVFPAHKIVLHARSEKWGNDLLSNIQQLDWSDLNEDVVLSLLRWIYTDLI  130

Query  123   PQEN--LTLELMKAASNFQLTELVEQCEKYLIGIVGFKDCVQLYAAAEELGAQKLKEHCS  180
               +N  L L+L+KAA  F L  L+  CE+ L+  VG + C++ Y  AEE+GA  L E+CS
Sbjct  131   DLQNDGLALDLLKAAHRFGLPSLLGICERALVTSVGVRSCIRFYCVAEEVGASTLLEYCS  190

Query  181   SLISAHWEDLTGEDFKEMPGSLLYKLLQTKSKYPLHAAVRLMREDVVFLYLVENNSGLTK  240
             S+IS HW+DLT +DF+ M G LL+++L+TK+K+PLHAAVRL+REDVV L + +  + L  
Sbjct  191   SIISTHWDDLTTDDFQHMSGPLLFEMLKTKTKHPLHAAVRLLREDVVSLCIQKYGNSL--  248

Query  241   AINALDHKGEMPLEVALKTRQPSLARTLVEHG-ADLSAKDSRGLSLLQAAIFKGDSYSAE  299
              +N     G +PLE+AL ++   +A++LV++G A+++A +  G SLL++A+  GD++SA 
Sbjct  249   -VNTFSENGILPLEMALSSKNAKIAKSLVDNGMANINAVNMEGFSLLKSALKNGDAFSAN  307

Query  300   FVIEQLENNGNMKELCEPMKLTRNVKDIKNPEELEGCTALHLITKHNSEN---MLTVASR  356
             F+++Q                   + D+  P +    TALH+I  +  +N   ++ V  +
Sbjct  308   FLLDQ-----------------NCLLDL--PSKPSSDTALHIICNYGPDNTPEIMEVVKK  348

Query  357   LLHAGIDPNLQNHRGWTALHNCIQERNEPLFDVLLECQSIDLDKSTNENDTPLCIAMKTD  416
             +L   ++ N+QN +G T LH  I  RN  +  +LL+  +ID++  T +    L +++   
Sbjct  349   ILQRQLNINIQNIKGETPLHIAIARRNVEMVKLLLKVPNIDINLRTYDEKCALELSLSMG  408

Query  417   PFSGFFAKKLLIKGATPNPVYKNTGDTLLHV--LIREYKEEAALFLIDYCKDNLMQKNND  474
                   A  LL  GA  +     TGD+LL V  L R   E++A+FL D+   +L   N  
Sbjct  409   DHEFLIASILLSMGARTDRTNSKTGDSLLQVFALDRHRGEKSAIFLADFA--DLDHINFR  466

Query  475   GYLVLHEACKVGSKNLTRALLKTGFPVNEVALSTG-DAPIHIAVSNLYFDIVMELLHAPN  533
             G   LH A      NL + L+  G   N   +  G  + +HIAV     D +   +   N
Sbjct  467   GLTALHIAALNNMPNLVKKLIVNGASSNLKHIDCGLKSALHIAVEANAIDALEAFVELKN  526

Query  534   SNSQLNLK-NNVN-ETPLSLAIKAPFKKGKDIVLALIKAGANINQCNNDGLTLLHQAILK  591
              +  ++    ++N ++PLSL +     K   +V  LI+ G+++N  N + L+ LHQ+I  
Sbjct  527   KSHDIDFNCQDINGDSPLSLCLSL---KRTTLVPTLIRGGSDVNGKNKNNLSPLHQSIKN  583

Query  592   EDSATAIFLLENGADMNTRTADGETPLQLSIHCRLGEVVEALCKRGVDTSIG----CPLW  647
             EDS  ++FLLE GAD+   T + ++ L LSI   L EVV+ALC+RG+  SI      PLW
Sbjct  584   EDSDISLFLLEQGADITALTENLDSALDLSIKHDLSEVVDALCRRGIALSINKNGESPLW  643

Query  648   DALDSDQEDVASILVKYGADTDCWGPGPDDCQQTLLHRAIDHNKEDIAQFLIRSGCDLNI  707
              AL+   EDVA ILV++G DTDCW  GP+ C+QTLLHRAID NKE +A FLI+S CDL+ 
Sbjct  644   SALEKGYEDVAKILVRHGIDTDCWDEGPEGCRQTLLHRAIDENKESVAIFLIQSQCDLDS  703

Query  708   PRKPGPDGIGGDEARDECTPLHLCCQWGLEQVVQTLIEHGADVNARDVEGKTPVHVAIQN  767
              R+PGP+G GGDEA+D+ +PLHLCC WG  +V+QTLI+HGA+VN  D E K+P+HVAI++
Sbjct  704   SRQPGPNGEGGDEAQDKASPLHLCCHWGQTKVLQTLIDHGANVNLIDAESKSPLHVAIES  763

Query  768   QHSQIISLLLCHPNIDLNKRDKKGLTPFATALTFRNNKAAQAILERLPKAAEQYDNKGRN  827
             Q+ +IIS+LLCHP+IDL  RDK G TPFATAL FRN+ AAQ IL+R P AAEQ D +GRN
Sbjct  764   QYDEIISILLCHPDIDLKLRDKSGNTPFATALDFRNHNAAQRILDRFPTAAEQMDIRGRN  823

Query  828   FLHTAIQKNDMESILFLLSIQVDVNSRVHDVTQTPPLHLAAVSGNEMLVRSLILAGARVN  887
             FLH AI K+D+ES+LFLL+IQVDVNSRVHD  Q+ PLHLAA S NEM+ R+LILAGAR+N
Sbjct  824   FLHLAILKDDLESVLFLLAIQVDVNSRVHDANQSSPLHLAAASQNEMITRNLILAGARMN  883

Query  888   DTDANRNTALHAAAKAGHAAIVSALLQNNINFDAVNADGDNALHVAVREGHVSVVRALLT  947
             + DA +   LH A + G+   VSAL+QNN ++DA +ADG+NALH+AVR     +VR LLT
Sbjct  884   ERDAVQKLPLHIAIERGNLPAVSALIQNNADYDATDADGNNALHIAVRCAQFFIVRELLT  943

Query  948   ECTLDAEAVNLKGRNPLHELARCGKDN-AATICELFLECMSQYPVNNADLDGNTPLLIAY  1006
             E  ++AEA NLKGRNPLHEL R  +D+ A  ICELFLE M +YP+N  D+DGNTPLL+++
Sbjct  944   ESRVNAEATNLKGRNPLHELCRVVEDSTAGLICELFLESMPKYPINIPDMDGNTPLLLSF  1003

Query  1007  MKGNGQLCRTLVKAGACLGSMNKEGITIFNYQVATKQLLYRLLDSLTQEAPWADKDLCLE  1066
             M+G   LC+ LVKAGACLG+ NK+GI IFN+++AT QLL+ LLD L QE+PWA+ D C  
Sbjct  1004  MRGQSPLCKILVKAGACLGTENKDGINIFNFKLATDQLLHNLLDQLPQESPWAESDYCQH  1063

Query  1067  CGTKFSLTMRKHHCRHCGRILCNKCSDQDVPIVKFGLNKPVRVCAVCFDVLQLG  1120
             C  +F++TMRKHHCRHCGR+LC+KCS  DVPI+KFG+NKPVRVC VCF+VLQ G
Sbjct  1064  CTNRFTITMRKHHCRHCGRVLCSKCSCNDVPILKFGINKPVRVCTVCFNVLQCG  1117


>Q7PLP4_DROME unnamed protein product
Length=1111

 Score = 996 bits (2575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 532/1129 (47%), Positives = 744/1129 (66%), Gaps = 48/1129 (4%)

Query  13    LSLLREQYVNLYNTNTELQREYAIVTANKQD-----TGFIGRLLTTIGSLYSQQRYSDVI  67
             L++  ++Y  L     ELQR+Y    A+ ++     + F+ RL  T+ SL+ +  Y+D+ 
Sbjct  5     LAVQSDEYTKLQRCYVELQRKYNENIASSENEESGLSSFLSRLSLTVASLFDKNTYADIY  64

Query  68    IKLKNQEIPAHKFILSARTDFFSEATLSEVTILDWTYLEPKIGLILLKWIYTGKVPQEN-  126
             I+ + +  PAHK +L AR++ +    LS +  LDW+ L   + L LL+WIYT  +  +N 
Sbjct  65    IRSQTRVFPAHKIVLHARSEKWGNDLLSNIQQLDWSDLNEDVVLSLLRWIYTDLIDLQND  124

Query  127   -LTLELMKAASNFQLTELVEQCEKYLIGIVGFKDCVQLYAAAEELGAQKLKEHCSSLISA  185
              L L+L+KAA  F L  L+  CE+ L+  VG + C++ Y  AEE+GA  L E+CSS+IS 
Sbjct  125   GLALDLLKAAHRFGLPSLLGICERALVTSVGVRSCIRFYCVAEEVGASTLLEYCSSIIST  184

Query  186   HWEDLTGEDFKEMPGSLLYKLLQTKSKYPLHAAVRLMREDVVFLYLVENNSGLTKAINAL  245
             HW+DLT +DF+ M G LL+++L+TK+K+PLHAAVRL+REDVV L + +  + L   +N  
Sbjct  185   HWDDLTTDDFQHMSGPLLFEMLKTKTKHPLHAAVRLLREDVVSLCIQKYGNSL---VNTF  241

Query  246   DHKGEMPLEVALKTRQPSLARTLVEHG-ADLSAKDSRGLSLLQAAIFKGDSYSAEFVIEQ  304
                G +PLE+AL ++   +A++LV++G A+++A +  G SLL++A+  GD++SA F+++Q
Sbjct  242   SENGILPLEMALSSKNAKIAKSLVDNGMANINAVNMEGFSLLKSALKNGDAFSANFLLDQ  301

Query  305   LENNGNMKELCEPMKLTRNVKDIKNPEELEGCTALHLITKHNSEN---MLTVASRLLHAG  361
                                + D+  P +    TALH+I  +  +N   ++ V  ++L   
Sbjct  302   -----------------NCLLDL--PSKPSSDTALHIICNYGPDNTPEIMEVVKKILQRQ  342

Query  362   IDPNLQNHRGWTALHNCIQERNEPLFDVLLECQSIDLDKSTNENDTPLCIAMKTDPFSGF  421
             ++ N+QN +G T LH  I  RN  +  +LL+  +ID++  T +    L +++        
Sbjct  343   LNINIQNIKGETPLHIAIARRNVEMVKLLLKVPNIDINLRTYDEKCALELSLSMGDHEFL  402

Query  422   FAKKLLIKGATPNPVYKNTGDTLLHV--LIREYKEEAALFLIDYCKDNLMQKNNDGYLVL  479
              A  LL  GA  +     TGD+LL V  L R   E++A+FL D+   +L   N  G   L
Sbjct  403   IASILLSMGARTDRTNSKTGDSLLQVFALDRHRGEKSAIFLADFA--DLDHINFRGLTAL  460

Query  480   HEACKVGSKNLTRALLKTGFPVNEVALSTG-DAPIHIAVSNLYFDIVMELLHAPNSNSQL  538
             H A      NL + L+  G   N   +  G  + +HIAV     D +   +   N +  +
Sbjct  461   HIAALNNMPNLVKKLIVNGASSNLKHIDCGLKSALHIAVEANAIDALEAFVELKNKSHDI  520

Query  539   NLK-NNVN-ETPLSLAIKAPFKKGKDIVLALIKAGANINQCNNDGLTLLHQAILKEDSAT  596
             +    ++N ++PLSL +     K   +V  LI+ G+++N  N + L+ LHQ+I  EDS  
Sbjct  521   DFNCQDINGDSPLSLCLSL---KRTTLVPTLIRGGSDVNGKNKNNLSPLHQSIKNEDSDI  577

Query  597   AIFLLENGADMNTRTADGETPLQLSIHCRLGEVVEALCKRGVDTSIG----CPLWDALDS  652
             ++FLLE GAD+   T + ++ L LSI   L EVV+ALC+RG+  SI      PLW AL+ 
Sbjct  578   SLFLLEQGADITALTENLDSALDLSIKHDLSEVVDALCRRGIALSINKNGESPLWSALEK  637

Query  653   DQEDVASILVKYGADTDCWGPGPDDCQQTLLHRAIDHNKEDIAQFLIRSGCDLNIPRKPG  712
               EDVA ILV++G DTDCW  GP+ C+QTLLHRAID NKE +A FLI+S CDL+  R+PG
Sbjct  638   GYEDVAKILVRHGIDTDCWDEGPEGCRQTLLHRAIDENKESVAIFLIQSQCDLDSSRQPG  697

Query  713   PDGIGGDEARDECTPLHLCCQWGLEQVVQTLIEHGADVNARDVEGKTPVHVAIQNQHSQI  772
             P+G GGDEA+D+ +PLHLCC WG  +V+QTLI+HGA+VN  D E K+P+HVAI++Q+ +I
Sbjct  698   PNGEGGDEAQDKASPLHLCCHWGQTKVLQTLIDHGANVNLIDAESKSPLHVAIESQYDEI  757

Query  773   ISLLLCHPNIDLNKRDKKGLTPFATALTFRNNKAAQAILERLPKAAEQYDNKGRNFLHTA  832
             IS+LLCHP+IDL  RDK G TPFATAL FRN+ AAQ IL+R P AAEQ D +GRNFLH A
Sbjct  758   ISILLCHPDIDLKLRDKSGNTPFATALDFRNHNAAQRILDRFPTAAEQMDIRGRNFLHLA  817

Query  833   IQKNDMESILFLLSIQVDVNSRVHDVTQTPPLHLAAVSGNEMLVRSLILAGARVNDTDAN  892
             I K+D+ES+LFLL+IQVDVNSRVHD  Q+ PLHLAA S NEM+ R+LILAGAR+N+ DA 
Sbjct  818   ILKDDLESVLFLLAIQVDVNSRVHDANQSSPLHLAAASQNEMITRNLILAGARMNERDAV  877

Query  893   RNTALHAAAKAGHAAIVSALLQNNINFDAVNADGDNALHVAVREGHVSVVRALLTECTLD  952
             +   LH A + G+   VSAL+QNN ++DA +ADG+NALH+AVR     +VR LLTE  ++
Sbjct  878   QKLPLHIAIERGNLPAVSALIQNNADYDATDADGNNALHIAVRCAQFFIVRELLTESRVN  937

Query  953   AEAVNLKGRNPLHELARCGKDN-AATICELFLECMSQYPVNNADLDGNTPLLIAYMKGNG  1011
             AEA NLKGRNPLHEL R  +D+ A  ICELFLE M +YP+N  D+DGNTPLL+++M+G  
Sbjct  938   AEATNLKGRNPLHELCRVVEDSTAGLICELFLESMPKYPINIPDMDGNTPLLLSFMRGQS  997

Query  1012  QLCRTLVKAGACLGSMNKEGITIFNYQVATKQLLYRLLDSLTQEAPWADKDLCLECGTKF  1071
              LC+ LVKAGACLG+ NK+GI IFN+++AT QLL+ LLD L QE+PWA+ D C  C  +F
Sbjct  998   PLCKILVKAGACLGTENKDGINIFNFKLATDQLLHNLLDQLPQESPWAESDYCQHCTNRF  1057

Query  1072  SLTMRKHHCRHCGRILCNKCSDQDVPIVKFGLNKPVRVCAVCFDVLQLG  1120
             ++TMRKHHCRHCGR+LC+KCS  DVPI+KFG+NKPVRVC VCF+VLQ G
Sbjct  1058  TITMRKHHCRHCGRVLCSKCSCNDVPILKFGINKPVRVCTVCFNVLQCG  1106



Lambda      K        H
   0.310    0.129    0.371 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 19813125786


Query= XP_050469377.1 rabankyrin-5 isoform X3 [Bombus huntii]

Length=925
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7PLP5_DROME  unnamed protein product                                 860     0.0  
Q7PLP4_DROME  unnamed protein product                                 859     0.0  
A8Y582_DROME  unnamed protein product                                 859     0.0  


>Q7PLP5_DROME unnamed protein product
Length=1124

 Score = 860 bits (2221),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/937 (49%), Positives = 628/937 (67%), Gaps = 41/937 (4%)

Query  1     MPGSLLYKLLQTKSKYPLHAAVRLMREDVVFLYLVENNSGLTKAINALDHKGEMPLEVAL  60
             M G LL+++L+TK+K+PLHAAVRL+REDVV L + +  + L   +N     G +PLE+AL
Sbjct  210   MSGPLLFEMLKTKTKHPLHAAVRLLREDVVSLCIQKYGNSL---VNTFSENGILPLEMAL  266

Query  61    KTRQPSLARTLVEHG-ADLSAKDSRGLSLLQAAIFKGDSYSAEFVIEQLENNGNMKELCE  119
              ++   +A++LV++G A+++A +  G SLL++A+  GD++SA F+++Q            
Sbjct  267   SSKNAKIAKSLVDNGMANINAVNMEGFSLLKSALKNGDAFSANFLLDQ------------  314

Query  120   PMKLTRNVKDIKNPEELEGCTALHLITKHNSEN---MLTVASRLLHAGIDPNLQNHRGWT  176
                    + D+  P +    TALH+I  +  +N   ++ V  ++L   ++ N+QN +G T
Sbjct  315   -----NCLLDL--PSKPSSDTALHIICNYGPDNTPEIMEVVKKILQRQLNINIQNIKGET  367

Query  177   ALHNCIQERNEPLFDVLLECQSIDLDKSTNENDTPLCIAMKTDPFSGFFAKKLLIKGATP  236
              LH  I  RN  +  +LL+  +ID++  T +    L +++         A  LL  GA  
Sbjct  368   PLHIAIARRNVEMVKLLLKVPNIDINLRTYDEKCALELSLSMGDHEFLIASILLSMGART  427

Query  237   NPVYKNTGDTLLHV--LIREYKEEAALFLIDYCKDNLMQKNNDGYLVLHEACKVGSKNLT  294
             +     TGD+LL V  L R   E++A+FL D+   +L   N  G   LH A      NL 
Sbjct  428   DRTNSKTGDSLLQVFALDRHRGEKSAIFLADFA--DLDHINFRGLTALHIAALNNMPNLV  485

Query  295   RALLKTGFPVNEVALSTG-DAPIHIAVSNLYFDIVMELLHAPNSNSQLNLK-NNVN-ETP  351
             + L+  G   N   +  G  + +HIAV     D +   +   N +  ++    ++N ++P
Sbjct  486   KKLIVNGASSNLKHIDCGLKSALHIAVEANAIDALEAFVELKNKSHDIDFNCQDINGDSP  545

Query  352   LSLAIKAPFKKGKDIVLALIKAGANINQCNNDGLTLLHQAILKEDSATAIFLLENGADMN  411
             LSL +     K   +V  LI+ G+++N  N + L+ LHQ+I  EDS  ++FLLE GAD+ 
Sbjct  546   LSLCLSL---KRTTLVPTLIRGGSDVNGKNKNNLSPLHQSIKNEDSDISLFLLEQGADIT  602

Query  412   TRTADGETPLQLSIHCRLGEVVEALCKRGVDTSIG----CPLWDALDSDQEDVASILVKY  467
               T + ++ L LSI   L EVV+ALC+RG+  SI      PLW AL+   EDVA ILV++
Sbjct  603   ALTENLDSALDLSIKHDLSEVVDALCRRGIALSINKNGESPLWSALEKGYEDVAKILVRH  662

Query  468   GADTDCWGPGPDDCQQTLLHRAIDHNKEDIAQFLIRSGCDLNIPRKPGPDGIGGDEARDE  527
             G DTDCW  GP+ C+QTLLHRAID NKE +A FLI+S CDL+  R+PGP+G GGDEA+D+
Sbjct  663   GIDTDCWDEGPEGCRQTLLHRAIDENKESVAIFLIQSQCDLDSSRQPGPNGEGGDEAQDK  722

Query  528   CTPLHLCCQWGLEQVVQTLIEHGADVNARDVEGKTPVHVAIQNQHSQIISLLLCHPNIDL  587
              +PLHLCC WG  +V+QTLI+HGA+VN  D E K+P+HVAI++Q+ +IIS+LLCHP+IDL
Sbjct  723   ASPLHLCCHWGQTKVLQTLIDHGANVNLIDAESKSPLHVAIESQYDEIISILLCHPDIDL  782

Query  588   NKRDKKGLTPFATALTFRNNKAAQAILERLPKAAEQYDNKGRNFLHTAIQKNDMESILFL  647
               RDK G TPFATAL FRN+ AAQ IL+R P AAEQ D +GRNFLH AI K+D+ES+LFL
Sbjct  783   KLRDKSGNTPFATALDFRNHNAAQRILDRFPTAAEQMDIRGRNFLHLAILKDDLESVLFL  842

Query  648   LSIQVDVNSRVHDVTQTPPLHLAAVSGNEMLVRSLILAGARVNDTDANRNTALHAAAKAG  707
             L+IQVDVNSRVHD  Q+ PLHLAA S NEM+ R+LILAGAR+N+ DA +   LH A + G
Sbjct  843   LAIQVDVNSRVHDANQSSPLHLAAASQNEMITRNLILAGARMNERDAVQKLPLHIAIERG  902

Query  708   HAAIVSALLQNNINFDAVNADGDNALHVAVREGHVSVVRALLTECTLDAEAVNLKGRNPL  767
             +   VSAL+QNN ++DA +ADG+NALH+AVR     +VR LLTE  ++AEA NLKGRNPL
Sbjct  903   NLPAVSALIQNNADYDATDADGNNALHIAVRCAQFFIVRELLTESRVNAEATNLKGRNPL  962

Query  768   HELARCGKDN-AATICELFLECMSQYPVNNADLDGNTPLLIAYMKGNGQLCRTLVKAGAC  826
             HEL R  +D+ A  ICELFLE M +YP+N  D+DGNTPLL+++M+G   LC+ LVKAGAC
Sbjct  963   HELCRVVEDSTAGLICELFLESMPKYPINIPDMDGNTPLLLSFMRGQSPLCKILVKAGAC  1022

Query  827   LGSMNKEGITIFNYQVATKQLLYRLLDSLTQEAPWADKDLCLECGTKFSLTMRKHHCRHC  886
             LG+ NK+GI IFN+++AT QLL+ LLD L QE+PWA+ D C  C  +F++TMRKHHCRHC
Sbjct  1023  LGTENKDGINIFNFKLATDQLLHNLLDQLPQESPWAESDYCQHCTNRFTITMRKHHCRHC  1082

Query  887   GRILCNKCSDQDVPIVKFGLNKPVRVCAVCFDVLQLG  923
             GR+LC+KCS  DVPI+KFG+NKPVRVC VCF+VLQ G
Sbjct  1083  GRVLCSKCSCNDVPILKFGINKPVRVCTVCFNVLQCG  1119


>Q7PLP4_DROME unnamed protein product
Length=1111

 Score = 859 bits (2219),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/937 (49%), Positives = 628/937 (67%), Gaps = 41/937 (4%)

Query  1     MPGSLLYKLLQTKSKYPLHAAVRLMREDVVFLYLVENNSGLTKAINALDHKGEMPLEVAL  60
             M G LL+++L+TK+K+PLHAAVRL+REDVV L + +  + L   +N     G +PLE+AL
Sbjct  197   MSGPLLFEMLKTKTKHPLHAAVRLLREDVVSLCIQKYGNSL---VNTFSENGILPLEMAL  253

Query  61    KTRQPSLARTLVEHG-ADLSAKDSRGLSLLQAAIFKGDSYSAEFVIEQLENNGNMKELCE  119
              ++   +A++LV++G A+++A +  G SLL++A+  GD++SA F+++Q            
Sbjct  254   SSKNAKIAKSLVDNGMANINAVNMEGFSLLKSALKNGDAFSANFLLDQ------------  301

Query  120   PMKLTRNVKDIKNPEELEGCTALHLITKHNSEN---MLTVASRLLHAGIDPNLQNHRGWT  176
                    + D+  P +    TALH+I  +  +N   ++ V  ++L   ++ N+QN +G T
Sbjct  302   -----NCLLDL--PSKPSSDTALHIICNYGPDNTPEIMEVVKKILQRQLNINIQNIKGET  354

Query  177   ALHNCIQERNEPLFDVLLECQSIDLDKSTNENDTPLCIAMKTDPFSGFFAKKLLIKGATP  236
              LH  I  RN  +  +LL+  +ID++  T +    L +++         A  LL  GA  
Sbjct  355   PLHIAIARRNVEMVKLLLKVPNIDINLRTYDEKCALELSLSMGDHEFLIASILLSMGART  414

Query  237   NPVYKNTGDTLLHV--LIREYKEEAALFLIDYCKDNLMQKNNDGYLVLHEACKVGSKNLT  294
             +     TGD+LL V  L R   E++A+FL D+   +L   N  G   LH A      NL 
Sbjct  415   DRTNSKTGDSLLQVFALDRHRGEKSAIFLADFA--DLDHINFRGLTALHIAALNNMPNLV  472

Query  295   RALLKTGFPVNEVALSTG-DAPIHIAVSNLYFDIVMELLHAPNSNSQLNLK-NNVN-ETP  351
             + L+  G   N   +  G  + +HIAV     D +   +   N +  ++    ++N ++P
Sbjct  473   KKLIVNGASSNLKHIDCGLKSALHIAVEANAIDALEAFVELKNKSHDIDFNCQDINGDSP  532

Query  352   LSLAIKAPFKKGKDIVLALIKAGANINQCNNDGLTLLHQAILKEDSATAIFLLENGADMN  411
             LSL +     K   +V  LI+ G+++N  N + L+ LHQ+I  EDS  ++FLLE GAD+ 
Sbjct  533   LSLCLSL---KRTTLVPTLIRGGSDVNGKNKNNLSPLHQSIKNEDSDISLFLLEQGADIT  589

Query  412   TRTADGETPLQLSIHCRLGEVVEALCKRGVDTSIG----CPLWDALDSDQEDVASILVKY  467
               T + ++ L LSI   L EVV+ALC+RG+  SI      PLW AL+   EDVA ILV++
Sbjct  590   ALTENLDSALDLSIKHDLSEVVDALCRRGIALSINKNGESPLWSALEKGYEDVAKILVRH  649

Query  468   GADTDCWGPGPDDCQQTLLHRAIDHNKEDIAQFLIRSGCDLNIPRKPGPDGIGGDEARDE  527
             G DTDCW  GP+ C+QTLLHRAID NKE +A FLI+S CDL+  R+PGP+G GGDEA+D+
Sbjct  650   GIDTDCWDEGPEGCRQTLLHRAIDENKESVAIFLIQSQCDLDSSRQPGPNGEGGDEAQDK  709

Query  528   CTPLHLCCQWGLEQVVQTLIEHGADVNARDVEGKTPVHVAIQNQHSQIISLLLCHPNIDL  587
              +PLHLCC WG  +V+QTLI+HGA+VN  D E K+P+HVAI++Q+ +IIS+LLCHP+IDL
Sbjct  710   ASPLHLCCHWGQTKVLQTLIDHGANVNLIDAESKSPLHVAIESQYDEIISILLCHPDIDL  769

Query  588   NKRDKKGLTPFATALTFRNNKAAQAILERLPKAAEQYDNKGRNFLHTAIQKNDMESILFL  647
               RDK G TPFATAL FRN+ AAQ IL+R P AAEQ D +GRNFLH AI K+D+ES+LFL
Sbjct  770   KLRDKSGNTPFATALDFRNHNAAQRILDRFPTAAEQMDIRGRNFLHLAILKDDLESVLFL  829

Query  648   LSIQVDVNSRVHDVTQTPPLHLAAVSGNEMLVRSLILAGARVNDTDANRNTALHAAAKAG  707
             L+IQVDVNSRVHD  Q+ PLHLAA S NEM+ R+LILAGAR+N+ DA +   LH A + G
Sbjct  830   LAIQVDVNSRVHDANQSSPLHLAAASQNEMITRNLILAGARMNERDAVQKLPLHIAIERG  889

Query  708   HAAIVSALLQNNINFDAVNADGDNALHVAVREGHVSVVRALLTECTLDAEAVNLKGRNPL  767
             +   VSAL+QNN ++DA +ADG+NALH+AVR     +VR LLTE  ++AEA NLKGRNPL
Sbjct  890   NLPAVSALIQNNADYDATDADGNNALHIAVRCAQFFIVRELLTESRVNAEATNLKGRNPL  949

Query  768   HELARCGKDN-AATICELFLECMSQYPVNNADLDGNTPLLIAYMKGNGQLCRTLVKAGAC  826
             HEL R  +D+ A  ICELFLE M +YP+N  D+DGNTPLL+++M+G   LC+ LVKAGAC
Sbjct  950   HELCRVVEDSTAGLICELFLESMPKYPINIPDMDGNTPLLLSFMRGQSPLCKILVKAGAC  1009

Query  827   LGSMNKEGITIFNYQVATKQLLYRLLDSLTQEAPWADKDLCLECGTKFSLTMRKHHCRHC  886
             LG+ NK+GI IFN+++AT QLL+ LLD L QE+PWA+ D C  C  +F++TMRKHHCRHC
Sbjct  1010  LGTENKDGINIFNFKLATDQLLHNLLDQLPQESPWAESDYCQHCTNRFTITMRKHHCRHC  1069

Query  887   GRILCNKCSDQDVPIVKFGLNKPVRVCAVCFDVLQLG  923
             GR+LC+KCS  DVPI+KFG+NKPVRVC VCF+VLQ G
Sbjct  1070  GRVLCSKCSCNDVPILKFGINKPVRVCTVCFNVLQCG  1106


>A8Y582_DROME unnamed protein product
Length=1122

 Score = 859 bits (2219),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/937 (49%), Positives = 628/937 (67%), Gaps = 41/937 (4%)

Query  1     MPGSLLYKLLQTKSKYPLHAAVRLMREDVVFLYLVENNSGLTKAINALDHKGEMPLEVAL  60
             M G LL+++L+TK+K+PLHAAVRL+REDVV L + +  + L   +N     G +PLE+AL
Sbjct  208   MSGPLLFEMLKTKTKHPLHAAVRLLREDVVSLCIQKYGNSL---VNTFSENGILPLEMAL  264

Query  61    KTRQPSLARTLVEHG-ADLSAKDSRGLSLLQAAIFKGDSYSAEFVIEQLENNGNMKELCE  119
              ++   +A++LV++G A+++A +  G SLL++A+  GD++SA F+++Q            
Sbjct  265   SSKNAKIAKSLVDNGMANINAVNMEGFSLLKSALKNGDAFSANFLLDQ------------  312

Query  120   PMKLTRNVKDIKNPEELEGCTALHLITKHNSEN---MLTVASRLLHAGIDPNLQNHRGWT  176
                    + D+  P +    TALH+I  +  +N   ++ V  ++L   ++ N+QN +G T
Sbjct  313   -----NCLLDL--PSKPSSDTALHIICNYGPDNTPEIMEVVKKILQRQLNINIQNIKGET  365

Query  177   ALHNCIQERNEPLFDVLLECQSIDLDKSTNENDTPLCIAMKTDPFSGFFAKKLLIKGATP  236
              LH  I  RN  +  +LL+  +ID++  T +    L +++         A  LL  GA  
Sbjct  366   PLHIAIARRNVEMVKLLLKVPNIDINLRTYDEKCALELSLSMGDHEFLIASILLSMGART  425

Query  237   NPVYKNTGDTLLHV--LIREYKEEAALFLIDYCKDNLMQKNNDGYLVLHEACKVGSKNLT  294
             +     TGD+LL V  L R   E++A+FL D+   +L   N  G   LH A      NL 
Sbjct  426   DRTNSKTGDSLLQVFALDRHRGEKSAIFLADFA--DLDHINFRGLTALHIAALNNMPNLV  483

Query  295   RALLKTGFPVNEVALSTG-DAPIHIAVSNLYFDIVMELLHAPNSNSQLNLK-NNVN-ETP  351
             + L+  G   N   +  G  + +HIAV     D +   +   N +  ++    ++N ++P
Sbjct  484   KKLIVNGASSNLKHIDCGLKSALHIAVEANAIDALEAFVELKNKSHDIDFNCQDINGDSP  543

Query  352   LSLAIKAPFKKGKDIVLALIKAGANINQCNNDGLTLLHQAILKEDSATAIFLLENGADMN  411
             LSL +     K   +V  LI+ G+++N  N + L+ LHQ+I  EDS  ++FLLE GAD+ 
Sbjct  544   LSLCLSL---KRTTLVPTLIRGGSDVNGKNKNNLSPLHQSIKNEDSDISLFLLEQGADIT  600

Query  412   TRTADGETPLQLSIHCRLGEVVEALCKRGVDTSIG----CPLWDALDSDQEDVASILVKY  467
               T + ++ L LSI   L EVV+ALC+RG+  SI      PLW AL+   EDVA ILV++
Sbjct  601   ALTENLDSALDLSIKHDLSEVVDALCRRGIALSINKNGESPLWSALEKGYEDVAKILVRH  660

Query  468   GADTDCWGPGPDDCQQTLLHRAIDHNKEDIAQFLIRSGCDLNIPRKPGPDGIGGDEARDE  527
             G DTDCW  GP+ C+QTLLHRAID NKE +A FLI+S CDL+  R+PGP+G GGDEA+D+
Sbjct  661   GIDTDCWDEGPEGCRQTLLHRAIDENKESVAIFLIQSQCDLDSSRQPGPNGEGGDEAQDK  720

Query  528   CTPLHLCCQWGLEQVVQTLIEHGADVNARDVEGKTPVHVAIQNQHSQIISLLLCHPNIDL  587
              +PLHLCC WG  +V+QTLI+HGA+VN  D E K+P+HVAI++Q+ +IIS+LLCHP+IDL
Sbjct  721   ASPLHLCCHWGQTKVLQTLIDHGANVNLIDAESKSPLHVAIESQYDEIISILLCHPDIDL  780

Query  588   NKRDKKGLTPFATALTFRNNKAAQAILERLPKAAEQYDNKGRNFLHTAIQKNDMESILFL  647
               RDK G TPFATAL FRN+ AAQ IL+R P AAEQ D +GRNFLH AI K+D+ES+LFL
Sbjct  781   KLRDKSGNTPFATALDFRNHNAAQRILDRFPTAAEQMDIRGRNFLHLAILKDDLESVLFL  840

Query  648   LSIQVDVNSRVHDVTQTPPLHLAAVSGNEMLVRSLILAGARVNDTDANRNTALHAAAKAG  707
             L+IQVDVNSRVHD  Q+ PLHLAA S NEM+ R+LILAGAR+N+ DA +   LH A + G
Sbjct  841   LAIQVDVNSRVHDANQSSPLHLAAASQNEMITRNLILAGARMNERDAVQKLPLHIAIERG  900

Query  708   HAAIVSALLQNNINFDAVNADGDNALHVAVREGHVSVVRALLTECTLDAEAVNLKGRNPL  767
             +   VSAL+QNN ++DA +ADG+NALH+AVR     +VR LLTE  ++AEA NLKGRNPL
Sbjct  901   NLPAVSALIQNNADYDATDADGNNALHIAVRCAQFFIVRELLTESRVNAEATNLKGRNPL  960

Query  768   HELARCGKDN-AATICELFLECMSQYPVNNADLDGNTPLLIAYMKGNGQLCRTLVKAGAC  826
             HEL R  +D+ A  ICELFLE M +YP+N  D+DGNTPLL+++M+G   LC+ LVKAGAC
Sbjct  961   HELCRVVEDSTAGLICELFLESMPKYPINIPDMDGNTPLLLSFMRGQSPLCKILVKAGAC  1020

Query  827   LGSMNKEGITIFNYQVATKQLLYRLLDSLTQEAPWADKDLCLECGTKFSLTMRKHHCRHC  886
             LG+ NK+GI IFN+++AT QLL+ LLD L QE+PWA+ D C  C  +F++TMRKHHCRHC
Sbjct  1021  LGTENKDGINIFNFKLATDQLLHNLLDQLPQESPWAESDYCQHCTNRFTITMRKHHCRHC  1080

Query  887   GRILCNKCSDQDVPIVKFGLNKPVRVCAVCFDVLQLG  923
             GR+LC+KCS  DVPI+KFG+NKPVRVC VCF+VLQ G
Sbjct  1081  GRVLCSKCSCNDVPILKFGINKPVRVCTVCFNVLQCG  1117



Lambda      K        H
   0.310    0.129    0.371 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 19813125786


Query= XP_050469378.1 unconventional myosin-XIX-like isoform X1 [Bombus
huntii]

Length=987
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MYOI_DICDI  unnamed protein product                                   251     2e-68
MYOD_DICDI  unnamed protein product                                   240     1e-65
MYOB_DICDI  unnamed protein product                                   238     8e-65


>MYOI_DICDI unnamed protein product
Length=2357

 Score = 251 bits (640),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 195/653 (30%), Positives = 339/653 (52%), Gaps = 57/653 (9%)

Query  17   ITDLGTLP--EDENIIIDFLLQRLQRGQIYTWVGSLLLTLNPNN--EVSTSHLYNSSEFN  72
            + D+ TLP   +E+++++ L  R ++ +IYT+ GS+L+ +NP     + T+ +  S  F 
Sbjct  15   VEDMITLPILTEESLLLN-LKMRYKKKEIYTYTGSILVAVNPYEILPIYTADIVKSY-FA  72

Query  73   KHIDISHTTYEANPHIFAVAAKAHYNLIKEHGQNAQVIVISGETGTGKTFNACKCLEFLS  132
            K  ++        PHIFAV+  A  N+I+E G+N Q I+ISGE+G GKT +    +++L+
Sbjct  73   KSRNLML------PHIFAVSDAAFTNMIEE-GKN-QSIIISGESGAGKTESTKLIIQYLA  124

Query  133  NINKWSVQLSQGDCAHNIMLRITDACRLISTFTTACTEKNEISSRHGQLVKLHY-KSGII  191
                   Q+ Q          I ++  ++  F  A T +N  SSR G+ +++ + + G I
Sbjct  125  ARTNRHSQVEQ---------MIVESSPILEAFGNAKTIRNNNSSRFGKFIEIQFNREGHI  175

Query  192  SGATINSFLLERNRVTRGSS---NFQIFYQMIFGMSPTELEIFNLSKDKYYDILNVIDCN  248
            SGA I ++LLE++R++  +S   N+ IFYQ++ G S    E   L + + Y  L+   C 
Sbjct  176  SGARIINYLLEKSRISHQASSERNYHIFYQLLAGASDELKEKLKLGEPEDYHYLSQSGCI  235

Query  249  KKKYFQ--ESFQDTLNALDILDFKSDQKKNIFQVLALLIHMGNIKFREDGEICAIDFNNN  306
            + +     E F+    A+++L    D++  IF +++ ++H+GN+KF +  +    + +  
Sbjct  236  RIENINDVEDFEHVKYAMNVLGLPEDKQFTIFSIVSAVLHIGNLKFEKSEKTQGAEGSEV  295

Query  307  KSKEALKSTCILSSLTEDTIMELLTT--ILINPQSTWRKHTSYHRHLVTVDACRNRLHSI  364
             +K+ LK    L S+    +   LT   +LI  Q+            + V+   +   S+
Sbjct  296  SNKDTLKIIAQLLSVDPVKLETCLTIRHVLIRGQNFVIP--------LKVNEAEDTRDSL  347

Query  365  IRYMYDLLFHWILNHANKTLSLKQQYSQWLGILDIFGFESFTKNGIEQLCVNYANEKMQQ  424
             + +Y  +F+W++   N  +   Q+ S ++G+LDIFGFE+F KN  EQ C+N+ANEK+QQ
Sbjct  348  AKALYGNVFNWLVVFINSKIHKPQKNSTFIGVLDIFGFENFKKNSFEQFCINFANEKLQQ  407

Query  425  YFIETCVENNRNDLQEEGFIKICNPSHTINLYKERLNVIEE---NLFLTLNDACQSPVVI  481
            +F +   +  + + ++E   KI       N  +E L++IE+    +   L++  + P   
Sbjct  408  HFNQHIFKLEQEEYEKE---KINWSKIVYNDNQECLDLIEKRPLGILSLLDEESRFPQAT  464

Query  482  DILTIIQSVCKNLH-NAQKKFLNEK----EGNFIIEHYSGPVTYSIEDLLSKNTDKVPNE  536
            D+     +    LH N +K    EK    +  F+++HY+G V Y  +  L KN D V ++
Sbjct  465  DL-----TYLDKLHTNHEKHPYYEKPRRSKNTFVVKHYAGEVHYDTQGFLDKNKDTVSDD  519

Query  537  ISLIFSTSKNKFLRSLINFGEEQYLHIVKGSITKKTMLAK-LKYNMDTLIKELRKCDLHY  595
            +S +   SK+KF+  L     E+     KG   KKT   +  K  + +LI  L     HY
Sbjct  520  LSSLLQGSKSKFIIELFTPPREEGDDSDKGREKKKTTAGQTFKTQLQSLINILSSTQPHY  579

Query  596  VRCVKPNRSINNE-WDRKNFQKQLACIGIFDALPLAKCKYPIRLRHQDFYVRY  647
            VRC+KPN +     +DR+  Q QL   G+ + + + K  YPIR  H++F  RY
Sbjct  580  VRCIKPNTTKEPAVYDRELIQAQLRYAGMMETIRIRKLGYPIRHTHKEFRDRY  632


>MYOD_DICDI unnamed protein product
Length=1109

 Score = 240 bits (613),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 204/739 (28%), Positives = 357/739 (48%), Gaps = 69/739 (9%)

Query  10   SQAGWDFITDLGTLPEDENIIIDFLLQRLQRGQIYTWVGSLLLTLNPNNEVSTSHLYNSS  69
            SQ G D +  L  +  D   I+D L +R     IYT++G++L+++NP  ++   +LY  S
Sbjct  5    SQHGVDDMVMLSKIANDS--ILDNLKKRYGGDVIYTYIGNVLISVNPFKQIK--NLY--S  58

Query  70   EFNKHIDISHTTYEANPHIFAVAAKAHYNLIKEHGQNAQVIVISGETGTGKTFNACKCLE  129
            E N         YE  PH +AVA   + ++  E GQ +Q ++ISGE+G GKT  A   ++
Sbjct  59   ERNLLEYRGKFRYELPPHAYAVADDMYRSMYAE-GQ-SQCVIISGESGAGKTEAAKLIMQ  116

Query  130  FLSNINKWSVQLSQGDCAHNIMLRITDACRLISTFTTACTEKNEISSRHGQLVKLHYKS-  188
            +++ ++     +S+     +++L   ++  L+  F  A T +N  SSR G+ +++ +   
Sbjct  117  YIAAVSGKGADVSR---VKDVIL---ESNPLLEAFGNAKTLRNNNSSRFGKYMEVQFNGI  170

Query  189  GIISGATINSFLLERNRV---TRGSSNFQIFYQMIFGMSPTELEIFNLSKDKYYDILNVI  245
            G   G  + ++LLE++RV   T+G  NF IFYQ++ G +        L     ++ L+  
Sbjct  171  GDPEGGRVTNYLLEKSRVVYQTKGERNFHIFYQLLSGANQQLKSELRLDTPDKFNYLSAS  230

Query  246  DCNKKKYFQES--FQDTLNALDILDFKSDQKKNIFQVLALLIHMGNIKFREDG-EICAID  302
             C       +S  FQD   A+ ++     ++K +F+++A ++++GN+ F+ +  +  AID
Sbjct  231  GCYTVDGVDDSGEFQDVCKAMKVIGLTDSEQKEVFRLVAAILYLGNVGFKNNAKDEAAID  290

Query  303  FNNNKSKEALKSTCILSSLTEDTIMELL--TTILINPQSTWRKHTSYHRHLVTVDACRNR  360
                +SK+AL++   L      +  + L   TI    Q    + ++Y     +  A  +R
Sbjct  291  ---QQSKKALENFAFLMQTDVSSCEKALCFRTISTGTQGRSARVSTYACPQNSEGAYYSR  347

Query  361  LHSIIRYMYDLLFHWILNHANKTLSLKQ-QYSQWLGILDIFGFESFTKNGIEQLCVNYAN  419
              ++ + +Y  LF WI+   N  L  KQ   S  +GILDI+GFE F KNG EQ+ +NY N
Sbjct  348  -DALAKALYSRLFDWIVGRVNSALGYKQNSQSLMIGILDIYGFEIFEKNGFEQMVINYVN  406

Query  420  EKMQQYFIETCVENNRNDLQEEGFIKICNPSHTINLYKERLNVIEENLFLTLNDACQSPV  479
            E++QQ FIE  ++  + +   EG            +  E+++     +     D  +S  
Sbjct  407  ERLQQIFIELTLKTEQEEYFNEG------------IQWEQIDYFNNKICC---DLIESKK  451

Query  480  VIDILTIIQSVCKNLHNAQKKFLNEKEGNF----------------IIEHYSGPVTYSIE  523
               ILTI+  VC       +KFL+  + +F                 I+HY+G V Y  E
Sbjct  452  PAGILTILDDVCNFPKGDDQKFLDRLKESFSSHAHFQSAAQSSSSFTIKHYAGDVEYCAE  511

Query  524  DLLSKNTDKVPNEISLIFSTSKNKFLRSLINFGEEQYLHIVKGSITKKTMLAKLKYNMDT  583
              + KN D + N++  + + + +K +  L  F E   ++  K      T   K+K ++  
Sbjct  512  GFVDKNKDLLFNDLVELAACTTSKLIPQL--FPE---INCEKDKRKPTTAGFKIKESIGA  566

Query  584  LIKELRKCDLHYVRCVKPNRSIN-NEWDRKNFQKQLACIGIFDALPLAKCKYPIRLRHQD  642
            L+K L  C  HY+RC+KPN +   N++D      Q+  +G+ + + + +  Y  R  +  
Sbjct  567  LVKALSACTPHYIRCIKPNGNKRANDFDTSLVMHQVKYLGLLENVRIRRAGYAYRQTYDK  626

Query  643  FYVRYSRKPMEMID--LDKCKLILESIVPKRDLQT-QVHFGKQLIFLTEP-IFLKLESYR  698
            F+ RY     E         +  +E+I+   DL+  Q   GK  IF+  P     LE  R
Sbjct  627  FFYRYRVCCKETWPNWTGGFESGVETILKSMDLEPKQYSKGKTKIFIRAPETVFNLEELR  686

Query  699  RNYRIKYANKIKAFWIKHS  717
                  YANK++ F+++ +
Sbjct  687  ERKVFTYANKLQRFFLRFT  705


>MYOB_DICDI unnamed protein product
Length=1111

 Score = 238 bits (607),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 200/728 (27%), Positives = 343/728 (47%), Gaps = 86/728 (12%)

Query  10   SQAGWDFITDLGTLPEDENIIIDFLLQRLQRGQIYTWVGSLLLTLNPNNEVSTSHLYNSS  69
            ++ G D +  L  + EDE  I + L +R     IYT +G +L+++NP   ++ S      
Sbjct  7    AKQGTDDLVMLPKVSEDE--ICENLKKRYMNDFIYTNIGPVLISVNPFRNLNNS----GP  60

Query  70   EFNKHIDISHTTYEANPHIFAVAAKAHYNLIKEHGQNAQVIVISGETGTGKTFNACKCLE  129
            +F +     H   E  PH++ +A  A Y  +K   +N Q ++ISGE+G GKT  A   + 
Sbjct  61   DFIEAYRGKHAQ-EVPPHVYQLAESA-YRAMKNDQEN-QCVIISGESGAGKTEAAKLIMG  117

Query  130  FLSNINKWSVQLSQGDCAHNIMLRITDACRLISTFTTACTEKNEISSRHGQLVKLHY-KS  188
            ++S I+  + ++      H I+    ++  L+  F  A T +N  SSR G+  ++ + K+
Sbjct  118  YVSAISGSTEKVEY--VKHVIL----ESNPLLEAFGNAKTLRNNNSSRFGKYFEIQFDKA  171

Query  189  GIISGATINSFLLERNRVT---RGSSNFQIFYQMIFGMSPTELEIFNLSKDKYYDILNVI  245
            G   G  I ++LLE++RV     G  NF IFYQ++ G S  E   + LS  + Y  LN  
Sbjct  172  GDPVGGKIYNYLLEKSRVVYQNPGERNFHIFYQLLAGASAQEKRDYVLSSPESYYYLNQS  231

Query  246  DCNKKKYFQE--SFQDTLNALDILDFKSDQKKNIFQVLALLIHMGNIKFREDGEICAIDF  303
             C       +   + +   A+D +   + ++ +I +++A ++H+GNI F ED +  A  +
Sbjct  232  QCYTVDGINDVSDYAEVRQAMDTIGLTAQEQSDIIRIVACVLHIGNIYFIEDDKGNAAIY  291

Query  304  NNNKSKEALKSTCILSSLTEDTIM-ELLTTILINPQSTWRKHTSYHRHLVTVDACRNRLH  362
            + N  + A    CI S+  ++ I+  ++ T         R   +  +++   +  R+   
Sbjct  292  DPNALELAASMLCIDSATLQNAILFRVINTGGAGGAGNRRSTYNVPQNVEQANGTRD---  348

Query  363  SIIRYMYDLLFHWILNHANKTLSL-KQQYSQWLGILDIFGFESFTKNGIEQLCVNYANEK  421
            ++ R +YD +F W++   N++LS  K  Y   +GILDIFGFE F KNG EQ C+N+ NEK
Sbjct  349  ALARTIYDRMFSWLVERVNQSLSYYKSPYQNVIGILDIFGFEIFEKNGFEQFCINFVNEK  408

Query  422  MQQYFIETCVENNRNDLQEEGFIKICNPSHTINLYKERLNVIEENLFLTLNDACQSPVVI  481
            +QQ+FIE  ++  + +   EG            +  E +      +   L +    P   
Sbjct  409  LQQFFIELTLKAEQEEYVREG------------IKWEPIKYFNNQIVCDLIEGKSPP---  453

Query  482  DILTIIQSVCKNLH----NAQKKFLNEKE-------------GNFIIEHYSGPVTYSIED  524
             I +++  +C  LH       +KFL +               G F I+HY+G VTY  E 
Sbjct  454  GIFSLLDDICSTLHAQSTGTDQKFLEKMAGIYDGHLHWRGMTGAFAIKHYAGEVTYEAEG  513

Query  525  LLSKNTDKVPNEISLIFSTSKNKFLRSLINFGEEQYLHIVKGSITKK---TMLAKLKYNM  581
               KN D +  ++      SK  FL SL N  E+       GS+ KK   T   K+K + 
Sbjct  514  FSDKNKDTLFFDLIEAIQCSKMPFLASLFN--ED------TGSLQKKRPTTAGFKIKTSA  565

Query  582  DTLIKELRKCDLHYVRCVKPNRSIN-NEWDRKNFQKQLACIGIFDALPLAKCKYPIRLRH  640
              L+K L +C  HY+RC+KPN +    +W+    + Q+  +G+ + + + +  +  R   
Sbjct  566  GELMKALSQCTPHYIRCIKPNETKKAKDWENSRVKHQVQYLGLLENVRVRRAGFAYRNTF  625

Query  641  QDFYVRYSRKPMEMID---------LDKCKLILESIVPKRDLQT-QVHFGKQLIFLTEP-  689
                 RY +   +            ++ CK I + +    +L+  Q   GK  +F+  P 
Sbjct  626  DKVLKRYKKLSSKTWGIWGEWKGDAIEGCKTIFQDM----NLEAGQWQLGKTKVFIRHPE  681

Query  690  -IFLKLES  696
             +FL  E+
Sbjct  682  TVFLLEEA  689



Lambda      K        H
   0.310    0.129    0.371 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 19813125786


Query= XP_050469379.1 unconventional myosin-XIX-like isoform X2 [Bombus
huntii]

Length=968
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MYOI_DICDI  unnamed protein product                                   251     1e-68
MYOD_DICDI  unnamed protein product                                   240     1e-65
MYOA_DICDI  unnamed protein product                                   238     3e-65


>MYOI_DICDI unnamed protein product
Length=2357

 Score = 251 bits (641),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 195/653 (30%), Positives = 339/653 (52%), Gaps = 57/653 (9%)

Query  17   ITDLGTLP--EDENIIIDFLLQRLQRGQIYTWVGSLLLTLNPNN--EVSTSHLYNSSEFN  72
            + D+ TLP   +E+++++ L  R ++ +IYT+ GS+L+ +NP     + T+ +  S  F 
Sbjct  15   VEDMITLPILTEESLLLN-LKMRYKKKEIYTYTGSILVAVNPYEILPIYTADIVKSY-FA  72

Query  73   KHIDISHTTYEANPHIFAVAAKAHYNLIKEHGQNAQVIVISGETGTGKTFNACKCLEFLS  132
            K  ++        PHIFAV+  A  N+I+E G+N Q I+ISGE+G GKT +    +++L+
Sbjct  73   KSRNLML------PHIFAVSDAAFTNMIEE-GKN-QSIIISGESGAGKTESTKLIIQYLA  124

Query  133  NINKWSVQLSQGDCAHNIMLRITDACRLISTFTTACTEKNEISSRHGQLVKLHY-KSGII  191
                   Q+ Q          I ++  ++  F  A T +N  SSR G+ +++ + + G I
Sbjct  125  ARTNRHSQVEQ---------MIVESSPILEAFGNAKTIRNNNSSRFGKFIEIQFNREGHI  175

Query  192  SGATINSFLLERNRVTRGSS---NFQIFYQMIFGMSPTELEIFNLSKDKYYDILNVIDCN  248
            SGA I ++LLE++R++  +S   N+ IFYQ++ G S    E   L + + Y  L+   C 
Sbjct  176  SGARIINYLLEKSRISHQASSERNYHIFYQLLAGASDELKEKLKLGEPEDYHYLSQSGCI  235

Query  249  KKKYFQ--ESFQDTLNALDILDFKSDQKKNIFQVLALLIHMGNIKFREDGEICAIDFNNN  306
            + +     E F+    A+++L    D++  IF +++ ++H+GN+KF +  +    + +  
Sbjct  236  RIENINDVEDFEHVKYAMNVLGLPEDKQFTIFSIVSAVLHIGNLKFEKSEKTQGAEGSEV  295

Query  307  KSKEALKSTCILSSLTEDTIMELLTT--ILINPQSTWRKHTSYHRHLVTVDACRNRLHSI  364
             +K+ LK    L S+    +   LT   +LI  Q+            + V+   +   S+
Sbjct  296  SNKDTLKIIAQLLSVDPVKLETCLTIRHVLIRGQNFVIP--------LKVNEAEDTRDSL  347

Query  365  IRYMYDLLFHWILNHANKTLSLKQQYSQWLGILDIFGFESFTKNGIEQLCVNYANEKMQQ  424
             + +Y  +F+W++   N  +   Q+ S ++G+LDIFGFE+F KN  EQ C+N+ANEK+QQ
Sbjct  348  AKALYGNVFNWLVVFINSKIHKPQKNSTFIGVLDIFGFENFKKNSFEQFCINFANEKLQQ  407

Query  425  YFIETCVENNRNDLQEEGFIKICNPSHTINLYKERLNVIEE---NLFLTLNDACQSPVVI  481
            +F +   +  + + ++E   KI       N  +E L++IE+    +   L++  + P   
Sbjct  408  HFNQHIFKLEQEEYEKE---KINWSKIVYNDNQECLDLIEKRPLGILSLLDEESRFPQAT  464

Query  482  DILTIIQSVCKNLH-NAQKKFLNEK----EGNFIIEHYSGPVTYSIEDLLSKNTDKVPNE  536
            D+     +    LH N +K    EK    +  F+++HY+G V Y  +  L KN D V ++
Sbjct  465  DL-----TYLDKLHTNHEKHPYYEKPRRSKNTFVVKHYAGEVHYDTQGFLDKNKDTVSDD  519

Query  537  ISLIFSTSKNKFLRSLINFGEEQYLHIVKGSITKKTMLAK-LKYNMDTLIKELRKCDLHY  595
            +S +   SK+KF+  L     E+     KG   KKT   +  K  + +LI  L     HY
Sbjct  520  LSSLLQGSKSKFIIELFTPPREEGDDSDKGREKKKTTAGQTFKTQLQSLINILSSTQPHY  579

Query  596  VRCVKPNRSINNE-WDRKNFQKQLACIGIFDALPLAKCKYPIRLRHQDFYVRY  647
            VRC+KPN +     +DR+  Q QL   G+ + + + K  YPIR  H++F  RY
Sbjct  580  VRCIKPNTTKEPAVYDRELIQAQLRYAGMMETIRIRKLGYPIRHTHKEFRDRY  632


>MYOD_DICDI unnamed protein product
Length=1109

 Score = 240 bits (613),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 204/737 (28%), Positives = 356/737 (48%), Gaps = 69/737 (9%)

Query  10   SQAGWDFITDLGTLPEDENIIIDFLLQRLQRGQIYTWVGSLLLTLNPNNEVSTSHLYNSS  69
            SQ G D +  L  +  D   I+D L +R     IYT++G++L+++NP  ++   +LY  S
Sbjct  5    SQHGVDDMVMLSKIANDS--ILDNLKKRYGGDVIYTYIGNVLISVNPFKQIK--NLY--S  58

Query  70   EFNKHIDISHTTYEANPHIFAVAAKAHYNLIKEHGQNAQVIVISGETGTGKTFNACKCLE  129
            E N         YE  PH +AVA   + ++  E GQ +Q ++ISGE+G GKT  A   ++
Sbjct  59   ERNLLEYRGKFRYELPPHAYAVADDMYRSMYAE-GQ-SQCVIISGESGAGKTEAAKLIMQ  116

Query  130  FLSNINKWSVQLSQGDCAHNIMLRITDACRLISTFTTACTEKNEISSRHGQLVKLHYKS-  188
            +++ ++     +S+     +++L   ++  L+  F  A T +N  SSR G+ +++ +   
Sbjct  117  YIAAVSGKGADVSR---VKDVIL---ESNPLLEAFGNAKTLRNNNSSRFGKYMEVQFNGI  170

Query  189  GIISGATINSFLLERNRV---TRGSSNFQIFYQMIFGMSPTELEIFNLSKDKYYDILNVI  245
            G   G  + ++LLE++RV   T+G  NF IFYQ++ G +        L     ++ L+  
Sbjct  171  GDPEGGRVTNYLLEKSRVVYQTKGERNFHIFYQLLSGANQQLKSELRLDTPDKFNYLSAS  230

Query  246  DCNKKKYFQES--FQDTLNALDILDFKSDQKKNIFQVLALLIHMGNIKFREDG-EICAID  302
             C       +S  FQD   A+ ++     ++K +F+++A ++++GN+ F+ +  +  AID
Sbjct  231  GCYTVDGVDDSGEFQDVCKAMKVIGLTDSEQKEVFRLVAAILYLGNVGFKNNAKDEAAID  290

Query  303  FNNNKSKEALKSTCILSSLTEDTIMELL--TTILINPQSTWRKHTSYHRHLVTVDACRNR  360
                +SK+AL++   L      +  + L   TI    Q    + ++Y     +  A  +R
Sbjct  291  ---QQSKKALENFAFLMQTDVSSCEKALCFRTISTGTQGRSARVSTYACPQNSEGAYYSR  347

Query  361  LHSIIRYMYDLLFHWILNHANKTLSLKQ-QYSQWLGILDIFGFESFTKNGIEQLCVNYAN  419
              ++ + +Y  LF WI+   N  L  KQ   S  +GILDI+GFE F KNG EQ+ +NY N
Sbjct  348  -DALAKALYSRLFDWIVGRVNSALGYKQNSQSLMIGILDIYGFEIFEKNGFEQMVINYVN  406

Query  420  EKMQQYFIETCVENNRNDLQEEGFIKICNPSHTINLYKERLNVIEENLFLTLNDACQSPV  479
            E++QQ FIE  ++  + +   EG            +  E+++     +     D  +S  
Sbjct  407  ERLQQIFIELTLKTEQEEYFNEG------------IQWEQIDYFNNKICC---DLIESKK  451

Query  480  VIDILTIIQSVCKNLHNAQKKFLNEKEGNF----------------IIEHYSGPVTYSIE  523
               ILTI+  VC       +KFL+  + +F                 I+HY+G V Y  E
Sbjct  452  PAGILTILDDVCNFPKGDDQKFLDRLKESFSSHAHFQSAAQSSSSFTIKHYAGDVEYCAE  511

Query  524  DLLSKNTDKVPNEISLIFSTSKNKFLRSLINFGEEQYLHIVKGSITKKTMLAKLKYNMDT  583
              + KN D + N++  + + + +K +  L  F E   ++  K      T   K+K ++  
Sbjct  512  GFVDKNKDLLFNDLVELAACTTSKLIPQL--FPE---INCEKDKRKPTTAGFKIKESIGA  566

Query  584  LIKELRKCDLHYVRCVKPNRSIN-NEWDRKNFQKQLACIGIFDALPLAKCKYPIRLRHQD  642
            L+K L  C  HY+RC+KPN +   N++D      Q+  +G+ + + + +  Y  R  +  
Sbjct  567  LVKALSACTPHYIRCIKPNGNKRANDFDTSLVMHQVKYLGLLENVRIRRAGYAYRQTYDK  626

Query  643  FYVRYSRKPMEMID--LDKCKLILESIVPKRDLQT-QVHFGKQLIFLTEP-IFLKLESYR  698
            F+ RY     E         +  +E+I+   DL+  Q   GK  IF+  P     LE  R
Sbjct  627  FFYRYRVCCKETWPNWTGGFESGVETILKSMDLEPKQYSKGKTKIFIRAPETVFNLEELR  686

Query  699  RNYRIKYANKIKAFWIK  715
                  YANK++ F+++
Sbjct  687  ERKVFTYANKLQRFFLR  703


>MYOA_DICDI unnamed protein product
Length=994

 Score = 238 bits (607),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 206/739 (28%), Positives = 362/739 (49%), Gaps = 89/739 (12%)

Query  37   RLQRGQIYTWVGSLLLTLNPNNEVSTSHLYNSSEFN----KHIDISHTTYEANPHIFAVA  92
            R + G IYT +G +L+++NP  ++    +Y + + N    KH       +E  PHI+++A
Sbjct  35   RYKEGLIYTSIGPVLVSMNPYKQLG---IYGNDQINLYKGKH------EFEIPPHIYSIA  85

Query  93   AKAHYNLIKEHGQNAQVIVISGETGTGKTFNACKCLEFLSNINKWSVQLSQGDCAHNIML  152
             KA Y  ++  G+N Q I+ISGE+G GKT  +   ++++++I   S ++ +      +  
Sbjct  86   DKA-YRALRSEGEN-QCIIISGESGAGKTEASKYIMQYIASITGSSTEVER------VKK  137

Query  153  RITDACRLISTFTTACTEKNEISSRHGQLVKLHYK-SGIISGATINSFLLERNRV---TR  208
             I ++  L+  F  A T +N  SSR G+ +++ +   G   G  I ++LLE++RV   T+
Sbjct  138  TILESNPLLEAFGNAKTLRNNNSSRFGKYMEIQFNLGGDPEGGKITNYLLEKSRVINQTQ  197

Query  209  GSSNFQIFYQMIFGMSPTELEIFNL-SKDKY-YDILNVID-CNKKKYF--QESFQDTLNA  263
            G  NF IFYQ++ G S  E + +NL S D+Y Y   N  + C        Q  F+ T NA
Sbjct  198  GERNFHIFYQLLKGSSEEEKKTYNLLSPDQYHYLTRNASNGCFTADGIDDQIGFKQTKNA  257

Query  264  LDILDFKSDQKKNIFQVLALLIHMGNIKFREDGEICAIDFNNNKSKEALKSTCILSSLTE  323
            + ++      +K IF  L+ ++ +GN+ F +         N +   +   +  I S +  
Sbjct  258  MKVVGIDEPLQKEIFATLSAILLLGNLSFNKSA-----SGNGSVISDKKLANTIASLMGV  312

Query  324  DTIMELLTTILINPQSTWRKHTSYHRHLV--TVDACRNRLHSIIRYMYDLLFHWILNHAN  381
            D I  +L + L++ Q +  +      + V  TV+       +  +  Y  LF +I+   N
Sbjct  313  DAI--VLESSLVSRQISTGQGARISTYSVPQTVEQAMYARDAFAKATYSKLFDFIVRKIN  370

Query  382  KTLSLKQQYSQWLGILDIFGFESFTKNGIEQLCVNYANEKMQQYFIETCVENNRNDLQEE  441
            +++ +K    + +G+LDI+GFE F  N  EQ C+NY NE +QQ FI+  ++  + +  +E
Sbjct  371  QSIEVKT-IGKVIGVLDIYGFEIFENNSFEQFCINYVNETLQQIFIDLTLKTEQEEYVQE  429

Query  442  GFIKICNPSHTINLYKERLNVIEE---NLFLTLNDACQSPVVIDILTIIQSVCKNL--HN  496
            G   I  P   IN  K  +++IE+    +   L++ C  P   D  T+I  + K+   H 
Sbjct  430  GITWI--PVQYIN-NKACVDLIEKKPIGILSLLDEECLFPEGND-QTMIDKLNKHFSNHT  485

Query  497  AQKKFLNEKEGNFIIEHYSGPVTYSIEDLLSKNTDKVPNEISLIFSTS------------  544
               K   +K   FII HY+G V Y+I+  L KN D + N++  + ++S            
Sbjct  486  HYSKVERQKNSQFIINHYAGKVFYNIDGFLDKNRDTLFNDLVTLATSSSCSLLVEIFKYV  545

Query  545  -------------KNKFLR-SLINFGEEQYLHIVKGSITKKTMLAKLKY--NMDTLIKEL  588
                         ++KF +    N   + ++   K    K+ + A  ++   + +L+K L
Sbjct  546  PPLEVDPEQEKKNRDKFSKNGFANNAAKTFIPTDK----KRPITAGFQFKNQVTSLLKSL  601

Query  589  RKCDLHYVRCVKPNRSINN-EWDRKNFQKQLACIGIFDALPLAKCKYPIRLRHQDFYVRY  647
              C  HYVRC+KPN ++   EWD+    +Q+A +G+F+ L + +  Y  R     F  RY
Sbjct  602  YSCSPHYVRCIKPNSNMRALEWDQSKCAEQVAYLGLFENLLVRRAGYCYRQTFSKFMRRY  661

Query  648  -----SRKPMEMIDLDK-CKLILESIVPKRDLQTQVHFGKQLIFLTEPIFLKLESYRRNY  701
                 S  P    D +K   L++  +  + +++ +V +GK  IF+  P  L L   +RN 
Sbjct  662  YMIGKSTWPKWSGDAEKGVNLLMGELTQEINIKEEVQYGKTKIFIRNPQPLFLLEDKRNK  721

Query  702  RI-KYANKIKAFWIKHRRK  719
            R+   A KI + W  ++++
Sbjct  722  RLNDLATKIGSVWKMYKQR  740



Lambda      K        H
   0.310    0.129    0.371 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 19813125786


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Oct 18, 2022  4:55 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_050469380.1 unconventional myosin-XIX-like isoform X3 [Bombus
huntii]

Length=904
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MYOI_DICDI  unnamed protein product                                   251     6e-69
MYOB_DICDI  unnamed protein product                                   236     1e-64
MYOD_DICDI  unnamed protein product                                   230     1e-62


>MYOI_DICDI unnamed protein product
Length=2357

 Score = 251 bits (641),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 195/653 (30%), Positives = 339/653 (52%), Gaps = 57/653 (9%)

Query  17   ITDLGTLP--EDENIIIDFLLQRLQRGQIYTWVGSLLLTLNPNN--EVSTSHLYNSSEFN  72
            + D+ TLP   +E+++++ L  R ++ +IYT+ GS+L+ +NP     + T+ +  S  F 
Sbjct  15   VEDMITLPILTEESLLLN-LKMRYKKKEIYTYTGSILVAVNPYEILPIYTADIVKSY-FA  72

Query  73   KHIDISHTTYEANPHIFAVAAKAHYNLIKEHGQNAQVIVISGETGTGKTFNACKCLEFLS  132
            K  ++        PHIFAV+  A  N+I+E G+N Q I+ISGE+G GKT +    +++L+
Sbjct  73   KSRNLML------PHIFAVSDAAFTNMIEE-GKN-QSIIISGESGAGKTESTKLIIQYLA  124

Query  133  NINKWSVQLSQGDCAHNIMLRITDACRLISTFTTACTEKNEISSRHGQLVKLHY-KSGII  191
                   Q+ Q          I ++  ++  F  A T +N  SSR G+ +++ + + G I
Sbjct  125  ARTNRHSQVEQ---------MIVESSPILEAFGNAKTIRNNNSSRFGKFIEIQFNREGHI  175

Query  192  SGATINSFLLERNRVTRGSS---NFQIFYQMIFGMSPTELEIFNLSKDKYYDILNVIDCN  248
            SGA I ++LLE++R++  +S   N+ IFYQ++ G S    E   L + + Y  L+   C 
Sbjct  176  SGARIINYLLEKSRISHQASSERNYHIFYQLLAGASDELKEKLKLGEPEDYHYLSQSGCI  235

Query  249  KKKYFQ--ESFQDTLNALDILDFKSDQKKNIFQVLALLIHMGNIKFREDGEICAIDFNNN  306
            + +     E F+    A+++L    D++  IF +++ ++H+GN+KF +  +    + +  
Sbjct  236  RIENINDVEDFEHVKYAMNVLGLPEDKQFTIFSIVSAVLHIGNLKFEKSEKTQGAEGSEV  295

Query  307  KSKEALKSTCILSSLTEDTIMELLTT--ILINPQSTWRKHTSYHRHLVTVDACRNRLHSI  364
             +K+ LK    L S+    +   LT   +LI  Q+            + V+   +   S+
Sbjct  296  SNKDTLKIIAQLLSVDPVKLETCLTIRHVLIRGQNFVIP--------LKVNEAEDTRDSL  347

Query  365  IRYMYDLLFHWILNHANKTLSLKQQYSQWLGILDIFGFESFTKNGIEQLCVNYANEKMQQ  424
             + +Y  +F+W++   N  +   Q+ S ++G+LDIFGFE+F KN  EQ C+N+ANEK+QQ
Sbjct  348  AKALYGNVFNWLVVFINSKIHKPQKNSTFIGVLDIFGFENFKKNSFEQFCINFANEKLQQ  407

Query  425  YFIETCVENNRNDLQEEGFIKICNPSHTINLYKERLNVIEE---NLFLTLNDACQSPVVI  481
            +F +   +  + + ++E   KI       N  +E L++IE+    +   L++  + P   
Sbjct  408  HFNQHIFKLEQEEYEKE---KINWSKIVYNDNQECLDLIEKRPLGILSLLDEESRFPQAT  464

Query  482  DILTIIQSVCKNLH-NAQKKFLNEK----EGNFIIEHYSGPVTYSIEDLLSKNTDKVPNE  536
            D+     +    LH N +K    EK    +  F+++HY+G V Y  +  L KN D V ++
Sbjct  465  DL-----TYLDKLHTNHEKHPYYEKPRRSKNTFVVKHYAGEVHYDTQGFLDKNKDTVSDD  519

Query  537  ISLIFSTSKNKFLRSLINFGEEQYLHIVKGSITKKTMLAK-LKYNMDTLIKELRKCDLHY  595
            +S +   SK+KF+  L     E+     KG   KKT   +  K  + +LI  L     HY
Sbjct  520  LSSLLQGSKSKFIIELFTPPREEGDDSDKGREKKKTTAGQTFKTQLQSLINILSSTQPHY  579

Query  596  VRCVKPNRSINNE-WDRKNFQKQLACIGIFDALPLAKCKYPIRLRHQDFYVRY  647
            VRC+KPN +     +DR+  Q QL   G+ + + + K  YPIR  H++F  RY
Sbjct  580  VRCIKPNTTKEPAVYDRELIQAQLRYAGMMETIRIRKLGYPIRHTHKEFRDRY  632


>MYOB_DICDI unnamed protein product
Length=1111

 Score = 236 bits (603),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 188/669 (28%), Positives = 320/669 (48%), Gaps = 70/669 (10%)

Query  10   SQAGWDFITDLGTLPEDENIIIDFLLQRLQRGQIYTWVGSLLLTLNPNNEVSTSHLYNSS  69
            ++ G D +  L  + EDE  I + L +R     IYT +G +L+++NP   ++ S      
Sbjct  7    AKQGTDDLVMLPKVSEDE--ICENLKKRYMNDFIYTNIGPVLISVNPFRNLNNS----GP  60

Query  70   EFNKHIDISHTTYEANPHIFAVAAKAHYNLIKEHGQNAQVIVISGETGTGKTFNACKCLE  129
            +F +     H   E  PH++ +A  A Y  +K   +N Q ++ISGE+G GKT  A   + 
Sbjct  61   DFIEAYRGKHAQ-EVPPHVYQLAESA-YRAMKNDQEN-QCVIISGESGAGKTEAAKLIMG  117

Query  130  FLSNINKWSVQLSQGDCAHNIMLRITDACRLISTFTTACTEKNEISSRHGQLVKLHY-KS  188
            ++S I+  + ++      H I+    ++  L+  F  A T +N  SSR G+  ++ + K+
Sbjct  118  YVSAISGSTEKVEY--VKHVIL----ESNPLLEAFGNAKTLRNNNSSRFGKYFEIQFDKA  171

Query  189  GIISGATINSFLLERNRVT---RGSSNFQIFYQMIFGMSPTELEIFNLSKDKYYDILNVI  245
            G   G  I ++LLE++RV     G  NF IFYQ++ G S  E   + LS  + Y  LN  
Sbjct  172  GDPVGGKIYNYLLEKSRVVYQNPGERNFHIFYQLLAGASAQEKRDYVLSSPESYYYLNQS  231

Query  246  DCNKKKYFQE--SFQDTLNALDILDFKSDQKKNIFQVLALLIHMGNIKFREDGEICAIDF  303
             C       +   + +   A+D +   + ++ +I +++A ++H+GNI F ED +  A  +
Sbjct  232  QCYTVDGINDVSDYAEVRQAMDTIGLTAQEQSDIIRIVACVLHIGNIYFIEDDKGNAAIY  291

Query  304  NNNKSKEALKSTCILSSLTEDTIM-ELLTTILINPQSTWRKHTSYHRHLVTVDACRNRLH  362
            + N  + A    CI S+  ++ I+  ++ T         R   +  +++   +  R+   
Sbjct  292  DPNALELAASMLCIDSATLQNAILFRVINTGGAGGAGNRRSTYNVPQNVEQANGTRD---  348

Query  363  SIIRYMYDLLFHWILNHANKTLSL-KQQYSQWLGILDIFGFESFTKNGIEQLCVNYANEK  421
            ++ R +YD +F W++   N++LS  K  Y   +GILDIFGFE F KNG EQ C+N+ NEK
Sbjct  349  ALARTIYDRMFSWLVERVNQSLSYYKSPYQNVIGILDIFGFEIFEKNGFEQFCINFVNEK  408

Query  422  MQQYFIETCVENNRNDLQEEGFIKICNPSHTINLYKERLNVIEENLFLTLNDACQSPVVI  481
            +QQ+FIE  ++  + +   EG            +  E +      +   L +    P   
Sbjct  409  LQQFFIELTLKAEQEEYVREG------------IKWEPIKYFNNQIVCDLIEGKSPP---  453

Query  482  DILTIIQSVCKNLH----NAQKKFLNEKE-------------GNFIIEHYSGPVTYSIED  524
             I +++  +C  LH       +KFL +               G F I+HY+G VTY  E 
Sbjct  454  GIFSLLDDICSTLHAQSTGTDQKFLEKMAGIYDGHLHWRGMTGAFAIKHYAGEVTYEAEG  513

Query  525  LLSKNTDKVPNEISLIFSTSKNKFLRSLINFGEEQYLHIVKGSITKK---TMLAKLKYNM  581
               KN D +  ++      SK  FL SL N  E+       GS+ KK   T   K+K + 
Sbjct  514  FSDKNKDTLFFDLIEAIQCSKMPFLASLFN--ED------TGSLQKKRPTTAGFKIKTSA  565

Query  582  DTLIKELRKCDLHYVRCVKPNRSIN-NEWDRKNFQKQLACIGIFDALPLAKCKYPIRLRH  640
              L+K L +C  HY+RC+KPN +    +W+    + Q+  +G+ + + + +  +  R   
Sbjct  566  GELMKALSQCTPHYIRCIKPNETKKAKDWENSRVKHQVQYLGLLENVRVRRAGFAYRNTF  625

Query  641  QDFYVRYSR  649
                 RY +
Sbjct  626  DKVLKRYKK  634


>MYOD_DICDI unnamed protein product
Length=1109

 Score = 230 bits (587),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 185/665 (28%), Positives = 326/665 (49%), Gaps = 65/665 (10%)

Query  10   SQAGWDFITDLGTLPEDENIIIDFLLQRLQRGQIYTWVGSLLLTLNPNNEVSTSHLYNSS  69
            SQ G D +  L  +  D   I+D L +R     IYT++G++L+++NP  ++   +LY  S
Sbjct  5    SQHGVDDMVMLSKIANDS--ILDNLKKRYGGDVIYTYIGNVLISVNPFKQIK--NLY--S  58

Query  70   EFNKHIDISHTTYEANPHIFAVAAKAHYNLIKEHGQNAQVIVISGETGTGKTFNACKCLE  129
            E N         YE  PH +AVA   + ++  E GQ +Q ++ISGE+G GKT  A   ++
Sbjct  59   ERNLLEYRGKFRYELPPHAYAVADDMYRSMYAE-GQ-SQCVIISGESGAGKTEAAKLIMQ  116

Query  130  FLSNINKWSVQLSQGDCAHNIMLRITDACRLISTFTTACTEKNEISSRHGQLVKLHYKS-  188
            +++ ++     +S+     +++L   ++  L+  F  A T +N  SSR G+ +++ +   
Sbjct  117  YIAAVSGKGADVSR---VKDVIL---ESNPLLEAFGNAKTLRNNNSSRFGKYMEVQFNGI  170

Query  189  GIISGATINSFLLERNRV---TRGSSNFQIFYQMIFGMSPTELEIFNLSKDKYYDILNVI  245
            G   G  + ++LLE++RV   T+G  NF IFYQ++ G +        L     ++ L+  
Sbjct  171  GDPEGGRVTNYLLEKSRVVYQTKGERNFHIFYQLLSGANQQLKSELRLDTPDKFNYLSAS  230

Query  246  DCNKKKYFQES--FQDTLNALDILDFKSDQKKNIFQVLALLIHMGNIKFREDG-EICAID  302
             C       +S  FQD   A+ ++     ++K +F+++A ++++GN+ F+ +  +  AID
Sbjct  231  GCYTVDGVDDSGEFQDVCKAMKVIGLTDSEQKEVFRLVAAILYLGNVGFKNNAKDEAAID  290

Query  303  FNNNKSKEALKSTCILSSLTEDTIMELL--TTILINPQSTWRKHTSYHRHLVTVDACRNR  360
                +SK+AL++   L      +  + L   TI    Q    + ++Y     +  A  +R
Sbjct  291  ---QQSKKALENFAFLMQTDVSSCEKALCFRTISTGTQGRSARVSTYACPQNSEGAYYSR  347

Query  361  LHSIIRYMYDLLFHWILNHANKTLSLKQ-QYSQWLGILDIFGFESFTKNGIEQLCVNYAN  419
              ++ + +Y  LF WI+   N  L  KQ   S  +GILDI+GFE F KNG EQ+ +NY N
Sbjct  348  -DALAKALYSRLFDWIVGRVNSALGYKQNSQSLMIGILDIYGFEIFEKNGFEQMVINYVN  406

Query  420  EKMQQYFIETCVENNRNDLQEEGFIKICNPSHTINLYKERLNVIEENLFLTLNDACQSPV  479
            E++QQ FIE  ++  + +   EG            +  E+++     +     D  +S  
Sbjct  407  ERLQQIFIELTLKTEQEEYFNEG------------IQWEQIDYFNNKICC---DLIESKK  451

Query  480  VIDILTIIQSVCKNLHNAQKKFLNEKEGNF----------------IIEHYSGPVTYSIE  523
               ILTI+  VC       +KFL+  + +F                 I+HY+G V Y  E
Sbjct  452  PAGILTILDDVCNFPKGDDQKFLDRLKESFSSHAHFQSAAQSSSSFTIKHYAGDVEYCAE  511

Query  524  DLLSKNTDKVPNEISLIFSTSKNKFLRSLINFGEEQYLHIVKGSITKKTMLAKLKYNMDT  583
              + KN D + N++  + + + +K +  L  F E   ++  K      T   K+K ++  
Sbjct  512  GFVDKNKDLLFNDLVELAACTTSKLIPQL--FPE---INCEKDKRKPTTAGFKIKESIGA  566

Query  584  LIKELRKCDLHYVRCVKPNRSIN-NEWDRKNFQKQLACIGIFDALPLAKCKYPIRLRHQD  642
            L+K L  C  HY+RC+KPN +   N++D      Q+  +G+ + + + +  Y  R  +  
Sbjct  567  LVKALSACTPHYIRCIKPNGNKRANDFDTSLVMHQVKYLGLLENVRIRRAGYAYRQTYDK  626

Query  643  FYVRY  647
            F+ RY
Sbjct  627  FFYRY  631



Lambda      K        H
   0.320    0.135    0.398 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11373493824


Query= XP_050469381.1 unconventional myosin-XIX-like isoform X4 [Bombus
huntii]

Length=881
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MYOI_DICDI  unnamed protein product                                   250     7e-69
MYOD_DICDI  unnamed protein product                                   240     4e-66
MYOB_DICDI  unnamed protein product                                   238     2e-65


>MYOI_DICDI unnamed protein product
Length=2357

 Score = 250 bits (639),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 195/653 (30%), Positives = 339/653 (52%), Gaps = 57/653 (9%)

Query  17   ITDLGTLP--EDENIIIDFLLQRLQRGQIYTWVGSLLLTLNPNN--EVSTSHLYNSSEFN  72
            + D+ TLP   +E+++++ L  R ++ +IYT+ GS+L+ +NP     + T+ +  S  F 
Sbjct  15   VEDMITLPILTEESLLLN-LKMRYKKKEIYTYTGSILVAVNPYEILPIYTADIVKSY-FA  72

Query  73   KHIDISHTTYEANPHIFAVAAKAHYNLIKEHGQNAQVIVISGETGTGKTFNACKCLEFLS  132
            K  ++        PHIFAV+  A  N+I+E G+N Q I+ISGE+G GKT +    +++L+
Sbjct  73   KSRNLML------PHIFAVSDAAFTNMIEE-GKN-QSIIISGESGAGKTESTKLIIQYLA  124

Query  133  NINKWSVQLSQGDCAHNIMLRITDACRLISTFTTACTEKNEISSRHGQLVKLHY-KSGII  191
                   Q+ Q          I ++  ++  F  A T +N  SSR G+ +++ + + G I
Sbjct  125  ARTNRHSQVEQ---------MIVESSPILEAFGNAKTIRNNNSSRFGKFIEIQFNREGHI  175

Query  192  SGATINSFLLERNRVTRGSS---NFQIFYQMIFGMSPTELEIFNLSKDKYYDILNVIDCN  248
            SGA I ++LLE++R++  +S   N+ IFYQ++ G S    E   L + + Y  L+   C 
Sbjct  176  SGARIINYLLEKSRISHQASSERNYHIFYQLLAGASDELKEKLKLGEPEDYHYLSQSGCI  235

Query  249  KKKYFQ--ESFQDTLNALDILDFKSDQKKNIFQVLALLIHMGNIKFREDGEICAIDFNNN  306
            + +     E F+    A+++L    D++  IF +++ ++H+GN+KF +  +    + +  
Sbjct  236  RIENINDVEDFEHVKYAMNVLGLPEDKQFTIFSIVSAVLHIGNLKFEKSEKTQGAEGSEV  295

Query  307  KSKEALKSTCILSSLTEDTIMELLTT--ILINPQSTWRKHTSYHRHLVTVDACRNRLHSI  364
             +K+ LK    L S+    +   LT   +LI  Q+            + V+   +   S+
Sbjct  296  SNKDTLKIIAQLLSVDPVKLETCLTIRHVLIRGQNFVIP--------LKVNEAEDTRDSL  347

Query  365  IRYMYDLLFHWILNHANKTLSLKQQYSQWLGILDIFGFESFTKNGIEQLCVNYANEKMQQ  424
             + +Y  +F+W++   N  +   Q+ S ++G+LDIFGFE+F KN  EQ C+N+ANEK+QQ
Sbjct  348  AKALYGNVFNWLVVFINSKIHKPQKNSTFIGVLDIFGFENFKKNSFEQFCINFANEKLQQ  407

Query  425  YFIETCVENNRNDLQEEGFIKICNPSHTINLYKERLNVIEE---NLFLTLNDACQSPVVI  481
            +F +   +  + + ++E   KI       N  +E L++IE+    +   L++  + P   
Sbjct  408  HFNQHIFKLEQEEYEKE---KINWSKIVYNDNQECLDLIEKRPLGILSLLDEESRFPQAT  464

Query  482  DILTIIQSVCKNLH-NAQKKFLNEK----EGNFIIEHYSGPVTYSIEDLLSKNTDKVPNE  536
            D+     +    LH N +K    EK    +  F+++HY+G V Y  +  L KN D V ++
Sbjct  465  DL-----TYLDKLHTNHEKHPYYEKPRRSKNTFVVKHYAGEVHYDTQGFLDKNKDTVSDD  519

Query  537  ISLIFSTSKNKFLRSLINFGEEQYLHIVKGSITKKTMLAK-LKYNMDTLIKELRKCDLHY  595
            +S +   SK+KF+  L     E+     KG   KKT   +  K  + +LI  L     HY
Sbjct  520  LSSLLQGSKSKFIIELFTPPREEGDDSDKGREKKKTTAGQTFKTQLQSLINILSSTQPHY  579

Query  596  VRCVKPNRSINNE-WDRKNFQKQLACIGIFDALPLAKCKYPIRLRHQDFYVRY  647
            VRC+KPN +     +DR+  Q QL   G+ + + + K  YPIR  H++F  RY
Sbjct  580  VRCIKPNTTKEPAVYDRELIQAQLRYAGMMETIRIRKLGYPIRHTHKEFRDRY  632


>MYOD_DICDI unnamed protein product
Length=1109

 Score = 240 bits (613),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 204/739 (28%), Positives = 357/739 (48%), Gaps = 69/739 (9%)

Query  10   SQAGWDFITDLGTLPEDENIIIDFLLQRLQRGQIYTWVGSLLLTLNPNNEVSTSHLYNSS  69
            SQ G D +  L  +  D   I+D L +R     IYT++G++L+++NP  ++   +LY  S
Sbjct  5    SQHGVDDMVMLSKIANDS--ILDNLKKRYGGDVIYTYIGNVLISVNPFKQIK--NLY--S  58

Query  70   EFNKHIDISHTTYEANPHIFAVAAKAHYNLIKEHGQNAQVIVISGETGTGKTFNACKCLE  129
            E N         YE  PH +AVA   + ++  E GQ +Q ++ISGE+G GKT  A   ++
Sbjct  59   ERNLLEYRGKFRYELPPHAYAVADDMYRSMYAE-GQ-SQCVIISGESGAGKTEAAKLIMQ  116

Query  130  FLSNINKWSVQLSQGDCAHNIMLRITDACRLISTFTTACTEKNEISSRHGQLVKLHYKS-  188
            +++ ++     +S+     +++L   ++  L+  F  A T +N  SSR G+ +++ +   
Sbjct  117  YIAAVSGKGADVSR---VKDVIL---ESNPLLEAFGNAKTLRNNNSSRFGKYMEVQFNGI  170

Query  189  GIISGATINSFLLERNRV---TRGSSNFQIFYQMIFGMSPTELEIFNLSKDKYYDILNVI  245
            G   G  + ++LLE++RV   T+G  NF IFYQ++ G +        L     ++ L+  
Sbjct  171  GDPEGGRVTNYLLEKSRVVYQTKGERNFHIFYQLLSGANQQLKSELRLDTPDKFNYLSAS  230

Query  246  DCNKKKYFQES--FQDTLNALDILDFKSDQKKNIFQVLALLIHMGNIKFREDG-EICAID  302
             C       +S  FQD   A+ ++     ++K +F+++A ++++GN+ F+ +  +  AID
Sbjct  231  GCYTVDGVDDSGEFQDVCKAMKVIGLTDSEQKEVFRLVAAILYLGNVGFKNNAKDEAAID  290

Query  303  FNNNKSKEALKSTCILSSLTEDTIMELL--TTILINPQSTWRKHTSYHRHLVTVDACRNR  360
                +SK+AL++   L      +  + L   TI    Q    + ++Y     +  A  +R
Sbjct  291  ---QQSKKALENFAFLMQTDVSSCEKALCFRTISTGTQGRSARVSTYACPQNSEGAYYSR  347

Query  361  LHSIIRYMYDLLFHWILNHANKTLSLKQ-QYSQWLGILDIFGFESFTKNGIEQLCVNYAN  419
              ++ + +Y  LF WI+   N  L  KQ   S  +GILDI+GFE F KNG EQ+ +NY N
Sbjct  348  -DALAKALYSRLFDWIVGRVNSALGYKQNSQSLMIGILDIYGFEIFEKNGFEQMVINYVN  406

Query  420  EKMQQYFIETCVENNRNDLQEEGFIKICNPSHTINLYKERLNVIEENLFLTLNDACQSPV  479
            E++QQ FIE  ++  + +   EG            +  E+++     +     D  +S  
Sbjct  407  ERLQQIFIELTLKTEQEEYFNEG------------IQWEQIDYFNNKICC---DLIESKK  451

Query  480  VIDILTIIQSVCKNLHNAQKKFLNEKEGNF----------------IIEHYSGPVTYSIE  523
               ILTI+  VC       +KFL+  + +F                 I+HY+G V Y  E
Sbjct  452  PAGILTILDDVCNFPKGDDQKFLDRLKESFSSHAHFQSAAQSSSSFTIKHYAGDVEYCAE  511

Query  524  DLLSKNTDKVPNEISLIFSTSKNKFLRSLINFGEEQYLHIVKGSITKKTMLAKLKYNMDT  583
              + KN D + N++  + + + +K +  L  F E   ++  K      T   K+K ++  
Sbjct  512  GFVDKNKDLLFNDLVELAACTTSKLIPQL--FPE---INCEKDKRKPTTAGFKIKESIGA  566

Query  584  LIKELRKCDLHYVRCVKPNRSIN-NEWDRKNFQKQLACIGIFDALPLAKCKYPIRLRHQD  642
            L+K L  C  HY+RC+KPN +   N++D      Q+  +G+ + + + +  Y  R  +  
Sbjct  567  LVKALSACTPHYIRCIKPNGNKRANDFDTSLVMHQVKYLGLLENVRIRRAGYAYRQTYDK  626

Query  643  FYVRYSRKPMEMID--LDKCKLILESIVPKRDLQT-QVHFGKQLIFLTEP-IFLKLESYR  698
            F+ RY     E         +  +E+I+   DL+  Q   GK  IF+  P     LE  R
Sbjct  627  FFYRYRVCCKETWPNWTGGFESGVETILKSMDLEPKQYSKGKTKIFIRAPETVFNLEELR  686

Query  699  RNYRIKYANKIKAFWIKHS  717
                  YANK++ F+++ +
Sbjct  687  ERKVFTYANKLQRFFLRFT  705


>MYOB_DICDI unnamed protein product
Length=1111

 Score = 238 bits (607),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 200/728 (27%), Positives = 343/728 (47%), Gaps = 86/728 (12%)

Query  10   SQAGWDFITDLGTLPEDENIIIDFLLQRLQRGQIYTWVGSLLLTLNPNNEVSTSHLYNSS  69
            ++ G D +  L  + EDE  I + L +R     IYT +G +L+++NP   ++ S      
Sbjct  7    AKQGTDDLVMLPKVSEDE--ICENLKKRYMNDFIYTNIGPVLISVNPFRNLNNS----GP  60

Query  70   EFNKHIDISHTTYEANPHIFAVAAKAHYNLIKEHGQNAQVIVISGETGTGKTFNACKCLE  129
            +F +     H   E  PH++ +A  A Y  +K   +N Q ++ISGE+G GKT  A   + 
Sbjct  61   DFIEAYRGKHAQ-EVPPHVYQLAESA-YRAMKNDQEN-QCVIISGESGAGKTEAAKLIMG  117

Query  130  FLSNINKWSVQLSQGDCAHNIMLRITDACRLISTFTTACTEKNEISSRHGQLVKLHY-KS  188
            ++S I+  + ++      H I+    ++  L+  F  A T +N  SSR G+  ++ + K+
Sbjct  118  YVSAISGSTEKVEY--VKHVIL----ESNPLLEAFGNAKTLRNNNSSRFGKYFEIQFDKA  171

Query  189  GIISGATINSFLLERNRVT---RGSSNFQIFYQMIFGMSPTELEIFNLSKDKYYDILNVI  245
            G   G  I ++LLE++RV     G  NF IFYQ++ G S  E   + LS  + Y  LN  
Sbjct  172  GDPVGGKIYNYLLEKSRVVYQNPGERNFHIFYQLLAGASAQEKRDYVLSSPESYYYLNQS  231

Query  246  DCNKKKYFQE--SFQDTLNALDILDFKSDQKKNIFQVLALLIHMGNIKFREDGEICAIDF  303
             C       +   + +   A+D +   + ++ +I +++A ++H+GNI F ED +  A  +
Sbjct  232  QCYTVDGINDVSDYAEVRQAMDTIGLTAQEQSDIIRIVACVLHIGNIYFIEDDKGNAAIY  291

Query  304  NNNKSKEALKSTCILSSLTEDTIM-ELLTTILINPQSTWRKHTSYHRHLVTVDACRNRLH  362
            + N  + A    CI S+  ++ I+  ++ T         R   +  +++   +  R+   
Sbjct  292  DPNALELAASMLCIDSATLQNAILFRVINTGGAGGAGNRRSTYNVPQNVEQANGTRD---  348

Query  363  SIIRYMYDLLFHWILNHANKTLSL-KQQYSQWLGILDIFGFESFTKNGIEQLCVNYANEK  421
            ++ R +YD +F W++   N++LS  K  Y   +GILDIFGFE F KNG EQ C+N+ NEK
Sbjct  349  ALARTIYDRMFSWLVERVNQSLSYYKSPYQNVIGILDIFGFEIFEKNGFEQFCINFVNEK  408

Query  422  MQQYFIETCVENNRNDLQEEGFIKICNPSHTINLYKERLNVIEENLFLTLNDACQSPVVI  481
            +QQ+FIE  ++  + +   EG            +  E +      +   L +    P   
Sbjct  409  LQQFFIELTLKAEQEEYVREG------------IKWEPIKYFNNQIVCDLIEGKSPP---  453

Query  482  DILTIIQSVCKNLH----NAQKKFLNEKE-------------GNFIIEHYSGPVTYSIED  524
             I +++  +C  LH       +KFL +               G F I+HY+G VTY  E 
Sbjct  454  GIFSLLDDICSTLHAQSTGTDQKFLEKMAGIYDGHLHWRGMTGAFAIKHYAGEVTYEAEG  513

Query  525  LLSKNTDKVPNEISLIFSTSKNKFLRSLINFGEEQYLHIVKGSITKK---TMLAKLKYNM  581
               KN D +  ++      SK  FL SL N  E+       GS+ KK   T   K+K + 
Sbjct  514  FSDKNKDTLFFDLIEAIQCSKMPFLASLFN--ED------TGSLQKKRPTTAGFKIKTSA  565

Query  582  DTLIKELRKCDLHYVRCVKPNRSIN-NEWDRKNFQKQLACIGIFDALPLAKCKYPIRLRH  640
              L+K L +C  HY+RC+KPN +    +W+    + Q+  +G+ + + + +  +  R   
Sbjct  566  GELMKALSQCTPHYIRCIKPNETKKAKDWENSRVKHQVQYLGLLENVRVRRAGFAYRNTF  625

Query  641  QDFYVRYSRKPMEMID---------LDKCKLILESIVPKRDLQT-QVHFGKQLIFLTEP-  689
                 RY +   +            ++ CK I + +    +L+  Q   GK  +F+  P 
Sbjct  626  DKVLKRYKKLSSKTWGIWGEWKGDAIEGCKTIFQDM----NLEAGQWQLGKTKVFIRHPE  681

Query  690  -IFLKLES  696
             +FL  E+
Sbjct  682  TVFLLEEA  689



Lambda      K        H
   0.320    0.135    0.398 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11373493824


Query= XP_050469382.1 SANT and BTB domain regulator of class switch
recombination isoform X1 [Bombus huntii]

Length=847
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q383Z9_TRYB2  unnamed protein product                                 49.7    9e-06
Q23144_CAEEL  unnamed protein product                                 33.1    0.90 
SUZ2_DROME  unnamed protein product                                   32.7    1.6  


>Q383Z9_TRYB2 unnamed protein product
Length=560

 Score = 49.7 bits (117),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 68/346 (20%), Positives = 121/346 (35%), Gaps = 107/346 (31%)

Query  257  DKSKSSKRSTDNEVEIHVCDEEKNIKKNFHCPQKLLIQKMRYF-----------------  299
            D  +S + + +  VE+ V D++ N  + F C   LL   M YF                 
Sbjct  13   DGCESPRGTCERLVEVSVYDKQSNEMRVFRCDLHLLESSMTYFTPIIKCYLDEEERQKSR  72

Query  300  -------ADVTAGQKLE----------------------EIDISVHCDVTIFDWLMRWVK  330
                   A  T  + ++                       I + V+CD++ F WLM +V+
Sbjct  73   EEKSLDRASSTGARSVKNSKTKAHEATKPLKRKGKEEKPPIPLHVNCDMSTFSWLMAYVE  132

Query  331  KDIIKKSEWPVLEINNVIPIMVSASFLQMEPLLESCLQYCRENISDILKTSTVLTGLDDN  390
                ++S  P     N + + +S++FL M  L+E  L Y ++++ +++ +   +      
Sbjct  133  GK--QRSFTP----KNAVSLALSSNFLHMTQLVEMTLLYIKDHLVEVILSGVNMDCFTGE  186

Query  391  LLIRLVEQFTNEDVEALKDKKDKIQSKLFCKLIMSLAEVMPDNK------------RGHY  438
            LL RL    +  DV           ++ F KL    AE  P+ +            R   
Sbjct  187  LLARLASMMSEGDV-----------ARAFLKLFDWHAEDSPNRRFLTALIRHMLCDRFGE  235

Query  439  SSLATLFKCSKCGKNIIQSVSNYV---------PCISSAMK--IDNHGNIHSKHIRD---  484
               ++L  C  CG    Q    ++         P      K  + + G +   H+     
Sbjct  236  GRPSSLRWCGLCGALFDQQELQHIERRYKNVRLPVCPRVTKNSVGHRGELLKTHVASKQE  295

Query  485  -------LTWTLNDYIISLRTELRSWRKVYWRLWGDCHFLFCTQCN  523
                   L+W           E+ +W    WR+ G  +   C +CN
Sbjct  296  ANIKFPPLSWH--------EKEVEAW---AWRVVGSLYLFVCRRCN  330


>Q23144_CAEEL unnamed protein product
Length=371

 Score = 33.1 bits (74),  Expect = 0.90, Method: Compositional matrix adjust.
 Identities = 24/104 (23%), Positives = 50/104 (48%), Gaps = 15/104 (14%)

Query  342  LEINNVIPIMVSASFLQMEPLLESCLQYCRENISDILKTSTVLTGLDDNLLIRLVEQFTN  401
            L +++++P++   S    EPLL +C ++           ST +  LD N LIRL+++   
Sbjct  143  LTLSSIVPVLDMLSHFHSEPLLTNCERF---------LMSTNIGHLDGNHLIRLLDKGLC  193

Query  402  EDVEALKDKKDKIQSKLFCKLIMSLAEVMPDNKRGHYSSLATLF  445
              ++       +I  ++ C  +MS    M D+ +    ++ ++F
Sbjct  194  VSLD------HRILGRILCICLMSPQAKMSDSSQELAGTIGSVF  231


>SUZ2_DROME unnamed protein product
Length=1368

 Score = 32.7 bits (73),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 29/135 (21%), Positives = 58/135 (43%), Gaps = 27/135 (20%)

Query  78   DWGKLTKIDIHYKIQNYNNTDEK-------YINSNVMQKH--------KSIHTAEEISSD  122
            +W + + +   Y+I  Y+N   K        IN ++  +H        KS+  AE++ S+
Sbjct  216  NWSRESPMAFCYRILLYDNEQTKNDENNLSRINQDIEPEHSVRRSKSAKSVTFAEDLESE  275

Query  123  TDDNNIKYSLHCIVPP-------NMQLKNKQTHTYDQNVISDFERCNQIMQNSLRIEDMN  175
             D  + +  + C  PP       N +L + +     ++ +S+F+    +  N +R  D  
Sbjct  276  IDSGSPRSKVRCKTPPKVSPSSKNKRLTSSKREAEPESPVSNFK---SLRSNDMRYSDYA  332

Query  176  IG--RSIDTTENFLI  188
            +   +S    E FL+
Sbjct  333  VSKVKSEPEQEQFLL  347



Lambda      K        H
   0.320    0.135    0.398 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11373493824


Query= XP_050469383.1 SANT and BTB domain regulator of class switch
recombination isoform X2 [Bombus huntii]

Length=846
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q383Z9_TRYB2  unnamed protein product                                 49.3    1e-05
Q23144_CAEEL  unnamed protein product                                 33.1    0.92 
SUZ2_DROME  unnamed protein product                                   32.7    1.6  


>Q383Z9_TRYB2 unnamed protein product
Length=560

 Score = 49.3 bits (116),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 68/346 (20%), Positives = 121/346 (35%), Gaps = 107/346 (31%)

Query  257  DKSKSSKRSTDNEVEIHVCDEEKNIKKNFHCPQKLLIQKMRYF-----------------  299
            D  +S + + +  VE+ V D++ N  + F C   LL   M YF                 
Sbjct  13   DGCESPRGTCERLVEVSVYDKQSNEMRVFRCDLHLLESSMTYFTPIIKCYLDEEERQKSR  72

Query  300  -------ADVTAGQKLE----------------------EIDISVHCDVTIFDWLMRWVK  330
                   A  T  + ++                       I + V+CD++ F WLM +V+
Sbjct  73   EEKSLDRASSTGARSVKNSKTKAHEATKPLKRKGKEEKPPIPLHVNCDMSTFSWLMAYVE  132

Query  331  KDIIKKSEWPVLEINNVIPIMVSASFLQMEPLLESCLQYCRENISDILKTSTVLTGLDDN  390
                ++S  P     N + + +S++FL M  L+E  L Y ++++ +++ +   +      
Sbjct  133  GK--QRSFTP----KNAVSLALSSNFLHMTQLVEMTLLYIKDHLVEVILSGVNMDCFTGE  186

Query  391  LLIRLVEQFTNEDVEALKDKKDKIQSKLFCKLIMSLAEVMPDNK------------RGHY  438
            LL RL    +  DV           ++ F KL    AE  P+ +            R   
Sbjct  187  LLARLASMMSEGDV-----------ARAFLKLFDWHAEDSPNRRFLTALIRHMLCDRFGE  235

Query  439  SSLATLFKCSKCGKNIIQSVSNYV---------PCISSAMK--IDNHGNIHSKHIRD---  484
               ++L  C  CG    Q    ++         P      K  + + G +   H+     
Sbjct  236  GRPSSLRWCGLCGALFDQQELQHIERRYKNVRLPVCPRVTKNSVGHRGELLKTHVASKQE  295

Query  485  -------LTWTLNDYIISLRTELRSWRKVYWRLWGDCHFLFCTQCN  523
                   L+W           E+ +W    WR+ G  +   C +CN
Sbjct  296  ANIKFPPLSWH--------EKEVEAW---AWRVVGSLYLFVCRRCN  330


>Q23144_CAEEL unnamed protein product
Length=371

 Score = 33.1 bits (74),  Expect = 0.92, Method: Compositional matrix adjust.
 Identities = 24/104 (23%), Positives = 50/104 (48%), Gaps = 15/104 (14%)

Query  342  LEINNVIPIMVSASFLQMEPLLESCLQYCRENISDILKTSTVLTGLDDNLLIRLVEQFTN  401
            L +++++P++   S    EPLL +C ++           ST +  LD N LIRL+++   
Sbjct  143  LTLSSIVPVLDMLSHFHSEPLLTNCERF---------LMSTNIGHLDGNHLIRLLDKGLC  193

Query  402  EDVEALKDKKDKIQSKLFCKLIMSLAEVMPDNKRGHYSSLATLF  445
              ++       +I  ++ C  +MS    M D+ +    ++ ++F
Sbjct  194  VSLD------HRILGRILCICLMSPQAKMSDSSQELAGTIGSVF  231


>SUZ2_DROME unnamed protein product
Length=1368

 Score = 32.7 bits (73),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 29/135 (21%), Positives = 58/135 (43%), Gaps = 27/135 (20%)

Query  78   DWGKLTKIDIHYKIQNYNNTDEK-------YINSNVMQKH--------KSIHTAEEISSD  122
            +W + + +   Y+I  Y+N   K        IN ++  +H        KS+  AE++ S+
Sbjct  216  NWSRESPMAFCYRILLYDNEQTKNDENNLSRINQDIEPEHSVRRSKSAKSVTFAEDLESE  275

Query  123  TDDNNIKYSLHCIVPP-------NMQLKNKQTHTYDQNVISDFERCNQIMQNSLRIEDMN  175
             D  + +  + C  PP       N +L + +     ++ +S+F+    +  N +R  D  
Sbjct  276  IDSGSPRSKVRCKTPPKVSPSSKNKRLTSSKREAEPESPVSNFK---SLRSNDMRYSDYA  332

Query  176  IG--RSIDTTENFLI  188
            +   +S    E FL+
Sbjct  333  VSKVKSEPEQEQFLL  347



Lambda      K        H
   0.320    0.135    0.398 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11373493824


Query= XP_050469384.1 lymphoid-specific helicase-like [Bombus huntii]

Length=796
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SMRCD_DROME  unnamed protein product                                  313     2e-94
Q9VPL9_DROME  unnamed protein product                                 299     1e-85
M9NCY5_DROME  unnamed protein product                                 298     1e-85


>SMRCD_DROME unnamed protein product
Length=844

 Score = 313 bits (803),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 201/571 (35%), Positives = 309/571 (54%), Gaps = 56/571 (10%)

Query  180  IIETPRYFKG--ELRDYQKEGLQWLKVLYENGINGILADEMGLGKTVQVIALLCHLIEKR  237
            I+E P+      +L DYQ  GL WL V+++  +NGILADEMGLGKT+QVIA L +L E  
Sbjct  276  IVEQPKLLSSGLQLADYQIIGLNWLTVMHKQEMNGILADEMGLGKTIQVIAFLAYLKENG  335

Query  238  -QGGPYLLVAPLSTLPNWMLEFEKFAPNLPIVLFHGTPEEKLILRSKIKHKYKITETYST  296
                 +L+V P STL NW  E  ++ P L +  +HG+ +E+  +R +        + ++ 
Sbjct  336  LSQAAHLIVVPSSTLDNWEAEISRWCPELVVEKYHGSQDERRRMRGRFAK-----DGFTG  390

Query  297  FPIVLTSFEV---PLLESSFIKSLSWRYIIIDEGHRIKNHECQLIKILKACKSMNRLLLT  353
            F ++LT++ +      E    +     Y+I DE H +KN   Q    L    +  R+LLT
Sbjct  391  FDVLLTTYHIVGSTPEERKMFRVCKLDYVIFDEAHMLKNMTTQRYANLITINARMRILLT  450

Query  354  GTPLQNNLAELWSLLNFLLPEIF-DDLAVFESWFDAKKHQGDEGAKKFLKLEEEKRVLSS  412
            GTPLQNNL EL SLL F++P+ F   +   +S F AKK + D    +  + +E +  +  
Sbjct  451  GTPLQNNLLELISLLCFVMPKFFAKSIEDIKSLF-AKKGKSDGDQDEVSQFQETQ--IQR  507

Query  413  LREILQPFLLRREKSEVCLDIPPKKELVVYAPLTELQ----HSLYKAVLNHDIDQLSKIE  468
             + I++PF+LRR K +V  ++P K  LV   P++  Q    H L     N+  +  S  E
Sbjct  508  AKRIMKPFVLRRLKKDVLKNLPKKLSLVEKVPMSSQQKIYYHELVDYYSNNKGEVCSSSE  567

Query  469  EEPIIYTEDGKRPKRKCALRNMNNIMSTYLDNDVSSNSSLQQIDDSGDSETWINVKSGNE  528
               I    + +R      + N   +M  Y      ++++L+     G S+   N  S  +
Sbjct  568  RAGIAIMMEMRR------IANHPLLMRHYF-----TDANLR-----GFSKRLANASSFKK  611

Query  529  ENLLMWKKYTDVTERNKDFLINVQTRHISLYKKIVNHPYLIHCPLGPDFLPQINEELVRS  588
             N    ++Y         F          +Y+ +  H +         +  +I + L+  
Sbjct  612  TN----EQYI--------FEELAVMSDFQVYQMMNKHEF---------YDVKIPDNLICD  650

Query  589  SGKLLVLDAMLARLKKHGHKVLLFSTMTMILDVIEDYLSLRDYKYVRLDGSTKLVDRKEN  648
            SGK L LD +L +LK  GH+VLLFS  TM+LD++E+YL +R + + RLDG+T +  R++ 
Sbjct  651  SGKFLYLDTLLPKLKAEGHRVLLFSQFTMMLDIVEEYLRIRKFGFCRLDGATAVNVRQDL  710

Query  649  IHNFNTNPEIFLFLISTRAGGIGLNLVGADTVIIYDCDWNPQADIQAMARCHRIGQTRPV  708
            I +FN +  IF+FL+ST+AGG+G+NL  ADT +I+D D+NP  D QA  RCHR+GQ RPV
Sbjct  711  ITDFNGDDSIFVFLLSTKAGGVGINLTAADTCVIHDIDFNPYNDKQAEDRCHRMGQQRPV  770

Query  709  VIYKLCTKGTIDEAIINRADAKRLLEKVVIS  739
             IY+L ++ TI+E I+  A+ K  LEK + S
Sbjct  771  TIYRLISESTIEEGILMAAEEKLKLEKDITS  801


>Q9VPL9_DROME unnamed protein product
Length=5322

 Score = 299 bits (765),  Expect = 1e-85, Method: Composition-based stats.
 Identities = 213/628 (34%), Positives = 325/628 (52%), Gaps = 116/628 (18%)

Query  182   ETPRYFKG-ELRDYQKEGLQWLKVLYENGINGILADEMGLGKTVQVIALLCHLIEKRQGG  240
             +TP Y  G  LR YQ EGL WLK  + N  N ILADEMGLGKT+Q +  +  + E    G
Sbjct  2019  KTPVYKGGNSLRPYQLEGLNWLKFSWYNTHNCILADEMGLGKTIQSLTFVHSVYEYGIRG  2078

Query  241   PYLLVAPLSTLPNWMLEFEKFAPNLPIVLFHGTPEEKLILRSKIKHKYK-----ITETYS  295
             P+L++APLST+PNW  EFE +  ++ +V++HG+   K +++   ++ YK     + +   
Sbjct  2079  PFLVIAPLSTIPNWQREFEGWT-DMNVVVYHGSVTSKQMIQD-YEYYYKTESGKVLKEPI  2136

Query  296   TFPIVLTSFEVPLLESSFIKSLSWRYIIIDEGHRIKNHECQLIKILKACKSMNRLLLTGT  355
              F +++T+FE+ + +   +K+ +WR  +IDE HR+KN  C+L++ L+     +R+LL+GT
Sbjct  2137  KFNVLITTFEMIVTDYMDLKAFNWRLCVIDEAHRLKNRNCKLLEGLRQLNLEHRVLLSGT  2196

Query  356   PLQNNLAELWSLLNFLLPEIFDDLAVFESWFDAKKHQGDEGAKKFLKLEEEKRVLSSLRE  415
             PLQNN++EL+SLLNFL P  F     F S F +            L+ EEE   ++ L+ 
Sbjct  2197  PLQNNISELFSLLNFLEPSQFSSQEEFMSEFGS------------LRTEEE---VNKLQA  2241

Query  416   ILQPFLLRREKSEVCLDIPPKKELVVYAPLTELQHSLYKAVLNHDIDQLSKIEEEPIIYT  475
             +L+P +LRR                                L  D+++    +EE II  
Sbjct  2242  LLKPMMLRR--------------------------------LKDDVEKSLAPKEETIIEV  2269

Query  476   EDGKRPKRKCALRNMNNIMSTYLDNDVSSNSSLQQIDDSGDSETWINVKSGNEENLLMWK  535
             E             + NI   Y    +                         E+N    K
Sbjct  2270  E-------------LTNIQKKYYRGIL-------------------------EQNFSFLK  2291

Query  536   KYTDVTERNKDFLINVQTRHISLYKKIVNHPYLIHCP---LGPDFLPQINEE-------L  585
             K T  T  N   L+N         +K   HPYL++     +  DF  Q  E+       L
Sbjct  2292  KGT--TSANIPNLMNTMME----LRKCCIHPYLLNGAEEQIQYDFKSQHGEDPESYYKNL  2345

Query  586   VRSSGKLLVLDAMLARLKKHGHKVLLFSTMTMILDVIEDYLSLRDYKYVRLDGSTKLVDR  645
             + S+GK++++D +L +LK +GH+VL+FS M   LD++EDYL  R Y + R+DG  +   R
Sbjct  2346  ILSAGKMVLIDKLLPKLKANGHRVLIFSQMVRCLDILEDYLVYRKYPFERIDGRIRGNLR  2405

Query  646   KENIHNFNT-NPEIFLFLISTRAGGIGLNLVGADTVIIYDCDWNPQADIQAMARCHRIGQ  704
             +E I  ++    + F+FL+ T+AGG+G+NL  ADTVIIYD DWNPQ D+QA ARCHRIGQ
Sbjct  2406  QEAIDRYSKPGSDRFVFLLCTKAGGLGINLTAADTVIIYDSDWNPQNDLQAQARCHRIGQ  2465

Query  705   TRPVVIYKLCTKGTIDEAIINRADAKRLLEKVVI-SKHIQSINVNNKADLLK--LQKLLG  761
              + V IY+L  + T +  + ++A  K  L+K V+ S + Q     N   L K  ++ LL 
Sbjct  2466  RKMVKIYRLLCRNTYEREMFDKASMKLGLDKAVLQSMNTQGSKDGNNKQLSKKEIEDLLK  2525

Query  762   SKECQIVASENEV---FTEEELNNLLDR  786
                   V  ++     F EE+++++L R
Sbjct  2526  KGAYGAVMDDDNAGDKFCEEDIDSILKR  2553


>M9NCY5_DROME unnamed protein product
Length=5343

 Score = 298 bits (764),  Expect = 1e-85, Method: Composition-based stats.
 Identities = 213/628 (34%), Positives = 325/628 (52%), Gaps = 116/628 (18%)

Query  182   ETPRYFKG-ELRDYQKEGLQWLKVLYENGINGILADEMGLGKTVQVIALLCHLIEKRQGG  240
             +TP Y  G  LR YQ EGL WLK  + N  N ILADEMGLGKT+Q +  +  + E    G
Sbjct  2019  KTPVYKGGNSLRPYQLEGLNWLKFSWYNTHNCILADEMGLGKTIQSLTFVHSVYEYGIRG  2078

Query  241   PYLLVAPLSTLPNWMLEFEKFAPNLPIVLFHGTPEEKLILRSKIKHKYK-----ITETYS  295
             P+L++APLST+PNW  EFE +  ++ +V++HG+   K +++   ++ YK     + +   
Sbjct  2079  PFLVIAPLSTIPNWQREFEGWT-DMNVVVYHGSVTSKQMIQD-YEYYYKTESGKVLKEPI  2136

Query  296   TFPIVLTSFEVPLLESSFIKSLSWRYIIIDEGHRIKNHECQLIKILKACKSMNRLLLTGT  355
              F +++T+FE+ + +   +K+ +WR  +IDE HR+KN  C+L++ L+     +R+LL+GT
Sbjct  2137  KFNVLITTFEMIVTDYMDLKAFNWRLCVIDEAHRLKNRNCKLLEGLRQLNLEHRVLLSGT  2196

Query  356   PLQNNLAELWSLLNFLLPEIFDDLAVFESWFDAKKHQGDEGAKKFLKLEEEKRVLSSLRE  415
             PLQNN++EL+SLLNFL P  F     F S F +            L+ EEE   ++ L+ 
Sbjct  2197  PLQNNISELFSLLNFLEPSQFSSQEEFMSEFGS------------LRTEEE---VNKLQA  2241

Query  416   ILQPFLLRREKSEVCLDIPPKKELVVYAPLTELQHSLYKAVLNHDIDQLSKIEEEPIIYT  475
             +L+P +LRR                                L  D+++    +EE II  
Sbjct  2242  LLKPMMLRR--------------------------------LKDDVEKSLAPKEETIIEV  2269

Query  476   EDGKRPKRKCALRNMNNIMSTYLDNDVSSNSSLQQIDDSGDSETWINVKSGNEENLLMWK  535
             E             + NI   Y    +                         E+N    K
Sbjct  2270  E-------------LTNIQKKYYRGIL-------------------------EQNFSFLK  2291

Query  536   KYTDVTERNKDFLINVQTRHISLYKKIVNHPYLIHCP---LGPDFLPQINEE-------L  585
             K T  T  N   L+N         +K   HPYL++     +  DF  Q  E+       L
Sbjct  2292  KGT--TSANIPNLMNTMME----LRKCCIHPYLLNGAEEQIQYDFKSQHGEDPESYYKNL  2345

Query  586   VRSSGKLLVLDAMLARLKKHGHKVLLFSTMTMILDVIEDYLSLRDYKYVRLDGSTKLVDR  645
             + S+GK++++D +L +LK +GH+VL+FS M   LD++EDYL  R Y + R+DG  +   R
Sbjct  2346  ILSAGKMVLIDKLLPKLKANGHRVLIFSQMVRCLDILEDYLVYRKYPFERIDGRIRGNLR  2405

Query  646   KENIHNFNT-NPEIFLFLISTRAGGIGLNLVGADTVIIYDCDWNPQADIQAMARCHRIGQ  704
             +E I  ++    + F+FL+ T+AGG+G+NL  ADTVIIYD DWNPQ D+QA ARCHRIGQ
Sbjct  2406  QEAIDRYSKPGSDRFVFLLCTKAGGLGINLTAADTVIIYDSDWNPQNDLQAQARCHRIGQ  2465

Query  705   TRPVVIYKLCTKGTIDEAIINRADAKRLLEKVVI-SKHIQSINVNNKADLLK--LQKLLG  761
              + V IY+L  + T +  + ++A  K  L+K V+ S + Q     N   L K  ++ LL 
Sbjct  2466  RKMVKIYRLLCRNTYEREMFDKASMKLGLDKAVLQSMNTQGSKDGNNKQLSKKEIEDLLK  2525

Query  762   SKECQIVASENEV---FTEEELNNLLDR  786
                   V  ++     F EE+++++L R
Sbjct  2526  KGAYGAVMDDDNAGDKFCEEDIDSILKR  2553



Lambda      K        H
   0.320    0.135    0.398 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11373493824


Query= XP_050469385.1 uncharacterized protein LOC126863359 isoform X1
[Bombus huntii]

Length=711
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8IRW9_DROME  unnamed protein product                                 247     2e-71
O76875_DROME  unnamed protein product                                 241     3e-71
Q960E5_DROME  unnamed protein product                                 246     3e-71


>Q8IRW9_DROME unnamed protein product
Length=742

 Score = 247 bits (630),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 119/265 (45%), Positives = 172/265 (65%), Gaps = 8/265 (3%)

Query  451  YEPILVVDERKCARCYRVFYVNQNNGEYLYHEPCVYHWGKLRSGLVAGTHCDTWECC-RG  509
            + P+     + CARC R F V++  G+YL HE C YH GK +      +H   W CC  G
Sbjct  473  FVPVERSLSKPCARCKRHFLVDELTGQYLTHEECQYHSGKYQRYYDGVSH-GRWTCCNEG  531

Query  510  RDNAQGCTIARMHVWTGLTPGYNGPFDGYVRTRLARTVPTDGNYGVYALDCEMCFTRRGL  569
             +++ GC +   HVW+G   G NGP+  +VRT    +   +    VYALDCEM +T RGL
Sbjct  532  EESSPGCCLGDRHVWSGSVVGVNGPYYDFVRTEHRGS--GEDEPAVYALDCEMSYTGRGL  589

Query  570  ELAKVTVVGIDGKVVYDTLVKPDTEVIDYNTRFSGITAKDLAKATKTLRDVQRDLTSFVH  629
            ++ KV++V ++G++VY+  V+P  ++IDYNT++SGIT  DL    K+L +VQRDL   + 
Sbjct  590  DVTKVSLVALNGQLVYEHFVRPVCDIIDYNTQYSGITETDLCSGAKSLAEVQRDLLQLIT  649

Query  630  AETILIGHGLENDLRALRLLHTTVIDTCVAFPHFLGYPFRSSLKTLARTVLRREIQV---  686
            A+TILIGHGLENDLRALRL+H T+IDT ++FPH  G+P+R +L+ L +  L+R+IQ    
Sbjct  650  ADTILIGHGLENDLRALRLVHNTLIDTSISFPHCNGFPYRRALRHLTKVHLKRDIQAGDG  709

Query  687  -KGHDSVEDARIVMDLMLRKLQHDI  710
              GH S ED+R  M+LML ++  ++
Sbjct  710  TTGHSSFEDSRACMELMLWRVNREL  734


>O76875_DROME unnamed protein product
Length=515

 Score = 241 bits (614),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 118/256 (46%), Positives = 169/256 (66%), Gaps = 8/256 (3%)

Query  460  RKCARCYRVFYVNQNNGEYLYHEPCVYHWGKLRSGLVAGTHCDTWECC-RGRDNAQGCTI  518
            + CARC R F V++  G+YL HE C YH GK +      +H   W CC  G +++ GC +
Sbjct  255  KPCARCKRHFLVDELTGQYLTHEECQYHSGKYQRYYDGVSH-GRWTCCNEGEESSPGCCL  313

Query  519  ARMHVWTGLTPGYNGPFDGYVRTRLARTVPTDGNYGVYALDCEMCFTRRGLELAKVTVVG  578
               HVW+G   G NGP+  +VRT    +   +    VYALDCEM +T RGL++ KV++V 
Sbjct  314  GDRHVWSGSVVGVNGPYYDFVRTEHRGS--GEDEPAVYALDCEMSYTGRGLDVTKVSLVA  371

Query  579  IDGKVVYDTLVKPDTEVIDYNTRFSGITAKDLAKATKTLRDVQRDLTSFVHAETILIGHG  638
            ++G++VY+  V+P  ++IDYNT++SGIT  DL    K+L +VQRDL   + A+TILIGHG
Sbjct  372  LNGQLVYEHFVRPVCDIIDYNTQYSGITETDLCSGAKSLAEVQRDLLQLITADTILIGHG  431

Query  639  LENDLRALRLLHTTVIDTCVAFPHFLGYPFRSSLKTLARTVLRREIQV----KGHDSVED  694
            LENDLRALRL+H T+IDT ++FPH  G+P+R +L+ L +  L+R+IQ      GH S ED
Sbjct  432  LENDLRALRLVHNTLIDTSISFPHCNGFPYRRALRHLTKVHLKRDIQAGDGTTGHSSFED  491

Query  695  ARIVMDLMLRKLQHDI  710
            +R  M+LML ++  ++
Sbjct  492  SRACMELMLWRVNREL  507


>Q960E5_DROME unnamed protein product
Length=757

 Score = 246 bits (629),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 119/265 (45%), Positives = 172/265 (65%), Gaps = 8/265 (3%)

Query  451  YEPILVVDERKCARCYRVFYVNQNNGEYLYHEPCVYHWGKLRSGLVAGTHCDTWECC-RG  509
            + P+     + CARC R F V++  G+YL HE C YH GK +      +H   W CC  G
Sbjct  488  FVPVERSLSKPCARCKRHFLVDELTGQYLTHEECQYHSGKYQRYYDGVSH-GRWTCCNEG  546

Query  510  RDNAQGCTIARMHVWTGLTPGYNGPFDGYVRTRLARTVPTDGNYGVYALDCEMCFTRRGL  569
             +++ GC +   HVW+G   G NGP+  +VRT    +   +    VYALDCEM +T RGL
Sbjct  547  EESSPGCCLGDRHVWSGSVVGVNGPYYDFVRTEHRGS--GEDEPAVYALDCEMSYTGRGL  604

Query  570  ELAKVTVVGIDGKVVYDTLVKPDTEVIDYNTRFSGITAKDLAKATKTLRDVQRDLTSFVH  629
            ++ KV++V ++G++VY+  V+P  ++IDYNT++SGIT  DL    K+L +VQRDL   + 
Sbjct  605  DVTKVSLVALNGQLVYEHFVRPVCDIIDYNTQYSGITETDLCSGAKSLAEVQRDLLQLIT  664

Query  630  AETILIGHGLENDLRALRLLHTTVIDTCVAFPHFLGYPFRSSLKTLARTVLRREIQV---  686
            A+TILIGHGLENDLRALRL+H T+IDT ++FPH  G+P+R +L+ L +  L+R+IQ    
Sbjct  665  ADTILIGHGLENDLRALRLVHNTLIDTSISFPHCNGFPYRRALRHLTKVHLKRDIQAGDG  724

Query  687  -KGHDSVEDARIVMDLMLRKLQHDI  710
              GH S ED+R  M+LML ++  ++
Sbjct  725  TTGHSSFEDSRACMELMLWRVNREL  749



Lambda      K        H
   0.320    0.135    0.398 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11373493824


Query= XP_050469386.1 uncharacterized protein LOC126863359 isoform X2
[Bombus huntii]

Length=683
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8IRW9_DROME  unnamed protein product                                 246     2e-71
Q960E5_DROME  unnamed protein product                                 246     3e-71
O76875_DROME  unnamed protein product                                 240     3e-71


>Q8IRW9_DROME unnamed protein product
Length=742

 Score = 246 bits (629),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 119/265 (45%), Positives = 172/265 (65%), Gaps = 8/265 (3%)

Query  423  YEPILVVDERKCARCYRVFYVNQNNGEYLYHEPCVYHWGKLRSGLVAGTHCDTWECC-RG  481
            + P+     + CARC R F V++  G+YL HE C YH GK +      +H   W CC  G
Sbjct  473  FVPVERSLSKPCARCKRHFLVDELTGQYLTHEECQYHSGKYQRYYDGVSH-GRWTCCNEG  531

Query  482  RDNAQGCTIARMHVWTGLTPGYNGPFDGYVRTRLARTVPTDGNYGVYALDCEMCFTRRGL  541
             +++ GC +   HVW+G   G NGP+  +VRT    +   +    VYALDCEM +T RGL
Sbjct  532  EESSPGCCLGDRHVWSGSVVGVNGPYYDFVRTEHRGS--GEDEPAVYALDCEMSYTGRGL  589

Query  542  ELAKVTVVGIDGKVVYDTLVKPDTEVIDYNTRFSGITAKDLAKATKTLRDVQRDLTSFVH  601
            ++ KV++V ++G++VY+  V+P  ++IDYNT++SGIT  DL    K+L +VQRDL   + 
Sbjct  590  DVTKVSLVALNGQLVYEHFVRPVCDIIDYNTQYSGITETDLCSGAKSLAEVQRDLLQLIT  649

Query  602  AETILIGHGLENDLRALRLLHTTVIDTCVAFPHFLGYPFRSSLKTLARTVLRREIQV---  658
            A+TILIGHGLENDLRALRL+H T+IDT ++FPH  G+P+R +L+ L +  L+R+IQ    
Sbjct  650  ADTILIGHGLENDLRALRLVHNTLIDTSISFPHCNGFPYRRALRHLTKVHLKRDIQAGDG  709

Query  659  -KGHDSVEDARIVMDLMLRKLQHDI  682
              GH S ED+R  M+LML ++  ++
Sbjct  710  TTGHSSFEDSRACMELMLWRVNREL  734


>Q960E5_DROME unnamed protein product
Length=757

 Score = 246 bits (628),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 119/265 (45%), Positives = 172/265 (65%), Gaps = 8/265 (3%)

Query  423  YEPILVVDERKCARCYRVFYVNQNNGEYLYHEPCVYHWGKLRSGLVAGTHCDTWECC-RG  481
            + P+     + CARC R F V++  G+YL HE C YH GK +      +H   W CC  G
Sbjct  488  FVPVERSLSKPCARCKRHFLVDELTGQYLTHEECQYHSGKYQRYYDGVSH-GRWTCCNEG  546

Query  482  RDNAQGCTIARMHVWTGLTPGYNGPFDGYVRTRLARTVPTDGNYGVYALDCEMCFTRRGL  541
             +++ GC +   HVW+G   G NGP+  +VRT    +   +    VYALDCEM +T RGL
Sbjct  547  EESSPGCCLGDRHVWSGSVVGVNGPYYDFVRTEHRGS--GEDEPAVYALDCEMSYTGRGL  604

Query  542  ELAKVTVVGIDGKVVYDTLVKPDTEVIDYNTRFSGITAKDLAKATKTLRDVQRDLTSFVH  601
            ++ KV++V ++G++VY+  V+P  ++IDYNT++SGIT  DL    K+L +VQRDL   + 
Sbjct  605  DVTKVSLVALNGQLVYEHFVRPVCDIIDYNTQYSGITETDLCSGAKSLAEVQRDLLQLIT  664

Query  602  AETILIGHGLENDLRALRLLHTTVIDTCVAFPHFLGYPFRSSLKTLARTVLRREIQV---  658
            A+TILIGHGLENDLRALRL+H T+IDT ++FPH  G+P+R +L+ L +  L+R+IQ    
Sbjct  665  ADTILIGHGLENDLRALRLVHNTLIDTSISFPHCNGFPYRRALRHLTKVHLKRDIQAGDG  724

Query  659  -KGHDSVEDARIVMDLMLRKLQHDI  682
              GH S ED+R  M+LML ++  ++
Sbjct  725  TTGHSSFEDSRACMELMLWRVNREL  749


>O76875_DROME unnamed protein product
Length=515

 Score = 240 bits (613),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 119/265 (45%), Positives = 172/265 (65%), Gaps = 8/265 (3%)

Query  423  YEPILVVDERKCARCYRVFYVNQNNGEYLYHEPCVYHWGKLRSGLVAGTHCDTWECC-RG  481
            + P+     + CARC R F V++  G+YL HE C YH GK +      +H   W CC  G
Sbjct  246  FVPVERSLSKPCARCKRHFLVDELTGQYLTHEECQYHSGKYQRYYDGVSH-GRWTCCNEG  304

Query  482  RDNAQGCTIARMHVWTGLTPGYNGPFDGYVRTRLARTVPTDGNYGVYALDCEMCFTRRGL  541
             +++ GC +   HVW+G   G NGP+  +VRT    +   +    VYALDCEM +T RGL
Sbjct  305  EESSPGCCLGDRHVWSGSVVGVNGPYYDFVRTEHRGS--GEDEPAVYALDCEMSYTGRGL  362

Query  542  ELAKVTVVGIDGKVVYDTLVKPDTEVIDYNTRFSGITAKDLAKATKTLRDVQRDLTSFVH  601
            ++ KV++V ++G++VY+  V+P  ++IDYNT++SGIT  DL    K+L +VQRDL   + 
Sbjct  363  DVTKVSLVALNGQLVYEHFVRPVCDIIDYNTQYSGITETDLCSGAKSLAEVQRDLLQLIT  422

Query  602  AETILIGHGLENDLRALRLLHTTVIDTCVAFPHFLGYPFRSSLKTLARTVLRREIQV---  658
            A+TILIGHGLENDLRALRL+H T+IDT ++FPH  G+P+R +L+ L +  L+R+IQ    
Sbjct  423  ADTILIGHGLENDLRALRLVHNTLIDTSISFPHCNGFPYRRALRHLTKVHLKRDIQAGDG  482

Query  659  -KGHDSVEDARIVMDLMLRKLQHDI  682
              GH S ED+R  M+LML ++  ++
Sbjct  483  TTGHSSFEDSRACMELMLWRVNREL  507



Lambda      K        H
   0.320    0.135    0.398 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11373493824


Query= XP_050469387.1 transducin beta-like protein 2 isoform X3 [Bombus
huntii]

Length=461
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VPL0_DROME  unnamed protein product                                 62.8    1e-10
GBB2_CAEEL  unnamed protein product                                   58.9    3e-09
TAF5_DROME  unnamed protein product                                   58.5    7e-09


>Q9VPL0_DROME unnamed protein product
Length=347

 Score = 62.8 bits (151),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 55/230 (24%), Positives = 104/230 (45%), Gaps = 19/230 (8%)

Query  100  VGVLKGHTGPVLDMNFSSNGRFLASCAEDRTVLLWCTKELTIKEKRSLRVNIEFDHATLV  159
            V  + GH+G V++ +F+ +G  + +C+ D+T+  W     T + +R  + +  F     V
Sbjct  91   VMAMSGHSGAVMEAHFTPDGSHIFTCSTDKTLAFWDIA--TGQRQRRFKGHGNF--VNSV  146

Query  160  RWSPDSKAFLIHKAVANTIEVYKISKKPDGTLASAIKTLEFPKRHTEDVVGMDIACTGKY  219
            + S   +  L   +   TI+++   KK       A  TLE P +    V  +    TG+ 
Sbjct  147  QGSRRGQQLLCSGSDDRTIKIWDARKK------HAAHTLESPFQ----VTAVCFGDTGEQ  196

Query  220  IITCSKMNDLVVWDLKGQ-VLATIELHLGSTYRARISPCGRFVGTSGFTPDANIWEIVFS  278
            +I+    N++ +WD++ Q VL  +  H  +     +SP G F+ T+       +W++   
Sbjct  197  VISGGIDNEVKIWDIRKQAVLHHLRGHSDTITGMSLSPEGDFILTNAMDNTLRVWDVRPY  256

Query  279  KSGEFKQVVKAFDLAGHS--SGILDFTFSADSSCMATVSKDETYRLYDIK  326
              GE  + VK F    H+    +L   +S  S  + + S D    ++D+ 
Sbjct  257  APGE--RCVKVFQGHQHNFEKNLLRCAWSPGSDKITSGSADRHVYIWDVN  304


 Score = 45.1 bits (105),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 41/87 (47%), Gaps = 7/87 (8%)

Query  239  LATIELHLGSTYRARISPCGRFVGTSGFTPDANIWEIVFSKSGEFKQVVKAFDLAGHSSG  298
            +  +E H G  + A   P G  + +SGF     IW++       ++       ++GHS  
Sbjct  48   IMQLEGHEGEIFTAEFHPEGELLLSSGFDRQIYIWQV-------YEDCENVMAMSGHSGA  100

Query  299  ILDFTFSADSSCMATVSKDETYRLYDI  325
            +++  F+ D S + T S D+T   +DI
Sbjct  101  VMEAHFTPDGSHIFTCSTDKTLAFWDI  127


>GBB2_CAEEL unnamed protein product
Length=356

 Score = 58.9 bits (141),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 58/230 (25%), Positives = 105/230 (46%), Gaps = 21/230 (9%)

Query  102  VLKGHTGPVLDMNFSSNGRFLASCAEDRTVLLWCTKELTIKEKRSLRVNIEFDHATLVRW  161
            +LKGH G VL M++S + R + S ++D  V++W     T  ++ +L +   +  A    +
Sbjct  63   ILKGHVGKVLCMDWSLDKRHIVSSSQDGKVIVW--DGFTTNKEHALTMPTTWVMA--CAF  118

Query  162  SPDSKAFLIHKAVANTIEVYKISKKPDGTLASAIKTLEFPKRHTEDVVGMDIACTGKYII  221
            SP S+  +    + N   V  +S + D      I+       HT  +       +   I+
Sbjct  119  SPSSQ-MIACGGLDNKCSVVPLSFEDD-----IIQKKRQVATHTSYMSCCTFLRSDNLIL  172

Query  222  TCSKMNDLVVWDLK-GQVLATIELHLGSTYRARISPC--GRFVGTSGFTPDANIWEIVFS  278
            T S  +   +WD++ GQ++     H G  +   +  C  G    ++G    + +W+I   
Sbjct  173  TGSGDSTCAIWDVESGQLIQNFHGHTGDVFAIDVPKCDTGNTFISAGADKHSLVWDI---  229

Query  279  KSGEFKQVVKAFDLAGHSSGILDFTFSADSSCMATVSKDETYRLYDIKIE  328
            +SG   Q V++F+  GH + I    F  +    AT S D T RL+D++ +
Sbjct  230  RSG---QCVQSFE--GHEADINTVRFHPNGDAFATGSDDATCRLFDLRAD  274


 Score = 33.5 bits (75),  Expect = 0.31, Method: Compositional matrix adjust.
 Identities = 31/152 (20%), Positives = 63/152 (41%), Gaps = 5/152 (3%)

Query  176  NTIEVYKISKKPDGTLASAIKTLEFPKRHTEDVVGMDIACTGKYIITCSKMNDLVVWD-L  234
            N I + + +++ D   A  +K     K H   V+ MD +   ++I++ S+   ++VWD  
Sbjct  39   NDIPIQQAAERLDVMGALGVKQRRILKGHVGKVLCMDWSLDKRHIVSSSQDGKVIVWDGF  98

Query  235  KGQVLATIELHLGSTYRARISPCGRFVGTSGFTPDANIWEIVFSKSGEFKQVVKAFDLAG  294
                   + +          SP  + +   G     ++  + F    E   + K   +A 
Sbjct  99   TTNKEHALTMPTTWVMACAFSPSSQMIACGGLDNKCSVVPLSF----EDDIIQKKRQVAT  154

Query  295  HSSGILDFTFSADSSCMATVSKDETYRLYDIK  326
            H+S +   TF    + + T S D T  ++D++
Sbjct  155  HTSYMSCCTFLRSDNLILTGSGDSTCAIWDVE  186


>TAF5_DROME unnamed protein product
Length=704

 Score = 58.5 bits (140),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 55/224 (25%), Positives = 86/224 (38%), Gaps = 23/224 (10%)

Query  103  LKGHTGPVLDMNFSSNGRFLASCAEDRTVLLWCTKELTIKEKRSLRVNIEFDHATLVRWS  162
            L GHTGPV    F+     L SC+ED T+ LW     +        V   +D    VR++
Sbjct  446  LMGHTGPVYRCAFAPEMNLLLSCSEDSTIRLWSLLTWSCVVTYRGHVYPVWD----VRFA  501

Query  163  PDSKAFLIHKAVANTIEVYKISKKPDGTLASAIKTLEFPKRHTEDVVGMDIACTGKYIIT  222
            P    F +  +   T  ++              + L     H  DV  +       Y+ T
Sbjct  502  PHGYYF-VSCSYDKTARLWATDSN---------QALRVFVGHLSDVDCVQFHPNSNYVAT  551

Query  223  CSKMNDLVVWD-LKGQVLATIELHLGSTYRARISPCGRFVGTSGFTPDANIWEIVFSKSG  281
             S    + +WD + GQ +  +  H GS      S CGR++ +     +  IW++    +G
Sbjct  552  GSSDRTVRLWDNMTGQSVRLMTGHKGSVSSLAFSACGRYLASGSVDHNIIIWDL---SNG  608

Query  282  EFKQVVKAFDLAGHSSGILDFTFSADSSCMATVSKDETYRLYDI  325
                      L  H+S +   TFS D + +A    D    L+D 
Sbjct  609  SLVTT-----LLRHTSTVTTITFSRDGTVLAAAGLDNNLTLWDF  647


 Score = 55.1 bits (131),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 38/178 (21%), Positives = 80/178 (45%), Gaps = 17/178 (10%)

Query  100  VGVLKGHTGPVLDMNFSSNGRFLASCAEDRTVLLWCTKELTIKEKRSLRVNI-EFDHATL  158
            V   +GH  PV D+ F+ +G +  SC+ D+T  LW T        ++LRV +        
Sbjct  485  VVTYRGHVYPVWDVRFAPHGYYFVSCSYDKTARLWAT-----DSNQALRVFVGHLSDVDC  539

Query  159  VRWSPDSKAFLIHKAVANTIEVYKISKKPDGTLASAIKTLEFPKRHTEDVVGMDIACTGK  218
            V++ P+S  ++   +   T+ ++      D     +++ +     H   V  +  +  G+
Sbjct  540  VQFHPNSN-YVATGSSDRTVRLW------DNMTGQSVRLM---TGHKGSVSSLAFSACGR  589

Query  219  YIITCSKMNDLVVWDL-KGQVLATIELHLGSTYRARISPCGRFVGTSGFTPDANIWEI  275
            Y+ + S  +++++WDL  G ++ T+  H  +      S  G  +  +G   +  +W+ 
Sbjct  590  YLASGSVDHNIIIWDLSNGSLVTTLLRHTSTVTTITFSRDGTVLAAAGLDNNLTLWDF  647


 Score = 35.0 bits (79),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 69/322 (21%), Positives = 113/322 (35%), Gaps = 101/322 (31%)

Query  102  VLKGHTGPVLDMNFSSNGRFLASCAEDRTVLLWC---TKELTIKEKRSLRVNIEFDHATL  158
            VL  H G V     S +   LA    D +V +W     K  T+K+  SLR   E D  + 
Sbjct  373  VLNSHQG-VTCAEISDDSTMLACGFGDSSVRIWSLTPAKLRTLKDADSLR---ELDKESA  428

Query  159  ---VRWSPDSKAFLIHKAVANTIEVYKISKKPDGTLASAIKTLEFPKRHTEDVVGMDIAC  215
               VR   D    +    + +T  VY+ +  P+  L                        
Sbjct  429  DINVRMLDDRSGEVTRSLMGHTGPVYRCAFAPEMNL------------------------  464

Query  216  TGKYIITCSKMNDLVVWDL-KGQVLATIELHLGSTYRARISPCGRFVGTSGFTPDANIWE  274
                +++CS+ + + +W L     + T   H+   +  R +P G +  +  +   A +W 
Sbjct  465  ----LLSCSEDSTIRLWSLLTWSCVVTYRGHVYPVWDVRFAPHGYYFVSCSYDKTARLW-  519

Query  275  IVFSKSGEFKQVVKAFDLAGHSSGILDFTFSADSSCMATVSKDETYRLYDIKIEFEKGED  334
                 + +  Q ++ F   GH S +    F  +S+ +AT S D T RL            
Sbjct  520  -----ATDSNQALRVF--VGHLSDVDCVQFHPNSNYVATGSSDRTVRL------------  560

Query  335  PHILQTGPWESTITANIALSPNTEVLAIAHGSSLSFYSTITGLLDTTIEDIFLGPITSLA  394
                    W++    ++ L                    +TG           G ++SLA
Sbjct  561  --------WDNMTGQSVRL--------------------MTG---------HKGSVSSLA  583

Query  395  FDAVGEYVLVAGDRHIKVFHNV  416
            F A G Y L +G     V HN+
Sbjct  584  FSACGRY-LASG----SVDHNI  600



Lambda      K        H
   0.320    0.135    0.398 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11373493824


Query= XP_050469388.1 zinc finger and SCAN domain-containing protein
21-like [Bombus huntii]

Length=580
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VZK2_DROME  unnamed protein product                                 333     4e-106
Q24140_DROME  unnamed protein product                                 321     2e-101
Q7KMM2_DROME  unnamed protein product                                 251     6e-76 


>Q9VZK2_DROME unnamed protein product
Length=653

 Score = 333 bits (854),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 157/196 (80%), Positives = 169/196 (86%), Gaps = 5/196 (3%)

Query  360  RDGTSSGS-----KTVAYTYEAFFVSDGRSKRRSVNTNGAAVPDKEAAQPDRPKFTCTEC  414
            +DG  SG+     KTVAYTYEAFFVSDGRSKR+ V    AA          + K+TC+EC
Sbjct  413  QDGEHSGASGASAKTVAYTYEAFFVSDGRSKRKHVADPAAAASGVPTPDQQKTKYTCSEC  472

Query  415  GKQYATSSNLSRHKQTHRSLDSQSAKKCIHCGKAYVSMPALAMHVLTHKLAHSCGVCGKM  474
            GKQYATSSNLSRHKQTHRSLDSQSAKKC  CGKAYVSMPALAMH+LTHKL+HSCGVCGK+
Sbjct  473  GKQYATSSNLSRHKQTHRSLDSQSAKKCHTCGKAYVSMPALAMHLLTHKLSHSCGVCGKL  532

Query  475  FSRPWLLQGHLRSHTGEKPYGCAHCGKAFADRSNLRAHMQTHSADKNYECSRCHKTFALK  534
            FSRPWLLQGHLRSHTGEKPYGCAHCGKAFADRSNLRAHMQTHS DKN+EC RCHKTFALK
Sbjct  533  FSRPWLLQGHLRSHTGEKPYGCAHCGKAFADRSNLRAHMQTHSVDKNFECKRCHKTFALK  592

Query  535  SYLNKHLESACLRDDE  550
            SYLNKHLESACL+D+E
Sbjct  593  SYLNKHLESACLKDEE  608


 Score = 110 bits (274),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 104/320 (33%), Positives = 126/320 (39%), Gaps = 84/320 (26%)

Query  1    MPRCLMAKKWKAYPWPDRVDDPQEEQNDPSNILQEQGNHGIQQTSASLEKRQHRHEPEDE  60
            MPRCL+AKKWKAYPW DR +D     N      Q   N   +     L+ R+   + +DE
Sbjct  1    MPRCLIAKKWKAYPWLDRTEDTS---NQQQQQEQSAPNSPRELEELHLKSRRSTLD-DDE  56

Query  61   EIDVVGDTDSRQVDHQQT-----------------------------------CWGPHSP  85
            EIDVVGD    +++ Q+T                                   CWGP SP
Sbjct  57   EIDVVGDKFLIKLEKQRTTADAAAAAATSSEAATSHSSNSSNMEASATTTTSKCWGPSSP  116

Query  86   TAGATAPSPPPLNASGALYYHGYTHESWINHEEPPKYATLRSAAELARPVVPSPPPP---  142
            TAG TAPSPPP +   A    G  +  +     P  Y       E    V+ +       
Sbjct  117  TAGTTAPSPPPHSPEAATRVAGNVYNGYTRELSPLHYTAYLPRMESEITVIRAAATALVA  176

Query  143  -------AAPQELAAVMTGSSLHQPHPAAPMTTPSSSSTSLCLPPRKSLSMCFTSTGTAL  195
                   +  Q LAA  T  S     P+   +      + L      S   CF+STG  L
Sbjct  177  ARTSGNGSGDQHLAAYQTPPSSTTSSPSCSPSGAGDRYSPLSSGQTSSERKCFSSTGATL  236

Query  196  SLPPKKKDIYRPYSL--QPMSDIRTSEIRTPEIRTSEVRTSEIRTSEIRTSEIRTSEIRT  253
            SLPPKKKDIYRPYSL  +P    R                                  R 
Sbjct  237  SLPPKKKDIYRPYSLDDKPAHGYRR---------------------------------RV  263

Query  254  SAEEDLSAAQAILDLSASPA  273
             AEEDL AA AILDLSAS A
Sbjct  264  PAEEDLHAAHAILDLSASTA  283


>Q24140_DROME unnamed protein product
Length=664

 Score = 321 bits (823),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 153/191 (80%), Positives = 165/191 (86%), Gaps = 3/191 (2%)

Query  361  DGTSSGS-KTVAYTYEAFFVSDGRSKRRSVNTNGAAVPDKEAAQPDRPKFTCTECGKQYA  419
            +G S  S KTVAYTYEAFFVSDGRSKR+ V    AA          + K+TC+ECGKQYA
Sbjct  418  NGASGASAKTVAYTYEAFFVSDGRSKRKHVADPAAAASGVPTPDQQKTKYTCSECGKQYA  477

Query  420  TSSNLSRHKQTHRSLDSQSAKKCIHCGKAYVSMPALAMHVLTHKLAHSCGVCGKMFSRPW  479
            TSSNLSRHKQTH  +DSQSAKKC  CGKAYVSMPALAMH+LTHKL+HSCGVCGK+FSRPW
Sbjct  478  TSSNLSRHKQTH--VDSQSAKKCHTCGKAYVSMPALAMHLLTHKLSHSCGVCGKLFSRPW  535

Query  480  LLQGHLRSHTGEKPYGCAHCGKAFADRSNLRAHMQTHSADKNYECSRCHKTFALKSYLNK  539
            LLQGHLRSHTGEKPYGCAHCGKAFADRSNLRAHMQTHS DKN+EC RCHKTFALKSYLNK
Sbjct  536  LLQGHLRSHTGEKPYGCAHCGKAFADRSNLRAHMQTHSVDKNFECKRCHKTFALKSYLNK  595

Query  540  HLESACLRDDE  550
            HLESACL+D+E
Sbjct  596  HLESACLKDEE  606


 Score = 107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 103/320 (32%), Positives = 125/320 (39%), Gaps = 84/320 (26%)

Query  1    MPRCLMAKKWKAYPWPDRVDDPQEEQNDPSNILQEQGNHGIQQTSASLEKRQHRHEPEDE  60
            MPRCL+AKKWKAYPW DR +D     N      Q   N   +     L+ R+   + +DE
Sbjct  1    MPRCLIAKKWKAYPWLDRTEDTC---NQQQQQEQSAPNSPRELEELHLKSRRSTLD-DDE  56

Query  61   EIDVVGDTDSRQVDHQQT-----------------------------------CWGPHSP  85
            EIDVVGD    +++ Q+T                                   CWGP SP
Sbjct  57   EIDVVGDKFLIKLEKQRTTADAAAAAATSSEAATSHSSNSSNMEASATTTTSKCWGPSSP  116

Query  86   TAGATAPSPPPLNASGALYYHGYTHESWINHEEPPKYATLRSAAELARPVVPSPPPP---  142
            TAG TAPSPPP +   A    G  +  +     P  Y       E    V+ +       
Sbjct  117  TAGTTAPSPPPHSPEAATRVAGNVYNGYTRELSPLHYTAYLPRMESEITVIRAAATALVA  176

Query  143  -------AAPQELAAVMTGSSLHQPHPAAPMTTPSSSSTSLCLPPRKSLSMCFTSTGTAL  195
                   +  Q LA   T  S     P+   +      + L      S   CF+STG  L
Sbjct  177  ARTSGNGSGDQHLAVYQTPPSSTTSSPSCSPSGAGDRYSPLSSGQTSSERKCFSSTGATL  236

Query  196  SLPPKKKDIYRPYSL--QPMSDIRTSEIRTPEIRTSEVRTSEIRTSEIRTSEIRTSEIRT  253
            SLPPKKKDIYRPYSL  +P    R                                  R 
Sbjct  237  SLPPKKKDIYRPYSLDDKPAHGYRR---------------------------------RV  263

Query  254  SAEEDLSAAQAILDLSASPA  273
             AEEDL AA AILDLSAS A
Sbjct  264  PAEEDLHAAHAILDLSASTA  283


>Q7KMM2_DROME unnamed protein product
Length=567

 Score = 251 bits (642),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 130/155 (84%), Gaps = 5/155 (3%)

Query  360  RDGTSSGS-----KTVAYTYEAFFVSDGRSKRRSVNTNGAAVPDKEAAQPDRPKFTCTEC  414
            +DG  SG+     KTVAYTYEAFFVSDGRSKR+ V    AA          + K+TC+EC
Sbjct  413  QDGEHSGASGASAKTVAYTYEAFFVSDGRSKRKHVADPAAAASGVPTPDQQKTKYTCSEC  472

Query  415  GKQYATSSNLSRHKQTHRSLDSQSAKKCIHCGKAYVSMPALAMHVLTHKLAHSCGVCGKM  474
            GKQYATSSNLSRHKQTHRSLDSQSAKKC  CGKAYVSMPALAMH+LTHKL+HSCGVCGK+
Sbjct  473  GKQYATSSNLSRHKQTHRSLDSQSAKKCHTCGKAYVSMPALAMHLLTHKLSHSCGVCGKL  532

Query  475  FSRPWLLQGHLRSHTGEKPYGCAHCGKAFADRSNL  509
            FSRPWLLQGHLRSHTGEKPYGCAHCGKAFADRSNL
Sbjct  533  FSRPWLLQGHLRSHTGEKPYGCAHCGKAFADRSNL  567


 Score = 110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 104/320 (33%), Positives = 126/320 (39%), Gaps = 84/320 (26%)

Query  1    MPRCLMAKKWKAYPWPDRVDDPQEEQNDPSNILQEQGNHGIQQTSASLEKRQHRHEPEDE  60
            MPRCL+AKKWKAYPW DR +D     N      Q   N   +     L+ R+   + +DE
Sbjct  1    MPRCLIAKKWKAYPWLDRTED---TSNQQQQQEQSAPNSPRELEELHLKSRRSTLD-DDE  56

Query  61   EIDVVGDTDSRQVDHQQT-----------------------------------CWGPHSP  85
            EIDVVGD    +++ Q+T                                   CWGP SP
Sbjct  57   EIDVVGDKFLIKLEKQRTTADAAAAAATSSEAATSHSSNSSNMEASATTTTSKCWGPSSP  116

Query  86   TAGATAPSPPPLNASGALYYHGYTHESWINHEEPPKYATLRSAAELARPVVPSPPPP---  142
            TAG TAPSPPP +   A    G  +  +     P  Y       E    V+ +       
Sbjct  117  TAGTTAPSPPPHSPEAATRVAGNVYNGYTRELSPLHYTAYLPRMESEITVIRAAATALVA  176

Query  143  -------AAPQELAAVMTGSSLHQPHPAAPMTTPSSSSTSLCLPPRKSLSMCFTSTGTAL  195
                   +  Q LAA  T  S     P+   +      + L      S   CF+STG  L
Sbjct  177  ARTSGNGSGDQHLAAYQTPPSSTTSSPSCSPSGAGDRYSPLSSGQTSSERKCFSSTGATL  236

Query  196  SLPPKKKDIYRPYSL--QPMSDIRTSEIRTPEIRTSEVRTSEIRTSEIRTSEIRTSEIRT  253
            SLPPKKKDIYRPYSL  +P    R                                  R 
Sbjct  237  SLPPKKKDIYRPYSLDDKPAHGYRR---------------------------------RV  263

Query  254  SAEEDLSAAQAILDLSASPA  273
             AEEDL AA AILDLSAS A
Sbjct  264  PAEEDLHAAHAILDLSASTA  283



Lambda      K        H
   0.320    0.135    0.398 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11373493824


Query= XP_050469389.1 mitochondrial Rho GTPase isoform X1 [Bombus huntii]

Length=672
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MIRO_DROME  unnamed protein product                                   770     0.0   
MIRO1_CAEEL  unnamed protein product                                  531     0.0   
GEMA_DICDI  unnamed protein product                                   330     1e-103


>MIRO_DROME unnamed protein product
Length=652

 Score = 770 bits (1988),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/692 (54%), Positives = 497/692 (72%), Gaps = 69/692 (10%)

Query  1    MVQRSVALRRNVRILLIGDRGVGKTSLILSLVSEEYAEDVPCKAEEITIPADVTPEQVPT  60
            M Q + + R+NVRILL+GD GVGKTSLILSLVSEEY E+VP +AEEITIPA+VTPEQVPT
Sbjct  1    MGQYTASQRKNVRILLVGDAGVGKTSLILSLVSEEYPEEVPPRAEEITIPANVTPEQVPT  60

Query  61   NIVDYSAAEQTEDQLTDEIQKAHVICVVYSVVDEDTLDRAVTYWLPLIR-RCLTDH----  115
            +IVD+SA EQ+ED L  EI KAHV+C+VY+V D+DTLDR  ++WLPL+R +C        
Sbjct  61   SIVDFSAVEQSEDALAAEINKAHVVCIVYAVDDDDTLDRITSHWLPLVRAKCNPSLDGEG  120

Query  116  ---------------RCPVVLVGNKIDLVDYSTIEAVYSIMKEFTEIESCIECSAKTLQN  160
                           R P+VLVGNKIDL++YST+++V +IM+++ EIESC+ECSAK+L N
Sbjct  121  DAEAEAEGDTQREPIRKPIVLVGNKIDLIEYSTMDSVLAIMEDYPEIESCVECSAKSLHN  180

Query  161  VSETFYYAQKAVLHPTTPLYNYDTHELTEECKIALQRIFKICDLDNDGLLNDMELNTFQQ  220
            +SE FYYAQKAVLHPT+PLY  +  ELT  CK +L RIFKICD+D D LLND ELN FQ+
Sbjct  181  ISEMFYYAQKAVLHPTSPLYMMEEQELTSACKKSLVRIFKICDIDGDNLLNDYELNLFQR  240

Query  221  WCFNIPLQPQVLEDVKAVLSKNIQDGICSGCVTLKGFMYLQCLFIQRGRNETTWAVLRKF  280
             CFN PLQPQ+L++VKAV+ KN+ DGI +  VTLKGF++L CLFIQRGRNETTWAVLR+F
Sbjct  241  RCFNTPLQPQILDEVKAVIQKNVPDGIYNDAVTLKGFLFLHCLFIQRGRNETTWAVLRRF  300

Query  281  GYDNELQMSKEYIYPLLKVPVGCTTELSHKGQEFLTLLFLQHDRDRDGALSPSEMESLFS  340
            GY+++L+M +EY+ P LK+P G +TELSH+GQ+FL  +F ++DRD DGALSP E + LFS
Sbjct  301  GYNDQLEMCQEYLRPPLKIPPGSSTELSHRGQQFLIAVFERYDRDGDGALSPEEHKMLFS  360

Query  341  RCLMPPW--GDEYKYTVPTNE-KGWITLQGYMCQWALLTLTNVRKALEYMAYLGYNMYNN  397
             C   PW    + + + P NE  GW+TL G++C+W L+TL +V K +EY+AYLG+N++ N
Sbjct  361  TCPAAPWSYSTDIRKSCPINETTGWVTLHGWLCRWTLMTLIDVVKTMEYLAYLGFNVHEN  420

Query  398  ECQTNAILVTREKKLDLAKKQSSRNVYSCHVIGPKSSGKTTLCRTFIDPKLEVYVLKLTN  457
            + Q  AI VTRE+++DLAK+QSSR+VY CHVIGPK SGKT +CR F+   +     KL  
Sbjct  421  DSQLAAIHVTRERRIDLAKRQSSRSVYKCHVIGPKGSGKTGMCRGFLVEDMH----KLIG  476

Query  458  EMVPPSSHVTVNTVHVYGQEKTIILRDINILNVQDALTPAQIQCDVAALVYDASNPKSFE  517
            +    +    +N+V VYGQEK +ILRDI++ +  D L P ++ CDVA LVYD+SNP+SFE
Sbjct  477  KEFKTNVVNCINSVQVYGQEKHLILRDIDVRHALDPLQPQEVNCDVACLVYDSSNPRSFE  536

Query  518  YIARIYIHLFQKYFADSKIPVLIIANKSDLSEVKQDYLLQPISFCNKYKLMPPQPYSISR  577
            Y+ARIYI    KY+A+SKIPV+I+  K D+ E +QDYL+QP  FC+KYKL+PP  +S+ +
Sbjct  537  YVARIYI----KYYAESKIPVMIVGTKCDMDERRQDYLMQPSEFCDKYKLLPPHLFSL-K  591

Query  578  TVRREIFVKLATMAAFPRFQGAWVLFYRDSPLRRMVHMLLVKPSPTQWWSSFTRHINQFG  637
            T ++E++ KLATMAAFP                                     H+ QFG
Sbjct  592  TNKKELYTKLATMAAFP-------------------------------------HLRQFG  614

Query  638  LLQGDSMVWWKAGLGIAVATVAGFVVMRVLNT  669
            L+  D  +W KAGLG+A AT+ GF+V++ ++ 
Sbjct  615  LMTEDPKLWLKAGLGVAAATMLGFIVLKTISA  646


>MIRO1_CAEEL unnamed protein product
Length=625

 Score = 531 bits (1367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/665 (42%), Positives = 408/665 (61%), Gaps = 56/665 (8%)

Query  11   NVRILLIGDRGVGKTSLILSLVSEEYAEDVPCKAEEITIPADVTPEQVPTNIVDYSAAEQ  70
            +VRI+LIGD G GKTSL++SL+ +E+ + VP + + + IPADVTPE V T+IVD S  E+
Sbjct  9    DVRIVLIGDEGCGKTSLVMSLLEDEWVDAVPRRLDRVLIPADVTPENVTTSIVDLSIKEE  68

Query  71   TEDQLTDEIQKAHVICVVYSVVDEDTLDRAVTYWLPLIRRCLTD-HRCPVVLVGNKIDLV  129
             E+ +  EI++A+VICVVYSV DE T+D   T WLPLIR+   + H  PV+LVGNK D  
Sbjct  69   DENWIVSEIRQANVICVVYSVTDESTVDGIQTKWLPLIRQSFGEYHETPVILVGNKSDGT  128

Query  130  DYSTIEAVYSIMKEFTEIESCIECSAKTLQNVSETFYYAQKAVLHPTTPLYNYDTHELTE  189
              +T + +  IM+  TE+E+C+ECSA+T++NVSE FYYAQKAV++PT PLY+ DT +LT+
Sbjct  129  ANNT-DKILPIMEANTEVETCVECSARTMKNVSEIFYYAQKAVIYPTRPLYDADTKQLTD  187

Query  190  ECKIALQRIFKICDLDNDGLLNDMELNTFQQWCFNIPLQPQVLEDVKAVLSKNIQDGICS  249
              + AL R+FKICD DNDG L+D ELN FQ+ CF IPL    LEDVK  +S    DG+ +
Sbjct  188  RARKALIRVFKICDRDNDGYLSDTELNDFQKLCFGIPLTSTALEDVKRAVSDGCPDGVAN  247

Query  250  GCVTLKGFMYLQCLFIQRGRNETTWAVLRKFGYDNELQMSKEYIYPLLKVPVGCTTELSH  309
              + L GF+YL  LFI+RGR+ETTWAVLRKFGY+  L++S++Y+YP + +PVGC+TELS 
Sbjct  248  DSLMLAGFLYLHLLFIERGRHETTWAVLRKFGYETSLKLSEDYLYPRITIPVGCSTELSP  307

Query  310  KGQEFLTLLFLQHDRDRDGALSPSEMESLFSRCLMPPWGDEYKYTVPTNEKGWITLQGYM  369
            +G +F++ LF ++D D+DG LSPSE+++LFS C +P    +    + TN++GW+T  GYM
Sbjct  308  EGVQFVSALFEKYDEDKDGCLSPSELQNLFSVCPVPVITKDNILALETNQRGWLTYNGYM  367

Query  370  CQWALLTLTNVRKALEYMAYLGYNMYNN-----ECQTNAILVTREKKLDLAKKQSSRNVY  424
              W + TL N+ +  E +AYLG+ +  +         ++I VTRE+K DL    + R V+
Sbjct  368  AYWNMTTLINLTQTFEQLAYLGFPVGRSGPGRAGNTLDSIRVTRERKKDLENHGTDRKVF  427

Query  425  SCHVIGPKSSGKTTLCRTFIDPKLEVYVLKLTNEMVPPSSHVTVNTVHVYGQEKTIILRD  484
             C V+G K +GKT   ++     +   V ++     P      +N V V  + K ++LR+
Sbjct  428  QCLVVGAKDAGKTVFMQSLAGRGM-ADVAQIGRRHSP----FVINRVRVKEESKYLLLRE  482

Query  485  INILNVQDALTPAQIQCDVAALVYDASNPKSFEYIARIYIHLFQKYFADSKIPVLIIANK  544
            +++L+ QDAL   +   DV A +YD SNP SF + A +Y    QKYF  +K P ++IA K
Sbjct  483  VDVLSPQDALGSGETSADVVAFLYDISNPDSFAFCATVY----QKYFYRTKTPCVMIATK  538

Query  545  SDLSEVKQDYLLQPISFCNKYKLMPPQPYSISRTVRRE--IFVKLATMAAFPRFQGAWVL  602
             +  EV Q + + P  FC +++L  P  +S     +    IF +LA MA +P        
Sbjct  539  VEREEVDQRWEVPPEEFCRQFELPKPIKFSTGNIGQSSSPIFEQLAMMAVYPH-------  591

Query  603  FYRDSPLRRMVHMLLVKPSPTQWWSSFTRHINQFGLLQGDSMVWWKAGLGIAVATVAGFV  662
                  LRR+ ++                          DS +  K   G A+  +AGF+
Sbjct  592  ------LRRVFYL-------------------------NDSNLLSKITFGAAIVALAGFL  620

Query  663  VMRVL  667
            V++ L
Sbjct  621  VLKNL  625


>GEMA_DICDI unnamed protein product
Length=658

 Score = 330 bits (845),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 189/548 (34%), Positives = 301/548 (55%), Gaps = 28/548 (5%)

Query  8    LRRNVRILLIGDRGVGKTSLILSLVSEEYAEDVPCKAEEITIPADVTPEQVPTNIVD-YS  66
            ++ N++++LIGD  VGK+++I S +SE ++E       E+TIPA+   E   T I+D + 
Sbjct  1    MKNNIKVILIGDEQVGKSTIINSFISESFSEITQKTLPEVTIPAEFNNEICSTRIIDTFD  60

Query  67   AAEQTEDQLTDEIQKAHVICVVYSVVDEDTLDRAVTYWLPLIRRCLTDHRCPVVLVGNKI  126
              +  ++Q+  EI+ A  I +VYSV   DT       W+PLI +    ++ P+++VGNK+
Sbjct  61   DGKNLKNQMNMEIRTADAIVIVYSVDRFDTFMSIRMKWIPLINQLRGSNKSPIIIVGNKL  120

Query  127  DLVD-------YSTIEAVYSIMKEFTEIESCIECSAKTLQNVSETFYYAQKAVLHPTTPL  179
            DLVD           E +      ++     +ECSAKT++N+ E  Y +Q +V  P   L
Sbjct  121  DLVDDKHENNKVQIEETIQYFRSTYSNTIQWLECSAKTMENLPELLYASQTSVFFPERIL  180

Query  180  YNYDTHELTEECKIALQRIFKICDLDNDGLLNDMELNTFQQWCFNIPLQPQVLEDVKAVL  239
            YN + +++TE C+ AL+RIFK+CD DNDG L++ E+N FQ  C +  +  + +++++  +
Sbjct  181  YNREENKMTEGCERALKRIFKLCDHDNDGSLSEEEINYFQTKCGHETMTSEEIQNIQQFV  240

Query  240  SKNIQDGICSGCVTLKGFMYLQCLFIQRGRNETTWAVLRKFGYDNELQMSKEYIYPLLKV  299
               I DG+ S   T KGF+Y+  LF+ RG  + TW  LR F YD++L + + Y++P L+V
Sbjct  241  LSKIPDGVNSNGFTEKGFLYMNLLFLLRGPCQHTWTSLRSFNYDDDLVLLESYVHPTLQV  300

Query  300  PVGCTTELSHKGQEFLTLLFLQHDRDRDGALSPSEMESLFSRCLMPPWGDEYKYTVPTNE  359
            P    T LS  G EF   LF ++D D DG LS  ++ SLFS     PW   ++    T++
Sbjct  301  PPNHNTILSSMGNEFFKSLFEKYDSDSDGVLSSFDLVSLFSTTPKIPWEIGFEKHFNTDK  360

Query  360  KGWITLQGYMCQWALLTLTNVRKALEYMAYLGYNMYNNECQTNAILVTREKKLDLAKKQS  419
               +TL G++  W L T  N +  LEY+AY G    NN     +IL +RE  LD+   Q 
Sbjct  361  DSNLTLSGFLSLWNLQTYENYKVTLEYLAYFGSQTENNNIDMISILNSRE--LDIKSNQF  418

Query  420  SRNVYSCHVIGPKSSGKTTLCRTFIDPKLE-VYVLKLTNEMVPPSSHVTVNTVHVYGQEK  478
            +RN+ +C+V G ++ GKTT   TFI      +Y     N+      H+  N        K
Sbjct  419  TRNIVNCYVFGAEAVGKTTFLNTFIGKSFSTLYNATNGNDNFKVCGHLLKN--------K  470

Query  479  TIILRDINILNVQDALTPAQI--QCDVAALVYDASNPKSFEYIARIYIHLFQKYFADSKI  536
             +IL +     V + +  A++  +CD+  L+YD ++ +SF++I  IY  L Q+      I
Sbjct  471  YLILSEY----VGEKIPTAELKSKCDLVCLLYDCNSEQSFKFIENIYNQLKQQQL---NI  523

Query  537  PVLIIANK  544
            P++ I  K
Sbjct  524  PIVFIRTK  531


 Score = 32.0 bits (71),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 27/130 (21%), Positives = 51/130 (39%), Gaps = 14/130 (11%)

Query  428  VIGPKSSGKTTLCRTFIDPKLEVYVLKLTNEMVPPSSH----VTVNTVHVYGQEKTIILR  483
            +IG +  GK+T+  +FI         K   E+  P+       +   +  +   K     
Sbjct  9    LIGDEQVGKSTIINSFISESFSEITQKTLPEVTIPAEFNNEICSTRIIDTFDDGK-----  63

Query  484  DINILNVQDALTPAQIQCDVAALVYDASNPKSFEYIARIYIHLFQKYFADSKIPVLIIAN  543
                 N+++ +       D   +VY      +F  I   +I L  +    +K P++I+ N
Sbjct  64   -----NLKNQMNMEIRTADAIVIVYSVDRFDTFMSIRMKWIPLINQLRGSNKSPIIIVGN  118

Query  544  KSDLSEVKQD  553
            K DL + K +
Sbjct  119  KLDLVDDKHE  128



Lambda      K        H
   0.320    0.135    0.398 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11373493824


Query= XP_050469390.1 mitochondrial Rho GTPase isoform X2 [Bombus huntii]

Length=668
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MIRO_DROME  unnamed protein product                                   776     0.0   
MIRO1_CAEEL  unnamed protein product                                  533     0.0   
GEMA_DICDI  unnamed protein product                                   326     2e-102


>MIRO_DROME unnamed protein product
Length=652

 Score = 776 bits (2005),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/688 (55%), Positives = 497/688 (72%), Gaps = 65/688 (9%)

Query  1    MVQRSVALRRNVRILLIGDRGVGKTSLILSLVSEEYAEDVPCKAEEITIPADVTPEQVPT  60
            M Q + + R+NVRILL+GD GVGKTSLILSLVSEEY E+VP +AEEITIPA+VTPEQVPT
Sbjct  1    MGQYTASQRKNVRILLVGDAGVGKTSLILSLVSEEYPEEVPPRAEEITIPANVTPEQVPT  60

Query  61   NIVDYSAAEQTEDQLTDEIQKAHVICVVYSVVDEDTLDRAVTYWLPLIR-RCLTDH----  115
            +IVD+SA EQ+ED L  EI KAHV+C+VY+V D+DTLDR  ++WLPL+R +C        
Sbjct  61   SIVDFSAVEQSEDALAAEINKAHVVCIVYAVDDDDTLDRITSHWLPLVRAKCNPSLDGEG  120

Query  116  ---------------RCPVVLVGNKIDLVDYSTIEAVYSIMKEFTEIESCIECSAKTLQN  160
                           R P+VLVGNKIDL++YST+++V +IM+++ EIESC+ECSAK+L N
Sbjct  121  DAEAEAEGDTQREPIRKPIVLVGNKIDLIEYSTMDSVLAIMEDYPEIESCVECSAKSLHN  180

Query  161  VSETFYYAQKAVLHPTTPLYNYDTHELTEECKIALQRIFKICDLDNDGLLNDMELNTFQQ  220
            +SE FYYAQKAVLHPT+PLY  +  ELT  CK +L RIFKICD+D D LLND ELN FQ+
Sbjct  181  ISEMFYYAQKAVLHPTSPLYMMEEQELTSACKKSLVRIFKICDIDGDNLLNDYELNLFQR  240

Query  221  WCFNIPLQPQVLEDVKAVLSKNIQDGICSGCVTLKGFMYLQCLFIQRGRNETTWAVLRKF  280
             CFN PLQPQ+L++VKAV+ KN+ DGI +  VTLKGF++L CLFIQRGRNETTWAVLR+F
Sbjct  241  RCFNTPLQPQILDEVKAVIQKNVPDGIYNDAVTLKGFLFLHCLFIQRGRNETTWAVLRRF  300

Query  281  GYDNELQMSKEYIYPLLKVPVGCTTELSHKGQEFLTLLFLQHDRDRDGALSPSEMESLFS  340
            GY+++L+M +EY+ P LK+P G +TELSH+GQ+FL  +F ++DRD DGALSP E + LFS
Sbjct  301  GYNDQLEMCQEYLRPPLKIPPGSSTELSHRGQQFLIAVFERYDRDGDGALSPEEHKMLFS  360

Query  341  RCLMPPW--GDEYKYTVPTNE-KGWITLQGYMCQWALLTLTNVRKALEYMAYLGYNMYNN  397
             C   PW    + + + P NE  GW+TL G++C+W L+TL +V K +EY+AYLG+N++ N
Sbjct  361  TCPAAPWSYSTDIRKSCPINETTGWVTLHGWLCRWTLMTLIDVVKTMEYLAYLGFNVHEN  420

Query  398  ECQTNAILVTREKKLDLAKKQSSRNVYSCHVIGPKSSGKTTLCRTFIDPKLEVYVLKLTN  457
            + Q  AI VTRE+++DLAK+QSSR+VY CHVIGPK SGKT +CR F+   +     KL  
Sbjct  421  DSQLAAIHVTRERRIDLAKRQSSRSVYKCHVIGPKGSGKTGMCRGFLVEDMH----KLIG  476

Query  458  EMVPPSSHVTVNTVHVYGQEKTIILRDINILNVQDALTPAQIQCDVAALVYDASNPKSFE  517
            +    +    +N+V VYGQEK +ILRDI++ +  D L P ++ CDVA LVYD+SNP+SFE
Sbjct  477  KEFKTNVVNCINSVQVYGQEKHLILRDIDVRHALDPLQPQEVNCDVACLVYDSSNPRSFE  536

Query  518  YIARIYIKYFADSKIPVLIIANKSDLSEVKQDYLLQPISFCNKYKLMPPQPYSISRTVRR  577
            Y+ARIYIKY+A+SKIPV+I+  K D+ E +QDYL+QP  FC+KYKL+PP  +S+ +T ++
Sbjct  537  YVARIYIKYYAESKIPVMIVGTKCDMDERRQDYLMQPSEFCDKYKLLPPHLFSL-KTNKK  595

Query  578  EIFVKLATMAAFPRFQGAWVLFYRDSPLRRMVHMLLVKPSPTQWWSSFTRHINQFGLLQG  637
            E++ KLATMAAFP                                     H+ QFGL+  
Sbjct  596  ELYTKLATMAAFP-------------------------------------HLRQFGLMTE  618

Query  638  DSMVWWKAGLGIAVATVAGFVVMRVLNT  665
            D  +W KAGLG+A AT+ GF+V++ ++ 
Sbjct  619  DPKLWLKAGLGVAAATMLGFIVLKTISA  646


>MIRO1_CAEEL unnamed protein product
Length=625

 Score = 533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/661 (42%), Positives = 407/661 (62%), Gaps = 52/661 (8%)

Query  11   NVRILLIGDRGVGKTSLILSLVSEEYAEDVPCKAEEITIPADVTPEQVPTNIVDYSAAEQ  70
            +VRI+LIGD G GKTSL++SL+ +E+ + VP + + + IPADVTPE V T+IVD S  E+
Sbjct  9    DVRIVLIGDEGCGKTSLVMSLLEDEWVDAVPRRLDRVLIPADVTPENVTTSIVDLSIKEE  68

Query  71   TEDQLTDEIQKAHVICVVYSVVDEDTLDRAVTYWLPLIRRCLTD-HRCPVVLVGNKIDLV  129
             E+ +  EI++A+VICVVYSV DE T+D   T WLPLIR+   + H  PV+LVGNK D  
Sbjct  69   DENWIVSEIRQANVICVVYSVTDESTVDGIQTKWLPLIRQSFGEYHETPVILVGNKSDGT  128

Query  130  DYSTIEAVYSIMKEFTEIESCIECSAKTLQNVSETFYYAQKAVLHPTTPLYNYDTHELTE  189
              +T + +  IM+  TE+E+C+ECSA+T++NVSE FYYAQKAV++PT PLY+ DT +LT+
Sbjct  129  ANNT-DKILPIMEANTEVETCVECSARTMKNVSEIFYYAQKAVIYPTRPLYDADTKQLTD  187

Query  190  ECKIALQRIFKICDLDNDGLLNDMELNTFQQWCFNIPLQPQVLEDVKAVLSKNIQDGICS  249
              + AL R+FKICD DNDG L+D ELN FQ+ CF IPL    LEDVK  +S    DG+ +
Sbjct  188  RARKALIRVFKICDRDNDGYLSDTELNDFQKLCFGIPLTSTALEDVKRAVSDGCPDGVAN  247

Query  250  GCVTLKGFMYLQCLFIQRGRNETTWAVLRKFGYDNELQMSKEYIYPLLKVPVGCTTELSH  309
              + L GF+YL  LFI+RGR+ETTWAVLRKFGY+  L++S++Y+YP + +PVGC+TELS 
Sbjct  248  DSLMLAGFLYLHLLFIERGRHETTWAVLRKFGYETSLKLSEDYLYPRITIPVGCSTELSP  307

Query  310  KGQEFLTLLFLQHDRDRDGALSPSEMESLFSRCLMPPWGDEYKYTVPTNEKGWITLQGYM  369
            +G +F++ LF ++D D+DG LSPSE+++LFS C +P    +    + TN++GW+T  GYM
Sbjct  308  EGVQFVSALFEKYDEDKDGCLSPSELQNLFSVCPVPVITKDNILALETNQRGWLTYNGYM  367

Query  370  CQWALLTLTNVRKALEYMAYLGYNMYNN-----ECQTNAILVTREKKLDLAKKQSSRNVY  424
              W + TL N+ +  E +AYLG+ +  +         ++I VTRE+K DL    + R V+
Sbjct  368  AYWNMTTLINLTQTFEQLAYLGFPVGRSGPGRAGNTLDSIRVTRERKKDLENHGTDRKVF  427

Query  425  SCHVIGPKSSGKTTLCRTFIDPKLEVYVLKLTNEMVPPSSHVTVNTVHVYGQEKTIILRD  484
             C V+G K +GKT   ++     +   V ++     P      +N V V  + K ++LR+
Sbjct  428  QCLVVGAKDAGKTVFMQSLAGRGM-ADVAQIGRRHSP----FVINRVRVKEESKYLLLRE  482

Query  485  INILNVQDALTPAQIQCDVAALVYDASNPKSFEYIARIYIKYFADSKIPVLIIANKSDLS  544
            +++L+ QDAL   +   DV A +YD SNP SF + A +Y KYF  +K P ++IA K +  
Sbjct  483  VDVLSPQDALGSGETSADVVAFLYDISNPDSFAFCATVYQKYFYRTKTPCVMIATKVERE  542

Query  545  EVKQDYLLQPISFCNKYKLMPPQPYSISRTVRRE--IFVKLATMAAFPRFQGAWVLFYRD  602
            EV Q + + P  FC +++L  P  +S     +    IF +LA MA +P            
Sbjct  543  EVDQRWEVPPEEFCRQFELPKPIKFSTGNIGQSSSPIFEQLAMMAVYPH-----------  591

Query  603  SPLRRMVHMLLVKPSPTQWWSSFTRHINQFGLLQGDSMVWWKAGLGIAVATVAGFVVMRV  662
              LRR+ ++                          DS +  K   G A+  +AGF+V++ 
Sbjct  592  --LRRVFYL-------------------------NDSNLLSKITFGAAIVALAGFLVLKN  624

Query  663  L  663
            L
Sbjct  625  L  625


>GEMA_DICDI unnamed protein product
Length=658

 Score = 326 bits (836),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 187/545 (34%), Positives = 299/545 (55%), Gaps = 26/545 (5%)

Query  8    LRRNVRILLIGDRGVGKTSLILSLVSEEYAEDVPCKAEEITIPADVTPEQVPTNIVD-YS  66
            ++ N++++LIGD  VGK+++I S +SE ++E       E+TIPA+   E   T I+D + 
Sbjct  1    MKNNIKVILIGDEQVGKSTIINSFISESFSEITQKTLPEVTIPAEFNNEICSTRIIDTFD  60

Query  67   AAEQTEDQLTDEIQKAHVICVVYSVVDEDTLDRAVTYWLPLIRRCLTDHRCPVVLVGNKI  126
              +  ++Q+  EI+ A  I +VYSV   DT       W+PLI +    ++ P+++VGNK+
Sbjct  61   DGKNLKNQMNMEIRTADAIVIVYSVDRFDTFMSIRMKWIPLINQLRGSNKSPIIIVGNKL  120

Query  127  DLVD-------YSTIEAVYSIMKEFTEIESCIECSAKTLQNVSETFYYAQKAVLHPTTPL  179
            DLVD           E +      ++     +ECSAKT++N+ E  Y +Q +V  P   L
Sbjct  121  DLVDDKHENNKVQIEETIQYFRSTYSNTIQWLECSAKTMENLPELLYASQTSVFFPERIL  180

Query  180  YNYDTHELTEECKIALQRIFKICDLDNDGLLNDMELNTFQQWCFNIPLQPQVLEDVKAVL  239
            YN + +++TE C+ AL+RIFK+CD DNDG L++ E+N FQ  C +  +  + +++++  +
Sbjct  181  YNREENKMTEGCERALKRIFKLCDHDNDGSLSEEEINYFQTKCGHETMTSEEIQNIQQFV  240

Query  240  SKNIQDGICSGCVTLKGFMYLQCLFIQRGRNETTWAVLRKFGYDNELQMSKEYIYPLLKV  299
               I DG+ S   T KGF+Y+  LF+ RG  + TW  LR F YD++L + + Y++P L+V
Sbjct  241  LSKIPDGVNSNGFTEKGFLYMNLLFLLRGPCQHTWTSLRSFNYDDDLVLLESYVHPTLQV  300

Query  300  PVGCTTELSHKGQEFLTLLFLQHDRDRDGALSPSEMESLFSRCLMPPWGDEYKYTVPTNE  359
            P    T LS  G EF   LF ++D D DG LS  ++ SLFS     PW   ++    T++
Sbjct  301  PPNHNTILSSMGNEFFKSLFEKYDSDSDGVLSSFDLVSLFSTTPKIPWEIGFEKHFNTDK  360

Query  360  KGWITLQGYMCQWALLTLTNVRKALEYMAYLGYNMYNNECQTNAILVTREKKLDLAKKQS  419
               +TL G++  W L T  N +  LEY+AY G    NN     +IL +RE  LD+   Q 
Sbjct  361  DSNLTLSGFLSLWNLQTYENYKVTLEYLAYFGSQTENNNIDMISILNSRE--LDIKSNQF  418

Query  420  SRNVYSCHVIGPKSSGKTTLCRTFIDPKLE-VYVLKLTNEMVPPSSHVTVNTVHVYGQEK  478
            +RN+ +C+V G ++ GKTT   TFI      +Y     N+      H+  N        K
Sbjct  419  TRNIVNCYVFGAEAVGKTTFLNTFIGKSFSTLYNATNGNDNFKVCGHLLKN--------K  470

Query  479  TIILRDINILNVQDALTPAQI--QCDVAALVYDASNPKSFEYIARIYIKYFADS-KIPVL  535
             +IL +     V + +  A++  +CD+  L+YD ++ +SF++I  IY +       IP++
Sbjct  471  YLILSEY----VGEKIPTAELKSKCDLVCLLYDCNSEQSFKFIENIYNQLKQQQLNIPIV  526

Query  536  IIANK  540
             I  K
Sbjct  527  FIRTK  531



Lambda      K        H
   0.320    0.135    0.398 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11373493824


Query= XP_050469391.1 mitochondrial Rho GTPase isoform X3 [Bombus huntii]

Length=668
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MIRO_DROME  unnamed protein product                                   776     0.0   
MIRO1_CAEEL  unnamed protein product                                  533     0.0   
GEMA_DICDI  unnamed protein product                                   329     2e-103


>MIRO_DROME unnamed protein product
Length=652

 Score = 776 bits (2004),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/688 (55%), Positives = 497/688 (72%), Gaps = 65/688 (9%)

Query  1    MVQRSVALRRNVRILLIGDRGVGKTSLILSLVSEEYAEDVPCKAEEITIPADVTPEQVPT  60
            M Q + + R+NVRILL+GD GVGKTSLILSLVSEEY E+VP +AEEITIPA+VTPEQVPT
Sbjct  1    MGQYTASQRKNVRILLVGDAGVGKTSLILSLVSEEYPEEVPPRAEEITIPANVTPEQVPT  60

Query  61   NIVDYSAAEQTEDQLTDEIQKAHVICVVYSVVDEDTLDRAVTYWLPLIR-RCLTDH----  115
            +IVD+SA EQ+ED L  EI KAHV+C+VY+V D+DTLDR  ++WLPL+R +C        
Sbjct  61   SIVDFSAVEQSEDALAAEINKAHVVCIVYAVDDDDTLDRITSHWLPLVRAKCNPSLDGEG  120

Query  116  ---------------RCPVVLVGNKIDLVDYSTIEAVYSIMKEFTEIESCIECSAKTLQN  160
                           R P+VLVGNKIDL++YST+++V +IM+++ EIESC+ECSAK+L N
Sbjct  121  DAEAEAEGDTQREPIRKPIVLVGNKIDLIEYSTMDSVLAIMEDYPEIESCVECSAKSLHN  180

Query  161  VSETFYYAQKAVLHPTTPLYNYDTHELTEECKIALQRIFKICDLDNDGLLNDMELNTFQQ  220
            +SE FYYAQKAVLHPT+PLY  +  ELT  CK +L RIFKICD+D D LLND ELN FQ+
Sbjct  181  ISEMFYYAQKAVLHPTSPLYMMEEQELTSACKKSLVRIFKICDIDGDNLLNDYELNLFQR  240

Query  221  WCFNIPLQPQVLEDVKAVLSKNIQDGICSGCVTLKGFMYLQCLFIQRGRNETTWAVLRKF  280
             CFN PLQPQ+L++VKAV+ KN+ DGI +  VTLKGF++L CLFIQRGRNETTWAVLR+F
Sbjct  241  RCFNTPLQPQILDEVKAVIQKNVPDGIYNDAVTLKGFLFLHCLFIQRGRNETTWAVLRRF  300

Query  281  GYDNELQMSKEYIYPLLKVPVGCTTELSHKGQEFLTLLFLQHDRDRDGALSPSEMESLFS  340
            GY+++L+M +EY+ P LK+P G +TELSH+GQ+FL  +F ++DRD DGALSP E + LFS
Sbjct  301  GYNDQLEMCQEYLRPPLKIPPGSSTELSHRGQQFLIAVFERYDRDGDGALSPEEHKMLFS  360

Query  341  RCLMPPW--GDEYKYTVPTNE-KGWITLQGYMCQWALLTLTNVRKALEYMAYLGYNMYNN  397
             C   PW    + + + P NE  GW+TL G++C+W L+TL +V K +EY+AYLG+N++ N
Sbjct  361  TCPAAPWSYSTDIRKSCPINETTGWVTLHGWLCRWTLMTLIDVVKTMEYLAYLGFNVHEN  420

Query  398  ECQTNAILVTREKKLDLAKKQSSRNVYSCHVIGPKSSGKTTLCRTFIDPKLEKLTNEMVP  457
            + Q  AI VTRE+++DLAK+QSSR+VY CHVIGPK SGKT +CR F+   + KL  +   
Sbjct  421  DSQLAAIHVTRERRIDLAKRQSSRSVYKCHVIGPKGSGKTGMCRGFLVEDMHKLIGKEFK  480

Query  458  PSSHVTVNTVHVYGQEKTIILRDINILNVQDALTPAQIQCDVAALVYDASNPKSFEYIAR  517
             +    +N+V VYGQEK +ILRDI++ +  D L P ++ CDVA LVYD+SNP+SFEY+AR
Sbjct  481  TNVVNCINSVQVYGQEKHLILRDIDVRHALDPLQPQEVNCDVACLVYDSSNPRSFEYVAR  540

Query  518  IYIHLFQKYFADSKIPVLIIANKSDLSEVKQDYLLQPISFCNKYKLMPPQPYSISRTVRR  577
            IYI    KY+A+SKIPV+I+  K D+ E +QDYL+QP  FC+KYKL+PP  +S+ +T ++
Sbjct  541  IYI----KYYAESKIPVMIVGTKCDMDERRQDYLMQPSEFCDKYKLLPPHLFSL-KTNKK  595

Query  578  EIFVKLATMAAFPRFQGAWVLFYRDSPLRRMVHMLLVKPSPTQWWSSFTRHINQFGLLQG  637
            E++ KLATMAAFP                                     H+ QFGL+  
Sbjct  596  ELYTKLATMAAFP-------------------------------------HLRQFGLMTE  618

Query  638  DSMVWWKAGLGIAVATVAGFVVMRVLNT  665
            D  +W KAGLG+A AT+ GF+V++ ++ 
Sbjct  619  DPKLWLKAGLGVAAATMLGFIVLKTISA  646


>MIRO1_CAEEL unnamed protein product
Length=625

 Score = 533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/661 (42%), Positives = 408/661 (62%), Gaps = 52/661 (8%)

Query  11   NVRILLIGDRGVGKTSLILSLVSEEYAEDVPCKAEEITIPADVTPEQVPTNIVDYSAAEQ  70
            +VRI+LIGD G GKTSL++SL+ +E+ + VP + + + IPADVTPE V T+IVD S  E+
Sbjct  9    DVRIVLIGDEGCGKTSLVMSLLEDEWVDAVPRRLDRVLIPADVTPENVTTSIVDLSIKEE  68

Query  71   TEDQLTDEIQKAHVICVVYSVVDEDTLDRAVTYWLPLIRRCLTD-HRCPVVLVGNKIDLV  129
             E+ +  EI++A+VICVVYSV DE T+D   T WLPLIR+   + H  PV+LVGNK D  
Sbjct  69   DENWIVSEIRQANVICVVYSVTDESTVDGIQTKWLPLIRQSFGEYHETPVILVGNKSDGT  128

Query  130  DYSTIEAVYSIMKEFTEIESCIECSAKTLQNVSETFYYAQKAVLHPTTPLYNYDTHELTE  189
              +T + +  IM+  TE+E+C+ECSA+T++NVSE FYYAQKAV++PT PLY+ DT +LT+
Sbjct  129  ANNT-DKILPIMEANTEVETCVECSARTMKNVSEIFYYAQKAVIYPTRPLYDADTKQLTD  187

Query  190  ECKIALQRIFKICDLDNDGLLNDMELNTFQQWCFNIPLQPQVLEDVKAVLSKNIQDGICS  249
              + AL R+FKICD DNDG L+D ELN FQ+ CF IPL    LEDVK  +S    DG+ +
Sbjct  188  RARKALIRVFKICDRDNDGYLSDTELNDFQKLCFGIPLTSTALEDVKRAVSDGCPDGVAN  247

Query  250  GCVTLKGFMYLQCLFIQRGRNETTWAVLRKFGYDNELQMSKEYIYPLLKVPVGCTTELSH  309
              + L GF+YL  LFI+RGR+ETTWAVLRKFGY+  L++S++Y+YP + +PVGC+TELS 
Sbjct  248  DSLMLAGFLYLHLLFIERGRHETTWAVLRKFGYETSLKLSEDYLYPRITIPVGCSTELSP  307

Query  310  KGQEFLTLLFLQHDRDRDGALSPSEMESLFSRCLMPPWGDEYKYTVPTNEKGWITLQGYM  369
            +G +F++ LF ++D D+DG LSPSE+++LFS C +P    +    + TN++GW+T  GYM
Sbjct  308  EGVQFVSALFEKYDEDKDGCLSPSELQNLFSVCPVPVITKDNILALETNQRGWLTYNGYM  367

Query  370  CQWALLTLTNVRKALEYMAYLGYNMYNN-----ECQTNAILVTREKKLDLAKKQSSRNVY  424
              W + TL N+ +  E +AYLG+ +  +         ++I VTRE+K DL    + R V+
Sbjct  368  AYWNMTTLINLTQTFEQLAYLGFPVGRSGPGRAGNTLDSIRVTRERKKDLENHGTDRKVF  427

Query  425  SCHVIGPKSSGKTTLCRTFIDPKLEKLTNEMVPPSSHVTVNTVHVYGQEKTIILRDINIL  484
             C V+G K +GKT   ++     +  +  ++    S   +N V V  + K ++LR++++L
Sbjct  428  QCLVVGAKDAGKTVFMQSLAGRGMADVA-QIGRRHSPFVINRVRVKEESKYLLLREVDVL  486

Query  485  NVQDALTPAQIQCDVAALVYDASNPKSFEYIARIYIHLFQKYFADSKIPVLIIANKSDLS  544
            + QDAL   +   DV A +YD SNP SF + A +Y    QKYF  +K P ++IA K +  
Sbjct  487  SPQDALGSGETSADVVAFLYDISNPDSFAFCATVY----QKYFYRTKTPCVMIATKVERE  542

Query  545  EVKQDYLLQPISFCNKYKLMPPQPYSISRTVRRE--IFVKLATMAAFPRFQGAWVLFYRD  602
            EV Q + + P  FC +++L  P  +S     +    IF +LA MA +P            
Sbjct  543  EVDQRWEVPPEEFCRQFELPKPIKFSTGNIGQSSSPIFEQLAMMAVYPH-----------  591

Query  603  SPLRRMVHMLLVKPSPTQWWSSFTRHINQFGLLQGDSMVWWKAGLGIAVATVAGFVVMRV  662
              LRR+ ++                          DS +  K   G A+  +AGF+V++ 
Sbjct  592  --LRRVFYL-------------------------NDSNLLSKITFGAAIVALAGFLVLKN  624

Query  663  L  663
            L
Sbjct  625  L  625


>GEMA_DICDI unnamed protein product
Length=658

 Score = 329 bits (844),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 187/543 (34%), Positives = 299/543 (55%), Gaps = 22/543 (4%)

Query  8    LRRNVRILLIGDRGVGKTSLILSLVSEEYAEDVPCKAEEITIPADVTPEQVPTNIVD-YS  66
            ++ N++++LIGD  VGK+++I S +SE ++E       E+TIPA+   E   T I+D + 
Sbjct  1    MKNNIKVILIGDEQVGKSTIINSFISESFSEITQKTLPEVTIPAEFNNEICSTRIIDTFD  60

Query  67   AAEQTEDQLTDEIQKAHVICVVYSVVDEDTLDRAVTYWLPLIRRCLTDHRCPVVLVGNKI  126
              +  ++Q+  EI+ A  I +VYSV   DT       W+PLI +    ++ P+++VGNK+
Sbjct  61   DGKNLKNQMNMEIRTADAIVIVYSVDRFDTFMSIRMKWIPLINQLRGSNKSPIIIVGNKL  120

Query  127  DLVD-------YSTIEAVYSIMKEFTEIESCIECSAKTLQNVSETFYYAQKAVLHPTTPL  179
            DLVD           E +      ++     +ECSAKT++N+ E  Y +Q +V  P   L
Sbjct  121  DLVDDKHENNKVQIEETIQYFRSTYSNTIQWLECSAKTMENLPELLYASQTSVFFPERIL  180

Query  180  YNYDTHELTEECKIALQRIFKICDLDNDGLLNDMELNTFQQWCFNIPLQPQVLEDVKAVL  239
            YN + +++TE C+ AL+RIFK+CD DNDG L++ E+N FQ  C +  +  + +++++  +
Sbjct  181  YNREENKMTEGCERALKRIFKLCDHDNDGSLSEEEINYFQTKCGHETMTSEEIQNIQQFV  240

Query  240  SKNIQDGICSGCVTLKGFMYLQCLFIQRGRNETTWAVLRKFGYDNELQMSKEYIYPLLKV  299
               I DG+ S   T KGF+Y+  LF+ RG  + TW  LR F YD++L + + Y++P L+V
Sbjct  241  LSKIPDGVNSNGFTEKGFLYMNLLFLLRGPCQHTWTSLRSFNYDDDLVLLESYVHPTLQV  300

Query  300  PVGCTTELSHKGQEFLTLLFLQHDRDRDGALSPSEMESLFSRCLMPPWGDEYKYTVPTNE  359
            P    T LS  G EF   LF ++D D DG LS  ++ SLFS     PW   ++    T++
Sbjct  301  PPNHNTILSSMGNEFFKSLFEKYDSDSDGVLSSFDLVSLFSTTPKIPWEIGFEKHFNTDK  360

Query  360  KGWITLQGYMCQWALLTLTNVRKALEYMAYLGYNMYNNECQTNAILVTREKKLDLAKKQS  419
               +TL G++  W L T  N +  LEY+AY G    NN     +IL +RE  LD+   Q 
Sbjct  361  DSNLTLSGFLSLWNLQTYENYKVTLEYLAYFGSQTENNNIDMISILNSRE--LDIKSNQF  418

Query  420  SRNVYSCHVIGPKSSGKTTLCRTFIDPKLEKLTNEMVPPSSHVTVNTVHVYGQEKTIILR  479
            +RN+ +C+V G ++ GKTT   TFI      L N     + +          + K +IL 
Sbjct  419  TRNIVNCYVFGAEAVGKTTFLNTFIGKSFSTLYN---ATNGNDNFKVCGHLLKNKYLILS  475

Query  480  DINILNVQDALTPAQI--QCDVAALVYDASNPKSFEYIARIYIHLFQKYFADSKIPVLII  537
            +     V + +  A++  +CD+  L+YD ++ +SF++I  IY  L Q+      IP++ I
Sbjct  476  EY----VGEKIPTAELKSKCDLVCLLYDCNSEQSFKFIENIYNQLKQQQL---NIPIVFI  528

Query  538  ANK  540
              K
Sbjct  529  RTK  531


 Score = 35.8 bits (81),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 28/126 (22%), Positives = 54/126 (43%), Gaps = 10/126 (8%)

Query  428  VIGPKSSGKTTLCRTFIDPKLEKLTNEMVPPSSHVTVNTVHVYGQEKTIILRDINIL---  484
            +IG +  GK+T+  +FI     ++T + +P        T+      +    R I+     
Sbjct  9    LIGDEQVGKSTIINSFISESFSEITQKTLPEV------TIPAEFNNEICSTRIIDTFDDG  62

Query  485  -NVQDALTPAQIQCDVAALVYDASNPKSFEYIARIYIHLFQKYFADSKIPVLIIANKSDL  543
             N+++ +       D   +VY      +F  I   +I L  +    +K P++I+ NK DL
Sbjct  63   KNLKNQMNMEIRTADAIVIVYSVDRFDTFMSIRMKWIPLINQLRGSNKSPIIIVGNKLDL  122

Query  544  SEVKQD  549
             + K +
Sbjct  123  VDDKHE  128



Lambda      K        H
   0.320    0.135    0.398 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11373493824


Query= XP_050469392.1 mitochondrial Rho GTPase isoform X4 [Bombus huntii]

Length=664
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MIRO_DROME  unnamed protein product                                   781     0.0   
MIRO1_CAEEL  unnamed protein product                                  535     0.0   
GEMA_DICDI  unnamed protein product                                   326     3e-102


>MIRO_DROME unnamed protein product
Length=652

 Score = 781 bits (2017),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/684 (55%), Positives = 497/684 (73%), Gaps = 61/684 (9%)

Query  1    MVQRSVALRRNVRILLIGDRGVGKTSLILSLVSEEYAEDVPCKAEEITIPADVTPEQVPT  60
            M Q + + R+NVRILL+GD GVGKTSLILSLVSEEY E+VP +AEEITIPA+VTPEQVPT
Sbjct  1    MGQYTASQRKNVRILLVGDAGVGKTSLILSLVSEEYPEEVPPRAEEITIPANVTPEQVPT  60

Query  61   NIVDYSAAEQTEDQLTDEIQKAHVICVVYSVVDEDTLDRAVTYWLPLIR-RCLTDH----  115
            +IVD+SA EQ+ED L  EI KAHV+C+VY+V D+DTLDR  ++WLPL+R +C        
Sbjct  61   SIVDFSAVEQSEDALAAEINKAHVVCIVYAVDDDDTLDRITSHWLPLVRAKCNPSLDGEG  120

Query  116  ---------------RCPVVLVGNKIDLVDYSTIEAVYSIMKEFTEIESCIECSAKTLQN  160
                           R P+VLVGNKIDL++YST+++V +IM+++ EIESC+ECSAK+L N
Sbjct  121  DAEAEAEGDTQREPIRKPIVLVGNKIDLIEYSTMDSVLAIMEDYPEIESCVECSAKSLHN  180

Query  161  VSETFYYAQKAVLHPTTPLYNYDTHELTEECKIALQRIFKICDLDNDGLLNDMELNTFQQ  220
            +SE FYYAQKAVLHPT+PLY  +  ELT  CK +L RIFKICD+D D LLND ELN FQ+
Sbjct  181  ISEMFYYAQKAVLHPTSPLYMMEEQELTSACKKSLVRIFKICDIDGDNLLNDYELNLFQR  240

Query  221  WCFNIPLQPQVLEDVKAVLSKNIQDGICSGCVTLKGFMYLQCLFIQRGRNETTWAVLRKF  280
             CFN PLQPQ+L++VKAV+ KN+ DGI +  VTLKGF++L CLFIQRGRNETTWAVLR+F
Sbjct  241  RCFNTPLQPQILDEVKAVIQKNVPDGIYNDAVTLKGFLFLHCLFIQRGRNETTWAVLRRF  300

Query  281  GYDNELQMSKEYIYPLLKVPVGCTTELSHKGQEFLTLLFLQHDRDRDGALSPSEMESLFS  340
            GY+++L+M +EY+ P LK+P G +TELSH+GQ+FL  +F ++DRD DGALSP E + LFS
Sbjct  301  GYNDQLEMCQEYLRPPLKIPPGSSTELSHRGQQFLIAVFERYDRDGDGALSPEEHKMLFS  360

Query  341  RCLMPPW--GDEYKYTVPTNE-KGWITLQGYMCQWALLTLTNVRKALEYMAYLGYNMYNN  397
             C   PW    + + + P NE  GW+TL G++C+W L+TL +V K +EY+AYLG+N++ N
Sbjct  361  TCPAAPWSYSTDIRKSCPINETTGWVTLHGWLCRWTLMTLIDVVKTMEYLAYLGFNVHEN  420

Query  398  ECQTNAILVTREKKLDLAKKQSSRNVYSCHVIGPKSSGKTTLCRTFIDPKLEKLTNEMVP  457
            + Q  AI VTRE+++DLAK+QSSR+VY CHVIGPK SGKT +CR F+   + KL  +   
Sbjct  421  DSQLAAIHVTRERRIDLAKRQSSRSVYKCHVIGPKGSGKTGMCRGFLVEDMHKLIGKEFK  480

Query  458  PSSHVTVNTVHVYGQEKTIILRDINILNVQDALTPAQIQCDVAALVYDASNPKSFEYIAR  517
             +    +N+V VYGQEK +ILRDI++ +  D L P ++ CDVA LVYD+SNP+SFEY+AR
Sbjct  481  TNVVNCINSVQVYGQEKHLILRDIDVRHALDPLQPQEVNCDVACLVYDSSNPRSFEYVAR  540

Query  518  IYIKYFADSKIPVLIIANKSDLSEVKQDYLLQPISFCNKYKLMPPQPYSISRTVRREIFV  577
            IYIKY+A+SKIPV+I+  K D+ E +QDYL+QP  FC+KYKL+PP  +S+ +T ++E++ 
Sbjct  541  IYIKYYAESKIPVMIVGTKCDMDERRQDYLMQPSEFCDKYKLLPPHLFSL-KTNKKELYT  599

Query  578  KLATMAAFPRFQGAWVLFYRDSPLRRMVHMLLVKPSPTQWWSSFTRHINQFGLLQGDSMV  637
            KLATMAAFP                                     H+ QFGL+  D  +
Sbjct  600  KLATMAAFP-------------------------------------HLRQFGLMTEDPKL  622

Query  638  WWKAGLGIAVATVAGFVVMRVLNT  661
            W KAGLG+A AT+ GF+V++ ++ 
Sbjct  623  WLKAGLGVAAATMLGFIVLKTISA  646


>MIRO1_CAEEL unnamed protein product
Length=625

 Score = 535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/657 (42%), Positives = 407/657 (62%), Gaps = 48/657 (7%)

Query  11   NVRILLIGDRGVGKTSLILSLVSEEYAEDVPCKAEEITIPADVTPEQVPTNIVDYSAAEQ  70
            +VRI+LIGD G GKTSL++SL+ +E+ + VP + + + IPADVTPE V T+IVD S  E+
Sbjct  9    DVRIVLIGDEGCGKTSLVMSLLEDEWVDAVPRRLDRVLIPADVTPENVTTSIVDLSIKEE  68

Query  71   TEDQLTDEIQKAHVICVVYSVVDEDTLDRAVTYWLPLIRRCLTD-HRCPVVLVGNKIDLV  129
             E+ +  EI++A+VICVVYSV DE T+D   T WLPLIR+   + H  PV+LVGNK D  
Sbjct  69   DENWIVSEIRQANVICVVYSVTDESTVDGIQTKWLPLIRQSFGEYHETPVILVGNKSDGT  128

Query  130  DYSTIEAVYSIMKEFTEIESCIECSAKTLQNVSETFYYAQKAVLHPTTPLYNYDTHELTE  189
              +T + +  IM+  TE+E+C+ECSA+T++NVSE FYYAQKAV++PT PLY+ DT +LT+
Sbjct  129  ANNT-DKILPIMEANTEVETCVECSARTMKNVSEIFYYAQKAVIYPTRPLYDADTKQLTD  187

Query  190  ECKIALQRIFKICDLDNDGLLNDMELNTFQQWCFNIPLQPQVLEDVKAVLSKNIQDGICS  249
              + AL R+FKICD DNDG L+D ELN FQ+ CF IPL    LEDVK  +S    DG+ +
Sbjct  188  RARKALIRVFKICDRDNDGYLSDTELNDFQKLCFGIPLTSTALEDVKRAVSDGCPDGVAN  247

Query  250  GCVTLKGFMYLQCLFIQRGRNETTWAVLRKFGYDNELQMSKEYIYPLLKVPVGCTTELSH  309
              + L GF+YL  LFI+RGR+ETTWAVLRKFGY+  L++S++Y+YP + +PVGC+TELS 
Sbjct  248  DSLMLAGFLYLHLLFIERGRHETTWAVLRKFGYETSLKLSEDYLYPRITIPVGCSTELSP  307

Query  310  KGQEFLTLLFLQHDRDRDGALSPSEMESLFSRCLMPPWGDEYKYTVPTNEKGWITLQGYM  369
            +G +F++ LF ++D D+DG LSPSE+++LFS C +P    +    + TN++GW+T  GYM
Sbjct  308  EGVQFVSALFEKYDEDKDGCLSPSELQNLFSVCPVPVITKDNILALETNQRGWLTYNGYM  367

Query  370  CQWALLTLTNVRKALEYMAYLGYNMYNN-----ECQTNAILVTREKKLDLAKKQSSRNVY  424
              W + TL N+ +  E +AYLG+ +  +         ++I VTRE+K DL    + R V+
Sbjct  368  AYWNMTTLINLTQTFEQLAYLGFPVGRSGPGRAGNTLDSIRVTRERKKDLENHGTDRKVF  427

Query  425  SCHVIGPKSSGKTTLCRTFIDPKLEKLTNEMVPPSSHVTVNTVHVYGQEKTIILRDINIL  484
             C V+G K +GKT   ++     +  +  ++    S   +N V V  + K ++LR++++L
Sbjct  428  QCLVVGAKDAGKTVFMQSLAGRGMADVA-QIGRRHSPFVINRVRVKEESKYLLLREVDVL  486

Query  485  NVQDALTPAQIQCDVAALVYDASNPKSFEYIARIYIKYFADSKIPVLIIANKSDLSEVKQ  544
            + QDAL   +   DV A +YD SNP SF + A +Y KYF  +K P ++IA K +  EV Q
Sbjct  487  SPQDALGSGETSADVVAFLYDISNPDSFAFCATVYQKYFYRTKTPCVMIATKVEREEVDQ  546

Query  545  DYLLQPISFCNKYKLMPPQPYSISRTVRRE--IFVKLATMAAFPRFQGAWVLFYRDSPLR  602
             + + P  FC +++L  P  +S     +    IF +LA MA +P              LR
Sbjct  547  RWEVPPEEFCRQFELPKPIKFSTGNIGQSSSPIFEQLAMMAVYPH-------------LR  593

Query  603  RMVHMLLVKPSPTQWWSSFTRHINQFGLLQGDSMVWWKAGLGIAVATVAGFVVMRVL  659
            R+ ++                          DS +  K   G A+  +AGF+V++ L
Sbjct  594  RVFYL-------------------------NDSNLLSKITFGAAIVALAGFLVLKNL  625


>GEMA_DICDI unnamed protein product
Length=658

 Score = 326 bits (835),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 185/540 (34%), Positives = 297/540 (55%), Gaps = 20/540 (4%)

Query  8    LRRNVRILLIGDRGVGKTSLILSLVSEEYAEDVPCKAEEITIPADVTPEQVPTNIVD-YS  66
            ++ N++++LIGD  VGK+++I S +SE ++E       E+TIPA+   E   T I+D + 
Sbjct  1    MKNNIKVILIGDEQVGKSTIINSFISESFSEITQKTLPEVTIPAEFNNEICSTRIIDTFD  60

Query  67   AAEQTEDQLTDEIQKAHVICVVYSVVDEDTLDRAVTYWLPLIRRCLTDHRCPVVLVGNKI  126
              +  ++Q+  EI+ A  I +VYSV   DT       W+PLI +    ++ P+++VGNK+
Sbjct  61   DGKNLKNQMNMEIRTADAIVIVYSVDRFDTFMSIRMKWIPLINQLRGSNKSPIIIVGNKL  120

Query  127  DLVD-------YSTIEAVYSIMKEFTEIESCIECSAKTLQNVSETFYYAQKAVLHPTTPL  179
            DLVD           E +      ++     +ECSAKT++N+ E  Y +Q +V  P   L
Sbjct  121  DLVDDKHENNKVQIEETIQYFRSTYSNTIQWLECSAKTMENLPELLYASQTSVFFPERIL  180

Query  180  YNYDTHELTEECKIALQRIFKICDLDNDGLLNDMELNTFQQWCFNIPLQPQVLEDVKAVL  239
            YN + +++TE C+ AL+RIFK+CD DNDG L++ E+N FQ  C +  +  + +++++  +
Sbjct  181  YNREENKMTEGCERALKRIFKLCDHDNDGSLSEEEINYFQTKCGHETMTSEEIQNIQQFV  240

Query  240  SKNIQDGICSGCVTLKGFMYLQCLFIQRGRNETTWAVLRKFGYDNELQMSKEYIYPLLKV  299
               I DG+ S   T KGF+Y+  LF+ RG  + TW  LR F YD++L + + Y++P L+V
Sbjct  241  LSKIPDGVNSNGFTEKGFLYMNLLFLLRGPCQHTWTSLRSFNYDDDLVLLESYVHPTLQV  300

Query  300  PVGCTTELSHKGQEFLTLLFLQHDRDRDGALSPSEMESLFSRCLMPPWGDEYKYTVPTNE  359
            P    T LS  G EF   LF ++D D DG LS  ++ SLFS     PW   ++    T++
Sbjct  301  PPNHNTILSSMGNEFFKSLFEKYDSDSDGVLSSFDLVSLFSTTPKIPWEIGFEKHFNTDK  360

Query  360  KGWITLQGYMCQWALLTLTNVRKALEYMAYLGYNMYNNECQTNAILVTREKKLDLAKKQS  419
               +TL G++  W L T  N +  LEY+AY G    NN     +IL +RE  LD+   Q 
Sbjct  361  DSNLTLSGFLSLWNLQTYENYKVTLEYLAYFGSQTENNNIDMISILNSRE--LDIKSNQF  418

Query  420  SRNVYSCHVIGPKSSGKTTLCRTFIDPKLEKLTNEMVPPSSHVTVNTVHVYGQEKTIILR  479
            +RN+ +C+V G ++ GKTT   TFI      L N     + +          + K +IL 
Sbjct  419  TRNIVNCYVFGAEAVGKTTFLNTFIGKSFSTLYN---ATNGNDNFKVCGHLLKNKYLILS  475

Query  480  DINILNVQDALTPAQI--QCDVAALVYDASNPKSFEYIARIYIKYFADS-KIPVLIIANK  536
            +     V + +  A++  +CD+  L+YD ++ +SF++I  IY +       IP++ I  K
Sbjct  476  EY----VGEKIPTAELKSKCDLVCLLYDCNSEQSFKFIENIYNQLKQQQLNIPIVFIRTK  531



Lambda      K        H
   0.320    0.135    0.398 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11373493824


Query= XP_050469393.1 mitochondrial Rho GTPase isoform X5 [Bombus huntii]

Length=648
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MIRO_DROME  unnamed protein product                                   780     0.0   
MIRO1_CAEEL  unnamed protein product                                  538     0.0   
GEMA_DICDI  unnamed protein product                                   329     8e-104


>MIRO_DROME unnamed protein product
Length=652

 Score = 780 bits (2013),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/668 (56%), Positives = 497/668 (74%), Gaps = 45/668 (7%)

Query  1    MVQRSVALRRNVRILLIGDRGVGKTSLILSLVSEEYAEDVPCKAEEITIPADVTPEQVPT  60
            M Q + + R+NVRILL+GD GVGKTSLILSLVSEEY E+VP +AEEITIPA+VTPEQVPT
Sbjct  1    MGQYTASQRKNVRILLVGDAGVGKTSLILSLVSEEYPEEVPPRAEEITIPANVTPEQVPT  60

Query  61   NIVDYSAAEQTEDQLTDEIQKAHVICVVYSVVDEDTLDRAVTYWLPLIR-RCLTDH----  115
            +IVD+SA EQ+ED L  EI KAHV+C+VY+V D+DTLDR  ++WLPL+R +C        
Sbjct  61   SIVDFSAVEQSEDALAAEINKAHVVCIVYAVDDDDTLDRITSHWLPLVRAKCNPSLDGEG  120

Query  116  ---------------RCPVVLVGNKIDLVDYSTIEAVYSIMKEFTEIESCIECSAKTLQN  160
                           R P+VLVGNKIDL++YST+++V +IM+++ EIESC+ECSAK+L N
Sbjct  121  DAEAEAEGDTQREPIRKPIVLVGNKIDLIEYSTMDSVLAIMEDYPEIESCVECSAKSLHN  180

Query  161  VSETFYYAQKAVLHPTTPLYNYDTHELTEECKIALQRIFKICDLDNDGLLNDMELNTFQQ  220
            +SE FYYAQKAVLHPT+PLY  +  ELT  CK +L RIFKICD+D D LLND ELN FQ+
Sbjct  181  ISEMFYYAQKAVLHPTSPLYMMEEQELTSACKKSLVRIFKICDIDGDNLLNDYELNLFQR  240

Query  221  WCFNIPLQPQVLEDVKAVLSKNIQDGICSGCVTLKGFMYLQCLFIQRGRNETTWAVLRKF  280
             CFN PLQPQ+L++VKAV+ KN+ DGI +  VTLKGF++L CLFIQRGRNETTWAVLR+F
Sbjct  241  RCFNTPLQPQILDEVKAVIQKNVPDGIYNDAVTLKGFLFLHCLFIQRGRNETTWAVLRRF  300

Query  281  GYDNELQMSKEYIYPLLKVPVGCTTELSHKGQEFLTLLFLQHDRDRDGALSPSEMESLFS  340
            GY+++L+M +EY+ P LK+P G +TELSH+GQ+FL  +F ++DRD DGALSP E + LFS
Sbjct  301  GYNDQLEMCQEYLRPPLKIPPGSSTELSHRGQQFLIAVFERYDRDGDGALSPEEHKMLFS  360

Query  341  RCLMPPW--GDEYKYTVPTNE-KGWITLQGYMCQWALLTLTNVRKALEYMAYLGYNMYNN  397
             C   PW    + + + P NE  GW+TL G++C+W L+TL +V K +EY+AYLG+N++ N
Sbjct  361  TCPAAPWSYSTDIRKSCPINETTGWVTLHGWLCRWTLMTLIDVVKTMEYLAYLGFNVHEN  420

Query  398  ECQTNAILVTREKKLDLAKKQSSRNVYSCHVIGPKSSGKTTLCRTFIDPKLEVYVLKLTN  457
            + Q  AI VTRE+++DLAK+QSSR+VY CHVIGPK SGKT +CR F+   +     KL  
Sbjct  421  DSQLAAIHVTRERRIDLAKRQSSRSVYKCHVIGPKGSGKTGMCRGFLVEDMH----KLIG  476

Query  458  EMVPPSSHVTVNTVHVYGQEKTIILRDINILNVQDALTPAQIQCDVAALVYDASNPKSFE  517
            +    +    +N+V VYGQEK +ILRDI++ +  D L P ++ CDVA LVYD+SNP+SFE
Sbjct  477  KEFKTNVVNCINSVQVYGQEKHLILRDIDVRHALDPLQPQEVNCDVACLVYDSSNPRSFE  536

Query  518  YIARIYIHLFQKYFADSKIPVLIIANKSDLSEVKQDYLLQPISFCNKYKLMPPQPYSISR  577
            Y+ARIYI    KY+A+SKIPV+I+  K D+ E +QDYL+QP  FC+KYKL+PP  +S+ +
Sbjct  537  YVARIYI----KYYAESKIPVMIVGTKCDMDERRQDYLMQPSEFCDKYKLLPPHLFSL-K  591

Query  578  TVRREIFVKLATMAAFPRFQGAWVLFYRDRHINQFGLLQGDSMVWWKAGLGIAVATVAGF  637
            T ++E++ KLATMAAFP             H+ QFGL+  D  +W KAGLG+A AT+ GF
Sbjct  592  TNKKELYTKLATMAAFP-------------HLRQFGLMTEDPKLWLKAGLGVAAATMLGF  638

Query  638  VVMRVLNT  645
            +V++ ++ 
Sbjct  639  IVLKTISA  646


>MIRO1_CAEEL unnamed protein product
Length=625

 Score = 538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/641 (44%), Positives = 405/641 (63%), Gaps = 32/641 (5%)

Query  11   NVRILLIGDRGVGKTSLILSLVSEEYAEDVPCKAEEITIPADVTPEQVPTNIVDYSAAEQ  70
            +VRI+LIGD G GKTSL++SL+ +E+ + VP + + + IPADVTPE V T+IVD S  E+
Sbjct  9    DVRIVLIGDEGCGKTSLVMSLLEDEWVDAVPRRLDRVLIPADVTPENVTTSIVDLSIKEE  68

Query  71   TEDQLTDEIQKAHVICVVYSVVDEDTLDRAVTYWLPLIRRCLTD-HRCPVVLVGNKIDLV  129
             E+ +  EI++A+VICVVYSV DE T+D   T WLPLIR+   + H  PV+LVGNK D  
Sbjct  69   DENWIVSEIRQANVICVVYSVTDESTVDGIQTKWLPLIRQSFGEYHETPVILVGNKSDGT  128

Query  130  DYSTIEAVYSIMKEFTEIESCIECSAKTLQNVSETFYYAQKAVLHPTTPLYNYDTHELTE  189
              +T + +  IM+  TE+E+C+ECSA+T++NVSE FYYAQKAV++PT PLY+ DT +LT+
Sbjct  129  ANNT-DKILPIMEANTEVETCVECSARTMKNVSEIFYYAQKAVIYPTRPLYDADTKQLTD  187

Query  190  ECKIALQRIFKICDLDNDGLLNDMELNTFQQWCFNIPLQPQVLEDVKAVLSKNIQDGICS  249
              + AL R+FKICD DNDG L+D ELN FQ+ CF IPL    LEDVK  +S    DG+ +
Sbjct  188  RARKALIRVFKICDRDNDGYLSDTELNDFQKLCFGIPLTSTALEDVKRAVSDGCPDGVAN  247

Query  250  GCVTLKGFMYLQCLFIQRGRNETTWAVLRKFGYDNELQMSKEYIYPLLKVPVGCTTELSH  309
              + L GF+YL  LFI+RGR+ETTWAVLRKFGY+  L++S++Y+YP + +PVGC+TELS 
Sbjct  248  DSLMLAGFLYLHLLFIERGRHETTWAVLRKFGYETSLKLSEDYLYPRITIPVGCSTELSP  307

Query  310  KGQEFLTLLFLQHDRDRDGALSPSEMESLFSRCLMPPWGDEYKYTVPTNEKGWITLQGYM  369
            +G +F++ LF ++D D+DG LSPSE+++LFS C +P    +    + TN++GW+T  GYM
Sbjct  308  EGVQFVSALFEKYDEDKDGCLSPSELQNLFSVCPVPVITKDNILALETNQRGWLTYNGYM  367

Query  370  CQWALLTLTNVRKALEYMAYLGYNMYNN-----ECQTNAILVTREKKLDLAKKQSSRNVY  424
              W + TL N+ +  E +AYLG+ +  +         ++I VTRE+K DL    + R V+
Sbjct  368  AYWNMTTLINLTQTFEQLAYLGFPVGRSGPGRAGNTLDSIRVTRERKKDLENHGTDRKVF  427

Query  425  SCHVIGPKSSGKTTLCRTFIDPKLEVYVLKLTNEMVPPSSHVTVNTVHVYGQEKTIILRD  484
             C V+G K +GKT   ++     +   V ++     P      +N V V  + K ++LR+
Sbjct  428  QCLVVGAKDAGKTVFMQSLAGRGM-ADVAQIGRRHSP----FVINRVRVKEESKYLLLRE  482

Query  485  INILNVQDALTPAQIQCDVAALVYDASNPKSFEYIARIYIHLFQKYFADSKIPVLIIANK  544
            +++L+ QDAL   +   DV A +YD SNP SF + A +Y    QKYF  +K P ++IA K
Sbjct  483  VDVLSPQDALGSGETSADVVAFLYDISNPDSFAFCATVY----QKYFYRTKTPCVMIATK  538

Query  545  SDLSEVKQDYLLQPISFCNKYKLMPPQPYSISRTVRRE--IFVKLATMAAFPRFQGAWVL  602
             +  EV Q + + P  FC +++L  P  +S     +    IF +LA MA +P  +  + L
Sbjct  539  VEREEVDQRWEVPPEEFCRQFELPKPIKFSTGNIGQSSSPIFEQLAMMAVYPHLRRVFYL  598

Query  603  FYRDRHINQFGLLQGDSMVWWKAGLGIAVATVAGFVVMRVL  643
                           DS +  K   G A+  +AGF+V++ L
Sbjct  599  --------------NDSNLLSKITFGAAIVALAGFLVLKNL  625


>GEMA_DICDI unnamed protein product
Length=658

 Score = 329 bits (844),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 189/548 (34%), Positives = 301/548 (55%), Gaps = 28/548 (5%)

Query  8    LRRNVRILLIGDRGVGKTSLILSLVSEEYAEDVPCKAEEITIPADVTPEQVPTNIVD-YS  66
            ++ N++++LIGD  VGK+++I S +SE ++E       E+TIPA+   E   T I+D + 
Sbjct  1    MKNNIKVILIGDEQVGKSTIINSFISESFSEITQKTLPEVTIPAEFNNEICSTRIIDTFD  60

Query  67   AAEQTEDQLTDEIQKAHVICVVYSVVDEDTLDRAVTYWLPLIRRCLTDHRCPVVLVGNKI  126
              +  ++Q+  EI+ A  I +VYSV   DT       W+PLI +    ++ P+++VGNK+
Sbjct  61   DGKNLKNQMNMEIRTADAIVIVYSVDRFDTFMSIRMKWIPLINQLRGSNKSPIIIVGNKL  120

Query  127  DLVD-------YSTIEAVYSIMKEFTEIESCIECSAKTLQNVSETFYYAQKAVLHPTTPL  179
            DLVD           E +      ++     +ECSAKT++N+ E  Y +Q +V  P   L
Sbjct  121  DLVDDKHENNKVQIEETIQYFRSTYSNTIQWLECSAKTMENLPELLYASQTSVFFPERIL  180

Query  180  YNYDTHELTEECKIALQRIFKICDLDNDGLLNDMELNTFQQWCFNIPLQPQVLEDVKAVL  239
            YN + +++TE C+ AL+RIFK+CD DNDG L++ E+N FQ  C +  +  + +++++  +
Sbjct  181  YNREENKMTEGCERALKRIFKLCDHDNDGSLSEEEINYFQTKCGHETMTSEEIQNIQQFV  240

Query  240  SKNIQDGICSGCVTLKGFMYLQCLFIQRGRNETTWAVLRKFGYDNELQMSKEYIYPLLKV  299
               I DG+ S   T KGF+Y+  LF+ RG  + TW  LR F YD++L + + Y++P L+V
Sbjct  241  LSKIPDGVNSNGFTEKGFLYMNLLFLLRGPCQHTWTSLRSFNYDDDLVLLESYVHPTLQV  300

Query  300  PVGCTTELSHKGQEFLTLLFLQHDRDRDGALSPSEMESLFSRCLMPPWGDEYKYTVPTNE  359
            P    T LS  G EF   LF ++D D DG LS  ++ SLFS     PW   ++    T++
Sbjct  301  PPNHNTILSSMGNEFFKSLFEKYDSDSDGVLSSFDLVSLFSTTPKIPWEIGFEKHFNTDK  360

Query  360  KGWITLQGYMCQWALLTLTNVRKALEYMAYLGYNMYNNECQTNAILVTREKKLDLAKKQS  419
               +TL G++  W L T  N +  LEY+AY G    NN     +IL +RE  LD+   Q 
Sbjct  361  DSNLTLSGFLSLWNLQTYENYKVTLEYLAYFGSQTENNNIDMISILNSRE--LDIKSNQF  418

Query  420  SRNVYSCHVIGPKSSGKTTLCRTFIDPKLE-VYVLKLTNEMVPPSSHVTVNTVHVYGQEK  478
            +RN+ +C+V G ++ GKTT   TFI      +Y     N+      H+  N        K
Sbjct  419  TRNIVNCYVFGAEAVGKTTFLNTFIGKSFSTLYNATNGNDNFKVCGHLLKN--------K  470

Query  479  TIILRDINILNVQDALTPAQI--QCDVAALVYDASNPKSFEYIARIYIHLFQKYFADSKI  536
             +IL +     V + +  A++  +CD+  L+YD ++ +SF++I  IY  L Q+      I
Sbjct  471  YLILSEY----VGEKIPTAELKSKCDLVCLLYDCNSEQSFKFIENIYNQLKQQQL---NI  523

Query  537  PVLIIANK  544
            P++ I  K
Sbjct  524  PIVFIRTK  531


 Score = 32.3 bits (72),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 27/130 (21%), Positives = 51/130 (39%), Gaps = 14/130 (11%)

Query  428  VIGPKSSGKTTLCRTFIDPKLEVYVLKLTNEMVPPSSH----VTVNTVHVYGQEKTIILR  483
            +IG +  GK+T+  +FI         K   E+  P+       +   +  +   K     
Sbjct  9    LIGDEQVGKSTIINSFISESFSEITQKTLPEVTIPAEFNNEICSTRIIDTFDDGK-----  63

Query  484  DINILNVQDALTPAQIQCDVAALVYDASNPKSFEYIARIYIHLFQKYFADSKIPVLIIAN  543
                 N+++ +       D   +VY      +F  I   +I L  +    +K P++I+ N
Sbjct  64   -----NLKNQMNMEIRTADAIVIVYSVDRFDTFMSIRMKWIPLINQLRGSNKSPIIIVGN  118

Query  544  KSDLSEVKQD  553
            K DL + K +
Sbjct  119  KLDLVDDKHE  128



Lambda      K        H
   0.320    0.135    0.398 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11373493824


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Oct 18, 2022  4:55 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_050469394.1 mitochondrial Rho GTPase isoform X6 [Bombus huntii]

Length=644
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MIRO_DROME  unnamed protein product                                   785     0.0   
MIRO1_CAEEL  unnamed protein product                                  540     0.0   
GEMA_DICDI  unnamed protein product                                   326     2e-102


>MIRO_DROME unnamed protein product
Length=652

 Score = 785 bits (2028),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/664 (57%), Positives = 497/664 (75%), Gaps = 41/664 (6%)

Query  1    MVQRSVALRRNVRILLIGDRGVGKTSLILSLVSEEYAEDVPCKAEEITIPADVTPEQVPT  60
            M Q + + R+NVRILL+GD GVGKTSLILSLVSEEY E+VP +AEEITIPA+VTPEQVPT
Sbjct  1    MGQYTASQRKNVRILLVGDAGVGKTSLILSLVSEEYPEEVPPRAEEITIPANVTPEQVPT  60

Query  61   NIVDYSAAEQTEDQLTDEIQKAHVICVVYSVVDEDTLDRAVTYWLPLIR-RCLTDH----  115
            +IVD+SA EQ+ED L  EI KAHV+C+VY+V D+DTLDR  ++WLPL+R +C        
Sbjct  61   SIVDFSAVEQSEDALAAEINKAHVVCIVYAVDDDDTLDRITSHWLPLVRAKCNPSLDGEG  120

Query  116  ---------------RCPVVLVGNKIDLVDYSTIEAVYSIMKEFTEIESCIECSAKTLQN  160
                           R P+VLVGNKIDL++YST+++V +IM+++ EIESC+ECSAK+L N
Sbjct  121  DAEAEAEGDTQREPIRKPIVLVGNKIDLIEYSTMDSVLAIMEDYPEIESCVECSAKSLHN  180

Query  161  VSETFYYAQKAVLHPTTPLYNYDTHELTEECKIALQRIFKICDLDNDGLLNDMELNTFQQ  220
            +SE FYYAQKAVLHPT+PLY  +  ELT  CK +L RIFKICD+D D LLND ELN FQ+
Sbjct  181  ISEMFYYAQKAVLHPTSPLYMMEEQELTSACKKSLVRIFKICDIDGDNLLNDYELNLFQR  240

Query  221  WCFNIPLQPQVLEDVKAVLSKNIQDGICSGCVTLKGFMYLQCLFIQRGRNETTWAVLRKF  280
             CFN PLQPQ+L++VKAV+ KN+ DGI +  VTLKGF++L CLFIQRGRNETTWAVLR+F
Sbjct  241  RCFNTPLQPQILDEVKAVIQKNVPDGIYNDAVTLKGFLFLHCLFIQRGRNETTWAVLRRF  300

Query  281  GYDNELQMSKEYIYPLLKVPVGCTTELSHKGQEFLTLLFLQHDRDRDGALSPSEMESLFS  340
            GY+++L+M +EY+ P LK+P G +TELSH+GQ+FL  +F ++DRD DGALSP E + LFS
Sbjct  301  GYNDQLEMCQEYLRPPLKIPPGSSTELSHRGQQFLIAVFERYDRDGDGALSPEEHKMLFS  360

Query  341  RCLMPPW--GDEYKYTVPTNE-KGWITLQGYMCQWALLTLTNVRKALEYMAYLGYNMYNN  397
             C   PW    + + + P NE  GW+TL G++C+W L+TL +V K +EY+AYLG+N++ N
Sbjct  361  TCPAAPWSYSTDIRKSCPINETTGWVTLHGWLCRWTLMTLIDVVKTMEYLAYLGFNVHEN  420

Query  398  ECQTNAILVTREKKLDLAKKQSSRNVYSCHVIGPKSSGKTTLCRTFIDPKLEVYVLKLTN  457
            + Q  AI VTRE+++DLAK+QSSR+VY CHVIGPK SGKT +CR F+   +     KL  
Sbjct  421  DSQLAAIHVTRERRIDLAKRQSSRSVYKCHVIGPKGSGKTGMCRGFLVEDMH----KLIG  476

Query  458  EMVPPSSHVTVNTVHVYGQEKTIILRDINILNVQDALTPAQIQCDVAALVYDASNPKSFE  517
            +    +    +N+V VYGQEK +ILRDI++ +  D L P ++ CDVA LVYD+SNP+SFE
Sbjct  477  KEFKTNVVNCINSVQVYGQEKHLILRDIDVRHALDPLQPQEVNCDVACLVYDSSNPRSFE  536

Query  518  YIARIYIKYFADSKIPVLIIANKSDLSEVKQDYLLQPISFCNKYKLMPPQPYSISRTVRR  577
            Y+ARIYIKY+A+SKIPV+I+  K D+ E +QDYL+QP  FC+KYKL+PP  +S+ +T ++
Sbjct  537  YVARIYIKYYAESKIPVMIVGTKCDMDERRQDYLMQPSEFCDKYKLLPPHLFSL-KTNKK  595

Query  578  EIFVKLATMAAFPRFQGAWVLFYRDRHINQFGLLQGDSMVWWKAGLGIAVATVAGFVVMR  637
            E++ KLATMAAFP             H+ QFGL+  D  +W KAGLG+A AT+ GF+V++
Sbjct  596  ELYTKLATMAAFP-------------HLRQFGLMTEDPKLWLKAGLGVAAATMLGFIVLK  642

Query  638  VLNT  641
             ++ 
Sbjct  643  TISA  646


>MIRO1_CAEEL unnamed protein product
Length=625

 Score = 540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/637 (44%), Positives = 404/637 (63%), Gaps = 28/637 (4%)

Query  11   NVRILLIGDRGVGKTSLILSLVSEEYAEDVPCKAEEITIPADVTPEQVPTNIVDYSAAEQ  70
            +VRI+LIGD G GKTSL++SL+ +E+ + VP + + + IPADVTPE V T+IVD S  E+
Sbjct  9    DVRIVLIGDEGCGKTSLVMSLLEDEWVDAVPRRLDRVLIPADVTPENVTTSIVDLSIKEE  68

Query  71   TEDQLTDEIQKAHVICVVYSVVDEDTLDRAVTYWLPLIRRCLTD-HRCPVVLVGNKIDLV  129
             E+ +  EI++A+VICVVYSV DE T+D   T WLPLIR+   + H  PV+LVGNK D  
Sbjct  69   DENWIVSEIRQANVICVVYSVTDESTVDGIQTKWLPLIRQSFGEYHETPVILVGNKSDGT  128

Query  130  DYSTIEAVYSIMKEFTEIESCIECSAKTLQNVSETFYYAQKAVLHPTTPLYNYDTHELTE  189
              +T + +  IM+  TE+E+C+ECSA+T++NVSE FYYAQKAV++PT PLY+ DT +LT+
Sbjct  129  ANNT-DKILPIMEANTEVETCVECSARTMKNVSEIFYYAQKAVIYPTRPLYDADTKQLTD  187

Query  190  ECKIALQRIFKICDLDNDGLLNDMELNTFQQWCFNIPLQPQVLEDVKAVLSKNIQDGICS  249
              + AL R+FKICD DNDG L+D ELN FQ+ CF IPL    LEDVK  +S    DG+ +
Sbjct  188  RARKALIRVFKICDRDNDGYLSDTELNDFQKLCFGIPLTSTALEDVKRAVSDGCPDGVAN  247

Query  250  GCVTLKGFMYLQCLFIQRGRNETTWAVLRKFGYDNELQMSKEYIYPLLKVPVGCTTELSH  309
              + L GF+YL  LFI+RGR+ETTWAVLRKFGY+  L++S++Y+YP + +PVGC+TELS 
Sbjct  248  DSLMLAGFLYLHLLFIERGRHETTWAVLRKFGYETSLKLSEDYLYPRITIPVGCSTELSP  307

Query  310  KGQEFLTLLFLQHDRDRDGALSPSEMESLFSRCLMPPWGDEYKYTVPTNEKGWITLQGYM  369
            +G +F++ LF ++D D+DG LSPSE+++LFS C +P    +    + TN++GW+T  GYM
Sbjct  308  EGVQFVSALFEKYDEDKDGCLSPSELQNLFSVCPVPVITKDNILALETNQRGWLTYNGYM  367

Query  370  CQWALLTLTNVRKALEYMAYLGYNMYNN-----ECQTNAILVTREKKLDLAKKQSSRNVY  424
              W + TL N+ +  E +AYLG+ +  +         ++I VTRE+K DL    + R V+
Sbjct  368  AYWNMTTLINLTQTFEQLAYLGFPVGRSGPGRAGNTLDSIRVTRERKKDLENHGTDRKVF  427

Query  425  SCHVIGPKSSGKTTLCRTFIDPKLEVYVLKLTNEMVPPSSHVTVNTVHVYGQEKTIILRD  484
             C V+G K +GKT   ++     +   V ++     P      +N V V  + K ++LR+
Sbjct  428  QCLVVGAKDAGKTVFMQSLAGRGM-ADVAQIGRRHSP----FVINRVRVKEESKYLLLRE  482

Query  485  INILNVQDALTPAQIQCDVAALVYDASNPKSFEYIARIYIKYFADSKIPVLIIANKSDLS  544
            +++L+ QDAL   +   DV A +YD SNP SF + A +Y KYF  +K P ++IA K +  
Sbjct  483  VDVLSPQDALGSGETSADVVAFLYDISNPDSFAFCATVYQKYFYRTKTPCVMIATKVERE  542

Query  545  EVKQDYLLQPISFCNKYKLMPPQPYSISRTVRRE--IFVKLATMAAFPRFQGAWVLFYRD  602
            EV Q + + P  FC +++L  P  +S     +    IF +LA MA +P  +  + L    
Sbjct  543  EVDQRWEVPPEEFCRQFELPKPIKFSTGNIGQSSSPIFEQLAMMAVYPHLRRVFYL----  598

Query  603  RHINQFGLLQGDSMVWWKAGLGIAVATVAGFVVMRVL  639
                       DS +  K   G A+  +AGF+V++ L
Sbjct  599  ----------NDSNLLSKITFGAAIVALAGFLVLKNL  625


>GEMA_DICDI unnamed protein product
Length=658

 Score = 326 bits (835),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 187/545 (34%), Positives = 299/545 (55%), Gaps = 26/545 (5%)

Query  8    LRRNVRILLIGDRGVGKTSLILSLVSEEYAEDVPCKAEEITIPADVTPEQVPTNIVD-YS  66
            ++ N++++LIGD  VGK+++I S +SE ++E       E+TIPA+   E   T I+D + 
Sbjct  1    MKNNIKVILIGDEQVGKSTIINSFISESFSEITQKTLPEVTIPAEFNNEICSTRIIDTFD  60

Query  67   AAEQTEDQLTDEIQKAHVICVVYSVVDEDTLDRAVTYWLPLIRRCLTDHRCPVVLVGNKI  126
              +  ++Q+  EI+ A  I +VYSV   DT       W+PLI +    ++ P+++VGNK+
Sbjct  61   DGKNLKNQMNMEIRTADAIVIVYSVDRFDTFMSIRMKWIPLINQLRGSNKSPIIIVGNKL  120

Query  127  DLVD-------YSTIEAVYSIMKEFTEIESCIECSAKTLQNVSETFYYAQKAVLHPTTPL  179
            DLVD           E +      ++     +ECSAKT++N+ E  Y +Q +V  P   L
Sbjct  121  DLVDDKHENNKVQIEETIQYFRSTYSNTIQWLECSAKTMENLPELLYASQTSVFFPERIL  180

Query  180  YNYDTHELTEECKIALQRIFKICDLDNDGLLNDMELNTFQQWCFNIPLQPQVLEDVKAVL  239
            YN + +++TE C+ AL+RIFK+CD DNDG L++ E+N FQ  C +  +  + +++++  +
Sbjct  181  YNREENKMTEGCERALKRIFKLCDHDNDGSLSEEEINYFQTKCGHETMTSEEIQNIQQFV  240

Query  240  SKNIQDGICSGCVTLKGFMYLQCLFIQRGRNETTWAVLRKFGYDNELQMSKEYIYPLLKV  299
               I DG+ S   T KGF+Y+  LF+ RG  + TW  LR F YD++L + + Y++P L+V
Sbjct  241  LSKIPDGVNSNGFTEKGFLYMNLLFLLRGPCQHTWTSLRSFNYDDDLVLLESYVHPTLQV  300

Query  300  PVGCTTELSHKGQEFLTLLFLQHDRDRDGALSPSEMESLFSRCLMPPWGDEYKYTVPTNE  359
            P    T LS  G EF   LF ++D D DG LS  ++ SLFS     PW   ++    T++
Sbjct  301  PPNHNTILSSMGNEFFKSLFEKYDSDSDGVLSSFDLVSLFSTTPKIPWEIGFEKHFNTDK  360

Query  360  KGWITLQGYMCQWALLTLTNVRKALEYMAYLGYNMYNNECQTNAILVTREKKLDLAKKQS  419
               +TL G++  W L T  N +  LEY+AY G    NN     +IL +RE  LD+   Q 
Sbjct  361  DSNLTLSGFLSLWNLQTYENYKVTLEYLAYFGSQTENNNIDMISILNSRE--LDIKSNQF  418

Query  420  SRNVYSCHVIGPKSSGKTTLCRTFIDPKLE-VYVLKLTNEMVPPSSHVTVNTVHVYGQEK  478
            +RN+ +C+V G ++ GKTT   TFI      +Y     N+      H+  N        K
Sbjct  419  TRNIVNCYVFGAEAVGKTTFLNTFIGKSFSTLYNATNGNDNFKVCGHLLKN--------K  470

Query  479  TIILRDINILNVQDALTPAQI--QCDVAALVYDASNPKSFEYIARIYIKYFADS-KIPVL  535
             +IL +     V + +  A++  +CD+  L+YD ++ +SF++I  IY +       IP++
Sbjct  471  YLILSEY----VGEKIPTAELKSKCDLVCLLYDCNSEQSFKFIENIYNQLKQQQLNIPIV  526

Query  536  IIANK  540
             I  K
Sbjct  527  FIRTK  531



Lambda      K        H
   0.322    0.136    0.412 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7723295310


Query= XP_050469395.1 mitochondrial Rho GTPase isoform X7 [Bombus huntii]

Length=640
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MIRO_DROME  unnamed protein product                                   791     0.0   
MIRO1_CAEEL  unnamed protein product                                  543     0.0   
GEMA_DICDI  unnamed protein product                                   326     1e-102


>MIRO_DROME unnamed protein product
Length=652

 Score = 791 bits (2043),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/660 (57%), Positives = 497/660 (75%), Gaps = 37/660 (6%)

Query  1    MVQRSVALRRNVRILLIGDRGVGKTSLILSLVSEEYAEDVPCKAEEITIPADVTPEQVPT  60
            M Q + + R+NVRILL+GD GVGKTSLILSLVSEEY E+VP +AEEITIPA+VTPEQVPT
Sbjct  1    MGQYTASQRKNVRILLVGDAGVGKTSLILSLVSEEYPEEVPPRAEEITIPANVTPEQVPT  60

Query  61   NIVDYSAAEQTEDQLTDEIQKAHVICVVYSVVDEDTLDRAVTYWLPLIR-RCLTDH----  115
            +IVD+SA EQ+ED L  EI KAHV+C+VY+V D+DTLDR  ++WLPL+R +C        
Sbjct  61   SIVDFSAVEQSEDALAAEINKAHVVCIVYAVDDDDTLDRITSHWLPLVRAKCNPSLDGEG  120

Query  116  ---------------RCPVVLVGNKIDLVDYSTIEAVYSIMKEFTEIESCIECSAKTLQN  160
                           R P+VLVGNKIDL++YST+++V +IM+++ EIESC+ECSAK+L N
Sbjct  121  DAEAEAEGDTQREPIRKPIVLVGNKIDLIEYSTMDSVLAIMEDYPEIESCVECSAKSLHN  180

Query  161  VSETFYYAQKAVLHPTTPLYNYDTHELTEECKIALQRIFKICDLDNDGLLNDMELNTFQQ  220
            +SE FYYAQKAVLHPT+PLY  +  ELT  CK +L RIFKICD+D D LLND ELN FQ+
Sbjct  181  ISEMFYYAQKAVLHPTSPLYMMEEQELTSACKKSLVRIFKICDIDGDNLLNDYELNLFQR  240

Query  221  WCFNIPLQPQVLEDVKAVLSKNIQDGICSGCVTLKGFMYLQCLFIQRGRNETTWAVLRKF  280
             CFN PLQPQ+L++VKAV+ KN+ DGI +  VTLKGF++L CLFIQRGRNETTWAVLR+F
Sbjct  241  RCFNTPLQPQILDEVKAVIQKNVPDGIYNDAVTLKGFLFLHCLFIQRGRNETTWAVLRRF  300

Query  281  GYDNELQMSKEYIYPLLKVPVGCTTELSHKGQEFLTLLFLQHDRDRDGALSPSEMESLFS  340
            GY+++L+M +EY+ P LK+P G +TELSH+GQ+FL  +F ++DRD DGALSP E + LFS
Sbjct  301  GYNDQLEMCQEYLRPPLKIPPGSSTELSHRGQQFLIAVFERYDRDGDGALSPEEHKMLFS  360

Query  341  RCLMPPW--GDEYKYTVPTNE-KGWITLQGYMCQWALLTLTNVRKALEYMAYLGYNMYNN  397
             C   PW    + + + P NE  GW+TL G++C+W L+TL +V K +EY+AYLG+N++ N
Sbjct  361  TCPAAPWSYSTDIRKSCPINETTGWVTLHGWLCRWTLMTLIDVVKTMEYLAYLGFNVHEN  420

Query  398  ECQTNAILVTREKKLDLAKKQSSRNVYSCHVIGPKSSGKTTLCRTFIDPKLEKLTNEMVP  457
            + Q  AI VTRE+++DLAK+QSSR+VY CHVIGPK SGKT +CR F+   + KL  +   
Sbjct  421  DSQLAAIHVTRERRIDLAKRQSSRSVYKCHVIGPKGSGKTGMCRGFLVEDMHKLIGKEFK  480

Query  458  PSSHVTVNTVHVYGQEKTIILRDINILNVQDALTPAQIQCDVAALVYDASNPKSFEYIAR  517
             +    +N+V VYGQEK +ILRDI++ +  D L P ++ CDVA LVYD+SNP+SFEY+AR
Sbjct  481  TNVVNCINSVQVYGQEKHLILRDIDVRHALDPLQPQEVNCDVACLVYDSSNPRSFEYVAR  540

Query  518  IYIKYFADSKIPVLIIANKSDLSEVKQDYLLQPISFCNKYKLMPPQPYSISRTVRREIFV  577
            IYIKY+A+SKIPV+I+  K D+ E +QDYL+QP  FC+KYKL+PP  +S+ +T ++E++ 
Sbjct  541  IYIKYYAESKIPVMIVGTKCDMDERRQDYLMQPSEFCDKYKLLPPHLFSL-KTNKKELYT  599

Query  578  KLATMAAFPRFQGAWVLFYRDRHINQFGLLQGDSMVWWKAGLGIAVATVAGFVVMRVLNT  637
            KLATMAAFP             H+ QFGL+  D  +W KAGLG+A AT+ GF+V++ ++ 
Sbjct  600  KLATMAAFP-------------HLRQFGLMTEDPKLWLKAGLGVAAATMLGFIVLKTISA  646


>MIRO1_CAEEL unnamed protein product
Length=625

 Score = 543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/633 (44%), Positives = 404/633 (64%), Gaps = 24/633 (4%)

Query  11   NVRILLIGDRGVGKTSLILSLVSEEYAEDVPCKAEEITIPADVTPEQVPTNIVDYSAAEQ  70
            +VRI+LIGD G GKTSL++SL+ +E+ + VP + + + IPADVTPE V T+IVD S  E+
Sbjct  9    DVRIVLIGDEGCGKTSLVMSLLEDEWVDAVPRRLDRVLIPADVTPENVTTSIVDLSIKEE  68

Query  71   TEDQLTDEIQKAHVICVVYSVVDEDTLDRAVTYWLPLIRRCLTD-HRCPVVLVGNKIDLV  129
             E+ +  EI++A+VICVVYSV DE T+D   T WLPLIR+   + H  PV+LVGNK D  
Sbjct  69   DENWIVSEIRQANVICVVYSVTDESTVDGIQTKWLPLIRQSFGEYHETPVILVGNKSDGT  128

Query  130  DYSTIEAVYSIMKEFTEIESCIECSAKTLQNVSETFYYAQKAVLHPTTPLYNYDTHELTE  189
              +T + +  IM+  TE+E+C+ECSA+T++NVSE FYYAQKAV++PT PLY+ DT +LT+
Sbjct  129  ANNT-DKILPIMEANTEVETCVECSARTMKNVSEIFYYAQKAVIYPTRPLYDADTKQLTD  187

Query  190  ECKIALQRIFKICDLDNDGLLNDMELNTFQQWCFNIPLQPQVLEDVKAVLSKNIQDGICS  249
              + AL R+FKICD DNDG L+D ELN FQ+ CF IPL    LEDVK  +S    DG+ +
Sbjct  188  RARKALIRVFKICDRDNDGYLSDTELNDFQKLCFGIPLTSTALEDVKRAVSDGCPDGVAN  247

Query  250  GCVTLKGFMYLQCLFIQRGRNETTWAVLRKFGYDNELQMSKEYIYPLLKVPVGCTTELSH  309
              + L GF+YL  LFI+RGR+ETTWAVLRKFGY+  L++S++Y+YP + +PVGC+TELS 
Sbjct  248  DSLMLAGFLYLHLLFIERGRHETTWAVLRKFGYETSLKLSEDYLYPRITIPVGCSTELSP  307

Query  310  KGQEFLTLLFLQHDRDRDGALSPSEMESLFSRCLMPPWGDEYKYTVPTNEKGWITLQGYM  369
            +G +F++ LF ++D D+DG LSPSE+++LFS C +P    +    + TN++GW+T  GYM
Sbjct  308  EGVQFVSALFEKYDEDKDGCLSPSELQNLFSVCPVPVITKDNILALETNQRGWLTYNGYM  367

Query  370  CQWALLTLTNVRKALEYMAYLGYNMYNN-----ECQTNAILVTREKKLDLAKKQSSRNVY  424
              W + TL N+ +  E +AYLG+ +  +         ++I VTRE+K DL    + R V+
Sbjct  368  AYWNMTTLINLTQTFEQLAYLGFPVGRSGPGRAGNTLDSIRVTRERKKDLENHGTDRKVF  427

Query  425  SCHVIGPKSSGKTTLCRTFIDPKLEKLTNEMVPPSSHVTVNTVHVYGQEKTIILRDINIL  484
             C V+G K +GKT   ++     +  +  ++    S   +N V V  + K ++LR++++L
Sbjct  428  QCLVVGAKDAGKTVFMQSLAGRGMADVA-QIGRRHSPFVINRVRVKEESKYLLLREVDVL  486

Query  485  NVQDALTPAQIQCDVAALVYDASNPKSFEYIARIYIKYFADSKIPVLIIANKSDLSEVKQ  544
            + QDAL   +   DV A +YD SNP SF + A +Y KYF  +K P ++IA K +  EV Q
Sbjct  487  SPQDALGSGETSADVVAFLYDISNPDSFAFCATVYQKYFYRTKTPCVMIATKVEREEVDQ  546

Query  545  DYLLQPISFCNKYKLMPPQPYSISRTVRRE--IFVKLATMAAFPRFQGAWVLFYRDRHIN  602
             + + P  FC +++L  P  +S     +    IF +LA MA +P  +  + L        
Sbjct  547  RWEVPPEEFCRQFELPKPIKFSTGNIGQSSSPIFEQLAMMAVYPHLRRVFYL--------  598

Query  603  QFGLLQGDSMVWWKAGLGIAVATVAGFVVMRVL  635
                   DS +  K   G A+  +AGF+V++ L
Sbjct  599  ------NDSNLLSKITFGAAIVALAGFLVLKNL  625


>GEMA_DICDI unnamed protein product
Length=658

 Score = 326 bits (836),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 185/540 (34%), Positives = 297/540 (55%), Gaps = 20/540 (4%)

Query  8    LRRNVRILLIGDRGVGKTSLILSLVSEEYAEDVPCKAEEITIPADVTPEQVPTNIVD-YS  66
            ++ N++++LIGD  VGK+++I S +SE ++E       E+TIPA+   E   T I+D + 
Sbjct  1    MKNNIKVILIGDEQVGKSTIINSFISESFSEITQKTLPEVTIPAEFNNEICSTRIIDTFD  60

Query  67   AAEQTEDQLTDEIQKAHVICVVYSVVDEDTLDRAVTYWLPLIRRCLTDHRCPVVLVGNKI  126
              +  ++Q+  EI+ A  I +VYSV   DT       W+PLI +    ++ P+++VGNK+
Sbjct  61   DGKNLKNQMNMEIRTADAIVIVYSVDRFDTFMSIRMKWIPLINQLRGSNKSPIIIVGNKL  120

Query  127  DLVD-------YSTIEAVYSIMKEFTEIESCIECSAKTLQNVSETFYYAQKAVLHPTTPL  179
            DLVD           E +      ++     +ECSAKT++N+ E  Y +Q +V  P   L
Sbjct  121  DLVDDKHENNKVQIEETIQYFRSTYSNTIQWLECSAKTMENLPELLYASQTSVFFPERIL  180

Query  180  YNYDTHELTEECKIALQRIFKICDLDNDGLLNDMELNTFQQWCFNIPLQPQVLEDVKAVL  239
            YN + +++TE C+ AL+RIFK+CD DNDG L++ E+N FQ  C +  +  + +++++  +
Sbjct  181  YNREENKMTEGCERALKRIFKLCDHDNDGSLSEEEINYFQTKCGHETMTSEEIQNIQQFV  240

Query  240  SKNIQDGICSGCVTLKGFMYLQCLFIQRGRNETTWAVLRKFGYDNELQMSKEYIYPLLKV  299
               I DG+ S   T KGF+Y+  LF+ RG  + TW  LR F YD++L + + Y++P L+V
Sbjct  241  LSKIPDGVNSNGFTEKGFLYMNLLFLLRGPCQHTWTSLRSFNYDDDLVLLESYVHPTLQV  300

Query  300  PVGCTTELSHKGQEFLTLLFLQHDRDRDGALSPSEMESLFSRCLMPPWGDEYKYTVPTNE  359
            P    T LS  G EF   LF ++D D DG LS  ++ SLFS     PW   ++    T++
Sbjct  301  PPNHNTILSSMGNEFFKSLFEKYDSDSDGVLSSFDLVSLFSTTPKIPWEIGFEKHFNTDK  360

Query  360  KGWITLQGYMCQWALLTLTNVRKALEYMAYLGYNMYNNECQTNAILVTREKKLDLAKKQS  419
               +TL G++  W L T  N +  LEY+AY G    NN     +IL +RE  LD+   Q 
Sbjct  361  DSNLTLSGFLSLWNLQTYENYKVTLEYLAYFGSQTENNNIDMISILNSRE--LDIKSNQF  418

Query  420  SRNVYSCHVIGPKSSGKTTLCRTFIDPKLEKLTNEMVPPSSHVTVNTVHVYGQEKTIILR  479
            +RN+ +C+V G ++ GKTT   TFI      L N     + +          + K +IL 
Sbjct  419  TRNIVNCYVFGAEAVGKTTFLNTFIGKSFSTLYN---ATNGNDNFKVCGHLLKNKYLILS  475

Query  480  DINILNVQDALTPAQI--QCDVAALVYDASNPKSFEYIARIYIKYFADS-KIPVLIIANK  536
            +     V + +  A++  +CD+  L+YD ++ +SF++I  IY +       IP++ I  K
Sbjct  476  EY----VGEKIPTAELKSKCDLVCLLYDCNSEQSFKFIENIYNQLKQQQLNIPIVFIRTK  531


 Score = 29.6 bits (65),  Expect = 8.4, Method: Compositional matrix adjust.
 Identities = 27/126 (21%), Positives = 53/126 (42%), Gaps = 14/126 (11%)

Query  428  VIGPKSSGKTTLCRTFIDPKLEKLTNEMVPPSSHVTVNTVHVYGQEKTIILRDINIL---  484
            +IG +  GK+T+  +FI     ++T + +P        T+      +    R I+     
Sbjct  9    LIGDEQVGKSTIINSFISESFSEITQKTLPEV------TIPAEFNNEICSTRIIDTFDDG  62

Query  485  -NVQDALTPAQIQCDVAALVYDASNPKSFEYIARIYI----KYFADSKIPVLIIANKSDL  539
             N+++ +       D   +VY      +F  I   +I    +    +K P++I+ NK DL
Sbjct  63   KNLKNQMNMEIRTADAIVIVYSVDRFDTFMSIRMKWIPLINQLRGSNKSPIIIVGNKLDL  122

Query  540  SEVKQD  545
             + K +
Sbjct  123  VDDKHE  128



Lambda      K        H
   0.322    0.136    0.412 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7723295310


Query= XP_050469396.1 mitochondrial Rho GTPase isoform X8 [Bombus huntii]

Length=635
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MIRO_DROME  unnamed protein product                                   790     0.0   
MIRO1_CAEEL  unnamed protein product                                  546     0.0   
GEMA_DICDI  unnamed protein product                                   330     4e-104


>MIRO_DROME unnamed protein product
Length=652

 Score = 790 bits (2039),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/655 (57%), Positives = 497/655 (76%), Gaps = 32/655 (5%)

Query  1    MVQRSVALRRNVRILLIGDRGVGKTSLILSLVSEEYAEDVPCKAEEITIPADVTPEQVPT  60
            M Q + + R+NVRILL+GD GVGKTSLILSLVSEEY E+VP +AEEITIPA+VTPEQVPT
Sbjct  1    MGQYTASQRKNVRILLVGDAGVGKTSLILSLVSEEYPEEVPPRAEEITIPANVTPEQVPT  60

Query  61   NIVDYSAAEQTEDQLTDEIQKAHVICVVYSVVDEDTLDRAVTYWLPLIR-RCLTDH----  115
            +IVD+SA EQ+ED L  EI KAHV+C+VY+V D+DTLDR  ++WLPL+R +C        
Sbjct  61   SIVDFSAVEQSEDALAAEINKAHVVCIVYAVDDDDTLDRITSHWLPLVRAKCNPSLDGEG  120

Query  116  ---------------RCPVVLVGNKIDLVDYSTIEAVYSIMKEFTEIESCIECSAKTLQN  160
                           R P+VLVGNKIDL++YST+++V +IM+++ EIESC+ECSAK+L N
Sbjct  121  DAEAEAEGDTQREPIRKPIVLVGNKIDLIEYSTMDSVLAIMEDYPEIESCVECSAKSLHN  180

Query  161  VSETFYYAQKAVLHPTTPLYNYDTHELTEECKIALQRIFKICDLDNDGLLNDMELNTFQQ  220
            +SE FYYAQKAVLHPT+PLY  +  ELT  CK +L RIFKICD+D D LLND ELN FQ+
Sbjct  181  ISEMFYYAQKAVLHPTSPLYMMEEQELTSACKKSLVRIFKICDIDGDNLLNDYELNLFQR  240

Query  221  WCFNIPLQPQVLEDVKAVLSKNIQDGICSGCVTLKGFMYLQCLFIQRGRNETTWAVLRKF  280
             CFN PLQPQ+L++VKAV+ KN+ DGI +  VTLKGF++L CLFIQRGRNETTWAVLR+F
Sbjct  241  RCFNTPLQPQILDEVKAVIQKNVPDGIYNDAVTLKGFLFLHCLFIQRGRNETTWAVLRRF  300

Query  281  GYDNELQMSKEYIYPLLKVPVGCTTELSHKGQEFLTLLFLQHDRDRDGALSPSEMESLFS  340
            GY+++L+M +EY+ P LK+P G +TELSH+GQ+FL  +F ++DRD DGALSP E + LFS
Sbjct  301  GYNDQLEMCQEYLRPPLKIPPGSSTELSHRGQQFLIAVFERYDRDGDGALSPEEHKMLFS  360

Query  341  RCLMPPW--GDEYKYTVPTNE-KGWITLQGYMCQWALLTLTNVRKALEYMAYLGYNMYNN  397
             C   PW    + + + P NE  GW+TL G++C+W L+TL +V K +EY+AYLG+N++ N
Sbjct  361  TCPAAPWSYSTDIRKSCPINETTGWVTLHGWLCRWTLMTLIDVVKTMEYLAYLGFNVHEN  420

Query  398  ECQTNAILVTREKKLDLAKKQSSRNVYSCHVIGPKSSGKTTLCRTFIDPKLEVYVLKLTN  457
            + Q  AI VTRE+++DLAK+QSSR+VY CHVIGPK SGKT +CR F+   +     KL  
Sbjct  421  DSQLAAIHVTRERRIDLAKRQSSRSVYKCHVIGPKGSGKTGMCRGFLVEDMH----KLIG  476

Query  458  EMVPPSSHVTVNTVHVYGQEKTIILRDINILNVQDALTPAQIQCDVAALVYDASNPKSFE  517
            +    +    +N+V VYGQEK +ILRDI++ +  D L P ++ CDVA LVYD+SNP+SFE
Sbjct  477  KEFKTNVVNCINSVQVYGQEKHLILRDIDVRHALDPLQPQEVNCDVACLVYDSSNPRSFE  536

Query  518  YIARIYIHLFQKYFADSKIPVLIIANKSDLSEVKQDYLLQPISFCNKYKLMPPQPYSISR  577
            Y+ARIYI    KY+A+SKIPV+I+  K D+ E +QDYL+QP  FC+KYKL+PP  +S+ +
Sbjct  537  YVARIYI----KYYAESKIPVMIVGTKCDMDERRQDYLMQPSEFCDKYKLLPPHLFSL-K  591

Query  578  TVRREIFVKLATMAAFPHINQFGLLQGDSMVWWKAGLGIAVATVAGFVVMRVLNT  632
            T ++E++ KLATMAAFPH+ QFGL+  D  +W KAGLG+A AT+ GF+V++ ++ 
Sbjct  592  TNKKELYTKLATMAAFPHLRQFGLMTEDPKLWLKAGLGVAAATMLGFIVLKTISA  646


>MIRO1_CAEEL unnamed protein product
Length=625

 Score = 546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/628 (45%), Positives = 406/628 (65%), Gaps = 19/628 (3%)

Query  11   NVRILLIGDRGVGKTSLILSLVSEEYAEDVPCKAEEITIPADVTPEQVPTNIVDYSAAEQ  70
            +VRI+LIGD G GKTSL++SL+ +E+ + VP + + + IPADVTPE V T+IVD S  E+
Sbjct  9    DVRIVLIGDEGCGKTSLVMSLLEDEWVDAVPRRLDRVLIPADVTPENVTTSIVDLSIKEE  68

Query  71   TEDQLTDEIQKAHVICVVYSVVDEDTLDRAVTYWLPLIRRCLTD-HRCPVVLVGNKIDLV  129
             E+ +  EI++A+VICVVYSV DE T+D   T WLPLIR+   + H  PV+LVGNK D  
Sbjct  69   DENWIVSEIRQANVICVVYSVTDESTVDGIQTKWLPLIRQSFGEYHETPVILVGNKSDGT  128

Query  130  DYSTIEAVYSIMKEFTEIESCIECSAKTLQNVSETFYYAQKAVLHPTTPLYNYDTHELTE  189
              +T + +  IM+  TE+E+C+ECSA+T++NVSE FYYAQKAV++PT PLY+ DT +LT+
Sbjct  129  ANNT-DKILPIMEANTEVETCVECSARTMKNVSEIFYYAQKAVIYPTRPLYDADTKQLTD  187

Query  190  ECKIALQRIFKICDLDNDGLLNDMELNTFQQWCFNIPLQPQVLEDVKAVLSKNIQDGICS  249
              + AL R+FKICD DNDG L+D ELN FQ+ CF IPL    LEDVK  +S    DG+ +
Sbjct  188  RARKALIRVFKICDRDNDGYLSDTELNDFQKLCFGIPLTSTALEDVKRAVSDGCPDGVAN  247

Query  250  GCVTLKGFMYLQCLFIQRGRNETTWAVLRKFGYDNELQMSKEYIYPLLKVPVGCTTELSH  309
              + L GF+YL  LFI+RGR+ETTWAVLRKFGY+  L++S++Y+YP + +PVGC+TELS 
Sbjct  248  DSLMLAGFLYLHLLFIERGRHETTWAVLRKFGYETSLKLSEDYLYPRITIPVGCSTELSP  307

Query  310  KGQEFLTLLFLQHDRDRDGALSPSEMESLFSRCLMPPWGDEYKYTVPTNEKGWITLQGYM  369
            +G +F++ LF ++D D+DG LSPSE+++LFS C +P    +    + TN++GW+T  GYM
Sbjct  308  EGVQFVSALFEKYDEDKDGCLSPSELQNLFSVCPVPVITKDNILALETNQRGWLTYNGYM  367

Query  370  CQWALLTLTNVRKALEYMAYLGYNMYNN-----ECQTNAILVTREKKLDLAKKQSSRNVY  424
              W + TL N+ +  E +AYLG+ +  +         ++I VTRE+K DL    + R V+
Sbjct  368  AYWNMTTLINLTQTFEQLAYLGFPVGRSGPGRAGNTLDSIRVTRERKKDLENHGTDRKVF  427

Query  425  SCHVIGPKSSGKTTLCRTFIDPKLEVYVLKLTNEMVPPSSHVTVNTVHVYGQEKTIILRD  484
             C V+G K +GKT   ++     +   V ++     P      +N V V  + K ++LR+
Sbjct  428  QCLVVGAKDAGKTVFMQSLAGRGM-ADVAQIGRRHSP----FVINRVRVKEESKYLLLRE  482

Query  485  INILNVQDALTPAQIQCDVAALVYDASNPKSFEYIARIYIHLFQKYFADSKIPVLIIANK  544
            +++L+ QDAL   +   DV A +YD SNP SF + A +Y    QKYF  +K P ++IA K
Sbjct  483  VDVLSPQDALGSGETSADVVAFLYDISNPDSFAFCATVY----QKYFYRTKTPCVMIATK  538

Query  545  SDLSEVKQDYLLQPISFCNKYKLMPPQPYSISRTVRRE--IFVKLATMAAFPHINQFGLL  602
             +  EV Q + + P  FC +++L  P  +S     +    IF +LA MA +PH+ +   L
Sbjct  539  VEREEVDQRWEVPPEEFCRQFELPKPIKFSTGNIGQSSSPIFEQLAMMAVYPHLRRVFYL  598

Query  603  QGDSMVWWKAGLGIAVATVAGFVVMRVL  630
              DS +  K   G A+  +AGF+V++ L
Sbjct  599  N-DSNLLSKITFGAAIVALAGFLVLKNL  625


>GEMA_DICDI unnamed protein product
Length=658

 Score = 330 bits (845),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 189/548 (34%), Positives = 301/548 (55%), Gaps = 28/548 (5%)

Query  8    LRRNVRILLIGDRGVGKTSLILSLVSEEYAEDVPCKAEEITIPADVTPEQVPTNIVD-YS  66
            ++ N++++LIGD  VGK+++I S +SE ++E       E+TIPA+   E   T I+D + 
Sbjct  1    MKNNIKVILIGDEQVGKSTIINSFISESFSEITQKTLPEVTIPAEFNNEICSTRIIDTFD  60

Query  67   AAEQTEDQLTDEIQKAHVICVVYSVVDEDTLDRAVTYWLPLIRRCLTDHRCPVVLVGNKI  126
              +  ++Q+  EI+ A  I +VYSV   DT       W+PLI +    ++ P+++VGNK+
Sbjct  61   DGKNLKNQMNMEIRTADAIVIVYSVDRFDTFMSIRMKWIPLINQLRGSNKSPIIIVGNKL  120

Query  127  DLVD-------YSTIEAVYSIMKEFTEIESCIECSAKTLQNVSETFYYAQKAVLHPTTPL  179
            DLVD           E +      ++     +ECSAKT++N+ E  Y +Q +V  P   L
Sbjct  121  DLVDDKHENNKVQIEETIQYFRSTYSNTIQWLECSAKTMENLPELLYASQTSVFFPERIL  180

Query  180  YNYDTHELTEECKIALQRIFKICDLDNDGLLNDMELNTFQQWCFNIPLQPQVLEDVKAVL  239
            YN + +++TE C+ AL+RIFK+CD DNDG L++ E+N FQ  C +  +  + +++++  +
Sbjct  181  YNREENKMTEGCERALKRIFKLCDHDNDGSLSEEEINYFQTKCGHETMTSEEIQNIQQFV  240

Query  240  SKNIQDGICSGCVTLKGFMYLQCLFIQRGRNETTWAVLRKFGYDNELQMSKEYIYPLLKV  299
               I DG+ S   T KGF+Y+  LF+ RG  + TW  LR F YD++L + + Y++P L+V
Sbjct  241  LSKIPDGVNSNGFTEKGFLYMNLLFLLRGPCQHTWTSLRSFNYDDDLVLLESYVHPTLQV  300

Query  300  PVGCTTELSHKGQEFLTLLFLQHDRDRDGALSPSEMESLFSRCLMPPWGDEYKYTVPTNE  359
            P    T LS  G EF   LF ++D D DG LS  ++ SLFS     PW   ++    T++
Sbjct  301  PPNHNTILSSMGNEFFKSLFEKYDSDSDGVLSSFDLVSLFSTTPKIPWEIGFEKHFNTDK  360

Query  360  KGWITLQGYMCQWALLTLTNVRKALEYMAYLGYNMYNNECQTNAILVTREKKLDLAKKQS  419
               +TL G++  W L T  N +  LEY+AY G    NN     +IL +RE  LD+   Q 
Sbjct  361  DSNLTLSGFLSLWNLQTYENYKVTLEYLAYFGSQTENNNIDMISILNSRE--LDIKSNQF  418

Query  420  SRNVYSCHVIGPKSSGKTTLCRTFIDPKLE-VYVLKLTNEMVPPSSHVTVNTVHVYGQEK  478
            +RN+ +C+V G ++ GKTT   TFI      +Y     N+      H+  N        K
Sbjct  419  TRNIVNCYVFGAEAVGKTTFLNTFIGKSFSTLYNATNGNDNFKVCGHLLKN--------K  470

Query  479  TIILRDINILNVQDALTPAQI--QCDVAALVYDASNPKSFEYIARIYIHLFQKYFADSKI  536
             +IL +     V + +  A++  +CD+  L+YD ++ +SF++I  IY  L Q+      I
Sbjct  471  YLILSEY----VGEKIPTAELKSKCDLVCLLYDCNSEQSFKFIENIYNQLKQQQL---NI  523

Query  537  PVLIIANK  544
            P++ I  K
Sbjct  524  PIVFIRTK  531


 Score = 32.3 bits (72),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 27/130 (21%), Positives = 51/130 (39%), Gaps = 14/130 (11%)

Query  428  VIGPKSSGKTTLCRTFIDPKLEVYVLKLTNEMVPPSSH----VTVNTVHVYGQEKTIILR  483
            +IG +  GK+T+  +FI         K   E+  P+       +   +  +   K     
Sbjct  9    LIGDEQVGKSTIINSFISESFSEITQKTLPEVTIPAEFNNEICSTRIIDTFDDGK-----  63

Query  484  DINILNVQDALTPAQIQCDVAALVYDASNPKSFEYIARIYIHLFQKYFADSKIPVLIIAN  543
                 N+++ +       D   +VY      +F  I   +I L  +    +K P++I+ N
Sbjct  64   -----NLKNQMNMEIRTADAIVIVYSVDRFDTFMSIRMKWIPLINQLRGSNKSPIIIVGN  118

Query  544  KSDLSEVKQD  553
            K DL + K +
Sbjct  119  KLDLVDDKHE  128



Lambda      K        H
   0.322    0.136    0.412 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7723295310


Query= XP_050469397.1 mitochondrial Rho GTPase isoform X9 [Bombus huntii]

Length=627
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MIRO_DROME  unnamed protein product                                   801     0.0   
MIRO1_CAEEL  unnamed protein product                                  551     0.0   
GEMA_DICDI  unnamed protein product                                   326     1e-102


>MIRO_DROME unnamed protein product
Length=652

 Score = 801 bits (2069),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/647 (58%), Positives = 497/647 (77%), Gaps = 24/647 (4%)

Query  1    MVQRSVALRRNVRILLIGDRGVGKTSLILSLVSEEYAEDVPCKAEEITIPADVTPEQVPT  60
            M Q + + R+NVRILL+GD GVGKTSLILSLVSEEY E+VP +AEEITIPA+VTPEQVPT
Sbjct  1    MGQYTASQRKNVRILLVGDAGVGKTSLILSLVSEEYPEEVPPRAEEITIPANVTPEQVPT  60

Query  61   NIVDYSAAEQTEDQLTDEIQKAHVICVVYSVVDEDTLDRAVTYWLPLIR-RCLTDH----  115
            +IVD+SA EQ+ED L  EI KAHV+C+VY+V D+DTLDR  ++WLPL+R +C        
Sbjct  61   SIVDFSAVEQSEDALAAEINKAHVVCIVYAVDDDDTLDRITSHWLPLVRAKCNPSLDGEG  120

Query  116  ---------------RCPVVLVGNKIDLVDYSTIEAVYSIMKEFTEIESCIECSAKTLQN  160
                           R P+VLVGNKIDL++YST+++V +IM+++ EIESC+ECSAK+L N
Sbjct  121  DAEAEAEGDTQREPIRKPIVLVGNKIDLIEYSTMDSVLAIMEDYPEIESCVECSAKSLHN  180

Query  161  VSETFYYAQKAVLHPTTPLYNYDTHELTEECKIALQRIFKICDLDNDGLLNDMELNTFQQ  220
            +SE FYYAQKAVLHPT+PLY  +  ELT  CK +L RIFKICD+D D LLND ELN FQ+
Sbjct  181  ISEMFYYAQKAVLHPTSPLYMMEEQELTSACKKSLVRIFKICDIDGDNLLNDYELNLFQR  240

Query  221  WCFNIPLQPQVLEDVKAVLSKNIQDGICSGCVTLKGFMYLQCLFIQRGRNETTWAVLRKF  280
             CFN PLQPQ+L++VKAV+ KN+ DGI +  VTLKGF++L CLFIQRGRNETTWAVLR+F
Sbjct  241  RCFNTPLQPQILDEVKAVIQKNVPDGIYNDAVTLKGFLFLHCLFIQRGRNETTWAVLRRF  300

Query  281  GYDNELQMSKEYIYPLLKVPVGCTTELSHKGQEFLTLLFLQHDRDRDGALSPSEMESLFS  340
            GY+++L+M +EY+ P LK+P G +TELSH+GQ+FL  +F ++DRD DGALSP E + LFS
Sbjct  301  GYNDQLEMCQEYLRPPLKIPPGSSTELSHRGQQFLIAVFERYDRDGDGALSPEEHKMLFS  360

Query  341  RCLMPPW--GDEYKYTVPTNE-KGWITLQGYMCQWALLTLTNVRKALEYMAYLGYNMYNN  397
             C   PW    + + + P NE  GW+TL G++C+W L+TL +V K +EY+AYLG+N++ N
Sbjct  361  TCPAAPWSYSTDIRKSCPINETTGWVTLHGWLCRWTLMTLIDVVKTMEYLAYLGFNVHEN  420

Query  398  ECQTNAILVTREKKLDLAKKQSSRNVYSCHVIGPKSSGKTTLCRTFIDPKLEKLTNEMVP  457
            + Q  AI VTRE+++DLAK+QSSR+VY CHVIGPK SGKT +CR F+   + KL  +   
Sbjct  421  DSQLAAIHVTRERRIDLAKRQSSRSVYKCHVIGPKGSGKTGMCRGFLVEDMHKLIGKEFK  480

Query  458  PSSHVTVNTVHVYGQEKTIILRDINILNVQDALTPAQIQCDVAALVYDASNPKSFEYIAR  517
             +    +N+V VYGQEK +ILRDI++ +  D L P ++ CDVA LVYD+SNP+SFEY+AR
Sbjct  481  TNVVNCINSVQVYGQEKHLILRDIDVRHALDPLQPQEVNCDVACLVYDSSNPRSFEYVAR  540

Query  518  IYIKYFADSKIPVLIIANKSDLSEVKQDYLLQPISFCNKYKLMPPQPYSISRTVRREIFV  577
            IYIKY+A+SKIPV+I+  K D+ E +QDYL+QP  FC+KYKL+PP  +S+ +T ++E++ 
Sbjct  541  IYIKYYAESKIPVMIVGTKCDMDERRQDYLMQPSEFCDKYKLLPPHLFSL-KTNKKELYT  599

Query  578  KLATMAAFPHINQFGLLQGDSMVWWKAGLGIAVATVAGFVVMRVLNT  624
            KLATMAAFPH+ QFGL+  D  +W KAGLG+A AT+ GF+V++ ++ 
Sbjct  600  KLATMAAFPHLRQFGLMTEDPKLWLKAGLGVAAATMLGFIVLKTISA  646


>MIRO1_CAEEL unnamed protein product
Length=625

 Score = 551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/620 (45%), Positives = 405/620 (65%), Gaps = 11/620 (2%)

Query  11   NVRILLIGDRGVGKTSLILSLVSEEYAEDVPCKAEEITIPADVTPEQVPTNIVDYSAAEQ  70
            +VRI+LIGD G GKTSL++SL+ +E+ + VP + + + IPADVTPE V T+IVD S  E+
Sbjct  9    DVRIVLIGDEGCGKTSLVMSLLEDEWVDAVPRRLDRVLIPADVTPENVTTSIVDLSIKEE  68

Query  71   TEDQLTDEIQKAHVICVVYSVVDEDTLDRAVTYWLPLIRRCLTD-HRCPVVLVGNKIDLV  129
             E+ +  EI++A+VICVVYSV DE T+D   T WLPLIR+   + H  PV+LVGNK D  
Sbjct  69   DENWIVSEIRQANVICVVYSVTDESTVDGIQTKWLPLIRQSFGEYHETPVILVGNKSDGT  128

Query  130  DYSTIEAVYSIMKEFTEIESCIECSAKTLQNVSETFYYAQKAVLHPTTPLYNYDTHELTE  189
              +T + +  IM+  TE+E+C+ECSA+T++NVSE FYYAQKAV++PT PLY+ DT +LT+
Sbjct  129  ANNT-DKILPIMEANTEVETCVECSARTMKNVSEIFYYAQKAVIYPTRPLYDADTKQLTD  187

Query  190  ECKIALQRIFKICDLDNDGLLNDMELNTFQQWCFNIPLQPQVLEDVKAVLSKNIQDGICS  249
              + AL R+FKICD DNDG L+D ELN FQ+ CF IPL    LEDVK  +S    DG+ +
Sbjct  188  RARKALIRVFKICDRDNDGYLSDTELNDFQKLCFGIPLTSTALEDVKRAVSDGCPDGVAN  247

Query  250  GCVTLKGFMYLQCLFIQRGRNETTWAVLRKFGYDNELQMSKEYIYPLLKVPVGCTTELSH  309
              + L GF+YL  LFI+RGR+ETTWAVLRKFGY+  L++S++Y+YP + +PVGC+TELS 
Sbjct  248  DSLMLAGFLYLHLLFIERGRHETTWAVLRKFGYETSLKLSEDYLYPRITIPVGCSTELSP  307

Query  310  KGQEFLTLLFLQHDRDRDGALSPSEMESLFSRCLMPPWGDEYKYTVPTNEKGWITLQGYM  369
            +G +F++ LF ++D D+DG LSPSE+++LFS C +P    +    + TN++GW+T  GYM
Sbjct  308  EGVQFVSALFEKYDEDKDGCLSPSELQNLFSVCPVPVITKDNILALETNQRGWLTYNGYM  367

Query  370  CQWALLTLTNVRKALEYMAYLGYNMYNN-----ECQTNAILVTREKKLDLAKKQSSRNVY  424
              W + TL N+ +  E +AYLG+ +  +         ++I VTRE+K DL    + R V+
Sbjct  368  AYWNMTTLINLTQTFEQLAYLGFPVGRSGPGRAGNTLDSIRVTRERKKDLENHGTDRKVF  427

Query  425  SCHVIGPKSSGKTTLCRTFIDPKLEKLTNEMVPPSSHVTVNTVHVYGQEKTIILRDINIL  484
             C V+G K +GKT   ++     +  +  ++    S   +N V V  + K ++LR++++L
Sbjct  428  QCLVVGAKDAGKTVFMQSLAGRGMADVA-QIGRRHSPFVINRVRVKEESKYLLLREVDVL  486

Query  485  NVQDALTPAQIQCDVAALVYDASNPKSFEYIARIYIKYFADSKIPVLIIANKSDLSEVKQ  544
            + QDAL   +   DV A +YD SNP SF + A +Y KYF  +K P ++IA K +  EV Q
Sbjct  487  SPQDALGSGETSADVVAFLYDISNPDSFAFCATVYQKYFYRTKTPCVMIATKVEREEVDQ  546

Query  545  DYLLQPISFCNKYKLMPPQPYSISRTVRRE--IFVKLATMAAFPHINQFGLLQGDSMVWW  602
             + + P  FC +++L  P  +S     +    IF +LA MA +PH+ +   L  DS +  
Sbjct  547  RWEVPPEEFCRQFELPKPIKFSTGNIGQSSSPIFEQLAMMAVYPHLRRVFYLN-DSNLLS  605

Query  603  KAGLGIAVATVAGFVVMRVL  622
            K   G A+  +AGF+V++ L
Sbjct  606  KITFGAAIVALAGFLVLKNL  625


>GEMA_DICDI unnamed protein product
Length=658

 Score = 326 bits (835),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 185/540 (34%), Positives = 297/540 (55%), Gaps = 20/540 (4%)

Query  8    LRRNVRILLIGDRGVGKTSLILSLVSEEYAEDVPCKAEEITIPADVTPEQVPTNIVD-YS  66
            ++ N++++LIGD  VGK+++I S +SE ++E       E+TIPA+   E   T I+D + 
Sbjct  1    MKNNIKVILIGDEQVGKSTIINSFISESFSEITQKTLPEVTIPAEFNNEICSTRIIDTFD  60

Query  67   AAEQTEDQLTDEIQKAHVICVVYSVVDEDTLDRAVTYWLPLIRRCLTDHRCPVVLVGNKI  126
              +  ++Q+  EI+ A  I +VYSV   DT       W+PLI +    ++ P+++VGNK+
Sbjct  61   DGKNLKNQMNMEIRTADAIVIVYSVDRFDTFMSIRMKWIPLINQLRGSNKSPIIIVGNKL  120

Query  127  DLVD-------YSTIEAVYSIMKEFTEIESCIECSAKTLQNVSETFYYAQKAVLHPTTPL  179
            DLVD           E +      ++     +ECSAKT++N+ E  Y +Q +V  P   L
Sbjct  121  DLVDDKHENNKVQIEETIQYFRSTYSNTIQWLECSAKTMENLPELLYASQTSVFFPERIL  180

Query  180  YNYDTHELTEECKIALQRIFKICDLDNDGLLNDMELNTFQQWCFNIPLQPQVLEDVKAVL  239
            YN + +++TE C+ AL+RIFK+CD DNDG L++ E+N FQ  C +  +  + +++++  +
Sbjct  181  YNREENKMTEGCERALKRIFKLCDHDNDGSLSEEEINYFQTKCGHETMTSEEIQNIQQFV  240

Query  240  SKNIQDGICSGCVTLKGFMYLQCLFIQRGRNETTWAVLRKFGYDNELQMSKEYIYPLLKV  299
               I DG+ S   T KGF+Y+  LF+ RG  + TW  LR F YD++L + + Y++P L+V
Sbjct  241  LSKIPDGVNSNGFTEKGFLYMNLLFLLRGPCQHTWTSLRSFNYDDDLVLLESYVHPTLQV  300

Query  300  PVGCTTELSHKGQEFLTLLFLQHDRDRDGALSPSEMESLFSRCLMPPWGDEYKYTVPTNE  359
            P    T LS  G EF   LF ++D D DG LS  ++ SLFS     PW   ++    T++
Sbjct  301  PPNHNTILSSMGNEFFKSLFEKYDSDSDGVLSSFDLVSLFSTTPKIPWEIGFEKHFNTDK  360

Query  360  KGWITLQGYMCQWALLTLTNVRKALEYMAYLGYNMYNNECQTNAILVTREKKLDLAKKQS  419
               +TL G++  W L T  N +  LEY+AY G    NN     +IL +RE  LD+   Q 
Sbjct  361  DSNLTLSGFLSLWNLQTYENYKVTLEYLAYFGSQTENNNIDMISILNSRE--LDIKSNQF  418

Query  420  SRNVYSCHVIGPKSSGKTTLCRTFIDPKLEKLTNEMVPPSSHVTVNTVHVYGQEKTIILR  479
            +RN+ +C+V G ++ GKTT   TFI      L N     + +          + K +IL 
Sbjct  419  TRNIVNCYVFGAEAVGKTTFLNTFIGKSFSTLYN---ATNGNDNFKVCGHLLKNKYLILS  475

Query  480  DINILNVQDALTPAQI--QCDVAALVYDASNPKSFEYIARIYIKYFADS-KIPVLIIANK  536
            +     V + +  A++  +CD+  L+YD ++ +SF++I  IY +       IP++ I  K
Sbjct  476  EY----VGEKIPTAELKSKCDLVCLLYDCNSEQSFKFIENIYNQLKQQQLNIPIVFIRTK  531


 Score = 29.6 bits (65),  Expect = 9.3, Method: Compositional matrix adjust.
 Identities = 27/126 (21%), Positives = 53/126 (42%), Gaps = 14/126 (11%)

Query  428  VIGPKSSGKTTLCRTFIDPKLEKLTNEMVPPSSHVTVNTVHVYGQEKTIILRDINIL---  484
            +IG +  GK+T+  +FI     ++T + +P        T+      +    R I+     
Sbjct  9    LIGDEQVGKSTIINSFISESFSEITQKTLPEV------TIPAEFNNEICSTRIIDTFDDG  62

Query  485  -NVQDALTPAQIQCDVAALVYDASNPKSFEYIARIYI----KYFADSKIPVLIIANKSDL  539
             N+++ +       D   +VY      +F  I   +I    +    +K P++I+ NK DL
Sbjct  63   KNLKNQMNMEIRTADAIVIVYSVDRFDTFMSIRMKWIPLINQLRGSNKSPIIIVGNKLDL  122

Query  540  SEVKQD  545
             + K +
Sbjct  123  VDDKHE  128



Lambda      K        H
   0.322    0.136    0.412 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7723295310


Query= XP_050469398.1 mitochondrial Rho GTPase isoform X10 [Bombus huntii]

Length=609
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MIRO_DROME  unnamed protein product                                   745     0.0   
MIRO1_CAEEL  unnamed protein product                                  529     0.0   
GEMA_DICDI  unnamed protein product                                   330     2e-104


>MIRO_DROME unnamed protein product
Length=652

 Score = 745 bits (1923),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/620 (58%), Positives = 470/620 (76%), Gaps = 32/620 (5%)

Query  1    MVQRSVALRRNVRILLIGDRGVGKTSLILSLVSEEYAEDVPCKAEEITIPADVTPEQVPT  60
            M Q + + R+NVRILL+GD GVGKTSLILSLVSEEY E+VP +AEEITIPA+VTPEQVPT
Sbjct  1    MGQYTASQRKNVRILLVGDAGVGKTSLILSLVSEEYPEEVPPRAEEITIPANVTPEQVPT  60

Query  61   NIVDYSAAEQTEDQLTDEIQKAHVICVVYSVVDEDTLDRAVTYWLPLIR-RCLTDH----  115
            +IVD+SA EQ+ED L  EI KAHV+C+VY+V D+DTLDR  ++WLPL+R +C        
Sbjct  61   SIVDFSAVEQSEDALAAEINKAHVVCIVYAVDDDDTLDRITSHWLPLVRAKCNPSLDGEG  120

Query  116  ---------------RCPVVLVGNKIDLVDYSTIEAVYSIMKEFTEIESCIECSAKTLQN  160
                           R P+VLVGNKIDL++YST+++V +IM+++ EIESC+ECSAK+L N
Sbjct  121  DAEAEAEGDTQREPIRKPIVLVGNKIDLIEYSTMDSVLAIMEDYPEIESCVECSAKSLHN  180

Query  161  VSETFYYAQKAVLHPTTPLYNYDTHELTEECKIALQRIFKICDLDNDGLLNDMELNTFQQ  220
            +SE FYYAQKAVLHPT+PLY  +  ELT  CK +L RIFKICD+D D LLND ELN FQ+
Sbjct  181  ISEMFYYAQKAVLHPTSPLYMMEEQELTSACKKSLVRIFKICDIDGDNLLNDYELNLFQR  240

Query  221  WCFNIPLQPQVLEDVKAVLSKNIQDGICSGCVTLKGFMYLQCLFIQRGRNETTWAVLRKF  280
             CFN PLQPQ+L++VKAV+ KN+ DGI +  VTLKGF++L CLFIQRGRNETTWAVLR+F
Sbjct  241  RCFNTPLQPQILDEVKAVIQKNVPDGIYNDAVTLKGFLFLHCLFIQRGRNETTWAVLRRF  300

Query  281  GYDNELQMSKEYIYPLLKVPVGCTTELSHKGQEFLTLLFLQHDRDRDGALSPSEMESLFS  340
            GY+++L+M +EY+ P LK+P G +TELSH+GQ+FL  +F ++DRD DGALSP E + LFS
Sbjct  301  GYNDQLEMCQEYLRPPLKIPPGSSTELSHRGQQFLIAVFERYDRDGDGALSPEEHKMLFS  360

Query  341  RCLMPPW--GDEYKYTVPTNE-KGWITLQGYMCQWALLTLTNVRKALEYMAYLGYNMYNN  397
             C   PW    + + + P NE  GW+TL G++C+W L+TL +V K +EY+AYLG+N++ N
Sbjct  361  TCPAAPWSYSTDIRKSCPINETTGWVTLHGWLCRWTLMTLIDVVKTMEYLAYLGFNVHEN  420

Query  398  ECQTNAILVTREKKLDLAKKQSSRNVYSCHVIGPKSSGKTTLCRTFIDPKLEVYVLKLTN  457
            + Q  AI VTRE+++DLAK+QSSR+VY CHVIGPK SGKT +CR F+   +     KL  
Sbjct  421  DSQLAAIHVTRERRIDLAKRQSSRSVYKCHVIGPKGSGKTGMCRGFLVEDMH----KLIG  476

Query  458  EMVPPSSHVTVNTVHVYGQEKTIILRDINILNVQDALTPAQIQCDVAALVYDASNPKSFE  517
            +    +    +N+V VYGQEK +ILRDI++ +  D L P ++ CDVA LVYD+SNP+SFE
Sbjct  477  KEFKTNVVNCINSVQVYGQEKHLILRDIDVRHALDPLQPQEVNCDVACLVYDSSNPRSFE  536

Query  518  YIARIYIHLFQKYFADSKIPVLIIANKSDLSEVKQDYLLQPISFCNKYKLMPPQPYSISR  577
            Y+ARIYI    KY+A+SKIPV+I+  K D+ E +QDYL+QP  FC+KYKL+PP  +S+ +
Sbjct  537  YVARIYI----KYYAESKIPVMIVGTKCDMDERRQDYLMQPSEFCDKYKLLPPHLFSL-K  591

Query  578  TVRREIFVKLATMAAFPRFQ  597
            T ++E++ KLATMAAFP  +
Sbjct  592  TNKKELYTKLATMAAFPHLR  611


>MIRO1_CAEEL unnamed protein product
Length=625

 Score = 529 bits (1363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/600 (45%), Positives = 389/600 (65%), Gaps = 18/600 (3%)

Query  11   NVRILLIGDRGVGKTSLILSLVSEEYAEDVPCKAEEITIPADVTPEQVPTNIVDYSAAEQ  70
            +VRI+LIGD G GKTSL++SL+ +E+ + VP + + + IPADVTPE V T+IVD S  E+
Sbjct  9    DVRIVLIGDEGCGKTSLVMSLLEDEWVDAVPRRLDRVLIPADVTPENVTTSIVDLSIKEE  68

Query  71   TEDQLTDEIQKAHVICVVYSVVDEDTLDRAVTYWLPLIRRCLTD-HRCPVVLVGNKIDLV  129
             E+ +  EI++A+VICVVYSV DE T+D   T WLPLIR+   + H  PV+LVGNK D  
Sbjct  69   DENWIVSEIRQANVICVVYSVTDESTVDGIQTKWLPLIRQSFGEYHETPVILVGNKSDGT  128

Query  130  DYSTIEAVYSIMKEFTEIESCIECSAKTLQNVSETFYYAQKAVLHPTTPLYNYDTHELTE  189
              +T + +  IM+  TE+E+C+ECSA+T++NVSE FYYAQKAV++PT PLY+ DT +LT+
Sbjct  129  ANNT-DKILPIMEANTEVETCVECSARTMKNVSEIFYYAQKAVIYPTRPLYDADTKQLTD  187

Query  190  ECKIALQRIFKICDLDNDGLLNDMELNTFQQWCFNIPLQPQVLEDVKAVLSKNIQDGICS  249
              + AL R+FKICD DNDG L+D ELN FQ+ CF IPL    LEDVK  +S    DG+ +
Sbjct  188  RARKALIRVFKICDRDNDGYLSDTELNDFQKLCFGIPLTSTALEDVKRAVSDGCPDGVAN  247

Query  250  GCVTLKGFMYLQCLFIQRGRNETTWAVLRKFGYDNELQMSKEYIYPLLKVPVGCTTELSH  309
              + L GF+YL  LFI+RGR+ETTWAVLRKFGY+  L++S++Y+YP + +PVGC+TELS 
Sbjct  248  DSLMLAGFLYLHLLFIERGRHETTWAVLRKFGYETSLKLSEDYLYPRITIPVGCSTELSP  307

Query  310  KGQEFLTLLFLQHDRDRDGALSPSEMESLFSRCLMPPWGDEYKYTVPTNEKGWITLQGYM  369
            +G +F++ LF ++D D+DG LSPSE+++LFS C +P    +    + TN++GW+T  GYM
Sbjct  308  EGVQFVSALFEKYDEDKDGCLSPSELQNLFSVCPVPVITKDNILALETNQRGWLTYNGYM  367

Query  370  CQWALLTLTNVRKALEYMAYLGYNMYNN-----ECQTNAILVTREKKLDLAKKQSSRNVY  424
              W + TL N+ +  E +AYLG+ +  +         ++I VTRE+K DL    + R V+
Sbjct  368  AYWNMTTLINLTQTFEQLAYLGFPVGRSGPGRAGNTLDSIRVTRERKKDLENHGTDRKVF  427

Query  425  SCHVIGPKSSGKTTLCRTFIDPKLEVYVLKLTNEMVPPSSHVTVNTVHVYGQEKTIILRD  484
             C V+G K +GKT   ++     +   V ++     P      +N V V  + K ++LR+
Sbjct  428  QCLVVGAKDAGKTVFMQSLAGRGM-ADVAQIGRRHSP----FVINRVRVKEESKYLLLRE  482

Query  485  INILNVQDALTPAQIQCDVAALVYDASNPKSFEYIARIYIHLFQKYFADSKIPVLIIANK  544
            +++L+ QDAL   +   DV A +YD SNP SF + A +Y    QKYF  +K P ++IA K
Sbjct  483  VDVLSPQDALGSGETSADVVAFLYDISNPDSFAFCATVY----QKYFYRTKTPCVMIATK  538

Query  545  SDLSEVKQDYLLQPISFCNKYKLMPPQPYSISRTVRRE--IFVKLATMAAFPRFQGAWVL  602
             +  EV Q + + P  FC +++L  P  +S     +    IF +LA MA +P  +  + L
Sbjct  539  VEREEVDQRWEVPPEEFCRQFELPKPIKFSTGNIGQSSSPIFEQLAMMAVYPHLRRVFYL  598


>GEMA_DICDI unnamed protein product
Length=658

 Score = 330 bits (845),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 189/548 (34%), Positives = 301/548 (55%), Gaps = 28/548 (5%)

Query  8    LRRNVRILLIGDRGVGKTSLILSLVSEEYAEDVPCKAEEITIPADVTPEQVPTNIVD-YS  66
            ++ N++++LIGD  VGK+++I S +SE ++E       E+TIPA+   E   T I+D + 
Sbjct  1    MKNNIKVILIGDEQVGKSTIINSFISESFSEITQKTLPEVTIPAEFNNEICSTRIIDTFD  60

Query  67   AAEQTEDQLTDEIQKAHVICVVYSVVDEDTLDRAVTYWLPLIRRCLTDHRCPVVLVGNKI  126
              +  ++Q+  EI+ A  I +VYSV   DT       W+PLI +    ++ P+++VGNK+
Sbjct  61   DGKNLKNQMNMEIRTADAIVIVYSVDRFDTFMSIRMKWIPLINQLRGSNKSPIIIVGNKL  120

Query  127  DLVD-------YSTIEAVYSIMKEFTEIESCIECSAKTLQNVSETFYYAQKAVLHPTTPL  179
            DLVD           E +      ++     +ECSAKT++N+ E  Y +Q +V  P   L
Sbjct  121  DLVDDKHENNKVQIEETIQYFRSTYSNTIQWLECSAKTMENLPELLYASQTSVFFPERIL  180

Query  180  YNYDTHELTEECKIALQRIFKICDLDNDGLLNDMELNTFQQWCFNIPLQPQVLEDVKAVL  239
            YN + +++TE C+ AL+RIFK+CD DNDG L++ E+N FQ  C +  +  + +++++  +
Sbjct  181  YNREENKMTEGCERALKRIFKLCDHDNDGSLSEEEINYFQTKCGHETMTSEEIQNIQQFV  240

Query  240  SKNIQDGICSGCVTLKGFMYLQCLFIQRGRNETTWAVLRKFGYDNELQMSKEYIYPLLKV  299
               I DG+ S   T KGF+Y+  LF+ RG  + TW  LR F YD++L + + Y++P L+V
Sbjct  241  LSKIPDGVNSNGFTEKGFLYMNLLFLLRGPCQHTWTSLRSFNYDDDLVLLESYVHPTLQV  300

Query  300  PVGCTTELSHKGQEFLTLLFLQHDRDRDGALSPSEMESLFSRCLMPPWGDEYKYTVPTNE  359
            P    T LS  G EF   LF ++D D DG LS  ++ SLFS     PW   ++    T++
Sbjct  301  PPNHNTILSSMGNEFFKSLFEKYDSDSDGVLSSFDLVSLFSTTPKIPWEIGFEKHFNTDK  360

Query  360  KGWITLQGYMCQWALLTLTNVRKALEYMAYLGYNMYNNECQTNAILVTREKKLDLAKKQS  419
               +TL G++  W L T  N +  LEY+AY G    NN     +IL +RE  LD+   Q 
Sbjct  361  DSNLTLSGFLSLWNLQTYENYKVTLEYLAYFGSQTENNNIDMISILNSRE--LDIKSNQF  418

Query  420  SRNVYSCHVIGPKSSGKTTLCRTFIDPKLE-VYVLKLTNEMVPPSSHVTVNTVHVYGQEK  478
            +RN+ +C+V G ++ GKTT   TFI      +Y     N+      H+  N        K
Sbjct  419  TRNIVNCYVFGAEAVGKTTFLNTFIGKSFSTLYNATNGNDNFKVCGHLLKN--------K  470

Query  479  TIILRDINILNVQDALTPAQI--QCDVAALVYDASNPKSFEYIARIYIHLFQKYFADSKI  536
             +IL +     V + +  A++  +CD+  L+YD ++ +SF++I  IY  L Q+      I
Sbjct  471  YLILSEY----VGEKIPTAELKSKCDLVCLLYDCNSEQSFKFIENIYNQLKQQQL---NI  523

Query  537  PVLIIANK  544
            P++ I  K
Sbjct  524  PIVFIRTK  531


 Score = 32.3 bits (72),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 27/130 (21%), Positives = 51/130 (39%), Gaps = 14/130 (11%)

Query  428  VIGPKSSGKTTLCRTFIDPKLEVYVLKLTNEMVPPSSH----VTVNTVHVYGQEKTIILR  483
            +IG +  GK+T+  +FI         K   E+  P+       +   +  +   K     
Sbjct  9    LIGDEQVGKSTIINSFISESFSEITQKTLPEVTIPAEFNNEICSTRIIDTFDDGK-----  63

Query  484  DINILNVQDALTPAQIQCDVAALVYDASNPKSFEYIARIYIHLFQKYFADSKIPVLIIAN  543
                 N+++ +       D   +VY      +F  I   +I L  +    +K P++I+ N
Sbjct  64   -----NLKNQMNMEIRTADAIVIVYSVDRFDTFMSIRMKWIPLINQLRGSNKSPIIIVGN  118

Query  544  KSDLSEVKQD  553
            K DL + K +
Sbjct  119  KLDLVDDKHE  128



Lambda      K        H
   0.322    0.136    0.412 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7723295310


Query= XP_050469399.1 zinc finger and SCAN domain-containing protein
21-like [Bombus huntii]

Length=580
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VZK2_DROME  unnamed protein product                                 333     4e-106
Q24140_DROME  unnamed protein product                                 321     2e-101
Q7KMM2_DROME  unnamed protein product                                 251     6e-76 


>Q9VZK2_DROME unnamed protein product
Length=653

 Score = 333 bits (854),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 157/196 (80%), Positives = 169/196 (86%), Gaps = 5/196 (3%)

Query  360  RDGTSSGS-----KTVAYTYEAFFVSDGRSKRRSVNTNGAAVPDKEAAQPDRPKFTCTEC  414
            +DG  SG+     KTVAYTYEAFFVSDGRSKR+ V    AA          + K+TC+EC
Sbjct  413  QDGEHSGASGASAKTVAYTYEAFFVSDGRSKRKHVADPAAAASGVPTPDQQKTKYTCSEC  472

Query  415  GKQYATSSNLSRHKQTHRSLDSQSAKKCIHCGKAYVSMPALAMHVLTHKLAHSCGVCGKM  474
            GKQYATSSNLSRHKQTHRSLDSQSAKKC  CGKAYVSMPALAMH+LTHKL+HSCGVCGK+
Sbjct  473  GKQYATSSNLSRHKQTHRSLDSQSAKKCHTCGKAYVSMPALAMHLLTHKLSHSCGVCGKL  532

Query  475  FSRPWLLQGHLRSHTGEKPYGCAHCGKAFADRSNLRAHMQTHSADKNYECSRCHKTFALK  534
            FSRPWLLQGHLRSHTGEKPYGCAHCGKAFADRSNLRAHMQTHS DKN+EC RCHKTFALK
Sbjct  533  FSRPWLLQGHLRSHTGEKPYGCAHCGKAFADRSNLRAHMQTHSVDKNFECKRCHKTFALK  592

Query  535  SYLNKHLESACLRDDE  550
            SYLNKHLESACL+D+E
Sbjct  593  SYLNKHLESACLKDEE  608


 Score = 110 bits (274),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 104/320 (33%), Positives = 126/320 (39%), Gaps = 84/320 (26%)

Query  1    MPRCLMAKKWKAYPWPDRVDDPQEEQNDPSNILQEQGNHGIQQTSASLEKRQHRHEPEDE  60
            MPRCL+AKKWKAYPW DR +D     N      Q   N   +     L+ R+   + +DE
Sbjct  1    MPRCLIAKKWKAYPWLDRTEDTS---NQQQQQEQSAPNSPRELEELHLKSRRSTLD-DDE  56

Query  61   EIDVVGDTDSRQVDHQQT-----------------------------------CWGPHSP  85
            EIDVVGD    +++ Q+T                                   CWGP SP
Sbjct  57   EIDVVGDKFLIKLEKQRTTADAAAAAATSSEAATSHSSNSSNMEASATTTTSKCWGPSSP  116

Query  86   TAGATAPSPPPLNASGALYYHGYTHESWINHEEPPKYATLRSAAELARPVVPSPPPP---  142
            TAG TAPSPPP +   A    G  +  +     P  Y       E    V+ +       
Sbjct  117  TAGTTAPSPPPHSPEAATRVAGNVYNGYTRELSPLHYTAYLPRMESEITVIRAAATALVA  176

Query  143  -------AAPQELAAVMTGSSLHQPHPAAPMTTPSSSSTSLCLPPRKSLSMCFTSTGTAL  195
                   +  Q LAA  T  S     P+   +      + L      S   CF+STG  L
Sbjct  177  ARTSGNGSGDQHLAAYQTPPSSTTSSPSCSPSGAGDRYSPLSSGQTSSERKCFSSTGATL  236

Query  196  SLPPKKKDIYRPYSL--QPMSDIRTSEIRTPEIRTSEVRTSEIRTSEIRTSEIRTSEIRT  253
            SLPPKKKDIYRPYSL  +P    R                                  R 
Sbjct  237  SLPPKKKDIYRPYSLDDKPAHGYRR---------------------------------RV  263

Query  254  SAEEDLSAAQAILDLSASPA  273
             AEEDL AA AILDLSAS A
Sbjct  264  PAEEDLHAAHAILDLSASTA  283


>Q24140_DROME unnamed protein product
Length=664

 Score = 321 bits (823),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 153/191 (80%), Positives = 165/191 (86%), Gaps = 3/191 (2%)

Query  361  DGTSSGS-KTVAYTYEAFFVSDGRSKRRSVNTNGAAVPDKEAAQPDRPKFTCTECGKQYA  419
            +G S  S KTVAYTYEAFFVSDGRSKR+ V    AA          + K+TC+ECGKQYA
Sbjct  418  NGASGASAKTVAYTYEAFFVSDGRSKRKHVADPAAAASGVPTPDQQKTKYTCSECGKQYA  477

Query  420  TSSNLSRHKQTHRSLDSQSAKKCIHCGKAYVSMPALAMHVLTHKLAHSCGVCGKMFSRPW  479
            TSSNLSRHKQTH  +DSQSAKKC  CGKAYVSMPALAMH+LTHKL+HSCGVCGK+FSRPW
Sbjct  478  TSSNLSRHKQTH--VDSQSAKKCHTCGKAYVSMPALAMHLLTHKLSHSCGVCGKLFSRPW  535

Query  480  LLQGHLRSHTGEKPYGCAHCGKAFADRSNLRAHMQTHSADKNYECSRCHKTFALKSYLNK  539
            LLQGHLRSHTGEKPYGCAHCGKAFADRSNLRAHMQTHS DKN+EC RCHKTFALKSYLNK
Sbjct  536  LLQGHLRSHTGEKPYGCAHCGKAFADRSNLRAHMQTHSVDKNFECKRCHKTFALKSYLNK  595

Query  540  HLESACLRDDE  550
            HLESACL+D+E
Sbjct  596  HLESACLKDEE  606


 Score = 107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 103/320 (32%), Positives = 125/320 (39%), Gaps = 84/320 (26%)

Query  1    MPRCLMAKKWKAYPWPDRVDDPQEEQNDPSNILQEQGNHGIQQTSASLEKRQHRHEPEDE  60
            MPRCL+AKKWKAYPW DR +D     N      Q   N   +     L+ R+   + +DE
Sbjct  1    MPRCLIAKKWKAYPWLDRTEDTC---NQQQQQEQSAPNSPRELEELHLKSRRSTLD-DDE  56

Query  61   EIDVVGDTDSRQVDHQQT-----------------------------------CWGPHSP  85
            EIDVVGD    +++ Q+T                                   CWGP SP
Sbjct  57   EIDVVGDKFLIKLEKQRTTADAAAAAATSSEAATSHSSNSSNMEASATTTTSKCWGPSSP  116

Query  86   TAGATAPSPPPLNASGALYYHGYTHESWINHEEPPKYATLRSAAELARPVVPSPPPP---  142
            TAG TAPSPPP +   A    G  +  +     P  Y       E    V+ +       
Sbjct  117  TAGTTAPSPPPHSPEAATRVAGNVYNGYTRELSPLHYTAYLPRMESEITVIRAAATALVA  176

Query  143  -------AAPQELAAVMTGSSLHQPHPAAPMTTPSSSSTSLCLPPRKSLSMCFTSTGTAL  195
                   +  Q LA   T  S     P+   +      + L      S   CF+STG  L
Sbjct  177  ARTSGNGSGDQHLAVYQTPPSSTTSSPSCSPSGAGDRYSPLSSGQTSSERKCFSSTGATL  236

Query  196  SLPPKKKDIYRPYSL--QPMSDIRTSEIRTPEIRTSEVRTSEIRTSEIRTSEIRTSEIRT  253
            SLPPKKKDIYRPYSL  +P    R                                  R 
Sbjct  237  SLPPKKKDIYRPYSLDDKPAHGYRR---------------------------------RV  263

Query  254  SAEEDLSAAQAILDLSASPA  273
             AEEDL AA AILDLSAS A
Sbjct  264  PAEEDLHAAHAILDLSASTA  283


>Q7KMM2_DROME unnamed protein product
Length=567

 Score = 251 bits (642),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 130/155 (84%), Gaps = 5/155 (3%)

Query  360  RDGTSSGS-----KTVAYTYEAFFVSDGRSKRRSVNTNGAAVPDKEAAQPDRPKFTCTEC  414
            +DG  SG+     KTVAYTYEAFFVSDGRSKR+ V    AA          + K+TC+EC
Sbjct  413  QDGEHSGASGASAKTVAYTYEAFFVSDGRSKRKHVADPAAAASGVPTPDQQKTKYTCSEC  472

Query  415  GKQYATSSNLSRHKQTHRSLDSQSAKKCIHCGKAYVSMPALAMHVLTHKLAHSCGVCGKM  474
            GKQYATSSNLSRHKQTHRSLDSQSAKKC  CGKAYVSMPALAMH+LTHKL+HSCGVCGK+
Sbjct  473  GKQYATSSNLSRHKQTHRSLDSQSAKKCHTCGKAYVSMPALAMHLLTHKLSHSCGVCGKL  532

Query  475  FSRPWLLQGHLRSHTGEKPYGCAHCGKAFADRSNL  509
            FSRPWLLQGHLRSHTGEKPYGCAHCGKAFADRSNL
Sbjct  533  FSRPWLLQGHLRSHTGEKPYGCAHCGKAFADRSNL  567


 Score = 110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 104/320 (33%), Positives = 126/320 (39%), Gaps = 84/320 (26%)

Query  1    MPRCLMAKKWKAYPWPDRVDDPQEEQNDPSNILQEQGNHGIQQTSASLEKRQHRHEPEDE  60
            MPRCL+AKKWKAYPW DR +D     N      Q   N   +     L+ R+   + +DE
Sbjct  1    MPRCLIAKKWKAYPWLDRTED---TSNQQQQQEQSAPNSPRELEELHLKSRRSTLD-DDE  56

Query  61   EIDVVGDTDSRQVDHQQT-----------------------------------CWGPHSP  85
            EIDVVGD    +++ Q+T                                   CWGP SP
Sbjct  57   EIDVVGDKFLIKLEKQRTTADAAAAAATSSEAATSHSSNSSNMEASATTTTSKCWGPSSP  116

Query  86   TAGATAPSPPPLNASGALYYHGYTHESWINHEEPPKYATLRSAAELARPVVPSPPPP---  142
            TAG TAPSPPP +   A    G  +  +     P  Y       E    V+ +       
Sbjct  117  TAGTTAPSPPPHSPEAATRVAGNVYNGYTRELSPLHYTAYLPRMESEITVIRAAATALVA  176

Query  143  -------AAPQELAAVMTGSSLHQPHPAAPMTTPSSSSTSLCLPPRKSLSMCFTSTGTAL  195
                   +  Q LAA  T  S     P+   +      + L      S   CF+STG  L
Sbjct  177  ARTSGNGSGDQHLAAYQTPPSSTTSSPSCSPSGAGDRYSPLSSGQTSSERKCFSSTGATL  236

Query  196  SLPPKKKDIYRPYSL--QPMSDIRTSEIRTPEIRTSEVRTSEIRTSEIRTSEIRTSEIRT  253
            SLPPKKKDIYRPYSL  +P    R                                  R 
Sbjct  237  SLPPKKKDIYRPYSLDDKPAHGYRR---------------------------------RV  263

Query  254  SAEEDLSAAQAILDLSASPA  273
             AEEDL AA AILDLSAS A
Sbjct  264  PAEEDLHAAHAILDLSASTA  283



Lambda      K        H
   0.322    0.136    0.412 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7723295310


Query= XP_050469400.1 translation factor GUF1 homolog, mitochondrial
[Bombus huntii]

Length=648
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GUF1_TRYB2  unnamed protein product                                   362     5e-115
EFGM_DROME  unnamed protein product                                   108     3e-24 
Q38BA0_TRYB2  unnamed protein product                                 105     2e-23 


>GUF1_TRYB2 unnamed protein product
Length=768

 Score = 362 bits (928),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 224/661 (34%), Positives = 358/661 (54%), Gaps = 85/661 (13%)

Query  48   PIENIRNFSIVAHVDHGKSTLADRLLEITGAVK--INSGEQILDKLQVEKERGITVKAQT  105
            P  NIRN ++VAHVDHGK+TL+D LL  TG +K  +N+G    D+L VE+ERGITVK+QT
Sbjct  108  PPSNIRNVAVVAHVDHGKTTLSDVLLRRTGVLKGSVNAGAYT-DRLLVERERGITVKSQT  166

Query  106  ASLNYTYKGIKYLLNLIDTPGHVDFSAEVHRSLAPCQGVVLVVDANDGVQAQTVANFHLA  165
             S+   Y G ++LLNLIDTPGHVDF  EV RS+   Q V+L+VD   G++AQT+++FH+A
Sbjct  167  CSMFLKYGGSEFLLNLIDTPGHVDFQYEVSRSVRAAQAVLLLVDVAQGIEAQTMSHFHMA  226

Query  166  MKNNLVIIPVINKID--LKFAKPERVINQLETLFDITESDVLKISAKLGTGVLKVLDAIV  223
            +   L IIPV  K+D  L     +  + QLE    +  S+V+  SAK   GV  +L AI+
Sbjct  227  LDQGLAIIPVFTKMDCVLNDTTVDAALQQLEDSTGLLRSEVVFTSAKEQLGVEALLQAII  286

Query  224  ERIPPP-------DVCRDK-----------------PFRALIFDSW--------------  245
            ER+P P       DVC+                   P RA++ DSW              
Sbjct  287  ERVPSPSGAIGLSDVCQLPPLLPGSTARVAMEAEMVPLRAILLDSWTRECGGGLYRPPSK  346

Query  246  ----------YDKYKGTI-LLIYIKEGSLSLKLHIVSMYTKKSYEVKNMSLLRPSEENVN  294
                       D+ K T+  L+ + +G+L+ + +I+  +++K YE + + ++ P      
Sbjct  347  TSSALSGNVKIDEDKDTVTCLVSVIDGTLTARTNILLYHSQKRYEAREVGVIHPELRPTG  406

Query  295  KLFAGQIGCISCNMRSSKEMIIGDTLH-------LKDHVAEPLLGFKTPKPMVFSGVYPI  347
             L  G +G +       ++  +G+TL+        +  +A P+ GF+   P+VF+G YP 
Sbjct  407  ALTVGMVGYVVFTRVQREDFSVGETLYTLPTRKFTRGGIA-PVPGFRRVHPVVFAGFYPD  465

Query  348  EKSQFEVMRTAIEKLTLNDSSVTIEMETSVALGHGWRLGFLGLLHMEVFMQRLEQEYGTC  407
            E      +R A+EKL +ND +VT+E     ALG G +LGFLG+LHM++F +RL  E+G  
Sbjct  466  EGEYVTQLREAVEKLRMNDPAVTVEPLECQALGSGLQLGFLGVLHMQIFQERLLSEFGQR  525

Query  408  SIVTTPSVTYKAKIFGKKNIKEYKTDMISFNNPAKFPDPNIVEELY-------EPMVLGS  460
             +VT P V YK           Y+      + P K    +    L+       EP V  +
Sbjct  526  VLVTPPVVQYK-----------YREAAGGDDQPPKPLSVHTWRWLHEGVSCYMEPHVTAT  574

Query  461  IIAPTEYVGTVLSLCFER--RGVQQTAKDIGHNRTLFQFLLPLNEIIVDFHDTLKQATSG  518
            ++ P+EY   ++    +R  RG Q   + +   R L ++ +PL +++  F   +K  + G
Sbjct  575  VVTPSEY-AQIIDGEAQRHYRGKQLDMRVMDDARVLLRYKMPLADMVRGFFTFVKSQSHG  633

Query  519  YGTFDYEDHNYQPTDILKLNIALNGNVVEELSTIVHISKARTTGRQICERLLDILPRQLF  578
            Y + +Y++  Y+  D+++++I +    +  L+ I    +A + G++I   L   L R   
Sbjct  634  YASLEYDELVYEEADLVRVDIVVQKARISALAVICPRHEAPSVGKRIVASLKSNLTRTAV  693

Query  579  EIVIQAIVSGKVIARETLKPYKKDVTAKLYGGDITRRMKLLAQQAQGKKKM--KMIGKIS  636
            +I +QA+V  KV+ARET++ Y+KDVTAK++ GDI+R+ K    Q +GK++M  + +G ++
Sbjct  694  DIPLQALVGSKVVARETVRAYRKDVTAKIHAGDISRKQKKWNDQKKGKERMARRTVGGVT  753

Query  637  I  637
            +
Sbjct  754  L  754


>EFGM_DROME unnamed protein product
Length=745

 Score = 108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 68/184 (37%), Positives = 107/184 (58%), Gaps = 15/184 (8%)

Query  20   NQIRIRQHLYYFNRFYSTNSEVTKEYDLPIENIRNFSIVAHVDHGKSTLADRLLEITGAV  79
            N +R+R         YS++++ ++    PIE IRN  I AH+D GK+TL +R+L  TG +
Sbjct  12   NTLRLRALKSLGKAGYSSHAKFSEHK--PIERIRNIGISAHIDSGKTTLTERILFYTGRI  69

Query  80   --------KINSGEQILDKLQVEKERGITVKAQTASLNYTYKGIKYLLNLIDTPGHVDFS  131
                    K N G   +D +++E++RGIT+  Q+A+    +K     +N+IDTPGHVDF+
Sbjct  70   AEMHEVRGKDNVG-ATMDSMELERQRGITI--QSAATYTLWKDTN--INIIDTPGHVDFT  124

Query  132  AEVHRSLAPCQGVVLVVDANDGVQAQTVANFHLAMKNNLVIIPVINKIDLKFAKPERVIN  191
             EV R+L    G VLV+ A  GVQ+QT+       + N+  +  INK+D   + P RV++
Sbjct  125  VEVERALRVLDGAVLVLCAVGGVQSQTLTVNRQMKRYNVPCLAFINKLDRLGSNPYRVLS  184

Query  192  QLET  195
            Q+ +
Sbjct  185  QMRS  188


 Score = 52.4 bits (124),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 58/255 (23%), Positives = 102/255 (40%), Gaps = 37/255 (15%)

Query  195  TLFDITESDVLKISAKLGTGVLKVLDAIVERIPPP---------------------DVCR  233
            T  + T + VL  +A    GV  +LDA+++ +P P                     +  R
Sbjct  282  TCINRTFTPVLVGTALKNKGVQPLLDAVLDYLPNPGEVENLGFIEKEGQDPEKVVLNPAR  341

Query  234  D--KPFRALIFDSWYDKYKGTILLIYIKEGSLSLKLHIVSMYTKKSYEVKNMSLLRPSE-  290
            D   PF  L F     ++ G +  +   +G L    +I +  T K   +  +  L  ++ 
Sbjct  342  DGKDPFVGLAFKLEAGRF-GQLTYLRCYQGVLRKGDNIFNARTNKKVRIARLVRLHSNQM  400

Query  291  ENVNKLFAGQIGCISCNMRSSKEMIIGDTLHLKDHVAEPLLGFKTPKPMVFSGVYPIEKS  350
            E+VN+++AG I  +        +   GDT          +     P+P+V   + P    
Sbjct  401  EDVNEVYAGDIFALF-----GVDCASGDTFTTNPKNNLSMESIFVPEPVVSMAIKPNNTK  455

Query  351  QFEVMRTAIEKLTLNDSSVTIEMETSV--ALGHGWRLGFLGLLHMEVFMQRLEQEYGTCS  408
              +    AI + T  D +     +  V   L  G     +G LH+E++ QR+E+EYG   
Sbjct  456  DRDNFSKAIARFTKEDPTFHFFFDNDVKETLVSG-----MGELHLEIYAQRMEREYGCPV  510

Query  409  IVTTPSVTYKAKIFG  423
             +  P V ++  + G
Sbjct  511  TLGKPKVAFRETLVG  525


 Score = 36.2 bits (82),  Expect = 0.094, Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 40/81 (49%), Gaps = 2/81 (2%)

Query  451  ELYEPMVLGSIIAPTEYVGTVLSLCFERRGVQQTAKDIGHNRTLFQFLLPLNEIIVDFHD  510
            ++ EP++L  + AP E+ G V+    +R G+    +      T++   +PLN++   +  
Sbjct  638  QILEPIMLVEVTAPEEFQGAVMGHLSKRHGIITGTEGTEGWFTVYA-EVPLNDMF-GYAG  695

Query  511  TLKQATSGYGTFDYEDHNYQP  531
             L+ +T G G F  E   Y P
Sbjct  696  ELRSSTQGKGEFTMEYSRYSP  716


>Q38BA0_TRYB2 unnamed protein product
Length=746

 Score = 105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 75/277 (27%), Positives = 138/277 (50%), Gaps = 31/277 (11%)

Query  28   LYYFNRFYSTNSEVTKEYDLPIENIRNFSIVAHVDHGKSTLADRLLEITGAV----KINS  83
            ++Y NRFY   S     +   I+ +RN  I AH+D GK+T+ +R+L  TG +    ++  
Sbjct  8    VFYPNRFYRLASSA---FLKNIDKLRNIGISAHIDSGKTTVTERILFYTGRIDKIHEVKG  64

Query  84   GEQI---LDKLQVEKERGITVKAQTASLNYTYKGIKYLLNLIDTPGHVDFSAEVHRSLAP  140
            G ++   +D +++EKERGIT+++      +      +L+N+IDTPGHVDF+ EV R+L  
Sbjct  65   GSEVGATMDSMELEKERGITIRSAATQCKWG----DHLINIIDTPGHVDFTIEVERALRV  120

Query  141  CQGVVLVVDANDGVQAQTVANFHLAMKNNLVIIPVINKIDLKFAKPERVINQLETLFDIT  200
              G V+++    GVQ+QT+       +  +  +  INK+D   A P R +        + 
Sbjct  121  LDGAVMLMCGVGGVQSQTLTVDRQMKRYGVPRVCFINKLDRDNANPRRALEMARERLGVN  180

Query  201  ESDVLKISAKLGTGVLKVLDAIVERIPPPDVCRDKPFRALIFDSWY-DKYKGTILLIYIK  259
             + +      L  GV +  + +V+ I           RA+ FD    +K +   +  YI 
Sbjct  181  AAFI-----HLNMGVAQDFEGVVDVIES---------RAVYFDGKNGEKIRFEDIPSYIA  226

Query  260  EGSLSLKLHIVSMYTKKSYEVKNMSL--LRPSEENVN  294
            +  ++ +  ++S       E++++ L  + P+ E ++
Sbjct  227  DDVVATRKELISRLADCDAEMEDVFLNDVEPTAEQIH  263


 Score = 36.2 bits (82),  Expect = 0.10, Method: Compositional matrix adjust.
 Identities = 41/198 (21%), Positives = 89/198 (45%), Gaps = 16/198 (8%)

Query  234  DKPFRALIFDSWYDKYKGTILLIYIKEGSLSLKLHIVSMYTKKSYEVKNMSLLRP-SEEN  292
            +KP  A IF     K  G +  I + +G +  + H++++ + K++  + +  +   S + 
Sbjct  338  EKPLVAAIFKLEETKKTGLLNYIRVYQGKMR-REHLMNVRSGKTFLPQKLVRMHANSTDQ  396

Query  293  VNKLFAGQIGCISCNMRSSKEMIIGDTLHLKDHVAEPLLGFK---TPKPMVFSGVYPIEK  349
            ++++ AG I  I   + +S     GDT+      A  L+  +    P  ++ + V     
Sbjct  397  IDEVRAGDICAIQGEIDASS----GDTIVKAGVTAGQLITCEDMYVPPRVISASVKINND  452

Query  350  SQFEVMRTAIEKLTLNDSSVTI--EMETSVALGHGWRLGFLGLLHMEVFMQRLEQEYGTC  407
                 +R  +      D +       ET+  +  G     +G LH++++++RL++EY   
Sbjct  453  RDSSKLRERMGAFMREDPTFCFYRNTETNEDIVEG-----MGELHLDIYIERLKREYDLE  507

Query  408  SIVTTPSVTYKAKIFGKK  425
             ++  P+V Y+  I  +K
Sbjct  508  VVLGKPTVNYREVITERK  525



Lambda      K        H
   0.322    0.136    0.412 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7723295310


Query= XP_050469401.1 mRNA-capping enzyme [Bombus huntii]

Length=593
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VY44_DROME  unnamed protein product                                 654     0.0   
MCE1_CAEEL  unnamed protein product                                   432     8e-145
Q6A3Q2_CAEEL  unnamed protein product                                 426     4e-143


>Q9VY44_DROME unnamed protein product
Length=649

 Score = 654 bits (1688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/610 (53%), Positives = 408/610 (67%), Gaps = 27/610 (4%)

Query  4    RNESKGPIPPRWLHCPRKAVKLIQNKFLAFKTPLSSAFDSQVPEECRFSVDMLFASLKSQ  63
            R    GP+P RWL+CPRK+  +I  +FLAFKTPLS+ F  ++P EC F  +MLF   K+ 
Sbjct  8    RERGSGPLPNRWLYCPRKSDTIIAERFLAFKTPLSNNFHDKMPIECTFQPEMLFEYCKTL  67

Query  64   KIKLGLWVDLTNTTRFYDKESLEAYGCKYLKLQCRGHGETPSEEQTRIFVQICRNFISFN  123
            K+KLGLWVDLTNT RFYD+ ++E  G KY+KLQCRGHGETPS EQT  F++I  NFI+  
Sbjct  68   KVKLGLWVDLTNTKRFYDRSAVEELGAKYIKLQCRGHGETPSPEQTHSFIEIVDNFINER  127

Query  124  PLEVIGVHCTHGFNRTGFLIISYLVETDGTSVDAGLAEFATARPPGIYKADYIQELFRRY  183
            P +VI VHCTHGFNRTGFLI+ YLVE    SV A LA FA+ARPPGIYK DYI EL++RY
Sbjct  128  PFDVIAVHCTHGFNRTGFLIVCYLVERLDCSVSAALAIFASARPPGIYKQDYINELYKRY  187

Query  184  DDVEDAPDPAPRPAWCLEYDDSN----VEDTDEGTSADNDNYNQDV--------------  225
            +D   AP    +P WCL+YDD N    V+D    TS      + D               
Sbjct  188  EDTNAAPAAPEQPNWCLDYDDGNGDGFVQDNSSSTSQQAGEQDDDAEEVEGEDAGGDCDA  247

Query  226  ------PNKKRRREFNNKNPIFMAGVPGVTPILEDRKLSGIQRRVQGICSWKSTGFPGSQ  279
                  P KKRRRE   KN  FMAGVPGV  + +  +L  +QR+VQ  C WK  GFPG+Q
Sbjct  248  STSDGQPRKKRRREMIIKNATFMAGVPGVRQVSDQPRLGDLQRKVQDWCDWKKNGFPGAQ  307

Query  280  PVSMDEDNIRLLHEKPYRVSWKADGTRYMMMIQADGEIYFVDRDNSVFQVNGMTFPHPKD  339
            PVSMD +NI+ L E PYRVSWKADGTRYMM+I    E+YF DR++S FQV  +TF   ++
Sbjct  308  PVSMDRENIKRLSEIPYRVSWKADGTRYMMLIDGRDEVYFFDRNHSCFQVENVTFVESRN  367

Query  340  ISRTLKDTLLDGEMVIDKANGKEYPRYLVYDVVMYDGKDISKLPFHPERSCIIEREIIGG  399
            ++  L  TL+DGEMV+DK      PRYL+YD+V    +D+   PF+P R   I+ E+IG 
Sbjct  368  LNEHLDGTLVDGEMVLDKIGETVTPRYLIYDIVRLSNRDVRDEPFYPNRLDYIKTEVIGP  427

Query  400  RHRAMKEGKLRKEMEPFSVRLKHFWDVTQAANLLSEKFAKQLGHEPDGLIFQPAKEPYCP  459
            R   MK G + + ++ FSVR K FWD+  +A LL EKF++ L HEPDGLIFQP+K+PY  
Sbjct  428  RILGMKHGIINQRLQAFSVRGKDFWDIWMSARLLGEKFSRTLAHEPDGLIFQPSKQPYTA  487

Query  460  GLSPDVLKWKPLSQNSVDFRLKIITESGEGILPKKIGYLYVGGMKEPFDKM-KVTKQIKD  518
            G   DV KWKP   NSVDFRLKIITE GEG+L KK+G+LYVGG   P+ +M ++TK+ ++
Sbjct  488  GTCSDVFKWKPHELNSVDFRLKIITERGEGLLTKKVGFLYVGGHDAPYGRMQRLTKETRE  547

Query  519  LNNAIIECKFEN-GQWVFMRERTDKSFPNSYNTAQSVCRSIIKPITTERLLDYINRHRFI  577
            L+N I+EC     G W FMRERTDK  PNSYNTA+SV  SI  P+T E LL++I    + 
Sbjct  548  LDNRIVECTMNQFGNWDFMRERTDKKNPNSYNTARSVVDSIKHPVTKEYLLNFIASSGY-  606

Query  578  IDDSDLMPPP  587
             +D  +MPPP
Sbjct  607  RNDHVMMPPP  616


>MCE1_CAEEL unnamed protein product
Length=623

 Score = 432 bits (1112),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 240/589 (41%), Positives = 341/589 (58%), Gaps = 30/589 (5%)

Query  5    NESKGPIPPRWLHCPRKAVKLIQNKFLAFKTPLSSAFDSQVPEE-CRFSVDMLFASLKSQ  63
            ++++  +P RWLHCP+    LI N F  FKTPL   +D+Q+ E   +F    +F+     
Sbjct  9    DKARMGLPDRWLHCPKTGT-LINNLFFPFKTPLCKMYDNQIAERRYQFHPAEVFSHPHLH  67

Query  64   KIKLGLWVDLTNTTRFYDKESLEAYGCKYLKLQCRGHGETPSEEQTRIFVQICRNFISFN  123
              K+GLW+DLTNT R+Y +E +  + C Y K++  G G +P++E T  F+++ + F    
Sbjct  68   GKKIGLWIDLTNTDRYYFREEVTEHECIYHKMKMAGRGVSPTQEDTDNFIKLVQEFHKKY  127

Query  124  PLEVIGVHCTHGFNRTGFLIISYLVETDGTSVDAGLAEFATARPPGIYKADYIQELFRRY  183
            P  V+GVHCTHGFNRTGFLI +YL + +   +DA + EFA  R  GIYK DYI +LF RY
Sbjct  128  PDRVVGVHCTHGFNRTGFLIAAYLFQVEEYGLDAAIGEFAENRQKGIYKQDYIDDLFARY  187

Query  184  DDVEDAPDPAP-RPAWCLEYDDSNVEDTDEGTSADNDNYNQDVPNKKRRREF--------  234
            D  ED    AP +P W  E         D G  +     +Q +P                
Sbjct  188  DPTEDDKILAPEKPDWEREMSIGMSTQIDNGRPST----SQQIPATNGNNNQNGNQLSGG  243

Query  235  NNKNPIFMAG-VPGVTPILEDRKLSGIQRRVQGICSWKSTGFPGSQPVSMDEDNIRLLHE  293
             + + +FM G + GV    ++ K S +Q +++ +C +   GFPG QPVS+   NI LL +
Sbjct  244  GDNSKLFMDGLIRGVKVCEDEGKKSMLQAKIKNLCKYNKQGFPGLQPVSLSRGNINLLEQ  303

Query  294  KPYRVSWKADGTRYMMMIQADGEIYFVDRDNSVFQVNGMTFPHPKDISRTLKDTLLDGEM  353
            + Y VSWKADG RY++ I  DG++Y  DRDN VF++  + F         L +TL+D E+
Sbjct  304  ESYMVSWKADGMRYIIYIN-DGDVYAFDRDNEVFEIENLDFVTKN--GAPLMETLVDTEV  360

Query  354  VIDKA--NGK--EYPRYLVYDVVMYDGKDISKLPFHPERSCIIEREIIGGRHRAMKEGKL  409
            +IDK   NG   + PR L+YD++ ++  ++ K PF+ +R  II+ EII  R  A K G+L
Sbjct  361  IIDKVEINGAMCDQPRMLIYDIMRFNSVNVMKEPFY-KRFEIIKTEIIDMRTAAFKTGRL  419

Query  410  RKEMEPFSVRLKHFWDVTQAANLLSEKFAKQLGHEPDGLIFQPAKEPYCPGLSPDVLKWK  469
            + E +  SVR K F+D+   A L   KF + +GHE DGLIFQP K  Y  G    VLKWK
Sbjct  420  KHENQIMSVRRKDFYDLEATAKLFGPKFVQHVGHEIDGLIFQPKKTKYETGRCDKVLKWK  479

Query  470  PLSQNSVDFRLKIITESGEGILPKKIGYLYVGGMKEPFDKMKVTKQIKDLNNAIIECKF-  528
            P S NSVDF LK+  +  EG+LP+ IGYL+V  + +PF  MK T  +K  +N IIEC   
Sbjct  480  PPSHNSVDFLLKVEKKCKEGMLPEWIGYLFVQNLSDPFGTMKATATLKKYHNKIIECTLL  539

Query  529  -----ENGQWVFMRERTDKSFPNSYNTAQSVCRSIIKPITTERLLDYIN  572
                    +W FMRERTDKS PN   TA++V  +++ P+T   L++Y+N
Sbjct  540  VDNQGRPKEWKFMRERTDKSLPNGLRTAENVVETMVNPVTETYLIEYVN  588


>Q6A3Q2_CAEEL unnamed protein product
Length=573

 Score = 426 bits (1096),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 238/580 (41%), Positives = 334/580 (58%), Gaps = 30/580 (5%)

Query  11   IPPRWLHCPRKAVKLIQNKFLAFKTPLSSAFDSQVPEE-CRFSVDMLFASLKSQKIKLGL  69
            +P RWLHCP+    LI N F  FKTPL   +D+Q+ E   +F    +F+       K+GL
Sbjct  3    LPDRWLHCPKTGT-LINNLFFPFKTPLCKMYDNQIAERRYQFHPAEVFSHPHLHGKKIGL  61

Query  70   WVDLTNTTRFYDKESLEAYGCKYLKLQCRGHGETPSEEQTRIFVQICRNFISFNPLEVIG  129
            W+DLTNT R+Y +E +  + C Y K++  G G +P++E T  F+++ + F    P  V+G
Sbjct  62   WIDLTNTDRYYFREEVTEHECIYHKMKMAGRGVSPTQEDTDNFIKLVQEFHKKYPDRVVG  121

Query  130  VHCTHGFNRTGFLIISYLVETDGTSVDAGLAEFATARPPGIYKADYIQELFRRYDDVEDA  189
            VHCTHGFNRTGFLI +YL + +   +DA + EFA  R  GIYK DYI +LF RYD  ED 
Sbjct  122  VHCTHGFNRTGFLIAAYLFQVEEYGLDAAIGEFAENRQKGIYKQDYIDDLFARYDPTEDD  181

Query  190  PDPAP-RPAWCLEYDDSNVEDTDEGTSADNDNYNQDVPNKKRRREF--------NNKNPI  240
               AP +P W  E         D G  +     +Q +P                 + + +
Sbjct  182  KILAPEKPDWEREMSIGMSTQIDNGRPST----SQQIPATNGNNNQNGNQLSGGGDNSKL  237

Query  241  FMAG-VPGVTPILEDRKLSGIQRRVQGICSWKSTGFPGSQPVSMDEDNIRLLHEKPYRVS  299
            FM G + GV    ++ K S +Q +++ +C +   GFPG QPVS+   NI LL ++ Y VS
Sbjct  238  FMDGLIRGVKVCEDEGKKSMLQAKIKNLCKYNKQGFPGLQPVSLSRGNINLLEQESYMVS  297

Query  300  WKADGTRYMMMIQADGEIYFVDRDNSVFQVNGMTFPHPKDISRTLKDTLLDGEMVIDKA-  358
            WKADG RY++ I  DG++Y  DRDN VF++  + F         L +TL+D E++IDK  
Sbjct  298  WKADGMRYIIYIN-DGDVYAFDRDNEVFEIENLDFVTKN--GAPLMETLVDTEVIIDKVE  354

Query  359  -NGK--EYPRYLVYDVVMYDGKDISKLPFHPERSCIIEREIIGGRHRAMKEGKLRKEMEP  415
             NG   + PR L+YD++ ++  ++ K PF+ +R  II+ EII  R  A K G+L+ E + 
Sbjct  355  INGAMCDQPRMLIYDIMRFNSVNVMKEPFY-KRFEIIKTEIIDMRTAAFKTGRLKHENQI  413

Query  416  FSVRLKHFWDVTQAANLLSEKFAKQLGHEPDGLIFQPAKEPYCPGLSPDVLKWKPLSQNS  475
             SVR K F+D+   A L   KF + +GHE DGLIFQP K  Y  G    VLKWKP S NS
Sbjct  414  MSVRRKDFYDLEATAKLFGPKFVQHVGHEIDGLIFQPKKTKYETGRCDKVLKWKPPSHNS  473

Query  476  VDFRLKIITESGEGILPKKIGYLYVGGMKEPFDKMKVTKQIKDLNNAIIECKF------E  529
            VDF LK+  +  EG+LP+ IGYL+V  + +PF  MK T  +K  +N IIEC         
Sbjct  474  VDFLLKVEKKCKEGMLPEWIGYLFVQNLSDPFGTMKATATLKKYHNKIIECTLLVDNQGR  533

Query  530  NGQWVFMRERTDKSFPNSYNTAQSVCRSIIKPITTERLLD  569
              +W FMRERTDKS PN   TA++V  +++ P+T   L++
Sbjct  534  PKEWKFMRERTDKSLPNGLRTAENVVETMVNPVTETYLIE  573



Lambda      K        H
   0.322    0.136    0.412 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7723295310


Query= XP_050469402.1 2-hydroxyacyl-CoA lyase 1 isoform X1 [Bombus huntii]

Length=566
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q38B52_TRYB2  unnamed protein product                                 31.6    1.9  
Q7JWH6_DROME  unnamed protein product                                 30.4    3.9  


>Q38B52_TRYB2 unnamed protein product
Length=323

 Score = 31.6 bits (70),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 21/94 (22%), Positives = 39/94 (41%), Gaps = 5/94 (5%)

Query  426  LYCKKNASTKRVICVEGDSAFGFSGMEIETMFRYKLPIIVIIINNNGIYGGLDNETFRQI  485
            +Y  K  S  R+  +      GF G+E+    RY+ P   +++N       +  E  +++
Sbjct  71   IYGHKGRSITRIFLLGPSHHKGFDGVEVCAAQRYETPFGPLVVN-----AKVGQEVEKEL  125

Query  486  QASGEPTQVIPPNSLTSETHYEKMLEMFGHKGHF  519
            +A+G P   +   +   E   E  L    H  H+
Sbjct  126  RAAGVPVGTMHRMTDEDEHSIEMQLPFISHLLHY  159


>Q7JWH6_DROME unnamed protein product
Length=372

 Score = 30.4 bits (67),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 21/93 (23%), Positives = 40/93 (43%), Gaps = 3/93 (3%)

Query  131  CAAVIPLHVEKAVRLSTYGRPGATYLDLPATLLIQSINKENI---YKVASCPPPPLIFPD  187
            C    PLH+E+        +P      +PA  L+   +   +   + +    PP  I  D
Sbjct  131  CQEQSPLHMEQPSEQEELHKPEDLVKTIPAESLVALSDPREMSVPFPLPLVHPPAQITDD  190

Query  188  QRLVQQAANLLMRARKPLLIIGKGAAYGRAENE  220
              +V+Q    + + RKP  ++  G++ G + N+
Sbjct  191  IMMVKQELMPMQQTRKPEAVLAAGSSGGTSGNK  223



Lambda      K        H
   0.322    0.136    0.412 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7723295310


Query= XP_050469403.1 2-hydroxyacyl-CoA lyase 1 isoform X2 [Bombus huntii]

Length=484
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q38B52_TRYB2  unnamed protein product                                 31.6    1.4  
Q7JWH6_DROME  unnamed protein product                                 30.4    3.6  
Q6V6U3_DROME  unnamed protein product                                 28.9    9.4  


>Q38B52_TRYB2 unnamed protein product
Length=323

 Score = 31.6 bits (70),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 21/94 (22%), Positives = 39/94 (41%), Gaps = 5/94 (5%)

Query  344  LYCKKNASTKRVICVEGDSAFGFSGMEIETMFRYKLPIIVIIINNNGIYGGLDNETFRQI  403
            +Y  K  S  R+  +      GF G+E+    RY+ P   +++N       +  E  +++
Sbjct  71   IYGHKGRSITRIFLLGPSHHKGFDGVEVCAAQRYETPFGPLVVNAK-----VGQEVEKEL  125

Query  404  QASGEPTQVIPPNSLTSETHYEKMLEMFGHKGHF  437
            +A+G P   +   +   E   E  L    H  H+
Sbjct  126  RAAGVPVGTMHRMTDEDEHSIEMQLPFISHLLHY  159


>Q7JWH6_DROME unnamed protein product
Length=372

 Score = 30.4 bits (67),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 21/93 (23%), Positives = 40/93 (43%), Gaps = 3/93 (3%)

Query  49   CAAVIPLHVEKAVRLSTYGRPGATYLDLPATLLIQSINKENI---YKVASCPPPPLIFPD  105
            C    PLH+E+        +P      +PA  L+   +   +   + +    PP  I  D
Sbjct  131  CQEQSPLHMEQPSEQEELHKPEDLVKTIPAESLVALSDPREMSVPFPLPLVHPPAQITDD  190

Query  106  QRLVQQAANLLMRARKPLLIIGKGAAYGRAENE  138
              +V+Q    + + RKP  ++  G++ G + N+
Sbjct  191  IMMVKQELMPMQQTRKPEAVLAAGSSGGTSGNK  223


>Q6V6U3_DROME unnamed protein product
Length=356

 Score = 28.9 bits (63),  Expect = 9.4, Method: Compositional matrix adjust.
 Identities = 15/41 (37%), Positives = 23/41 (56%), Gaps = 2/41 (5%)

Query  391  IYGGLDNETFRQIQASGEPTQ--VIPPNSLTSETHYEKMLE  429
            IYG  D +TFR++Q +GE ++  +       S   Y+K LE
Sbjct  33   IYGASDGKTFRELQKAGEFSKNAMAVAQDFESVIKYKKHLE  73



Lambda      K        H
   0.322    0.136    0.412 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7723295310


Query= XP_050469404.1 sialin-like isoform X1 [Bombus huntii]

Length=534
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8MRP7_DROME  unnamed protein product                                 204     4e-59
Q9VPX2_DROME  unnamed protein product                                 192     7e-55
Q9VR44_DROME  unnamed protein product                                 184     6e-52


>Q8MRP7_DROME unnamed protein product
Length=497

 Score = 204 bits (518),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 129/450 (29%), Positives = 233/450 (52%), Gaps = 12/450 (3%)

Query  92   RIEATQNAVDPMAHNIRVRRNNDKGKIRPTN--IELFNGLPF-DWRPEIRGQLIAAYSYG  148
            R+  +   V    ++  + +NN    + P+    + FN   + ++  + +G L A++ +G
Sbjct  41   RVNLSVALVAMTDNSTSLAQNNTNTGVAPSEPGFDFFNSERYYNFTQKEKGNLQASFFFG  100

Query  149  NVPGNFIGGLMAVKWGAKQSILWTSIVAAIVSLISPILAQLHWGVLLFSRIIIGVTGGVT  208
             +     GG +A ++GAK  +++   +AA+++++SP+  Q  W  L   R ++G+  G  
Sbjct  101  YIVTQVPGGYIAQRYGAKTMLMYGLGIAALITMLSPMSLQFGWVALAVMRFVMGLAQGAV  160

Query  209  FPACHSLVAQWAPPNEKARF-VWSLLGGTFGTILTYPMVAGIAENI-HWENGWYIPSLLM  266
             PA H+L+A+W+P +E+         G  FGT++       IA+++  W + +Y+     
Sbjct  161  HPATHALLAKWSPADERGMLGTLCYSGAQFGTVVMLATSGFIADSVLGWPSIFYLGGACG  220

Query  267  MIWIFFWAVVTYDTPAEHPGISDEEKEYIQSSQAGTVRKEKPSLKETPVKEIFTSIPFLS  326
             IW+ FW + +  TP EH  IS  E +YI  S++    +    L  TP K IF+S+PFLS
Sbjct  221  FIWMVFWYLFSASTPEEHRLISPGELKYITDSRSDGKMQSAEKLAPTPWKAIFSSLPFLS  280

Query  327  LVCCHFGNLFLLFFYQNAMMLYLTKALGFELTKGGIAASLPWACRMLFGFFFSWAGDTLK  386
            L+  H  ++F  +     +  Y+ K    ++ KG + +SLP+   +L  FFF W    L+
Sbjct  281  LLVVHCTHIFGYWLLLMQIPTYMKKIYHVDIKKGALLSSLPYMVMLLLSFFFVWLSKVLQ  340

Query  387  RKGTVSVTMIRKGATFFSHFLPGIFLILVGYVGCD-LILANVFLVLALGFNGAASISNLS  445
            +K  +S++  RK      H++P + LI +GYV  D   LA   L L +G +GA  +    
Sbjct  341  KKEGMSLSFNRKIFNSIGHWIPMLSLIALGYVPADNAPLAVTLLTLTVGISGATYLGFQV  400

Query  446  NNQDLSPNFAGFIYGIMNTVGCASGMI--ISPMVEEIAGKYGNPIDRWQTLFWIGSGVCI  503
            N+ DLSPN+AG + GI N   CA+ ++  I+P++          +  W+ +F + +    
Sbjct  401  NHIDLSPNYAGTLMGITN---CAANVMSGIAPVIVGQIVVDETSVTEWRLVFLLAAAFYF  457

Query  504  ICMIIFLLGGSGNIQSWNEIR-TQPDAERG  532
            +  ++F++ G   +Q W+  R  + DAE+G
Sbjct  458  LGNLLFVIFGRTEVQWWDSPRDNKEDAEQG  487


>Q9VPX2_DROME unnamed protein product
Length=512

 Score = 192 bits (489),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 121/425 (28%), Positives = 217/425 (51%), Gaps = 9/425 (2%)

Query  109  VRRNNDKGKIRPTNIELFNGLPFDWRPEIRGQLIAAYSYGNVPGNFIGGLMAVKWGAKQS  168
            V   N  G       ++ +G PFDW   ++G L++ Y +G +        +A  + AK  
Sbjct  79   VEECNPPGGASNVTAKVEDG-PFDWSEPLQGTLLSCYFWGYLVSQIPLAHVAENFSAKWV  137

Query  169  ILWTSIVAAIVSLISPILAQLHWGVLLFSRIIIGVTGGVTFPACHSLVAQWAPPNEKARF  228
            +L++  +  + +L++P+  +LH+G L+  R++ GV GG +FPA H ++A WAPP E  R 
Sbjct  138  MLFSVAINVVCTLLTPVFTELHYGGLILMRVLEGVGGGASFPAMHVMIASWAPPTE--RM  195

Query  229  VWSLL---GGTFGTILTYPMVAGIAENIHWENGWYIPSLLMMIWIFFWAVVTYDTPAEHP  285
            V S +   G + GT L+  +    +    WE+ +Y+   L  IW+  W ++  D P +  
Sbjct  196  VMSTIIYVGTSAGTALSILLAGVCSAQWGWESVFYVMGALSCIWMLLWVILVQDNPNKQR  255

Query  286  GISDEEKEYIQSSQAGTVRKEKPSLKETPVKEIFTSIPFLSLVCCHFGNLFLLFFYQNAM  345
             IS EE++ I SS  GT +K +      P  ++FTS+PF +++  H  + F  + +   +
Sbjct  256  FISLEERQMITSS-LGTEQKTEHH-PAVPWGKVFTSVPFWAILIAHTCSNFGWYMFLIEI  313

Query  346  MLYLTKALGFELTKGGIAASLPWACRMLFGFFFSWAGDTLKRKGTVSVTMIRKGATFFSH  405
              Y+ + L F +      ++LP+   ++F        D+L+ KG ++ T+ RK AT    
Sbjct  314  PFYMKQVLKFNVASNAALSALPYFPMIIFSICLGKLLDSLQAKGKITTTVARKTATSICT  373

Query  406  FLPGIFLILVGYVGCDLILANVFLVLALGFNGAASISNLSNNQDLSPNFAGFIYGIMNTV  465
             +PG+ L+++ Y+GC    A   + + +   G+     LSN+ D++PNFAG +  + NT 
Sbjct  374  LIPGVCLLVLCYIGCRHYEAVSVMSVGIVAMGSMFSGFLSNHIDIAPNFAGTLVALTNTA  433

Query  466  GCASGMIISPMVEEIAGKYGNPIDRWQTLFWIGSGVCIICMIIFLLGGSGNIQSWNEIRT  525
                G+++ P+      K    I  W+ +F +   +  +  ++F+  GSG+ Q WN+  T
Sbjct  434  ATLPGIVV-PLFVGFVTKGNQNIGAWRIIFGVTIVLFALEFLVFVFLGSGSEQPWNKAGT  492

Query  526  QPDAE  530
              D E
Sbjct  493  PKDPE  497


>Q9VR44_DROME unnamed protein product
Length=493

 Score = 184 bits (468),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 123/459 (27%), Positives = 231/459 (50%), Gaps = 14/459 (3%)

Query  72   RRAISWLDPGAYLEDYILSERIEATQNAVDPMAHNIRVRRNND--------KGKIRPTNI  123
            R+ ++ L    ++ +Y L  R+  T   VD +  N+    N               P  +
Sbjct  19   RQVLNLLTMLGFMLNYAL--RVNLTIAIVDMVRPNVTSAVNATLVGNSTAANSTASPDGV  76

Query  124  ELFNGLPFDWRPEIRGQLIAAYSYGNVPGNFIGGLMAVKWGAKQSILWTSIVAAIVSLIS  183
            +++    F W       ++  + +G +     GG +A   G ++    + + A++++LI+
Sbjct  77   DVYEE-RFPWDSYQTNFVLGCFFWGYILTELPGGRLAELIGGRRVFGHSMLWASLLTLIT  135

Query  184  PILAQLHWGVLLFSRIIIGVTGGVTFPACHSLVAQWAPPNEKARFVWSLLGGTFGTILTY  243
            P+ A +++ VL+  R+++G   G ++PA H + A W PP E+++F+ +++  + G  +T 
Sbjct  136  PLAAHINYVVLIVVRVVLGFMLGASWPAIHPVAAVWIPPMERSKFMSNMMASSLGAAITM  195

Query  244  PMVAGIAENIHWENGWYIPSLLMMIWIFFWAVVTYDTPAEHPGISDEEKEYIQSSQAGTV  303
            P+   +     W + +Y+   + ++W   W    Y+TPA HP IS EE+  I+ +   T 
Sbjct  196  PICGYLISVAGWASVFYLTGAVGLLWSLAWFTFVYETPATHPRISAEERREIEEAIGTTT  255

Query  304  RKEKPSLKETPVKEIFTSIPFLSLVCCHFGNLFLLFFYQNAMMLYLTKALGFELTKGGIA  363
             K++PS    P  ++  S    +++ CH   +F  F   N +  +++K L F++ + G+ 
Sbjct  256  SKKRPS--HVPWGQLLCSPAVWAIIICHGLAVFGFFTVVNQLPTFMSKILHFDIKQNGLF  313

Query  364  ASLPWACRMLFGFFFSWAGDTLKRKGTVSVTMIRKGATFFSHFLPGIFLILVGYVGCDLI  423
            +SLP+  + +     S+  D L++KGT+S T  RK  T F+  +PG+ +I+  ++G D  
Sbjct  314  SSLPYLGKYVMAVASSYLADYLRKKGTLSTTATRKLFTTFALVIPGLLMIVQVFLGYDAT  373

Query  424  LANVFLVLALGFNGAASISNLSNNQDLSPNFAGFIYGIMNTVGCASGMIISPMVEEIAGK  483
             +     LAL  +GA +   L N  D++PNF G I+G+ NT+    G + + MV  +  K
Sbjct  374  WSVTIFSLALFAHGAVTAGYLGNGLDIAPNFGGTIFGLANTLSSFGGFLSTSMVGALTYK  433

Query  484  YGNPIDRWQTLFWIGSGVCIICMIIFLLGGSGNIQSWNE  522
                   WQ +FWI +   I   ++F + GSG +Q WN 
Sbjct  434  -DQSFHSWQIVFWILAATYISAAVVFAILGSGELQPWNN  471



Lambda      K        H
   0.322    0.136    0.412 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7723295310


Query= XP_050469405.1 sialin-like isoform X1 [Bombus huntii]

Length=534
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8MRP7_DROME  unnamed protein product                                 204     4e-59
Q9VPX2_DROME  unnamed protein product                                 192     7e-55
Q9VR44_DROME  unnamed protein product                                 184     6e-52


>Q8MRP7_DROME unnamed protein product
Length=497

 Score = 204 bits (518),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 129/450 (29%), Positives = 233/450 (52%), Gaps = 12/450 (3%)

Query  92   RIEATQNAVDPMAHNIRVRRNNDKGKIRPTN--IELFNGLPF-DWRPEIRGQLIAAYSYG  148
            R+  +   V    ++  + +NN    + P+    + FN   + ++  + +G L A++ +G
Sbjct  41   RVNLSVALVAMTDNSTSLAQNNTNTGVAPSEPGFDFFNSERYYNFTQKEKGNLQASFFFG  100

Query  149  NVPGNFIGGLMAVKWGAKQSILWTSIVAAIVSLISPILAQLHWGVLLFSRIIIGVTGGVT  208
             +     GG +A ++GAK  +++   +AA+++++SP+  Q  W  L   R ++G+  G  
Sbjct  101  YIVTQVPGGYIAQRYGAKTMLMYGLGIAALITMLSPMSLQFGWVALAVMRFVMGLAQGAV  160

Query  209  FPACHSLVAQWAPPNEKARF-VWSLLGGTFGTILTYPMVAGIAENI-HWENGWYIPSLLM  266
             PA H+L+A+W+P +E+         G  FGT++       IA+++  W + +Y+     
Sbjct  161  HPATHALLAKWSPADERGMLGTLCYSGAQFGTVVMLATSGFIADSVLGWPSIFYLGGACG  220

Query  267  MIWIFFWAVVTYDTPAEHPGISDEEKEYIQSSQAGTVRKEKPSLKETPVKEIFTSIPFLS  326
             IW+ FW + +  TP EH  IS  E +YI  S++    +    L  TP K IF+S+PFLS
Sbjct  221  FIWMVFWYLFSASTPEEHRLISPGELKYITDSRSDGKMQSAEKLAPTPWKAIFSSLPFLS  280

Query  327  LVCCHFGNLFLLFFYQNAMMLYLTKALGFELTKGGIAASLPWACRMLFGFFFSWAGDTLK  386
            L+  H  ++F  +     +  Y+ K    ++ KG + +SLP+   +L  FFF W    L+
Sbjct  281  LLVVHCTHIFGYWLLLMQIPTYMKKIYHVDIKKGALLSSLPYMVMLLLSFFFVWLSKVLQ  340

Query  387  RKGTVSVTMIRKGATFFSHFLPGIFLILVGYVGCD-LILANVFLVLALGFNGAASISNLS  445
            +K  +S++  RK      H++P + LI +GYV  D   LA   L L +G +GA  +    
Sbjct  341  KKEGMSLSFNRKIFNSIGHWIPMLSLIALGYVPADNAPLAVTLLTLTVGISGATYLGFQV  400

Query  446  NNQDLSPNFAGFIYGIMNTVGCASGMI--ISPMVEEIAGKYGNPIDRWQTLFWIGSGVCI  503
            N+ DLSPN+AG + GI N   CA+ ++  I+P++          +  W+ +F + +    
Sbjct  401  NHIDLSPNYAGTLMGITN---CAANVMSGIAPVIVGQIVVDETSVTEWRLVFLLAAAFYF  457

Query  504  ICMIIFLLGGSGNIQSWNEIR-TQPDAERG  532
            +  ++F++ G   +Q W+  R  + DAE+G
Sbjct  458  LGNLLFVIFGRTEVQWWDSPRDNKEDAEQG  487


>Q9VPX2_DROME unnamed protein product
Length=512

 Score = 192 bits (489),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 121/425 (28%), Positives = 217/425 (51%), Gaps = 9/425 (2%)

Query  109  VRRNNDKGKIRPTNIELFNGLPFDWRPEIRGQLIAAYSYGNVPGNFIGGLMAVKWGAKQS  168
            V   N  G       ++ +G PFDW   ++G L++ Y +G +        +A  + AK  
Sbjct  79   VEECNPPGGASNVTAKVEDG-PFDWSEPLQGTLLSCYFWGYLVSQIPLAHVAENFSAKWV  137

Query  169  ILWTSIVAAIVSLISPILAQLHWGVLLFSRIIIGVTGGVTFPACHSLVAQWAPPNEKARF  228
            +L++  +  + +L++P+  +LH+G L+  R++ GV GG +FPA H ++A WAPP E  R 
Sbjct  138  MLFSVAINVVCTLLTPVFTELHYGGLILMRVLEGVGGGASFPAMHVMIASWAPPTE--RM  195

Query  229  VWSLL---GGTFGTILTYPMVAGIAENIHWENGWYIPSLLMMIWIFFWAVVTYDTPAEHP  285
            V S +   G + GT L+  +    +    WE+ +Y+   L  IW+  W ++  D P +  
Sbjct  196  VMSTIIYVGTSAGTALSILLAGVCSAQWGWESVFYVMGALSCIWMLLWVILVQDNPNKQR  255

Query  286  GISDEEKEYIQSSQAGTVRKEKPSLKETPVKEIFTSIPFLSLVCCHFGNLFLLFFYQNAM  345
             IS EE++ I SS  GT +K +      P  ++FTS+PF +++  H  + F  + +   +
Sbjct  256  FISLEERQMITSS-LGTEQKTEHH-PAVPWGKVFTSVPFWAILIAHTCSNFGWYMFLIEI  313

Query  346  MLYLTKALGFELTKGGIAASLPWACRMLFGFFFSWAGDTLKRKGTVSVTMIRKGATFFSH  405
              Y+ + L F +      ++LP+   ++F        D+L+ KG ++ T+ RK AT    
Sbjct  314  PFYMKQVLKFNVASNAALSALPYFPMIIFSICLGKLLDSLQAKGKITTTVARKTATSICT  373

Query  406  FLPGIFLILVGYVGCDLILANVFLVLALGFNGAASISNLSNNQDLSPNFAGFIYGIMNTV  465
             +PG+ L+++ Y+GC    A   + + +   G+     LSN+ D++PNFAG +  + NT 
Sbjct  374  LIPGVCLLVLCYIGCRHYEAVSVMSVGIVAMGSMFSGFLSNHIDIAPNFAGTLVALTNTA  433

Query  466  GCASGMIISPMVEEIAGKYGNPIDRWQTLFWIGSGVCIICMIIFLLGGSGNIQSWNEIRT  525
                G+++ P+      K    I  W+ +F +   +  +  ++F+  GSG+ Q WN+  T
Sbjct  434  ATLPGIVV-PLFVGFVTKGNQNIGAWRIIFGVTIVLFALEFLVFVFLGSGSEQPWNKAGT  492

Query  526  QPDAE  530
              D E
Sbjct  493  PKDPE  497


>Q9VR44_DROME unnamed protein product
Length=493

 Score = 184 bits (468),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 123/459 (27%), Positives = 231/459 (50%), Gaps = 14/459 (3%)

Query  72   RRAISWLDPGAYLEDYILSERIEATQNAVDPMAHNIRVRRNND--------KGKIRPTNI  123
            R+ ++ L    ++ +Y L  R+  T   VD +  N+    N               P  +
Sbjct  19   RQVLNLLTMLGFMLNYAL--RVNLTIAIVDMVRPNVTSAVNATLVGNSTAANSTASPDGV  76

Query  124  ELFNGLPFDWRPEIRGQLIAAYSYGNVPGNFIGGLMAVKWGAKQSILWTSIVAAIVSLIS  183
            +++    F W       ++  + +G +     GG +A   G ++    + + A++++LI+
Sbjct  77   DVYEE-RFPWDSYQTNFVLGCFFWGYILTELPGGRLAELIGGRRVFGHSMLWASLLTLIT  135

Query  184  PILAQLHWGVLLFSRIIIGVTGGVTFPACHSLVAQWAPPNEKARFVWSLLGGTFGTILTY  243
            P+ A +++ VL+  R+++G   G ++PA H + A W PP E+++F+ +++  + G  +T 
Sbjct  136  PLAAHINYVVLIVVRVVLGFMLGASWPAIHPVAAVWIPPMERSKFMSNMMASSLGAAITM  195

Query  244  PMVAGIAENIHWENGWYIPSLLMMIWIFFWAVVTYDTPAEHPGISDEEKEYIQSSQAGTV  303
            P+   +     W + +Y+   + ++W   W    Y+TPA HP IS EE+  I+ +   T 
Sbjct  196  PICGYLISVAGWASVFYLTGAVGLLWSLAWFTFVYETPATHPRISAEERREIEEAIGTTT  255

Query  304  RKEKPSLKETPVKEIFTSIPFLSLVCCHFGNLFLLFFYQNAMMLYLTKALGFELTKGGIA  363
             K++PS    P  ++  S    +++ CH   +F  F   N +  +++K L F++ + G+ 
Sbjct  256  SKKRPS--HVPWGQLLCSPAVWAIIICHGLAVFGFFTVVNQLPTFMSKILHFDIKQNGLF  313

Query  364  ASLPWACRMLFGFFFSWAGDTLKRKGTVSVTMIRKGATFFSHFLPGIFLILVGYVGCDLI  423
            +SLP+  + +     S+  D L++KGT+S T  RK  T F+  +PG+ +I+  ++G D  
Sbjct  314  SSLPYLGKYVMAVASSYLADYLRKKGTLSTTATRKLFTTFALVIPGLLMIVQVFLGYDAT  373

Query  424  LANVFLVLALGFNGAASISNLSNNQDLSPNFAGFIYGIMNTVGCASGMIISPMVEEIAGK  483
             +     LAL  +GA +   L N  D++PNF G I+G+ NT+    G + + MV  +  K
Sbjct  374  WSVTIFSLALFAHGAVTAGYLGNGLDIAPNFGGTIFGLANTLSSFGGFLSTSMVGALTYK  433

Query  484  YGNPIDRWQTLFWIGSGVCIICMIIFLLGGSGNIQSWNE  522
                   WQ +FWI +   I   ++F + GSG +Q WN 
Sbjct  434  -DQSFHSWQIVFWILAATYISAAVVFAILGSGELQPWNN  471



Lambda      K        H
   0.322    0.136    0.412 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7723295310


Query= XP_050469406.1 sialin-like isoform X2 [Bombus huntii]

Length=528
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8MRP7_DROME  unnamed protein product                                 204     4e-59
Q9VPX2_DROME  unnamed protein product                                 193     6e-55
Q9VR44_DROME  unnamed protein product                                 184     7e-52


>Q8MRP7_DROME unnamed protein product
Length=497

 Score = 204 bits (518),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 129/450 (29%), Positives = 233/450 (52%), Gaps = 12/450 (3%)

Query  86   RIEATQNAVDPMAHNIRVRRNNDKGKIRPTN--IELFNGLPF-DWRPEIRGQLIAAYSYG  142
            R+  +   V    ++  + +NN    + P+    + FN   + ++  + +G L A++ +G
Sbjct  41   RVNLSVALVAMTDNSTSLAQNNTNTGVAPSEPGFDFFNSERYYNFTQKEKGNLQASFFFG  100

Query  143  NVPGNFIGGLMAVKWGAKQSILWTSIVAAIVSLISPILAQLHWGVLLFSRIIIGVTGGVT  202
             +     GG +A ++GAK  +++   +AA+++++SP+  Q  W  L   R ++G+  G  
Sbjct  101  YIVTQVPGGYIAQRYGAKTMLMYGLGIAALITMLSPMSLQFGWVALAVMRFVMGLAQGAV  160

Query  203  FPACHSLVAQWAPPNEKARF-VWSLLGGTFGTILTYPMVAGIAENI-HWENGWYIPSLLM  260
             PA H+L+A+W+P +E+         G  FGT++       IA+++  W + +Y+     
Sbjct  161  HPATHALLAKWSPADERGMLGTLCYSGAQFGTVVMLATSGFIADSVLGWPSIFYLGGACG  220

Query  261  MIWIFFWAVVTYDTPAEHPGISDEEKEYIQSSQAGTVRKEKPSLKETPVKEIFTSIPFLS  320
             IW+ FW + +  TP EH  IS  E +YI  S++    +    L  TP K IF+S+PFLS
Sbjct  221  FIWMVFWYLFSASTPEEHRLISPGELKYITDSRSDGKMQSAEKLAPTPWKAIFSSLPFLS  280

Query  321  LVCCHFGNLFLLFFYQNAMMLYLTKALGFELTKGGIAASLPWACRMLFGFFFSWAGDTLK  380
            L+  H  ++F  +     +  Y+ K    ++ KG + +SLP+   +L  FFF W    L+
Sbjct  281  LLVVHCTHIFGYWLLLMQIPTYMKKIYHVDIKKGALLSSLPYMVMLLLSFFFVWLSKVLQ  340

Query  381  RKGTVSVTMIRKGATFFSHFLPGIFLILVGYVGCD-LILANVFLVLALGFNGAASISNLS  439
            +K  +S++  RK      H++P + LI +GYV  D   LA   L L +G +GA  +    
Sbjct  341  KKEGMSLSFNRKIFNSIGHWIPMLSLIALGYVPADNAPLAVTLLTLTVGISGATYLGFQV  400

Query  440  NNQDLSPNFAGFIYGIMNTVGCASGMI--ISPMVEEIAGKYGNPIDRWQTLFWIGSGVCI  497
            N+ DLSPN+AG + GI N   CA+ ++  I+P++          +  W+ +F + +    
Sbjct  401  NHIDLSPNYAGTLMGITN---CAANVMSGIAPVIVGQIVVDETSVTEWRLVFLLAAAFYF  457

Query  498  ICMIIFLLGGSGNIQSWNEIR-TQPDAERG  526
            +  ++F++ G   +Q W+  R  + DAE+G
Sbjct  458  LGNLLFVIFGRTEVQWWDSPRDNKEDAEQG  487


>Q9VPX2_DROME unnamed protein product
Length=512

 Score = 193 bits (490),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 121/425 (28%), Positives = 217/425 (51%), Gaps = 9/425 (2%)

Query  103  VRRNNDKGKIRPTNIELFNGLPFDWRPEIRGQLIAAYSYGNVPGNFIGGLMAVKWGAKQS  162
            V   N  G       ++ +G PFDW   ++G L++ Y +G +        +A  + AK  
Sbjct  79   VEECNPPGGASNVTAKVEDG-PFDWSEPLQGTLLSCYFWGYLVSQIPLAHVAENFSAKWV  137

Query  163  ILWTSIVAAIVSLISPILAQLHWGVLLFSRIIIGVTGGVTFPACHSLVAQWAPPNEKARF  222
            +L++  +  + +L++P+  +LH+G L+  R++ GV GG +FPA H ++A WAPP E  R 
Sbjct  138  MLFSVAINVVCTLLTPVFTELHYGGLILMRVLEGVGGGASFPAMHVMIASWAPPTE--RM  195

Query  223  VWSLL---GGTFGTILTYPMVAGIAENIHWENGWYIPSLLMMIWIFFWAVVTYDTPAEHP  279
            V S +   G + GT L+  +    +    WE+ +Y+   L  IW+  W ++  D P +  
Sbjct  196  VMSTIIYVGTSAGTALSILLAGVCSAQWGWESVFYVMGALSCIWMLLWVILVQDNPNKQR  255

Query  280  GISDEEKEYIQSSQAGTVRKEKPSLKETPVKEIFTSIPFLSLVCCHFGNLFLLFFYQNAM  339
             IS EE++ I SS  GT +K +      P  ++FTS+PF +++  H  + F  + +   +
Sbjct  256  FISLEERQMITSS-LGTEQKTEHH-PAVPWGKVFTSVPFWAILIAHTCSNFGWYMFLIEI  313

Query  340  MLYLTKALGFELTKGGIAASLPWACRMLFGFFFSWAGDTLKRKGTVSVTMIRKGATFFSH  399
              Y+ + L F +      ++LP+   ++F        D+L+ KG ++ T+ RK AT    
Sbjct  314  PFYMKQVLKFNVASNAALSALPYFPMIIFSICLGKLLDSLQAKGKITTTVARKTATSICT  373

Query  400  FLPGIFLILVGYVGCDLILANVFLVLALGFNGAASISNLSNNQDLSPNFAGFIYGIMNTV  459
             +PG+ L+++ Y+GC    A   + + +   G+     LSN+ D++PNFAG +  + NT 
Sbjct  374  LIPGVCLLVLCYIGCRHYEAVSVMSVGIVAMGSMFSGFLSNHIDIAPNFAGTLVALTNTA  433

Query  460  GCASGMIISPMVEEIAGKYGNPIDRWQTLFWIGSGVCIICMIIFLLGGSGNIQSWNEIRT  519
                G+++ P+      K    I  W+ +F +   +  +  ++F+  GSG+ Q WN+  T
Sbjct  434  ATLPGIVV-PLFVGFVTKGNQNIGAWRIIFGVTIVLFALEFLVFVFLGSGSEQPWNKAGT  492

Query  520  QPDAE  524
              D E
Sbjct  493  PKDPE  497


>Q9VR44_DROME unnamed protein product
Length=493

 Score = 184 bits (467),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 123/459 (27%), Positives = 231/459 (50%), Gaps = 14/459 (3%)

Query  66   RRAISWLDPGAYLEDYILSERIEATQNAVDPMAHNIRVRRNND--------KGKIRPTNI  117
            R+ ++ L    ++ +Y L  R+  T   VD +  N+    N               P  +
Sbjct  19   RQVLNLLTMLGFMLNYAL--RVNLTIAIVDMVRPNVTSAVNATLVGNSTAANSTASPDGV  76

Query  118  ELFNGLPFDWRPEIRGQLIAAYSYGNVPGNFIGGLMAVKWGAKQSILWTSIVAAIVSLIS  177
            +++    F W       ++  + +G +     GG +A   G ++    + + A++++LI+
Sbjct  77   DVYEE-RFPWDSYQTNFVLGCFFWGYILTELPGGRLAELIGGRRVFGHSMLWASLLTLIT  135

Query  178  PILAQLHWGVLLFSRIIIGVTGGVTFPACHSLVAQWAPPNEKARFVWSLLGGTFGTILTY  237
            P+ A +++ VL+  R+++G   G ++PA H + A W PP E+++F+ +++  + G  +T 
Sbjct  136  PLAAHINYVVLIVVRVVLGFMLGASWPAIHPVAAVWIPPMERSKFMSNMMASSLGAAITM  195

Query  238  PMVAGIAENIHWENGWYIPSLLMMIWIFFWAVVTYDTPAEHPGISDEEKEYIQSSQAGTV  297
            P+   +     W + +Y+   + ++W   W    Y+TPA HP IS EE+  I+ +   T 
Sbjct  196  PICGYLISVAGWASVFYLTGAVGLLWSLAWFTFVYETPATHPRISAEERREIEEAIGTTT  255

Query  298  RKEKPSLKETPVKEIFTSIPFLSLVCCHFGNLFLLFFYQNAMMLYLTKALGFELTKGGIA  357
             K++PS    P  ++  S    +++ CH   +F  F   N +  +++K L F++ + G+ 
Sbjct  256  SKKRPS--HVPWGQLLCSPAVWAIIICHGLAVFGFFTVVNQLPTFMSKILHFDIKQNGLF  313

Query  358  ASLPWACRMLFGFFFSWAGDTLKRKGTVSVTMIRKGATFFSHFLPGIFLILVGYVGCDLI  417
            +SLP+  + +     S+  D L++KGT+S T  RK  T F+  +PG+ +I+  ++G D  
Sbjct  314  SSLPYLGKYVMAVASSYLADYLRKKGTLSTTATRKLFTTFALVIPGLLMIVQVFLGYDAT  373

Query  418  LANVFLVLALGFNGAASISNLSNNQDLSPNFAGFIYGIMNTVGCASGMIISPMVEEIAGK  477
             +     LAL  +GA +   L N  D++PNF G I+G+ NT+    G + + MV  +  K
Sbjct  374  WSVTIFSLALFAHGAVTAGYLGNGLDIAPNFGGTIFGLANTLSSFGGFLSTSMVGALTYK  433

Query  478  YGNPIDRWQTLFWIGSGVCIICMIIFLLGGSGNIQSWNE  516
                   WQ +FWI +   I   ++F + GSG +Q WN 
Sbjct  434  -DQSFHSWQIVFWILAATYISAAVVFAILGSGELQPWNN  471



Lambda      K        H
   0.322    0.136    0.412 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7723295310


Query= XP_050469407.1 uncharacterized protein LOC126863365 [Bombus huntii]

Length=515
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TAF6_DROME  unnamed protein product                                   45.8    8e-05
Q9VPT4_DROME  unnamed protein product                                 33.5    0.47 
M9PC25_DROME  unnamed protein product                                 33.1    0.57 


>TAF6_DROME unnamed protein product
Length=606

 Score = 45.8 bits (107),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/90 (29%), Positives = 44/90 (49%), Gaps = 10/90 (11%)

Query  40   LSTDWISAIGEELGMHPLPDSLLKRLAEDASYRLREVLHKCVTRLKHSKRKRLTSTDVNA  99
            +S + +  I E +G+  L D   K LAED S +L+ ++      + H+KR++L+      
Sbjct  21   ISAESMKVIAESIGVGSLSDDAAKELAEDVSIKLKRIVQDAAKFMNHAKRQKLS------  74

Query  100  VITNLCDVDPVLGAPESLPEYHTEAKVFVP  129
                + D+D  L      P+Y   AK F+P
Sbjct  75   ----VRDIDMSLKVRNVEPQYGFVAKDFIP  100


>Q9VPT4_DROME unnamed protein product
Length=717

 Score = 33.5 bits (75),  Expect = 0.47, Method: Compositional matrix adjust.
 Identities = 28/98 (29%), Positives = 48/98 (49%), Gaps = 4/98 (4%)

Query  21   NGDSNSNNTNDNNTRRYAVLSTDWISAIGEELGMH--PLPDSLLKRLAEDASYRLREVLH  78
              +++ N++   + + YA      I    E+       L   +  RLAEDASY++ E+++
Sbjct  109  GAEASGNSSRMGHQKSYAGFDPRSIKIFWEQHDQTDVELSQDVCARLAEDASYKVWELIN  168

Query  79   KCVTRLKHSKRKRLTSTDVNAVITNLCDVDPVLGAPES  116
                  +HS    +T   VN V+ +  DV P+LGA +S
Sbjct  169  NVKIYSRHSG-GVVTYDLVNEVLKD-ADVPPMLGAMDS  204


>M9PC25_DROME unnamed protein product
Length=714

 Score = 33.1 bits (74),  Expect = 0.57, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 35/60 (58%), Gaps = 2/60 (3%)

Query  57   LPDSLLKRLAEDASYRLREVLHKCVTRLKHSKRKRLTSTDVNAVITNLCDVDPVLGAPES  116
            L   +  RLAEDASY++ E+++      +HS    +T   VN V+ +  DV P+LGA +S
Sbjct  144  LSQDVCARLAEDASYKVWELINNVKIYSRHSG-GVVTYDLVNEVLKD-ADVPPMLGAMDS  201



Lambda      K        H
   0.322    0.136    0.412 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7723295310


Query= XP_050469408.1 arginyl-tRNA--protein transferase 1 isoform X1
[Bombus huntii]

Length=479
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ATE1_DROME  unnamed protein product                                   318     1e-103
ATE1_DICDI  unnamed protein product                                   147     5e-38 


>ATE1_DROME unnamed protein product
Length=484

 Score = 318 bits (814),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 199/483 (41%), Positives = 272/483 (56%), Gaps = 39/483 (8%)

Query  1    MGTHRLTVQDYQALVDRGWRRCGSYCYKSTMDQTCCPMYTIKCEALQFKISKSQKKVLKR  60
            M  ++L  +DYQ L+DRGWRRCG YCYK    +TCCP YTIKC  L+FK+SKS K++L+R
Sbjct  30   MHAYQLDCRDYQDLIDRGWRRCGYYCYKLRNQETCCPCYTIKCNGLEFKLSKSNKRILRR  89

Query  61   MAKFLRNELHKDDTMDTYDGDFHNNID----IEEIPNHNKHFLKVDKDISDMNVKFISDE  116
            + +FLR+   ++   +  DGD   + D      E+          DK    +NV+ ++  
Sbjct  90   INRFLRDG-KRESKPEAGDGDGEADADYAIVAPEVTASEPQPQLPDKSPPVINVEQVASL  148

Query  117  VNARLHPSTSDRGQKKHGLENKKHNSESVPAASSYNNDSHSTPQSLQSVEMNPTRIPCMK  176
              A+  P+             K+  + +V A +  +N S     S  +   N    PC K
Sbjct  149  ATAQRKPT-------------KQATAAAVEAPTLGSNKSSLLSSSAAAPISNK---PCKK  192

Query  177  AKLLRKQRKQNKLMTQGKTQEEIEAIFKENKQENQAKSLEQIFDEVYNGTNRLELKLVRT  236
            AK +R  R+  KL          ++     K   Q K+L   F    + TN+  LKL   
Sbjct  193  AKQMRLDRRLAKLG---------DSASYSTKSLTQEKTLRD-FLNTDSETNKHRLKLRLI  242

Query  237  SPMSSGYLNTSKQSYEVYKKYQTTIHGVLAEKVTEMQYMGFLVNSPLQPWTPDDGPPSGY  296
                  +  T  QS+ +YKKYQ +IH    +   +  Y   L  +PLQ   P DGP  GY
Sbjct  243  HVYDDEFRRTLPQSFALYKKYQISIHNDPPKD--QDAYKEHLQATPLQNEKPWDGPEMGY  300

Query  297  GSFHEQYWLDNELIAVGVIDILPSCVSSVYFFYDPAYSHLSLGTFSSLREVYLTRQLNKI  356
            GSFH+QYWLD++LIAVGVIDILP CVSSVYFFYDP YS LSLGT+ SLRE+ L + L + 
Sbjct  301  GSFHQQYWLDDKLIAVGVIDILPGCVSSVYFFYDPDYSFLSLGTYGSLREIELVQSLAEK  360

Query  357  AKDLKYYYMGFYIHSCPKMRYKARMRPSKLLCPETYAWFDIEPCL-LKLDKQKYSRLNDD  415
               LKYYYMGFYIHSCPKMRYK ++ PS LLCPETY W  +   +  KLD+ KY RLN+D
Sbjct  361  VPSLKYYYMGFYIHSCPKMRYKGKLSPSYLLCPETYEWLPLTDVIRAKLDEHKYQRLNED  420

Query  416  IDA--INEDNIVDIRKV-LILYRQIAMPYEIYKKQAQTITQDEEDEIKEYTSLVGMKCAQ  472
              A  +NE  +  + +V L+L  +    Y+ +++   T++ D  D I EY+ LVG +CA+
Sbjct  421  PAARDVNEFLMEHLDEVKLLLGGRTRTDYKHFRQLRGTVSDD--DIIIEYSKLVGKECAR  478

Query  473  RLL  475
            R+L
Sbjct  479  RML  481


>ATE1_DICDI unnamed protein product
Length=629

 Score = 147 bits (370),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 91/123 (74%), Gaps = 3/123 (2%)

Query  292  PPSGYGSFHEQYWLDNELIAVGVIDILPSCVSSVYFFYDPAYSHLSLGTFSSLREVYLTR  351
            P  GYGSFH+ Y LD +L+ VGVIDILP C+SSVYFFYDP ++ LSLG +S+L E+   +
Sbjct  436  PKPGYGSFHQYYRLDGKLVGVGVIDILPECLSSVYFFYDPDFNFLSLGKYSALNEIEWVQ  495

Query  352  QLNKIAKDLKYYYMGFYIHSCPKMRYKARMRPSKLLCPETYAWFDIEPCL--LKLDKQKY  409
            ++++    LKYYYMG+YIHSC KM+YKA  +PS+LLC ET+ W + +  +  L+ DK KY
Sbjct  496  KVSQSIPQLKYYYMGYYIHSCQKMKYKANYQPSQLLCLETFKWVEFKKAISFLQPDK-KY  554

Query  410  SRL  412
            SR 
Sbjct  555  SRF  557


 Score = 68.9 bits (167),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 82/325 (25%), Positives = 139/325 (43%), Gaps = 45/325 (14%)

Query  1    MGTHRLTVQDYQALVDRGWRRCGSYCYK--STMDQTCCPMYTIKCEALQFKISKSQKKVL  58
            M   +LT +DYQ L+D+GWRR G++ YK  ++  +TCCP YTI+ +   FK SK  K  +
Sbjct  43   MVADQLTCEDYQLLIDQGWRRSGTFLYKPNNSDKKTCCPQYTIRLDTSSFKPSKDNKSTI  102

Query  59   KRMAKFLRNEL--HKDDTMDTYDGDFHNNIDIEEIPNHNKHFLKVDKDISDMNVKFISDE  116
            K+   ++ N +   KD +  +   D  N   I+    +N +    D++I  +N   I   
Sbjct  103  KKFNNYILNNIIKEKDSSTTSTTKDIINTTQIKSNTKNNNN-KTNDENIIKLNNDIIEII  161

Query  117  VNARLHPSTSDRGQK--KHGLENKKHNSESVPAASSYNNDSHSTPQSLQSVEMNPTRIPC  174
            +N       +++ +K  K  L+ K ++++ +    SY         SL     N  R   
Sbjct  162  LNNEFINKFNEQDKKILKENLKIKINSNKMIKETGSY---------SLSFGIFNKYRSEL  212

Query  175  MKAKLLRKQRKQNKLMTQGKTQEEIEAIFKENKQENQAKSLE-----QIFDE--------  221
             +  +   Q     ++   KT    +  F   K +N   + +     QI ++        
Sbjct  213  NQHSITIDQIINFTILEFNKTINNSDYQFNLEKGQNNHINFKMINSSQILNDSTKTKTLN  272

Query  222  VYNGTNRLELKLVRTSPMSSGYLNTSKQSYEV--------------YKKYQTTIHGVLAE  267
            + N +N+       T+  ++   N  K  +E+              Y KYQ  IH    E
Sbjct  273  IQNNSNKNSTTTATTATTTTTTTNEPKHKFEISIHKPKCTDEVFSLYCKYQKIIHKEDDE  332

Query  268  KVTEMQYMGFLVNSPLQPWT-PDDG  291
            K T+  +  FLV+SPL P   PD+ 
Sbjct  333  K-TKSGFKRFLVDSPLIPIIHPDES  356



Lambda      K        H
   0.322    0.136    0.412 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7723295310


Query= XP_050469409.1 arginyl-tRNA--protein transferase 1 isoform X2
[Bombus huntii]

Length=477
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ATE1_DROME  unnamed protein product                                   332     3e-109
ATE1_DICDI  unnamed protein product                                   147     3e-38 


>ATE1_DROME unnamed protein product
Length=484

 Score = 332 bits (852),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 199/482 (41%), Positives = 279/482 (58%), Gaps = 39/482 (8%)

Query  1    MGTHRLTVQDYQALVDRGWRRCGSYCYKSTMDQTCCPMYTIKCEALQFKISKSQKKVLKR  60
            M  ++L  +DYQ L+DRGWRRCG YCYK    +TCCP YTIKC  L+FK+SKS K++L+R
Sbjct  30   MHAYQLDCRDYQDLIDRGWRRCGYYCYKLRNQETCCPCYTIKCNGLEFKLSKSNKRILRR  89

Query  61   MAKFLRNELHKDDTMDTYDGDFHNNID----IEEIPNHNKHFLKVDKDISDMNVKFISDE  116
            + +FLR+   ++   +  DGD   + D      E+          DK    +NV+ ++  
Sbjct  90   INRFLRDG-KRESKPEAGDGDGEADADYAIVAPEVTASEPQPQLPDKSPPVINVEQVASL  148

Query  117  VNARLHPSTSDRGQKKHGLENKKHNSESVPAASSYNNDSHSTPQSLQSVEMNPTRIPCMK  176
              A+  P+             K+  + +V A +  +N S     S  +   N    PC K
Sbjct  149  ATAQRKPT-------------KQATAAAVEAPTLGSNKSSLLSSSAAAPISNK---PCKK  192

Query  177  AKLLRKQRKQNKLMTQGKTQEEIEAIFKENKQENQAKSLEQIFD-EVYNGTNRLEMKLVR  235
            AK +R  R+  KL          ++     K   Q K+L    + +     +RL+++L+ 
Sbjct  193  AKQMRLDRRLAKLG---------DSASYSTKSLTQEKTLRDFLNTDSETNKHRLKLRLIH  243

Query  236  TMSDEFIKTLKISANLFKKYQMTIHGETEKESDDKSFFNFLVKSSLQPWTPDDGPPSGYG  295
               DEF +TL  S  L+KKYQ++IH +  K+ D  ++   L  + LQ   P DGP  GYG
Sbjct  244  VYDDEFRRTLPQSFALYKKYQISIHNDPPKDQD--AYKEHLQATPLQNEKPWDGPEMGYG  301

Query  296  SFHEQYWLDNELIAVGVIDILPSCVSSVYFFYDPAYSHLSLGTFSSLREVYLTRQLNKIA  355
            SFH+QYWLD++LIAVGVIDILP CVSSVYFFYDP YS LSLGT+ SLRE+ L + L +  
Sbjct  302  SFHQQYWLDDKLIAVGVIDILPGCVSSVYFFYDPDYSFLSLGTYGSLREIELVQSLAEKV  361

Query  356  KDLKYYYMGFYIHSCPKMRYKARMRPSKLLCPETYAWFDIEPCL-LKLDKQKYSRLNDDI  414
              LKYYYMGFYIHSCPKMRYK ++ PS LLCPETY W  +   +  KLD+ KY RLN+D 
Sbjct  362  PSLKYYYMGFYIHSCPKMRYKGKLSPSYLLCPETYEWLPLTDVIRAKLDEHKYQRLNEDP  421

Query  415  DA--INEDNIVDIRKV-LILYRQIAMPYEIYKKQAQTITQDEEDEIKEYTSLVGMKCAQR  471
             A  +NE  +  + +V L+L  +    Y+ +++   T++ D  D I EY+ LVG +CA+R
Sbjct  422  AARDVNEFLMEHLDEVKLLLGGRTRTDYKHFRQLRGTVSDD--DIIIEYSKLVGKECARR  479

Query  472  LL  473
            +L
Sbjct  480  ML  481


>ATE1_DICDI unnamed protein product
Length=629

 Score = 147 bits (371),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 91/123 (74%), Gaps = 3/123 (2%)

Query  290  PPSGYGSFHEQYWLDNELIAVGVIDILPSCVSSVYFFYDPAYSHLSLGTFSSLREVYLTR  349
            P  GYGSFH+ Y LD +L+ VGVIDILP C+SSVYFFYDP ++ LSLG +S+L E+   +
Sbjct  436  PKPGYGSFHQYYRLDGKLVGVGVIDILPECLSSVYFFYDPDFNFLSLGKYSALNEIEWVQ  495

Query  350  QLNKIAKDLKYYYMGFYIHSCPKMRYKARMRPSKLLCPETYAWFDIEPCL--LKLDKQKY  407
            ++++    LKYYYMG+YIHSC KM+YKA  +PS+LLC ET+ W + +  +  L+ DK KY
Sbjct  496  KVSQSIPQLKYYYMGYYIHSCQKMKYKANYQPSQLLCLETFKWVEFKKAISFLQPDK-KY  554

Query  408  SRL  410
            SR 
Sbjct  555  SRF  557


 Score = 68.2 bits (165),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 48/79 (61%), Gaps = 2/79 (3%)

Query  1    MGTHRLTVQDYQALVDRGWRRCGSYCYK--STMDQTCCPMYTIKCEALQFKISKSQKKVL  58
            M   +LT +DYQ L+D+GWRR G++ YK  ++  +TCCP YTI+ +   FK SK  K  +
Sbjct  43   MVADQLTCEDYQLLIDQGWRRSGTFLYKPNNSDKKTCCPQYTIRLDTSSFKPSKDNKSTI  102

Query  59   KRMAKFLRNELHKDDTMDT  77
            K+   ++ N + K+    T
Sbjct  103  KKFNNYILNNIIKEKDSST  121



Lambda      K        H
   0.322    0.136    0.412 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7723295310


Query= XP_050469410.1 arginyl-tRNA--protein transferase 1 isoform X3
[Bombus huntii]

Length=564
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ATE1_DROME  unnamed protein product                                   333     3e-108
ATE1_DICDI  unnamed protein product                                   147     2e-37 


>ATE1_DROME unnamed protein product
Length=484

 Score = 333 bits (853),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 217/564 (38%), Positives = 291/564 (52%), Gaps = 92/564 (16%)

Query  5    SYSIVEYYGEQDGYKCGYCKSPNTNFSHGMGTHRLTVQDYQALVDRGWRRCGSYCYKSTM  64
            S SIV YYG Q   KCGYC   N + SHGM  ++L  +DYQ L+DRGWRRCG YCYK   
Sbjct  2    SLSIVSYYGSQQS-KCGYCAGANCSLSHGMHAYQLDCRDYQDLIDRGWRRCGYYCYKLRN  60

Query  65   DQTCCPMYTIKCEALQFKISKSQKKVLKRMAKFLRNELHKDDTMDTYDGDFHNNID----  120
             +TCCP YTIKC  L+FK+SKS K++L+R+ +FLR+   ++   +  DGD   + D    
Sbjct  61   QETCCPCYTIKCNGLEFKLSKSNKRILRRINRFLRDG-KRESKPEAGDGDGEADADYAIV  119

Query  121  IEEIPNHNKHFLKVDKDISDMNVKFISDEVNARLHPSTSDRGQKKHGLENKKHNSESVPA  180
              E+          DK    +NV+ ++    A+  P+             K+  + +V A
Sbjct  120  APEVTASEPQPQLPDKSPPVINVEQVASLATAQRKPT-------------KQATAAAVEA  166

Query  181  ASSYNNDSHSTPQSLQSVEMNPTRIPCMKAKLLRKQRKQNKLMTQGKTQEEIEAIFKENK  240
             +  +N S     S  +   N    PC KAK +R  R+  KL          ++     K
Sbjct  167  PTLGSNKSSLLSSSAAAPISNK---PCKKAKQMRLDRRLAKLG---------DSASYSTK  214

Query  241  QENQAKSLEQIFDEVYNGTNRLELKLVRTSPMSSGYLNTSKQSYEVYKKYQTTIHGVLAE  300
               Q K+L   F    + TN+  LKL         +  T  QS+ +YKKYQ +IH     
Sbjct  215  SLTQEKTLRD-FLNTDSETNKHRLKLRLIHVYDDEFRRTLPQSFALYKKYQISIH-----  268

Query  301  KVTEMQYMGFLVNSPLQMKLVRTMSDEFIKTLKISANLFKKYQMTIHGETEKESDDKSFF  360
                        N P                                       D  ++ 
Sbjct  269  ------------NDP-------------------------------------PKDQDAYK  279

Query  361  NFLVKSSLQPWTPDDGPPSGYGSFHEQYWLDNELIAVGVIDILPSCVSSVYFFYDPAYSH  420
              L  + LQ   P DGP  GYGSFH+QYWLD++LIAVGVIDILP CVSSVYFFYDP YS 
Sbjct  280  EHLQATPLQNEKPWDGPEMGYGSFHQQYWLDDKLIAVGVIDILPGCVSSVYFFYDPDYSF  339

Query  421  LSLGTFSSLREVYLTRQLNKIAKDLKYYYMGFYIHSCPKMRYKARMRPSKLLCPETYAWF  480
            LSLGT+ SLRE+ L + L +    LKYYYMGFYIHSCPKMRYK ++ PS LLCPETY W 
Sbjct  340  LSLGTYGSLREIELVQSLAEKVPSLKYYYMGFYIHSCPKMRYKGKLSPSYLLCPETYEWL  399

Query  481  DIEPCL-LKLDKQKYSRLNDDIDA--INEDNIVDIRKV-LILYRQIAMPYEIYKKQAQTI  536
             +   +  KLD+ KY RLN+D  A  +NE  +  + +V L+L  +    Y+ +++   T+
Sbjct  400  PLTDVIRAKLDEHKYQRLNEDPAARDVNEFLMEHLDEVKLLLGGRTRTDYKHFRQLRGTV  459

Query  537  TQDEEDEIKEYTSLVGMKCAQRLL  560
            + D  D I EY+ LVG +CA+R+L
Sbjct  460  SDD--DIIIEYSKLVGKECARRML  481


>ATE1_DICDI unnamed protein product
Length=629

 Score = 147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 91/123 (74%), Gaps = 3/123 (2%)

Query  377  PPSGYGSFHEQYWLDNELIAVGVIDILPSCVSSVYFFYDPAYSHLSLGTFSSLREVYLTR  436
            P  GYGSFH+ Y LD +L+ VGVIDILP C+SSVYFFYDP ++ LSLG +S+L E+   +
Sbjct  436  PKPGYGSFHQYYRLDGKLVGVGVIDILPECLSSVYFFYDPDFNFLSLGKYSALNEIEWVQ  495

Query  437  QLNKIAKDLKYYYMGFYIHSCPKMRYKARMRPSKLLCPETYAWFDIEPCL--LKLDKQKY  494
            ++++    LKYYYMG+YIHSC KM+YKA  +PS+LLC ET+ W + +  +  L+ DK KY
Sbjct  496  KVSQSIPQLKYYYMGYYIHSCQKMKYKANYQPSQLLCLETFKWVEFKKAISFLQPDK-KY  554

Query  495  SRL  497
            SR 
Sbjct  555  SRF  557


 Score = 74.3 bits (181),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 60/109 (55%), Gaps = 6/109 (6%)

Query  7    SIVEYYGEQDGYKCGYCKS---PNTNFSHGMGTHRLTVQDYQALVDRGWRRCGSYCYK--  61
            S++  +G  D   C YC +         +GM   +LT +DYQ L+D+GWRR G++ YK  
Sbjct  14   SLIYPHGSYDS-SCNYCDAGEDKKGRICYGMVADQLTCEDYQLLIDQGWRRSGTFLYKPN  72

Query  62   STMDQTCCPMYTIKCEALQFKISKSQKKVLKRMAKFLRNELHKDDTMDT  110
            ++  +TCCP YTI+ +   FK SK  K  +K+   ++ N + K+    T
Sbjct  73   NSDKKTCCPQYTIRLDTSSFKPSKDNKSTIKKFNNYILNNIIKEKDSST  121



Lambda      K        H
   0.322    0.136    0.412 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7723295310


Query= XP_050469411.1 la-related protein 6 [Bombus huntii]

Length=547
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A1Z9R1_DROME  unnamed protein product                                 243     1e-70
Q54TG6_DICDI  unnamed protein product                                 88.6    7e-19
Q38C07_TRYB2  unnamed protein product                                 79.7    5e-16


>A1Z9R1_DROME unnamed protein product
Length=867

 Score = 243 bits (619),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 172/453 (38%), Positives = 243/453 (54%), Gaps = 78/453 (17%)

Query  96   KDQKQPTSTEVSTTTQ--------DDFVPPSDELAEKICAQVEFYFSDENIVKDAFLLKH  147
            K+Q+ P   E  T  Q        D  + PS+ELA +I   VEFYFS+E+I+KDAFLLKH
Sbjct  248  KEQEVPVHQEQDTEPQGPNEIDTLDPSLIPSEELAAEITDAVEFYFSNESILKDAFLLKH  307

Query  148  VKRNKEGYVSLKLISSFKRVKHLSRDWRVVGAALA-KSKKLQVNPQGTKLRRVDPLPPFD  206
            V+RNKEG+VSLKL+SSFKRV+ L+R+W+VVG A+  KS+K+++N  GTK+RR++PLP FD
Sbjct  308  VRRNKEGFVSLKLVSSFKRVRQLTREWKVVGDAVRRKSRKIELNDVGTKVRRIEPLPSFD  367

Query  207  QTTPSRTILAARLPVEKLSVESVAEIFRPCGEIALIRVLRPGHPAPAEVRQAIAKRPELA  266
            +T PSRTI+A  LP++KL++E V+++F PCGEIALIR+L+PG   P +VRQ + K PEL 
Sbjct  368  ETMPSRTIVACDLPLDKLTIEKVSDLFSPCGEIALIRILKPGMAIPVDVRQFMNKYPEL-  426

Query  267  SSEECAMVEFTDSASARTALQMTLGDAKVFELQQSSDKKRKQQPAKKSA--LTRLTKEEA  324
              +ECA+VE+ +S+SAR A  +  G  +V+E+     K  K+    + A  + R+ +   
Sbjct  427  QQKECALVEYLESSSARDARHLN-GPFQVYEMVAPKKKTGKKAAVIQIAAPVARMVENYR  485

Query  325  YNSSS--------CASGSET-EDGRARHKKPIHGY---------PMYHAYPGHPFQ----  362
            Y + +          SG ET  D R + K+    +         P YHA P   +Q    
Sbjct  486  YYNDANYERSRGGSFSGHETVPDLRFKLKRNNSDFQPSYYQQTGPSYHANPYQHYQPRGS  545

Query  363  --------GPPSPDAWLSRRLSACSVSGSENGFILRRLSSCS------GSGSGSETGSFG  408
                    GP     +  RR S  S   +     L  +S  S      G+   S   S  
Sbjct  546  IGNQNQEVGPNGFFGYGPRRYSNTSTISANTAAALGDVSPISSAVNSGGNPMVSGISSLQ  605

Query  409  RRYSACSSGSETGYCHPVFPPSYYYQENRRFSCCSSSG-------SECSGVCYHSSRRGS  461
            RR S CS  + T   +P          +RR S CS +G       S CS  C        
Sbjct  606  RRLSNCSEQNYTPEVNPSM--------SRRASNCSETGGVPQRRDSNCSESC--------  649

Query  462  ADYGPFLRRLSACSRDSAFDAGSRRLSLCSSGS  494
                P  RR+S  ++ +  D   R+ S+CS+GS
Sbjct  650  ----PCSRRVSDFAQTT--DTSYRKTSVCSNGS  676


 Score = 36.6 bits (83),  Expect = 0.061, Method: Compositional matrix adjust.
 Identities = 69/251 (27%), Positives = 92/251 (37%), Gaps = 97/251 (39%)

Query  365  PSPDAWLSRRLSACSVSGSENGFILRRLSSCSGS--------GSGSETGSFGRRYSACSS  416
            P  +  +SRR S CS +G   G   RR S+CS S             T +  R+ S CS+
Sbjct  618  PEVNPSMSRRASNCSETG---GVPQRRDSNCSESCPCSRRVSDFAQTTDTSYRKTSVCSN  674

Query  417  GSETGYCHPVFPPSYYYQENRRFSCCS-------SSGSECSGVCYHSS------------  457
            GS    C     P     + RRFS  S       S+ SE SG     S            
Sbjct  675  GS----C-----PGNNQNQERRFSNGSMQFERTFSNASESSGFYRRPSNDFNIEREPIQT  725

Query  458  ---------------RRGSADYGPFLRRLSACSRDSAFDAGSRRLSL-------CSSGSE  495
                           RR S ++     +L+A   D+A   G RR+S        CS GSE
Sbjct  726  DQLVGGGGGGYQVWPRRYSNNFQQLSSKLAAY--DNAQYIGGRRISTDSGYDRRCSFGSE  783

Query  496  ---------QGSYC-------------RPRSNSGIALTHLP------------ENVTRMP  521
                      GS+              +PRS +G  L   P            E++ R P
Sbjct  784  GFEGSPRSRTGSFLSNYKHGGGDGYDGQPRSRTGSFLDGSPRSRSGSFAQRAAESLVRTP  843

Query  522  SGPDGTRGFGR  532
             GPDG++GFG+
Sbjct  844  MGPDGSKGFGQ  854


>Q54TG6_DICDI unnamed protein product
Length=354

 Score = 88.6 bits (218),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 75/127 (59%), Gaps = 3/127 (2%)

Query  118  SDELAEKICAQVEFYFSDENIVKDAFLLKHVKRNKEGYVSLKLISSFKRVKHLSRDWRVV  177
            S+E + +I  QVE+YFSD N  +D FL     +N + Y+S+ +I+SF R+K +S D +++
Sbjct  2    SEETSTQILKQVEYYFSDSNFPRDKFLRSEAAKNVDNYISIDVIASFNRMKTISTDLQLI  61

Query  178  GAALAKSKKLQVNPQGTKLRRVDPLPPFDQTTPSRTILAARLPVEKLSVESVAEIFRPCG  237
              AL KS +LQV+  G  +RR+DPLP  +     +T+ +   P E  ++E V E F   G
Sbjct  62   TEALKKSTRLQVSEDGKMVRRLDPLP--ENIDCGKTLYSKGWP-EDTTIEKVQEFFNANG  118

Query  238  EIALIRV  244
               ++ V
Sbjct  119  GYKVVSV  125


>Q38C07_TRYB2 unnamed protein product
Length=335

 Score = 79.7 bits (195),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 56/159 (35%), Positives = 83/159 (52%), Gaps = 4/159 (3%)

Query  115  VPPSDELAEKICAQVEFYFSDENIVKDAFLLKHVKRNKEGYVSLKLISSFKRVKHLSRDW  174
            +P S E  +K+  QVEFYFSD N+ +D FL   +  N EG+VSL+ + +FKRV  ++ D 
Sbjct  1    MPLSSENKQKLQKQVEFYFSDVNVQRDIFLKGKMAENAEGFVSLETLLTFKRVNSVTTDV  60

Query  175  RVVGAALAKSKKLQVNPQGTKLRRVDPLPPFDQTTPSRTILAARLPVEKLSVESVAEIFR  234
            + V  A+  S+KL ++  G  +RR DPLP   QT   +T+    +P    ++E + E F 
Sbjct  61   KEVVEAIRPSEKLVLSEDGLMVRRRDPLPESIQTD-HQTVYVKPVP-PTATLEQLTEFFS  118

Query  235  PCGEIALI--RVLRPGHPAPAEVRQAIAKRPELASSEEC  271
              G +  +  R       AP E R   +      SSEE 
Sbjct  119  KHGTVQAVWRRYFAGKKDAPPESRTKPSVFVVFNSSEEA  157



Lambda      K        H
   0.322    0.136    0.412 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7723295310


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Oct 18, 2022  4:55 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_050469412.1 FAS-associated factor 2 [Bombus huntii]

Length=434
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7JUP3_DROME  unnamed protein product                                 70.5    8e-13
A0A0B4LFH2_DROME  unnamed protein product                             70.5    1e-12
Q38CY2_TRYB2  unnamed protein product                                 60.8    5e-10


>Q7JUP3_DROME unnamed protein product
Length=695

 Score = 70.5 bits (171),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 75/333 (23%), Positives = 152/333 (46%), Gaps = 39/333 (12%)

Query  125  SSDPVEDVINFIRSYEESYGNSHPVFYQGSYSQA-----LSDAKQELRFLLVYLHKDEAQ  179
            + D +     F+ +Y+  YG   P F+ GS   A     L  AK E + L +YLH  ++ 
Sbjct  367  TDDEISGSTQFVENYKARYGEPCPEFFVGSLENAKQLACLRSAK-ERKLLAIYLHHGKSI  425

Query  180  NVDQWCRNTLGNVEVVQYVNTHTLFWACNVK----------------SGEGYKVAEALKS  223
              + +C   + +  ++Q      + +  ++                 S      A  +K 
Sbjct  426  LSNVFCDQLMKHESIIQTFKEKFVLYGWDMTYESNKDMFLSSLTACISSNASLTARNIKL  485

Query  224  GSYPFLAIIVLRDNRMT-----IVGRMEGTPSPSELISRLQTFIDHNEINL-IQARQERA  277
               P  AI+++  +R       ++  + G     +L++RL    +  E  L ++ RQE  
Sbjct  486  DKLP--AIMLVGKSRQLGSNCEVLSVIHGNIGLDDLLTRLIETCEMFEEQLQVEIRQED-  542

Query  278  ERSAAQSLRQQQDQAYEESLRADQEKDRRREEERRAREEREAREKEQLNAQEMEIQRIRR  337
            ER+A   ++ +QD AY+E+L+AD  KD      +R +E  +  E++++ ++  E +  RR
Sbjct  543  ERAARDQVKAEQDMAYQETLQADMAKD----AAKRQKEAAQLAERKRMESERAE-EDARR  597

Query  338  EKELTVCKVPLEPEPTDPNACHLQIKLGERT---MKRRFLMSDTLEDVYHWIFSQPDSPV  394
            E    V +  L  EP++      +I++ + T   ++RRF +++ L+D+ +++ +      
Sbjct  598  ESIRLVAQQSLPQEPSEQETGTSKIRVRKPTGDFLERRFFINNNLQDLLNFVTANGFLIE  657

Query  395  SFEITTSFPKRILYPCREILTLSDAGLTHREVL  427
             +++ +S+P+R L       TL    L  +E +
Sbjct  658  EYKLISSWPRRDLTAIESSQTLESLKLYPQETV  690


>A0A0B4LFH2_DROME unnamed protein product
Length=690

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 75/333 (23%), Positives = 152/333 (46%), Gaps = 39/333 (12%)

Query  125  SSDPVEDVINFIRSYEESYGNSHPVFYQGSYSQA-----LSDAKQELRFLLVYLHKDEAQ  179
            + D +     F+ +Y+  YG   P F+ GS   A     L  AK E + L +YLH  ++ 
Sbjct  362  TDDEISGSTQFVENYKARYGEPCPEFFVGSLENAKQLACLRSAK-ERKLLAIYLHHGKSI  420

Query  180  NVDQWCRNTLGNVEVVQYVNTHTLFWACNVK----------------SGEGYKVAEALKS  223
              + +C   + +  ++Q      + +  ++                 S      A  +K 
Sbjct  421  LSNVFCDQLMKHESIIQTFKEKFVLYGWDMTYESNKDMFLSSLTACISSNASLTARNIKL  480

Query  224  GSYPFLAIIVLRDNRMT-----IVGRMEGTPSPSELISRLQTFIDHNEINL-IQARQERA  277
               P  AI+++  +R       ++  + G     +L++RL    +  E  L ++ RQE  
Sbjct  481  DKLP--AIMLVGKSRQLGSNCEVLSVIHGNIGLDDLLTRLIETCEMFEEQLQVEIRQED-  537

Query  278  ERSAAQSLRQQQDQAYEESLRADQEKDRRREEERRAREEREAREKEQLNAQEMEIQRIRR  337
            ER+A   ++ +QD AY+E+L+AD  KD      +R +E  +  E++++ ++  E +  RR
Sbjct  538  ERAARDQVKAEQDMAYQETLQADMAKD----AAKRQKEAAQLAERKRMESERAE-EDARR  592

Query  338  EKELTVCKVPLEPEPTDPNACHLQIKLGERT---MKRRFLMSDTLEDVYHWIFSQPDSPV  394
            E    V +  L  EP++      +I++ + T   ++RRF +++ L+D+ +++ +      
Sbjct  593  ESIRLVAQQSLPQEPSEQETGTSKIRVRKPTGDFLERRFFINNNLQDLLNFVTANGFLIE  652

Query  395  SFEITTSFPKRILYPCREILTLSDAGLTHREVL  427
             +++ +S+P+R L       TL    L  +E +
Sbjct  653  EYKLISSWPRRDLTAIESSQTLESLKLYPQETV  685


>Q38CY2_TRYB2 unnamed protein product
Length=315

 Score = 60.8 bits (146),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 69/286 (24%), Positives = 123/286 (43%), Gaps = 47/286 (16%)

Query  153  GSYSQALSDAKQELRFLLVYLHKDEAQNVDQWCRNTLGNVEVVQYVNTHTLFWACNVKSG  212
            G +  AL +A+    +LL+YLH    ++   +    L N  + + + +  + +A +V   
Sbjct  21   GRFKDALDEAQCRPAYLLIYLHCPTHEDTPAFLSEVLPNPPLRELIESRFVLYAASVMEP  80

Query  213  EGYKVAEALKSGSYPFLAIIVLRDNRMTIVGRMEGTPSPSELISRLQTFIDHNEINL---  269
            EGY+++   ++ ++PFLA+ + R+  +T+    +G     +L+   Q   D  +  L   
Sbjct  81   EGYRLSLEFEATTFPFLAVTLRRETVLTV----KGLCCARDLVKYFQAMFDRFDGVLAEE  136

Query  270  IQARQERAERSAAQSLRQQQDQAYEESLRADQEKDRRREEERRAREEREAREK-------  322
            I  R ER ER     +R + D   E  +   Q  DR+R EE     E++ R+K       
Sbjct  137  IHLRHEREER-----MRARTDD--ERHIAEMQAVDRKRIEEF----EKKKRDKVMRLLLE  185

Query  323  ---------------EQLNAQEMEIQRIRREKELTVCKVPLEPE-PTDPNACHLQI----  362
                           ++   +EM IQ  R +   T  ++ L PE P D +          
Sbjct  186  SEEMRRKLEEEEEECDRRQHEEMFIQ-TRSDIARTEAEMRLAPEPPADADVSTTTFISFR  244

Query  363  KLGERTMKRRFLMSDTLEDVYHWIFSQPD-SPVSFEITTSFPKRIL  407
             L  +  KRRF +SD L ++  +  +  D    +F++    P R L
Sbjct  245  SLSGKQSKRRFYLSDRLSNLREYGKTLEDYDGCNFQLVVGHPPRAL  290



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4782626282


Query= XP_050469413.1 RNA-binding protein cabeza-like isoform X1 [Bombus
huntii]

Length=418
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CAZ_DROME  unnamed protein product                                    143     1e-38
CAPR1_DROME  unnamed protein product                                  30.8    2.5  


>CAZ_DROME unnamed protein product
Length=399

 Score = 143 bits (361),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 112/224 (50%), Positives = 136/224 (61%), Gaps = 28/224 (13%)

Query  44   NQYSQPPPSSGSNYGSGYNSYNSSGGQDYNQSQNQNSYPNSYGSGGGSGNGSSGNYSGSY  103
            N ++ PPP    NY            Q  N++ N N  P +YG  GG      G  SGS 
Sbjct  15   NNFAVPPP----NYQ-----------QMPNKTGNYNEPPPNYGKQGG------GYDSGSG  53

Query  104  GHGGGGSGGYNRNSSGGGYGGGQGGGGGSRYGDRGGYSDRSGGSYNSGGGRGGYNKGGYG  163
              G GGS       +GGG GG     GG+ YG+ G   D     +    G GG   GG G
Sbjct  54   HRGSGGS------GNGGGGGGSWNDRGGNSYGNGGASKDSYNKGHGGYSGGGGGGGGGGG  107

Query  164  DRGGGNDGMVTQEDTIFVSGMDPSISEEEICQHFGAIGIIKNDKRTGKPKVWMYKDKNTG  223
               GGND M+TQEDTIFVSGMDPS +E++I  HFGAIGIIK DKRT KPK+W+YK+K TG
Sbjct  108  GGSGGND-MITQEDTIFVSGMDPSTTEQDIETHFGAIGIIKKDKRTMKPKIWLYKNKETG  166

Query  224  KSKGEATVTYDDQNAARSAIDWFDGKEFKGRTIKVQIAQHKSSW  267
             SKGEATVTYDD NAA+SAI+WFDG++F G  IKV +AQ +++W
Sbjct  167  ASKGEATVTYDDTNAAQSAIEWFDGRDFNGNAIKVSLAQRQNNW  210


>CAPR1_DROME unnamed protein product
Length=961

 Score = 30.8 bits (68),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 18/34 (53%), Positives = 22/34 (65%), Gaps = 0/34 (0%)

Query  283  RGSGGFGSRGGGGDRDDHHRGGGGDDRRDGGGRG  316
            R SG +  RGG  D  D  +GG GD+RR+GG RG
Sbjct  804  RNSGNYQRRGGDRDNRDRDQGGRGDERRNGGDRG  837



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4782626282


Query= XP_050469414.1 RNA-binding protein cabeza-like isoform X2 [Bombus
huntii]

Length=417
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CAZ_DROME  unnamed protein product                                    158     4e-44
CAPR1_DROME  unnamed protein product                                  30.8    2.5  


>CAZ_DROME unnamed protein product
Length=399

 Score = 158 bits (399),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 83/96 (86%), Gaps = 0/96 (0%)

Query  171  MVTQEDTIFVSGMDPSISEEEICQHFGAIGIIKNDKRTGKPKVWMYKDKNTGKSKGEATV  230
            M+TQEDTIFVSGMDPS +E++I  HFGAIGIIK DKRT KPK+W+YK+K TG SKGEATV
Sbjct  115  MITQEDTIFVSGMDPSTTEQDIETHFGAIGIIKKDKRTMKPKIWLYKNKETGASKGEATV  174

Query  231  TYDDQNAARSAIDWFDGKEFKGRTIKVQIAQHKSSW  266
            TYDD NAA+SAI+WFDG++F G  IKV +AQ +++W
Sbjct  175  TYDDTNAAQSAIEWFDGRDFNGNAIKVSLAQRQNNW  210


>CAPR1_DROME unnamed protein product
Length=961

 Score = 30.8 bits (68),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 18/34 (53%), Positives = 22/34 (65%), Gaps = 0/34 (0%)

Query  282  RGSGGFGSRGGGGDRDDHHRGGGGDDRRDGGGRG  315
            R SG +  RGG  D  D  +GG GD+RR+GG RG
Sbjct  804  RNSGNYQRRGGDRDNRDRDQGGRGDERRNGGDRG  837



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4782626282


Query= XP_050469415.1 RNA-binding protein cabeza-like isoform X3 [Bombus
huntii]

Length=351
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CAZ_DROME  unnamed protein product                                    152     1e-42
CAPR1_DROME  unnamed protein product                                  35.0    0.097
Q9NLD1_CAEEL  unnamed protein product                                 30.0    3.2  


>CAZ_DROME unnamed protein product
Length=399

 Score = 152 bits (385),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 83/96 (86%), Gaps = 0/96 (0%)

Query  105  MVTQEDTIFVSGMDPSISEEEICQHFGAIGIIKNDKRTGKPKVWMYKDKNTGKSKGEATV  164
            M+TQEDTIFVSGMDPS +E++I  HFGAIGIIK DKRT KPK+W+YK+K TG SKGEATV
Sbjct  115  MITQEDTIFVSGMDPSTTEQDIETHFGAIGIIKKDKRTMKPKIWLYKNKETGASKGEATV  174

Query  165  TYDDQNAARSAIDWFDGKEFKGRTIKVQIAQHKSSW  200
            TYDD NAA+SAI+WFDG++F G  IKV +AQ +++W
Sbjct  175  TYDDTNAAQSAIEWFDGRDFNGNAIKVSLAQRQNNW  210


>CAPR1_DROME unnamed protein product
Length=961

 Score = 35.0 bits (79),  Expect = 0.097, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 28/44 (64%), Gaps = 2/44 (5%)

Query  211  GGGRGRGSGGFGSRGGGGDRDDHHRGGGGDDRRDGGGRGGDWRC  254
            G GR R SG +  RGG  D  D  +GG GD+RR+GG R G++R 
Sbjct  800  GDGR-RNSGNYQRRGGDRDNRDRDQGGRGDERRNGGDR-GNYRS  841


>Q9NLD1_CAEEL unnamed protein product
Length=611

 Score = 30.0 bits (66),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 18/53 (34%), Positives = 30/53 (57%), Gaps = 4/53 (8%)

Query  146  KVW---MYKDKNTGKSKGEATVTYDDQNAARSAIDWFDGKEFK-GRTIKVQIA  194
            K+W   +  D  +G S+G A VTY ++  A +A   +DG E   G+ +KV ++
Sbjct  225  KIWDLRLMMDPMSGASRGYAFVTYCNKEDAAAAAKTYDGHEISTGKPLKVNVS  277



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4782626282


Query= XP_050469416.1 protein MCM10 homolog [Bombus huntii]

Length=713
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MCM10_DROME  unnamed protein product                                  259     2e-75


>MCM10_DROME unnamed protein product
Length=776

 Score = 259 bits (661),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 138/349 (40%), Positives = 214/349 (61%), Gaps = 36/349 (10%)

Query  70   VYDDTLDSSDDEDRRYFEEQKYSNYGRDIKTLLKKET-------IKKDEDR---------  113
            + +  LDSSDDE+ + F E+KY+ YG DI   LK++        + ++ D+         
Sbjct  80   IKEPELDSSDDEEVKNFLERKYNEYGSDINKRLKQQQENAYESKVAREVDQELKKSIHVV  139

Query  114  ------------PLPRKS--SRTFDFSATKTNKNLNTVTNNAIVTAKDVYSDPFFGLRIV  159
                        P+ R+S  S TF           +T  ++A V+A  V++DP FGLR++
Sbjct  140  TSTPQPLKNPHNPIKRQSAVSTTFQRPPPVAAAVASTSQSSAPVSA--VFTDPVFGLRMI  197

Query  160  NPIISSAELKARMSDKVPVTVSRIKYHLNPEKMEKDWVIAGVLINKSTPKTSQKGSTYAI  219
            NP++SS+ L+ RM+ + PV  S + YH+    + KDWVIAG L++K+  K ++KG  Y+ 
Sbjct  198  NPLVSSSLLQERMTGRKPVPFSGVAYHIERGDLAKDWVIAGALVSKNPVKNTKKGDPYST  257

Query  220  WKISDLSDNMNTVCLFMFSNAYKTLWKTTIGTVIGILNPNVLESK-DNSDLATLSVDNPQ  278
            WK+SDL   + T+ LF+F  A+K+LWKT  G  + +LNP + E +  +SD+A LS+D+ Q
Sbjct  258  WKLSDLRGEVKTISLFLFKEAHKSLWKTAEGLCLAVLNPTIFERRAGSSDVACLSIDSSQ  317

Query  279  RVMILGKSKDMGKCKSRKKNGEPCSSIINLSRCEFCLYHIKQEYKKCSRRAELQAFSNTQ  338
            +VMILG+SKD+G C++ KKNG+ C+S++NL+ C++C++H+KQEY K SRR+ELQ  S T 
Sbjct  318  KVMILGQSKDLGTCRATKKNGDKCTSVVNLTDCDYCIFHVKQEYGKMSRRSELQ--SATA  375

Query  339  KFSIDMLKQKPQQKQKSFFNNMPEFNAVVAVKNKKLEEKDAKRLALLSG  387
               I+ L+ K   K + F+     F AV A K+ KL  K+  RL++L+G
Sbjct  376  GRGINELRNKVLGKNEVFYGGQ-TFTAVPARKSAKLITKERDRLSMLAG  423


 Score = 207 bits (527),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 99/187 (53%), Positives = 130/187 (70%), Gaps = 6/187 (3%)

Query  525  EKLKKGKKRPRESENDERQETKKSNVLSDKFKEMMQTKSAHTDLIEKSYEQEQDKYFNKL  584
            EK     KR +  E+D R+  +KS +     +++M   S+HT+L+E    + Q++YFNKL
Sbjct  596  EKFSSSAKRQKIDEDD-RELMRKSRI-----EKIMAATSSHTNLVEMREREAQEEYFNKL  649

Query  585  EMKERMEEKMLTTYKVPCKAVRCLICKYTSFSASEMCKEQNHPLRVADAVKRFFKCGDCG  644
            E KE MEEKMLTTYK+PCKAV C +CKYT+FSAS+ CKEQ HPL+V DA KRFF+C DCG
Sbjct  650  ERKEAMEEKMLTTYKMPCKAVICQVCKYTAFSASDRCKEQKHPLKVVDAEKRFFQCKDCG  709

Query  645  NRTVSLDRIPSHSCIKCSSSNWTRAAMMDERRTNVSVTTLSIRGDEETFIGSTTKDANLN  704
            NRT ++ ++P  SC  C  S W R AM+ E++      TLS+RGDEETF+G     ANLN
Sbjct  710  NRTTTVFKLPKQSCKNCKGSRWQRTAMIREKKILTGRETLSVRGDEETFMGCLAGSANLN  769

Query  705  LLVPDKD  711
            LLVPD++
Sbjct  770  LLVPDEE  776



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4782626282


Query= XP_050469417.1 prohormone-2-like [Bombus huntii]

Length=359


***** No hits found *****



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4782626282


Query= XP_050469418.1 U5 small nuclear ribonucleoprotein 40 kDa protein
isoform X1 [Bombus huntii]

Length=351
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VPL0_DROME  unnamed protein product                                 487     6e-174
WDS_DROME  unnamed protein product                                    148     3e-41 
Q57W14_TRYB2  unnamed protein product                                 140     5e-38 


>Q9VPL0_DROME unnamed protein product
Length=347

 Score = 487 bits (1253),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 216/344 (63%), Positives = 284/344 (83%), Gaps = 2/344 (1%)

Query  6    KRKGDDILALVPASKRTKNEVV-FSSREKAVVQNGPPRTSSLFAPIMLLEGHQGDIFSLE  64
            KR  + ++ L   +KR+KN+++ +++R+KA++++G  RTS+L APIM LEGH+G+IF+ E
Sbjct  4    KRPNNSVI-LAQEAKRSKNDLMAYTNRDKALLESGVRRTSNLQAPIMQLEGHEGEIFTAE  62

Query  65   FHPEGQYLASTGFDRQIFIWNVYGECENISVLTGHSGAIMELHFSPDGNHLYTASTDMTL  124
            FHPEG+ L S+GFDRQI+IW VY +CEN+  ++GHSGA+ME HF+PDG+H++T STD TL
Sbjct  63   FHPEGELLLSSGFDRQIYIWQVYEDCENVMAMSGHSGAVMEAHFTPDGSHIFTCSTDKTL  122

Query  125  GLWDIAAGTRIKKLKGHTSFVNSVSGARRGLTQLCSGSDDSTIRVWDPRKRGQCYTLNNT  184
              WDIA G R ++ KGH +FVNSV G+RRG   LCSGSDD TI++WD RK+   +TL + 
Sbjct  123  AFWDIATGQRQRRFKGHGNFVNSVQGSRRGQQLLCSGSDDRTIKIWDARKKHAAHTLESP  182

Query  185  YQVTAVTFNDTAEQVISGGIDNDIKVWDLRKNSILYKLKGHSDTITGLSLSPDGSYILSN  244
            +QVTAV F DT EQVISGGIDN++K+WD+RK ++L+ L+GHSDTITG+SLSP+G +IL+N
Sbjct  183  FQVTAVCFGDTGEQVISGGIDNEVKIWDIRKQAVLHHLRGHSDTITGMSLSPEGDFILTN  242

Query  245  AVDNTLRIWDVRPFAPYERCVKIISGHQHNFEKNLLRCAWSPDGSKVSAGSSDRFHYIWD  304
            A+DNTLR+WDVRP+AP ERCVK+  GHQHNFEKNLLRCAWSP   K+++GS+DR  YIWD
Sbjct  243  AMDNTLRVWDVRPYAPGERCVKVFQGHQHNFEKNLLRCAWSPGSDKITSGSADRHVYIWD  302

Query  305  TTSRRILYKLPGHNGSVNDIDFHPKEPIVCSGSSDKQIYLGEIE  348
              +RRILYKLPGHNGSVN +DF PKEP++ SGSSDK +YLGEI+
Sbjct  303  VNTRRILYKLPGHNGSVNAVDFSPKEPLILSGSSDKTLYLGEID  346


 Score = 33.9 bits (76),  Expect = 0.20, Method: Compositional matrix adjust.
 Identities = 31/126 (25%), Positives = 50/126 (40%), Gaps = 10/126 (8%)

Query  236  PDGSYILSNAVD---NTLRIWDVRPFAPYERCVKIISGHQ------HNFEKNLLRCAWSP  286
            P+ S IL+       N L  +  R  A  E  V+  S  Q         E  +    + P
Sbjct  6    PNNSVILAQEAKRSKNDLMAYTNRDKALLESGVRRTSNLQAPIMQLEGHEGEIFTAEFHP  65

Query  287  DGSKVSAGSSDRFHYIWDTTSR-RILYKLPGHNGSVNDIDFHPKEPIVCSGSSDKQIYLG  345
            +G  + +   DR  YIW        +  + GH+G+V +  F P    + + S+DK +   
Sbjct  66   EGELLLSSGFDRQIYIWQVYEDCENVMAMSGHSGAVMEAHFTPDGSHIFTCSTDKTLAFW  125

Query  346  EIEAAQ  351
            +I   Q
Sbjct  126  DIATGQ  131


>WDS_DROME unnamed protein product
Length=361

 Score = 148 bits (373),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 97/299 (32%), Positives = 159/299 (53%), Gaps = 17/299 (6%)

Query  53   LEGHQGDIFSLEFHPEGQYLASTGFDRQIFIWNVY-GECENISVLTGHSGAIMELHFSPD  111
            L GH   + +++F P G++LAS+  D+ I IW  Y G+ E    ++GH   I ++ +S D
Sbjct  68   LAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEK--TISGHKLGISDVAWSSD  125

Query  112  GNHLYTASTDMTLGLWDIAAGTRIKKLKGHTSFVNSVSGARRGLTQLCSGSDDSTIRVWD  171
               L + S D TL +W+++ G  +K LKGH+++V   +   +    + SGS D ++R+WD
Sbjct  126  SRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQS-NLIVSGSFDESVRIWD  184

Query  172  PRKRGQCYTLNNTYQ--VTAVTFNDTAEQVISGGIDNDIKVWDLRKNSILYKL-KGHSDT  228
             R  G+C      +   V+AV FN     ++S   D   ++WD      L  L    +  
Sbjct  185  VR-TGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPP  243

Query  229  ITGLSLSPDGSYILSNAVDNTLRIWDVRPFAPYERCVKIISGHQHNFEKNLLRCAWSPDG  288
            ++ +  SP+G YIL+  +DNTL++WD        +C+K  +GH++  EK  +   +S  G
Sbjct  244  VSFVKFSPNGKYILAATLDNTLKLWDYSK----GKCLKTYTGHKN--EKYCIFANFSVTG  297

Query  289  SK-VSAGSSDRFHYIWDTTSRRILYKLPGHNGSVNDIDFHPKEPIVCSGS--SDKQIYL  344
             K + +GS D   YIW+  S+ ++ KL GH  +V     HP E I+ S +  +DK I L
Sbjct  298  GKWIVSGSEDNMVYIWNLQSKEVVQKLQGHTDTVLCTACHPTENIIASAALENDKTIKL  356


 Score = 97.8 bits (242),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 68/247 (28%), Positives = 125/247 (51%), Gaps = 24/247 (10%)

Query  24   NEVVFSSREKAVVQNGPPRTSSLF-----APIMLLEGHQGDIFSLEFHPEGQYLASTGFD  78
            ++V +SS  + +V     +T  ++       +  L+GH   +F   F+P+   + S  FD
Sbjct  118  SDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSNLIVSGSFD  177

Query  79   RQIFIWNV-YGECENISVLTGHSGAIMELHFSPDGNHLYTASTDMTLGLWDIAAGTRIKK  137
              + IW+V  G+C  +  L  HS  +  +HF+ DG+ + ++S D    +WD A+G  +K 
Sbjct  178  ESVRIWDVRTGKC--LKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKT  235

Query  138  L----KGHTSFVNSVSGARRGLTQLCSGSDDSTIRVWDPRKRGQC---YT--LNNTYQVT  188
            L        SFV      +  L    + + D+T+++WD   +G+C   YT   N  Y + 
Sbjct  236  LIDDDNPPVSFVKFSPNGKYIL----AATLDNTLKLWD-YSKGKCLKTYTGHKNEKYCIF  290

Query  189  AVTFNDTAEQVISGGIDNDIKVWDLRKNSILYKLKGHSDTITGLSLSPDGSYILSNAVDN  248
            A       + ++SG  DN + +W+L+   ++ KL+GH+DT+   +  P  + I S A++N
Sbjct  291  ANFSVTGGKWIVSGSEDNMVYIWNLQSKEVVQKLQGHTDTVLCTACHPTENIIASAALEN  350

Query  249  --TLRIW  253
              T+++W
Sbjct  351  DKTIKLW  357


 Score = 65.1 bits (157),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/136 (26%), Positives = 72/136 (53%), Gaps = 10/136 (7%)

Query  217  SILYKLKGHSDTITGLSLSPDGSYILSNAVDNTLRIWDVRPFAPYE-RCVKIISGHQHNF  275
            ++ + L GH+  ++ +  SP+G ++ S++ D  ++IW       Y+ +  K ISGH+   
Sbjct  63   TLKFTLAGHTKAVSAVKFSPNGEWLASSSADKLIKIW-----GAYDGKFEKTISGHKLGI  117

Query  276  EKNLLRCAWSPDGSKVSAGSSDRFHYIWDTTSRRILYKLPGHNGSVNDIDFHPKEPIVCS  335
                   AWS D   + +GS D+   +W+ ++ + L  L GH+  V   +F+P+  ++ S
Sbjct  118  SD----VAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSNLIVS  173

Query  336  GSSDKQIYLGEIEAAQ  351
            GS D+ + + ++   +
Sbjct  174  GSFDESVRIWDVRTGK  189


>Q57W14_TRYB2 unnamed protein product
Length=419

 Score = 140 bits (353),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 85/293 (29%), Positives = 152/293 (52%), Gaps = 14/293 (5%)

Query  50   IMLLEGHQGDIFSLEFH-PEGQYLASTGFDRQIFIWNV-YGECENISVLTGHSGAIMELH  107
            I+ LEGH+  ++S+ F+ P G  +A+  FD+   IW+    +C     L GH   I+ + 
Sbjct  130  IVSLEGHRNVVYSVSFNNPYGNRVATGSFDKTCKIWDARTAQC--YCTLAGHMAEIVCMS  187

Query  108  FSPDGNHLYTASTDMTLGLWDIAAGTRIKKLKGHTSFVNSVSGARRGLTQLCSGSDDSTI  167
            F+P   HL + S D T  +W++  G  +  L GHT+ + S++    G   L +GS D+T 
Sbjct  188  FNPQSTHLSSGSMDYTAKVWNVETGQELYTLLGHTAEIVSLNFNTNGDLIL-TGSFDTTA  246

Query  168  RVWDPRKRGQCYTLNN-TYQVTAVTFNDTAEQVISGGIDNDIKVWDLRKNSILYKLKGHS  226
            ++WD R     +TL++   ++++  FN      ++G ID   K+WD+     +  L+GH+
Sbjct  247  KLWDVRTGKCVHTLSSHRAEISSTQFNFAGNLCVTGCIDRTSKLWDVGSGQCVSTLRGHT  306

Query  227  DTITGLSLSPDGSYILSNAVDNTLRIWDVRPFAPYERCVKIISGHQHNFEKNLLRCAWSP  286
            D I  ++ S  GS I++ + D T R++D   F     CV  + GH    E  + +  ++P
Sbjct  307  DEILDVAFSTSGSQIVTASADATARVYDTATF----NCVASLVGH----EGEISKVQFNP  358

Query  287  DGSKVSAGSSDRFHYIWDTTSRRILYKLPGHNGSVNDIDFHPKEPIVCSGSSD  339
             G+K+ + ++D+   +W   + + L  L GHN  +    F+ +   + +GS D
Sbjct  359  QGTKIISAANDKTCRVWSVETGQNLQTLTGHNDEIFSCAFNYEGDTILTGSKD  411


 Score = 127 bits (319),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 81/307 (26%), Positives = 143/307 (47%), Gaps = 12/307 (4%)

Query  47   FAPIMLLEGHQGDIFSLEFHPEGQYLASTGFDRQIFIWNVYGECENISVLTGHSGAIMEL  106
            F     L  H   + +  F+  G    +  +DR   +W+     E +S L GH   +  +
Sbjct  85   FYLFKTLRAHMLPLTNCAFNKGGDSFITGSYDRTCKVWDTATGNEIVS-LEGHRNVVYSV  143

Query  107  HFS-PDGNHLYTASTDMTLGLWDIAAGTRIKKLKGHTSFVNSVSGARRGLTQLCSGSDDS  165
             F+ P GN + T S D T  +WD         L GH + +  +S   +  T L SGS D 
Sbjct  144  SFNNPYGNRVATGSFDKTCKIWDARTAQCYCTLAGHMAEIVCMSFNPQS-THLSSGSMDY  202

Query  166  TIRVWDPRKRGQCYTL-NNTYQVTAVTFNDTAEQVISGGIDNDIKVWDLRKNSILYKLKG  224
            T +VW+     + YTL  +T ++ ++ FN   + +++G  D   K+WD+R    ++ L  
Sbjct  203  TAKVWNVETGQELYTLLGHTAEIVSLNFNTNGDLILTGSFDTTAKLWDVRTGKCVHTLSS  262

Query  225  HSDTITGLSLSPDGSYILSNAVDNTLRIWDVRPFAPYERCVKIISGHQHNFEKNLLRCAW  284
            H   I+    +  G+  ++  +D T ++WDV       +CV  + GH       +L  A+
Sbjct  263  HRAEISSTQFNFAGNLCVTGCIDRTSKLWDVGS----GQCVSTLRGHT----DEILDVAF  314

Query  285  SPDGSKVSAGSSDRFHYIWDTTSRRILYKLPGHNGSVNDIDFHPKEPIVCSGSSDKQIYL  344
            S  GS++   S+D    ++DT +   +  L GH G ++ + F+P+   + S ++DK   +
Sbjct  315  STSGSQIVTASADATARVYDTATFNCVASLVGHEGEISKVQFNPQGTKIISAANDKTCRV  374

Query  345  GEIEAAQ  351
              +E  Q
Sbjct  375  WSVETGQ  381


 Score = 100 bits (250),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 63/203 (31%), Positives = 100/203 (49%), Gaps = 5/203 (2%)

Query  53   LEGHQGDIFSLEFHPEGQYLASTGFDRQIFIWNV-YGECENISVLTGHSGAIMELHFSPD  111
            L GH  +I SL F+  G  + +  FD    +W+V  G+C  +  L+ H   I    F+  
Sbjct  218  LLGHTAEIVSLNFNTNGDLILTGSFDTTAKLWDVRTGKC--VHTLSSHRAEISSTQFNFA  275

Query  112  GNHLYTASTDMTLGLWDIAAGTRIKKLKGHTSFVNSVSGARRGLTQLCSGSDDSTIRVWD  171
            GN   T   D T  LWD+ +G  +  L+GHT  +  V+ +  G +Q+ + S D+T RV+D
Sbjct  276  GNLCVTGCIDRTSKLWDVGSGQCVSTLRGHTDEILDVAFSTSG-SQIVTASADATARVYD  334

Query  172  PRKRGQCYTL-NNTYQVTAVTFNDTAEQVISGGIDNDIKVWDLRKNSILYKLKGHSDTIT  230
                    +L  +  +++ V FN    ++IS   D   +VW +     L  L GH+D I 
Sbjct  335  TATFNCVASLVGHEGEISKVQFNPQGTKIISAANDKTCRVWSVETGQNLQTLTGHNDEIF  394

Query  231  GLSLSPDGSYILSNAVDNTLRIW  253
              + + +G  IL+ + DNT  IW
Sbjct  395  SCAFNYEGDTILTGSKDNTCGIW  417


 Score = 58.5 bits (140),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/108 (30%), Positives = 56/108 (52%), Gaps = 6/108 (6%)

Query  25   EVVFSSREKAVVQNGPPRT-----SSLFAPIMLLEGHQGDIFSLEFHPEGQYLASTGFDR  79
            +V FS+    +V      T     ++ F  +  L GH+G+I  ++F+P+G  + S   D+
Sbjct  311  DVAFSTSGSQIVTASADATARVYDTATFNCVASLVGHEGEISKVQFNPQGTKIISAANDK  370

Query  80   QIFIWNVYGECENISVLTGHSGAIMELHFSPDGNHLYTASTDMTLGLW  127
               +W+V    +N+  LTGH+  I    F+ +G+ + T S D T G+W
Sbjct  371  TCRVWSVETG-QNLQTLTGHNDEIFSCAFNYEGDTILTGSKDNTCGIW  417



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4782626282


Query= XP_050469419.1 U5 small nuclear ribonucleoprotein 40 kDa protein
isoform X1 [Bombus huntii]

Length=351
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VPL0_DROME  unnamed protein product                                 487     6e-174
WDS_DROME  unnamed protein product                                    148     3e-41 
Q57W14_TRYB2  unnamed protein product                                 140     5e-38 


>Q9VPL0_DROME unnamed protein product
Length=347

 Score = 487 bits (1253),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 216/344 (63%), Positives = 284/344 (83%), Gaps = 2/344 (1%)

Query  6    KRKGDDILALVPASKRTKNEVV-FSSREKAVVQNGPPRTSSLFAPIMLLEGHQGDIFSLE  64
            KR  + ++ L   +KR+KN+++ +++R+KA++++G  RTS+L APIM LEGH+G+IF+ E
Sbjct  4    KRPNNSVI-LAQEAKRSKNDLMAYTNRDKALLESGVRRTSNLQAPIMQLEGHEGEIFTAE  62

Query  65   FHPEGQYLASTGFDRQIFIWNVYGECENISVLTGHSGAIMELHFSPDGNHLYTASTDMTL  124
            FHPEG+ L S+GFDRQI+IW VY +CEN+  ++GHSGA+ME HF+PDG+H++T STD TL
Sbjct  63   FHPEGELLLSSGFDRQIYIWQVYEDCENVMAMSGHSGAVMEAHFTPDGSHIFTCSTDKTL  122

Query  125  GLWDIAAGTRIKKLKGHTSFVNSVSGARRGLTQLCSGSDDSTIRVWDPRKRGQCYTLNNT  184
              WDIA G R ++ KGH +FVNSV G+RRG   LCSGSDD TI++WD RK+   +TL + 
Sbjct  123  AFWDIATGQRQRRFKGHGNFVNSVQGSRRGQQLLCSGSDDRTIKIWDARKKHAAHTLESP  182

Query  185  YQVTAVTFNDTAEQVISGGIDNDIKVWDLRKNSILYKLKGHSDTITGLSLSPDGSYILSN  244
            +QVTAV F DT EQVISGGIDN++K+WD+RK ++L+ L+GHSDTITG+SLSP+G +IL+N
Sbjct  183  FQVTAVCFGDTGEQVISGGIDNEVKIWDIRKQAVLHHLRGHSDTITGMSLSPEGDFILTN  242

Query  245  AVDNTLRIWDVRPFAPYERCVKIISGHQHNFEKNLLRCAWSPDGSKVSAGSSDRFHYIWD  304
            A+DNTLR+WDVRP+AP ERCVK+  GHQHNFEKNLLRCAWSP   K+++GS+DR  YIWD
Sbjct  243  AMDNTLRVWDVRPYAPGERCVKVFQGHQHNFEKNLLRCAWSPGSDKITSGSADRHVYIWD  302

Query  305  TTSRRILYKLPGHNGSVNDIDFHPKEPIVCSGSSDKQIYLGEIE  348
              +RRILYKLPGHNGSVN +DF PKEP++ SGSSDK +YLGEI+
Sbjct  303  VNTRRILYKLPGHNGSVNAVDFSPKEPLILSGSSDKTLYLGEID  346


 Score = 33.9 bits (76),  Expect = 0.20, Method: Compositional matrix adjust.
 Identities = 31/126 (25%), Positives = 50/126 (40%), Gaps = 10/126 (8%)

Query  236  PDGSYILSNAVD---NTLRIWDVRPFAPYERCVKIISGHQ------HNFEKNLLRCAWSP  286
            P+ S IL+       N L  +  R  A  E  V+  S  Q         E  +    + P
Sbjct  6    PNNSVILAQEAKRSKNDLMAYTNRDKALLESGVRRTSNLQAPIMQLEGHEGEIFTAEFHP  65

Query  287  DGSKVSAGSSDRFHYIWDTTSR-RILYKLPGHNGSVNDIDFHPKEPIVCSGSSDKQIYLG  345
            +G  + +   DR  YIW        +  + GH+G+V +  F P    + + S+DK +   
Sbjct  66   EGELLLSSGFDRQIYIWQVYEDCENVMAMSGHSGAVMEAHFTPDGSHIFTCSTDKTLAFW  125

Query  346  EIEAAQ  351
            +I   Q
Sbjct  126  DIATGQ  131


>WDS_DROME unnamed protein product
Length=361

 Score = 148 bits (373),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 97/299 (32%), Positives = 159/299 (53%), Gaps = 17/299 (6%)

Query  53   LEGHQGDIFSLEFHPEGQYLASTGFDRQIFIWNVY-GECENISVLTGHSGAIMELHFSPD  111
            L GH   + +++F P G++LAS+  D+ I IW  Y G+ E    ++GH   I ++ +S D
Sbjct  68   LAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEK--TISGHKLGISDVAWSSD  125

Query  112  GNHLYTASTDMTLGLWDIAAGTRIKKLKGHTSFVNSVSGARRGLTQLCSGSDDSTIRVWD  171
               L + S D TL +W+++ G  +K LKGH+++V   +   +    + SGS D ++R+WD
Sbjct  126  SRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQS-NLIVSGSFDESVRIWD  184

Query  172  PRKRGQCYTLNNTYQ--VTAVTFNDTAEQVISGGIDNDIKVWDLRKNSILYKL-KGHSDT  228
             R  G+C      +   V+AV FN     ++S   D   ++WD      L  L    +  
Sbjct  185  VR-TGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPP  243

Query  229  ITGLSLSPDGSYILSNAVDNTLRIWDVRPFAPYERCVKIISGHQHNFEKNLLRCAWSPDG  288
            ++ +  SP+G YIL+  +DNTL++WD        +C+K  +GH++  EK  +   +S  G
Sbjct  244  VSFVKFSPNGKYILAATLDNTLKLWDYSK----GKCLKTYTGHKN--EKYCIFANFSVTG  297

Query  289  SK-VSAGSSDRFHYIWDTTSRRILYKLPGHNGSVNDIDFHPKEPIVCSGS--SDKQIYL  344
             K + +GS D   YIW+  S+ ++ KL GH  +V     HP E I+ S +  +DK I L
Sbjct  298  GKWIVSGSEDNMVYIWNLQSKEVVQKLQGHTDTVLCTACHPTENIIASAALENDKTIKL  356


 Score = 97.8 bits (242),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 68/247 (28%), Positives = 125/247 (51%), Gaps = 24/247 (10%)

Query  24   NEVVFSSREKAVVQNGPPRTSSLF-----APIMLLEGHQGDIFSLEFHPEGQYLASTGFD  78
            ++V +SS  + +V     +T  ++       +  L+GH   +F   F+P+   + S  FD
Sbjct  118  SDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSNLIVSGSFD  177

Query  79   RQIFIWNV-YGECENISVLTGHSGAIMELHFSPDGNHLYTASTDMTLGLWDIAAGTRIKK  137
              + IW+V  G+C  +  L  HS  +  +HF+ DG+ + ++S D    +WD A+G  +K 
Sbjct  178  ESVRIWDVRTGKC--LKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKT  235

Query  138  L----KGHTSFVNSVSGARRGLTQLCSGSDDSTIRVWDPRKRGQC---YT--LNNTYQVT  188
            L        SFV      +  L    + + D+T+++WD   +G+C   YT   N  Y + 
Sbjct  236  LIDDDNPPVSFVKFSPNGKYIL----AATLDNTLKLWD-YSKGKCLKTYTGHKNEKYCIF  290

Query  189  AVTFNDTAEQVISGGIDNDIKVWDLRKNSILYKLKGHSDTITGLSLSPDGSYILSNAVDN  248
            A       + ++SG  DN + +W+L+   ++ KL+GH+DT+   +  P  + I S A++N
Sbjct  291  ANFSVTGGKWIVSGSEDNMVYIWNLQSKEVVQKLQGHTDTVLCTACHPTENIIASAALEN  350

Query  249  --TLRIW  253
              T+++W
Sbjct  351  DKTIKLW  357


 Score = 65.1 bits (157),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/136 (26%), Positives = 72/136 (53%), Gaps = 10/136 (7%)

Query  217  SILYKLKGHSDTITGLSLSPDGSYILSNAVDNTLRIWDVRPFAPYE-RCVKIISGHQHNF  275
            ++ + L GH+  ++ +  SP+G ++ S++ D  ++IW       Y+ +  K ISGH+   
Sbjct  63   TLKFTLAGHTKAVSAVKFSPNGEWLASSSADKLIKIW-----GAYDGKFEKTISGHKLGI  117

Query  276  EKNLLRCAWSPDGSKVSAGSSDRFHYIWDTTSRRILYKLPGHNGSVNDIDFHPKEPIVCS  335
                   AWS D   + +GS D+   +W+ ++ + L  L GH+  V   +F+P+  ++ S
Sbjct  118  SD----VAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSNLIVS  173

Query  336  GSSDKQIYLGEIEAAQ  351
            GS D+ + + ++   +
Sbjct  174  GSFDESVRIWDVRTGK  189


>Q57W14_TRYB2 unnamed protein product
Length=419

 Score = 140 bits (353),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 85/293 (29%), Positives = 152/293 (52%), Gaps = 14/293 (5%)

Query  50   IMLLEGHQGDIFSLEFH-PEGQYLASTGFDRQIFIWNV-YGECENISVLTGHSGAIMELH  107
            I+ LEGH+  ++S+ F+ P G  +A+  FD+   IW+    +C     L GH   I+ + 
Sbjct  130  IVSLEGHRNVVYSVSFNNPYGNRVATGSFDKTCKIWDARTAQC--YCTLAGHMAEIVCMS  187

Query  108  FSPDGNHLYTASTDMTLGLWDIAAGTRIKKLKGHTSFVNSVSGARRGLTQLCSGSDDSTI  167
            F+P   HL + S D T  +W++  G  +  L GHT+ + S++    G   L +GS D+T 
Sbjct  188  FNPQSTHLSSGSMDYTAKVWNVETGQELYTLLGHTAEIVSLNFNTNGDLIL-TGSFDTTA  246

Query  168  RVWDPRKRGQCYTLNN-TYQVTAVTFNDTAEQVISGGIDNDIKVWDLRKNSILYKLKGHS  226
            ++WD R     +TL++   ++++  FN      ++G ID   K+WD+     +  L+GH+
Sbjct  247  KLWDVRTGKCVHTLSSHRAEISSTQFNFAGNLCVTGCIDRTSKLWDVGSGQCVSTLRGHT  306

Query  227  DTITGLSLSPDGSYILSNAVDNTLRIWDVRPFAPYERCVKIISGHQHNFEKNLLRCAWSP  286
            D I  ++ S  GS I++ + D T R++D   F     CV  + GH    E  + +  ++P
Sbjct  307  DEILDVAFSTSGSQIVTASADATARVYDTATF----NCVASLVGH----EGEISKVQFNP  358

Query  287  DGSKVSAGSSDRFHYIWDTTSRRILYKLPGHNGSVNDIDFHPKEPIVCSGSSD  339
             G+K+ + ++D+   +W   + + L  L GHN  +    F+ +   + +GS D
Sbjct  359  QGTKIISAANDKTCRVWSVETGQNLQTLTGHNDEIFSCAFNYEGDTILTGSKD  411


 Score = 127 bits (319),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 81/307 (26%), Positives = 143/307 (47%), Gaps = 12/307 (4%)

Query  47   FAPIMLLEGHQGDIFSLEFHPEGQYLASTGFDRQIFIWNVYGECENISVLTGHSGAIMEL  106
            F     L  H   + +  F+  G    +  +DR   +W+     E +S L GH   +  +
Sbjct  85   FYLFKTLRAHMLPLTNCAFNKGGDSFITGSYDRTCKVWDTATGNEIVS-LEGHRNVVYSV  143

Query  107  HFS-PDGNHLYTASTDMTLGLWDIAAGTRIKKLKGHTSFVNSVSGARRGLTQLCSGSDDS  165
             F+ P GN + T S D T  +WD         L GH + +  +S   +  T L SGS D 
Sbjct  144  SFNNPYGNRVATGSFDKTCKIWDARTAQCYCTLAGHMAEIVCMSFNPQS-THLSSGSMDY  202

Query  166  TIRVWDPRKRGQCYTL-NNTYQVTAVTFNDTAEQVISGGIDNDIKVWDLRKNSILYKLKG  224
            T +VW+     + YTL  +T ++ ++ FN   + +++G  D   K+WD+R    ++ L  
Sbjct  203  TAKVWNVETGQELYTLLGHTAEIVSLNFNTNGDLILTGSFDTTAKLWDVRTGKCVHTLSS  262

Query  225  HSDTITGLSLSPDGSYILSNAVDNTLRIWDVRPFAPYERCVKIISGHQHNFEKNLLRCAW  284
            H   I+    +  G+  ++  +D T ++WDV       +CV  + GH       +L  A+
Sbjct  263  HRAEISSTQFNFAGNLCVTGCIDRTSKLWDVGS----GQCVSTLRGHT----DEILDVAF  314

Query  285  SPDGSKVSAGSSDRFHYIWDTTSRRILYKLPGHNGSVNDIDFHPKEPIVCSGSSDKQIYL  344
            S  GS++   S+D    ++DT +   +  L GH G ++ + F+P+   + S ++DK   +
Sbjct  315  STSGSQIVTASADATARVYDTATFNCVASLVGHEGEISKVQFNPQGTKIISAANDKTCRV  374

Query  345  GEIEAAQ  351
              +E  Q
Sbjct  375  WSVETGQ  381


 Score = 100 bits (250),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 63/203 (31%), Positives = 100/203 (49%), Gaps = 5/203 (2%)

Query  53   LEGHQGDIFSLEFHPEGQYLASTGFDRQIFIWNV-YGECENISVLTGHSGAIMELHFSPD  111
            L GH  +I SL F+  G  + +  FD    +W+V  G+C  +  L+ H   I    F+  
Sbjct  218  LLGHTAEIVSLNFNTNGDLILTGSFDTTAKLWDVRTGKC--VHTLSSHRAEISSTQFNFA  275

Query  112  GNHLYTASTDMTLGLWDIAAGTRIKKLKGHTSFVNSVSGARRGLTQLCSGSDDSTIRVWD  171
            GN   T   D T  LWD+ +G  +  L+GHT  +  V+ +  G +Q+ + S D+T RV+D
Sbjct  276  GNLCVTGCIDRTSKLWDVGSGQCVSTLRGHTDEILDVAFSTSG-SQIVTASADATARVYD  334

Query  172  PRKRGQCYTL-NNTYQVTAVTFNDTAEQVISGGIDNDIKVWDLRKNSILYKLKGHSDTIT  230
                    +L  +  +++ V FN    ++IS   D   +VW +     L  L GH+D I 
Sbjct  335  TATFNCVASLVGHEGEISKVQFNPQGTKIISAANDKTCRVWSVETGQNLQTLTGHNDEIF  394

Query  231  GLSLSPDGSYILSNAVDNTLRIW  253
              + + +G  IL+ + DNT  IW
Sbjct  395  SCAFNYEGDTILTGSKDNTCGIW  417


 Score = 58.5 bits (140),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/108 (30%), Positives = 56/108 (52%), Gaps = 6/108 (6%)

Query  25   EVVFSSREKAVVQNGPPRT-----SSLFAPIMLLEGHQGDIFSLEFHPEGQYLASTGFDR  79
            +V FS+    +V      T     ++ F  +  L GH+G+I  ++F+P+G  + S   D+
Sbjct  311  DVAFSTSGSQIVTASADATARVYDTATFNCVASLVGHEGEISKVQFNPQGTKIISAANDK  370

Query  80   QIFIWNVYGECENISVLTGHSGAIMELHFSPDGNHLYTASTDMTLGLW  127
               +W+V    +N+  LTGH+  I    F+ +G+ + T S D T G+W
Sbjct  371  TCRVWSVETG-QNLQTLTGHNDEIFSCAFNYEGDTILTGSKDNTCGIW  417



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4782626282


Query= XP_050469420.1 U5 small nuclear ribonucleoprotein 40 kDa protein
isoform X2 [Bombus huntii]

Length=301
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VPL0_DROME  unnamed protein product                                 455     3e-162
WDS_DROME  unnamed protein product                                    147     1e-41 
Q57W14_TRYB2  unnamed protein product                                 139     6e-38 


>Q9VPL0_DROME unnamed protein product
Length=347

 Score = 455 bits (1170),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 198/298 (66%), Positives = 249/298 (84%), Gaps = 0/298 (0%)

Query  1    MLLEGHQGDIFSLEFHPEGQYLASTGFDRQIFIWNVYGECENISVLTGHSGAIMELHFSP  60
            M LEGH+G+IF+ EFHPEG+ L S+GFDRQI+IW VY +CEN+  ++GHSGA+ME HF+P
Sbjct  49   MQLEGHEGEIFTAEFHPEGELLLSSGFDRQIYIWQVYEDCENVMAMSGHSGAVMEAHFTP  108

Query  61   DGNHLYTASTDMTLGLWDIAAGTRIKKLKGHTSFVNSVSGARRGLTQLCSGSDDSTIRVW  120
            DG+H++T STD TL  WDIA G R ++ KGH +FVNSV G+RRG   LCSGSDD TI++W
Sbjct  109  DGSHIFTCSTDKTLAFWDIATGQRQRRFKGHGNFVNSVQGSRRGQQLLCSGSDDRTIKIW  168

Query  121  DPRKRGQCYTLNNTYQVTAVTFNDTAEQVISGGIDNDIKVWDLRKNSILYKLKGHSDTIT  180
            D RK+   +TL + +QVTAV F DT EQVISGGIDN++K+WD+RK ++L+ L+GHSDTIT
Sbjct  169  DARKKHAAHTLESPFQVTAVCFGDTGEQVISGGIDNEVKIWDIRKQAVLHHLRGHSDTIT  228

Query  181  GLSLSPDGSYILSNAVDNTLRIWDVRPFAPYERCVKIISGHQHNFEKNLLRCAWSPDGSK  240
            G+SLSP+G +IL+NA+DNTLR+WDVRP+AP ERCVK+  GHQHNFEKNLLRCAWSP   K
Sbjct  229  GMSLSPEGDFILTNAMDNTLRVWDVRPYAPGERCVKVFQGHQHNFEKNLLRCAWSPGSDK  288

Query  241  VSAGSSDRFHYIWDTTSRRILYKLPGHNGSVNDIDFHPKEPIVCSGSSDKQIYLGEIE  298
            +++GS+DR  YIWD  +RRILYKLPGHNGSVN +DF PKEP++ SGSSDK +YLGEI+
Sbjct  289  ITSGSADRHVYIWDVNTRRILYKLPGHNGSVNAVDFSPKEPLILSGSSDKTLYLGEID  346


 Score = 59.7 bits (143),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 37/129 (29%), Positives = 62/129 (48%), Gaps = 12/129 (9%)

Query  169  LYKLKGHSDTITGLSLSPDGSYILSNAVDNTLRIWDVRPFAPYERC--VKIISGHQHNFE  226
            + +L+GH   I      P+G  +LS+  D  + IW V     YE C  V  +SGH     
Sbjct  48   IMQLEGHEGEIFTAEFHPEGELLLSSGFDRQIYIWQV-----YEDCENVMAMSGH----S  98

Query  227  KNLLRCAWSPDGSKVSAGSSDRFHYIWDTTSRRILYKLPGHNGSVNDIDFHPK-EPIVCS  285
              ++   ++PDGS +   S+D+    WD  + +   +  GH   VN +    + + ++CS
Sbjct  99   GAVMEAHFTPDGSHIFTCSTDKTLAFWDIATGQRQRRFKGHGNFVNSVQGSRRGQQLLCS  158

Query  286  GSSDKQIYL  294
            GS D+ I +
Sbjct  159  GSDDRTIKI  167


 Score = 33.5 bits (75),  Expect = 0.19, Method: Compositional matrix adjust.
 Identities = 31/126 (25%), Positives = 50/126 (40%), Gaps = 10/126 (8%)

Query  186  PDGSYILSNAVD---NTLRIWDVRPFAPYERCVKIISGHQ------HNFEKNLLRCAWSP  236
            P+ S IL+       N L  +  R  A  E  V+  S  Q         E  +    + P
Sbjct  6    PNNSVILAQEAKRSKNDLMAYTNRDKALLESGVRRTSNLQAPIMQLEGHEGEIFTAEFHP  65

Query  237  DGSKVSAGSSDRFHYIWDTTSR-RILYKLPGHNGSVNDIDFHPKEPIVCSGSSDKQIYLG  295
            +G  + +   DR  YIW        +  + GH+G+V +  F P    + + S+DK +   
Sbjct  66   EGELLLSSGFDRQIYIWQVYEDCENVMAMSGHSGAVMEAHFTPDGSHIFTCSTDKTLAFW  125

Query  296  EIEAAQ  301
            +I   Q
Sbjct  126  DIATGQ  131


>WDS_DROME unnamed protein product
Length=361

 Score = 147 bits (371),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 97/299 (32%), Positives = 159/299 (53%), Gaps = 17/299 (6%)

Query  3    LEGHQGDIFSLEFHPEGQYLASTGFDRQIFIWNVY-GECENISVLTGHSGAIMELHFSPD  61
            L GH   + +++F P G++LAS+  D+ I IW  Y G+ E    ++GH   I ++ +S D
Sbjct  68   LAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEK--TISGHKLGISDVAWSSD  125

Query  62   GNHLYTASTDMTLGLWDIAAGTRIKKLKGHTSFVNSVSGARRGLTQLCSGSDDSTIRVWD  121
               L + S D TL +W+++ G  +K LKGH+++V   +   +    + SGS D ++R+WD
Sbjct  126  SRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQS-NLIVSGSFDESVRIWD  184

Query  122  PRKRGQCYTLNNTYQ--VTAVTFNDTAEQVISGGIDNDIKVWDLRKNSILYKL-KGHSDT  178
             R  G+C      +   V+AV FN     ++S   D   ++WD      L  L    +  
Sbjct  185  VR-TGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPP  243

Query  179  ITGLSLSPDGSYILSNAVDNTLRIWDVRPFAPYERCVKIISGHQHNFEKNLLRCAWSPDG  238
            ++ +  SP+G YIL+  +DNTL++WD        +C+K  +GH++  EK  +   +S  G
Sbjct  244  VSFVKFSPNGKYILAATLDNTLKLWDYS----KGKCLKTYTGHKN--EKYCIFANFSVTG  297

Query  239  SK-VSAGSSDRFHYIWDTTSRRILYKLPGHNGSVNDIDFHPKEPIVCSGS--SDKQIYL  294
             K + +GS D   YIW+  S+ ++ KL GH  +V     HP E I+ S +  +DK I L
Sbjct  298  GKWIVSGSEDNMVYIWNLQSKEVVQKLQGHTDTVLCTACHPTENIIASAALENDKTIKL  356


 Score = 96.7 bits (239),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 63/213 (30%), Positives = 111/213 (52%), Gaps = 19/213 (9%)

Query  3    LEGHQGDIFSLEFHPEGQYLASTGFDRQIFIWNV-YGECENISVLTGHSGAIMELHFSPD  61
            L+GH   +F   F+P+   + S  FD  + IW+V  G+C  +  L  HS  +  +HF+ D
Sbjct  152  LKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKC--LKTLPAHSDPVSAVHFNRD  209

Query  62   GNHLYTASTDMTLGLWDIAAGTRIKKL----KGHTSFVNSVSGARRGLTQLCSGSDDSTI  117
            G+ + ++S D    +WD A+G  +K L        SFV      +  L    + + D+T+
Sbjct  210  GSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYIL----AATLDNTL  265

Query  118  RVWDPRKRGQC---YT--LNNTYQVTAVTFNDTAEQVISGGIDNDIKVWDLRKNSILYKL  172
            ++WD   +G+C   YT   N  Y + A       + ++SG  DN + +W+L+   ++ KL
Sbjct  266  KLWD-YSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQSKEVVQKL  324

Query  173  KGHSDTITGLSLSPDGSYILSNAVDN--TLRIW  203
            +GH+DT+   +  P  + I S A++N  T+++W
Sbjct  325  QGHTDTVLCTACHPTENIIASAALENDKTIKLW  357


 Score = 64.7 bits (156),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/136 (26%), Positives = 72/136 (53%), Gaps = 10/136 (7%)

Query  167  SILYKLKGHSDTITGLSLSPDGSYILSNAVDNTLRIWDVRPFAPYE-RCVKIISGHQHNF  225
            ++ + L GH+  ++ +  SP+G ++ S++ D  ++IW       Y+ +  K ISGH+   
Sbjct  63   TLKFTLAGHTKAVSAVKFSPNGEWLASSSADKLIKIW-----GAYDGKFEKTISGHKLGI  117

Query  226  EKNLLRCAWSPDGSKVSAGSSDRFHYIWDTTSRRILYKLPGHNGSVNDIDFHPKEPIVCS  285
                   AWS D   + +GS D+   +W+ ++ + L  L GH+  V   +F+P+  ++ S
Sbjct  118  SD----VAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSNLIVS  173

Query  286  GSSDKQIYLGEIEAAQ  301
            GS D+ + + ++   +
Sbjct  174  GSFDESVRIWDVRTGK  189


 Score = 41.6 bits (96),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/123 (21%), Positives = 60/123 (49%), Gaps = 5/123 (4%)

Query  2    LLEGHQGDIFSLEFHPEGQYLASTGFDRQIFIWNVYGECENISVLTGHSGA--IMELHFS  59
            L++     +  ++F P G+Y+ +   D  + +W+ Y + + +   TGH      +  +FS
Sbjct  236  LIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWD-YSKGKCLKTYTGHKNEKYCIFANFS  294

Query  60   PDGNH-LYTASTDMTLGLWDIAAGTRIKKLKGHT-SFVNSVSGARRGLTQLCSGSDDSTI  117
              G   + + S D  + +W++ +   ++KL+GHT + + +       +    +  +D TI
Sbjct  295  VTGGKWIVSGSEDNMVYIWNLQSKEVVQKLQGHTDTVLCTACHPTENIIASAALENDKTI  354

Query  118  RVW  120
            ++W
Sbjct  355  KLW  357


>Q57W14_TRYB2 unnamed protein product
Length=419

 Score = 139 bits (349),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 83/290 (29%), Positives = 150/290 (52%), Gaps = 14/290 (5%)

Query  3    LEGHQGDIFSLEFH-PEGQYLASTGFDRQIFIWNV-YGECENISVLTGHSGAIMELHFSP  60
            LEGH+  ++S+ F+ P G  +A+  FD+   IW+    +C     L GH   I+ + F+P
Sbjct  133  LEGHRNVVYSVSFNNPYGNRVATGSFDKTCKIWDARTAQC--YCTLAGHMAEIVCMSFNP  190

Query  61   DGNHLYTASTDMTLGLWDIAAGTRIKKLKGHTSFVNSVSGARRGLTQLCSGSDDSTIRVW  120
               HL + S D T  +W++  G  +  L GHT+ + S++    G   + +GS D+T ++W
Sbjct  191  QSTHLSSGSMDYTAKVWNVETGQELYTLLGHTAEIVSLNFNTNG-DLILTGSFDTTAKLW  249

Query  121  DPRKRGQCYTLNN-TYQVTAVTFNDTAEQVISGGIDNDIKVWDLRKNSILYKLKGHSDTI  179
            D R     +TL++   ++++  FN      ++G ID   K+WD+     +  L+GH+D I
Sbjct  250  DVRTGKCVHTLSSHRAEISSTQFNFAGNLCVTGCIDRTSKLWDVGSGQCVSTLRGHTDEI  309

Query  180  TGLSLSPDGSYILSNAVDNTLRIWDVRPFAPYERCVKIISGHQHNFEKNLLRCAWSPDGS  239
              ++ S  GS I++ + D T R++D   F     CV  + GH    E  + +  ++P G+
Sbjct  310  LDVAFSTSGSQIVTASADATARVYDTATF----NCVASLVGH----EGEISKVQFNPQGT  361

Query  240  KVSAGSSDRFHYIWDTTSRRILYKLPGHNGSVNDIDFHPKEPIVCSGSSD  289
            K+ + ++D+   +W   + + L  L GHN  +    F+ +   + +GS D
Sbjct  362  KIISAANDKTCRVWSVETGQNLQTLTGHNDEIFSCAFNYEGDTILTGSKD  411


 Score = 127 bits (318),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 80/301 (27%), Positives = 142/301 (47%), Gaps = 12/301 (4%)

Query  3    LEGHQGDIFSLEFHPEGQYLASTGFDRQIFIWNVYGECENISVLTGHSGAIMELHFS-PD  61
            L  H   + +  F+  G    +  +DR   +W+     E +S L GH   +  + F+ P 
Sbjct  91   LRAHMLPLTNCAFNKGGDSFITGSYDRTCKVWDTATGNEIVS-LEGHRNVVYSVSFNNPY  149

Query  62   GNHLYTASTDMTLGLWDIAAGTRIKKLKGHTSFVNSVSGARRGLTQLCSGSDDSTIRVWD  121
            GN + T S D T  +WD         L GH + +  +S   +  T L SGS D T +VW+
Sbjct  150  GNRVATGSFDKTCKIWDARTAQCYCTLAGHMAEIVCMSFNPQS-THLSSGSMDYTAKVWN  208

Query  122  PRKRGQCYTL-NNTYQVTAVTFNDTAEQVISGGIDNDIKVWDLRKNSILYKLKGHSDTIT  180
                 + YTL  +T ++ ++ FN   + +++G  D   K+WD+R    ++ L  H   I+
Sbjct  209  VETGQELYTLLGHTAEIVSLNFNTNGDLILTGSFDTTAKLWDVRTGKCVHTLSSHRAEIS  268

Query  181  GLSLSPDGSYILSNAVDNTLRIWDVRPFAPYERCVKIISGHQHNFEKNLLRCAWSPDGSK  240
                +  G+  ++  +D T ++WDV       +CV  + GH       +L  A+S  GS+
Sbjct  269  STQFNFAGNLCVTGCIDRTSKLWDVGS----GQCVSTLRGHT----DEILDVAFSTSGSQ  320

Query  241  VSAGSSDRFHYIWDTTSRRILYKLPGHNGSVNDIDFHPKEPIVCSGSSDKQIYLGEIEAA  300
            +   S+D    ++DT +   +  L GH G ++ + F+P+   + S ++DK   +  +E  
Sbjct  321  IVTASADATARVYDTATFNCVASLVGHEGEISKVQFNPQGTKIISAANDKTCRVWSVETG  380

Query  301  Q  301
            Q
Sbjct  381  Q  381


 Score = 100 bits (249),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 63/203 (31%), Positives = 100/203 (49%), Gaps = 5/203 (2%)

Query  3    LEGHQGDIFSLEFHPEGQYLASTGFDRQIFIWNV-YGECENISVLTGHSGAIMELHFSPD  61
            L GH  +I SL F+  G  + +  FD    +W+V  G+C  +  L+ H   I    F+  
Sbjct  218  LLGHTAEIVSLNFNTNGDLILTGSFDTTAKLWDVRTGKC--VHTLSSHRAEISSTQFNFA  275

Query  62   GNHLYTASTDMTLGLWDIAAGTRIKKLKGHTSFVNSVSGARRGLTQLCSGSDDSTIRVWD  121
            GN   T   D T  LWD+ +G  +  L+GHT  +  V+ +  G +Q+ + S D+T RV+D
Sbjct  276  GNLCVTGCIDRTSKLWDVGSGQCVSTLRGHTDEILDVAFSTSG-SQIVTASADATARVYD  334

Query  122  PRKRGQCYTL-NNTYQVTAVTFNDTAEQVISGGIDNDIKVWDLRKNSILYKLKGHSDTIT  180
                    +L  +  +++ V FN    ++IS   D   +VW +     L  L GH+D I 
Sbjct  335  TATFNCVASLVGHEGEISKVQFNPQGTKIISAANDKTCRVWSVETGQNLQTLTGHNDEIF  394

Query  181  GLSLSPDGSYILSNAVDNTLRIW  203
              + + +G  IL+ + DNT  IW
Sbjct  395  SCAFNYEGDTILTGSKDNTCGIW  417



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4782626282


Query= XP_050469421.1 U5 small nuclear ribonucleoprotein 40 kDa protein
isoform X2 [Bombus huntii]

Length=301
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VPL0_DROME  unnamed protein product                                 455     3e-162
WDS_DROME  unnamed protein product                                    147     1e-41 
Q57W14_TRYB2  unnamed protein product                                 139     6e-38 


>Q9VPL0_DROME unnamed protein product
Length=347

 Score = 455 bits (1170),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 198/298 (66%), Positives = 249/298 (84%), Gaps = 0/298 (0%)

Query  1    MLLEGHQGDIFSLEFHPEGQYLASTGFDRQIFIWNVYGECENISVLTGHSGAIMELHFSP  60
            M LEGH+G+IF+ EFHPEG+ L S+GFDRQI+IW VY +CEN+  ++GHSGA+ME HF+P
Sbjct  49   MQLEGHEGEIFTAEFHPEGELLLSSGFDRQIYIWQVYEDCENVMAMSGHSGAVMEAHFTP  108

Query  61   DGNHLYTASTDMTLGLWDIAAGTRIKKLKGHTSFVNSVSGARRGLTQLCSGSDDSTIRVW  120
            DG+H++T STD TL  WDIA G R ++ KGH +FVNSV G+RRG   LCSGSDD TI++W
Sbjct  109  DGSHIFTCSTDKTLAFWDIATGQRQRRFKGHGNFVNSVQGSRRGQQLLCSGSDDRTIKIW  168

Query  121  DPRKRGQCYTLNNTYQVTAVTFNDTAEQVISGGIDNDIKVWDLRKNSILYKLKGHSDTIT  180
            D RK+   +TL + +QVTAV F DT EQVISGGIDN++K+WD+RK ++L+ L+GHSDTIT
Sbjct  169  DARKKHAAHTLESPFQVTAVCFGDTGEQVISGGIDNEVKIWDIRKQAVLHHLRGHSDTIT  228

Query  181  GLSLSPDGSYILSNAVDNTLRIWDVRPFAPYERCVKIISGHQHNFEKNLLRCAWSPDGSK  240
            G+SLSP+G +IL+NA+DNTLR+WDVRP+AP ERCVK+  GHQHNFEKNLLRCAWSP   K
Sbjct  229  GMSLSPEGDFILTNAMDNTLRVWDVRPYAPGERCVKVFQGHQHNFEKNLLRCAWSPGSDK  288

Query  241  VSAGSSDRFHYIWDTTSRRILYKLPGHNGSVNDIDFHPKEPIVCSGSSDKQIYLGEIE  298
            +++GS+DR  YIWD  +RRILYKLPGHNGSVN +DF PKEP++ SGSSDK +YLGEI+
Sbjct  289  ITSGSADRHVYIWDVNTRRILYKLPGHNGSVNAVDFSPKEPLILSGSSDKTLYLGEID  346


 Score = 59.7 bits (143),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 37/129 (29%), Positives = 62/129 (48%), Gaps = 12/129 (9%)

Query  169  LYKLKGHSDTITGLSLSPDGSYILSNAVDNTLRIWDVRPFAPYERC--VKIISGHQHNFE  226
            + +L+GH   I      P+G  +LS+  D  + IW V     YE C  V  +SGH     
Sbjct  48   IMQLEGHEGEIFTAEFHPEGELLLSSGFDRQIYIWQV-----YEDCENVMAMSGH----S  98

Query  227  KNLLRCAWSPDGSKVSAGSSDRFHYIWDTTSRRILYKLPGHNGSVNDIDFHPK-EPIVCS  285
              ++   ++PDGS +   S+D+    WD  + +   +  GH   VN +    + + ++CS
Sbjct  99   GAVMEAHFTPDGSHIFTCSTDKTLAFWDIATGQRQRRFKGHGNFVNSVQGSRRGQQLLCS  158

Query  286  GSSDKQIYL  294
            GS D+ I +
Sbjct  159  GSDDRTIKI  167


 Score = 33.5 bits (75),  Expect = 0.19, Method: Compositional matrix adjust.
 Identities = 31/126 (25%), Positives = 50/126 (40%), Gaps = 10/126 (8%)

Query  186  PDGSYILSNAVD---NTLRIWDVRPFAPYERCVKIISGHQ------HNFEKNLLRCAWSP  236
            P+ S IL+       N L  +  R  A  E  V+  S  Q         E  +    + P
Sbjct  6    PNNSVILAQEAKRSKNDLMAYTNRDKALLESGVRRTSNLQAPIMQLEGHEGEIFTAEFHP  65

Query  237  DGSKVSAGSSDRFHYIWDTTSR-RILYKLPGHNGSVNDIDFHPKEPIVCSGSSDKQIYLG  295
            +G  + +   DR  YIW        +  + GH+G+V +  F P    + + S+DK +   
Sbjct  66   EGELLLSSGFDRQIYIWQVYEDCENVMAMSGHSGAVMEAHFTPDGSHIFTCSTDKTLAFW  125

Query  296  EIEAAQ  301
            +I   Q
Sbjct  126  DIATGQ  131


>WDS_DROME unnamed protein product
Length=361

 Score = 147 bits (371),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 97/299 (32%), Positives = 159/299 (53%), Gaps = 17/299 (6%)

Query  3    LEGHQGDIFSLEFHPEGQYLASTGFDRQIFIWNVY-GECENISVLTGHSGAIMELHFSPD  61
            L GH   + +++F P G++LAS+  D+ I IW  Y G+ E    ++GH   I ++ +S D
Sbjct  68   LAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEK--TISGHKLGISDVAWSSD  125

Query  62   GNHLYTASTDMTLGLWDIAAGTRIKKLKGHTSFVNSVSGARRGLTQLCSGSDDSTIRVWD  121
               L + S D TL +W+++ G  +K LKGH+++V   +   +    + SGS D ++R+WD
Sbjct  126  SRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQS-NLIVSGSFDESVRIWD  184

Query  122  PRKRGQCYTLNNTYQ--VTAVTFNDTAEQVISGGIDNDIKVWDLRKNSILYKL-KGHSDT  178
             R  G+C      +   V+AV FN     ++S   D   ++WD      L  L    +  
Sbjct  185  VR-TGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPP  243

Query  179  ITGLSLSPDGSYILSNAVDNTLRIWDVRPFAPYERCVKIISGHQHNFEKNLLRCAWSPDG  238
            ++ +  SP+G YIL+  +DNTL++WD        +C+K  +GH++  EK  +   +S  G
Sbjct  244  VSFVKFSPNGKYILAATLDNTLKLWDYS----KGKCLKTYTGHKN--EKYCIFANFSVTG  297

Query  239  SK-VSAGSSDRFHYIWDTTSRRILYKLPGHNGSVNDIDFHPKEPIVCSGS--SDKQIYL  294
             K + +GS D   YIW+  S+ ++ KL GH  +V     HP E I+ S +  +DK I L
Sbjct  298  GKWIVSGSEDNMVYIWNLQSKEVVQKLQGHTDTVLCTACHPTENIIASAALENDKTIKL  356


 Score = 96.7 bits (239),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 63/213 (30%), Positives = 111/213 (52%), Gaps = 19/213 (9%)

Query  3    LEGHQGDIFSLEFHPEGQYLASTGFDRQIFIWNV-YGECENISVLTGHSGAIMELHFSPD  61
            L+GH   +F   F+P+   + S  FD  + IW+V  G+C  +  L  HS  +  +HF+ D
Sbjct  152  LKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKC--LKTLPAHSDPVSAVHFNRD  209

Query  62   GNHLYTASTDMTLGLWDIAAGTRIKKL----KGHTSFVNSVSGARRGLTQLCSGSDDSTI  117
            G+ + ++S D    +WD A+G  +K L        SFV      +  L    + + D+T+
Sbjct  210  GSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYIL----AATLDNTL  265

Query  118  RVWDPRKRGQC---YT--LNNTYQVTAVTFNDTAEQVISGGIDNDIKVWDLRKNSILYKL  172
            ++WD   +G+C   YT   N  Y + A       + ++SG  DN + +W+L+   ++ KL
Sbjct  266  KLWD-YSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQSKEVVQKL  324

Query  173  KGHSDTITGLSLSPDGSYILSNAVDN--TLRIW  203
            +GH+DT+   +  P  + I S A++N  T+++W
Sbjct  325  QGHTDTVLCTACHPTENIIASAALENDKTIKLW  357


 Score = 64.7 bits (156),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/136 (26%), Positives = 72/136 (53%), Gaps = 10/136 (7%)

Query  167  SILYKLKGHSDTITGLSLSPDGSYILSNAVDNTLRIWDVRPFAPYE-RCVKIISGHQHNF  225
            ++ + L GH+  ++ +  SP+G ++ S++ D  ++IW       Y+ +  K ISGH+   
Sbjct  63   TLKFTLAGHTKAVSAVKFSPNGEWLASSSADKLIKIW-----GAYDGKFEKTISGHKLGI  117

Query  226  EKNLLRCAWSPDGSKVSAGSSDRFHYIWDTTSRRILYKLPGHNGSVNDIDFHPKEPIVCS  285
                   AWS D   + +GS D+   +W+ ++ + L  L GH+  V   +F+P+  ++ S
Sbjct  118  SD----VAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSNLIVS  173

Query  286  GSSDKQIYLGEIEAAQ  301
            GS D+ + + ++   +
Sbjct  174  GSFDESVRIWDVRTGK  189


 Score = 41.6 bits (96),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/123 (21%), Positives = 60/123 (49%), Gaps = 5/123 (4%)

Query  2    LLEGHQGDIFSLEFHPEGQYLASTGFDRQIFIWNVYGECENISVLTGHSGA--IMELHFS  59
            L++     +  ++F P G+Y+ +   D  + +W+ Y + + +   TGH      +  +FS
Sbjct  236  LIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWD-YSKGKCLKTYTGHKNEKYCIFANFS  294

Query  60   PDGNH-LYTASTDMTLGLWDIAAGTRIKKLKGHT-SFVNSVSGARRGLTQLCSGSDDSTI  117
              G   + + S D  + +W++ +   ++KL+GHT + + +       +    +  +D TI
Sbjct  295  VTGGKWIVSGSEDNMVYIWNLQSKEVVQKLQGHTDTVLCTACHPTENIIASAALENDKTI  354

Query  118  RVW  120
            ++W
Sbjct  355  KLW  357


>Q57W14_TRYB2 unnamed protein product
Length=419

 Score = 139 bits (349),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 83/290 (29%), Positives = 150/290 (52%), Gaps = 14/290 (5%)

Query  3    LEGHQGDIFSLEFH-PEGQYLASTGFDRQIFIWNV-YGECENISVLTGHSGAIMELHFSP  60
            LEGH+  ++S+ F+ P G  +A+  FD+   IW+    +C     L GH   I+ + F+P
Sbjct  133  LEGHRNVVYSVSFNNPYGNRVATGSFDKTCKIWDARTAQC--YCTLAGHMAEIVCMSFNP  190

Query  61   DGNHLYTASTDMTLGLWDIAAGTRIKKLKGHTSFVNSVSGARRGLTQLCSGSDDSTIRVW  120
               HL + S D T  +W++  G  +  L GHT+ + S++    G   + +GS D+T ++W
Sbjct  191  QSTHLSSGSMDYTAKVWNVETGQELYTLLGHTAEIVSLNFNTNG-DLILTGSFDTTAKLW  249

Query  121  DPRKRGQCYTLNN-TYQVTAVTFNDTAEQVISGGIDNDIKVWDLRKNSILYKLKGHSDTI  179
            D R     +TL++   ++++  FN      ++G ID   K+WD+     +  L+GH+D I
Sbjct  250  DVRTGKCVHTLSSHRAEISSTQFNFAGNLCVTGCIDRTSKLWDVGSGQCVSTLRGHTDEI  309

Query  180  TGLSLSPDGSYILSNAVDNTLRIWDVRPFAPYERCVKIISGHQHNFEKNLLRCAWSPDGS  239
              ++ S  GS I++ + D T R++D   F     CV  + GH    E  + +  ++P G+
Sbjct  310  LDVAFSTSGSQIVTASADATARVYDTATF----NCVASLVGH----EGEISKVQFNPQGT  361

Query  240  KVSAGSSDRFHYIWDTTSRRILYKLPGHNGSVNDIDFHPKEPIVCSGSSD  289
            K+ + ++D+   +W   + + L  L GHN  +    F+ +   + +GS D
Sbjct  362  KIISAANDKTCRVWSVETGQNLQTLTGHNDEIFSCAFNYEGDTILTGSKD  411


 Score = 127 bits (318),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 80/301 (27%), Positives = 142/301 (47%), Gaps = 12/301 (4%)

Query  3    LEGHQGDIFSLEFHPEGQYLASTGFDRQIFIWNVYGECENISVLTGHSGAIMELHFS-PD  61
            L  H   + +  F+  G    +  +DR   +W+     E +S L GH   +  + F+ P 
Sbjct  91   LRAHMLPLTNCAFNKGGDSFITGSYDRTCKVWDTATGNEIVS-LEGHRNVVYSVSFNNPY  149

Query  62   GNHLYTASTDMTLGLWDIAAGTRIKKLKGHTSFVNSVSGARRGLTQLCSGSDDSTIRVWD  121
            GN + T S D T  +WD         L GH + +  +S   +  T L SGS D T +VW+
Sbjct  150  GNRVATGSFDKTCKIWDARTAQCYCTLAGHMAEIVCMSFNPQS-THLSSGSMDYTAKVWN  208

Query  122  PRKRGQCYTL-NNTYQVTAVTFNDTAEQVISGGIDNDIKVWDLRKNSILYKLKGHSDTIT  180
                 + YTL  +T ++ ++ FN   + +++G  D   K+WD+R    ++ L  H   I+
Sbjct  209  VETGQELYTLLGHTAEIVSLNFNTNGDLILTGSFDTTAKLWDVRTGKCVHTLSSHRAEIS  268

Query  181  GLSLSPDGSYILSNAVDNTLRIWDVRPFAPYERCVKIISGHQHNFEKNLLRCAWSPDGSK  240
                +  G+  ++  +D T ++WDV       +CV  + GH       +L  A+S  GS+
Sbjct  269  STQFNFAGNLCVTGCIDRTSKLWDVGS----GQCVSTLRGHT----DEILDVAFSTSGSQ  320

Query  241  VSAGSSDRFHYIWDTTSRRILYKLPGHNGSVNDIDFHPKEPIVCSGSSDKQIYLGEIEAA  300
            +   S+D    ++DT +   +  L GH G ++ + F+P+   + S ++DK   +  +E  
Sbjct  321  IVTASADATARVYDTATFNCVASLVGHEGEISKVQFNPQGTKIISAANDKTCRVWSVETG  380

Query  301  Q  301
            Q
Sbjct  381  Q  381


 Score = 100 bits (249),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 63/203 (31%), Positives = 100/203 (49%), Gaps = 5/203 (2%)

Query  3    LEGHQGDIFSLEFHPEGQYLASTGFDRQIFIWNV-YGECENISVLTGHSGAIMELHFSPD  61
            L GH  +I SL F+  G  + +  FD    +W+V  G+C  +  L+ H   I    F+  
Sbjct  218  LLGHTAEIVSLNFNTNGDLILTGSFDTTAKLWDVRTGKC--VHTLSSHRAEISSTQFNFA  275

Query  62   GNHLYTASTDMTLGLWDIAAGTRIKKLKGHTSFVNSVSGARRGLTQLCSGSDDSTIRVWD  121
            GN   T   D T  LWD+ +G  +  L+GHT  +  V+ +  G +Q+ + S D+T RV+D
Sbjct  276  GNLCVTGCIDRTSKLWDVGSGQCVSTLRGHTDEILDVAFSTSG-SQIVTASADATARVYD  334

Query  122  PRKRGQCYTL-NNTYQVTAVTFNDTAEQVISGGIDNDIKVWDLRKNSILYKLKGHSDTIT  180
                    +L  +  +++ V FN    ++IS   D   +VW +     L  L GH+D I 
Sbjct  335  TATFNCVASLVGHEGEISKVQFNPQGTKIISAANDKTCRVWSVETGQNLQTLTGHNDEIF  394

Query  181  GLSLSPDGSYILSNAVDNTLRIW  203
              + + +G  IL+ + DNT  IW
Sbjct  395  SCAFNYEGDTILTGSKDNTCGIW  417



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4782626282


Query= XP_050469422.1 40S ribosomal protein S6-like isoform X1 [Bombus
huntii]

Length=251
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RS6_DROME  unnamed protein product                                    376     2e-133
RS6_CAEEL  unnamed protein product                                    286     5e-98 
Q8IDR9_PLAF7  unnamed protein product                                 258     8e-86 


>RS6_DROME unnamed protein product
Length=248

 Score = 376 bits (966),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 185/239 (77%), Positives = 213/239 (89%), Gaps = 2/239 (1%)

Query  1    MKLNVSYPATGCQKLFEISDEHKLRIFYEKRMGAEVEADALGNEWKGYVVRISGGNDKQG  60
            MKLNVSYPATGCQKLFE+ DEHKLR+FYEKRMG  VEAD LG+EWKGY +RI+GGNDKQG
Sbjct  1    MKLNVSYPATGCQKLFEVVDEHKLRVFYEKRMGQVVEADILGDEWKGYQLRIAGGNDKQG  60

Query  61   FPMKQGVLTNGRVRLLLSKGHSCYRPRRDGERKRKSVRGCIVDSNLSVLALVIVKKGEKD  120
            FPMKQGVLT+GRVRLLL KGHSCYRPRR GERKRKSVRGCIVD+N+SVLALV++KKGEKD
Sbjct  61   FPMKQGVLTHGRVRLLLKKGHSCYRPRRTGERKRKSVRGCIVDANMSVLALVVLKKGEKD  120

Query  121  IPDLTDKEVPRRLGPKRASKIRKLFNLSKEDDVRRFVVKRPI-QKEGKPQRSKAPKIQRL  179
            IP LTD  +PRRLGPKRASKIRKL+NLSKEDDVRRFVV+RP+  K+ K   SKAPKIQRL
Sbjct  121  IPGLTDTTIPRRLGPKRASKIRKLYNLSKEDDVRRFVVRRPLPAKDNKKATSKAPKIQRL  180

Query  180  ITPLTLQRKRHRLALKRRRCLARKQQAAEYAKLLAQRQKEAKNRRQEELKRRRSASMRD  238
            ITP+ LQRK  R+ALK++R +A K+ +A+YAKLL QR+KE+K +R EE KRRRSAS+R+
Sbjct  181  ITPVVLQRKHRRIALKKKRQIASKEASADYAKLLVQRKKESKAKR-EEAKRRRSASIRE  238


>RS6_CAEEL unnamed protein product
Length=246

 Score = 286 bits (733),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 140/219 (64%), Positives = 170/219 (78%), Gaps = 0/219 (0%)

Query  1    MKLNVSYPATGCQKLFEISDEHKLRIFYEKRMGAEVEADALGNEWKGYVVRISGGNDKQG  60
            M+LN +YPATG QK FE+ +E KLR+F+EKRM  EV  DALG+EWKGYVVRI GGNDKQG
Sbjct  1    MRLNFAYPATGLQKSFEVDEEKKLRLFFEKRMSQEVAIDALGDEWKGYVVRIGGGNDKQG  60

Query  61   FPMKQGVLTNGRVRLLLSKGHSCYRPRRDGERKRKSVRGCIVDSNLSVLALVIVKKGEKD  120
            FPMKQG+LTNGRVRLLL KG SCYR R++GERKRKSVRGCIVD+N+S L+LVIVKKG+ +
Sbjct  61   FPMKQGILTNGRVRLLLKKGQSCYRERKNGERKRKSVRGCIVDANMSALSLVIVKKGDGE  120

Query  121  IPDLTDKEVPRRLGPKRASKIRKLFNLSKEDDVRRFVVKRPIQKEGKPQRSKAPKIQRLI  180
            I  LTD  +PR+LGPKRASKIRKLFNL+K DDV ++V+           ++ APKIQRLI
Sbjct  121  IEGLTDSVLPRKLGPKRASKIRKLFNLTKHDDVTKYVITHDKTFPDGVTKTIAPKIQRLI  180

Query  181  TPLTLQRKRHRLALKRRRCLARKQQAAEYAKLLAQRQKE  219
            TP  + RK++ L  KR + +  +  AA Y KLLA+  KE
Sbjct  181  TPARIARKKYLLRQKRNQKIKMRDDAAAYHKLLAKYSKE  219


>Q8IDR9_PLAF7 unnamed protein product
Length=306

 Score = 258 bits (658),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 134/219 (61%), Positives = 157/219 (72%), Gaps = 1/219 (0%)

Query  1    MKLNVSYPATGCQKLFEISDEHKLRIFYEKRMGAEVEADALGNEWKGYVVRISGGNDKQG  60
            MKLN+S P    QK  EI DE KL  F EKR+G  V  D++G E+ GYV RI+GGNDKQG
Sbjct  1    MKLNISNPLNNVQKSIEIDDEKKLLPFMEKRIGNAVPGDSIGEEFTGYVFRITGGNDKQG  60

Query  61   FPMKQGVLTNGRVRLLLSKGHSCYRPRRDGERKRKSVRGCIVDSNLSVLALVIVKKGEKD  120
            FPM QGVLTN RVRLL  KG  CYRPR+ GERKRKSVRGCIV  +LS L L +VKKG  +
Sbjct  61   FPMIQGVLTNNRVRLLFKKGMKCYRPRKKGERKRKSVRGCIVGQDLSALNLTLVKKGVNE  120

Query  121  IPDLTDKEVPRRLGPKRASKIRKLFNLSKEDDVRRFVVKRPIQKEGKPQRSKAPKIQRLI  180
            IP LTDK V ++LGPKRASKIRKLFNL K DDVR++V+ R I K GK +  K PKIQRL+
Sbjct  121  IPGLTDKAVGKKLGPKRASKIRKLFNLDKSDDVRKYVIGRAITKNGKTKFIK-PKIQRLV  179

Query  181  TPLTLQRKRHRLALKRRRCLARKQQAAEYAKLLAQRQKE  219
            T   L RKR+ L  K +R L +KQQ  EY +LL + + E
Sbjct  180  TEKRLLRKRNLLQAKEKRRLEKKQQLKEYKQLLNKYRSE  218



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4782626282


Query= XP_050469423.1 40S ribosomal protein S6-like isoform X2 [Bombus
huntii]

Length=220
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RS6_DROME  unnamed protein product                                    313     7e-109
RS6_CAEEL  unnamed protein product                                    242     5e-81 
Q8IDR9_PLAF7  unnamed protein product                                 225     1e-73 


>RS6_DROME unnamed protein product
Length=248

 Score = 313 bits (801),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 157/208 (75%), Positives = 183/208 (88%), Gaps = 2/208 (1%)

Query  1    MGAEVEADALGNEWKGYVVRISGGNDKQGFPMKQGVLTNGRVRLLLSKGHSCYRPRRDGE  60
            MG  VEAD LG+EWKGY +RI+GGNDKQGFPMKQGVLT+GRVRLLL KGHSCYRPRR GE
Sbjct  32   MGQVVEADILGDEWKGYQLRIAGGNDKQGFPMKQGVLTHGRVRLLLKKGHSCYRPRRTGE  91

Query  61   RKRKSVRGCIVDSNLSVLALVIVKKGEKDIPDLTDKEVPRRLGPKRASKIRKLFNLSKED  120
            RKRKSVRGCIVD+N+SVLALV++KKGEKDIP LTD  +PRRLGPKRASKIRKL+NLSKED
Sbjct  92   RKRKSVRGCIVDANMSVLALVVLKKGEKDIPGLTDTTIPRRLGPKRASKIRKLYNLSKED  151

Query  121  DVRRFVVKRPI-QKEGKPQRSKAPKIQRLITPLTLQRKRHRLALKRRRCLARKQQAAEYA  179
            DVRRFVV+RP+  K+ K   SKAPKIQRLITP+ LQRK  R+ALK++R +A K+ +A+YA
Sbjct  152  DVRRFVVRRPLPAKDNKKATSKAPKIQRLITPVVLQRKHRRIALKKKRQIASKEASADYA  211

Query  180  KLLAQRQKEAKNRRQEELKRRRSASMRD  207
            KLL QR+KE+K +R EE KRRRSAS+R+
Sbjct  212  KLLVQRKKESKAKR-EEAKRRRSASIRE  238


>RS6_CAEEL unnamed protein product
Length=246

 Score = 242 bits (617),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 144/188 (77%), Gaps = 0/188 (0%)

Query  1    MGAEVEADALGNEWKGYVVRISGGNDKQGFPMKQGVLTNGRVRLLLSKGHSCYRPRRDGE  60
            M  EV  DALG+EWKGYVVRI GGNDKQGFPMKQG+LTNGRVRLLL KG SCYR R++GE
Sbjct  32   MSQEVAIDALGDEWKGYVVRIGGGNDKQGFPMKQGILTNGRVRLLLKKGQSCYRERKNGE  91

Query  61   RKRKSVRGCIVDSNLSVLALVIVKKGEKDIPDLTDKEVPRRLGPKRASKIRKLFNLSKED  120
            RKRKSVRGCIVD+N+S L+LVIVKKG+ +I  LTD  +PR+LGPKRASKIRKLFNL+K D
Sbjct  92   RKRKSVRGCIVDANMSALSLVIVKKGDGEIEGLTDSVLPRKLGPKRASKIRKLFNLTKHD  151

Query  121  DVRRFVVKRPIQKEGKPQRSKAPKIQRLITPLTLQRKRHRLALKRRRCLARKQQAAEYAK  180
            DV ++V+           ++ APKIQRLITP  + RK++ L  KR + +  +  AA Y K
Sbjct  152  DVTKYVITHDKTFPDGVTKTIAPKIQRLITPARIARKKYLLRQKRNQKIKMRDDAAAYHK  211

Query  181  LLAQRQKE  188
            LLA+  KE
Sbjct  212  LLAKYSKE  219


>Q8IDR9_PLAF7 unnamed protein product
Length=306

 Score = 225 bits (574),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/188 (62%), Positives = 138/188 (73%), Gaps = 1/188 (1%)

Query  1    MGAEVEADALGNEWKGYVVRISGGNDKQGFPMKQGVLTNGRVRLLLSKGHSCYRPRRDGE  60
            +G  V  D++G E+ GYV RI+GGNDKQGFPM QGVLTN RVRLL  KG  CYRPR+ GE
Sbjct  32   IGNAVPGDSIGEEFTGYVFRITGGNDKQGFPMIQGVLTNNRVRLLFKKGMKCYRPRKKGE  91

Query  61   RKRKSVRGCIVDSNLSVLALVIVKKGEKDIPDLTDKEVPRRLGPKRASKIRKLFNLSKED  120
            RKRKSVRGCIV  +LS L L +VKKG  +IP LTDK V ++LGPKRASKIRKLFNL K D
Sbjct  92   RKRKSVRGCIVGQDLSALNLTLVKKGVNEIPGLTDKAVGKKLGPKRASKIRKLFNLDKSD  151

Query  121  DVRRFVVKRPIQKEGKPQRSKAPKIQRLITPLTLQRKRHRLALKRRRCLARKQQAAEYAK  180
            DVR++V+ R I K GK +  K PKIQRL+T   L RKR+ L  K +R L +KQQ  EY +
Sbjct  152  DVRKYVIGRAITKNGKTKFIK-PKIQRLVTEKRLLRKRNLLQAKEKRRLEKKQQLKEYKQ  210

Query  181  LLAQRQKE  188
            LL + + E
Sbjct  211  LLNKYRSE  218



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4782626282


Query= XP_050469424.1 mediator of RNA polymerase II transcription subunit
19 [Bombus huntii]

Length=242
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MED19_DROME  unnamed protein product                                  223     8e-72


>MED19_DROME unnamed protein product
Length=337

 Score = 223 bits (567),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 148/224 (66%), Positives = 180/224 (80%), Gaps = 4/224 (2%)

Query  15   SPKSSPRGA-RSPVVSRQDSTGTLKTTISLGKNPSIVHSGPFYLMKEPPGESELTGATNL  73
            SPKSSP G  RSPVV+RQDS+GTLKTTISLGK P+I+H+GPFY MKEPP ++ELTG  +L
Sbjct  11   SPKSSPHGGGRSPVVARQDSSGTLKTTISLGKTPTIIHTGPFYSMKEPPAKAELTGDKDL  70

Query  74   MTYYGLEHSYSKFSGKKLKEQLSSFLPNLPGIIDRPGH-LDNSSLRSVIEKPPIGGKDLI  132
            MT YGL H+ +KF  KK KE L+SFL N+PGI D   H ++NS+LRSVIEKPPIGGK+L+
Sbjct  71   MTEYGLHHTLTKFKEKKFKESLASFLQNIPGINDLITHPVENSTLRSVIEKPPIGGKELL  130

Query  133  PLTSVQLAGFRLHPGPLPEQYRYVNQAPQRKHKNKHKKHKHKPGEVPSGQEATATDIGGS  192
            PLT VQLAGFRLHPGPLPEQYR     P RKHKNKHKK KHK G V +GQE+T  D  G 
Sbjct  131  PLTPVQLAGFRLHPGPLPEQYRTTYVTPARKHKNKHKKQKHKDG-VTTGQESTLLDSAGL  189

Query  193  DTHEKKHKKQKRHDEEKEARKKRKKEKKRKKQKHSPEYSGGLTP  236
            +T+EKKHKKQKRH+++KE +K++K++K++KK + SPE   GL P
Sbjct  190  ETYEKKHKKQKRHEDDKERKKRKKEKKRKKKNQ-SPEPGVGLLP  232



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4782626282


Query= XP_050469425.1 mediator of RNA polymerase II transcription subunit
19 [Bombus huntii]

Length=242
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MED19_DROME  unnamed protein product                                  223     8e-72


>MED19_DROME unnamed protein product
Length=337

 Score = 223 bits (567),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 148/224 (66%), Positives = 180/224 (80%), Gaps = 4/224 (2%)

Query  15   SPKSSPRGA-RSPVVSRQDSTGTLKTTISLGKNPSIVHSGPFYLMKEPPGESELTGATNL  73
            SPKSSP G  RSPVV+RQDS+GTLKTTISLGK P+I+H+GPFY MKEPP ++ELTG  +L
Sbjct  11   SPKSSPHGGGRSPVVARQDSSGTLKTTISLGKTPTIIHTGPFYSMKEPPAKAELTGDKDL  70

Query  74   MTYYGLEHSYSKFSGKKLKEQLSSFLPNLPGIIDRPGH-LDNSSLRSVIEKPPIGGKDLI  132
            MT YGL H+ +KF  KK KE L+SFL N+PGI D   H ++NS+LRSVIEKPPIGGK+L+
Sbjct  71   MTEYGLHHTLTKFKEKKFKESLASFLQNIPGINDLITHPVENSTLRSVIEKPPIGGKELL  130

Query  133  PLTSVQLAGFRLHPGPLPEQYRYVNQAPQRKHKNKHKKHKHKPGEVPSGQEATATDIGGS  192
            PLT VQLAGFRLHPGPLPEQYR     P RKHKNKHKK KHK G V +GQE+T  D  G 
Sbjct  131  PLTPVQLAGFRLHPGPLPEQYRTTYVTPARKHKNKHKKQKHKDG-VTTGQESTLLDSAGL  189

Query  193  DTHEKKHKKQKRHDEEKEARKKRKKEKKRKKQKHSPEYSGGLTP  236
            +T+EKKHKKQKRH+++KE +K++K++K++KK + SPE   GL P
Sbjct  190  ETYEKKHKKQKRHEDDKERKKRKKEKKRKKKNQ-SPEPGVGLLP  232



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4782626282


Query= XP_050469426.1 protein abrupt-like [Bombus huntii]

Length=503
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

BAB1_DROME  unnamed protein product                                   114     2e-26
LOLAL_DROME  unnamed protein product                                  100     6e-25
BAB2_DROME  unnamed protein product                                   108     1e-24


>BAB1_DROME unnamed protein product
Length=977

 Score = 114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 76/118 (64%), Gaps = 0/118 (0%)

Query  12   QSYWFKWNDYQNHLSDVVRQLLEEDCMVDVTLAAGGERIHAHRIVLCACSTLFREILSQV  71
            Q +  +WN+YQ +L+ +  QLL+ +C VDVTLA  G  + AH++VL ACS  F+ +L++ 
Sbjct  100  QQFCLRWNNYQTNLTTIFDQLLQNECFVDVTLACDGRSMKAHKMVLSACSPYFQTLLAET  159

Query  72   NEDHPTIILSDISAQDIKSIIEFTYHGEVRVPVENISTLLDAARSLKICGLIEIDGLE  129
               HP +I+ D++  D+K+I+EF Y GE+ V  + I  LL  A  LK+ GL ++  +E
Sbjct  160  PCQHPIVIMRDVNWSDLKAIVEFMYRGEINVSQDQIGPLLRIAEMLKVRGLADVTHME  217


>LOLAL_DROME unnamed protein product
Length=127

 Score = 100 bits (248),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 67/114 (59%), Gaps = 0/114 (0%)

Query  11   NQSYWFKWNDYQNHLSDVVRQLLEEDCMVDVTLAAGGERIHAHRIVLCACSTLFREILSQ  70
            +Q ++ KWND+Q ++    R L +E    DVTLA  G+   AH++VL ACS  F+ +L +
Sbjct  5    DQQFFLKWNDFQTNMVTSFRHLRDEKSFTDVTLACEGQTCKAHKMVLSACSPYFKALLEE  64

Query  71   VNEDHPTIILSDISAQDIKSIIEFTYHGEVRVPVENISTLLDAARSLKICGLIE  124
                HP IIL D+S   +++I+EF Y GEV V  E +   L  A  LK+ GL E
Sbjct  65   NPSKHPIIILKDVSYIHLQAILEFMYAGEVNVSQEQLPAFLKTADRLKVKGLAE  118


>BAB2_DROME unnamed protein product
Length=1067

 Score = 108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 74/115 (64%), Gaps = 0/115 (0%)

Query  11   NQSYWFKWNDYQNHLSDVVRQLLEEDCMVDVTLAAGGERIHAHRIVLCACSTLFREILSQ  70
             Q +  +WN+YQ++L++V  +LL+ +  VDVTL+  G  I AH++VL ACS  F+ +   
Sbjct  195  GQQFCLRWNNYQSNLTNVFDELLQSESFVDVTLSCEGHSIKAHKMVLSACSPYFQALFYD  254

Query  71   VNEDHPTIILSDISAQDIKSIIEFTYHGEVRVPVENISTLLDAARSLKICGLIEI  125
                HP II+ D+S  D+K+++EF Y GE+ V  + I+ LL  A +LKI GL E+
Sbjct  255  NPCQHPIIIMRDVSWSDLKALVEFMYKGEINVCQDQINPLLKVAETLKIRGLAEV  309



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4782626282


Query= XP_050469427.1 mediator of RNA polymerase II transcription subunit
19 [Bombus huntii]

Length=242
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MED19_DROME  unnamed protein product                                  223     8e-72


>MED19_DROME unnamed protein product
Length=337

 Score = 223 bits (567),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 148/224 (66%), Positives = 180/224 (80%), Gaps = 4/224 (2%)

Query  15   SPKSSPRGA-RSPVVSRQDSTGTLKTTISLGKNPSIVHSGPFYLMKEPPGESELTGATNL  73
            SPKSSP G  RSPVV+RQDS+GTLKTTISLGK P+I+H+GPFY MKEPP ++ELTG  +L
Sbjct  11   SPKSSPHGGGRSPVVARQDSSGTLKTTISLGKTPTIIHTGPFYSMKEPPAKAELTGDKDL  70

Query  74   MTYYGLEHSYSKFSGKKLKEQLSSFLPNLPGIIDRPGH-LDNSSLRSVIEKPPIGGKDLI  132
            MT YGL H+ +KF  KK KE L+SFL N+PGI D   H ++NS+LRSVIEKPPIGGK+L+
Sbjct  71   MTEYGLHHTLTKFKEKKFKESLASFLQNIPGINDLITHPVENSTLRSVIEKPPIGGKELL  130

Query  133  PLTSVQLAGFRLHPGPLPEQYRYVNQAPQRKHKNKHKKHKHKPGEVPSGQEATATDIGGS  192
            PLT VQLAGFRLHPGPLPEQYR     P RKHKNKHKK KHK G V +GQE+T  D  G 
Sbjct  131  PLTPVQLAGFRLHPGPLPEQYRTTYVTPARKHKNKHKKQKHKDG-VTTGQESTLLDSAGL  189

Query  193  DTHEKKHKKQKRHDEEKEARKKRKKEKKRKKQKHSPEYSGGLTP  236
            +T+EKKHKKQKRH+++KE +K++K++K++KK + SPE   GL P
Sbjct  190  ETYEKKHKKQKRHEDDKERKKRKKEKKRKKKNQ-SPEPGVGLLP  232



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4782626282


Query= XP_050469428.1 probable Bax inhibitor 1 [Bombus huntii]

Length=236
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

BI1_DROME  unnamed protein product                                    186     7e-59
Q9VYT4_DROME  unnamed protein product                                 29.3    3.6  
Q8T9B4_DROME  unnamed protein product                                 28.1    8.6  


>BI1_DROME unnamed protein product
Length=245

 Score = 186 bits (473),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 101/231 (44%), Positives = 144/231 (62%), Gaps = 1/231 (0%)

Query  6    NTFVNSFTKKLEPPVRQHLKNVYGCLSMSMLSAAGGVYIHMFSELLRANLLTTLGTLGLL  65
             TF+N    + EP VR+HL  VY  L  +  + A G  + M  + L   +L  + TL L+
Sbjct  13   QTFMNGLGDRYEPYVREHLSKVYMVLGSTAAATAMGAMLQM-RDFLDLGVLAAVATLVLV  71

Query  66   FTLINTPDNGKNQKLRLSYLLGFAFFSGLGLGPLLQLVMSVNPTVIVTALIGTIVIFVSF  125
              L    D+GKN   RL  L  F F SG  LGPLL  + S+NP +I++AL GT V F+S 
Sbjct  72   LGLHFYKDDGKNYYTRLGMLYAFGFCSGQTLGPLLGYICSINPAIILSALTGTFVTFISL  131

Query  126  SISSLLAERGRWLYLGGTLISLLNIMVLFSFVNLFLRWTIFYQAYLYIGLFLMCGFVIYD  185
            S+S+LLAE+G++LYLGG L+S++N M L S  N+  +        LY+G+F+M  F++YD
Sbjct  132  SLSALLAEQGKYLYLGGMLVSVINTMALLSLFNMVFKSYFVQVTQLYVGVFVMAAFIVYD  191

Query  186  TQLIIEKYHMGSKDFILHSLDLFVDFVNIFRHLLIILTQKEILKDQRKRRD  236
            TQ I+EK   G++D + H+LDLF D +++FR LLIILTQKE  K   +R++
Sbjct  192  TQNIVEKCRNGNRDVVQHALDLFFDVLSMFRRLLIILTQKEERKQNERRQN  242


>Q9VYT4_DROME unnamed protein product
Length=1254

 Score = 29.3 bits (64),  Expect = 3.6, Method: Composition-based stats.
 Identities = 16/60 (27%), Positives = 31/60 (52%), Gaps = 1/60 (2%)

Query  20   VRQHLKNVYGCLSMSMLSAAGGVYIHMFSELLRA-NLLTTLGTLGLLFTLINTPDNGKNQ  78
            + +H K +YG  S+ +   A    +   + ++ A N+  ++  LG    LI+ PDNG+ +
Sbjct  226  IEKHCKKIYGLDSILVALLAAKAEVKFNANVVTAENIAKSITELGFPTELIDEPDNGEAE  285


>Q8T9B4_DROME unnamed protein product
Length=985

 Score = 28.1 bits (61),  Expect = 8.6, Method: Compositional matrix adjust.
 Identities = 22/76 (29%), Positives = 36/76 (47%), Gaps = 12/76 (16%)

Query  69   INTPD---NGKNQKLRLSYLLGFAFFSGLGLGPLLQLVMSVNPTVIVTALIGTIVIFVSF  125
            +N+PD   NG N +++   +LG    +G G   L+Q ++   P     A  G I +  S 
Sbjct  86   VNSPDYSLNGVNLRVQPGTMLGIVGRTGSGKSSLIQAILGELP-----AESGEIKVNGSM  140

Query  126  SISSLLAERGRWLYLG  141
            S +S    +  WL+ G
Sbjct  141  SYAS----QEPWLFSG  152



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4782626282


Query= XP_050469429.1 uncharacterized protein LOC126863376 [Bombus huntii]

Length=225
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

HSP7A_CAEEL  unnamed protein product                                  28.9    4.3  
G5EBH3_CAEEL  unnamed protein product                                 28.5    5.8  
Q8IRS0_DROME  unnamed protein product                                 28.1    8.6  


>HSP7A_CAEEL unnamed protein product
Length=640

 Score = 28.9 bits (63),  Expect = 4.3, Method: Compositional matrix adjust.
 Identities = 17/57 (30%), Positives = 28/57 (49%), Gaps = 0/57 (0%)

Query  141  YDNITRTSKQEGKENILETLKNSVEKSNYPSSRLNKQIYNLILKEGQKECEATQKLL  197
            Y NITR   +E   ++  +  + VEKS   +     Q+++++L  G       QKLL
Sbjct  295  YTNITRARFEELCADLFRSTMDPVEKSLRDAKMDKSQVHDIVLVGGSTRIPKVQKLL  351


>G5EBH3_CAEEL unnamed protein product
Length=3953

 Score = 28.5 bits (62),  Expect = 5.8, Method: Compositional matrix adjust.
 Identities = 11/35 (31%), Positives = 19/35 (54%), Gaps = 0/35 (0%)

Query  118   DIISEERNKDLGLRAKTHQLGVTYDNITRTSKQEG  152
             D+ISE   +   +  + H++   +DN+ R  KQ G
Sbjct  998   DLISEGHGQSRKIEVRQHKINAMWDNLERLRKQRG  1032


>Q8IRS0_DROME unnamed protein product
Length=1607

 Score = 28.1 bits (61),  Expect = 8.6, Method: Composition-based stats.
 Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 1/55 (2%)

Query  116  FEDIISEERNKDLGLRAKTHQLGVTYDNITRTSKQEGKENILETLKNSVEKSNYP  170
            FE   S E N+ L L AK    G +Y  +   S  +GKE++  T +N   K N P
Sbjct  194  FERSYSLEGNETLQLSAKELTPGGSY-QVQAYSVYQGKESVAYTSRNFTTKPNTP  247



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4782626282


Query= XP_050469430.1 serine/threonine-protein kinase RIO3-like [Bombus
huntii]

Length=214
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q384A7_TRYB2  unnamed protein product                                 32.3    0.30 
ERF1_TRYBB  unnamed protein product                                   30.0    1.6  
DOM_DROME  unnamed protein product                                    29.6    2.2  


>Q384A7_TRYB2 unnamed protein product
Length=566

 Score = 32.3 bits (72),  Expect = 0.30, Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 1/43 (2%)

Query  29   LQEKELKKSRIQTVDNVNIENYTICETNDTENDEVIAHMLQDQ  71
            LQ K L  S + + DN     Y+ C  ++ EN+EV+  +LQD+
Sbjct  458  LQRKLLAHS-LLSFDNCRTVVYSTCSVHEAENEEVVRQVLQDE  499


>ERF1_TRYBB unnamed protein product
Length=452

 Score = 30.0 bits (66),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 18/80 (23%), Positives = 43/80 (54%), Gaps = 6/80 (8%)

Query  32   KELKKSRIQTV---DNVNIENYTICETNDTENDEVIAHMLQDQFNKEYNLMLKHTEK---  85
            K L+   ++T+   +++NI  YT+ +    +++E   H++ ++  K  N+ ++ + K   
Sbjct  311  KCLEAGAVETLIVYEDLNIYRYTVVKNRGADDEETFVHVMSEEEAKRSNIHMQESGKTRN  370

Query  86   KLNRDSKVNITYTNYRTSLC  105
            ++ ++  V+   TNYR   C
Sbjct  371  EIEQEDFVDWLATNYRKFGC  390


>DOM_DROME unnamed protein product
Length=3198

 Score = 29.6 bits (65),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 18/61 (30%), Positives = 34/61 (56%), Gaps = 8/61 (13%)

Query  75    EYNLMLKHTEKKLNRDSKV---NITYTNYRTSLCED-----QDEQDTDSEDTTKDFDRFV  126
             E N++ K  +K++  D  +   N T T +++S  +D     Q EQD  S++ +++ DR V
Sbjct  1788  EVNILKKANQKRMLSDMAIEGGNFTTTYFKSSTIKDLFTMEQSEQDESSQEKSENKDRIV  1847

Query  127   S  127
             +
Sbjct  1848  A  1848



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4782626282


Query= XP_050469431.1 serine/threonine-protein kinase RIO3-like [Bombus
huntii]

Length=214
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q384A7_TRYB2  unnamed protein product                                 32.3    0.30 
ERF1_TRYBB  unnamed protein product                                   30.0    1.6  
DOM_DROME  unnamed protein product                                    29.6    2.2  


>Q384A7_TRYB2 unnamed protein product
Length=566

 Score = 32.3 bits (72),  Expect = 0.30, Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 1/43 (2%)

Query  29   LQEKELKKSRIQTVDNVNIENYTICETNDTENDEVIAHMLQDQ  71
            LQ K L  S + + DN     Y+ C  ++ EN+EV+  +LQD+
Sbjct  458  LQRKLLAHS-LLSFDNCRTVVYSTCSVHEAENEEVVRQVLQDE  499


>ERF1_TRYBB unnamed protein product
Length=452

 Score = 30.0 bits (66),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 18/80 (23%), Positives = 43/80 (54%), Gaps = 6/80 (8%)

Query  32   KELKKSRIQTV---DNVNIENYTICETNDTENDEVIAHMLQDQFNKEYNLMLKHTEK---  85
            K L+   ++T+   +++NI  YT+ +    +++E   H++ ++  K  N+ ++ + K   
Sbjct  311  KCLEAGAVETLIVYEDLNIYRYTVVKNRGADDEETFVHVMSEEEAKRSNIHMQESGKTRN  370

Query  86   KLNRDSKVNITYTNYRTSLC  105
            ++ ++  V+   TNYR   C
Sbjct  371  EIEQEDFVDWLATNYRKFGC  390


>DOM_DROME unnamed protein product
Length=3198

 Score = 29.6 bits (65),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 18/61 (30%), Positives = 34/61 (56%), Gaps = 8/61 (13%)

Query  75    EYNLMLKHTEKKLNRDSKV---NITYTNYRTSLCED-----QDEQDTDSEDTTKDFDRFV  126
             E N++ K  +K++  D  +   N T T +++S  +D     Q EQD  S++ +++ DR V
Sbjct  1788  EVNILKKANQKRMLSDMAIEGGNFTTTYFKSSTIKDLFTMEQSEQDESSQEKSENKDRIV  1847

Query  127   S  127
             +
Sbjct  1848  A  1848



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4782626282


Query= XP_050469432.1 mediator of RNA polymerase II transcription subunit
21 isoform X1 [Bombus huntii]

Length=179
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MED21_DROME  unnamed protein product                                  185     1e-60
MED21_CAEEL  unnamed protein product                                  71.6    2e-16
HIL_DROME  unnamed protein product                                    32.3    0.22 


>MED21_DROME unnamed protein product
Length=142

 Score = 185 bits (470),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 93/134 (69%), Positives = 111/134 (83%), Gaps = 2/134 (1%)

Query  1    MADRLTQLQDTINQQAEHFCNSVGILQQYSTPSKFPGFDRVG--TPQPHQPQEDYAALFA  58
            MADRLTQLQDT+NQQAEHFCN++G++QQ S PSKF  F+R+G  TP P  PQEDYA LFA
Sbjct  1    MADRLTQLQDTVNQQAEHFCNAIGVIQQTSLPSKFVNFERIGPQTPIPCPPQEDYAQLFA  60

Query  59   TLIARCAKDIDTLIESLPSEESSQELQVASLSRLEQENQEAGEQLEEVVKQGEALLQRIQ  118
             LIARCAKDIDTLIESLP+E+SS ELQ +SL RLE ENQ     LEEVV++GE LL+++Q
Sbjct  61   QLIARCAKDIDTLIESLPNEDSSIELQNSSLKRLEIENQGTARDLEEVVQKGELLLEKMQ  120

Query  119  AALQDIAQSQLDMQ  132
             +L+ IAQ+QLDMQ
Sbjct  121  YSLECIAQAQLDMQ  134


>MED21_CAEEL unnamed protein product
Length=130

 Score = 71.6 bits (174),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 75/130 (58%), Gaps = 7/130 (5%)

Query  1    MADRLTQLQDTINQQAEHFCNSVGILQQYSTPSKFPGFDRVGTPQPHQPQEDYAALFATL  60
            MADR+TQLQD IN+ A    N++G+LQ  + P +F    +    +P+       A+FA  
Sbjct  1    MADRMTQLQDMINEMAGLMTNAIGVLQATAPPCEFGAISQELEDEPN------CAIFAAG  54

Query  61   IARCAKDIDTLIESLPSEESSQELQV-ASLSRLEQENQEAGEQLEEVVKQGEALLQRIQA  119
            IA+ AK+I+ LI+S P E  +QE +V   + + +++ +E   +L  +V     L+  +Q 
Sbjct  55   IAKAAKNIEILIDSFPIEAGNQEAEVEEKMIKNDEKQREKVNELVGLVGDSNRLVGVVQK  114

Query  120  ALQDIAQSQL  129
             L +I+++Q+
Sbjct  115  KLAEISKTQM  124


>HIL_DROME unnamed protein product
Length=818

 Score = 32.3 bits (72),  Expect = 0.22, Method: Composition-based stats.
 Identities = 14/48 (29%), Positives = 23/48 (48%), Gaps = 0/48 (0%)

Query  22   SVGILQQYSTPSKFPGFDRVGTPQPHQPQEDYAALFATLIARCAKDID  69
            +V   Q Y+ P +F   DR+      + Q+ +  L   L+ RC  DI+
Sbjct  339  AVSKFQIYTDPIEFEDVDRIAISVAQEDQKTFTDLVRQLVGRCTTDIE  386



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4782626282


Query= XP_050469433.1 mediator of RNA polymerase II transcription subunit
21 isoform X2 [Bombus huntii]

Length=178
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MED21_DROME  unnamed protein product                                  179     3e-58
MED21_CAEEL  unnamed protein product                                  67.4    1e-14
HIL_DROME  unnamed protein product                                    32.3    0.21 


>MED21_DROME unnamed protein product
Length=142

 Score = 179 bits (453),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 92/134 (69%), Positives = 110/134 (82%), Gaps = 3/134 (2%)

Query  1    MADRLTQLQDTINQ-AEHFCNSVGILQQYSTPSKFPGFDRVG--TPQPHQPQEDYAALFA  57
            MADRLTQLQDT+NQ AEHFCN++G++QQ S PSKF  F+R+G  TP P  PQEDYA LFA
Sbjct  1    MADRLTQLQDTVNQQAEHFCNAIGVIQQTSLPSKFVNFERIGPQTPIPCPPQEDYAQLFA  60

Query  58   TLIARCAKDIDTLIESLPSEESSQELQVASLSRLEQENQEAGEQLEEVVKQGEALLQRIQ  117
             LIARCAKDIDTLIESLP+E+SS ELQ +SL RLE ENQ     LEEVV++GE LL+++Q
Sbjct  61   QLIARCAKDIDTLIESLPNEDSSIELQNSSLKRLEIENQGTARDLEEVVQKGELLLEKMQ  120

Query  118  AALQDIAQSQLDMQ  131
             +L+ IAQ+QLDMQ
Sbjct  121  YSLECIAQAQLDMQ  134


>MED21_CAEEL unnamed protein product
Length=130

 Score = 67.4 bits (163),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 75/130 (58%), Gaps = 8/130 (6%)

Query  1    MADRLTQLQDTINQ-AEHFCNSVGILQQYSTPSKFPGFDRVGTPQPHQPQEDYAALFATL  59
            MADR+TQLQD IN+ A    N++G+LQ  + P +F    +    +P+       A+FA  
Sbjct  1    MADRMTQLQDMINEMAGLMTNAIGVLQATAPPCEFGAISQELEDEPN------CAIFAAG  54

Query  60   IARCAKDIDTLIESLPSEESSQELQV-ASLSRLEQENQEAGEQLEEVVKQGEALLQRIQA  118
            IA+ AK+I+ LI+S P E  +QE +V   + + +++ +E   +L  +V     L+  +Q 
Sbjct  55   IAKAAKNIEILIDSFPIEAGNQEAEVEEKMIKNDEKQREKVNELVGLVGDSNRLVGVVQK  114

Query  119  ALQDIAQSQL  128
             L +I+++Q+
Sbjct  115  KLAEISKTQM  124


>HIL_DROME unnamed protein product
Length=818

 Score = 32.3 bits (72),  Expect = 0.21, Method: Composition-based stats.
 Identities = 14/48 (29%), Positives = 23/48 (48%), Gaps = 0/48 (0%)

Query  21   SVGILQQYSTPSKFPGFDRVGTPQPHQPQEDYAALFATLIARCAKDID  68
            +V   Q Y+ P +F   DR+      + Q+ +  L   L+ RC  DI+
Sbjct  339  AVSKFQIYTDPIEFEDVDRIAISVAQEDQKTFTDLVRQLVGRCTTDIE  386



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4782626282


Query= XP_050469434.1 uncharacterized protein LOC126863379 isoform X1
[Bombus huntii]

Length=169
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SGPL_DROME  unnamed protein product                                   28.1    4.6  


>SGPL_DROME unnamed protein product
Length=545

 Score = 28.1 bits (61),  Expect = 4.6, Method: Compositional matrix adjust.
 Identities = 13/49 (27%), Positives = 27/49 (55%), Gaps = 5/49 (10%)

Query  77   FKTPMITTVERDC-----APQKRTVLTYSDNKWQNREEIVTSAYKEGCF  120
            F+   +T++  D      AP+  +V+ YSD K+++ +  VT+ +  G +
Sbjct  328  FEVKGVTSISADTHKYGFAPKGSSVILYSDKKYKDHQFTVTTDWPGGVY  376



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4782626282


Query= XP_050469435.1 uncharacterized protein LOC126863379 isoform X2
[Bombus huntii]

Length=158
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SGPL_DROME  unnamed protein product                                   28.1    4.2  


>SGPL_DROME unnamed protein product
Length=545

 Score = 28.1 bits (61),  Expect = 4.2, Method: Compositional matrix adjust.
 Identities = 13/49 (27%), Positives = 27/49 (55%), Gaps = 5/49 (10%)

Query  66   FKTPMITTVERDC-----APQKRTVLTYSDNKWQNREEIVTSAYKEGCF  109
            F+   +T++  D      AP+  +V+ YSD K+++ +  VT+ +  G +
Sbjct  328  FEVKGVTSISADTHKYGFAPKGSSVILYSDKKYKDHQFTVTTDWPGGVY  376



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4782626282


Query= XP_050469436.1 uncharacterized protein LOC126863379 isoform X3
[Bombus huntii]

Length=149
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SGPL_DROME  unnamed protein product                                   28.1    3.6  
Q54RL3_DICDI  unnamed protein product                                 26.6    9.3  
Q21301_CAEEL  unnamed protein product                                 26.9    9.4  


>SGPL_DROME unnamed protein product
Length=545

 Score = 28.1 bits (61),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 13/49 (27%), Positives = 27/49 (55%), Gaps = 5/49 (10%)

Query  57   FKTPMITTVERDC-----APQKRTVLTYSDNKWQNREEIVTSAYKEGCF  100
            F+   +T++  D      AP+  +V+ YSD K+++ +  VT+ +  G +
Sbjct  328  FEVKGVTSISADTHKYGFAPKGSSVILYSDKKYKDHQFTVTTDWPGGVY  376


>Q54RL3_DICDI unnamed protein product
Length=545

 Score = 26.6 bits (57),  Expect = 9.3, Method: Composition-based stats.
 Identities = 10/19 (53%), Positives = 13/19 (68%), Gaps = 1/19 (5%)

Query  108  PAGPSEYCFCGHHLCNSSE  126
            P GP+ Y +C HH C+ SE
Sbjct  440  PWGPN-YPYCNHHCCHGSE  457


>Q21301_CAEEL unnamed protein product
Length=1056

 Score = 26.9 bits (58),  Expect = 9.4, Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 31/74 (42%), Gaps = 1/74 (1%)

Query  2    ISDGIERGIACFKCYASQSGHEKTDLLCSHFDGSPRFQVYCPSSTLCGKRTIYSKFKTPM  61
            + DG+ +     KC    + H    LL +     P F VY  SS       +Y++F + +
Sbjct  94   LDDGVHKKKINIKCSIHPAVHLARQLLSAVKHYFPDFGVYLQSSIDVNPSALYTEFPS-L  152

Query  62   ITTVERDCAPQKRT  75
             T   R C   +RT
Sbjct  153  PTASPRPCHSFRRT  166



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4782626282


Query= XP_050469437.1 coiled-coil-helix-coiled-coil-helix domain-containing
protein 10, mitochondrial [Bombus huntii]

Length=142
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VX77_DROME  unnamed protein product                                 126     9e-38
X2JFJ0_DROME  unnamed protein product                                 121     3e-36
HAR1_CAEEL  unnamed protein product                                   94.4    2e-25


>Q9VX77_DROME unnamed protein product
Length=170

 Score = 126 bits (317),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 82/170 (48%), Positives = 99/170 (58%), Gaps = 30/170 (18%)

Query  1    MPRRGRAANPPPRTVRRASAPVATAPAH-----------------------PPASTPMVA  37
            M RRGR+A+PPP T R A                                 PP++  M A
Sbjct  1    MVRRGRSASPPPSTRRTAPVQARAPAPAPAPVQTRAPAPAASAPVPAPMSAPPSAVGMPA  60

Query  38   QPQQPSLMGQMAATAGGVAIGSAVGHTIGHAVTGLFSG-GSSEAAAAPVGVAPAAVQSAP  96
             PQQPS+  QMAATAGGVA+GSA+GHT+GH +T LFSG G  EAAA     A  A Q   
Sbjct  61   -PQQPSMFQQMAATAGGVAVGSAIGHTVGHGLTSLFSGSGDKEAAAPAPAAAAPAPQQPY  119

Query  97   VSAPAG-----GACAWEVKQFLECAQNQSDLSLCEGFNEALRQCKASNNL  141
             +         GACAWE+KQF++CAQ Q+DL+LCEGFNEALRQCK S++L
Sbjct  120  YAQQQQPNEPQGACAWELKQFIQCAQGQADLTLCEGFNEALRQCKQSHHL  169


>X2JFJ0_DROME unnamed protein product
Length=122

 Score = 121 bits (303),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 85/119 (71%), Gaps = 7/119 (6%)

Query  29   PPASTPMVAQPQQPSLMGQMAATAGGVAIGSAVGHTIGHAVTGLFSG-GSSEAAAAPVGV  87
            PP++  M A PQQPS+  QMAATAGGVA+GSA+GHT+GH +T LFSG G  EAAA     
Sbjct  4    PPSAVGMPA-PQQPSMFQQMAATAGGVAVGSAIGHTVGHGLTSLFSGSGDKEAAAPAPAA  62

Query  88   APAAVQSAPVSAPAG-----GACAWEVKQFLECAQNQSDLSLCEGFNEALRQCKASNNL  141
            A  A Q    +         GACAWE+KQF++CAQ Q+DL+LCEGFNEALRQCK S++L
Sbjct  63   AAPAPQQPYYAQQQQPNEPQGACAWELKQFIQCAQGQADLTLCEGFNEALRQCKQSHHL  121


>HAR1_CAEEL unnamed protein product
Length=154

 Score = 94.4 bits (233),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 67/104 (64%), Gaps = 5/104 (5%)

Query  34   PMVAQPQQPSLMGQMAATAGGVAIGSAVGHTIGHAVTGLFSGGSSEAAAAPVGVAPAAVQ  93
            PM A  Q P LM QMAATAGGVAIGSAVGH +G    G+F+GG S  A      A A   
Sbjct  53   PMGAPSQGPGLMKQMAATAGGVAIGSAVGHAVG----GMFTGGGSSHAEQAPAAAAAPAG  108

Query  94   SAPVSAPAGGACAWEVKQFLECAQNQSDLSLCEGFNEALRQCKA  137
            +   S  +   C +E +QF++CAQNQSD+SLC GFN+  +QCKA
Sbjct  109  APQASGYS-QPCEFEWRQFVDCAQNQSDVSLCNGFNDIFKQCKA  151



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4782626282


Query= XP_050469438.1 juvenile hormone esterase-like [Bombus huntii]

Length=479
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q24201_DROME  unnamed protein product                                 223     2e-66
Q9VIB5_DROME  unnamed protein product                                 221     2e-65
Q24198_DROME  unnamed protein product                                 179     3e-50


>Q24201_DROME unnamed protein product
Length=556

 Score = 223 bits (568),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 152/438 (35%), Positives = 224/438 (51%), Gaps = 51/438 (12%)

Query  4    QSDYVTSVFSGHEDCLYLNVYTREMIFKGKVRLRPVMVWLYGGGYMSGHCNSSLYGPDFF  63
            Q  +V     G EDCLYLNVYT  +      + RPVMVW++GGG++ G  N   YGPD+F
Sbjct  81   QVQFVFDKVEGSEDCLYLNVYTNNV---KPDKARPVMVWIHGGGFIIGEANREWYGPDYF  137

Query  64   MEEDVVLVTFNYRLSVLGFLALNHP--NATGNAGLKDQQLAFQWVQSNIAAFGGDPEQVT  121
            M+EDVVLVT  YRL  LGF++L  P  N  GNAGLKDQ LA +W+++N A+FGGDP  +T
Sbjct  138  MKEDVVLVTIQYRLGALGFMSLKSPELNVPGNAGLKDQVLALKWIKNNCASFGGDPNCIT  197

Query  122  IFGESAGSTSIGFHMLSERSRGLFRRSISMSGTPLCPWAYHTPEQMIHNAYKLAGFLNYV  181
            +FGESAG  S  + ML+++++GLF R I  SG+ +CPWAY+    + HN Y++A  + Y 
Sbjct  198  VFGESAGGASTHYMMLTDQTQGLFHRGILQSGSAICPWAYNG--DITHNPYRIAKLVGYK  255

Query  182  PKSRD-DLLNYLRHAPAIKLIRAAEKV-----DLNILPFRPTIENPDIDPTNSSFLTECP  235
             +  D D+L +L++  A  LIR  E V      +N + FR     P ++P ++    EC 
Sbjct  256  GEDNDKDVLEFLQNVKAKDLIRVEENVLTLEERMNKIMFR---FGPSLEPFSTP---ECV  309

Query  236  IAKYHNGDFYHHDMMLGYTRNEILLFLG----------PPIG----VANMIDWARKYLQS  281
            I+K         +MM     N I +F+G          P +     V   +D    ++  
Sbjct  310  ISKPPK------EMMKTAWSNSIPMFIGNTSYEGLLWVPEVKLMPQVLQQLDAGTPFIPK  363

Query  282  INTYNEKYTKEPIALFAQIICNFFNTSYNKLEKIAMDIL----FSGPIDLTQRLITTHNK  337
                 E  +KE +  ++  I +   T         MD+     F  P          +  
Sbjct  364  ELLATEP-SKEKLDSWSAQIRDVHRTGSESTPDNYMDLCSIYYFVFPALRVVHSRHAYAA  422

Query  338  GHSIYYYRLSYQSK---YSWHIVDHN-PLNGTAHFDDVGYIFNS-NALRAPTNPRHRFNR  392
            G  +Y+YR  + S+   + + I+     + G +H DD+ Y F+S  A R P   R   N 
Sbjct  423  GAPVYFYRYDFDSEELIFPYRIMRMGRGVKGVSHADDLSYQFSSLLARRLPKESREYRN-  481

Query  393  FRKKMVKLWANFAKYGDP  410
              ++ V +W  FA  G+P
Sbjct  482  -IERTVGIWTQFAATGNP  498


>Q9VIB5_DROME unnamed protein product
Length=572

 Score = 221 bits (562),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 150/439 (34%), Positives = 222/439 (51%), Gaps = 53/439 (12%)

Query  4    QSDYVTSVFSGHEDCLYLNVYTREMIFKGKVRLRPVMVWLYGGGYMSGHCNSSLYGPDFF  63
            Q  +V     G EDCLYLNVYT  +      + RPVMVW++GGG++ G  N   YGPD+F
Sbjct  97   QVQFVFDKVEGSEDCLYLNVYTNNV---KPDKARPVMVWIHGGGFIIGEANREWYGPDYF  153

Query  64   MEEDVVLVTFNYRLSVLGFLALNHP--NATGNAGLKDQQLAFQWVQSNIAAFGGDPEQVT  121
            M+EDVVLVT  YRL  LGF++L  P  N  GNAGLKDQ LA +W+++N A+FGGDP  +T
Sbjct  154  MKEDVVLVTIQYRLGALGFMSLKSPELNVPGNAGLKDQVLALKWIKNNCASFGGDPNCIT  213

Query  122  IFGESAGSTSIGFHMLSERSRGLFRRSISMSGTPLCPWAYHTPEQMIHNAYKLAGFLNYV  181
            +FGESAG  S  + ML+++++GLF R I  SG+ +CPWAY+    + HN Y++A  + Y 
Sbjct  214  VFGESAGGASTHYMMLTDQTQGLFHRGILQSGSAICPWAYNG--DITHNPYRIAKLVGYK  271

Query  182  PKSRD-DLLNYLRHAPAIKLIRAAEKVDLNILPFRPTIEN------PDIDPTNSSFLTEC  234
             +  D D+L +L++  A  LIR  E    N+L     +        P ++P ++    EC
Sbjct  272  GEDNDKDVLEFLQNVKAKDLIRVEE----NVLTLEERMNKIMFAFGPSLEPFSTP---EC  324

Query  235  PIAKYHNGDFYHHDMMLGYTRNEILLFLG----------PPIG----VANMIDWARKYLQ  280
             I+K         +MM     N I +F+G          P +     V   +D    ++ 
Sbjct  325  VISKPPK------EMMKTAWSNSIPMFIGNTSYEGLLWVPEVKLMPQVLQQLDAGTPFIP  378

Query  281  SINTYNEKYTKEPIALFAQIICNFFNTSYNKLEKIAMDIL----FSGPIDLTQRLITTHN  336
                  E  +KE +  ++  I +   T         MD+     F  P          + 
Sbjct  379  KELLATEP-SKEKLDSWSAQIRDVHRTGSESTPDNYMDLCSIYYFVFPALRVVHSRHAYA  437

Query  337  KGHSIYYYRLSYQSK---YSWHIVD-HNPLNGTAHFDDVGYIFNS-NALRAPTNPRHRFN  391
             G  +Y+YR  + S+   + + I+     + G +H DD+ Y F+S  A R P   R   N
Sbjct  438  AGAPVYFYRYDFDSEELIFPYRIMRLGRGVKGVSHADDLSYQFSSLLARRLPKESREYRN  497

Query  392  RFRKKMVKLWANFAKYGDP  410
               ++ V +W  FA  G+P
Sbjct  498  --IERTVGIWTQFAATGNP  514


>Q24198_DROME unnamed protein product
Length=542

 Score = 179 bits (455),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 139/431 (32%), Positives = 209/431 (48%), Gaps = 38/431 (9%)

Query  4    QSDYVTSVFSGHEDCLYLNVYTREMIFKGKVRLRPVMVWLYGGGYMSGHCNSSLYGPDFF  63
            Q   +T    G EDCLYLNVY++++  +  +   PVMV++YGG +  G     LYGPD+F
Sbjct  74   QRGLLTREIEGGEDCLYLNVYSKQLKSEKPL---PVMVYIYGGAFTVGEATRELYGPDYF  130

Query  64   MEEDVVLVTFNYRLSVLGFLALNHPN--ATGNAGLKDQQLAFQWVQSNIAAFGGDPEQVT  121
            M +DVVLVT NYR+  LGFL+L  P+    GNAGLKDQ LA +WV+  I+ F GD   +T
Sbjct  131  MTKDVVLVTLNYRVDCLGFLSLKDPSLKVPGNAGLKDQVLALKWVKQYISNFNGDDSNIT  190

Query  122  IFGESAGSTSIGFHMLSERSRGLFRRSISMSGTPLCPWAYHTPEQMIHNAYKLAGFLNYV  181
            +FGESAG  S  F M +E++RGLF ++I MSGT    WA +  E     A++LA    + 
Sbjct  191  VFGESAGGCSTHFMMCTEQTRGLFHKAIPMSGTVHNYWANNPAEDF---AFRLAQQNGFT  247

Query  182  PKSRD-DLLNYLRHAPAIKLIR-----AAEKVDLNILPFRPTIENPDIDPTNSSFLTECP  235
             ++ D  +L YL+  PA  L+         + +  +  F PT+E           + + P
Sbjct  248  GENDDAKVLEYLQGVPARDLVNHNLLTPEHRRNGLLFAFGPTVE---AYVGEDCVVPKPP  304

Query  236  IAKYHNGDFYHHDMMLGYTRNEILLFLGPPIGVANM-----IDWARKYLQSINTYNEKYT  290
            +    +    +  +MLG T  E  LF+ P +  AN+     +      L  ++       
Sbjct  305  VEMARDAWSNNFPVMLGGTSFEG-LFMYPAVS-ANLKALDSLSQDPTRLVPVDVRTVSSE  362

Query  291  KEPIALFAQIICNFFNTS-------YNKLEKIAMDILFSGPIDLTQRLITTHNKGHSIYY  343
            KE +    +++  +F  S        N L+  +  I + G  + T     T+ K  + YY
Sbjct  363  KENLEYSQRLMKAYFGYSPPSSELLLNMLDFYSYKIFWHG-FNRTFNARLTYAKAPT-YY  420

Query  344  YRLSYQSK----YSWHIVDHNPLNGTAHFDDVGYIFNSNALRAPTNPRHRFNRFRKKMVK  399
            YR  + S     Y           G AH DD+ Y+F  NA     +      R  ++M+ 
Sbjct  421  YRFDFDSPNFNFYRAKFCGDKIKTGVAHADDLSYLFR-NAGSWKLDKTSAEYRTIERMIG  479

Query  400  LWANFAKYGDP  410
            +W  FA   +P
Sbjct  480  IWTAFAATSNP  490



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4782626282


Query= XP_050469439.1 uncharacterized protein LOC126863382 [Bombus huntii]

Length=102
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A0A0B4KH12_DROME  unnamed protein product                             26.9    3.2  
A0A0B4KHG7_DROME  unnamed protein product                             26.9    3.3  
A0A0B4KHT0_DROME  unnamed protein product                             26.9    3.3  


>A0A0B4KH12_DROME unnamed protein product
Length=1119

 Score = 26.9 bits (58),  Expect = 3.2, Method: Composition-based stats.
 Identities = 15/42 (36%), Positives = 25/42 (60%), Gaps = 0/42 (0%)

Query  9    KVEIQKTLISLNEITLKIKNELNIINDLVKKDGQLHTAVVDA  50
            K++ Q+  I   EI ++I+ +LN ++DL K   QL   +VD 
Sbjct  405  KLKCQRADIPNPEIPVRIQVQLNQVSDLQKVISQLGIIIVDG  446


>A0A0B4KHG7_DROME unnamed protein product
Length=1122

 Score = 26.9 bits (58),  Expect = 3.3, Method: Composition-based stats.
 Identities = 15/42 (36%), Positives = 25/42 (60%), Gaps = 0/42 (0%)

Query  9    KVEIQKTLISLNEITLKIKNELNIINDLVKKDGQLHTAVVDA  50
            K++ Q+  I   EI ++I+ +LN ++DL K   QL   +VD 
Sbjct  405  KLKCQRADIPNPEIPVRIQVQLNQVSDLQKVISQLGIIIVDG  446


>A0A0B4KHT0_DROME unnamed protein product
Length=1125

 Score = 26.9 bits (58),  Expect = 3.3, Method: Composition-based stats.
 Identities = 15/42 (36%), Positives = 25/42 (60%), Gaps = 0/42 (0%)

Query  9    KVEIQKTLISLNEITLKIKNELNIINDLVKKDGQLHTAVVDA  50
            K++ Q+  I   EI ++I+ +LN ++DL K   QL   +VD 
Sbjct  405  KLKCQRADIPNPEIPVRIQVQLNQVSDLQKVISQLGIIIVDG  446



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4782626282


Query= XP_050469440.1 cytochrome b-c1 complex subunit 6, mitochondrial
[Bombus huntii]

Length=87
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PH4H_CAEEL  unnamed protein product                                   28.5    0.56 
Q57YU5_TRYB2  unnamed protein product                                 25.8    3.0  
Q57VB4_TRYB2  unnamed protein product                                 26.6    3.4  


>PH4H_CAEEL unnamed protein product
Length=457

 Score = 28.5 bits (62),  Expect = 0.56, Method: Composition-based stats.
 Identities = 23/80 (29%), Positives = 36/80 (45%), Gaps = 8/80 (10%)

Query  1   MSFLQSFLQRYMPTVKAEEEELIDPQKI---LRERCSRQPKCTSLQEKLDTCNQRVNSR-  56
           + FL+  ++ Y+  V A+    I    I   LRE+     +   L +  D     + SR 
Sbjct  9   LDFLKYAMESYVADVNAD----IGKTTIVFTLREKAGALAETLKLFQAHDVNLSHIESRP  64

Query  57  SNTEETCMEELIDYVECVDH  76
           S T E C E L+++ E  DH
Sbjct  65  SKTHEGCYEVLVEFAEAEDH  84


>Q57YU5_TRYB2 unnamed protein product
Length=71

 Score = 25.8 bits (55),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 19/40 (48%), Gaps = 1/40 (3%)

Query  48  TCNQRV-NSRSNTEETCMEELIDYVECVDHCVAKTLFSKL  86
            C +R+ +  S  E  C  +  D V CVD CV   L+  L
Sbjct  31  ACLERIKDIPSEKEPHCYHQYFDIVHCVDVCVDPKLWPTL  70


>Q57VB4_TRYB2 unnamed protein product
Length=1118

 Score = 26.6 bits (57),  Expect = 3.4, Method: Composition-based stats.
 Identities = 14/46 (30%), Positives = 26/46 (57%), Gaps = 2/46 (4%)

Query  16   KAEEEELIDPQKILRERCSRQPKCTSLQEKL--DTCNQRVNSRSNT  59
            + E++EL +  KI+ E+   +P  TSL  +L  D C ++   R ++
Sbjct  231  QVEDDELSEICKIVFEKAVSEPSYTSLYARLAQDVCKEKKEERDSS  276



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4782626282


Query= XP_050469441.1 teneurin-m isoform X1 [Bombus huntii]

Length=3235
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TENM_DROME  unnamed protein product                                   3868    0.0  
TENA_DROME  unnamed protein product                                   1130    0.0  
H1ZUX0_CAEEL  unnamed protein product                                 796     0.0  


>TENM_DROME unnamed protein product
Length=2731

 Score = 3868 bits (10031),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1776/2361 (75%), Positives = 2061/2361 (87%), Gaps = 30/2361 (1%)

Query  872   GARTFPARSFPPDGTTFAQVGLGQKLSKEIPPYSYWNMQFYQSEAAYVRFDYNIPRGASI  931
             GARTFPARSFPPDGTTF Q+ LGQKL+KEI PYSYWNMQFYQSE AYV+FDY IPRGASI
Sbjct  376   GARTFPARSFPPDGTTFGQITLGQKLTKEIQPYSYWNMQFYQSEPAYVKFDYTIPRGASI  435

Query  932   GVYARRNALPTHTQYDLLEVLSGFKA--RTTRASHVSVIPSIKKEVTHYMEPGHWFLSLY  989
             GVY RRNALPTHTQY   EVLSGF A  RT RA+H+S    I +EVT YMEPGHWF+SLY
Sbjct  436   GVYGRRNALPTHTQYHFKEVLSGFSASTRTARAAHLS----ITREVTRYMEPGHWFVSLY  491

Query  990   NDDGDPQEVSFIAMIAEDMTHNCPNGCSGKGECLLGHCQCNPGFGGEDCSESVCPVLCSQ  1049
             NDDGD QE++F A +AEDMT NCPNGCSG G+CLLGHCQCNPGFGG+DCSESVCPVLCSQ
Sbjct  492   NDDGDVQELTFYAAVAEDMTQNCPNGCSGNGQCLLGHCQCNPGFGGDDCSESVCPVLCSQ  551

Query  1050  RGEYINGECQCNPGWKGKECSLRHDECEVPDCNGHGHCTNGKCNCVRGYKGKYCEEVDCP  1109
              GEY NGEC CNPGWKGKECSLRHDECEV DC+GHGHC +GKC C+RGYKGK+CEEVDCP
Sbjct  552   HGEYTNGECICNPGWKGKECSLRHDECEVADCSGHGHCVSGKCQCMRGYKGKFCEEVDCP  611

Query  1110  HPTCSGHGFCAEGTCICKKGWKGADCSQMDKEALQCLPDCSGHGNFDLETQTCLCEPMWS  1169
             HP CSGHGFCA+GTCICKKGWKG DC+ MD++ALQCLPDCSGHG FDL+TQTC CE  WS
Sbjct  612   HPNCSGHGFCADGTCICKKGWKGPDCATMDQDALQCLPDCSGHGTFDLDTQTCTCEAKWS  671

Query  1170  GDDCSKELCDLDCGPHGHCVDNACDCLPGWSGELCNLKQCDPRCNEHGQCKNGTCLCVTG  1229
             GDDCSKELCDLDCG HG C  +AC C P W GE CN + CD RCNEHGQCKNGTCLCVTG
Sbjct  672   GDDCSKELCDLDCGQHGRCEGDACACDPEWGGEYCNTRLCDVRCNEHGQCKNGTCLCVTG  731

Query  1230  WNGKHCTMEGCPNSCSGHGQCRVGNDGQWECRCYDGWDGKDCNVLLEQNCNDGRDNDKDG  1289
             WNGKHCT+EGCPNSC+GHGQCRV  +GQWECRCY+GWDG DC + LE NC D +DNDKDG
Sbjct  732   WNGKHCTIEGCPNSCAGHGQCRVSGEGQWECRCYEGWDGPDCGIALELNCGDSKDNDKDG  791

Query  1290  LIDCADPECCSNHICRSSQLCVSAPKPIDILLRKQPPAITASFFERMKFLIDEGSLQNYA  1349
             L+DC DPECC++H+C++SQLCVSAPKPID+LLRKQPPAITASFFERMKFLIDE SLQNYA
Sbjct  792   LVDCEDPECCASHVCKTSQLCVSAPKPIDVLLRKQPPAITASFFERMKFLIDESSLQNYA  851

Query  1350  RQETFNESMFWNHFNTSRSAVVRGRVVTHLGTGLMGVRVSTSTPLEGFTLTRDDGWFDLL  1409
             + ETFNES         RSAV+RGRVVT LG GL+GVRVST+T LEGFTLTRDDGWFDL+
Sbjct  852   KLETFNES---------RSAVIRGRVVTSLGMGLVGVRVSTTTLLEGFTLTRDDGWFDLM  902

Query  1410  VNGGGAVTLQFGRSPFKPQSHIVFVPWNEVVIIDKIVMSTAEEKQTS-HIPYACAAHDYD  1468
             VNGGGAVTLQFGR+PF+PQS IV VPWNEVVIID +VMS +EEK  +    + C AHDYD
Sbjct  903   VNGGGAVTLQFGRAPFRPQSRIVQVPWNEVVIIDLVVMSMSEEKGLAVTTTHTCFAHDYD  962

Query  1469  LMKPVVLATWKHGFQGACPDKSAILAESQVIQESLQIPGTGLNLVYHSSRAAGYLSTIQL  1528
             LMKPVVLA+WKHGFQGACPD+SAILAESQVIQESLQIPGTGLNLVYHSSRAAGYLSTI+L
Sbjct  963   LMKPVVLASWKHGFQGACPDRSAILAESQVIQESLQIPGTGLNLVYHSSRAAGYLSTIKL  1022

Query  1529  QLTPEVIPPTLNLIHLRITIEGILFEKTFEADPVIKFTYAWNRLNVYRQRVYGVTTAMVK  1588
             QLTP+VIP +L+LIHLRITIEGILFE+ FEADP IKFTYAWNRLN+YRQRVYGVTTA+VK
Sbjct  1023  QLTPDVIPTSLHLIHLRITIEGILFERIFEADPGIKFTYAWNRLNIYRQRVYGVTTAVVK  1082

Query  1589  VGYEYNDCKDIIWDVQTTKLSGHDMSISEVGGWNLDIHHRYNFHEGILQKGDGSNIYLKQ  1648
             VGY+Y DC DI+WD+QTTKLSGHDMSISEVGGWNLDIHHRYNFHEGILQKGDGSNIYL+ 
Sbjct  1083  VGYQYTDCTDIVWDIQTTKLSGHDMSISEVGGWNLDIHHRYNFHEGILQKGDGSNIYLRN  1142

Query  1649  KPRVILTTMGDGHQRSLDCYDCDRQAEASNQRLLAPVALATASDGSIFVGDFNLVRKILV  1708
             KPR+ILTTMGDGHQR L+C DCD QA  + QRLLAPVALA A DGS+FVGDFN +R+I+ 
Sbjct  1143  KPRIILTTMGDGHQRPLECPDCDGQA--TKQRLLAPVALAAAPDGSLFVGDFNYIRRIMT  1200

Query  1709  DGTVRTVVRLNATRVSYRYHIALSPLDGSLYISDPESHQIIRVRDTNDYSEPDHNWETVV  1768
             DG++RTVV+LNATRVSYRYH+ALSPLDG+LY+SDPESHQIIRVRDTNDYS+P+ NWE VV
Sbjct  1201  DGSIRTVVKLNATRVSYRYHMALSPLDGTLYVSDPESHQIIRVRDTNDYSQPELNWEAVV  1260

Query  1769  GSGERCLPGDEAHCGDGALARDAKLAYPKGVAVSADNVLYFADGTNIRMVDRDGIITTVI  1828
             GSGERCLPGDEAHCGDGALA+DAKLAYPKG+A+S+DN+LYFADGTNIRMVDRDGI++T+I
Sbjct  1261  GSGERCLPGDEAHCGDGALAKDAKLAYPKGIAISSDNILYFADGTNIRMVDRDGIVSTLI  1320

Query  1829  GNHMHKSHWKPIPCEGTLNVEEVHLRWPTELAINPLDNSLHMIDDHMVLQLAPDGRVKVV  1888
             GNHMHKSHWKPIPCEGTL +EE+HLRWPTELA++P+DN+LH+IDDHM+L++ PDGRV+V+
Sbjct  1321  GNHMHKSHWKPIPCEGTLKLEEMHLRWPTELAVSPMDNTLHIIDDHMILRMTPDGRVRVI  1380

Query  1889  AGRPLHCASPSSSFDTELATHATLVMPQSIAFGPSGNLYIAESDSQRINRVRVIGTDGKI  1948
             +GRPLHCA+ S+++DT+LATHATLVMPQSIAFGP G LY+AESDSQRINRVRVIGTDG+I
Sbjct  1381  SGRPLHCATASTAYDTDLATHATLVMPQSIAFGPLGELYVAESDSQRINRVRVIGTDGRI  1440

Query  1949  SPYAGAESKCNCLERGCDCFDADHYLASTSKFNTISAVAVSPDGVVHIGDQANYRIRSVM  2008
             +P+AGAESKCNCLERGCDCF+A+HYLA+++KFNTI+A+AV+PD  VHI DQANYRIRSVM
Sbjct  1441  APFAGAESKCNCLERGCDCFEAEHYLATSAKFNTIAALAVTPDSHVHIADQANYRIRSVM  1500

Query  2009  ASIPDASGAREYEIYSPDTQEIYVFNRFGQHVATKNILTGEIVYQFTYNVNTSNGKLSTV  2068
             +SIP+AS +REYEIY+PD QEIY+FNRFGQHV+T+NILTGE  Y FTYNVNTSNGKLSTV
Sbjct  1501  SSIPEASPSREYEIYAPDMQEIYIFNRFGQHVSTRNILTGETTYVFTYNVNTSNGKLSTV  1560

Query  2069  TDAAGNKVFLLRDYSSQVNSIENTKGQKCRLRMSRMKMLHELSTPDNYNVTFDYHGPTGL  2128
             TDAAGNKVFLLRDY+SQVNSIENTKGQKCRLRM+RMKMLHELSTPDNYNVT++YHGPTGL
Sbjct  1561  TDAAGNKVFLLRDYTSQVNSIENTKGQKCRLRMTRMKMLHELSTPDNYNVTYEYHGPTGL  1620

Query  2129  LKTKLDSTGRSYVYNYDEFGRLTSAVTPTGKVISLTFDLSLKGAVVKVGQNNRKPISMLI  2188
             L+TKLDSTGRSYVYNYDEFGRLTSAVTPTG+VI L+FDLS+KGA VKV +N +K +S+LI
Sbjct  1621  LRTKLDSTGRSYVYNYDEFGRLTSAVTPTGRVIELSFDLSVKGAQVKVSENAQKEMSLLI  1680

Query  2189  KGSSVVTKVGEAEQRTTVLSDGSVGQVTPWAHTVSTDTLPYSVLAEIEPLLGESYPVPAK  2248
             +G++V+ + G AE RTTV  DGS   +TPW H +  +  PY++LAE  PLLGESYPVPAK
Sbjct  1681  QGATVIVRNGAAESRTTVDMDGSTTSITPWGHNLQMEVAPYTILAEQSPLLGESYPVPAK  1740

Query  2249  QRTEIAGDLANRFEWRYFLRKFQ----GNKYRSESKTVAQVGRKLRINGDILLSLEYDRE  2304
             QRTEIAGDLANRFEWRYF+R+ Q    G + +   + V +VGRKLR+NGD +L+LEYDRE
Sbjct  1741  QRTEIAGDLANRFEWRYFVRRQQPLQAGKQSKGPPRPVTEVGRKLRVNGDNVLTLEYDRE  1800

Query  2305  TNSVAVFMDDDAELLNVTYDRTARPVKWGPRNGIFSGVELEYDRFSRLTSWTWGDISETY  2364
             T SV V +DD  ELLNVTYDRT+RP+ + P++G ++ V+LEYDRF RL SW WG + E Y
Sbjct  1801  TQSVVVMVDDKQELLNVTYDRTSRPISFRPQSGDYADVDLEYDRFGRLVSWKWGVLQEAY  1860

Query  2365  GFDRAGRLYEIKYSDGTSMVYAFKDMFSSLPLKVTTPRGSDYLLQYDEAGALQSLTTPRG  2424
              FDR GRL EIKY DG++MVYAFKDMF SLPLKVTTPR SDYLLQYD+AGALQSLTTPRG
Sbjct  1861  SFDRNGRLNEIKYGDGSTMVYAFKDMFGSLPLKVTTPRRSDYLLQYDDAGALQSLTTPRG  1920

Query  2425  HIHAFSLQTSLGFYKYQYYSPMNRHPYEILYNDDGQILAKVYPHQSGKVAYVYDHTGKLE  2484
             HIHAFSLQTSLGF+KYQYYSP+NRHP+EILYND+GQILAK++PHQSGKVA+V+D  G+LE
Sbjct  1921  HIHAFSLQTSLGFFKYQYYSPINRHPFEILYNDEGQILAKIHPHQSGKVAFVHDTAGRLE  1980

Query  2485  TTLAGLSSIHYTYQETTSLVHSIDINEPNFEMRIEYKYHAGIVKDEKIKFGSKSGLDNAR  2544
             T LAGLSS HYTYQ+TTSLV S+++ EP FE+R E+KYHAGI+KDEK++FGSK+ L +AR
Sbjct  1981  TILAGLSSTHYTYQDTTSLVKSVEVQEPGFELRREFKYHAGILKDEKLRFGSKNSLASAR  2040

Query  2545  YRYQYDGNARISGIEVDINGKQLPQLRLKYNQNLGILEGVGDLRIYRNLFNRSVMQDSSK  2604
             Y+Y YDGNAR+SGIE+ I+ K+LP  R KY+QNLG LE V DL+I RN FNR+V+QDS+K
Sbjct  2041  YKYAYDGNARLSGIEMAIDDKELPTTRYKYSQNLGQLEVVQDLKITRNAFNRTVIQDSAK  2100

Query  2605  QFFTVTDYDEHGRVKTVLMNIRSLDVFRMELEYDNRNRIKMRKLSIGKDAMEKKEWTKME  2664
             QFF + DYD+HGRVK+VLMN++++DVFR+EL+YD RNRIK +K + G+        T  +
Sbjct  2101  QFFAIVDYDQHGRVKSVLMNVKNIDVFRLELDYDLRNRIKSQKTTFGRS-------TAFD  2153

Query  2665  KITYNADGHVLEVADTENNWQYAYDENGNVIGVTEHNEKIALGYDSGDRVVQYGDVEFNS  2724
             KI YNADGHV+EV  T NNW+Y +DENGN +GV +  EK  LGYD GDRV++ GDVEFN+
Sbjct  2154  KINYNADGHVVEVLGT-NNWKYLFDENGNTVGVVDQGEKFNLGYDIGDRVIKVGDVEFNN  2212

Query  2725  YDGRGFVVIRGEHKYRYNSRGQLIHASEHKKFQIWYFYDDRGRLVAWNDDRENITQFFYA  2784
             YD RGFVV RGE KYRYN+RGQLIH+ E ++FQ WY+YDDR RLVAW+D++ N TQ++YA
Sbjct  2213  YDARGFVVKRGEQKYRYNNRGQLIHSFERERFQSWYYYDDRSRLVAWHDNKGNTTQYYYA  2272

Query  2785  NPKTPDLITHIHFPKSSKTFRFLYDSRNFLMTVETSEQRFYVATDQNGSPLALFDTNGNL  2844
             NP+TP L+TH+HFPK S+T +  YD R+ L+ +E  +QR+YVATDQNGSPLA FD NG++
Sbjct  2273  NPRTPHLVTHVHFPKISRTMKLFYDDRDMLIALEHEDQRYYVATDQNGSPLAFFDQNGSI  2332

Query  2845  IKEMRRTPFGKIIKDTNPDFYLPIDFHGGLLDPNTKLVYLNKRLYDPTVGQWMTPAWEQM  2904
             +KEM+RTPFG+IIKDT P+F++PIDFHGGL+DP+TKLVY  +R YDP VGQWMTP WE +
Sbjct  2333  VKEMKRTPFGRIIKDTKPEFFVPIDFHGGLIDPHTKLVYTEQRQYDPHVGQWMTPLWETL  2392

Query  2905  ANELTTPTDIFIYRFRNNDPINFKQNVEYMTDLASWLKLYGYDISAMLGSEYMKQMVYQP  2964
             A E++ PTD+FIYR+ NNDPIN  +   YM DL SWL+L+GYD++ M  S Y K   Y P
Sbjct  2393  ATEMSHPTDVFIYRYHNNDPINPNKPQNYMIDLDSWLQLFGYDLNNMQSSRYTKLAQYTP  2452

Query  2965  SATITSPQLTPDFGVMSGLQCIVNRVHEKFSDLGFVPKPLLKLEPKTRNLLPRVAHRRAV  3024
              A+I S  L PDFGV+SGL+CIV +  EKFSD  FVPKPLLK+EPK RNLLPRV++RR V
Sbjct  2453  QASIKSNTLAPDFGVISGLECIVEKTSEKFSDFDFVPKPLLKMEPKMRNLLPRVSYRRGV  2512

Query  3025  FGEGILVSRVGGRSLVSVVDGVNSVVQDVVTSVFNNSYFLPLHFSVHDQDVFYFVKDNAL  3084
             FGEG+L+SR+GGR+LVSVVDG NSVVQDVV+SVFNNSYFL LHFS+HDQDVFYFVKDN L
Sbjct  2513  FGEGVLLSRIGGRALVSVVDGSNSVVQDVVSSVFNNSYFLDLHFSIHDQDVFYFVKDNVL  2572

Query  3085  KIRDDMEELRRLGGMFNVSTHETTEHGAGTWKELRLHNPDAAVVIKYGADPEQERHRILK  3144
             K+RDD EELRRLGGMFN+STHE ++HG    KELRLH PDA V+IKYG DPEQERHRILK
Sbjct  2573  KLRDDNEELRRLGGMFNISTHEISDHGGSAAKELRLHGPDAVVIIKYGVDPEQERHRILK  2632

Query  3145  HAHKRAVERAWEIEKQLVMAGFQGRGDWSKEEKDELISRGTVSGYEGVDIHSVHRYPQLA  3204
             HAHKRAVERAWE+EKQLV AGFQGRGDW++EEK+EL+  G V G+ G+DIHS+H+YPQLA
Sbjct  2633  HAHKRAVERAWELEKQLVAAGFQGRGDWTEEEKEELVQHGDVDGWNGIDIHSIHKYPQLA  2692

Query  3205  DDPGNVAFTRDTKRKRRKSGN  3225
             DDPGNVAF RD KRKRRK+G+
Sbjct  2693  DDPGNVAFQRDAKRKRRKTGS  2713


>TENA_DROME unnamed protein product
Length=3004

 Score = 1130 bits (2924),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 514/1029 (50%), Positives = 698/1029 (68%), Gaps = 45/1029 (4%)

Query  970   SIKKEVTHYMEPGHWFLSLYNDDGDPQEVSFIAMIAEDMTHNCPNGCSGKGECLLGHCQC  1029
             ++   +  Y++ G WF+S+YND+     VS +A  AE ++  CPN CSG+G C LG C C
Sbjct  518   TVNVSLLQYLDTGLWFISVYNDELVAHSVSLLAEEAEGVSTTCPNDCSGRGSCYLGKCDC  577

Query  1030  NPGFGGEDCSESVCPVLCSQRGEYINGECQCNPGWKGKECSLRHDECEVPDCNGHGHCTN  1089
               G+ G DCS+SVCPVLCS  G Y  G C C  GWKG EC +   ECEVP+C+ HG C  
Sbjct  578   IDGYQGVDCSKSVCPVLCSAHGHYGGGVCHCEEGWKGAECDIPVGECEVPNCSSHGRCIE  637

Query  1090  GKCNCVRGYKGKYCEEVDCPHPTCSGHGFCAEGTCICKKGWKGADCSQMDKEALQCLPDC  1149
             G+C+C RG+KG YC++ DC  P CSGHG C  G C CK GW+G DC  +D++  QCLP C
Sbjct  638   GECHCERGWKGPYCDQHDCLDPLCSGHGTCVAGQCYCKAGWQGEDCGTIDQQVYQCLPGC  697

Query  1150  SGHGNFDLETQTCLCEPMWSGDDCSKELCDLDCGPHGHCVDNACDCLPGWSGELCNLKQC  1209
             S HG +DLET  C+CE  W+G DCS+ +C LDCG +G C    C C  GW+G LC+   C
Sbjct  698   SEHGTYDLETGQCVCERHWTGPDCSQAVCSLDCGRNGVCESGKCRCNSGWTGNLCDQLPC  757

Query  1210  DPRCNEHGQCKNGTCLCVTGWNGKHCTMEGCPNSCSGHGQCRVGNDGQWECRCYDGWDGK  1269
             D RC+EHGQCKNGTC+C  GWNG+HCT+ GC N CS HGQC + N G++ C C +GW G+
Sbjct  758   DSRCSEHGQCKNGTCVCSQGWNGRHCTLPGCENGCSRHGQCTLEN-GEYRCDCIEGWAGR  816

Query  1270  DCNVLLEQNCNDGRDNDKDGLIDCADPECCSNHICRSSQLCVSAPKPIDILLRKQPPAIT  1329
             DC++ LE NC D  DND DG+ DC+D ECCS+  C    +C+S+  P+++LLRKQPP++T
Sbjct  817   DCSIALELNCKDNIDNDGDGMTDCSDSECCSHPACSEHIMCLSSNDPVEVLLRKQPPSVT  876

Query  1330  ASFFERMKFLIDEGSLQNYARQETFNESMFWNHFNTSRSAVVRGRVVTHLGTGLMGVRVS  1389
             ASF++R+KFLI+E S+Q+YA  + ++E         +R +V+RG+V+T  G G++G+RVS
Sbjct  877   ASFYQRVKFLIEENSVQSYAHMDEYSE---------NRVSVMRGQVITPQGLGIVGIRVS  927

Query  1390  TSTPLE-GFTLTRDDGWFDLLVNGGGAVTLQFGRSPFKPQSHIVFVPWNEVVIIDKIVMS  1448
                    GFTLTR  GWFD+LVNGGGAVTLQF RSPF+P +  VFVPWN +V++  + M 
Sbjct  928   VDRDSRFGFTLTRQGGWFDVLVNGGGAVTLQFQRSPFRPLTRTVFVPWNRIVVLPPVQMQ  987

Query  1449  TAEEKQTS-----------------HIPY-----------ACAAHDYDLMKPVVLATWKH  1480
              +++ +T+                  I Y            C  HD++ ++P +++TW  
Sbjct  988   LSDDDETTSRNIKVAPLNPALTFLNSIHYHTADEANDASKVCMDHDHEKLRPQLISTWMP  1047

Query  1481  GFQGACPDKSAILAESQVIQESLQIPGTGLNLVYHSSRAAGYLSTIQLQLTPEVIPPTLN  1540
                GA P K  I AE+Q++QES+QIPG+ L+L Y SS+A+GYLS ++++LT E IPPTL 
Sbjct  1048  NGVGAMPGKRVIFAETQIVQESIQIPGSDLHLTYQSSQASGYLSIVRMRLTGETIPPTLT  1107

Query  1541  LIHLRITIEGILFEKTFEADPVIKFTYAWNRLNVYRQRVYGVTTAMVKVGYEYNDCKDII  1600
              +H+ + IEG L  KT+EADP +  T+AWN+ NVYRQ+VYGVT A + VGY+++ C+  +
Sbjct  1108  HVHVGVEIEGALHVKTYEADPSLVHTFAWNKRNVYRQKVYGVTVARISVGYQHSTCQSPV  1167

Query  1601  WDVQTTKLSGHDMSISEVGGWNLDIHHRYNFHEGILQKGDGSNIYLKQKPRVILTTMGDG  1660
             W  QT KL G+D+ IS++GGW LDIHH YNFHEGILQKGDGS +++K+ PR +   MG G
Sbjct  1168  WIAQTAKLQGYDVDISDIGGWGLDIHHHYNFHEGILQKGDGSTLHMKEYPRTVKVVMGTG  1227

Query  1661  HQRSLDCYD-CDRQAEASNQRLLAPVALATASDGSIFVGDFNLVRKILVDGTVRTVVRLN  1719
              QR L C D C+    A + +LL P+ALAT  DGS++VGDFNLVR+I  DG V T+++L+
Sbjct  1228  LQRPLTCPDYCN--GVAKDAKLLTPIALATGPDGSLYVGDFNLVRRITPDGKVYTILQLS  1285

Query  1720  ATRVSYRYHIALSPLDGSLYISDPESHQIIRVRDTNDYSEPDHNWETVVGSGERCLPGDE  1779
             AT+VSY+Y++A+SP DG LYISDPE HQI+R+       +P  N + VVGSG+RC+PGDE
Sbjct  1286  ATQVSYQYYLAVSPADGHLYISDPERHQILRLVRLEKVKDPSINSDPVVGSGQRCIPGDE  1345

Query  1780  AHCGDGALARDAKLAYPKGVAVSADNVLYFADGTNIRMVDRDGIITTVIGNHMHKSHWKP  1839
              +CGDG  A  A+L++PKG+A++AD  +Y ADGTNIR VD  G+I T+IG+H H +HW P
Sbjct  1346  GNCGDGGPALLARLSHPKGLAIAADRTMYIADGTNIRAVDPKGVIHTLIGHHGHHNHWSP  1405

Query  1840  IPCEGTLNVEEVHLRWPTELAINPLDNSLHMIDDHMVLQLAPDGRVKVVAGRPLHCASPS  1899
              PC GTL   +  L+WPT LA++PLD SLH IDD +VL+L  D +++VVAG PLHC++  
Sbjct  1406  APCSGTLMANQAQLQWPTGLALSPLDGSLHFIDDRLVLRLTSDMKIRVVAGTPLHCSNGG  1465

Query  1900  SSFDT-ELATHATLVMPQSIAFGPSGNLYIAESDSQRINRVRVIGTDGKISPYAGAESKC  1958
                   +      L    ++AF P GNLYIA+SDS+R+N +RV+ T G +  +AG +   
Sbjct  1466  QDGRVNKTGADNVLGTVLAMAFSPFGNLYIADSDSRRVNSIRVVDTAGNMRYFAGKQEGT  1525

Query  1959  NCLERGCDC  1967
                 + CDC
Sbjct  1526  G--SQTCDC  1532


 Score = 729 bits (1883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/1323 (33%), Positives = 703/1323 (53%), Gaps = 110/1323 (8%)

Query  1969  DADHYLASTSKFNTISAVAVSPDGVVHIGDQANYRIRSVMASIPDASGAREYEIYSPDTQ  2028
             +A+  L+S ++F  ISA+AV+ DGV+++ DQ +  + ++   +P      E+ I  P + 
Sbjct  1677  NAETLLSSNARFQAISAIAVAQDGVINVADQGSLHVLALEHYLPSHDENGEFHIPFPPSS  1736

Query  2029  EIYVFNRFGQHVATKNILTGEIVYQFTYNVNTSNGKLSTVTDAAGNKVFLLRDYSSQVNS  2088
             EIYVFNR+GQHVATK++ +G+  Y F Y+ NTS G+LSTVTDA+GNK+  LRDYS+ V+S
Sbjct  1737  EIYVFNRYGQHVATKDLTSGKTRYSFLYSKNTSFGRLSTVTDASGNKIQFLRDYSNVVSS  1796

Query  2089  IENTKGQKCRLRMSRMKMLHELSTPDNYNVTFDYHGPTGLLKTKLDSTGRSYVYNYDEFG  2148
             IENT+  K  ++++ + ++ +LS      +  DY   TGLL ++  S G +Y+Y YDEFG
Sbjct  1797  IENTQDHKSEIQINGIGIMTKLSEKGRQEIELDYDSNTGLLNSR-SSGGETYIYQYDEFG  1855

Query  2149  RLTSAVTPTGKVISLTFDLS-LKGAVVKVGQN-----NRKPIS-----MLIKGS--SVVT  2195
             R+T  + P+G+++ +T  L+  +G  V V  +     +R+ I+     +L+ G   S   
Sbjct  1856  RVTGMILPSGEIVRITSQLADSQGLTVYVHASVESLFSRERIAGEANELLVLGGVRSTFL  1915

Query  2196  KVGEAEQRTTVLSDGSVGQVTPWAHTVSTDTLPYSVLAEIEPLLGESYPVPAK-------  2248
             K G+A     + ++ ++       H  +   +  S +A   PLL  + PV A+       
Sbjct  1916  KRGQAHADAELKANNTL-----VIHGDNGVVVEASAVAR-HPLLEAALPVEAEMLAMWSH  1969

Query  2249  QRTEIAGDLANRFEWRYFLRKFQGNKYRSESKTVAQVGRKLRINGDILLSLEYDRETNSV  2308
             Q   +   L N     Y +    G+  R+  +T   + R++ +N   ++ +E+D+ TN  
Sbjct  1970  QSVTMGEGLTNSM---YSVYSLVGD-VRNPQQT---LNREIWVNQSRVIGVEFDQFTNRE  2022

Query  2309  AVFMDDDAELLNVTYDRTARPVKWGPRNGIFSGVELEYDRFSRLTSWTWGDISETYGFDR  2368
               +      +L V YD++  P  + P NG    V + YDRF+R+  W WG     Y +DR
Sbjct  2023  TFYDARRTPILIVAYDQSGLPKSYYPTNGY--PVNITYDRFNRVEGWAWGPAELKYSYDR  2080

Query  2369  AGRLYEI-KYSDG-TSMVYAFKDMFSSLPLKVTTPRGSDYLLQYDEAGALQSLTTPRGHI  2426
              G L EI    DG  S VY   ++ S + L         ++LQYD+AG L+ +  P G  
Sbjct  2081  HGLLSEITSQQDGIVSFVYNDWNLVSEIGLASQ----RKFVLQYDDAGGLRHVVLPSGTR  2136

Query  2427  HAFSLQTSLGFYKYQYYSPMNRHPYEILYNDDGQILAKVYPHQSGKVAYVYDHTGKLETT  2486
             H+FS+QTS+GF +  Y  P +   Y   Y+  G +L  + P    ++ Y Y+  G+L   
Sbjct  2137  HSFSMQTSIGFIRCTYTPPGSTRAYLQHYSHAGALLQTILPGDGARIVYRYNAAGQLTEV  2196

Query  2487  LAGLSSIHYTYQETTSLVHSIDINEPNFEMRIEYKYHAGIVKDEKIKFGSKSGLDNARYR  2546
             + G     + Y E T +  ++   E   E R +++Y AG++ +E+I + +K+GL NA++ 
Sbjct  2197  VHGDGRSEFQYNEATGMPSTVSHTERELEYRWDFEYAAGLLAEERIDYVAKTGLSNAKFS  2256

Query  2547  YQYDGNARISGIEVDINGKQLPQLRLKYNQNLGILEGVGDLRIYRNLFNRSVMQDSSKQF  2606
             Y+YD   R+  ++  I G+ LP     Y+   G    +G  R  +   N++ + D +  F
Sbjct  2257  YEYDSQLRVVALQGRIGGQSLPTQAFAYDPRTGRPSLIGQFRFSQPAQNQTQLHDGTASF  2316

Query  2607  FTVTDYDEHGRVKT--VLMNIRSLDVFRMELEYDNRNRIKMRKLSIGKDAMEKKEWTKME  2664
                 D    GR +T  + + I  L+VFRME  Y    RI   +       M    +T ++
Sbjct  2317  TRTVD----GRFQTQRMALAIHRLEVFRMEFSYGVHGRISQTRTYTRN--MAVNSYTNVK  2370

Query  2665  KITYNADGHVLEVADTENNWQYAYDENGNVIGVTEHNEKIALGYDSGDRVVQYGDVEFNS  2724
               T++ DG ++ V + +  W + YD+NGN++ +T     I + Y++ DR+V++G+ ++  
Sbjct  2371  NYTWDCDGQLVGV-EAQEPWGFRYDDNGNLLSLTYRGNTIPMEYNAQDRIVKFGEGQYK-  2428

Query  2725  YDGRGFVVIRG-EHKYRYNSRGQLIHASEHKKFQIWYFYDDRGRLVAWNDDRENITQFFY  2783
             YD RG V     E ++ YN++G L+ AS+  +F + Y+YD   RL    D+  N+TQFFY
Sbjct  2429  YDARGLVAQNAREERFHYNTQGLLVRASKRGRFDVRYYYDHLKRLTTRKDNFGNVTQFFY  2488

Query  2784  ANPKTPDLITHIHFPKSSKTFRFLYDSRNFLMTVETSEQRFYVATDQNGSPLALFDTNGN  2843
              N + P  ++ I+ P+  K     YD    L+  +    ++YVATDQ+G+PL LF+  G 
Sbjct  2489  TNQQRPYEVSQIYSPRDGKLMSLTYDDVGHLIYAQVYRHKYYVATDQSGTPLMLFNQYGE  2548

Query  2844  LIKEMRRTPFGKIIKDTNPDFYLPIDFHGGLLDPNTKLVYL-NKRLYDPTVGQWMTPAWE  2902
              I+E+ R+PFG I+ D+NP  YLPIDF GG+LD  T LV++ + R+YDP +GQWM+P W+
Sbjct  2549  GIREIMRSPFGHIVYDSNPYLYLPIDFCGGILDQVTTLVHMGDGRVYDPLIGQWMSPDWQ  2608

Query  2903  QMANELTTPTDIFIYRFRNNDPINFKQNVEYMTDLASWLKLYGYDISAMLGSEYMKQMVY  2962
             ++A  + TPT + +YRF  NDPIN      Y  D A+W++  GY++  ++    + + ++
Sbjct  2609  RVAERIITPTRLHLYRFNGNDPINVGHERHYPEDFAAWMRTLGYNVGNLV--PQLARDLW  2666

Query  2963  QPSATITSPQL-------------TPDFGVMSGLQCIVN-RVHEKFSDLGFVPKPLLK--  3006
             QP A    P                P   V SG    +N R    F  L   P+  LK  
Sbjct  2667  QPPALWGRPPANPVALNLRRPFDNIPTMAVESGFLAHLNVRRMSDFEQLSAPPRSALKCD  2726

Query  3007  -LEPKTRNLLPRVAHRRAVFGEGILVSRVG-GRSLVSVVDGVNSVVQDVVTSVFNNSYFL  3064
              ++P  + +    +     FG+GI+VSR   G+++VS V   N++ +DV TSVFN S  L
Sbjct  2727  VMDPSPKTI---GSDTEPPFGKGIVVSRTADGQAIVSSVPAANAIYRDVYTSVFNRSKLL  2783

Query  3065  PLHFSVHD--QDVFYFVKDNALKIRDDMEELRRLGGMFNVSTHETTEHG-----------  3111
             P  F VH+  QD F+FVK++A +  +D ++L+RL G  N + HE T              
Sbjct  2784  PFTFVVHNAQQDSFFFVKEDAWRATEDRQQLKRLQGQVNTTFHEITREATVGSGPAGAAN  2843

Query  3112  --------------------AGTWKELRLHNPDAAVVIKYGADPEQERHRILKHAHKRAV  3151
                                  G + ++++H   A + ++YG    +E+ R++ HA   AV
Sbjct  2844  GGAGSSSSSSSSSGGGSSSNTGNYLDVKIHGAHAIINLRYGTTVAKEQQRLMHHAKLTAV  2903

Query  3152  ERAWEIEKQLVMAGFQGRGDWSKEEKDELISRGTVSGYEGVDIHSVHRYPQLADDPGNVA  3211
              +AW  EK+ + +G     +WS++E DE++ +   + YEG  IH V+ YP+LA+DP N+ 
Sbjct  2904  RKAWHREKEALRSGLTTALEWSQQETDEILKQSYANNYEGEYIHDVNLYPELAEDPYNIK  2963

Query  3212  FTR  3214
             F +
Sbjct  2964  FVK  2966


 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 35/54 (65%), Gaps = 0/54 (0%)

Query  901  IPPYSYWNMQFYQSEAAYVRFDYNIPRGASIGVYARRNALPTHTQYDLLEVLSG  954
            IP Y +W ++F     A++RF++ +P GA   VY+RRN  P+ TQ+D +E + G
Sbjct  367  IPAYQFWTLEFRNKHPAFIRFNFTLPWGAHFAVYSRRNVAPSVTQHDFVEFIKG  420


>H1ZUX0_CAEEL unnamed protein product
Length=2837

 Score = 796 bits (2055),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 666/2537 (26%), Positives = 1136/2537 (45%), Gaps = 344/2537 (14%)

Query  879   RSFPPDGTTFAQVGLGQKLSKEIPPYSYWNMQFYQSEAAYVRFDYNIPRGASIGVYARRN  938
             R+ PP       + LG+++  E  P S    +   ++ + +RF+  +  GA + +     
Sbjct  423   RALPP------AISLGERVDVEFFPKSMATTELTVTKPSRIRFNATVGSGAQLVLLMSAG  476

Query  939   ALPTHTQYDLL---------------EVLSGFKARTTRA--------SHVSVIPSIKKEV  975
               P+ + +D L                ++  F +R+ R+         ++ ++       
Sbjct  477   VHPSLSLHDALFPIRADRIRDSKSPTHIVEEFGSRSRRSLGASSSRHRNIEILSPRSATF  536

Query  976   THYMEPGHWFLSLYNDDGDPQEVSFIAMIAEDMTHN---------------------CPN  1014
               ++  G  +L+  N+    + +SF+A   +  T                       C +
Sbjct  537   EQFVLEGRHYLTFINERSRVEPISFVAEELQRPTTPPKTSSSGTSGAKEHPLASVLVCES  596

Query  1015  GCSGKGECLLGHCQCNPGFGGEDCSESVCPVLCSQRGEYINGECQCNPGWKGKECSLRHD  1074
              C+ +GEC+ G C C PGF G  C E+VCPV+CS  G +  G C C  G+KGKEC +RH+
Sbjct  597   NCNQRGECVHGKCHCAPGFTGRTCDEAVCPVVCSGNGVFSGGICVCKSGFKGKECEMRHN  656

Query  1075  ECEVPDCNGHGHC-TNGKCNCVRGYKGKYCEEVDCPHPTCSGHGFCAEGTCICKKGWKGA  1133
              CEV DCNG G C T+G+C C  G+ G+ CE   CPH +C   G C  GTC C  GW+G 
Sbjct  657   WCEVADCNGRGRCDTDGRCRCNPGWTGEACELRACPHASCHDRGVCVNGTCYCMDGWRGN  716

Query  1134  DC--------------------------SQMDKEALQCLPD-------------------  1148
             DC                          S+  K  ++  P                    
Sbjct  717   DCSVFADAIVHVPQAQSPPRRGQEPTESSKTRKAQVKPTPTSEKKKESRELQKPIIATVQ  776

Query  1149  --------CSGHGNFDLETQTCLCEPMWSGDDCSKELCDLDCGPHGHCVDN-ACDCLPGW  1199
                     CS HG   L    C CE  W   DCS++ C      +G C+D+ +C C  GW
Sbjct  777   VPTESSHPCSAHGQ--LIDDICQCESGWDSVDCSQQACQC---VNGDCLDDGSCQCWKGW  831

Query  1200  SGELCNLKQCDPRCNEHGQC-KNGTCLCVTGWNGKHCTMEGCPNSCSGHGQCRVGN-DGQ  1257
              G  C  K+C   C + G+C  +G+C C +GWNG++C ++GCPN CSG G+C +     +
Sbjct  832   RGSNCTDKKCAIGCEDRGKCASDGSCKCSSGWNGENCAIDGCPNQCSGKGECGMDRRSSE  891

Query  1258  WECRCYDGWDGKDCNVLLEQNCNDGRDNDKDGLIDCADPECCSNHICRSSQLCVSAPKPI  1317
             W CRC  G  G DC+V +E +C+DG DND DGLIDC DPECCS+  C S  +C +A  PI
Sbjct  892   WSCRCQAGSTGVDCSVSVEMHCDDGLDNDSDGLIDCDDPECCSSSSCSSESVCSTAASPI  951

Query  1318  DILLRKQPPAITASFFERMKFLIDEGSLQNYARQETFNESMFWNHFNTSRSAVVRGRVV-  1376
             ++L+R  PP   A+F +R+ FLI E S+Q+Y     FNE++          +V+RGRV+ 
Sbjct  952   EVLMR-MPPIFNANFAQRVGFLIMEKSVQSYTDSSQFNENLI---------SVIRGRVMW  1001

Query  1377  -------THLGT-------GLMGVRVSTST-PLEGFTLTRDDGWFDLLVNGGGAVTLQFG  1421
                      L T        L+GVRVS +  PL GFTLTR+DG+FDL VNG  +VTLQF 
Sbjct  1002  GGSPTGSDDLSTYSNKSTVPLVGVRVSDAAHPLYGFTLTREDGYFDLTVNGARSVTLQFL  1061

Query  1422  RSPFKPQSHIVFVPWNEVVIIDKIVMSTAEEKQTSHIPYA-----CAAHDYDLMKPVVLA  1476
             R+ F+     VFV   +++ ID IV+          I  A     C+     +   V+++
Sbjct  1062  RTQFQSVKKSVFVSPRQIIHIDDIVLYRQSGGSPPAISMAPARAKCSPTLRRIPDVVLIS  1121

Query  1477  TWKHGFQGA----CPDKSAILAESQVIQESLQIPGTGLNLVYHSSRAAGYLSTIQLQLTP  1532
              W++   G       D S I+ +S+ I ESL I GT + LVY S+R+    ST+ + L  
Sbjct  1122  NWQYTSDGIETDETSDSSRIVVDSRSIFESLPIQGTDVRLVYDSARSPAAPSTMLIGLLY  1181

Query  1533  EVIPPTLNLIHLRITIEGILFEKTFEADPVIKFTYAWNRLNVYRQRVYGVTTAMVKVGYE  1592
             + +   L  +H+ I I G  F++       + + +AW+++N YRQ   G+    V+VGYE
Sbjct  1182  DRVDKELRKVHINIRIAGRRFDRVLAPRTNLTYVFAWDKMNAYRQSESGLVPVTVRVGYE  1241

Query  1593  YNDC---KDIIWDVQTTKLSGHDMSISEVGGWNLDIHHRYNFHEGILQKGDGS-NIYLKQ  1648
             Y  C    + +W  + +++ G          W LDIHH  +    +++ G+G   +  + 
Sbjct  1242  YQGCDRTSERVWQTRRSQMMGATARKMIGTMWTLDIHHHLDIVNNVVEMGNGGYRLITES  1301

Query  1649  KPRVILTTMGDGHQRSLDCYDCDRQAEASNQRLLAPVALATASDGSIFVGDFNLVRKILV  1708
             +PRV      DG +R ++C  C+ + ++ +  L  P  +  A DGS+ +GD N++R++  
Sbjct  1302  EPRVSTFAGLDGVKRDVECLKCEGKVDSIS--LFRPTTVVYAQDGSLIIGDHNMIRRVSQ  1359

Query  1709  DGTVRTVVRLNATRVSYRYHIALSPLDGSLYISDPESHQIIRVRDTNDYSEPDHNWETVV  1768
             DG V T++ L     S+ Y+IA+SP+DG++ IS P   Q+ R+  + +  +  +N++ + 
Sbjct  1360  DGQVSTILTLGLADTSHSYYIAVSPVDGTIAISLPLHKQVWRI-SSLEPQDSRNNYDVLA  1418

Query  1769  GSGERCLPGDEAHCGDGALARDAKLAYPKGVAVSADNVLYFADGTNIRMVDRDGIITTVI  1828
             G G  C    ++ CGDGALA++A+L +PKG++      LY AD   IR++D  G I + I
Sbjct  1419  GDGTVCASAVDS-CGDGALAQNAQLIFPKGISFDKMGNLYLADSRRIRVIDTTGHIRS-I  1476

Query  1829  GNHMHKSHWKPI-PCEGTLNVEEVHLRWPTELAINPLDNSLHMIDDHMVLQL-APDGRVK  1886
             G      H  PI  C     + ++ + WPT L I+P+  S+ ++D ++V ++      V 
Sbjct  1477  GETTPDQH--PIRTCAQITKLVDLQMEWPTSLTIDPITGSVLVLDTNVVYEIDVVHDVVT  1534

Query  1887  VVAGRPLHC--ASPSSSFDTELATHATLVM--PQSIAFGPSGNLYIAESDSQRINRVRVI  1942
             +  G P  C  A+ +SS   +   H   ++   + I  G  G +Y+ ESD +R+N+VR +
Sbjct  1535  IALGSPTTCDLANATSSASAKSLDHRRHLIQNARDITVGTDGAIYVVESDGRRLNQVRKL  1594

Query  1943  GTD-GKISPYAGAESKCNCLERGCDCFDA---DHYLASTSKFNTISAVAVSPDGVVHIGD  1998
              +D    S   G +S C+C    C C DA       AS +  ++  AV VSP G V I D
Sbjct  1595  SSDRSTFSILTGGKSPCSCDVAACGCDDAVSLRDVAASQAHLSSPYAVCVSPSGDVIIAD  1654

Query  1999  QANYRIRSVMASIPDASG-AREYEIYSPDTQEIYVFNRFGQHVATKNILTGEIVYQFTYN  2057
               N +I+ V A +    G +R YE+   + QE Y FNR GQH +T +++TG   + F+Y 
Sbjct  1655  SGNSKIKKVSARMAKYDGRSRTYEVTDAERQEKYTFNRHGQHSSTVSLITGRTFFNFSYQ  1714

Query  2058  VNTSNGKLSTVTDAAGNKVFLLRDYSSQVNSIENTKGQKCRLRMSR----MKMLHELSTP  2113
             V++    +S +  A+G  + +L+   S  + +E T GQ+  L MS     ++ + +  + 
Sbjct  1715  VDSPISMISEIRAASGVVLRVLKRNDSLFD-LETTLGQRTTLTMSAYDGTLEQVSKRDSA  1773

Query  2114  DNYNVTFDYHGPTGLLKTKLDSTGRSYVYNYDEFGRLTSAVTPTGKVISLTFD---LSLK  2170
              + + T  ++   GLL +++D    +  + YDE+GR           I L  D     L 
Sbjct  1774  TSRDATKLFY-KKGLLTSRID-VATAVGFEYDEYGR----------AIGLKRDREYWRLG  1821

Query  2171  GAVVKVGQNNRKPI--------SMLIKGSSVVTKVGEAEQRTTVLSDGSVGQVTPWAHTV  2222
                + +G  N + +          L +G+  V     A  R   L +      +P    +
Sbjct  1822  EETISMGSVNTEVLLNGQRFQQVRLGEGNLAVHSTNGATTRLISLRNEGYSLASP----L  1877

Query  2223  STDTLPYSVLAEIEPLLGESYPVPAKQRTEIAG-------DLANRFEWRYFLRKFQGNKY  2275
              T TL Y   + I    GE  P+ +++RT++         +L  R++WR+  R+   +  
Sbjct  1878  GTSTL-YDKSSSIPDSNGE--PLISRRRTKVPAIGNPQRRELTTRWDWRHVARRGDDSDG  1934

Query  2276  RSESKTVAQVGRKLRINGDILLSLEYDRETNSVAVFM----DDDAELLNVTYDRTARPVK  2331
                 + VA+      ING  + S+EYD ++N   + +    DD   LL + Y  + R  +
Sbjct  1935  SLGRRKVAE------INGVNMFSMEYDVKSNQDTLRLGSTTDDAQALLFIDYTSSGRIRR  1988

Query  2332  W-GPRNGIFSGVELEYDRFSRLTSWTWGDISETYGFDRAGRLYEIKYSDGTSMVYAFKDM  2390
                P +   + + + +D   R +  TWG       +D + RL E    DG  +       
Sbjct  1989  ISAPEDSQMAEMNITWDGAGRKSEVTWGSWKIRLTYDNSNRLTEHAI-DGARVPIKMSYA  2047

Query  2391  FSSLPLKVTTPRGSDYLLQYDEAGALQSLTTPRGHIHAFSLQTSLGF--YKYQYYSPMNR  2448
              +S         G+ + +QYD    ++ + +      +FS   +LG   +  +  + +N 
Sbjct  2048  GASRRPNEIQHDGAKWNIQYDNYDRIKEVISKSQEATSFS-SIALGGDEWVLKRRTSLNS  2106

Query  2449  HPYEILYNDDGQILAKVYPHQSGKVAYVYDHTGKLETTLAGLSSIHYTYQETTSLVHSID  2508
              P  +  + +G++L    P ++        +  + +  + G ++     +ETT +     
Sbjct  2107  KPSLVRLSREGKVLESTTPDEN-------HYWLERKDPITGRTTEILNDEETTVVTCWSP  2159

Query  2509  INEP------NFEMRIEYKYHAGIVKDEKIKFGSKSGLD-NARYRYQYDGNARISGIEVD  2561
                P      N +     + H    K   I   + S     + + Y+YD   R++ I+  
Sbjct  2160  EGAPMCSRSRNLQENTTMQGHLVARKSVTIMTPTSSEPSITSSFTYEYDDMLRVTTIQPV  2219

Query  2562  INGKQLPQLRLKYNQNLGILEGVGDLRIYRNLFN-----RSVMQDSSKQFFTVTDYDEHG  2616
             I    L  ++L Y++  G +  +   +  R+          +M ++SK      D+ +  
Sbjct  2220  IEQSVLESIQLSYDERRGHVAAINGFKWARDASTSRCQGHGLMYETSK----ANDHRQVV  2275

Query  2617  RVKTVLMNIR-SLDVFRMELEYDNRNRIKMRKLSIGKDAMEKKEWTKMEKITYNADGHVL  2675
               K +  + R S+ + R     D   R     L I     ++ +  K+ + T++A G   
Sbjct  2276  ERKLIFGDARASIKIIR-----DKAGRASESHLEISSSGTQRNQ--KITR-TFDAAGR--  2325

Query  2676  EVADTENNWQYAYDENGNVIGVTEHNEKIALGYDSGDRVVQYGDVEFNSYDGRGFVVIRG  2735
              VA  E N Q       N     E      + ++ G  +  + D+ +   D  G+VV R 
Sbjct  2326  -VASVEQNDQEPVRIIWNSDARVEKINDRVVEWNRGGALKTFQDISYQ-VDSIGWVVKRD  2383

Query  2736  EHK-YRYNSRGQLIHASEHKKFQIWYFYDDRGRLVAWNDDRENITQFFYANPKTPDLITH  2794
                 + Y+ +G+L+ A    + +I  FYD   R+V   + ++ I  F+Y    TP L++ 
Sbjct  2384  NTTVFGYDGKGRLVSA-RSSQLRINIFYDREDRVVQIQNSKDFI-HFYYGYIDTPKLVS-  2440

Query  2795  IHFPKSSKTFRFLYDSRNFLMTVETSE-QRFYVATDQNGSPLALFDTNGNLIKEMRRTPF  2853
              HF K+ K     YD  +    +++ +  R+ + TD+  +  A+   + N+++ + R+ F
Sbjct  2441  -HFSKNGKISTLFYDDDSVPFAMQSDDGTRYALLTDETSTIKAIIG-DSNVLRIIDRSVF  2498

Query  2854  GKIIKDTNPDF-YLPIDFHGGLLDPNTKLVYLNK-RLYDPTVGQWMTPAWE-----QMAN  2906
             G ++  ++    +LPI + GG+      +  LN  R  D    ++M+ + E     ++  
Sbjct  2499  GALLPSSSSSHPFLPIGYLGGIEISEISVSILNNGRPLDLYSERYMSISPEAVVRLELNE  2558

Query  2907  ELTTPTDIFIYRFRNNDPINFKQNVEYMTDLASWLKLYGYDISAMLGSEYMKQMVYQPSA  2966
             + +   D+      +  P   +   E   D  +W  L G                     
Sbjct  2559  KFSNSIDLMALEI-DRQPFRVENVPE---DFETWFSLAGL--------------------  2594

Query  2967  TITSPQLTPDFGV-MSGLQCIVNRVHEKFSDLGFVPKPLLKLEPKTRNLLPRVAHRRAV-  3024
                SP L P   + +     IV+R+   F      P+ L  L   T  L  R+A   ++ 
Sbjct  2595  ---SPNLLPSAHLGLPASSAIVHRLLSSF------PRKLRPLTHLTTVLPTRLASDISLT  2645

Query  3025  --------------FGEGILVSR--VGGRSLVSVVDGVNSVVQDVVTSVFNNSYFLPLHF  3068
                           F   ++++     G  +V ++  + S  ++V++ +F+    L    
Sbjct  2646  SPTSETSWSIDDVGFSNLLILNEDATTGEVMVEMLSDLKSEEREVISKLFDGVKSL----  2701

Query  3069  SVHDQDVFYFVKDNALKIRDDMEELRRLGGMFNVSTHETTEHGAGTWKE-LRLHNPDAAV  3127
                D   +  V    L         R       +S+   +       K+ + L N  + +
Sbjct  2702  ---DFATWGLVPTRHL--------WRAPNSKLELSSTSFSHFTMAVNKDSVELRNGKSKI  2750

Query  3128  VIKYGADPEQERHRILKHAHKRAVERAWEIEKQLVMAGFQGRGDWSKEEKDELISRGTVS  3187
             V+ +  +  +   +I++    R     W  E++   AG +    WS  E  EL S+G+VS
Sbjct  2751  VVHFSENKAEIVKKIVEELKTRENIAVWRAERKRAEAGEKTWRQWSDRETRELTSKGSVS  2810

Query  3188  GYEGVDIHSVHRYPQLA  3204
             GY+ +++   H+   LA
Sbjct  2811  GYD-IEMKPAHQSGLLA  2826



Lambda      K        H
   0.318    0.134    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4782626282


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Oct 18, 2022  4:55 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_050469442.1 teneurin-m isoform X2 [Bombus huntii]

Length=3231
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TENM_DROME  unnamed protein product                                   3873    0.0  
TENA_DROME  unnamed protein product                                   1130    0.0  
H1ZUX0_CAEEL  unnamed protein product                                 793     0.0  


>TENM_DROME unnamed protein product
Length=2731

 Score = 3873 bits (10044),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1776/2357 (75%), Positives = 2060/2357 (87%), Gaps = 26/2357 (1%)

Query  872   GARTFPARSFPPDGTTFAQVGLGQKLSKEIPPYSYWNMQFYQSEAAYVRFDYNIPRGASI  931
             GARTFPARSFPPDGTTF Q+ LGQKL+KEI PYSYWNMQFYQSE AYV+FDY IPRGASI
Sbjct  376   GARTFPARSFPPDGTTFGQITLGQKLTKEIQPYSYWNMQFYQSEPAYVKFDYTIPRGASI  435

Query  932   GVYARRNALPTHTQYDLLEVLSGFKA--RTTRASHPSIKKEVTHYMEPGHWFLSLYNDDG  989
             GVY RRNALPTHTQY   EVLSGF A  RT RA+H SI +EVT YMEPGHWF+SLYNDDG
Sbjct  436   GVYGRRNALPTHTQYHFKEVLSGFSASTRTARAAHLSITREVTRYMEPGHWFVSLYNDDG  495

Query  990   DPQEVSFIAMIAEDMTHNCPNGCSGKGECLLGHCQCNPGFGGEDCSESVCPVLCSQRGEY  1049
             D QE++F A +AEDMT NCPNGCSG G+CLLGHCQCNPGFGG+DCSESVCPVLCSQ GEY
Sbjct  496   DVQELTFYAAVAEDMTQNCPNGCSGNGQCLLGHCQCNPGFGGDDCSESVCPVLCSQHGEY  555

Query  1050  INGECQCNPGWKGKECSLRHDECEVPDCNGHGHCTNGKCNCVRGYKGKYCEEVDCPHPTC  1109
              NGEC CNPGWKGKECSLRHDECEV DC+GHGHC +GKC C+RGYKGK+CEEVDCPHP C
Sbjct  556   TNGECICNPGWKGKECSLRHDECEVADCSGHGHCVSGKCQCMRGYKGKFCEEVDCPHPNC  615

Query  1110  SGHGFCAEGTCICKKGWKGADCSQMDKEALQCLPDCSGHGNFDLETQTCLCEPMWSGDDC  1169
             SGHGFCA+GTCICKKGWKG DC+ MD++ALQCLPDCSGHG FDL+TQTC CE  WSGDDC
Sbjct  616   SGHGFCADGTCICKKGWKGPDCATMDQDALQCLPDCSGHGTFDLDTQTCTCEAKWSGDDC  675

Query  1170  SKELCDLDCGPHGHCVDNACDCLPGWSGELCNLKQCDPRCNEHGQCKNGTCLCVTGWNGK  1229
             SKELCDLDCG HG C  +AC C P W GE CN + CD RCNEHGQCKNGTCLCVTGWNGK
Sbjct  676   SKELCDLDCGQHGRCEGDACACDPEWGGEYCNTRLCDVRCNEHGQCKNGTCLCVTGWNGK  735

Query  1230  HCTMEGCPNSCSGHGQCRVGNDGQWECRCYDGWDGKDCNVLLEQNCNDGRDNDKDGLIDC  1289
             HCT+EGCPNSC+GHGQCRV  +GQWECRCY+GWDG DC + LE NC D +DNDKDGL+DC
Sbjct  736   HCTIEGCPNSCAGHGQCRVSGEGQWECRCYEGWDGPDCGIALELNCGDSKDNDKDGLVDC  795

Query  1290  ADPECCSNHICRSSQLCVSAPKPIDILLRKQPPAITASFFERMKFLIDEGSLQNYARQET  1349
              DPECC++H+C++SQLCVSAPKPID+LLRKQPPAITASFFERMKFLIDE SLQNYA+ ET
Sbjct  796   EDPECCASHVCKTSQLCVSAPKPIDVLLRKQPPAITASFFERMKFLIDESSLQNYAKLET  855

Query  1350  FNESMFWNHFNTSRSAVVRGRVVTHLGTGLMGVRVSTSTPLEGFTLTRDDGWFDLLVNGG  1409
             FNES         RSAV+RGRVVT LG GL+GVRVST+T LEGFTLTRDDGWFDL+VNGG
Sbjct  856   FNES---------RSAVIRGRVVTSLGMGLVGVRVSTTTLLEGFTLTRDDGWFDLMVNGG  906

Query  1410  GAVTLQFGRSPFKPQSHIVFVPWNEVVIIDKIVMSTAEEKQTS-HIPYACAAHDYDLMKP  1468
             GAVTLQFGR+PF+PQS IV VPWNEVVIID +VMS +EEK  +    + C AHDYDLMKP
Sbjct  907   GAVTLQFGRAPFRPQSRIVQVPWNEVVIIDLVVMSMSEEKGLAVTTTHTCFAHDYDLMKP  966

Query  1469  VVLATWKHGFQGACPDKSAILAESQVIQESLQIPGTGLNLVYHSSRAAGYLSTIQLQLTP  1528
             VVLA+WKHGFQGACPD+SAILAESQVIQESLQIPGTGLNLVYHSSRAAGYLSTI+LQLTP
Sbjct  967   VVLASWKHGFQGACPDRSAILAESQVIQESLQIPGTGLNLVYHSSRAAGYLSTIKLQLTP  1026

Query  1529  EVIPPTLNLIHLRITIEGILFEKTFEADPVIKFTYAWNRLNVYRQRVYGVTTAMVKVGYE  1588
             +VIP +L+LIHLRITIEGILFE+ FEADP IKFTYAWNRLN+YRQRVYGVTTA+VKVGY+
Sbjct  1027  DVIPTSLHLIHLRITIEGILFERIFEADPGIKFTYAWNRLNIYRQRVYGVTTAVVKVGYQ  1086

Query  1589  YNDCKDIIWDVQTTKLSGHDMSISEVGGWNLDIHHRYNFHEGILQKGDGSNIYLKQKPRV  1648
             Y DC DI+WD+QTTKLSGHDMSISEVGGWNLDIHHRYNFHEGILQKGDGSNIYL+ KPR+
Sbjct  1087  YTDCTDIVWDIQTTKLSGHDMSISEVGGWNLDIHHRYNFHEGILQKGDGSNIYLRNKPRI  1146

Query  1649  ILTTMGDGHQRSLDCYDCDRQAEASNQRLLAPVALATASDGSIFVGDFNLVRKILVDGTV  1708
             ILTTMGDGHQR L+C DCD QA  + QRLLAPVALA A DGS+FVGDFN +R+I+ DG++
Sbjct  1147  ILTTMGDGHQRPLECPDCDGQA--TKQRLLAPVALAAAPDGSLFVGDFNYIRRIMTDGSI  1204

Query  1709  RTVVRLNATRVSYRYHIALSPLDGSLYISDPESHQIIRVRDTNDYSEPDHNWETVVGSGE  1768
             RTVV+LNATRVSYRYH+ALSPLDG+LY+SDPESHQIIRVRDTNDYS+P+ NWE VVGSGE
Sbjct  1205  RTVVKLNATRVSYRYHMALSPLDGTLYVSDPESHQIIRVRDTNDYSQPELNWEAVVGSGE  1264

Query  1769  RCLPGDEAHCGDGALARDAKLAYPKGVAVSADNVLYFADGTNIRMVDRDGIITTVIGNHM  1828
             RCLPGDEAHCGDGALA+DAKLAYPKG+A+S+DN+LYFADGTNIRMVDRDGI++T+IGNHM
Sbjct  1265  RCLPGDEAHCGDGALAKDAKLAYPKGIAISSDNILYFADGTNIRMVDRDGIVSTLIGNHM  1324

Query  1829  HKSHWKPIPCEGTLNVEEVHLRWPTELAINPLDNSLHMIDDHMVLQLAPDGRVKVVAGRP  1888
             HKSHWKPIPCEGTL +EE+HLRWPTELA++P+DN+LH+IDDHM+L++ PDGRV+V++GRP
Sbjct  1325  HKSHWKPIPCEGTLKLEEMHLRWPTELAVSPMDNTLHIIDDHMILRMTPDGRVRVISGRP  1384

Query  1889  LHCASPSSSFDTELATHATLVMPQSIAFGPSGNLYIAESDSQRINRVRVIGTDGKISPYA  1948
             LHCA+ S+++DT+LATHATLVMPQSIAFGP G LY+AESDSQRINRVRVIGTDG+I+P+A
Sbjct  1385  LHCATASTAYDTDLATHATLVMPQSIAFGPLGELYVAESDSQRINRVRVIGTDGRIAPFA  1444

Query  1949  GAESKCNCLERGCDCFDADHYLASTSKFNTISAVAVSPDGVVHIGDQANYRIRSVMASIP  2008
             GAESKCNCLERGCDCF+A+HYLA+++KFNTI+A+AV+PD  VHI DQANYRIRSVM+SIP
Sbjct  1445  GAESKCNCLERGCDCFEAEHYLATSAKFNTIAALAVTPDSHVHIADQANYRIRSVMSSIP  1504

Query  2009  DASGAREYEIYSPDTQEIYVFNRFGQHVATKNILTGEIVYQFTYNVNTSNGKLSTVTDAA  2068
             +AS +REYEIY+PD QEIY+FNRFGQHV+T+NILTGE  Y FTYNVNTSNGKLSTVTDAA
Sbjct  1505  EASPSREYEIYAPDMQEIYIFNRFGQHVSTRNILTGETTYVFTYNVNTSNGKLSTVTDAA  1564

Query  2069  GNKVFLLRDYSSQVNSIENTKGQKCRLRMSRMKMLHELSTPDNYNVTFDYHGPTGLLKTK  2128
             GNKVFLLRDY+SQVNSIENTKGQKCRLRM+RMKMLHELSTPDNYNVT++YHGPTGLL+TK
Sbjct  1565  GNKVFLLRDYTSQVNSIENTKGQKCRLRMTRMKMLHELSTPDNYNVTYEYHGPTGLLRTK  1624

Query  2129  LDSTGRSYVYNYDEFGRLTSAVTPTGKVISLTFDLSLKGAVVKVGQNNRKPISMLIKGSS  2188
             LDSTGRSYVYNYDEFGRLTSAVTPTG+VI L+FDLS+KGA VKV +N +K +S+LI+G++
Sbjct  1625  LDSTGRSYVYNYDEFGRLTSAVTPTGRVIELSFDLSVKGAQVKVSENAQKEMSLLIQGAT  1684

Query  2189  VVTKVGEAEQRTTVLSDGSVGQVTPWAHTVSTDTLPYSVLAEIEPLLGESYPVPAKQRTE  2248
             V+ + G AE RTTV  DGS   +TPW H +  +  PY++LAE  PLLGESYPVPAKQRTE
Sbjct  1685  VIVRNGAAESRTTVDMDGSTTSITPWGHNLQMEVAPYTILAEQSPLLGESYPVPAKQRTE  1744

Query  2249  IAGDLANRFEWRYFLRKFQ----GNKYRSESKTVAQVGRKLRINGDILLSLEYDRETNSV  2304
             IAGDLANRFEWRYF+R+ Q    G + +   + V +VGRKLR+NGD +L+LEYDRET SV
Sbjct  1745  IAGDLANRFEWRYFVRRQQPLQAGKQSKGPPRPVTEVGRKLRVNGDNVLTLEYDRETQSV  1804

Query  2305  AVFMDDDAELLNVTYDRTARPVKWGPRNGIFSGVELEYDRFSRLTSWTWGDISETYGFDR  2364
              V +DD  ELLNVTYDRT+RP+ + P++G ++ V+LEYDRF RL SW WG + E Y FDR
Sbjct  1805  VVMVDDKQELLNVTYDRTSRPISFRPQSGDYADVDLEYDRFGRLVSWKWGVLQEAYSFDR  1864

Query  2365  AGRLYEIKYSDGTSMVYAFKDMFSSLPLKVTTPRGSDYLLQYDEAGALQSLTTPRGHIHA  2424
              GRL EIKY DG++MVYAFKDMF SLPLKVTTPR SDYLLQYD+AGALQSLTTPRGHIHA
Sbjct  1865  NGRLNEIKYGDGSTMVYAFKDMFGSLPLKVTTPRRSDYLLQYDDAGALQSLTTPRGHIHA  1924

Query  2425  FSLQTSLGFYKYQYYSPMNRHPYEILYNDDGQILAKVYPHQSGKVAYVYDHTGKLETTLA  2484
             FSLQTSLGF+KYQYYSP+NRHP+EILYND+GQILAK++PHQSGKVA+V+D  G+LET LA
Sbjct  1925  FSLQTSLGFFKYQYYSPINRHPFEILYNDEGQILAKIHPHQSGKVAFVHDTAGRLETILA  1984

Query  2485  GLSSIHYTYQETTSLVHSIDINEPNFEMRIEYKYHAGIVKDEKIKFGSKSGLDNARYRYQ  2544
             GLSS HYTYQ+TTSLV S+++ EP FE+R E+KYHAGI+KDEK++FGSK+ L +ARY+Y 
Sbjct  1985  GLSSTHYTYQDTTSLVKSVEVQEPGFELRREFKYHAGILKDEKLRFGSKNSLASARYKYA  2044

Query  2545  YDGNARISGIEVDINGKQLPQLRLKYNQNLGILEGVGDLRIYRNLFNRSVMQDSSKQFFT  2604
             YDGNAR+SGIE+ I+ K+LP  R KY+QNLG LE V DL+I RN FNR+V+QDS+KQFF 
Sbjct  2045  YDGNARLSGIEMAIDDKELPTTRYKYSQNLGQLEVVQDLKITRNAFNRTVIQDSAKQFFA  2104

Query  2605  VTDYDEHGRVKTVLMNIRSLDVFRMELEYDNRNRIKMRKLSIGKDAMEKKEWTKMEKITY  2664
             + DYD+HGRVK+VLMN++++DVFR+EL+YD RNRIK +K + G+        T  +KI Y
Sbjct  2105  IVDYDQHGRVKSVLMNVKNIDVFRLELDYDLRNRIKSQKTTFGRS-------TAFDKINY  2157

Query  2665  NADGHVLEVADTENNWQYAYDENGNVIGVTEHNEKIALGYDSGDRVVQYGDVEFNSYDGR  2724
             NADGHV+EV  T NNW+Y +DENGN +GV +  EK  LGYD GDRV++ GDVEFN+YD R
Sbjct  2158  NADGHVVEVLGT-NNWKYLFDENGNTVGVVDQGEKFNLGYDIGDRVIKVGDVEFNNYDAR  2216

Query  2725  GFVVIRGEHKYRYNSRGQLIHASEHKKFQIWYFYDDRGRLVAWNDDRENITQFFYANPKT  2784
             GFVV RGE KYRYN+RGQLIH+ E ++FQ WY+YDDR RLVAW+D++ N TQ++YANP+T
Sbjct  2217  GFVVKRGEQKYRYNNRGQLIHSFERERFQSWYYYDDRSRLVAWHDNKGNTTQYYYANPRT  2276

Query  2785  PDLITHIHFPKSSKTFRFLYDSRNFLMTVETSEQRFYVATDQNGSPLALFDTNGNLIKEM  2844
             P L+TH+HFPK S+T +  YD R+ L+ +E  +QR+YVATDQNGSPLA FD NG+++KEM
Sbjct  2277  PHLVTHVHFPKISRTMKLFYDDRDMLIALEHEDQRYYVATDQNGSPLAFFDQNGSIVKEM  2336

Query  2845  RRTPFGKIIKDTNPDFYLPIDFHGGLLDPNTKLVYLNKRLYDPTVGQWMTPAWEQMANEL  2904
             +RTPFG+IIKDT P+F++PIDFHGGL+DP+TKLVY  +R YDP VGQWMTP WE +A E+
Sbjct  2337  KRTPFGRIIKDTKPEFFVPIDFHGGLIDPHTKLVYTEQRQYDPHVGQWMTPLWETLATEM  2396

Query  2905  TTPTDIFIYRFRNNDPINFKQNVEYMTDLASWLKLYGYDISAMLGSEYMKQMVYQPSATI  2964
             + PTD+FIYR+ NNDPIN  +   YM DL SWL+L+GYD++ M  S Y K   Y P A+I
Sbjct  2397  SHPTDVFIYRYHNNDPINPNKPQNYMIDLDSWLQLFGYDLNNMQSSRYTKLAQYTPQASI  2456

Query  2965  TSPQLTPDFGVMSGLQCIVNRVHEKFSDLGFVPKPLLKLEPKTRNLLPRVAHRRAVFGEG  3024
              S  L PDFGV+SGL+CIV +  EKFSD  FVPKPLLK+EPK RNLLPRV++RR VFGEG
Sbjct  2457  KSNTLAPDFGVISGLECIVEKTSEKFSDFDFVPKPLLKMEPKMRNLLPRVSYRRGVFGEG  2516

Query  3025  ILVSRVGGRSLVSVVDGVNSVVQDVVTSVFNNSYFLPLHFSVHDQDVFYFVKDNALKIRD  3084
             +L+SR+GGR+LVSVVDG NSVVQDVV+SVFNNSYFL LHFS+HDQDVFYFVKDN LK+RD
Sbjct  2517  VLLSRIGGRALVSVVDGSNSVVQDVVSSVFNNSYFLDLHFSIHDQDVFYFVKDNVLKLRD  2576

Query  3085  DMEELRRLGGMFNVSTHETTEHGAGTWKELRLHNPDAAVVIKYGADPEQERHRILKHAHK  3144
             D EELRRLGGMFN+STHE ++HG    KELRLH PDA V+IKYG DPEQERHRILKHAHK
Sbjct  2577  DNEELRRLGGMFNISTHEISDHGGSAAKELRLHGPDAVVIIKYGVDPEQERHRILKHAHK  2636

Query  3145  RAVERAWEIEKQLVMAGFQGRGDWSKEEKDELISRGTVSGYEGVDIHSVHRYPQLADDPG  3204
             RAVERAWE+EKQLV AGFQGRGDW++EEK+EL+  G V G+ G+DIHS+H+YPQLADDPG
Sbjct  2637  RAVERAWELEKQLVAAGFQGRGDWTEEEKEELVQHGDVDGWNGIDIHSIHKYPQLADDPG  2696

Query  3205  NVAFTRDTKRKRRKSGN  3221
             NVAF RD KRKRRK+G+
Sbjct  2697  NVAFQRDAKRKRRKTGS  2713


>TENA_DROME unnamed protein product
Length=3004

 Score = 1130 bits (2923),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 514/1029 (50%), Positives = 698/1029 (68%), Gaps = 45/1029 (4%)

Query  966   SIKKEVTHYMEPGHWFLSLYNDDGDPQEVSFIAMIAEDMTHNCPNGCSGKGECLLGHCQC  1025
             ++   +  Y++ G WF+S+YND+     VS +A  AE ++  CPN CSG+G C LG C C
Sbjct  518   TVNVSLLQYLDTGLWFISVYNDELVAHSVSLLAEEAEGVSTTCPNDCSGRGSCYLGKCDC  577

Query  1026  NPGFGGEDCSESVCPVLCSQRGEYINGECQCNPGWKGKECSLRHDECEVPDCNGHGHCTN  1085
               G+ G DCS+SVCPVLCS  G Y  G C C  GWKG EC +   ECEVP+C+ HG C  
Sbjct  578   IDGYQGVDCSKSVCPVLCSAHGHYGGGVCHCEEGWKGAECDIPVGECEVPNCSSHGRCIE  637

Query  1086  GKCNCVRGYKGKYCEEVDCPHPTCSGHGFCAEGTCICKKGWKGADCSQMDKEALQCLPDC  1145
             G+C+C RG+KG YC++ DC  P CSGHG C  G C CK GW+G DC  +D++  QCLP C
Sbjct  638   GECHCERGWKGPYCDQHDCLDPLCSGHGTCVAGQCYCKAGWQGEDCGTIDQQVYQCLPGC  697

Query  1146  SGHGNFDLETQTCLCEPMWSGDDCSKELCDLDCGPHGHCVDNACDCLPGWSGELCNLKQC  1205
             S HG +DLET  C+CE  W+G DCS+ +C LDCG +G C    C C  GW+G LC+   C
Sbjct  698   SEHGTYDLETGQCVCERHWTGPDCSQAVCSLDCGRNGVCESGKCRCNSGWTGNLCDQLPC  757

Query  1206  DPRCNEHGQCKNGTCLCVTGWNGKHCTMEGCPNSCSGHGQCRVGNDGQWECRCYDGWDGK  1265
             D RC+EHGQCKNGTC+C  GWNG+HCT+ GC N CS HGQC + N G++ C C +GW G+
Sbjct  758   DSRCSEHGQCKNGTCVCSQGWNGRHCTLPGCENGCSRHGQCTLEN-GEYRCDCIEGWAGR  816

Query  1266  DCNVLLEQNCNDGRDNDKDGLIDCADPECCSNHICRSSQLCVSAPKPIDILLRKQPPAIT  1325
             DC++ LE NC D  DND DG+ DC+D ECCS+  C    +C+S+  P+++LLRKQPP++T
Sbjct  817   DCSIALELNCKDNIDNDGDGMTDCSDSECCSHPACSEHIMCLSSNDPVEVLLRKQPPSVT  876

Query  1326  ASFFERMKFLIDEGSLQNYARQETFNESMFWNHFNTSRSAVVRGRVVTHLGTGLMGVRVS  1385
             ASF++R+KFLI+E S+Q+YA  + ++E         +R +V+RG+V+T  G G++G+RVS
Sbjct  877   ASFYQRVKFLIEENSVQSYAHMDEYSE---------NRVSVMRGQVITPQGLGIVGIRVS  927

Query  1386  TSTPLE-GFTLTRDDGWFDLLVNGGGAVTLQFGRSPFKPQSHIVFVPWNEVVIIDKIVMS  1444
                    GFTLTR  GWFD+LVNGGGAVTLQF RSPF+P +  VFVPWN +V++  + M 
Sbjct  928   VDRDSRFGFTLTRQGGWFDVLVNGGGAVTLQFQRSPFRPLTRTVFVPWNRIVVLPPVQMQ  987

Query  1445  TAEEKQTS-----------------HIPY-----------ACAAHDYDLMKPVVLATWKH  1476
              +++ +T+                  I Y            C  HD++ ++P +++TW  
Sbjct  988   LSDDDETTSRNIKVAPLNPALTFLNSIHYHTADEANDASKVCMDHDHEKLRPQLISTWMP  1047

Query  1477  GFQGACPDKSAILAESQVIQESLQIPGTGLNLVYHSSRAAGYLSTIQLQLTPEVIPPTLN  1536
                GA P K  I AE+Q++QES+QIPG+ L+L Y SS+A+GYLS ++++LT E IPPTL 
Sbjct  1048  NGVGAMPGKRVIFAETQIVQESIQIPGSDLHLTYQSSQASGYLSIVRMRLTGETIPPTLT  1107

Query  1537  LIHLRITIEGILFEKTFEADPVIKFTYAWNRLNVYRQRVYGVTTAMVKVGYEYNDCKDII  1596
              +H+ + IEG L  KT+EADP +  T+AWN+ NVYRQ+VYGVT A + VGY+++ C+  +
Sbjct  1108  HVHVGVEIEGALHVKTYEADPSLVHTFAWNKRNVYRQKVYGVTVARISVGYQHSTCQSPV  1167

Query  1597  WDVQTTKLSGHDMSISEVGGWNLDIHHRYNFHEGILQKGDGSNIYLKQKPRVILTTMGDG  1656
             W  QT KL G+D+ IS++GGW LDIHH YNFHEGILQKGDGS +++K+ PR +   MG G
Sbjct  1168  WIAQTAKLQGYDVDISDIGGWGLDIHHHYNFHEGILQKGDGSTLHMKEYPRTVKVVMGTG  1227

Query  1657  HQRSLDCYD-CDRQAEASNQRLLAPVALATASDGSIFVGDFNLVRKILVDGTVRTVVRLN  1715
              QR L C D C+    A + +LL P+ALAT  DGS++VGDFNLVR+I  DG V T+++L+
Sbjct  1228  LQRPLTCPDYCN--GVAKDAKLLTPIALATGPDGSLYVGDFNLVRRITPDGKVYTILQLS  1285

Query  1716  ATRVSYRYHIALSPLDGSLYISDPESHQIIRVRDTNDYSEPDHNWETVVGSGERCLPGDE  1775
             AT+VSY+Y++A+SP DG LYISDPE HQI+R+       +P  N + VVGSG+RC+PGDE
Sbjct  1286  ATQVSYQYYLAVSPADGHLYISDPERHQILRLVRLEKVKDPSINSDPVVGSGQRCIPGDE  1345

Query  1776  AHCGDGALARDAKLAYPKGVAVSADNVLYFADGTNIRMVDRDGIITTVIGNHMHKSHWKP  1835
              +CGDG  A  A+L++PKG+A++AD  +Y ADGTNIR VD  G+I T+IG+H H +HW P
Sbjct  1346  GNCGDGGPALLARLSHPKGLAIAADRTMYIADGTNIRAVDPKGVIHTLIGHHGHHNHWSP  1405

Query  1836  IPCEGTLNVEEVHLRWPTELAINPLDNSLHMIDDHMVLQLAPDGRVKVVAGRPLHCASPS  1895
              PC GTL   +  L+WPT LA++PLD SLH IDD +VL+L  D +++VVAG PLHC++  
Sbjct  1406  APCSGTLMANQAQLQWPTGLALSPLDGSLHFIDDRLVLRLTSDMKIRVVAGTPLHCSNGG  1465

Query  1896  SSFDT-ELATHATLVMPQSIAFGPSGNLYIAESDSQRINRVRVIGTDGKISPYAGAESKC  1954
                   +      L    ++AF P GNLYIA+SDS+R+N +RV+ T G +  +AG +   
Sbjct  1466  QDGRVNKTGADNVLGTVLAMAFSPFGNLYIADSDSRRVNSIRVVDTAGNMRYFAGKQEGT  1525

Query  1955  NCLERGCDC  1963
                 + CDC
Sbjct  1526  G--SQTCDC  1532


 Score = 729 bits (1882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/1321 (32%), Positives = 701/1321 (53%), Gaps = 106/1321 (8%)

Query  1965  DADHYLASTSKFNTISAVAVSPDGVVHIGDQANYRIRSVMASIPDASGAREYEIYSPDTQ  2024
             +A+  L+S ++F  ISA+AV+ DGV+++ DQ +  + ++   +P      E+ I  P + 
Sbjct  1677  NAETLLSSNARFQAISAIAVAQDGVINVADQGSLHVLALEHYLPSHDENGEFHIPFPPSS  1736

Query  2025  EIYVFNRFGQHVATKNILTGEIVYQFTYNVNTSNGKLSTVTDAAGNKVFLLRDYSSQVNS  2084
             EIYVFNR+GQHVATK++ +G+  Y F Y+ NTS G+LSTVTDA+GNK+  LRDYS+ V+S
Sbjct  1737  EIYVFNRYGQHVATKDLTSGKTRYSFLYSKNTSFGRLSTVTDASGNKIQFLRDYSNVVSS  1796

Query  2085  IENTKGQKCRLRMSRMKMLHELSTPDNYNVTFDYHGPTGLLKTKLDSTGRSYVYNYDEFG  2144
             IENT+  K  ++++ + ++ +LS      +  DY   TGLL ++  S G +Y+Y YDEFG
Sbjct  1797  IENTQDHKSEIQINGIGIMTKLSEKGRQEIELDYDSNTGLLNSR-SSGGETYIYQYDEFG  1855

Query  2145  RLTSAVTPTGKVISLTFDLS-LKGAVVKVGQN-----NRKPIS-----MLIKGS--SVVT  2191
             R+T  + P+G+++ +T  L+  +G  V V  +     +R+ I+     +L+ G   S   
Sbjct  1856  RVTGMILPSGEIVRITSQLADSQGLTVYVHASVESLFSRERIAGEANELLVLGGVRSTFL  1915

Query  2192  KVGEAEQRTTVLSDGSVGQVTPWAHTVSTDTLPYSVLAEIEPLLGESYPVPAK-------  2244
             K G+A     + ++ ++       H  +   +  S +A   PLL  + PV A+       
Sbjct  1916  KRGQAHADAELKANNTL-----VIHGDNGVVVEASAVAR-HPLLEAALPVEAEMLAMWSH  1969

Query  2245  QRTEIAGDLANRFEWRYFLRKFQGNKYRSESKTVAQVGRKLRINGDILLSLEYDRETNSV  2304
             Q   +   L N     Y +    G+  R+  +T   + R++ +N   ++ +E+D+ TN  
Sbjct  1970  QSVTMGEGLTNSM---YSVYSLVGD-VRNPQQT---LNREIWVNQSRVIGVEFDQFTNRE  2022

Query  2305  AVFMDDDAELLNVTYDRTARPVKWGPRNGIFSGVELEYDRFSRLTSWTWGDISETYGFDR  2364
               +      +L V YD++  P  + P NG    V + YDRF+R+  W WG     Y +DR
Sbjct  2023  TFYDARRTPILIVAYDQSGLPKSYYPTNGY--PVNITYDRFNRVEGWAWGPAELKYSYDR  2080

Query  2365  AGRLYEIKYSDGTSMVYAFKDMFSSLPLKVTTPRGSDYLLQYDEAGALQSLTTPRGHIHA  2424
              G L EI       + + + D      + + + R   ++LQYD+AG L+ +  P G  H+
Sbjct  2081  HGLLSEITSQQDGIVSFVYNDWNLVSEIGLASQR--KFVLQYDDAGGLRHVVLPSGTRHS  2138

Query  2425  FSLQTSLGFYKYQYYSPMNRHPYEILYNDDGQILAKVYPHQSGKVAYVYDHTGKLETTLA  2484
             FS+QTS+GF +  Y  P +   Y   Y+  G +L  + P    ++ Y Y+  G+L   + 
Sbjct  2139  FSMQTSIGFIRCTYTPPGSTRAYLQHYSHAGALLQTILPGDGARIVYRYNAAGQLTEVVH  2198

Query  2485  GLSSIHYTYQETTSLVHSIDINEPNFEMRIEYKYHAGIVKDEKIKFGSKSGLDNARYRYQ  2544
             G     + Y E T +  ++   E   E R +++Y AG++ +E+I + +K+GL NA++ Y+
Sbjct  2199  GDGRSEFQYNEATGMPSTVSHTERELEYRWDFEYAAGLLAEERIDYVAKTGLSNAKFSYE  2258

Query  2545  YDGNARISGIEVDINGKQLPQLRLKYNQNLGILEGVGDLRIYRNLFNRSVMQDSSKQFFT  2604
             YD   R+  ++  I G+ LP     Y+   G    +G  R  +   N++ + D +  F  
Sbjct  2259  YDSQLRVVALQGRIGGQSLPTQAFAYDPRTGRPSLIGQFRFSQPAQNQTQLHDGTASFTR  2318

Query  2605  VTDYDEHGRVKT--VLMNIRSLDVFRMELEYDNRNRIKMRKLSIGKDAMEKKEWTKMEKI  2662
               D    GR +T  + + I  L+VFRME  Y    RI   +       M    +T ++  
Sbjct  2319  TVD----GRFQTQRMALAIHRLEVFRMEFSYGVHGRISQTRTYTRN--MAVNSYTNVKNY  2372

Query  2663  TYNADGHVLEVADTENNWQYAYDENGNVIGVTEHNEKIALGYDSGDRVVQYGDVEFNSYD  2722
             T++ DG ++ V + +  W + YD+NGN++ +T     I + Y++ DR+V++G+ ++  YD
Sbjct  2373  TWDCDGQLVGV-EAQEPWGFRYDDNGNLLSLTYRGNTIPMEYNAQDRIVKFGEGQYK-YD  2430

Query  2723  GRGFVVIRG-EHKYRYNSRGQLIHASEHKKFQIWYFYDDRGRLVAWNDDRENITQFFYAN  2781
              RG V     E ++ YN++G L+ AS+  +F + Y+YD   RL    D+  N+TQFFY N
Sbjct  2431  ARGLVAQNAREERFHYNTQGLLVRASKRGRFDVRYYYDHLKRLTTRKDNFGNVTQFFYTN  2490

Query  2782  PKTPDLITHIHFPKSSKTFRFLYDSRNFLMTVETSEQRFYVATDQNGSPLALFDTNGNLI  2841
              + P  ++ I+ P+  K     YD    L+  +    ++YVATDQ+G+PL LF+  G  I
Sbjct  2491  QQRPYEVSQIYSPRDGKLMSLTYDDVGHLIYAQVYRHKYYVATDQSGTPLMLFNQYGEGI  2550

Query  2842  KEMRRTPFGKIIKDTNPDFYLPIDFHGGLLDPNTKLVYL-NKRLYDPTVGQWMTPAWEQM  2900
             +E+ R+PFG I+ D+NP  YLPIDF GG+LD  T LV++ + R+YDP +GQWM+P W+++
Sbjct  2551  REIMRSPFGHIVYDSNPYLYLPIDFCGGILDQVTTLVHMGDGRVYDPLIGQWMSPDWQRV  2610

Query  2901  ANELTTPTDIFIYRFRNNDPINFKQNVEYMTDLASWLKLYGYDISAMLGSEYMKQMVYQP  2960
             A  + TPT + +YRF  NDPIN      Y  D A+W++  GY++  ++    + + ++QP
Sbjct  2611  AERIITPTRLHLYRFNGNDPINVGHERHYPEDFAAWMRTLGYNVGNLV--PQLARDLWQP  2668

Query  2961  SATITSPQL-------------TPDFGVMSGLQCIVN-RVHEKFSDLGFVPKPLLK---L  3003
              A    P                P   V SG    +N R    F  L   P+  LK   +
Sbjct  2669  PALWGRPPANPVALNLRRPFDNIPTMAVESGFLAHLNVRRMSDFEQLSAPPRSALKCDVM  2728

Query  3004  EPKTRNLLPRVAHRRAVFGEGILVSRVG-GRSLVSVVDGVNSVVQDVVTSVFNNSYFLPL  3062
             +P  + +    +     FG+GI+VSR   G+++VS V   N++ +DV TSVFN S  LP 
Sbjct  2729  DPSPKTI---GSDTEPPFGKGIVVSRTADGQAIVSSVPAANAIYRDVYTSVFNRSKLLPF  2785

Query  3063  HFSVHD--QDVFYFVKDNALKIRDDMEELRRLGGMFNVSTHETTEHG-------------  3107
              F VH+  QD F+FVK++A +  +D ++L+RL G  N + HE T                
Sbjct  2786  TFVVHNAQQDSFFFVKEDAWRATEDRQQLKRLQGQVNTTFHEITREATVGSGPAGAANGG  2845

Query  3108  ------------------AGTWKELRLHNPDAAVVIKYGADPEQERHRILKHAHKRAVER  3149
                                G + ++++H   A + ++YG    +E+ R++ HA   AV +
Sbjct  2846  AGSSSSSSSSSGGGSSSNTGNYLDVKIHGAHAIINLRYGTTVAKEQQRLMHHAKLTAVRK  2905

Query  3150  AWEIEKQLVMAGFQGRGDWSKEEKDELISRGTVSGYEGVDIHSVHRYPQLADDPGNVAFT  3209
             AW  EK+ + +G     +WS++E DE++ +   + YEG  IH V+ YP+LA+DP N+ F 
Sbjct  2906  AWHREKEALRSGLTTALEWSQQETDEILKQSYANNYEGEYIHDVNLYPELAEDPYNIKFV  2965

Query  3210  R  3210
             +
Sbjct  2966  K  2966


 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 35/54 (65%), Gaps = 0/54 (0%)

Query  901  IPPYSYWNMQFYQSEAAYVRFDYNIPRGASIGVYARRNALPTHTQYDLLEVLSG  954
            IP Y +W ++F     A++RF++ +P GA   VY+RRN  P+ TQ+D +E + G
Sbjct  367  IPAYQFWTLEFRNKHPAFIRFNFTLPWGAHFAVYSRRNVAPSVTQHDFVEFIKG  420


>H1ZUX0_CAEEL unnamed protein product
Length=2837

 Score = 793 bits (2049),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 667/2537 (26%), Positives = 1134/2537 (45%), Gaps = 348/2537 (14%)

Query  879   RSFPPDGTTFAQVGLGQKLSKEIPPYSYWNMQFYQSEAAYVRFDYNIPRGASIGVYARRN  938
             R+ PP       + LG+++  E  P S    +   ++ + +RF+  +  GA + +     
Sbjct  423   RALPP------AISLGERVDVEFFPKSMATTELTVTKPSRIRFNATVGSGAQLVLLMSAG  476

Query  939   ALPTHTQYDLL---------------EVLSGFKARTTRASHPSIKKE------------V  971
               P+ + +D L                ++  F +R+ R+   S  +              
Sbjct  477   VHPSLSLHDALFPIRADRIRDSKSPTHIVEEFGSRSRRSLGASSSRHRNIEILSPRSATF  536

Query  972   THYMEPGHWFLSLYNDDGDPQEVSFIAMIAEDMTHN---------------------CPN  1010
               ++  G  +L+  N+    + +SF+A   +  T                       C +
Sbjct  537   EQFVLEGRHYLTFINERSRVEPISFVAEELQRPTTPPKTSSSGTSGAKEHPLASVLVCES  596

Query  1011  GCSGKGECLLGHCQCNPGFGGEDCSESVCPVLCSQRGEYINGECQCNPGWKGKECSLRHD  1070
              C+ +GEC+ G C C PGF G  C E+VCPV+CS  G +  G C C  G+KGKEC +RH+
Sbjct  597   NCNQRGECVHGKCHCAPGFTGRTCDEAVCPVVCSGNGVFSGGICVCKSGFKGKECEMRHN  656

Query  1071  ECEVPDCNGHGHC-TNGKCNCVRGYKGKYCEEVDCPHPTCSGHGFCAEGTCICKKGWKGA  1129
              CEV DCNG G C T+G+C C  G+ G+ CE   CPH +C   G C  GTC C  GW+G 
Sbjct  657   WCEVADCNGRGRCDTDGRCRCNPGWTGEACELRACPHASCHDRGVCVNGTCYCMDGWRGN  716

Query  1130  DC--------------------------SQMDKEALQCLPD-------------------  1144
             DC                          S+  K  ++  P                    
Sbjct  717   DCSVFADAIVHVPQAQSPPRRGQEPTESSKTRKAQVKPTPTSEKKKESRELQKPIIATVQ  776

Query  1145  --------CSGHGNFDLETQTCLCEPMWSGDDCSKELCDLDCGPHGHCVDN-ACDCLPGW  1195
                     CS HG   L    C CE  W   DCS++ C      +G C+D+ +C C  GW
Sbjct  777   VPTESSHPCSAHGQ--LIDDICQCESGWDSVDCSQQACQC---VNGDCLDDGSCQCWKGW  831

Query  1196  SGELCNLKQCDPRCNEHGQC-KNGTCLCVTGWNGKHCTMEGCPNSCSGHGQCRVGN-DGQ  1253
              G  C  K+C   C + G+C  +G+C C +GWNG++C ++GCPN CSG G+C +     +
Sbjct  832   RGSNCTDKKCAIGCEDRGKCASDGSCKCSSGWNGENCAIDGCPNQCSGKGECGMDRRSSE  891

Query  1254  WECRCYDGWDGKDCNVLLEQNCNDGRDNDKDGLIDCADPECCSNHICRSSQLCVSAPKPI  1313
             W CRC  G  G DC+V +E +C+DG DND DGLIDC DPECCS+  C S  +C +A  PI
Sbjct  892   WSCRCQAGSTGVDCSVSVEMHCDDGLDNDSDGLIDCDDPECCSSSSCSSESVCSTAASPI  951

Query  1314  DILLRKQPPAITASFFERMKFLIDEGSLQNYARQETFNESMFWNHFNTSRSAVVRGRVV-  1372
             ++L+R  PP   A+F +R+ FLI E S+Q+Y     FNE++          +V+RGRV+ 
Sbjct  952   EVLMR-MPPIFNANFAQRVGFLIMEKSVQSYTDSSQFNENLI---------SVIRGRVMW  1001

Query  1373  -------THLGT-------GLMGVRVSTST-PLEGFTLTRDDGWFDLLVNGGGAVTLQFG  1417
                      L T        L+GVRVS +  PL GFTLTR+DG+FDL VNG  +VTLQF 
Sbjct  1002  GGSPTGSDDLSTYSNKSTVPLVGVRVSDAAHPLYGFTLTREDGYFDLTVNGARSVTLQFL  1061

Query  1418  RSPFKPQSHIVFVPWNEVVIIDKIVMSTAEEKQTSHIPYA-----CAAHDYDLMKPVVLA  1472
             R+ F+     VFV   +++ ID IV+          I  A     C+     +   V+++
Sbjct  1062  RTQFQSVKKSVFVSPRQIIHIDDIVLYRQSGGSPPAISMAPARAKCSPTLRRIPDVVLIS  1121

Query  1473  TWKHGFQGA----CPDKSAILAESQVIQESLQIPGTGLNLVYHSSRAAGYLSTIQLQLTP  1528
              W++   G       D S I+ +S+ I ESL I GT + LVY S+R+    ST+ + L  
Sbjct  1122  NWQYTSDGIETDETSDSSRIVVDSRSIFESLPIQGTDVRLVYDSARSPAAPSTMLIGLLY  1181

Query  1529  EVIPPTLNLIHLRITIEGILFEKTFEADPVIKFTYAWNRLNVYRQRVYGVTTAMVKVGYE  1588
             + +   L  +H+ I I G  F++       + + +AW+++N YRQ   G+    V+VGYE
Sbjct  1182  DRVDKELRKVHINIRIAGRRFDRVLAPRTNLTYVFAWDKMNAYRQSESGLVPVTVRVGYE  1241

Query  1589  YNDC---KDIIWDVQTTKLSGHDMSISEVGGWNLDIHHRYNFHEGILQKGDGS-NIYLKQ  1644
             Y  C    + +W  + +++ G          W LDIHH  +    +++ G+G   +  + 
Sbjct  1242  YQGCDRTSERVWQTRRSQMMGATARKMIGTMWTLDIHHHLDIVNNVVEMGNGGYRLITES  1301

Query  1645  KPRVILTTMGDGHQRSLDCYDCDRQAEASNQRLLAPVALATASDGSIFVGDFNLVRKILV  1704
             +PRV      DG +R ++C  C+ + ++ +  L  P  +  A DGS+ +GD N++R++  
Sbjct  1302  EPRVSTFAGLDGVKRDVECLKCEGKVDSIS--LFRPTTVVYAQDGSLIIGDHNMIRRVSQ  1359

Query  1705  DGTVRTVVRLNATRVSYRYHIALSPLDGSLYISDPESHQIIRVRDTNDYSEPDHNWETVV  1764
             DG V T++ L     S+ Y+IA+SP+DG++ IS P   Q+ R+  + +  +  +N++ + 
Sbjct  1360  DGQVSTILTLGLADTSHSYYIAVSPVDGTIAISLPLHKQVWRI-SSLEPQDSRNNYDVLA  1418

Query  1765  GSGERCLPGDEAHCGDGALARDAKLAYPKGVAVSADNVLYFADGTNIRMVDRDGIITTVI  1824
             G G  C    ++ CGDGALA++A+L +PKG++      LY AD   IR++D  G I + I
Sbjct  1419  GDGTVCASAVDS-CGDGALAQNAQLIFPKGISFDKMGNLYLADSRRIRVIDTTGHIRS-I  1476

Query  1825  GNHMHKSHWKPI-PCEGTLNVEEVHLRWPTELAINPLDNSLHMIDDHMVLQL-APDGRVK  1882
             G      H  PI  C     + ++ + WPT L I+P+  S+ ++D ++V ++      V 
Sbjct  1477  GETTPDQH--PIRTCAQITKLVDLQMEWPTSLTIDPITGSVLVLDTNVVYEIDVVHDVVT  1534

Query  1883  VVAGRPLHC--ASPSSSFDTELATHATLVM--PQSIAFGPSGNLYIAESDSQRINRVRVI  1938
             +  G P  C  A+ +SS   +   H   ++   + I  G  G +Y+ ESD +R+N+VR +
Sbjct  1535  IALGSPTTCDLANATSSASAKSLDHRRHLIQNARDITVGTDGAIYVVESDGRRLNQVRKL  1594

Query  1939  GTD-GKISPYAGAESKCNCLERGCDCFDA---DHYLASTSKFNTISAVAVSPDGVVHIGD  1994
              +D    S   G +S C+C    C C DA       AS +  ++  AV VSP G V I D
Sbjct  1595  SSDRSTFSILTGGKSPCSCDVAACGCDDAVSLRDVAASQAHLSSPYAVCVSPSGDVIIAD  1654

Query  1995  QANYRIRSVMASIPDASG-AREYEIYSPDTQEIYVFNRFGQHVATKNILTGEIVYQFTYN  2053
               N +I+ V A +    G +R YE+   + QE Y FNR GQH +T +++TG   + F+Y 
Sbjct  1655  SGNSKIKKVSARMAKYDGRSRTYEVTDAERQEKYTFNRHGQHSSTVSLITGRTFFNFSYQ  1714

Query  2054  VNTSNGKLSTVTDAAGNKVFLLRDYSSQVNSIENTKGQKCRLRMSR----MKMLHELSTP  2109
             V++    +S +  A+G  + +L+   S  + +E T GQ+  L MS     ++ + +  + 
Sbjct  1715  VDSPISMISEIRAASGVVLRVLKRNDSLFD-LETTLGQRTTLTMSAYDGTLEQVSKRDSA  1773

Query  2110  DNYNVTFDYHGPTGLLKTKLDSTGRSYVYNYDEFGRLTSAVTPTGKVISLTFD---LSLK  2166
              + + T  ++   GLL +++D    +  + YDE+GR           I L  D     L 
Sbjct  1774  TSRDATKLFY-KKGLLTSRID-VATAVGFEYDEYGR----------AIGLKRDREYWRLG  1821

Query  2167  GAVVKVGQNNRKPI--------SMLIKGSSVVTKVGEAEQRTTVLSDGSVGQVTPWAHTV  2218
                + +G  N + +          L +G+  V     A  R   L +      +P    +
Sbjct  1822  EETISMGSVNTEVLLNGQRFQQVRLGEGNLAVHSTNGATTRLISLRNEGYSLASP----L  1877

Query  2219  STDTLPYSVLAEIEPLLGESYPVPAKQRTEIAG-------DLANRFEWRYFLRKFQGNKY  2271
              T TL Y   + I    GE  P+ +++RT++         +L  R++WR+  R+   +  
Sbjct  1878  GTSTL-YDKSSSIPDSNGE--PLISRRRTKVPAIGNPQRRELTTRWDWRHVARRGDDSDG  1934

Query  2272  RSESKTVAQVGRKLRINGDILLSLEYDRETNSVAVFM----DDDAELLNVTYDRTARPVK  2327
                 + VA+      ING  + S+EYD ++N   + +    DD   LL + Y  + R  +
Sbjct  1935  SLGRRKVAE------INGVNMFSMEYDVKSNQDTLRLGSTTDDAQALLFIDYTSSGRIRR  1988

Query  2328  W-GPRNGIFSGVELEYDRFSRLTSWTWGDISETYGFDRAGRLYEIKYSDGTSMVYAFKDM  2386
                P +   + + + +D   R +  TWG       +D + RL E    DG  +       
Sbjct  1989  ISAPEDSQMAEMNITWDGAGRKSEVTWGSWKIRLTYDNSNRLTEHAI-DGARVPIKMSYA  2047

Query  2387  FSSLPLKVTTPRGSDYLLQYDEAGALQSLTTPRGHIHAFSLQTSLGF--YKYQYYSPMNR  2444
              +S         G+ + +QYD    ++ + +      +FS   +LG   +  +  + +N 
Sbjct  2048  GASRRPNEIQHDGAKWNIQYDNYDRIKEVISKSQEATSFS-SIALGGDEWVLKRRTSLNS  2106

Query  2445  HPYEILYNDDGQILAKVYPHQSGKVAYVYDHTGKLETTLAGLSSIHYTYQETTSLVHSID  2504
              P  +  + +G++L    P ++        +  + +  + G ++     +ETT +     
Sbjct  2107  KPSLVRLSREGKVLESTTPDEN-------HYWLERKDPITGRTTEILNDEETTVVTCWSP  2159

Query  2505  INEP------NFEMRIEYKYHAGIVKDEKIKFGSKSGLD-NARYRYQYDGNARISGIEVD  2557
                P      N +     + H    K   I   + S     + + Y+YD   R++ I+  
Sbjct  2160  EGAPMCSRSRNLQENTTMQGHLVARKSVTIMTPTSSEPSITSSFTYEYDDMLRVTTIQPV  2219

Query  2558  INGKQLPQLRLKYNQNLGILEGVGDLRIYRNLFN-----RSVMQDSSKQFFTVTDYDEHG  2612
             I    L  ++L Y++  G +  +   +  R+          +M ++SK      D+ +  
Sbjct  2220  IEQSVLESIQLSYDERRGHVAAINGFKWARDASTSRCQGHGLMYETSK----ANDHRQVV  2275

Query  2613  RVKTVLMNIR-SLDVFRMELEYDNRNRIKMRKLSIGKDAMEKKEWTKMEKITYNADGHVL  2671
               K +  + R S+ + R     D   R     L I     ++ +  K+ + T++A G   
Sbjct  2276  ERKLIFGDARASIKIIR-----DKAGRASESHLEISSSGTQRNQ--KITR-TFDAAGR--  2325

Query  2672  EVADTENNWQYAYDENGNVIGVTEHNEKIALGYDSGDRVVQYGDVEFNSYDGRGFVVIRG  2731
              VA  E N Q       N     E      + ++ G  +  + D+ +   D  G+VV R 
Sbjct  2326  -VASVEQNDQEPVRIIWNSDARVEKINDRVVEWNRGGALKTFQDISYQ-VDSIGWVVKRD  2383

Query  2732  EHK-YRYNSRGQLIHASEHKKFQIWYFYDDRGRLVAWNDDRENITQFFYANPKTPDLITH  2790
                 + Y+ +G+L+ A    + +I  FYD   R+V   + ++ I  F+Y    TP L++ 
Sbjct  2384  NTTVFGYDGKGRLVSA-RSSQLRINIFYDREDRVVQIQNSKDFI-HFYYGYIDTPKLVS-  2440

Query  2791  IHFPKSSKTFRFLYDSRNFLMTVETSE-QRFYVATDQNGSPLALFDTNGNLIKEMRRTPF  2849
              HF K+ K     YD  +    +++ +  R+ + TD+  +  A+   + N+++ + R+ F
Sbjct  2441  -HFSKNGKISTLFYDDDSVPFAMQSDDGTRYALLTDETSTIKAIIG-DSNVLRIIDRSVF  2498

Query  2850  GKIIKDTNPDF-YLPIDFHGGLLDPNTKLVYLNK-RLYDPTVGQWMTPAWE-----QMAN  2902
             G ++  ++    +LPI + GG+      +  LN  R  D    ++M+ + E     ++  
Sbjct  2499  GALLPSSSSSHPFLPIGYLGGIEISEISVSILNNGRPLDLYSERYMSISPEAVVRLELNE  2558

Query  2903  ELTTPTDIFIYRFRNNDPINFKQNVEYMTDLASWLKLYGYDISAMLGSEYMKQMVYQPSA  2962
             + +   D+      +  P   +   E   D  +W  L G                     
Sbjct  2559  KFSNSIDLMALEI-DRQPFRVENVPE---DFETWFSLAGL--------------------  2594

Query  2963  TITSPQLTPDFGV-MSGLQCIVNRVHEKFSDLGFVPKPLLKLEPKTRNLLPRVAHRRAV-  3020
                SP L P   + +     IV+R+   F      P+ L  L   T  L  R+A   ++ 
Sbjct  2595  ---SPNLLPSAHLGLPASSAIVHRLLSSF------PRKLRPLTHLTTVLPTRLASDISLT  2645

Query  3021  --------------FGEGILVSR--VGGRSLVSVVDGVNSVVQDVVTSVFNNSYFLPLHF  3064
                           F   ++++     G  +V ++  + S  ++V++ +F+    L    
Sbjct  2646  SPTSETSWSIDDVGFSNLLILNEDATTGEVMVEMLSDLKSEEREVISKLFDGVKSL----  2701

Query  3065  SVHDQDVFYFVKDNALKIRDDMEELRRLGGMFNVSTHETTEHGAGTWKE-LRLHNPDAAV  3123
                D   +  V    L         R       +S+   +       K+ + L N  + +
Sbjct  2702  ---DFATWGLVPTRHL--------WRAPNSKLELSSTSFSHFTMAVNKDSVELRNGKSKI  2750

Query  3124  VIKYGADPEQERHRILKHAHKRAVERAWEIEKQLVMAGFQGRGDWSKEEKDELISRGTVS  3183
             V+ +  +  +   +I++    R     W  E++   AG +    WS  E  EL S+G+VS
Sbjct  2751  VVHFSENKAEIVKKIVEELKTRENIAVWRAERKRAEAGEKTWRQWSDRETRELTSKGSVS  2810

Query  3184  GYEGVDIHSVHRYPQLA  3200
             GY+ +++   H+   LA
Sbjct  2811  GYD-IEMKPAHQSGLLA  2826



Lambda      K        H
   0.315    0.132    0.397 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 43955775900


Query= XP_050469443.1 teneurin-m isoform X3 [Bombus huntii]

Length=3226
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TENM_DROME  unnamed protein product                                   3877    0.0  
TENA_DROME  unnamed protein product                                   1138    0.0  
H1ZUX0_CAEEL  unnamed protein product                                 799     0.0  


>TENM_DROME unnamed protein product
Length=2731

 Score = 3877 bits (10055),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1776/2352 (76%), Positives = 2061/2352 (88%), Gaps = 21/2352 (1%)

Query  872   GARTFPARSFPPDGTTFAQVGLGQKLSKEIPPYSYWNMQFYQSEAAYVRFDYNIPRGASI  931
             GARTFPARSFPPDGTTF Q+ LGQKL+KEI PYSYWNMQFYQSE AYV+FDY IPRGASI
Sbjct  376   GARTFPARSFPPDGTTFGQITLGQKLTKEIQPYSYWNMQFYQSEPAYVKFDYTIPRGASI  435

Query  932   GVYARRNALPTHTQYDLLEVLSGFKA--RTTRASHVSVIPSIKKEVTHYMEPGHWFLSLY  989
             GVY RRNALPTHTQY   EVLSGF A  RT RA+H+S    I +EVT YMEPGHWF+SLY
Sbjct  436   GVYGRRNALPTHTQYHFKEVLSGFSASTRTARAAHLS----ITREVTRYMEPGHWFVSLY  491

Query  990   NDDGDPQEVSFIAMIAEDMTHNCPNGCSGKGECLLGHCQCNPGFGGEDCSESVCPVLCSQ  1049
             NDDGD QE++F A +AEDMT NCPNGCSG G+CLLGHCQCNPGFGG+DCSESVCPVLCSQ
Sbjct  492   NDDGDVQELTFYAAVAEDMTQNCPNGCSGNGQCLLGHCQCNPGFGGDDCSESVCPVLCSQ  551

Query  1050  RGEYINGECQCNPGWKGKECSLRHDECEVPDCNGHGHCTNGKCNCVRGYKGKYCEEVDCP  1109
              GEY NGEC CNPGWKGKECSLRHDECEV DC+GHGHC +GKC C+RGYKGK+CEEVDCP
Sbjct  552   HGEYTNGECICNPGWKGKECSLRHDECEVADCSGHGHCVSGKCQCMRGYKGKFCEEVDCP  611

Query  1110  HPTCSGHGFCAEGTCICKKGWKGADCSQMDKEALQCLPDCSGHGNFDLETQTCLCEPMWS  1169
             HP CSGHGFCA+GTCICKKGWKG DC+ MD++ALQCLPDCSGHG FDL+TQTC CE  WS
Sbjct  612   HPNCSGHGFCADGTCICKKGWKGPDCATMDQDALQCLPDCSGHGTFDLDTQTCTCEAKWS  671

Query  1170  GDDCSKELCDLDCGPHGHCVDNACDCLPGWSGELCNLKQCDPRCNEHGQCKNGTCLCVTG  1229
             GDDCSKELCDLDCG HG C  +AC C P W GE CN + CD RCNEHGQCKNGTCLCVTG
Sbjct  672   GDDCSKELCDLDCGQHGRCEGDACACDPEWGGEYCNTRLCDVRCNEHGQCKNGTCLCVTG  731

Query  1230  WNGKHCTMEGCPNSCSGHGQCRVGNDGQWECRCYDGWDGKDCNVLLEQNCNDGRDNDKDG  1289
             WNGKHCT+EGCPNSC+GHGQCRV  +GQWECRCY+GWDG DC + LE NC D +DNDKDG
Sbjct  732   WNGKHCTIEGCPNSCAGHGQCRVSGEGQWECRCYEGWDGPDCGIALELNCGDSKDNDKDG  791

Query  1290  LIDCADPECCSNHICRSSQLCVSAPKPIDILLRKQPPAITASFFERMKFLIDEGSLQNYA  1349
             L+DC DPECC++H+C++SQLCVSAPKPID+LLRKQPPAITASFFERMKFLIDE SLQNYA
Sbjct  792   LVDCEDPECCASHVCKTSQLCVSAPKPIDVLLRKQPPAITASFFERMKFLIDESSLQNYA  851

Query  1350  RQETFNESRSAVVRGRVVTHLGTGLMGVRVSTSTPLEGFTLTRDDGWFDLLVNGGGAVTL  1409
             + ETFNESRSAV+RGRVVT LG GL+GVRVST+T LEGFTLTRDDGWFDL+VNGGGAVTL
Sbjct  852   KLETFNESRSAVIRGRVVTSLGMGLVGVRVSTTTLLEGFTLTRDDGWFDLMVNGGGAVTL  911

Query  1410  QFGRSPFKPQSHIVFVPWNEVVIIDKIVMSTAEEKQTS-HIPYACAAHDYDLMKPVVLAT  1468
             QFGR+PF+PQS IV VPWNEVVIID +VMS +EEK  +    + C AHDYDLMKPVVLA+
Sbjct  912   QFGRAPFRPQSRIVQVPWNEVVIIDLVVMSMSEEKGLAVTTTHTCFAHDYDLMKPVVLAS  971

Query  1469  WKHGFQGACPDKSAILAESQVIQESLQIPGTGLNLVYHSSRAAGYLSTIQLQLTPEVIPP  1528
             WKHGFQGACPD+SAILAESQVIQESLQIPGTGLNLVYHSSRAAGYLSTI+LQLTP+VIP 
Sbjct  972   WKHGFQGACPDRSAILAESQVIQESLQIPGTGLNLVYHSSRAAGYLSTIKLQLTPDVIPT  1031

Query  1529  TLNLIHLRITIEGILFEKTFEADPVIKFTYAWNRLNVYRQRVYGVTTAMVKVGYEYNDCK  1588
             +L+LIHLRITIEGILFE+ FEADP IKFTYAWNRLN+YRQRVYGVTTA+VKVGY+Y DC 
Sbjct  1032  SLHLIHLRITIEGILFERIFEADPGIKFTYAWNRLNIYRQRVYGVTTAVVKVGYQYTDCT  1091

Query  1589  DIIWDVQTTKLSGHDMSISEVGGWNLDIHHRYNFHEGILQKGDGSNIYLKQKPRVILTTM  1648
             DI+WD+QTTKLSGHDMSISEVGGWNLDIHHRYNFHEGILQKGDGSNIYL+ KPR+ILTTM
Sbjct  1092  DIVWDIQTTKLSGHDMSISEVGGWNLDIHHRYNFHEGILQKGDGSNIYLRNKPRIILTTM  1151

Query  1649  GDGHQRSLDCYDCDRQAEASNQRLLAPVALATASDGSIFVGDFNLVRKILVDGTVRTVVR  1708
             GDGHQR L+C DCD QA  + QRLLAPVALA A DGS+FVGDFN +R+I+ DG++RTVV+
Sbjct  1152  GDGHQRPLECPDCDGQA--TKQRLLAPVALAAAPDGSLFVGDFNYIRRIMTDGSIRTVVK  1209

Query  1709  LNATRVSYRYHIALSPLDGSLYISDPESHQIIRVRDTNDYSEPDHNWETVVGSGERCLPG  1768
             LNATRVSYRYH+ALSPLDG+LY+SDPESHQIIRVRDTNDYS+P+ NWE VVGSGERCLPG
Sbjct  1210  LNATRVSYRYHMALSPLDGTLYVSDPESHQIIRVRDTNDYSQPELNWEAVVGSGERCLPG  1269

Query  1769  DEAHCGDGALARDAKLAYPKGVAVSADNVLYFADGTNIRMVDRDGIITTVIGNHMHKSHW  1828
             DEAHCGDGALA+DAKLAYPKG+A+S+DN+LYFADGTNIRMVDRDGI++T+IGNHMHKSHW
Sbjct  1270  DEAHCGDGALAKDAKLAYPKGIAISSDNILYFADGTNIRMVDRDGIVSTLIGNHMHKSHW  1329

Query  1829  KPIPCEGTLNVEEVHLRWPTELAINPLDNSLHMIDDHMVLQLAPDGRVKVVAGRPLHCAS  1888
             KPIPCEGTL +EE+HLRWPTELA++P+DN+LH+IDDHM+L++ PDGRV+V++GRPLHCA+
Sbjct  1330  KPIPCEGTLKLEEMHLRWPTELAVSPMDNTLHIIDDHMILRMTPDGRVRVISGRPLHCAT  1389

Query  1889  PSSSFDTELATHATLVMPQSIAFGPSGNLYIAESDSQRINRVRVIGTDGKISPYAGAESK  1948
              S+++DT+LATHATLVMPQSIAFGP G LY+AESDSQRINRVRVIGTDG+I+P+AGAESK
Sbjct  1390  ASTAYDTDLATHATLVMPQSIAFGPLGELYVAESDSQRINRVRVIGTDGRIAPFAGAESK  1449

Query  1949  CNCLERGCDCFDADHYLASTSKFNTISAVAVSPDGVVHIGDQANYRIRSVMASIPDASGA  2008
             CNCLERGCDCF+A+HYLA+++KFNTI+A+AV+PD  VHI DQANYRIRSVM+SIP+AS +
Sbjct  1450  CNCLERGCDCFEAEHYLATSAKFNTIAALAVTPDSHVHIADQANYRIRSVMSSIPEASPS  1509

Query  2009  REYEIYSPDTQEIYVFNRFGQHVATKNILTGEIVYQFTYNVNTSNGKLSTVTDAAGNKVF  2068
             REYEIY+PD QEIY+FNRFGQHV+T+NILTGE  Y FTYNVNTSNGKLSTVTDAAGNKVF
Sbjct  1510  REYEIYAPDMQEIYIFNRFGQHVSTRNILTGETTYVFTYNVNTSNGKLSTVTDAAGNKVF  1569

Query  2069  LLRDYSSQVNSIENTKGQKCRLRMSRMKMLHELSTPDNYNVTFDYHGPTGLLKTKLDSTG  2128
             LLRDY+SQVNSIENTKGQKCRLRM+RMKMLHELSTPDNYNVT++YHGPTGLL+TKLDSTG
Sbjct  1570  LLRDYTSQVNSIENTKGQKCRLRMTRMKMLHELSTPDNYNVTYEYHGPTGLLRTKLDSTG  1629

Query  2129  RSYVYNYDEFGRLTSAVTPTGKVISLTFDLSLKGAVVKVGQNNRKPISMLIKGSSVVTKV  2188
             RSYVYNYDEFGRLTSAVTPTG+VI L+FDLS+KGA VKV +N +K +S+LI+G++V+ + 
Sbjct  1630  RSYVYNYDEFGRLTSAVTPTGRVIELSFDLSVKGAQVKVSENAQKEMSLLIQGATVIVRN  1689

Query  2189  GEAEQRTTVLSDGSVGQVTPWAHTVSTDTLPYSVLAEIEPLLGESYPVPAKQRTEIAGDL  2248
             G AE RTTV  DGS   +TPW H +  +  PY++LAE  PLLGESYPVPAKQRTEIAGDL
Sbjct  1690  GAAESRTTVDMDGSTTSITPWGHNLQMEVAPYTILAEQSPLLGESYPVPAKQRTEIAGDL  1749

Query  2249  ANRFEWRYFLRKFQ----GNKYRSESKTVAQVGRKLRINGDILLSLEYDRETNSVAVFMD  2304
             ANRFEWRYF+R+ Q    G + +   + V +VGRKLR+NGD +L+LEYDRET SV V +D
Sbjct  1750  ANRFEWRYFVRRQQPLQAGKQSKGPPRPVTEVGRKLRVNGDNVLTLEYDRETQSVVVMVD  1809

Query  2305  DDAELLNVTYDRTARPVKWGPRNGIFSGVELEYDRFSRLTSWTWGDISETYGFDRAGRLY  2364
             D  ELLNVTYDRT+RP+ + P++G ++ V+LEYDRF RL SW WG + E Y FDR GRL 
Sbjct  1810  DKQELLNVTYDRTSRPISFRPQSGDYADVDLEYDRFGRLVSWKWGVLQEAYSFDRNGRLN  1869

Query  2365  EIKYSDGTSMVYAFKDMFSSLPLKVTTPRGSDYLLQYDEAGALQSLTTPRGHIHAFSLQT  2424
             EIKY DG++MVYAFKDMF SLPLKVTTPR SDYLLQYD+AGALQSLTTPRGHIHAFSLQT
Sbjct  1870  EIKYGDGSTMVYAFKDMFGSLPLKVTTPRRSDYLLQYDDAGALQSLTTPRGHIHAFSLQT  1929

Query  2425  SLGFYKYQYYSPMNRHPYEILYNDDGQILAKVYPHQSGKVAYVYDHTGKLETTLAGLSSI  2484
             SLGF+KYQYYSP+NRHP+EILYND+GQILAK++PHQSGKVA+V+D  G+LET LAGLSS 
Sbjct  1930  SLGFFKYQYYSPINRHPFEILYNDEGQILAKIHPHQSGKVAFVHDTAGRLETILAGLSST  1989

Query  2485  HYTYQETTSLVHSIDINEPNFEMRIEYKYHAGIVKDEKIKFGSKSGLDNARYRYQYDGNA  2544
             HYTYQ+TTSLV S+++ EP FE+R E+KYHAGI+KDEK++FGSK+ L +ARY+Y YDGNA
Sbjct  1990  HYTYQDTTSLVKSVEVQEPGFELRREFKYHAGILKDEKLRFGSKNSLASARYKYAYDGNA  2049

Query  2545  RISGIEVDINGKQLPQLRLKYNQNLGILEGVGDLRIYRNLFNRSVMQDSSKQFFTVTDYD  2604
             R+SGIE+ I+ K+LP  R KY+QNLG LE V DL+I RN FNR+V+QDS+KQFF + DYD
Sbjct  2050  RLSGIEMAIDDKELPTTRYKYSQNLGQLEVVQDLKITRNAFNRTVIQDSAKQFFAIVDYD  2109

Query  2605  EHGRVKTVLMNIRSLDVFRMELEYDNRNRIKMRKLSIGKDAMEKKEWTKMEKITYNADGH  2664
             +HGRVK+VLMN++++DVFR+EL+YD RNRIK +K + G+        T  +KI YNADGH
Sbjct  2110  QHGRVKSVLMNVKNIDVFRLELDYDLRNRIKSQKTTFGRS-------TAFDKINYNADGH  2162

Query  2665  VLEVADTENNWQYAYDENGNVIGVTEHNEKIALGYDSGDRVVQYGDVEFNSYDGRGFVVI  2724
             V+EV  T NNW+Y +DENGN +GV +  EK  LGYD GDRV++ GDVEFN+YD RGFVV 
Sbjct  2163  VVEVLGT-NNWKYLFDENGNTVGVVDQGEKFNLGYDIGDRVIKVGDVEFNNYDARGFVVK  2221

Query  2725  RGEHKYRYNSRGQLIHASEHKKFQIWYFYDDRGRLVAWNDDRENITQFFYANPKTPDLIT  2784
             RGE KYRYN+RGQLIH+ E ++FQ WY+YDDR RLVAW+D++ N TQ++YANP+TP L+T
Sbjct  2222  RGEQKYRYNNRGQLIHSFERERFQSWYYYDDRSRLVAWHDNKGNTTQYYYANPRTPHLVT  2281

Query  2785  HIHFPKSSKTFRFLYDSRNFLMTVETSEQRFYVATDQNGSPLALFDTNGNLIKEMRRTPF  2844
             H+HFPK S+T +  YD R+ L+ +E  +QR+YVATDQNGSPLA FD NG+++KEM+RTPF
Sbjct  2282  HVHFPKISRTMKLFYDDRDMLIALEHEDQRYYVATDQNGSPLAFFDQNGSIVKEMKRTPF  2341

Query  2845  GKIIKDTNPDFYLPIDFHGGLLDPNTKLVYLNKRLYDPTVGQWMTPAWEQMANELTTPTD  2904
             G+IIKDT P+F++PIDFHGGL+DP+TKLVY  +R YDP VGQWMTP WE +A E++ PTD
Sbjct  2342  GRIIKDTKPEFFVPIDFHGGLIDPHTKLVYTEQRQYDPHVGQWMTPLWETLATEMSHPTD  2401

Query  2905  IFIYRFRNNDPINFKQNVEYMTDLASWLKLYGYDISAMLGSEYMKQMVYQPSATITSPQL  2964
             +FIYR+ NNDPIN  +   YM DL SWL+L+GYD++ M  S Y K   Y P A+I S  L
Sbjct  2402  VFIYRYHNNDPINPNKPQNYMIDLDSWLQLFGYDLNNMQSSRYTKLAQYTPQASIKSNTL  2461

Query  2965  TPDFGVMSGLQCIVNRVHEKFSDLGFVPKPLLKLEPKTRNLLPRVAHRRAVFGEGILVSR  3024
              PDFGV+SGL+CIV +  EKFSD  FVPKPLLK+EPK RNLLPRV++RR VFGEG+L+SR
Sbjct  2462  APDFGVISGLECIVEKTSEKFSDFDFVPKPLLKMEPKMRNLLPRVSYRRGVFGEGVLLSR  2521

Query  3025  VGGRSLVSVVDGVNSVVQDVVTSVFNNSYFLPLHFSVHDQDVFYFVKDNALKIRDDMEEL  3084
             +GGR+LVSVVDG NSVVQDVV+SVFNNSYFL LHFS+HDQDVFYFVKDN LK+RDD EEL
Sbjct  2522  IGGRALVSVVDGSNSVVQDVVSSVFNNSYFLDLHFSIHDQDVFYFVKDNVLKLRDDNEEL  2581

Query  3085  RRLGGMFNVSTHETTEHGAGTWKELRLHNPDAAVVIKYGADPEQERHRILKHAHKRAVER  3144
             RRLGGMFN+STHE ++HG    KELRLH PDA V+IKYG DPEQERHRILKHAHKRAVER
Sbjct  2582  RRLGGMFNISTHEISDHGGSAAKELRLHGPDAVVIIKYGVDPEQERHRILKHAHKRAVER  2641

Query  3145  AWEIEKQLVMAGFQGRGDWSKEEKDELISRGTVSGYEGVDIHSVHRYPQLADDPGNVAFT  3204
             AWE+EKQLV AGFQGRGDW++EEK+EL+  G V G+ G+DIHS+H+YPQLADDPGNVAF 
Sbjct  2642  AWELEKQLVAAGFQGRGDWTEEEKEELVQHGDVDGWNGIDIHSIHKYPQLADDPGNVAFQ  2701

Query  3205  RDTKRKRRKSGN  3216
             RD KRKRRK+G+
Sbjct  2702  RDAKRKRRKTGS  2713


>TENA_DROME unnamed protein product
Length=3004

 Score = 1138 bits (2944),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 514/1020 (50%), Positives = 698/1020 (68%), Gaps = 36/1020 (4%)

Query  970   SIKKEVTHYMEPGHWFLSLYNDDGDPQEVSFIAMIAEDMTHNCPNGCSGKGECLLGHCQC  1029
             ++   +  Y++ G WF+S+YND+     VS +A  AE ++  CPN CSG+G C LG C C
Sbjct  518   TVNVSLLQYLDTGLWFISVYNDELVAHSVSLLAEEAEGVSTTCPNDCSGRGSCYLGKCDC  577

Query  1030  NPGFGGEDCSESVCPVLCSQRGEYINGECQCNPGWKGKECSLRHDECEVPDCNGHGHCTN  1089
               G+ G DCS+SVCPVLCS  G Y  G C C  GWKG EC +   ECEVP+C+ HG C  
Sbjct  578   IDGYQGVDCSKSVCPVLCSAHGHYGGGVCHCEEGWKGAECDIPVGECEVPNCSSHGRCIE  637

Query  1090  GKCNCVRGYKGKYCEEVDCPHPTCSGHGFCAEGTCICKKGWKGADCSQMDKEALQCLPDC  1149
             G+C+C RG+KG YC++ DC  P CSGHG C  G C CK GW+G DC  +D++  QCLP C
Sbjct  638   GECHCERGWKGPYCDQHDCLDPLCSGHGTCVAGQCYCKAGWQGEDCGTIDQQVYQCLPGC  697

Query  1150  SGHGNFDLETQTCLCEPMWSGDDCSKELCDLDCGPHGHCVDNACDCLPGWSGELCNLKQC  1209
             S HG +DLET  C+CE  W+G DCS+ +C LDCG +G C    C C  GW+G LC+   C
Sbjct  698   SEHGTYDLETGQCVCERHWTGPDCSQAVCSLDCGRNGVCESGKCRCNSGWTGNLCDQLPC  757

Query  1210  DPRCNEHGQCKNGTCLCVTGWNGKHCTMEGCPNSCSGHGQCRVGNDGQWECRCYDGWDGK  1269
             D RC+EHGQCKNGTC+C  GWNG+HCT+ GC N CS HGQC + N G++ C C +GW G+
Sbjct  758   DSRCSEHGQCKNGTCVCSQGWNGRHCTLPGCENGCSRHGQCTLEN-GEYRCDCIEGWAGR  816

Query  1270  DCNVLLEQNCNDGRDNDKDGLIDCADPECCSNHICRSSQLCVSAPKPIDILLRKQPPAIT  1329
             DC++ LE NC D  DND DG+ DC+D ECCS+  C    +C+S+  P+++LLRKQPP++T
Sbjct  817   DCSIALELNCKDNIDNDGDGMTDCSDSECCSHPACSEHIMCLSSNDPVEVLLRKQPPSVT  876

Query  1330  ASFFERMKFLIDEGSLQNYARQETFNESRSAVVRGRVVTHLGTGLMGVRVSTSTPLE-GF  1388
             ASF++R+KFLI+E S+Q+YA  + ++E+R +V+RG+V+T  G G++G+RVS       GF
Sbjct  877   ASFYQRVKFLIEENSVQSYAHMDEYSENRVSVMRGQVITPQGLGIVGIRVSVDRDSRFGF  936

Query  1389  TLTRDDGWFDLLVNGGGAVTLQFGRSPFKPQSHIVFVPWNEVVIIDKIVMSTAEEKQTS-  1447
             TLTR  GWFD+LVNGGGAVTLQF RSPF+P +  VFVPWN +V++  + M  +++ +T+ 
Sbjct  937   TLTRQGGWFDVLVNGGGAVTLQFQRSPFRPLTRTVFVPWNRIVVLPPVQMQLSDDDETTS  996

Query  1448  ----------------HIPY-----------ACAAHDYDLMKPVVLATWKHGFQGACPDK  1480
                              I Y            C  HD++ ++P +++TW     GA P K
Sbjct  997   RNIKVAPLNPALTFLNSIHYHTADEANDASKVCMDHDHEKLRPQLISTWMPNGVGAMPGK  1056

Query  1481  SAILAESQVIQESLQIPGTGLNLVYHSSRAAGYLSTIQLQLTPEVIPPTLNLIHLRITIE  1540
               I AE+Q++QES+QIPG+ L+L Y SS+A+GYLS ++++LT E IPPTL  +H+ + IE
Sbjct  1057  RVIFAETQIVQESIQIPGSDLHLTYQSSQASGYLSIVRMRLTGETIPPTLTHVHVGVEIE  1116

Query  1541  GILFEKTFEADPVIKFTYAWNRLNVYRQRVYGVTTAMVKVGYEYNDCKDIIWDVQTTKLS  1600
             G L  KT+EADP +  T+AWN+ NVYRQ+VYGVT A + VGY+++ C+  +W  QT KL 
Sbjct  1117  GALHVKTYEADPSLVHTFAWNKRNVYRQKVYGVTVARISVGYQHSTCQSPVWIAQTAKLQ  1176

Query  1601  GHDMSISEVGGWNLDIHHRYNFHEGILQKGDGSNIYLKQKPRVILTTMGDGHQRSLDCYD  1660
             G+D+ IS++GGW LDIHH YNFHEGILQKGDGS +++K+ PR +   MG G QR L C D
Sbjct  1177  GYDVDISDIGGWGLDIHHHYNFHEGILQKGDGSTLHMKEYPRTVKVVMGTGLQRPLTCPD  1236

Query  1661  -CDRQAEASNQRLLAPVALATASDGSIFVGDFNLVRKILVDGTVRTVVRLNATRVSYRYH  1719
              C+    A + +LL P+ALAT  DGS++VGDFNLVR+I  DG V T+++L+AT+VSY+Y+
Sbjct  1237  YCN--GVAKDAKLLTPIALATGPDGSLYVGDFNLVRRITPDGKVYTILQLSATQVSYQYY  1294

Query  1720  IALSPLDGSLYISDPESHQIIRVRDTNDYSEPDHNWETVVGSGERCLPGDEAHCGDGALA  1779
             +A+SP DG LYISDPE HQI+R+       +P  N + VVGSG+RC+PGDE +CGDG  A
Sbjct  1295  LAVSPADGHLYISDPERHQILRLVRLEKVKDPSINSDPVVGSGQRCIPGDEGNCGDGGPA  1354

Query  1780  RDAKLAYPKGVAVSADNVLYFADGTNIRMVDRDGIITTVIGNHMHKSHWKPIPCEGTLNV  1839
               A+L++PKG+A++AD  +Y ADGTNIR VD  G+I T+IG+H H +HW P PC GTL  
Sbjct  1355  LLARLSHPKGLAIAADRTMYIADGTNIRAVDPKGVIHTLIGHHGHHNHWSPAPCSGTLMA  1414

Query  1840  EEVHLRWPTELAINPLDNSLHMIDDHMVLQLAPDGRVKVVAGRPLHCASPSSSFDT-ELA  1898
              +  L+WPT LA++PLD SLH IDD +VL+L  D +++VVAG PLHC++        +  
Sbjct  1415  NQAQLQWPTGLALSPLDGSLHFIDDRLVLRLTSDMKIRVVAGTPLHCSNGGQDGRVNKTG  1474

Query  1899  THATLVMPQSIAFGPSGNLYIAESDSQRINRVRVIGTDGKISPYAGAESKCNCLERGCDC  1958
                 L    ++AF P GNLYIA+SDS+R+N +RV+ T G +  +AG +       + CDC
Sbjct  1475  ADNVLGTVLAMAFSPFGNLYIADSDSRRVNSIRVVDTAGNMRYFAGKQEGTG--SQTCDC  1532


 Score = 729 bits (1883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/1321 (32%), Positives = 701/1321 (53%), Gaps = 106/1321 (8%)

Query  1960  DADHYLASTSKFNTISAVAVSPDGVVHIGDQANYRIRSVMASIPDASGAREYEIYSPDTQ  2019
             +A+  L+S ++F  ISA+AV+ DGV+++ DQ +  + ++   +P      E+ I  P + 
Sbjct  1677  NAETLLSSNARFQAISAIAVAQDGVINVADQGSLHVLALEHYLPSHDENGEFHIPFPPSS  1736

Query  2020  EIYVFNRFGQHVATKNILTGEIVYQFTYNVNTSNGKLSTVTDAAGNKVFLLRDYSSQVNS  2079
             EIYVFNR+GQHVATK++ +G+  Y F Y+ NTS G+LSTVTDA+GNK+  LRDYS+ V+S
Sbjct  1737  EIYVFNRYGQHVATKDLTSGKTRYSFLYSKNTSFGRLSTVTDASGNKIQFLRDYSNVVSS  1796

Query  2080  IENTKGQKCRLRMSRMKMLHELSTPDNYNVTFDYHGPTGLLKTKLDSTGRSYVYNYDEFG  2139
             IENT+  K  ++++ + ++ +LS      +  DY   TGLL ++  S G +Y+Y YDEFG
Sbjct  1797  IENTQDHKSEIQINGIGIMTKLSEKGRQEIELDYDSNTGLLNSR-SSGGETYIYQYDEFG  1855

Query  2140  RLTSAVTPTGKVISLTFDLS-LKGAVVKVGQN-----NRKPIS-----MLIKGS--SVVT  2186
             R+T  + P+G+++ +T  L+  +G  V V  +     +R+ I+     +L+ G   S   
Sbjct  1856  RVTGMILPSGEIVRITSQLADSQGLTVYVHASVESLFSRERIAGEANELLVLGGVRSTFL  1915

Query  2187  KVGEAEQRTTVLSDGSVGQVTPWAHTVSTDTLPYSVLAEIEPLLGESYPVPAK-------  2239
             K G+A     + ++ ++       H  +   +  S +A   PLL  + PV A+       
Sbjct  1916  KRGQAHADAELKANNTL-----VIHGDNGVVVEASAVAR-HPLLEAALPVEAEMLAMWSH  1969

Query  2240  QRTEIAGDLANRFEWRYFLRKFQGNKYRSESKTVAQVGRKLRINGDILLSLEYDRETNSV  2299
             Q   +   L N     Y +    G+  R+  +T   + R++ +N   ++ +E+D+ TN  
Sbjct  1970  QSVTMGEGLTNSM---YSVYSLVGD-VRNPQQT---LNREIWVNQSRVIGVEFDQFTNRE  2022

Query  2300  AVFMDDDAELLNVTYDRTARPVKWGPRNGIFSGVELEYDRFSRLTSWTWGDISETYGFDR  2359
               +      +L V YD++  P  + P NG    V + YDRF+R+  W WG     Y +DR
Sbjct  2023  TFYDARRTPILIVAYDQSGLPKSYYPTNGY--PVNITYDRFNRVEGWAWGPAELKYSYDR  2080

Query  2360  AGRLYEIKYSDGTSMVYAFKDMFSSLPLKVTTPRGSDYLLQYDEAGALQSLTTPRGHIHA  2419
              G L EI       + + + D      + + + R   ++LQYD+AG L+ +  P G  H+
Sbjct  2081  HGLLSEITSQQDGIVSFVYNDWNLVSEIGLASQR--KFVLQYDDAGGLRHVVLPSGTRHS  2138

Query  2420  FSLQTSLGFYKYQYYSPMNRHPYEILYNDDGQILAKVYPHQSGKVAYVYDHTGKLETTLA  2479
             FS+QTS+GF +  Y  P +   Y   Y+  G +L  + P    ++ Y Y+  G+L   + 
Sbjct  2139  FSMQTSIGFIRCTYTPPGSTRAYLQHYSHAGALLQTILPGDGARIVYRYNAAGQLTEVVH  2198

Query  2480  GLSSIHYTYQETTSLVHSIDINEPNFEMRIEYKYHAGIVKDEKIKFGSKSGLDNARYRYQ  2539
             G     + Y E T +  ++   E   E R +++Y AG++ +E+I + +K+GL NA++ Y+
Sbjct  2199  GDGRSEFQYNEATGMPSTVSHTERELEYRWDFEYAAGLLAEERIDYVAKTGLSNAKFSYE  2258

Query  2540  YDGNARISGIEVDINGKQLPQLRLKYNQNLGILEGVGDLRIYRNLFNRSVMQDSSKQFFT  2599
             YD   R+  ++  I G+ LP     Y+   G    +G  R  +   N++ + D +  F  
Sbjct  2259  YDSQLRVVALQGRIGGQSLPTQAFAYDPRTGRPSLIGQFRFSQPAQNQTQLHDGTASFTR  2318

Query  2600  VTDYDEHGRVKT--VLMNIRSLDVFRMELEYDNRNRIKMRKLSIGKDAMEKKEWTKMEKI  2657
               D    GR +T  + + I  L+VFRME  Y    RI   +       M    +T ++  
Sbjct  2319  TVD----GRFQTQRMALAIHRLEVFRMEFSYGVHGRISQTRTYTRN--MAVNSYTNVKNY  2372

Query  2658  TYNADGHVLEVADTENNWQYAYDENGNVIGVTEHNEKIALGYDSGDRVVQYGDVEFNSYD  2717
             T++ DG ++ V + +  W + YD+NGN++ +T     I + Y++ DR+V++G+ ++  YD
Sbjct  2373  TWDCDGQLVGV-EAQEPWGFRYDDNGNLLSLTYRGNTIPMEYNAQDRIVKFGEGQYK-YD  2430

Query  2718  GRGFVVIRG-EHKYRYNSRGQLIHASEHKKFQIWYFYDDRGRLVAWNDDRENITQFFYAN  2776
              RG V     E ++ YN++G L+ AS+  +F + Y+YD   RL    D+  N+TQFFY N
Sbjct  2431  ARGLVAQNAREERFHYNTQGLLVRASKRGRFDVRYYYDHLKRLTTRKDNFGNVTQFFYTN  2490

Query  2777  PKTPDLITHIHFPKSSKTFRFLYDSRNFLMTVETSEQRFYVATDQNGSPLALFDTNGNLI  2836
              + P  ++ I+ P+  K     YD    L+  +    ++YVATDQ+G+PL LF+  G  I
Sbjct  2491  QQRPYEVSQIYSPRDGKLMSLTYDDVGHLIYAQVYRHKYYVATDQSGTPLMLFNQYGEGI  2550

Query  2837  KEMRRTPFGKIIKDTNPDFYLPIDFHGGLLDPNTKLVYL-NKRLYDPTVGQWMTPAWEQM  2895
             +E+ R+PFG I+ D+NP  YLPIDF GG+LD  T LV++ + R+YDP +GQWM+P W+++
Sbjct  2551  REIMRSPFGHIVYDSNPYLYLPIDFCGGILDQVTTLVHMGDGRVYDPLIGQWMSPDWQRV  2610

Query  2896  ANELTTPTDIFIYRFRNNDPINFKQNVEYMTDLASWLKLYGYDISAMLGSEYMKQMVYQP  2955
             A  + TPT + +YRF  NDPIN      Y  D A+W++  GY++  ++    + + ++QP
Sbjct  2611  AERIITPTRLHLYRFNGNDPINVGHERHYPEDFAAWMRTLGYNVGNLV--PQLARDLWQP  2668

Query  2956  SATITSPQL-------------TPDFGVMSGLQCIVN-RVHEKFSDLGFVPKPLLK---L  2998
              A    P                P   V SG    +N R    F  L   P+  LK   +
Sbjct  2669  PALWGRPPANPVALNLRRPFDNIPTMAVESGFLAHLNVRRMSDFEQLSAPPRSALKCDVM  2728

Query  2999  EPKTRNLLPRVAHRRAVFGEGILVSRVG-GRSLVSVVDGVNSVVQDVVTSVFNNSYFLPL  3057
             +P  + +    +     FG+GI+VSR   G+++VS V   N++ +DV TSVFN S  LP 
Sbjct  2729  DPSPKTI---GSDTEPPFGKGIVVSRTADGQAIVSSVPAANAIYRDVYTSVFNRSKLLPF  2785

Query  3058  HFSVHD--QDVFYFVKDNALKIRDDMEELRRLGGMFNVSTHETTEHG-------------  3102
              F VH+  QD F+FVK++A +  +D ++L+RL G  N + HE T                
Sbjct  2786  TFVVHNAQQDSFFFVKEDAWRATEDRQQLKRLQGQVNTTFHEITREATVGSGPAGAANGG  2845

Query  3103  ------------------AGTWKELRLHNPDAAVVIKYGADPEQERHRILKHAHKRAVER  3144
                                G + ++++H   A + ++YG    +E+ R++ HA   AV +
Sbjct  2846  AGSSSSSSSSSGGGSSSNTGNYLDVKIHGAHAIINLRYGTTVAKEQQRLMHHAKLTAVRK  2905

Query  3145  AWEIEKQLVMAGFQGRGDWSKEEKDELISRGTVSGYEGVDIHSVHRYPQLADDPGNVAFT  3204
             AW  EK+ + +G     +WS++E DE++ +   + YEG  IH V+ YP+LA+DP N+ F 
Sbjct  2906  AWHREKEALRSGLTTALEWSQQETDEILKQSYANNYEGEYIHDVNLYPELAEDPYNIKFV  2965

Query  3205  R  3205
             +
Sbjct  2966  K  2966


 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 35/54 (65%), Gaps = 0/54 (0%)

Query  901  IPPYSYWNMQFYQSEAAYVRFDYNIPRGASIGVYARRNALPTHTQYDLLEVLSG  954
            IP Y +W ++F     A++RF++ +P GA   VY+RRN  P+ TQ+D +E + G
Sbjct  367  IPAYQFWTLEFRNKHPAFIRFNFTLPWGAHFAVYSRRNVAPSVTQHDFVEFIKG  420


>H1ZUX0_CAEEL unnamed protein product
Length=2837

 Score = 799 bits (2064),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 666/2528 (26%), Positives = 1135/2528 (45%), Gaps = 335/2528 (13%)

Query  879   RSFPPDGTTFAQVGLGQKLSKEIPPYSYWNMQFYQSEAAYVRFDYNIPRGASIGVYARRN  938
             R+ PP       + LG+++  E  P S    +   ++ + +RF+  +  GA + +     
Sbjct  423   RALPP------AISLGERVDVEFFPKSMATTELTVTKPSRIRFNATVGSGAQLVLLMSAG  476

Query  939   ALPTHTQYDLL---------------EVLSGFKARTTRA--------SHVSVIPSIKKEV  975
               P+ + +D L                ++  F +R+ R+         ++ ++       
Sbjct  477   VHPSLSLHDALFPIRADRIRDSKSPTHIVEEFGSRSRRSLGASSSRHRNIEILSPRSATF  536

Query  976   THYMEPGHWFLSLYNDDGDPQEVSFIAMIAEDMTHN---------------------CPN  1014
               ++  G  +L+  N+    + +SF+A   +  T                       C +
Sbjct  537   EQFVLEGRHYLTFINERSRVEPISFVAEELQRPTTPPKTSSSGTSGAKEHPLASVLVCES  596

Query  1015  GCSGKGECLLGHCQCNPGFGGEDCSESVCPVLCSQRGEYINGECQCNPGWKGKECSLRHD  1074
              C+ +GEC+ G C C PGF G  C E+VCPV+CS  G +  G C C  G+KGKEC +RH+
Sbjct  597   NCNQRGECVHGKCHCAPGFTGRTCDEAVCPVVCSGNGVFSGGICVCKSGFKGKECEMRHN  656

Query  1075  ECEVPDCNGHGHC-TNGKCNCVRGYKGKYCEEVDCPHPTCSGHGFCAEGTCICKKGWKGA  1133
              CEV DCNG G C T+G+C C  G+ G+ CE   CPH +C   G C  GTC C  GW+G 
Sbjct  657   WCEVADCNGRGRCDTDGRCRCNPGWTGEACELRACPHASCHDRGVCVNGTCYCMDGWRGN  716

Query  1134  DC--------------------------SQMDKEALQCLPD-------------------  1148
             DC                          S+  K  ++  P                    
Sbjct  717   DCSVFADAIVHVPQAQSPPRRGQEPTESSKTRKAQVKPTPTSEKKKESRELQKPIIATVQ  776

Query  1149  --------CSGHGNFDLETQTCLCEPMWSGDDCSKELCDLDCGPHGHCVDN-ACDCLPGW  1199
                     CS HG   L    C CE  W   DCS++ C      +G C+D+ +C C  GW
Sbjct  777   VPTESSHPCSAHGQ--LIDDICQCESGWDSVDCSQQACQC---VNGDCLDDGSCQCWKGW  831

Query  1200  SGELCNLKQCDPRCNEHGQC-KNGTCLCVTGWNGKHCTMEGCPNSCSGHGQCRVGN-DGQ  1257
              G  C  K+C   C + G+C  +G+C C +GWNG++C ++GCPN CSG G+C +     +
Sbjct  832   RGSNCTDKKCAIGCEDRGKCASDGSCKCSSGWNGENCAIDGCPNQCSGKGECGMDRRSSE  891

Query  1258  WECRCYDGWDGKDCNVLLEQNCNDGRDNDKDGLIDCADPECCSNHICRSSQLCVSAPKPI  1317
             W CRC  G  G DC+V +E +C+DG DND DGLIDC DPECCS+  C S  +C +A  PI
Sbjct  892   WSCRCQAGSTGVDCSVSVEMHCDDGLDNDSDGLIDCDDPECCSSSSCSSESVCSTAASPI  951

Query  1318  DILLRKQPPAITASFFERMKFLIDEGSLQNYARQETFNESRSAVVRGRVV--------TH  1369
             ++L+R  PP   A+F +R+ FLI E S+Q+Y     FNE+  +V+RGRV+          
Sbjct  952   EVLMR-MPPIFNANFAQRVGFLIMEKSVQSYTDSSQFNENLISVIRGRVMWGGSPTGSDD  1010

Query  1370  LGT-------GLMGVRVSTST-PLEGFTLTRDDGWFDLLVNGGGAVTLQFGRSPFKPQSH  1421
             L T        L+GVRVS +  PL GFTLTR+DG+FDL VNG  +VTLQF R+ F+    
Sbjct  1011  LSTYSNKSTVPLVGVRVSDAAHPLYGFTLTREDGYFDLTVNGARSVTLQFLRTQFQSVKK  1070

Query  1422  IVFVPWNEVVIIDKIVMSTAEEKQTSHIPYA-----CAAHDYDLMKPVVLATWKHGFQGA  1476
              VFV   +++ ID IV+          I  A     C+     +   V+++ W++   G 
Sbjct  1071  SVFVSPRQIIHIDDIVLYRQSGGSPPAISMAPARAKCSPTLRRIPDVVLISNWQYTSDGI  1130

Query  1477  ----CPDKSAILAESQVIQESLQIPGTGLNLVYHSSRAAGYLSTIQLQLTPEVIPPTLNL  1532
                   D S I+ +S+ I ESL I GT + LVY S+R+    ST+ + L  + +   L  
Sbjct  1131  ETDETSDSSRIVVDSRSIFESLPIQGTDVRLVYDSARSPAAPSTMLIGLLYDRVDKELRK  1190

Query  1533  IHLRITIEGILFEKTFEADPVIKFTYAWNRLNVYRQRVYGVTTAMVKVGYEYNDC---KD  1589
             +H+ I I G  F++       + + +AW+++N YRQ   G+    V+VGYEY  C    +
Sbjct  1191  VHINIRIAGRRFDRVLAPRTNLTYVFAWDKMNAYRQSESGLVPVTVRVGYEYQGCDRTSE  1250

Query  1590  IIWDVQTTKLSGHDMSISEVGGWNLDIHHRYNFHEGILQKGDGS-NIYLKQKPRVILTTM  1648
              +W  + +++ G          W LDIHH  +    +++ G+G   +  + +PRV     
Sbjct  1251  RVWQTRRSQMMGATARKMIGTMWTLDIHHHLDIVNNVVEMGNGGYRLITESEPRVSTFAG  1310

Query  1649  GDGHQRSLDCYDCDRQAEASNQRLLAPVALATASDGSIFVGDFNLVRKILVDGTVRTVVR  1708
              DG +R ++C  C+ + ++ +  L  P  +  A DGS+ +GD N++R++  DG V T++ 
Sbjct  1311  LDGVKRDVECLKCEGKVDSIS--LFRPTTVVYAQDGSLIIGDHNMIRRVSQDGQVSTILT  1368

Query  1709  LNATRVSYRYHIALSPLDGSLYISDPESHQIIRVRDTNDYSEPDHNWETVVGSGERCLPG  1768
             L     S+ Y+IA+SP+DG++ IS P   Q+ R+  + +  +  +N++ + G G  C   
Sbjct  1369  LGLADTSHSYYIAVSPVDGTIAISLPLHKQVWRI-SSLEPQDSRNNYDVLAGDGTVCASA  1427

Query  1769  DEAHCGDGALARDAKLAYPKGVAVSADNVLYFADGTNIRMVDRDGIITTVIGNHMHKSHW  1828
              ++ CGDGALA++A+L +PKG++      LY AD   IR++D  G I + IG      H 
Sbjct  1428  VDS-CGDGALAQNAQLIFPKGISFDKMGNLYLADSRRIRVIDTTGHIRS-IGETTPDQH-  1484

Query  1829  KPI-PCEGTLNVEEVHLRWPTELAINPLDNSLHMIDDHMVLQL-APDGRVKVVAGRPLHC  1886
              PI  C     + ++ + WPT L I+P+  S+ ++D ++V ++      V +  G P  C
Sbjct  1485  -PIRTCAQITKLVDLQMEWPTSLTIDPITGSVLVLDTNVVYEIDVVHDVVTIALGSPTTC  1543

Query  1887  --ASPSSSFDTELATHATLVM--PQSIAFGPSGNLYIAESDSQRINRVRVIGTD-GKISP  1941
               A+ +SS   +   H   ++   + I  G  G +Y+ ESD +R+N+VR + +D    S 
Sbjct  1544  DLANATSSASAKSLDHRRHLIQNARDITVGTDGAIYVVESDGRRLNQVRKLSSDRSTFSI  1603

Query  1942  YAGAESKCNCLERGCDCFDA---DHYLASTSKFNTISAVAVSPDGVVHIGDQANYRIRSV  1998
               G +S C+C    C C DA       AS +  ++  AV VSP G V I D  N +I+ V
Sbjct  1604  LTGGKSPCSCDVAACGCDDAVSLRDVAASQAHLSSPYAVCVSPSGDVIIADSGNSKIKKV  1663

Query  1999  MASIPDASG-AREYEIYSPDTQEIYVFNRFGQHVATKNILTGEIVYQFTYNVNTSNGKLS  2057
              A +    G +R YE+   + QE Y FNR GQH +T +++TG   + F+Y V++    +S
Sbjct  1664  SARMAKYDGRSRTYEVTDAERQEKYTFNRHGQHSSTVSLITGRTFFNFSYQVDSPISMIS  1723

Query  2058  TVTDAAGNKVFLLRDYSSQVNSIENTKGQKCRLRMSR----MKMLHELSTPDNYNVTFDY  2113
              +  A+G  + +L+   S  + +E T GQ+  L MS     ++ + +  +  + + T  +
Sbjct  1724  EIRAASGVVLRVLKRNDSLFD-LETTLGQRTTLTMSAYDGTLEQVSKRDSATSRDATKLF  1782

Query  2114  HGPTGLLKTKLDSTGRSYVYNYDEFGRLTSAVTPTGKVISLTFD---LSLKGAVVKVGQN  2170
             +   GLL +++D    +  + YDE+GR           I L  D     L    + +G  
Sbjct  1783  Y-KKGLLTSRID-VATAVGFEYDEYGR----------AIGLKRDREYWRLGEETISMGSV  1830

Query  2171  NRKPI--------SMLIKGSSVVTKVGEAEQRTTVLSDGSVGQVTPWAHTVSTDTLPYSV  2222
             N + +          L +G+  V     A  R   L +      +P    + T TL Y  
Sbjct  1831  NTEVLLNGQRFQQVRLGEGNLAVHSTNGATTRLISLRNEGYSLASP----LGTSTL-YDK  1885

Query  2223  LAEIEPLLGESYPVPAKQRTEIAG-------DLANRFEWRYFLRKFQGNKYRSESKTVAQ  2275
              + I    GE  P+ +++RT++         +L  R++WR+  R+   +      + VA+
Sbjct  1886  SSSIPDSNGE--PLISRRRTKVPAIGNPQRRELTTRWDWRHVARRGDDSDGSLGRRKVAE  1943

Query  2276  VGRKLRINGDILLSLEYDRETNSVAVFM----DDDAELLNVTYDRTARPVKW-GPRNGIF  2330
                   ING  + S+EYD ++N   + +    DD   LL + Y  + R  +   P +   
Sbjct  1944  ------INGVNMFSMEYDVKSNQDTLRLGSTTDDAQALLFIDYTSSGRIRRISAPEDSQM  1997

Query  2331  SGVELEYDRFSRLTSWTWGDISETYGFDRAGRLYEIKYSDGTSMVYAFKDMFSSLPLKVT  2390
             + + + +D   R +  TWG       +D + RL E    DG  +        +S      
Sbjct  1998  AEMNITWDGAGRKSEVTWGSWKIRLTYDNSNRLTEHAI-DGARVPIKMSYAGASRRPNEI  2056

Query  2391  TPRGSDYLLQYDEAGALQSLTTPRGHIHAFSLQTSLGF--YKYQYYSPMNRHPYEILYND  2448
                G+ + +QYD    ++ + +      +FS   +LG   +  +  + +N  P  +  + 
Sbjct  2057  QHDGAKWNIQYDNYDRIKEVISKSQEATSFS-SIALGGDEWVLKRRTSLNSKPSLVRLSR  2115

Query  2449  DGQILAKVYPHQSGKVAYVYDHTGKLETTLAGLSSIHYTYQETTSLVHSIDINEP-----  2503
             +G++L    P ++        +  + +  + G ++     +ETT +        P     
Sbjct  2116  EGKVLESTTPDEN-------HYWLERKDPITGRTTEILNDEETTVVTCWSPEGAPMCSRS  2168

Query  2504  -NFEMRIEYKYHAGIVKDEKIKFGSKSGLD-NARYRYQYDGNARISGIEVDINGKQLPQL  2561
              N +     + H    K   I   + S     + + Y+YD   R++ I+  I    L  +
Sbjct  2169  RNLQENTTMQGHLVARKSVTIMTPTSSEPSITSSFTYEYDDMLRVTTIQPVIEQSVLESI  2228

Query  2562  RLKYNQNLGILEGVGDLRIYRNLFN-----RSVMQDSSKQFFTVTDYDEHGRVKTVLMNI  2616
             +L Y++  G +  +   +  R+          +M ++SK      D+ +    K +  + 
Sbjct  2229  QLSYDERRGHVAAINGFKWARDASTSRCQGHGLMYETSK----ANDHRQVVERKLIFGDA  2284

Query  2617  R-SLDVFRMELEYDNRNRIKMRKLSIGKDAMEKKEWTKMEKITYNADGHVLEVADTENNW  2675
             R S+ + R     D   R     L I     ++ +  K+ + T++A G    VA  E N 
Sbjct  2285  RASIKIIR-----DKAGRASESHLEISSSGTQRNQ--KITR-TFDAAGR---VASVEQND  2333

Query  2676  QYAYDENGNVIGVTEHNEKIALGYDSGDRVVQYGDVEFNSYDGRGFVVIRGEHK-YRYNS  2734
             Q       N     E      + ++ G  +  + D+ +   D  G+VV R     + Y+ 
Sbjct  2334  QEPVRIIWNSDARVEKINDRVVEWNRGGALKTFQDISYQ-VDSIGWVVKRDNTTVFGYDG  2392

Query  2735  RGQLIHASEHKKFQIWYFYDDRGRLVAWNDDRENITQFFYANPKTPDLITHIHFPKSSKT  2794
             +G+L+ A    + +I  FYD   R+V   + ++ I  F+Y    TP L++  HF K+ K 
Sbjct  2393  KGRLVSA-RSSQLRINIFYDREDRVVQIQNSKDFI-HFYYGYIDTPKLVS--HFSKNGKI  2448

Query  2795  FRFLYDSRNFLMTVETSE-QRFYVATDQNGSPLALFDTNGNLIKEMRRTPFGKIIKDTNP  2853
                 YD  +    +++ +  R+ + TD+  +  A+   + N+++ + R+ FG ++  ++ 
Sbjct  2449  STLFYDDDSVPFAMQSDDGTRYALLTDETSTIKAIIG-DSNVLRIIDRSVFGALLPSSSS  2507

Query  2854  DF-YLPIDFHGGLLDPNTKLVYLNK-RLYDPTVGQWMTPAWE-----QMANELTTPTDIF  2906
                +LPI + GG+      +  LN  R  D    ++M+ + E     ++  + +   D+ 
Sbjct  2508  SHPFLPIGYLGGIEISEISVSILNNGRPLDLYSERYMSISPEAVVRLELNEKFSNSIDLM  2567

Query  2907  IYRFRNNDPINFKQNVEYMTDLASWLKLYGYDISAMLGSEYMKQMVYQPSATITSPQLTP  2966
                  +  P   +   E   D  +W  L G                        SP L P
Sbjct  2568  ALEI-DRQPFRVENVPE---DFETWFSLAGL-----------------------SPNLLP  2600

Query  2967  DFGV-MSGLQCIVNRVHEKFSDLGFVPKPLLKLEPKTRNLLPRVAHRRAV----------  3015
                + +     IV+R+   F      P+ L  L   T  L  R+A   ++          
Sbjct  2601  SAHLGLPASSAIVHRLLSSF------PRKLRPLTHLTTVLPTRLASDISLTSPTSETSWS  2654

Query  3016  -----FGEGILVSR--VGGRSLVSVVDGVNSVVQDVVTSVFNNSYFLPLHFSVHDQDVFY  3068
                  F   ++++     G  +V ++  + S  ++V++ +F+    L       D   + 
Sbjct  2655  IDDVGFSNLLILNEDATTGEVMVEMLSDLKSEEREVISKLFDGVKSL-------DFATWG  2707

Query  3069  FVKDNALKIRDDMEELRRLGGMFNVSTHETTEHGAGTWKE-LRLHNPDAAVVIKYGADPE  3127
              V    L         R       +S+   +       K+ + L N  + +V+ +  +  
Sbjct  2708  LVPTRHL--------WRAPNSKLELSSTSFSHFTMAVNKDSVELRNGKSKIVVHFSENKA  2759

Query  3128  QERHRILKHAHKRAVERAWEIEKQLVMAGFQGRGDWSKEEKDELISRGTVSGYEGVDIHS  3187
             +   +I++    R     W  E++   AG +    WS  E  EL S+G+VSGY+ +++  
Sbjct  2760  EIVKKIVEELKTRENIAVWRAERKRAEAGEKTWRQWSDRETRELTSKGSVSGYD-IEMKP  2818

Query  3188  VHRYPQLA  3195
              H+   LA
Sbjct  2819  AHQSGLLA  2826



Lambda      K        H
   0.315    0.132    0.397 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 43955775900


Query= XP_050469444.1 teneurin-m isoform X4 [Bombus huntii]

Length=2675
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TENM_DROME  unnamed protein product                                   3880    0.0  
TENA_DROME  unnamed protein product                                   1120    0.0  
H1ZUX1_CAEEL  unnamed protein product                                 798     0.0  


>TENM_DROME unnamed protein product
Length=2731

 Score = 3880 bits (10061),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1851/2659 (70%), Positives = 2172/2659 (82%), Gaps = 126/2659 (5%)

Query  100   VARDSALLVH--NGCLLDNSAPRGPPDVPPRNPTMSRV-NGRLPGSHAASDHERDPDLQP  156
              A ++A   H   G LL+   P  PPDVPPRNPTMSR+ NGRL       ++  D D +P
Sbjct  88    TANNTAQRTHGRQGFLLEGVTPTAPPDVPPRNPTMSRMQNGRL-----TVNNPNDADFEP  142

Query  157   SCLVRTSSGGFYSIPKIPKNEYN--------NKNQSTGNSPIKVEL-------QNNMDRV  201
             SCLVRT SG  Y    IP    N         K+ S  ++P K  L       Q  M  V
Sbjct  143   SCLVRTPSGNVY----IPSGNLNINKGSPIDFKSGSACSTPTKDTLKGYERSTQGCMGPV  198

Query  202   PLPYGHAPSMIPMRRQSIRCHFVKG-VDWCS--W-------KLIAMILLMVSLCITAAL-  250
              LP     + +P    S   +F K  V  CS  W        L A +++++ L  T  + 
Sbjct  199   -LPQRSVMNGLPAHHYSAPMNFRKDLVARCSSPWFGIGSISVLFAFVVMLILLTTTGVIK  257

Query  251   ------CYVIV-----------------SSIVNRSYQSTKACAVLVGENSDTKPLSSDGN  287
                   C V+V                 S + N S ++     + + +       +  G+
Sbjct  258   WNQSPPCSVLVGNEASEVTAAKSTNTDLSKLHNSSVRAKNGQGIGLAQGQSGLGAAGVGS  317

Query  288   K------TSSSATASSSQSSG----------------------------RTRQQASSGGA  313
                    T ++AT++S  + G                             +   A++GGA
Sbjct  318   GGGSSAATVTTATSNSGTAQGLQSTSASAEATSSAATSSSQSSLTPSLSSSLANANNGGA  377

Query  314   RTFPARSFPPDGTTFAQVGLGQKLSKEIPPYSYWNMQFYQSEAAYVRFDYNIPRGASIGV  373
             RTFPARSFPPDGTTF Q+ LGQKL+KEI PYSYWNMQFYQSE AYV+FDY IPRGASIGV
Sbjct  378   RTFPARSFPPDGTTFGQITLGQKLTKEIQPYSYWNMQFYQSEPAYVKFDYTIPRGASIGV  437

Query  374   YARRNALPTHTQYDLLEVLSGFKA--RTTRASHVSVIPSIKKEVTHYMEPGHWFLSLYND  431
             Y RRNALPTHTQY   EVLSGF A  RT RA+H+S    I +EVT YMEPGHWF+SLYND
Sbjct  438   YGRRNALPTHTQYHFKEVLSGFSASTRTARAAHLS----ITREVTRYMEPGHWFVSLYND  493

Query  432   DGDPQEVSFIAMIAEDMTHNCPNGCSGKGECLLGHCQCNPGFGGEDCSESVCPVLCSQRG  491
             DGD QE++F A +AEDMT NCPNGCSG G+CLLGHCQCNPGFGG+DCSESVCPVLCSQ G
Sbjct  494   DGDVQELTFYAAVAEDMTQNCPNGCSGNGQCLLGHCQCNPGFGGDDCSESVCPVLCSQHG  553

Query  492   EYINGECQCNPGWKGKECSLRHDECEVPDCNGHGHCTNGKCNCVRGYKGKYCEEVDCPHP  551
             EY NGEC CNPGWKGKECSLRHDECEV DC+GHGHC +GKC C+RGYKGK+CEEVDCPHP
Sbjct  554   EYTNGECICNPGWKGKECSLRHDECEVADCSGHGHCVSGKCQCMRGYKGKFCEEVDCPHP  613

Query  552   TCSGHGFCAEGTCICKKGWKGADCSQMDKEALQCLPDCSGHGNFDLETQTCLCEPMWSGD  611
              CSGHGFCA+GTCICKKGWKG DC+ MD++ALQCLPDCSGHG FDL+TQTC CE  WSGD
Sbjct  614   NCSGHGFCADGTCICKKGWKGPDCATMDQDALQCLPDCSGHGTFDLDTQTCTCEAKWSGD  673

Query  612   DCSKELCDLDCGPHGHCVDNACDCLPGWSGELCNLKQCDPRCNEHGQCKNGTCLCVTGWN  671
             DCSKELCDLDCG HG C  +AC C P W GE CN + CD RCNEHGQCKNGTCLCVTGWN
Sbjct  674   DCSKELCDLDCGQHGRCEGDACACDPEWGGEYCNTRLCDVRCNEHGQCKNGTCLCVTGWN  733

Query  672   GKHCTMEGCPNSCSGHGQCRVGNDGQWECRCYDGWDGKDCNVLLEQNCNDGRDNDKDGLI  731
             GKHCT+EGCPNSC+GHGQCRV  +GQWECRCY+GWDG DC + LE NC D +DNDKDGL+
Sbjct  734   GKHCTIEGCPNSCAGHGQCRVSGEGQWECRCYEGWDGPDCGIALELNCGDSKDNDKDGLV  793

Query  732   DCADPECCSNHICRSSQLCVSAPKPIDILLRKQPPAITASFFERMKFLIDEGSLQNYARQ  791
             DC DPECC++H+C++SQLCVSAPKPID+LLRKQPPAITASFFERMKFLIDE SLQNYA+ 
Sbjct  794   DCEDPECCASHVCKTSQLCVSAPKPIDVLLRKQPPAITASFFERMKFLIDESSLQNYAKL  853

Query  792   ETFNESMFWNHFNTSRSAVVRGRVVTHLGTGLMGVRVSTSTPLEGFTLTRDDGWFDLLVN  851
             ETFNES         RSAV+RGRVVT LG GL+GVRVST+T LEGFTLTRDDGWFDL+VN
Sbjct  854   ETFNES---------RSAVIRGRVVTSLGMGLVGVRVSTTTLLEGFTLTRDDGWFDLMVN  904

Query  852   GGGAVTLQFGRSPFKPQSHIVFVPWNEVVIIDKIVMSTAEEKQTS-HIPYACAAHDYDLM  910
             GGGAVTLQFGR+PF+PQS IV VPWNEVVIID +VMS +EEK  +    + C AHDYDLM
Sbjct  905   GGGAVTLQFGRAPFRPQSRIVQVPWNEVVIIDLVVMSMSEEKGLAVTTTHTCFAHDYDLM  964

Query  911   KPVVLATWKHGFQGACPDKSAILAESQVIQESLQIPGTGLNLVYHSSRAAGYLSTIQLQL  970
             KPVVLA+WKHGFQGACPD+SAILAESQVIQESLQIPGTGLNLVYHSSRAAGYLSTI+LQL
Sbjct  965   KPVVLASWKHGFQGACPDRSAILAESQVIQESLQIPGTGLNLVYHSSRAAGYLSTIKLQL  1024

Query  971   TPEVIPPTLNLIHLRITIEGILFEKTFEADPVIKFTYAWNRLNVYRQRVYGVTTAMVKVG  1030
             TP+VIP +L+LIHLRITIEGILFE+ FEADP IKFTYAWNRLN+YRQRVYGVTTA+VKVG
Sbjct  1025  TPDVIPTSLHLIHLRITIEGILFERIFEADPGIKFTYAWNRLNIYRQRVYGVTTAVVKVG  1084

Query  1031  YEYNDCKDIIWDVQTTKLSGHDMSISEVGGWNLDIHHRYNFHEGILQKGDGSNIYLKQKP  1090
             Y+Y DC DI+WD+QTTKLSGHDMSISEVGGWNLDIHHRYNFHEGILQKGDGSNIYL+ KP
Sbjct  1085  YQYTDCTDIVWDIQTTKLSGHDMSISEVGGWNLDIHHRYNFHEGILQKGDGSNIYLRNKP  1144

Query  1091  RVILTTMGDGHQRSLDCYDCDRQAEASNQRLLAPVALATASDGSIFVGDFNLVRKILVDG  1150
             R+ILTTMGDGHQR L+C DCD QA  + QRLLAPVALA A DGS+FVGDFN +R+I+ DG
Sbjct  1145  RIILTTMGDGHQRPLECPDCDGQA--TKQRLLAPVALAAAPDGSLFVGDFNYIRRIMTDG  1202

Query  1151  TVRTVVRLNATRVSYRYHIALSPLDGSLYISDPESHQIIRVRDTNDYSEPDHNWETVVGS  1210
             ++RTVV+LNATRVSYRYH+ALSPLDG+LY+SDPESHQIIRVRDTNDYS+P+ NWE VVGS
Sbjct  1203  SIRTVVKLNATRVSYRYHMALSPLDGTLYVSDPESHQIIRVRDTNDYSQPELNWEAVVGS  1262

Query  1211  GERCLPGDEAHCGDGALARDAKLAYPKGVAVSADNVLYFADGTNIRMVDRDGIITTVIGN  1270
             GERCLPGDEAHCGDGALA+DAKLAYPKG+A+S+DN+LYFADGTNIRMVDRDGI++T+IGN
Sbjct  1263  GERCLPGDEAHCGDGALAKDAKLAYPKGIAISSDNILYFADGTNIRMVDRDGIVSTLIGN  1322

Query  1271  HMHKSHWKPIPCEGTLNVEEVHLRWPTELAINPLDNSLHMIDDHMVLQLAPDGRVKVVAG  1330
             HMHKSHWKPIPCEGTL +EE+HLRWPTELA++P+DN+LH+IDDHM+L++ PDGRV+V++G
Sbjct  1323  HMHKSHWKPIPCEGTLKLEEMHLRWPTELAVSPMDNTLHIIDDHMILRMTPDGRVRVISG  1382

Query  1331  RPLHCASPSSSFDTELATHATLVMPQSIAFGPSGNLYIAESDSQRINRVRVIGTDGKISP  1390
             RPLHCA+ S+++DT+LATHATLVMPQSIAFGP G LY+AESDSQRINRVRVIGTDG+I+P
Sbjct  1383  RPLHCATASTAYDTDLATHATLVMPQSIAFGPLGELYVAESDSQRINRVRVIGTDGRIAP  1442

Query  1391  YAGAESKCNCLERGCDCFDADHYLASTSKFNTISAVAVSPDGVVHIGDQANYRIRSVMAS  1450
             +AGAESKCNCLERGCDCF+A+HYLA+++KFNTI+A+AV+PD  VHI DQANYRIRSVM+S
Sbjct  1443  FAGAESKCNCLERGCDCFEAEHYLATSAKFNTIAALAVTPDSHVHIADQANYRIRSVMSS  1502

Query  1451  IPDASGAREYEIYSPDTQEIYVFNRFGQHVATKNILTGEIVYQFTYNVNTSNGKLSTVTD  1510
             IP+AS +REYEIY+PD QEIY+FNRFGQHV+T+NILTGE  Y FTYNVNTSNGKLSTVTD
Sbjct  1503  IPEASPSREYEIYAPDMQEIYIFNRFGQHVSTRNILTGETTYVFTYNVNTSNGKLSTVTD  1562

Query  1511  AAGNKVFLLRDYSSQVNSIENTKGQKCRLRMSRMKMLHELSTPDNYNVTFDYHGPTGLLK  1570
             AAGNKVFLLRDY+SQVNSIENTKGQKCRLRM+RMKMLHELSTPDNYNVT++YHGPTGLL+
Sbjct  1563  AAGNKVFLLRDYTSQVNSIENTKGQKCRLRMTRMKMLHELSTPDNYNVTYEYHGPTGLLR  1622

Query  1571  TKLDSTGRSYVYNYDEFGRLTSAVTPTGKVISLTFDLSLKGAVVKVGQNNRKPISMLIKG  1630
             TKLDSTGRSYVYNYDEFGRLTSAVTPTG+VI L+FDLS+KGA VKV +N +K +S+LI+G
Sbjct  1623  TKLDSTGRSYVYNYDEFGRLTSAVTPTGRVIELSFDLSVKGAQVKVSENAQKEMSLLIQG  1682

Query  1631  SSVVTKVGEAEQRTTVLSDGSVGQVTPWAHTVSTDTLPYSVLAEIEPLLGESYPVPAKQR  1690
             ++V+ + G AE RTTV  DGS   +TPW H +  +  PY++LAE  PLLGESYPVPAKQR
Sbjct  1683  ATVIVRNGAAESRTTVDMDGSTTSITPWGHNLQMEVAPYTILAEQSPLLGESYPVPAKQR  1742

Query  1691  TEIAGDLANRFEWRYFLRKFQ----GNKYRSESKTVAQVGRKLRINGDILLSLEYDRETN  1746
             TEIAGDLANRFEWRYF+R+ Q    G + +   + V +VGRKLR+NGD +L+LEYDRET 
Sbjct  1743  TEIAGDLANRFEWRYFVRRQQPLQAGKQSKGPPRPVTEVGRKLRVNGDNVLTLEYDRETQ  1802

Query  1747  SVAVFMDDDAELLNVTYDRTARPVKWGPRNGIFSGVELEYDRFSRLTSWTWGDISETYGF  1806
             SV V +DD  ELLNVTYDRT+RP+ + P++G ++ V+LEYDRF RL SW WG + E Y F
Sbjct  1803  SVVVMVDDKQELLNVTYDRTSRPISFRPQSGDYADVDLEYDRFGRLVSWKWGVLQEAYSF  1862

Query  1807  DRAGRLYEIKYSDGTSMVYAFKDMFSSLPLKVTTPRGSDYLLQYDEAGALQSLTTPRGHI  1866
             DR GRL EIKY DG++MVYAFKDMF SLPLKVTTPR SDYLLQYD+AGALQSLTTPRGHI
Sbjct  1863  DRNGRLNEIKYGDGSTMVYAFKDMFGSLPLKVTTPRRSDYLLQYDDAGALQSLTTPRGHI  1922

Query  1867  HAFSLQTSLGFYKYQYYSPMNRHPYEILYNDDGQILAKVYPHQSGKVAYVYDHTGKLETT  1926
             HAFSLQTSLGF+KYQYYSP+NRHP+EILYND+GQILAK++PHQSGKVA+V+D  G+LET 
Sbjct  1923  HAFSLQTSLGFFKYQYYSPINRHPFEILYNDEGQILAKIHPHQSGKVAFVHDTAGRLETI  1982

Query  1927  LAGLSSIHYTYQETTSLVHSIDINEPNFEMRIEYKYHAGIVKDEKIKFGSKSGLDNARYR  1986
             LAGLSS HYTYQ+TTSLV S+++ EP FE+R E+KYHAGI+KDEK++FGSK+ L +ARY+
Sbjct  1983  LAGLSSTHYTYQDTTSLVKSVEVQEPGFELRREFKYHAGILKDEKLRFGSKNSLASARYK  2042

Query  1987  YQYDGNARISGIEVDINGKQLPQLRLKYNQNLGILEGVGDLRIYRNLFNRSVMQDSSKQF  2046
             Y YDGNAR+SGIE+ I+ K+LP  R KY+QNLG LE V DL+I RN FNR+V+QDS+KQF
Sbjct  2043  YAYDGNARLSGIEMAIDDKELPTTRYKYSQNLGQLEVVQDLKITRNAFNRTVIQDSAKQF  2102

Query  2047  FTVTDYDEHGRVKTVLMNIRSLDVFRMELEYDNRNRIKMRKLSIGKDAMEKKEWTKMEKI  2106
             F + DYD+HGRVK+VLMN++++DVFR+EL+YD RNRIK +K + G+        T  +KI
Sbjct  2103  FAIVDYDQHGRVKSVLMNVKNIDVFRLELDYDLRNRIKSQKTTFGRS-------TAFDKI  2155

Query  2107  TYNADGHVLEVADTENNWQYAYDENGNVIGVTEHNEKIALGYDSGDRVVQYGDVEFNSYD  2166
              YNADGHV+EV  T NNW+Y +DENGN +GV +  EK  LGYD GDRV++ GDVEFN+YD
Sbjct  2156  NYNADGHVVEVLGT-NNWKYLFDENGNTVGVVDQGEKFNLGYDIGDRVIKVGDVEFNNYD  2214

Query  2167  GRGFVVIRGEHKYRYNSRGQLIHASEHKKFQIWYFYDDRGRLVAWNDDRENITQFFYANP  2226
              RGFVV RGE KYRYN+RGQLIH+ E ++FQ WY+YDDR RLVAW+D++ N TQ++YANP
Sbjct  2215  ARGFVVKRGEQKYRYNNRGQLIHSFERERFQSWYYYDDRSRLVAWHDNKGNTTQYYYANP  2274

Query  2227  KTPDLITHIHFPKSSKTFRFLYDSRNFLMTVETSEQRFYVATDQNGSPLALFDTNGNLIK  2286
             +TP L+TH+HFPK S+T +  YD R+ L+ +E  +QR+YVATDQNGSPLA FD NG+++K
Sbjct  2275  RTPHLVTHVHFPKISRTMKLFYDDRDMLIALEHEDQRYYVATDQNGSPLAFFDQNGSIVK  2334

Query  2287  EMRRTPFGKIIKDTNPDFYLPIDFHGGLLDPNTKLVYLNKRLYDPTVGQWMTPAWEQMAN  2346
             EM+RTPFG+IIKDT P+F++PIDFHGGL+DP+TKLVY  +R YDP VGQWMTP WE +A 
Sbjct  2335  EMKRTPFGRIIKDTKPEFFVPIDFHGGLIDPHTKLVYTEQRQYDPHVGQWMTPLWETLAT  2394

Query  2347  ELTTPTDIFIYRFRNNDPINFKQNVEYMTDLASWLKLYGYDISAMLGSEYMKQMVYQPSA  2406
             E++ PTD+FIYR+ NNDPIN  +   YM DL SWL+L+GYD++ M  S Y K   Y P A
Sbjct  2395  EMSHPTDVFIYRYHNNDPINPNKPQNYMIDLDSWLQLFGYDLNNMQSSRYTKLAQYTPQA  2454

Query  2407  TITSPQLTPDFGVMSGLQCIVNRVHEKFSDLGFVPKPLLKLEPKTRNLLPRVAHRRAVFG  2466
             +I S  L PDFGV+SGL+CIV +  EKFSD  FVPKPLLK+EPK RNLLPRV++RR VFG
Sbjct  2455  SIKSNTLAPDFGVISGLECIVEKTSEKFSDFDFVPKPLLKMEPKMRNLLPRVSYRRGVFG  2514

Query  2467  EGILVSRVGGRSLVSVVDGVNSVVQDVVTSVFNNSYFLPLHFSVHDQDVFYFVKDNALKI  2526
             EG+L+SR+GGR+LVSVVDG NSVVQDVV+SVFNNSYFL LHFS+HDQDVFYFVKDN LK+
Sbjct  2515  EGVLLSRIGGRALVSVVDGSNSVVQDVVSSVFNNSYFLDLHFSIHDQDVFYFVKDNVLKL  2574

Query  2527  RDDMEELRRLGGMFNVSTHETTEHGAGTWKELRLHNPDAAVVIKYGADPEQERHRILKHA  2586
             RDD EELRRLGGMFN+STHE ++HG    KELRLH PDA V+IKYG DPEQERHRILKHA
Sbjct  2575  RDDNEELRRLGGMFNISTHEISDHGGSAAKELRLHGPDAVVIIKYGVDPEQERHRILKHA  2634

Query  2587  HKRAVERAWEIEKQLVMAGFQGRGDWSKEEKDELISRGTVSGYEGVDIHSVHRYPQLADD  2646
             HKRAVERAWE+EKQLV AGFQGRGDW++EEK+EL+  G V G+ G+DIHS+H+YPQLADD
Sbjct  2635  HKRAVERAWELEKQLVAAGFQGRGDWTEEEKEELVQHGDVDGWNGIDIHSIHKYPQLADD  2694

Query  2647  PGNVAFTRDTKRKRRKSGN  2665
             PGNVAF RD KRKRRK+G+
Sbjct  2695  PGNVAFQRDAKRKRRKTGS  2713


>TENA_DROME unnamed protein product
Length=3004

 Score = 1120 bits (2897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 514/1029 (50%), Positives = 698/1029 (68%), Gaps = 45/1029 (4%)

Query  410   SIKKEVTHYMEPGHWFLSLYNDDGDPQEVSFIAMIAEDMTHNCPNGCSGKGECLLGHCQC  469
             ++   +  Y++ G WF+S+YND+     VS +A  AE ++  CPN CSG+G C LG C C
Sbjct  518   TVNVSLLQYLDTGLWFISVYNDELVAHSVSLLAEEAEGVSTTCPNDCSGRGSCYLGKCDC  577

Query  470   NPGFGGEDCSESVCPVLCSQRGEYINGECQCNPGWKGKECSLRHDECEVPDCNGHGHCTN  529
               G+ G DCS+SVCPVLCS  G Y  G C C  GWKG EC +   ECEVP+C+ HG C  
Sbjct  578   IDGYQGVDCSKSVCPVLCSAHGHYGGGVCHCEEGWKGAECDIPVGECEVPNCSSHGRCIE  637

Query  530   GKCNCVRGYKGKYCEEVDCPHPTCSGHGFCAEGTCICKKGWKGADCSQMDKEALQCLPDC  589
             G+C+C RG+KG YC++ DC  P CSGHG C  G C CK GW+G DC  +D++  QCLP C
Sbjct  638   GECHCERGWKGPYCDQHDCLDPLCSGHGTCVAGQCYCKAGWQGEDCGTIDQQVYQCLPGC  697

Query  590   SGHGNFDLETQTCLCEPMWSGDDCSKELCDLDCGPHGHCVDNACDCLPGWSGELCNLKQC  649
             S HG +DLET  C+CE  W+G DCS+ +C LDCG +G C    C C  GW+G LC+   C
Sbjct  698   SEHGTYDLETGQCVCERHWTGPDCSQAVCSLDCGRNGVCESGKCRCNSGWTGNLCDQLPC  757

Query  650   DPRCNEHGQCKNGTCLCVTGWNGKHCTMEGCPNSCSGHGQCRVGNDGQWECRCYDGWDGK  709
             D RC+EHGQCKNGTC+C  GWNG+HCT+ GC N CS HGQC + N G++ C C +GW G+
Sbjct  758   DSRCSEHGQCKNGTCVCSQGWNGRHCTLPGCENGCSRHGQCTLEN-GEYRCDCIEGWAGR  816

Query  710   DCNVLLEQNCNDGRDNDKDGLIDCADPECCSNHICRSSQLCVSAPKPIDILLRKQPPAIT  769
             DC++ LE NC D  DND DG+ DC+D ECCS+  C    +C+S+  P+++LLRKQPP++T
Sbjct  817   DCSIALELNCKDNIDNDGDGMTDCSDSECCSHPACSEHIMCLSSNDPVEVLLRKQPPSVT  876

Query  770   ASFFERMKFLIDEGSLQNYARQETFNESMFWNHFNTSRSAVVRGRVVTHLGTGLMGVRVS  829
             ASF++R+KFLI+E S+Q+YA  + ++E         +R +V+RG+V+T  G G++G+RVS
Sbjct  877   ASFYQRVKFLIEENSVQSYAHMDEYSE---------NRVSVMRGQVITPQGLGIVGIRVS  927

Query  830   TSTPLE-GFTLTRDDGWFDLLVNGGGAVTLQFGRSPFKPQSHIVFVPWNEVVIIDKIVMS  888
                    GFTLTR  GWFD+LVNGGGAVTLQF RSPF+P +  VFVPWN +V++  + M 
Sbjct  928   VDRDSRFGFTLTRQGGWFDVLVNGGGAVTLQFQRSPFRPLTRTVFVPWNRIVVLPPVQMQ  987

Query  889   TAEEKQTS-----------------HIPY-----------ACAAHDYDLMKPVVLATWKH  920
              +++ +T+                  I Y            C  HD++ ++P +++TW  
Sbjct  988   LSDDDETTSRNIKVAPLNPALTFLNSIHYHTADEANDASKVCMDHDHEKLRPQLISTWMP  1047

Query  921   GFQGACPDKSAILAESQVIQESLQIPGTGLNLVYHSSRAAGYLSTIQLQLTPEVIPPTLN  980
                GA P K  I AE+Q++QES+QIPG+ L+L Y SS+A+GYLS ++++LT E IPPTL 
Sbjct  1048  NGVGAMPGKRVIFAETQIVQESIQIPGSDLHLTYQSSQASGYLSIVRMRLTGETIPPTLT  1107

Query  981   LIHLRITIEGILFEKTFEADPVIKFTYAWNRLNVYRQRVYGVTTAMVKVGYEYNDCKDII  1040
              +H+ + IEG L  KT+EADP +  T+AWN+ NVYRQ+VYGVT A + VGY+++ C+  +
Sbjct  1108  HVHVGVEIEGALHVKTYEADPSLVHTFAWNKRNVYRQKVYGVTVARISVGYQHSTCQSPV  1167

Query  1041  WDVQTTKLSGHDMSISEVGGWNLDIHHRYNFHEGILQKGDGSNIYLKQKPRVILTTMGDG  1100
             W  QT KL G+D+ IS++GGW LDIHH YNFHEGILQKGDGS +++K+ PR +   MG G
Sbjct  1168  WIAQTAKLQGYDVDISDIGGWGLDIHHHYNFHEGILQKGDGSTLHMKEYPRTVKVVMGTG  1227

Query  1101  HQRSLDCYD-CDRQAEASNQRLLAPVALATASDGSIFVGDFNLVRKILVDGTVRTVVRLN  1159
              QR L C D C+    A + +LL P+ALAT  DGS++VGDFNLVR+I  DG V T+++L+
Sbjct  1228  LQRPLTCPDYCN--GVAKDAKLLTPIALATGPDGSLYVGDFNLVRRITPDGKVYTILQLS  1285

Query  1160  ATRVSYRYHIALSPLDGSLYISDPESHQIIRVRDTNDYSEPDHNWETVVGSGERCLPGDE  1219
             AT+VSY+Y++A+SP DG LYISDPE HQI+R+       +P  N + VVGSG+RC+PGDE
Sbjct  1286  ATQVSYQYYLAVSPADGHLYISDPERHQILRLVRLEKVKDPSINSDPVVGSGQRCIPGDE  1345

Query  1220  AHCGDGALARDAKLAYPKGVAVSADNVLYFADGTNIRMVDRDGIITTVIGNHMHKSHWKP  1279
              +CGDG  A  A+L++PKG+A++AD  +Y ADGTNIR VD  G+I T+IG+H H +HW P
Sbjct  1346  GNCGDGGPALLARLSHPKGLAIAADRTMYIADGTNIRAVDPKGVIHTLIGHHGHHNHWSP  1405

Query  1280  IPCEGTLNVEEVHLRWPTELAINPLDNSLHMIDDHMVLQLAPDGRVKVVAGRPLHCASPS  1339
              PC GTL   +  L+WPT LA++PLD SLH IDD +VL+L  D +++VVAG PLHC++  
Sbjct  1406  APCSGTLMANQAQLQWPTGLALSPLDGSLHFIDDRLVLRLTSDMKIRVVAGTPLHCSNGG  1465

Query  1340  SSFDT-ELATHATLVMPQSIAFGPSGNLYIAESDSQRINRVRVIGTDGKISPYAGAESKC  1398
                   +      L    ++AF P GNLYIA+SDS+R+N +RV+ T G +  +AG +   
Sbjct  1466  QDGRVNKTGADNVLGTVLAMAFSPFGNLYIADSDSRRVNSIRVVDTAGNMRYFAGKQEGT  1525

Query  1399  NCLERGCDC  1407
                 + CDC
Sbjct  1526  G--SQTCDC  1532


 Score = 729 bits (1881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/1321 (32%), Positives = 699/1321 (53%), Gaps = 106/1321 (8%)

Query  1409  DADHYLASTSKFNTISAVAVSPDGVVHIGDQANYRIRSVMASIPDASGAREYEIYSPDTQ  1468
             +A+  L+S ++F  ISA+AV+ DGV+++ DQ +  + ++   +P      E+ I  P + 
Sbjct  1677  NAETLLSSNARFQAISAIAVAQDGVINVADQGSLHVLALEHYLPSHDENGEFHIPFPPSS  1736

Query  1469  EIYVFNRFGQHVATKNILTGEIVYQFTYNVNTSNGKLSTVTDAAGNKVFLLRDYSSQVNS  1528
             EIYVFNR+GQHVATK++ +G+  Y F Y+ NTS G+LSTVTDA+GNK+  LRDYS+ V+S
Sbjct  1737  EIYVFNRYGQHVATKDLTSGKTRYSFLYSKNTSFGRLSTVTDASGNKIQFLRDYSNVVSS  1796

Query  1529  IENTKGQKCRLRMSRMKMLHELSTPDNYNVTFDYHGPTGLLKTKLDSTGRSYVYNYDEFG  1588
             IENT+  K  ++++ + ++ +LS      +  DY   TGLL ++  S G +Y+Y YDEFG
Sbjct  1797  IENTQDHKSEIQINGIGIMTKLSEKGRQEIELDYDSNTGLLNSR-SSGGETYIYQYDEFG  1855

Query  1589  RLTSAVTPTGKVISLTFDLS-LKGAVVKVGQN-----NRKPIS-----MLIKGS--SVVT  1635
             R+T  + P+G+++ +T  L+  +G  V V  +     +R+ I+     +L+ G   S   
Sbjct  1856  RVTGMILPSGEIVRITSQLADSQGLTVYVHASVESLFSRERIAGEANELLVLGGVRSTFL  1915

Query  1636  KVGEAEQRTTVLSDGSVGQVTPWAHTVSTDTLPYSVLAEIEPLLGESYPVPAK-------  1688
             K G+A     + ++ ++       H  +   +  S +A   PLL  + PV A+       
Sbjct  1916  KRGQAHADAELKANNTL-----VIHGDNGVVVEASAVAR-HPLLEAALPVEAEMLAMWSH  1969

Query  1689  QRTEIAGDLANRFEWRYFLRKFQGNKYRSESKTVAQVGRKLRINGDILLSLEYDRETNSV  1748
             Q   +   L N     Y L        R+  +T   + R++ +N   ++ +E+D+ TN  
Sbjct  1970  QSVTMGEGLTNSMYSVYSLV----GDVRNPQQT---LNREIWVNQSRVIGVEFDQFTNRE  2022

Query  1749  AVFMDDDAELLNVTYDRTARPVKWGPRNGIFSGVELEYDRFSRLTSWTWGDISETYGFDR  1808
               +      +L V YD++  P  + P NG    V + YDRF+R+  W WG     Y +DR
Sbjct  2023  TFYDARRTPILIVAYDQSGLPKSYYPTNGY--PVNITYDRFNRVEGWAWGPAELKYSYDR  2080

Query  1809  AGRLYEIKYSDGTSMVYAFKDMFSSLPLKVTTPRGSDYLLQYDEAGALQSLTTPRGHIHA  1868
              G L EI       + + + D      + + + R   ++LQYD+AG L+ +  P G  H+
Sbjct  2081  HGLLSEITSQQDGIVSFVYNDWNLVSEIGLASQR--KFVLQYDDAGGLRHVVLPSGTRHS  2138

Query  1869  FSLQTSLGFYKYQYYSPMNRHPYEILYNDDGQILAKVYPHQSGKVAYVYDHTGKLETTLA  1928
             FS+QTS+GF +  Y  P +   Y   Y+  G +L  + P    ++ Y Y+  G+L   + 
Sbjct  2139  FSMQTSIGFIRCTYTPPGSTRAYLQHYSHAGALLQTILPGDGARIVYRYNAAGQLTEVVH  2198

Query  1929  GLSSIHYTYQETTSLVHSIDINEPNFEMRIEYKYHAGIVKDEKIKFGSKSGLDNARYRYQ  1988
             G     + Y E T +  ++   E   E R +++Y AG++ +E+I + +K+GL NA++ Y+
Sbjct  2199  GDGRSEFQYNEATGMPSTVSHTERELEYRWDFEYAAGLLAEERIDYVAKTGLSNAKFSYE  2258

Query  1989  YDGNARISGIEVDINGKQLPQLRLKYNQNLGILEGVGDLRIYRNLFNRSVMQDSSKQFFT  2048
             YD   R+  ++  I G+ LP     Y+   G    +G  R  +   N++ + D +  F  
Sbjct  2259  YDSQLRVVALQGRIGGQSLPTQAFAYDPRTGRPSLIGQFRFSQPAQNQTQLHDGTASFTR  2318

Query  2049  VTDYDEHGRVKT--VLMNIRSLDVFRMELEYDNRNRIKMRKLSIGKDAMEKKEWTKMEKI  2106
               D    GR +T  + + I  L+VFRME  Y    RI   +       M    +T ++  
Sbjct  2319  TVD----GRFQTQRMALAIHRLEVFRMEFSYGVHGRISQTRTYTRN--MAVNSYTNVKNY  2372

Query  2107  TYNADGHVLEVADTENNWQYAYDENGNVIGVTEHNEKIALGYDSGDRVVQYGDVEFNSYD  2166
             T++ DG ++ V + +  W + YD+NGN++ +T     I + Y++ DR+V++G+ ++  YD
Sbjct  2373  TWDCDGQLVGV-EAQEPWGFRYDDNGNLLSLTYRGNTIPMEYNAQDRIVKFGEGQYK-YD  2430

Query  2167  GRGFVVIRG-EHKYRYNSRGQLIHASEHKKFQIWYFYDDRGRLVAWNDDRENITQFFYAN  2225
              RG V     E ++ YN++G L+ AS+  +F + Y+YD   RL    D+  N+TQFFY N
Sbjct  2431  ARGLVAQNAREERFHYNTQGLLVRASKRGRFDVRYYYDHLKRLTTRKDNFGNVTQFFYTN  2490

Query  2226  PKTPDLITHIHFPKSSKTFRFLYDSRNFLMTVETSEQRFYVATDQNGSPLALFDTNGNLI  2285
              + P  ++ I+ P+  K     YD    L+  +    ++YVATDQ+G+PL LF+  G  I
Sbjct  2491  QQRPYEVSQIYSPRDGKLMSLTYDDVGHLIYAQVYRHKYYVATDQSGTPLMLFNQYGEGI  2550

Query  2286  KEMRRTPFGKIIKDTNPDFYLPIDFHGGLLDPNTKLVYL-NKRLYDPTVGQWMTPAWEQM  2344
             +E+ R+PFG I+ D+NP  YLPIDF GG+LD  T LV++ + R+YDP +GQWM+P W+++
Sbjct  2551  REIMRSPFGHIVYDSNPYLYLPIDFCGGILDQVTTLVHMGDGRVYDPLIGQWMSPDWQRV  2610

Query  2345  ANELTTPTDIFIYRFRNNDPINFKQNVEYMTDLASWLKLYGYDISAMLGSEYMKQMVYQP  2404
             A  + TPT + +YRF  NDPIN      Y  D A+W++  GY++  ++    + + ++QP
Sbjct  2611  AERIITPTRLHLYRFNGNDPINVGHERHYPEDFAAWMRTLGYNVGNLV--PQLARDLWQP  2668

Query  2405  SATITSPQLT-------------PDFGVMSGLQCIVN-RVHEKFSDLGFVPKPLLK---L  2447
              A    P                P   V SG    +N R    F  L   P+  LK   +
Sbjct  2669  PALWGRPPANPVALNLRRPFDNIPTMAVESGFLAHLNVRRMSDFEQLSAPPRSALKCDVM  2728

Query  2448  EPKTRNLLPRVAHRRAVFGEGILVSRVG-GRSLVSVVDGVNSVVQDVVTSVFNNSYFLPL  2506
             +P  + +    +     FG+GI+VSR   G+++VS V   N++ +DV TSVFN S  LP 
Sbjct  2729  DPSPKTI---GSDTEPPFGKGIVVSRTADGQAIVSSVPAANAIYRDVYTSVFNRSKLLPF  2785

Query  2507  HFSVHD--QDVFYFVKDNALKIRDDMEELRRLGGMFNVSTHETTEHG-------------  2551
              F VH+  QD F+FVK++A +  +D ++L+RL G  N + HE T                
Sbjct  2786  TFVVHNAQQDSFFFVKEDAWRATEDRQQLKRLQGQVNTTFHEITREATVGSGPAGAANGG  2845

Query  2552  ------------------AGTWKELRLHNPDAAVVIKYGADPEQERHRILKHAHKRAVER  2593
                                G + ++++H   A + ++YG    +E+ R++ HA   AV +
Sbjct  2846  AGSSSSSSSSSGGGSSSNTGNYLDVKIHGAHAIINLRYGTTVAKEQQRLMHHAKLTAVRK  2905

Query  2594  AWEIEKQLVMAGFQGRGDWSKEEKDELISRGTVSGYEGVDIHSVHRYPQLADDPGNVAFT  2653
             AW  EK+ + +G     +WS++E DE++ +   + YEG  IH V+ YP+LA+DP N+ F 
Sbjct  2906  AWHREKEALRSGLTTALEWSQQETDEILKQSYANNYEGEYIHDVNLYPELAEDPYNIKFV  2965

Query  2654  R  2654
             +
Sbjct  2966  K  2966


 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 35/54 (65%), Gaps = 0/54 (0%)

Query  341  IPPYSYWNMQFYQSEAAYVRFDYNIPRGASIGVYARRNALPTHTQYDLLEVLSG  394
            IP Y +W ++F     A++RF++ +P GA   VY+RRN  P+ TQ+D +E + G
Sbjct  367  IPAYQFWTLEFRNKHPAFIRFNFTLPWGAHFAVYSRRNVAPSVTQHDFVEFIKG  420


 Score = 33.5 bits (75),  Expect = 4.0, Method: Compositional matrix adjust.
 Identities = 15/42 (36%), Positives = 23/42 (55%), Gaps = 0/42 (0%)

Query  230  CSWKLIAMILLMVSLCITAALCYVIVSSIVNRSYQSTKACAV  271
            CSWK +++ L+ VS+ +TA L Y    S +  +  ST    V
Sbjct  162  CSWKCLSIALIFVSVVLTAMLAYFAAVSSMKPNMDSTNCILV  203


>H1ZUX1_CAEEL unnamed protein product
Length=2763

 Score = 798 bits (2061),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 667/2537 (26%), Positives = 1138/2537 (45%), Gaps = 344/2537 (14%)

Query  319   RSFPPDGTTFAQVGLGQKLSKEIPPYSYWNMQFYQSEAAYVRFDYNIPRGASIGVYARRN  378
             R+ PP       + LG+++  E  P S    +   ++ + +RF+  +  GA + +     
Sbjct  349   RALPP------AISLGERVDVEFFPKSMATTELTVTKPSRIRFNATVGSGAQLVLLMSAG  402

Query  379   ALPTHTQYDLL---------------EVLSGFKARTTRA--------SHVSVIPSIKKEV  415
               P+ + +D L                ++  F +R+ R+         ++ ++       
Sbjct  403   VHPSLSLHDALFPIRADRIRDSKSPTHIVEEFGSRSRRSLGASSSRHRNIEILSPRSATF  462

Query  416   THYMEPGHWFLSLYNDDGDPQEVSFIAMIAEDMTHN---------------------CPN  454
               ++  G  +L+  N+    + +SF+A   +  T                       C +
Sbjct  463   EQFVLEGRHYLTFINERSRVEPISFVAEELQRPTTPPKTSSSGTSGAKEHPLASVLVCES  522

Query  455   GCSGKGECLLGHCQCNPGFGGEDCSESVCPVLCSQRGEYINGECQCNPGWKGKECSLRHD  514
              C+ +GEC+ G C C PGF G  C E+VCPV+CS  G +  G C C  G+KGKEC +RH+
Sbjct  523   NCNQRGECVHGKCHCAPGFTGRTCDEAVCPVVCSGNGVFSGGICVCKSGFKGKECEMRHN  582

Query  515   ECEVPDCNGHGHC-TNGKCNCVRGYKGKYCEEVDCPHPTCSGHGFCAEGTCICKKGWKGA  573
              CEV DCNG G C T+G+C C  G+ G+ CE   CPH +C   G C  GTC C  GW+G 
Sbjct  583   WCEVADCNGRGRCDTDGRCRCNPGWTGEACELRACPHASCHDRGVCVNGTCYCMDGWRGN  642

Query  574   DC--------------------------SQMDKEALQCLPD-------------------  588
             DC                          S+  K  ++  P                    
Sbjct  643   DCSVFADAIVHVPQAQSPPRRGQEPTESSKTRKAQVKPTPTSEKKKESRELQKPIIATVQ  702

Query  589   --------CSGHGNFDLETQTCLCEPMWSGDDCSKELCDLDCGPHGHCVDN-ACDCLPGW  639
                     CS HG   L    C CE  W   DCS++ C      +G C+D+ +C C  GW
Sbjct  703   VPTESSHPCSAHGQ--LIDDICQCESGWDSVDCSQQACQC---VNGDCLDDGSCQCWKGW  757

Query  640   SGELCNLKQCDPRCNEHGQC-KNGTCLCVTGWNGKHCTMEGCPNSCSGHGQCRVGN-DGQ  697
              G  C  K+C   C + G+C  +G+C C +GWNG++C ++GCPN CSG G+C +     +
Sbjct  758   RGSNCTDKKCAIGCEDRGKCASDGSCKCSSGWNGENCAIDGCPNQCSGKGECGMDRRSSE  817

Query  698   WECRCYDGWDGKDCNVLLEQNCNDGRDNDKDGLIDCADPECCSNHICRSSQLCVSAPKPI  757
             W CRC  G  G DC+V +E +C+DG DND DGLIDC DPECCS+  C S  +C +A  PI
Sbjct  818   WSCRCQAGSTGVDCSVSVEMHCDDGLDNDSDGLIDCDDPECCSSSSCSSESVCSTAASPI  877

Query  758   DILLRKQPPAITASFFERMKFLIDEGSLQNYARQETFNESMFWNHFNTSRSAVVRGRVV-  816
             ++L+R  PP   A+F +R+ FLI E S+Q+Y     FNE++          +V+RGRV+ 
Sbjct  878   EVLMR-MPPIFNANFAQRVGFLIMEKSVQSYTDSSQFNENLI---------SVIRGRVMW  927

Query  817   -------THLGT-------GLMGVRVSTST-PLEGFTLTRDDGWFDLLVNGGGAVTLQFG  861
                      L T        L+GVRVS +  PL GFTLTR+DG+FDL VNG  +VTLQF 
Sbjct  928   GGSPTGSDDLSTYSNKSTVPLVGVRVSDAAHPLYGFTLTREDGYFDLTVNGARSVTLQFL  987

Query  862   RSPFKPQSHIVFVPWNEVVIIDKIVMSTAEEKQTSHIPYA-----CAAHDYDLMKPVVLA  916
             R+ F+     VFV   +++ ID IV+          I  A     C+     +   V+++
Sbjct  988   RTQFQSVKKSVFVSPRQIIHIDDIVLYRQSGGSPPAISMAPARAKCSPTLRRIPDVVLIS  1047

Query  917   TWKHGFQG----ACPDKSAILAESQVIQESLQIPGTGLNLVYHSSRAAGYLSTIQLQLTP  972
              W++   G       D S I+ +S+ I ESL I GT + LVY S+R+    ST+ + L  
Sbjct  1048  NWQYTSDGIETDETSDSSRIVVDSRSIFESLPIQGTDVRLVYDSARSPAAPSTMLIGLLY  1107

Query  973   EVIPPTLNLIHLRITIEGILFEKTFEADPVIKFTYAWNRLNVYRQRVYGVTTAMVKVGYE  1032
             + +   L  +H+ I I G  F++       + + +AW+++N YRQ   G+    V+VGYE
Sbjct  1108  DRVDKELRKVHINIRIAGRRFDRVLAPRTNLTYVFAWDKMNAYRQSESGLVPVTVRVGYE  1167

Query  1033  YNDC---KDIIWDVQTTKLSGHDMSISEVGGWNLDIHHRYNFHEGILQKGDGS-NIYLKQ  1088
             Y  C    + +W  + +++ G          W LDIHH  +    +++ G+G   +  + 
Sbjct  1168  YQGCDRTSERVWQTRRSQMMGATARKMIGTMWTLDIHHHLDIVNNVVEMGNGGYRLITES  1227

Query  1089  KPRVILTTMGDGHQRSLDCYDCDRQAEASNQRLLAPVALATASDGSIFVGDFNLVRKILV  1148
             +PRV      DG +R ++C  C+ + ++ +  L  P  +  A DGS+ +GD N++R++  
Sbjct  1228  EPRVSTFAGLDGVKRDVECLKCEGKVDSIS--LFRPTTVVYAQDGSLIIGDHNMIRRVSQ  1285

Query  1149  DGTVRTVVRLNATRVSYRYHIALSPLDGSLYISDPESHQIIRVRDTNDYSEPDHNWETVV  1208
             DG V T++ L     S+ Y+IA+SP+DG++ IS P   Q+ R+  + +  +  +N++ + 
Sbjct  1286  DGQVSTILTLGLADTSHSYYIAVSPVDGTIAISLPLHKQVWRI-SSLEPQDSRNNYDVLA  1344

Query  1209  GSGERCLPGDEAHCGDGALARDAKLAYPKGVAVSADNVLYFADGTNIRMVDRDGIITTVI  1268
             G G  C    ++ CGDGALA++A+L +PKG++      LY AD   IR++D  G I + I
Sbjct  1345  GDGTVCASAVDS-CGDGALAQNAQLIFPKGISFDKMGNLYLADSRRIRVIDTTGHIRS-I  1402

Query  1269  GNHMHKSHWKPI-PCEGTLNVEEVHLRWPTELAINPLDNSLHMIDDHMVLQLAPDGRVKV  1327
             G      H  PI  C     + ++ + WPT L I+P+  S+ ++D ++V ++     V  
Sbjct  1403  GETTPDQH--PIRTCAQITKLVDLQMEWPTSLTIDPITGSVLVLDTNVVYEIDVVHDVVT  1460

Query  1328  VA-GRPLHC--ASPSSSFDTELATHATLVM--PQSIAFGPSGNLYIAESDSQRINRVRVI  1382
             +A G P  C  A+ +SS   +   H   ++   + I  G  G +Y+ ESD +R+N+VR +
Sbjct  1461  IALGSPTTCDLANATSSASAKSLDHRRHLIQNARDITVGTDGAIYVVESDGRRLNQVRKL  1520

Query  1383  GTD-GKISPYAGAESKCNCLERGCDCFDA---DHYLASTSKFNTISAVAVSPDGVVHIGD  1438
              +D    S   G +S C+C    C C DA       AS +  ++  AV VSP G V I D
Sbjct  1521  SSDRSTFSILTGGKSPCSCDVAACGCDDAVSLRDVAASQAHLSSPYAVCVSPSGDVIIAD  1580

Query  1439  QANYRIRSVMASIPDASG-AREYEIYSPDTQEIYVFNRFGQHVATKNILTGEIVYQFTYN  1497
               N +I+ V A +    G +R YE+   + QE Y FNR GQH +T +++TG   + F+Y 
Sbjct  1581  SGNSKIKKVSARMAKYDGRSRTYEVTDAERQEKYTFNRHGQHSSTVSLITGRTFFNFSYQ  1640

Query  1498  VNTSNGKLSTVTDAAGNKVFLLRDYSSQVNSIENTKGQKCRLRMS----RMKMLHELSTP  1553
             V++    +S +  A+G  + +L+   S  + +E T GQ+  L MS     ++ + +  + 
Sbjct  1641  VDSPISMISEIRAASGVVLRVLKRNDSLFD-LETTLGQRTTLTMSAYDGTLEQVSKRDSA  1699

Query  1554  DNYNVTFDYHGPTGLLKTKLDSTGRSYVYNYDEFGRLTSAVTPTGKVISLTFDLS---LK  1610
              + + T  ++   GLL +++D    +  + YDE+GR           I L  D     L 
Sbjct  1700  TSRDATKLFY-KKGLLTSRID-VATAVGFEYDEYGR----------AIGLKRDREYWRLG  1747

Query  1611  GAVVKVGQNNRKPI--------SMLIKGSSVVTKVGEAEQRTTVLSDGSVGQVTPWAHTV  1662
                + +G  N + +          L +G+  V     A  R   L +      +P    +
Sbjct  1748  EETISMGSVNTEVLLNGQRFQQVRLGEGNLAVHSTNGATTRLISLRNEGYSLASP----L  1803

Query  1663  STDTLPYSVLAEIEPLLGESYPVPAKQRTEIAG-------DLANRFEWRYFLRKFQGNKY  1715
              T TL Y   + I    GE  P+ +++RT++         +L  R++WR+  R+   +  
Sbjct  1804  GTSTL-YDKSSSIPDSNGE--PLISRRRTKVPAIGNPQRRELTTRWDWRHVARRGDDSDG  1860

Query  1716  RSESKTVAQVGRKLRINGDILLSLEYDRETNSVAVFM----DDDAELLNVTYDRTARPVK  1771
                 + VA+      ING  + S+EYD ++N   + +    DD   LL + Y  + R  +
Sbjct  1861  SLGRRKVAE------INGVNMFSMEYDVKSNQDTLRLGSTTDDAQALLFIDYTSSGRIRR  1914

Query  1772  W-GPRNGIFSGVELEYDRFSRLTSWTWGDISETYGFDRAGRLYEIKYSDGTSMVYAFKDM  1830
                P +   + + + +D   R +  TWG       +D + RL E    DG  +       
Sbjct  1915  ISAPEDSQMAEMNITWDGAGRKSEVTWGSWKIRLTYDNSNRLTEHAI-DGARVPIKMSYA  1973

Query  1831  FSSLPLKVTTPRGSDYLLQYDEAGALQSLTTPRGHIHAFSLQTSLGFYKY--QYYSPMNR  1888
              +S         G+ + +QYD    ++ + +      +FS   +LG  ++  +  + +N 
Sbjct  1974  GASRRPNEIQHDGAKWNIQYDNYDRIKEVISKSQEATSFS-SIALGGDEWVLKRRTSLNS  2032

Query  1889  HPYEILYNDDGQILAKVYPHQSGKVAYVYDHTGKLETTLAGLSSIHYTYQETTSLVHSID  1948
              P  +  + +G++L    P ++        +  + +  + G ++     +ETT +     
Sbjct  2033  KPSLVRLSREGKVLESTTPDEN-------HYWLERKDPITGRTTEILNDEETTVVTCWSP  2085

Query  1949  INEP------NFEMRIEYKYHAGIVKDEKIKFGSKSGLD-NARYRYQYDGNARISGIEVD  2001
                P      N +     + H    K   I   + S     + + Y+YD   R++ I+  
Sbjct  2086  EGAPMCSRSRNLQENTTMQGHLVARKSVTIMTPTSSEPSITSSFTYEYDDMLRVTTIQPV  2145

Query  2002  INGKQLPQLRLKYNQNLGILEGVGDLRIYRNLFN-----RSVMQDSSKQFFTVTDYDEHG  2056
             I    L  ++L Y++  G +  +   +  R+          +M ++SK      D+ +  
Sbjct  2146  IEQSVLESIQLSYDERRGHVAAINGFKWARDASTSRCQGHGLMYETSK----ANDHRQVV  2201

Query  2057  RVKTVLMNIR-SLDVFRMELEYDNRNRIKMRKLSIGKDAMEKKEWTKMEKITYNADGHVL  2115
               K +  + R S+ + R     D   R     L I     ++ +  K+ + T++A G   
Sbjct  2202  ERKLIFGDARASIKIIR-----DKAGRASESHLEISSSGTQRNQ--KITR-TFDAAGR--  2251

Query  2116  EVADTENNWQYAYDENGNVIGVTEHNEKIALGYDSGDRVVQYGDVEFNSYDGRGFVVIRG  2175
              VA  E N Q       N     E      + ++ G  +  + D+ +   D  G+VV R 
Sbjct  2252  -VASVEQNDQEPVRIIWNSDARVEKINDRVVEWNRGGALKTFQDISYQ-VDSIGWVVKRD  2309

Query  2176  EHK-YRYNSRGQLIHASEHKKFQIWYFYDDRGRLVAWNDDRENITQFFYANPKTPDLITH  2234
                 + Y+ +G+L+ A    + +I  FYD   R+V   + ++ I  F+Y    TP L++ 
Sbjct  2310  NTTVFGYDGKGRLVSA-RSSQLRINIFYDREDRVVQIQNSKDFI-HFYYGYIDTPKLVS-  2366

Query  2235  IHFPKSSKTFRFLYDSRNFLMTVETSE-QRFYVATDQNGSPLALFDTNGNLIKEMRRTPF  2293
              HF K+ K     YD  +    +++ +  R+ + TD+  +  A+   + N+++ + R+ F
Sbjct  2367  -HFSKNGKISTLFYDDDSVPFAMQSDDGTRYALLTDETSTIKAIIG-DSNVLRIIDRSVF  2424

Query  2294  GKIIKDTNPDF-YLPIDFHGGLLDPNTKLVYLNK-RLYDPTVGQWMTPAWE-----QMAN  2346
             G ++  ++    +LPI + GG+      +  LN  R  D    ++M+ + E     ++  
Sbjct  2425  GALLPSSSSSHPFLPIGYLGGIEISEISVSILNNGRPLDLYSERYMSISPEAVVRLELNE  2484

Query  2347  ELTTPTDIFIYRFRNNDPINFKQNVEYMTDLASWLKLYGYDISAMLGSEYMKQMVYQPSA  2406
             + +   D+      +  P   +   E   D  +W  L G                     
Sbjct  2485  KFSNSIDLMALEI-DRQPFRVENVPE---DFETWFSLAGL--------------------  2520

Query  2407  TITSPQLTPDFGV-MSGLQCIVNRVHEKFSDLGFVPKPLLKLEPKTRNLLPRVAHRRAV-  2464
                SP L P   + +     IV+R+   F      P+ L  L   T  L  R+A   ++ 
Sbjct  2521  ---SPNLLPSAHLGLPASSAIVHRLLSSF------PRKLRPLTHLTTVLPTRLASDISLT  2571

Query  2465  --------------FGEGILVSR--VGGRSLVSVVDGVNSVVQDVVTSVFNNSYFLPLHF  2508
                           F   ++++     G  +V ++  + S  ++V++ +F+    L    
Sbjct  2572  SPTSETSWSIDDVGFSNLLILNEDATTGEVMVEMLSDLKSEEREVISKLFDGVKSL----  2627

Query  2509  SVHDQDVFYFVKDNALKIRDDMEELRRLGGMFNVSTHETTEHGAGTWKE-LRLHNPDAAV  2567
                D   +  V    L         R       +S+   +       K+ + L N  + +
Sbjct  2628  ---DFATWGLVPTRHL--------WRAPNSKLELSSTSFSHFTMAVNKDSVELRNGKSKI  2676

Query  2568  VIKYGADPEQERHRILKHAHKRAVERAWEIEKQLVMAGFQGRGDWSKEEKDELISRGTVS  2627
             V+ +  +  +   +I++    R     W  E++   AG +    WS  E  EL S+G+VS
Sbjct  2677  VVHFSENKAEIVKKIVEELKTRENIAVWRAERKRAEAGEKTWRQWSDRETRELTSKGSVS  2736

Query  2628  GYEGVDIHSVHRYPQLA  2644
             GY+ +++   H+   LA
Sbjct  2737  GYD-IEMKPAHQSGLLA  2752



Lambda      K        H
   0.315    0.132    0.397 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 43955775900


Query= XP_050469445.1 teneurin-m isoform X4 [Bombus huntii]

Length=2675
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TENM_DROME  unnamed protein product                                   3880    0.0  
TENA_DROME  unnamed protein product                                   1120    0.0  
H1ZUX1_CAEEL  unnamed protein product                                 798     0.0  


>TENM_DROME unnamed protein product
Length=2731

 Score = 3880 bits (10061),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1851/2659 (70%), Positives = 2172/2659 (82%), Gaps = 126/2659 (5%)

Query  100   VARDSALLVH--NGCLLDNSAPRGPPDVPPRNPTMSRV-NGRLPGSHAASDHERDPDLQP  156
              A ++A   H   G LL+   P  PPDVPPRNPTMSR+ NGRL       ++  D D +P
Sbjct  88    TANNTAQRTHGRQGFLLEGVTPTAPPDVPPRNPTMSRMQNGRL-----TVNNPNDADFEP  142

Query  157   SCLVRTSSGGFYSIPKIPKNEYN--------NKNQSTGNSPIKVEL-------QNNMDRV  201
             SCLVRT SG  Y    IP    N         K+ S  ++P K  L       Q  M  V
Sbjct  143   SCLVRTPSGNVY----IPSGNLNINKGSPIDFKSGSACSTPTKDTLKGYERSTQGCMGPV  198

Query  202   PLPYGHAPSMIPMRRQSIRCHFVKG-VDWCS--W-------KLIAMILLMVSLCITAAL-  250
              LP     + +P    S   +F K  V  CS  W        L A +++++ L  T  + 
Sbjct  199   -LPQRSVMNGLPAHHYSAPMNFRKDLVARCSSPWFGIGSISVLFAFVVMLILLTTTGVIK  257

Query  251   ------CYVIV-----------------SSIVNRSYQSTKACAVLVGENSDTKPLSSDGN  287
                   C V+V                 S + N S ++     + + +       +  G+
Sbjct  258   WNQSPPCSVLVGNEASEVTAAKSTNTDLSKLHNSSVRAKNGQGIGLAQGQSGLGAAGVGS  317

Query  288   K------TSSSATASSSQSSG----------------------------RTRQQASSGGA  313
                    T ++AT++S  + G                             +   A++GGA
Sbjct  318   GGGSSAATVTTATSNSGTAQGLQSTSASAEATSSAATSSSQSSLTPSLSSSLANANNGGA  377

Query  314   RTFPARSFPPDGTTFAQVGLGQKLSKEIPPYSYWNMQFYQSEAAYVRFDYNIPRGASIGV  373
             RTFPARSFPPDGTTF Q+ LGQKL+KEI PYSYWNMQFYQSE AYV+FDY IPRGASIGV
Sbjct  378   RTFPARSFPPDGTTFGQITLGQKLTKEIQPYSYWNMQFYQSEPAYVKFDYTIPRGASIGV  437

Query  374   YARRNALPTHTQYDLLEVLSGFKA--RTTRASHVSVIPSIKKEVTHYMEPGHWFLSLYND  431
             Y RRNALPTHTQY   EVLSGF A  RT RA+H+S    I +EVT YMEPGHWF+SLYND
Sbjct  438   YGRRNALPTHTQYHFKEVLSGFSASTRTARAAHLS----ITREVTRYMEPGHWFVSLYND  493

Query  432   DGDPQEVSFIAMIAEDMTHNCPNGCSGKGECLLGHCQCNPGFGGEDCSESVCPVLCSQRG  491
             DGD QE++F A +AEDMT NCPNGCSG G+CLLGHCQCNPGFGG+DCSESVCPVLCSQ G
Sbjct  494   DGDVQELTFYAAVAEDMTQNCPNGCSGNGQCLLGHCQCNPGFGGDDCSESVCPVLCSQHG  553

Query  492   EYINGECQCNPGWKGKECSLRHDECEVPDCNGHGHCTNGKCNCVRGYKGKYCEEVDCPHP  551
             EY NGEC CNPGWKGKECSLRHDECEV DC+GHGHC +GKC C+RGYKGK+CEEVDCPHP
Sbjct  554   EYTNGECICNPGWKGKECSLRHDECEVADCSGHGHCVSGKCQCMRGYKGKFCEEVDCPHP  613

Query  552   TCSGHGFCAEGTCICKKGWKGADCSQMDKEALQCLPDCSGHGNFDLETQTCLCEPMWSGD  611
              CSGHGFCA+GTCICKKGWKG DC+ MD++ALQCLPDCSGHG FDL+TQTC CE  WSGD
Sbjct  614   NCSGHGFCADGTCICKKGWKGPDCATMDQDALQCLPDCSGHGTFDLDTQTCTCEAKWSGD  673

Query  612   DCSKELCDLDCGPHGHCVDNACDCLPGWSGELCNLKQCDPRCNEHGQCKNGTCLCVTGWN  671
             DCSKELCDLDCG HG C  +AC C P W GE CN + CD RCNEHGQCKNGTCLCVTGWN
Sbjct  674   DCSKELCDLDCGQHGRCEGDACACDPEWGGEYCNTRLCDVRCNEHGQCKNGTCLCVTGWN  733

Query  672   GKHCTMEGCPNSCSGHGQCRVGNDGQWECRCYDGWDGKDCNVLLEQNCNDGRDNDKDGLI  731
             GKHCT+EGCPNSC+GHGQCRV  +GQWECRCY+GWDG DC + LE NC D +DNDKDGL+
Sbjct  734   GKHCTIEGCPNSCAGHGQCRVSGEGQWECRCYEGWDGPDCGIALELNCGDSKDNDKDGLV  793

Query  732   DCADPECCSNHICRSSQLCVSAPKPIDILLRKQPPAITASFFERMKFLIDEGSLQNYARQ  791
             DC DPECC++H+C++SQLCVSAPKPID+LLRKQPPAITASFFERMKFLIDE SLQNYA+ 
Sbjct  794   DCEDPECCASHVCKTSQLCVSAPKPIDVLLRKQPPAITASFFERMKFLIDESSLQNYAKL  853

Query  792   ETFNESMFWNHFNTSRSAVVRGRVVTHLGTGLMGVRVSTSTPLEGFTLTRDDGWFDLLVN  851
             ETFNES         RSAV+RGRVVT LG GL+GVRVST+T LEGFTLTRDDGWFDL+VN
Sbjct  854   ETFNES---------RSAVIRGRVVTSLGMGLVGVRVSTTTLLEGFTLTRDDGWFDLMVN  904

Query  852   GGGAVTLQFGRSPFKPQSHIVFVPWNEVVIIDKIVMSTAEEKQTS-HIPYACAAHDYDLM  910
             GGGAVTLQFGR+PF+PQS IV VPWNEVVIID +VMS +EEK  +    + C AHDYDLM
Sbjct  905   GGGAVTLQFGRAPFRPQSRIVQVPWNEVVIIDLVVMSMSEEKGLAVTTTHTCFAHDYDLM  964

Query  911   KPVVLATWKHGFQGACPDKSAILAESQVIQESLQIPGTGLNLVYHSSRAAGYLSTIQLQL  970
             KPVVLA+WKHGFQGACPD+SAILAESQVIQESLQIPGTGLNLVYHSSRAAGYLSTI+LQL
Sbjct  965   KPVVLASWKHGFQGACPDRSAILAESQVIQESLQIPGTGLNLVYHSSRAAGYLSTIKLQL  1024

Query  971   TPEVIPPTLNLIHLRITIEGILFEKTFEADPVIKFTYAWNRLNVYRQRVYGVTTAMVKVG  1030
             TP+VIP +L+LIHLRITIEGILFE+ FEADP IKFTYAWNRLN+YRQRVYGVTTA+VKVG
Sbjct  1025  TPDVIPTSLHLIHLRITIEGILFERIFEADPGIKFTYAWNRLNIYRQRVYGVTTAVVKVG  1084

Query  1031  YEYNDCKDIIWDVQTTKLSGHDMSISEVGGWNLDIHHRYNFHEGILQKGDGSNIYLKQKP  1090
             Y+Y DC DI+WD+QTTKLSGHDMSISEVGGWNLDIHHRYNFHEGILQKGDGSNIYL+ KP
Sbjct  1085  YQYTDCTDIVWDIQTTKLSGHDMSISEVGGWNLDIHHRYNFHEGILQKGDGSNIYLRNKP  1144

Query  1091  RVILTTMGDGHQRSLDCYDCDRQAEASNQRLLAPVALATASDGSIFVGDFNLVRKILVDG  1150
             R+ILTTMGDGHQR L+C DCD QA  + QRLLAPVALA A DGS+FVGDFN +R+I+ DG
Sbjct  1145  RIILTTMGDGHQRPLECPDCDGQA--TKQRLLAPVALAAAPDGSLFVGDFNYIRRIMTDG  1202

Query  1151  TVRTVVRLNATRVSYRYHIALSPLDGSLYISDPESHQIIRVRDTNDYSEPDHNWETVVGS  1210
             ++RTVV+LNATRVSYRYH+ALSPLDG+LY+SDPESHQIIRVRDTNDYS+P+ NWE VVGS
Sbjct  1203  SIRTVVKLNATRVSYRYHMALSPLDGTLYVSDPESHQIIRVRDTNDYSQPELNWEAVVGS  1262

Query  1211  GERCLPGDEAHCGDGALARDAKLAYPKGVAVSADNVLYFADGTNIRMVDRDGIITTVIGN  1270
             GERCLPGDEAHCGDGALA+DAKLAYPKG+A+S+DN+LYFADGTNIRMVDRDGI++T+IGN
Sbjct  1263  GERCLPGDEAHCGDGALAKDAKLAYPKGIAISSDNILYFADGTNIRMVDRDGIVSTLIGN  1322

Query  1271  HMHKSHWKPIPCEGTLNVEEVHLRWPTELAINPLDNSLHMIDDHMVLQLAPDGRVKVVAG  1330
             HMHKSHWKPIPCEGTL +EE+HLRWPTELA++P+DN+LH+IDDHM+L++ PDGRV+V++G
Sbjct  1323  HMHKSHWKPIPCEGTLKLEEMHLRWPTELAVSPMDNTLHIIDDHMILRMTPDGRVRVISG  1382

Query  1331  RPLHCASPSSSFDTELATHATLVMPQSIAFGPSGNLYIAESDSQRINRVRVIGTDGKISP  1390
             RPLHCA+ S+++DT+LATHATLVMPQSIAFGP G LY+AESDSQRINRVRVIGTDG+I+P
Sbjct  1383  RPLHCATASTAYDTDLATHATLVMPQSIAFGPLGELYVAESDSQRINRVRVIGTDGRIAP  1442

Query  1391  YAGAESKCNCLERGCDCFDADHYLASTSKFNTISAVAVSPDGVVHIGDQANYRIRSVMAS  1450
             +AGAESKCNCLERGCDCF+A+HYLA+++KFNTI+A+AV+PD  VHI DQANYRIRSVM+S
Sbjct  1443  FAGAESKCNCLERGCDCFEAEHYLATSAKFNTIAALAVTPDSHVHIADQANYRIRSVMSS  1502

Query  1451  IPDASGAREYEIYSPDTQEIYVFNRFGQHVATKNILTGEIVYQFTYNVNTSNGKLSTVTD  1510
             IP+AS +REYEIY+PD QEIY+FNRFGQHV+T+NILTGE  Y FTYNVNTSNGKLSTVTD
Sbjct  1503  IPEASPSREYEIYAPDMQEIYIFNRFGQHVSTRNILTGETTYVFTYNVNTSNGKLSTVTD  1562

Query  1511  AAGNKVFLLRDYSSQVNSIENTKGQKCRLRMSRMKMLHELSTPDNYNVTFDYHGPTGLLK  1570
             AAGNKVFLLRDY+SQVNSIENTKGQKCRLRM+RMKMLHELSTPDNYNVT++YHGPTGLL+
Sbjct  1563  AAGNKVFLLRDYTSQVNSIENTKGQKCRLRMTRMKMLHELSTPDNYNVTYEYHGPTGLLR  1622

Query  1571  TKLDSTGRSYVYNYDEFGRLTSAVTPTGKVISLTFDLSLKGAVVKVGQNNRKPISMLIKG  1630
             TKLDSTGRSYVYNYDEFGRLTSAVTPTG+VI L+FDLS+KGA VKV +N +K +S+LI+G
Sbjct  1623  TKLDSTGRSYVYNYDEFGRLTSAVTPTGRVIELSFDLSVKGAQVKVSENAQKEMSLLIQG  1682

Query  1631  SSVVTKVGEAEQRTTVLSDGSVGQVTPWAHTVSTDTLPYSVLAEIEPLLGESYPVPAKQR  1690
             ++V+ + G AE RTTV  DGS   +TPW H +  +  PY++LAE  PLLGESYPVPAKQR
Sbjct  1683  ATVIVRNGAAESRTTVDMDGSTTSITPWGHNLQMEVAPYTILAEQSPLLGESYPVPAKQR  1742

Query  1691  TEIAGDLANRFEWRYFLRKFQ----GNKYRSESKTVAQVGRKLRINGDILLSLEYDRETN  1746
             TEIAGDLANRFEWRYF+R+ Q    G + +   + V +VGRKLR+NGD +L+LEYDRET 
Sbjct  1743  TEIAGDLANRFEWRYFVRRQQPLQAGKQSKGPPRPVTEVGRKLRVNGDNVLTLEYDRETQ  1802

Query  1747  SVAVFMDDDAELLNVTYDRTARPVKWGPRNGIFSGVELEYDRFSRLTSWTWGDISETYGF  1806
             SV V +DD  ELLNVTYDRT+RP+ + P++G ++ V+LEYDRF RL SW WG + E Y F
Sbjct  1803  SVVVMVDDKQELLNVTYDRTSRPISFRPQSGDYADVDLEYDRFGRLVSWKWGVLQEAYSF  1862

Query  1807  DRAGRLYEIKYSDGTSMVYAFKDMFSSLPLKVTTPRGSDYLLQYDEAGALQSLTTPRGHI  1866
             DR GRL EIKY DG++MVYAFKDMF SLPLKVTTPR SDYLLQYD+AGALQSLTTPRGHI
Sbjct  1863  DRNGRLNEIKYGDGSTMVYAFKDMFGSLPLKVTTPRRSDYLLQYDDAGALQSLTTPRGHI  1922

Query  1867  HAFSLQTSLGFYKYQYYSPMNRHPYEILYNDDGQILAKVYPHQSGKVAYVYDHTGKLETT  1926
             HAFSLQTSLGF+KYQYYSP+NRHP+EILYND+GQILAK++PHQSGKVA+V+D  G+LET 
Sbjct  1923  HAFSLQTSLGFFKYQYYSPINRHPFEILYNDEGQILAKIHPHQSGKVAFVHDTAGRLETI  1982

Query  1927  LAGLSSIHYTYQETTSLVHSIDINEPNFEMRIEYKYHAGIVKDEKIKFGSKSGLDNARYR  1986
             LAGLSS HYTYQ+TTSLV S+++ EP FE+R E+KYHAGI+KDEK++FGSK+ L +ARY+
Sbjct  1983  LAGLSSTHYTYQDTTSLVKSVEVQEPGFELRREFKYHAGILKDEKLRFGSKNSLASARYK  2042

Query  1987  YQYDGNARISGIEVDINGKQLPQLRLKYNQNLGILEGVGDLRIYRNLFNRSVMQDSSKQF  2046
             Y YDGNAR+SGIE+ I+ K+LP  R KY+QNLG LE V DL+I RN FNR+V+QDS+KQF
Sbjct  2043  YAYDGNARLSGIEMAIDDKELPTTRYKYSQNLGQLEVVQDLKITRNAFNRTVIQDSAKQF  2102

Query  2047  FTVTDYDEHGRVKTVLMNIRSLDVFRMELEYDNRNRIKMRKLSIGKDAMEKKEWTKMEKI  2106
             F + DYD+HGRVK+VLMN++++DVFR+EL+YD RNRIK +K + G+        T  +KI
Sbjct  2103  FAIVDYDQHGRVKSVLMNVKNIDVFRLELDYDLRNRIKSQKTTFGRS-------TAFDKI  2155

Query  2107  TYNADGHVLEVADTENNWQYAYDENGNVIGVTEHNEKIALGYDSGDRVVQYGDVEFNSYD  2166
              YNADGHV+EV  T NNW+Y +DENGN +GV +  EK  LGYD GDRV++ GDVEFN+YD
Sbjct  2156  NYNADGHVVEVLGT-NNWKYLFDENGNTVGVVDQGEKFNLGYDIGDRVIKVGDVEFNNYD  2214

Query  2167  GRGFVVIRGEHKYRYNSRGQLIHASEHKKFQIWYFYDDRGRLVAWNDDRENITQFFYANP  2226
              RGFVV RGE KYRYN+RGQLIH+ E ++FQ WY+YDDR RLVAW+D++ N TQ++YANP
Sbjct  2215  ARGFVVKRGEQKYRYNNRGQLIHSFERERFQSWYYYDDRSRLVAWHDNKGNTTQYYYANP  2274

Query  2227  KTPDLITHIHFPKSSKTFRFLYDSRNFLMTVETSEQRFYVATDQNGSPLALFDTNGNLIK  2286
             +TP L+TH+HFPK S+T +  YD R+ L+ +E  +QR+YVATDQNGSPLA FD NG+++K
Sbjct  2275  RTPHLVTHVHFPKISRTMKLFYDDRDMLIALEHEDQRYYVATDQNGSPLAFFDQNGSIVK  2334

Query  2287  EMRRTPFGKIIKDTNPDFYLPIDFHGGLLDPNTKLVYLNKRLYDPTVGQWMTPAWEQMAN  2346
             EM+RTPFG+IIKDT P+F++PIDFHGGL+DP+TKLVY  +R YDP VGQWMTP WE +A 
Sbjct  2335  EMKRTPFGRIIKDTKPEFFVPIDFHGGLIDPHTKLVYTEQRQYDPHVGQWMTPLWETLAT  2394

Query  2347  ELTTPTDIFIYRFRNNDPINFKQNVEYMTDLASWLKLYGYDISAMLGSEYMKQMVYQPSA  2406
             E++ PTD+FIYR+ NNDPIN  +   YM DL SWL+L+GYD++ M  S Y K   Y P A
Sbjct  2395  EMSHPTDVFIYRYHNNDPINPNKPQNYMIDLDSWLQLFGYDLNNMQSSRYTKLAQYTPQA  2454

Query  2407  TITSPQLTPDFGVMSGLQCIVNRVHEKFSDLGFVPKPLLKLEPKTRNLLPRVAHRRAVFG  2466
             +I S  L PDFGV+SGL+CIV +  EKFSD  FVPKPLLK+EPK RNLLPRV++RR VFG
Sbjct  2455  SIKSNTLAPDFGVISGLECIVEKTSEKFSDFDFVPKPLLKMEPKMRNLLPRVSYRRGVFG  2514

Query  2467  EGILVSRVGGRSLVSVVDGVNSVVQDVVTSVFNNSYFLPLHFSVHDQDVFYFVKDNALKI  2526
             EG+L+SR+GGR+LVSVVDG NSVVQDVV+SVFNNSYFL LHFS+HDQDVFYFVKDN LK+
Sbjct  2515  EGVLLSRIGGRALVSVVDGSNSVVQDVVSSVFNNSYFLDLHFSIHDQDVFYFVKDNVLKL  2574

Query  2527  RDDMEELRRLGGMFNVSTHETTEHGAGTWKELRLHNPDAAVVIKYGADPEQERHRILKHA  2586
             RDD EELRRLGGMFN+STHE ++HG    KELRLH PDA V+IKYG DPEQERHRILKHA
Sbjct  2575  RDDNEELRRLGGMFNISTHEISDHGGSAAKELRLHGPDAVVIIKYGVDPEQERHRILKHA  2634

Query  2587  HKRAVERAWEIEKQLVMAGFQGRGDWSKEEKDELISRGTVSGYEGVDIHSVHRYPQLADD  2646
             HKRAVERAWE+EKQLV AGFQGRGDW++EEK+EL+  G V G+ G+DIHS+H+YPQLADD
Sbjct  2635  HKRAVERAWELEKQLVAAGFQGRGDWTEEEKEELVQHGDVDGWNGIDIHSIHKYPQLADD  2694

Query  2647  PGNVAFTRDTKRKRRKSGN  2665
             PGNVAF RD KRKRRK+G+
Sbjct  2695  PGNVAFQRDAKRKRRKTGS  2713


>TENA_DROME unnamed protein product
Length=3004

 Score = 1120 bits (2897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 514/1029 (50%), Positives = 698/1029 (68%), Gaps = 45/1029 (4%)

Query  410   SIKKEVTHYMEPGHWFLSLYNDDGDPQEVSFIAMIAEDMTHNCPNGCSGKGECLLGHCQC  469
             ++   +  Y++ G WF+S+YND+     VS +A  AE ++  CPN CSG+G C LG C C
Sbjct  518   TVNVSLLQYLDTGLWFISVYNDELVAHSVSLLAEEAEGVSTTCPNDCSGRGSCYLGKCDC  577

Query  470   NPGFGGEDCSESVCPVLCSQRGEYINGECQCNPGWKGKECSLRHDECEVPDCNGHGHCTN  529
               G+ G DCS+SVCPVLCS  G Y  G C C  GWKG EC +   ECEVP+C+ HG C  
Sbjct  578   IDGYQGVDCSKSVCPVLCSAHGHYGGGVCHCEEGWKGAECDIPVGECEVPNCSSHGRCIE  637

Query  530   GKCNCVRGYKGKYCEEVDCPHPTCSGHGFCAEGTCICKKGWKGADCSQMDKEALQCLPDC  589
             G+C+C RG+KG YC++ DC  P CSGHG C  G C CK GW+G DC  +D++  QCLP C
Sbjct  638   GECHCERGWKGPYCDQHDCLDPLCSGHGTCVAGQCYCKAGWQGEDCGTIDQQVYQCLPGC  697

Query  590   SGHGNFDLETQTCLCEPMWSGDDCSKELCDLDCGPHGHCVDNACDCLPGWSGELCNLKQC  649
             S HG +DLET  C+CE  W+G DCS+ +C LDCG +G C    C C  GW+G LC+   C
Sbjct  698   SEHGTYDLETGQCVCERHWTGPDCSQAVCSLDCGRNGVCESGKCRCNSGWTGNLCDQLPC  757

Query  650   DPRCNEHGQCKNGTCLCVTGWNGKHCTMEGCPNSCSGHGQCRVGNDGQWECRCYDGWDGK  709
             D RC+EHGQCKNGTC+C  GWNG+HCT+ GC N CS HGQC + N G++ C C +GW G+
Sbjct  758   DSRCSEHGQCKNGTCVCSQGWNGRHCTLPGCENGCSRHGQCTLEN-GEYRCDCIEGWAGR  816

Query  710   DCNVLLEQNCNDGRDNDKDGLIDCADPECCSNHICRSSQLCVSAPKPIDILLRKQPPAIT  769
             DC++ LE NC D  DND DG+ DC+D ECCS+  C    +C+S+  P+++LLRKQPP++T
Sbjct  817   DCSIALELNCKDNIDNDGDGMTDCSDSECCSHPACSEHIMCLSSNDPVEVLLRKQPPSVT  876

Query  770   ASFFERMKFLIDEGSLQNYARQETFNESMFWNHFNTSRSAVVRGRVVTHLGTGLMGVRVS  829
             ASF++R+KFLI+E S+Q+YA  + ++E         +R +V+RG+V+T  G G++G+RVS
Sbjct  877   ASFYQRVKFLIEENSVQSYAHMDEYSE---------NRVSVMRGQVITPQGLGIVGIRVS  927

Query  830   TSTPLE-GFTLTRDDGWFDLLVNGGGAVTLQFGRSPFKPQSHIVFVPWNEVVIIDKIVMS  888
                    GFTLTR  GWFD+LVNGGGAVTLQF RSPF+P +  VFVPWN +V++  + M 
Sbjct  928   VDRDSRFGFTLTRQGGWFDVLVNGGGAVTLQFQRSPFRPLTRTVFVPWNRIVVLPPVQMQ  987

Query  889   TAEEKQTS-----------------HIPY-----------ACAAHDYDLMKPVVLATWKH  920
              +++ +T+                  I Y            C  HD++ ++P +++TW  
Sbjct  988   LSDDDETTSRNIKVAPLNPALTFLNSIHYHTADEANDASKVCMDHDHEKLRPQLISTWMP  1047

Query  921   GFQGACPDKSAILAESQVIQESLQIPGTGLNLVYHSSRAAGYLSTIQLQLTPEVIPPTLN  980
                GA P K  I AE+Q++QES+QIPG+ L+L Y SS+A+GYLS ++++LT E IPPTL 
Sbjct  1048  NGVGAMPGKRVIFAETQIVQESIQIPGSDLHLTYQSSQASGYLSIVRMRLTGETIPPTLT  1107

Query  981   LIHLRITIEGILFEKTFEADPVIKFTYAWNRLNVYRQRVYGVTTAMVKVGYEYNDCKDII  1040
              +H+ + IEG L  KT+EADP +  T+AWN+ NVYRQ+VYGVT A + VGY+++ C+  +
Sbjct  1108  HVHVGVEIEGALHVKTYEADPSLVHTFAWNKRNVYRQKVYGVTVARISVGYQHSTCQSPV  1167

Query  1041  WDVQTTKLSGHDMSISEVGGWNLDIHHRYNFHEGILQKGDGSNIYLKQKPRVILTTMGDG  1100
             W  QT KL G+D+ IS++GGW LDIHH YNFHEGILQKGDGS +++K+ PR +   MG G
Sbjct  1168  WIAQTAKLQGYDVDISDIGGWGLDIHHHYNFHEGILQKGDGSTLHMKEYPRTVKVVMGTG  1227

Query  1101  HQRSLDCYD-CDRQAEASNQRLLAPVALATASDGSIFVGDFNLVRKILVDGTVRTVVRLN  1159
              QR L C D C+    A + +LL P+ALAT  DGS++VGDFNLVR+I  DG V T+++L+
Sbjct  1228  LQRPLTCPDYCN--GVAKDAKLLTPIALATGPDGSLYVGDFNLVRRITPDGKVYTILQLS  1285

Query  1160  ATRVSYRYHIALSPLDGSLYISDPESHQIIRVRDTNDYSEPDHNWETVVGSGERCLPGDE  1219
             AT+VSY+Y++A+SP DG LYISDPE HQI+R+       +P  N + VVGSG+RC+PGDE
Sbjct  1286  ATQVSYQYYLAVSPADGHLYISDPERHQILRLVRLEKVKDPSINSDPVVGSGQRCIPGDE  1345

Query  1220  AHCGDGALARDAKLAYPKGVAVSADNVLYFADGTNIRMVDRDGIITTVIGNHMHKSHWKP  1279
              +CGDG  A  A+L++PKG+A++AD  +Y ADGTNIR VD  G+I T+IG+H H +HW P
Sbjct  1346  GNCGDGGPALLARLSHPKGLAIAADRTMYIADGTNIRAVDPKGVIHTLIGHHGHHNHWSP  1405

Query  1280  IPCEGTLNVEEVHLRWPTELAINPLDNSLHMIDDHMVLQLAPDGRVKVVAGRPLHCASPS  1339
              PC GTL   +  L+WPT LA++PLD SLH IDD +VL+L  D +++VVAG PLHC++  
Sbjct  1406  APCSGTLMANQAQLQWPTGLALSPLDGSLHFIDDRLVLRLTSDMKIRVVAGTPLHCSNGG  1465

Query  1340  SSFDT-ELATHATLVMPQSIAFGPSGNLYIAESDSQRINRVRVIGTDGKISPYAGAESKC  1398
                   +      L    ++AF P GNLYIA+SDS+R+N +RV+ T G +  +AG +   
Sbjct  1466  QDGRVNKTGADNVLGTVLAMAFSPFGNLYIADSDSRRVNSIRVVDTAGNMRYFAGKQEGT  1525

Query  1399  NCLERGCDC  1407
                 + CDC
Sbjct  1526  G--SQTCDC  1532


 Score = 729 bits (1881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/1321 (32%), Positives = 699/1321 (53%), Gaps = 106/1321 (8%)

Query  1409  DADHYLASTSKFNTISAVAVSPDGVVHIGDQANYRIRSVMASIPDASGAREYEIYSPDTQ  1468
             +A+  L+S ++F  ISA+AV+ DGV+++ DQ +  + ++   +P      E+ I  P + 
Sbjct  1677  NAETLLSSNARFQAISAIAVAQDGVINVADQGSLHVLALEHYLPSHDENGEFHIPFPPSS  1736

Query  1469  EIYVFNRFGQHVATKNILTGEIVYQFTYNVNTSNGKLSTVTDAAGNKVFLLRDYSSQVNS  1528
             EIYVFNR+GQHVATK++ +G+  Y F Y+ NTS G+LSTVTDA+GNK+  LRDYS+ V+S
Sbjct  1737  EIYVFNRYGQHVATKDLTSGKTRYSFLYSKNTSFGRLSTVTDASGNKIQFLRDYSNVVSS  1796

Query  1529  IENTKGQKCRLRMSRMKMLHELSTPDNYNVTFDYHGPTGLLKTKLDSTGRSYVYNYDEFG  1588
             IENT+  K  ++++ + ++ +LS      +  DY   TGLL ++  S G +Y+Y YDEFG
Sbjct  1797  IENTQDHKSEIQINGIGIMTKLSEKGRQEIELDYDSNTGLLNSR-SSGGETYIYQYDEFG  1855

Query  1589  RLTSAVTPTGKVISLTFDLS-LKGAVVKVGQN-----NRKPIS-----MLIKGS--SVVT  1635
             R+T  + P+G+++ +T  L+  +G  V V  +     +R+ I+     +L+ G   S   
Sbjct  1856  RVTGMILPSGEIVRITSQLADSQGLTVYVHASVESLFSRERIAGEANELLVLGGVRSTFL  1915

Query  1636  KVGEAEQRTTVLSDGSVGQVTPWAHTVSTDTLPYSVLAEIEPLLGESYPVPAK-------  1688
             K G+A     + ++ ++       H  +   +  S +A   PLL  + PV A+       
Sbjct  1916  KRGQAHADAELKANNTL-----VIHGDNGVVVEASAVAR-HPLLEAALPVEAEMLAMWSH  1969

Query  1689  QRTEIAGDLANRFEWRYFLRKFQGNKYRSESKTVAQVGRKLRINGDILLSLEYDRETNSV  1748
             Q   +   L N     Y L        R+  +T   + R++ +N   ++ +E+D+ TN  
Sbjct  1970  QSVTMGEGLTNSMYSVYSLV----GDVRNPQQT---LNREIWVNQSRVIGVEFDQFTNRE  2022

Query  1749  AVFMDDDAELLNVTYDRTARPVKWGPRNGIFSGVELEYDRFSRLTSWTWGDISETYGFDR  1808
               +      +L V YD++  P  + P NG    V + YDRF+R+  W WG     Y +DR
Sbjct  2023  TFYDARRTPILIVAYDQSGLPKSYYPTNGY--PVNITYDRFNRVEGWAWGPAELKYSYDR  2080

Query  1809  AGRLYEIKYSDGTSMVYAFKDMFSSLPLKVTTPRGSDYLLQYDEAGALQSLTTPRGHIHA  1868
              G L EI       + + + D      + + + R   ++LQYD+AG L+ +  P G  H+
Sbjct  2081  HGLLSEITSQQDGIVSFVYNDWNLVSEIGLASQR--KFVLQYDDAGGLRHVVLPSGTRHS  2138

Query  1869  FSLQTSLGFYKYQYYSPMNRHPYEILYNDDGQILAKVYPHQSGKVAYVYDHTGKLETTLA  1928
             FS+QTS+GF +  Y  P +   Y   Y+  G +L  + P    ++ Y Y+  G+L   + 
Sbjct  2139  FSMQTSIGFIRCTYTPPGSTRAYLQHYSHAGALLQTILPGDGARIVYRYNAAGQLTEVVH  2198

Query  1929  GLSSIHYTYQETTSLVHSIDINEPNFEMRIEYKYHAGIVKDEKIKFGSKSGLDNARYRYQ  1988
             G     + Y E T +  ++   E   E R +++Y AG++ +E+I + +K+GL NA++ Y+
Sbjct  2199  GDGRSEFQYNEATGMPSTVSHTERELEYRWDFEYAAGLLAEERIDYVAKTGLSNAKFSYE  2258

Query  1989  YDGNARISGIEVDINGKQLPQLRLKYNQNLGILEGVGDLRIYRNLFNRSVMQDSSKQFFT  2048
             YD   R+  ++  I G+ LP     Y+   G    +G  R  +   N++ + D +  F  
Sbjct  2259  YDSQLRVVALQGRIGGQSLPTQAFAYDPRTGRPSLIGQFRFSQPAQNQTQLHDGTASFTR  2318

Query  2049  VTDYDEHGRVKT--VLMNIRSLDVFRMELEYDNRNRIKMRKLSIGKDAMEKKEWTKMEKI  2106
               D    GR +T  + + I  L+VFRME  Y    RI   +       M    +T ++  
Sbjct  2319  TVD----GRFQTQRMALAIHRLEVFRMEFSYGVHGRISQTRTYTRN--MAVNSYTNVKNY  2372

Query  2107  TYNADGHVLEVADTENNWQYAYDENGNVIGVTEHNEKIALGYDSGDRVVQYGDVEFNSYD  2166
             T++ DG ++ V + +  W + YD+NGN++ +T     I + Y++ DR+V++G+ ++  YD
Sbjct  2373  TWDCDGQLVGV-EAQEPWGFRYDDNGNLLSLTYRGNTIPMEYNAQDRIVKFGEGQYK-YD  2430

Query  2167  GRGFVVIRG-EHKYRYNSRGQLIHASEHKKFQIWYFYDDRGRLVAWNDDRENITQFFYAN  2225
              RG V     E ++ YN++G L+ AS+  +F + Y+YD   RL    D+  N+TQFFY N
Sbjct  2431  ARGLVAQNAREERFHYNTQGLLVRASKRGRFDVRYYYDHLKRLTTRKDNFGNVTQFFYTN  2490

Query  2226  PKTPDLITHIHFPKSSKTFRFLYDSRNFLMTVETSEQRFYVATDQNGSPLALFDTNGNLI  2285
              + P  ++ I+ P+  K     YD    L+  +    ++YVATDQ+G+PL LF+  G  I
Sbjct  2491  QQRPYEVSQIYSPRDGKLMSLTYDDVGHLIYAQVYRHKYYVATDQSGTPLMLFNQYGEGI  2550

Query  2286  KEMRRTPFGKIIKDTNPDFYLPIDFHGGLLDPNTKLVYL-NKRLYDPTVGQWMTPAWEQM  2344
             +E+ R+PFG I+ D+NP  YLPIDF GG+LD  T LV++ + R+YDP +GQWM+P W+++
Sbjct  2551  REIMRSPFGHIVYDSNPYLYLPIDFCGGILDQVTTLVHMGDGRVYDPLIGQWMSPDWQRV  2610

Query  2345  ANELTTPTDIFIYRFRNNDPINFKQNVEYMTDLASWLKLYGYDISAMLGSEYMKQMVYQP  2404
             A  + TPT + +YRF  NDPIN      Y  D A+W++  GY++  ++    + + ++QP
Sbjct  2611  AERIITPTRLHLYRFNGNDPINVGHERHYPEDFAAWMRTLGYNVGNLV--PQLARDLWQP  2668

Query  2405  SATITSPQLT-------------PDFGVMSGLQCIVN-RVHEKFSDLGFVPKPLLK---L  2447
              A    P                P   V SG    +N R    F  L   P+  LK   +
Sbjct  2669  PALWGRPPANPVALNLRRPFDNIPTMAVESGFLAHLNVRRMSDFEQLSAPPRSALKCDVM  2728

Query  2448  EPKTRNLLPRVAHRRAVFGEGILVSRVG-GRSLVSVVDGVNSVVQDVVTSVFNNSYFLPL  2506
             +P  + +    +     FG+GI+VSR   G+++VS V   N++ +DV TSVFN S  LP 
Sbjct  2729  DPSPKTI---GSDTEPPFGKGIVVSRTADGQAIVSSVPAANAIYRDVYTSVFNRSKLLPF  2785

Query  2507  HFSVHD--QDVFYFVKDNALKIRDDMEELRRLGGMFNVSTHETTEHG-------------  2551
              F VH+  QD F+FVK++A +  +D ++L+RL G  N + HE T                
Sbjct  2786  TFVVHNAQQDSFFFVKEDAWRATEDRQQLKRLQGQVNTTFHEITREATVGSGPAGAANGG  2845

Query  2552  ------------------AGTWKELRLHNPDAAVVIKYGADPEQERHRILKHAHKRAVER  2593
                                G + ++++H   A + ++YG    +E+ R++ HA   AV +
Sbjct  2846  AGSSSSSSSSSGGGSSSNTGNYLDVKIHGAHAIINLRYGTTVAKEQQRLMHHAKLTAVRK  2905

Query  2594  AWEIEKQLVMAGFQGRGDWSKEEKDELISRGTVSGYEGVDIHSVHRYPQLADDPGNVAFT  2653
             AW  EK+ + +G     +WS++E DE++ +   + YEG  IH V+ YP+LA+DP N+ F 
Sbjct  2906  AWHREKEALRSGLTTALEWSQQETDEILKQSYANNYEGEYIHDVNLYPELAEDPYNIKFV  2965

Query  2654  R  2654
             +
Sbjct  2966  K  2966


 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 35/54 (65%), Gaps = 0/54 (0%)

Query  341  IPPYSYWNMQFYQSEAAYVRFDYNIPRGASIGVYARRNALPTHTQYDLLEVLSG  394
            IP Y +W ++F     A++RF++ +P GA   VY+RRN  P+ TQ+D +E + G
Sbjct  367  IPAYQFWTLEFRNKHPAFIRFNFTLPWGAHFAVYSRRNVAPSVTQHDFVEFIKG  420


 Score = 33.5 bits (75),  Expect = 4.0, Method: Compositional matrix adjust.
 Identities = 15/42 (36%), Positives = 23/42 (55%), Gaps = 0/42 (0%)

Query  230  CSWKLIAMILLMVSLCITAALCYVIVSSIVNRSYQSTKACAV  271
            CSWK +++ L+ VS+ +TA L Y    S +  +  ST    V
Sbjct  162  CSWKCLSIALIFVSVVLTAMLAYFAAVSSMKPNMDSTNCILV  203


>H1ZUX1_CAEEL unnamed protein product
Length=2763

 Score = 798 bits (2061),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 667/2537 (26%), Positives = 1138/2537 (45%), Gaps = 344/2537 (14%)

Query  319   RSFPPDGTTFAQVGLGQKLSKEIPPYSYWNMQFYQSEAAYVRFDYNIPRGASIGVYARRN  378
             R+ PP       + LG+++  E  P S    +   ++ + +RF+  +  GA + +     
Sbjct  349   RALPP------AISLGERVDVEFFPKSMATTELTVTKPSRIRFNATVGSGAQLVLLMSAG  402

Query  379   ALPTHTQYDLL---------------EVLSGFKARTTRA--------SHVSVIPSIKKEV  415
               P+ + +D L                ++  F +R+ R+         ++ ++       
Sbjct  403   VHPSLSLHDALFPIRADRIRDSKSPTHIVEEFGSRSRRSLGASSSRHRNIEILSPRSATF  462

Query  416   THYMEPGHWFLSLYNDDGDPQEVSFIAMIAEDMTHN---------------------CPN  454
               ++  G  +L+  N+    + +SF+A   +  T                       C +
Sbjct  463   EQFVLEGRHYLTFINERSRVEPISFVAEELQRPTTPPKTSSSGTSGAKEHPLASVLVCES  522

Query  455   GCSGKGECLLGHCQCNPGFGGEDCSESVCPVLCSQRGEYINGECQCNPGWKGKECSLRHD  514
              C+ +GEC+ G C C PGF G  C E+VCPV+CS  G +  G C C  G+KGKEC +RH+
Sbjct  523   NCNQRGECVHGKCHCAPGFTGRTCDEAVCPVVCSGNGVFSGGICVCKSGFKGKECEMRHN  582

Query  515   ECEVPDCNGHGHC-TNGKCNCVRGYKGKYCEEVDCPHPTCSGHGFCAEGTCICKKGWKGA  573
              CEV DCNG G C T+G+C C  G+ G+ CE   CPH +C   G C  GTC C  GW+G 
Sbjct  583   WCEVADCNGRGRCDTDGRCRCNPGWTGEACELRACPHASCHDRGVCVNGTCYCMDGWRGN  642

Query  574   DC--------------------------SQMDKEALQCLPD-------------------  588
             DC                          S+  K  ++  P                    
Sbjct  643   DCSVFADAIVHVPQAQSPPRRGQEPTESSKTRKAQVKPTPTSEKKKESRELQKPIIATVQ  702

Query  589   --------CSGHGNFDLETQTCLCEPMWSGDDCSKELCDLDCGPHGHCVDN-ACDCLPGW  639
                     CS HG   L    C CE  W   DCS++ C      +G C+D+ +C C  GW
Sbjct  703   VPTESSHPCSAHGQ--LIDDICQCESGWDSVDCSQQACQC---VNGDCLDDGSCQCWKGW  757

Query  640   SGELCNLKQCDPRCNEHGQC-KNGTCLCVTGWNGKHCTMEGCPNSCSGHGQCRVGN-DGQ  697
              G  C  K+C   C + G+C  +G+C C +GWNG++C ++GCPN CSG G+C +     +
Sbjct  758   RGSNCTDKKCAIGCEDRGKCASDGSCKCSSGWNGENCAIDGCPNQCSGKGECGMDRRSSE  817

Query  698   WECRCYDGWDGKDCNVLLEQNCNDGRDNDKDGLIDCADPECCSNHICRSSQLCVSAPKPI  757
             W CRC  G  G DC+V +E +C+DG DND DGLIDC DPECCS+  C S  +C +A  PI
Sbjct  818   WSCRCQAGSTGVDCSVSVEMHCDDGLDNDSDGLIDCDDPECCSSSSCSSESVCSTAASPI  877

Query  758   DILLRKQPPAITASFFERMKFLIDEGSLQNYARQETFNESMFWNHFNTSRSAVVRGRVV-  816
             ++L+R  PP   A+F +R+ FLI E S+Q+Y     FNE++          +V+RGRV+ 
Sbjct  878   EVLMR-MPPIFNANFAQRVGFLIMEKSVQSYTDSSQFNENLI---------SVIRGRVMW  927

Query  817   -------THLGT-------GLMGVRVSTST-PLEGFTLTRDDGWFDLLVNGGGAVTLQFG  861
                      L T        L+GVRVS +  PL GFTLTR+DG+FDL VNG  +VTLQF 
Sbjct  928   GGSPTGSDDLSTYSNKSTVPLVGVRVSDAAHPLYGFTLTREDGYFDLTVNGARSVTLQFL  987

Query  862   RSPFKPQSHIVFVPWNEVVIIDKIVMSTAEEKQTSHIPYA-----CAAHDYDLMKPVVLA  916
             R+ F+     VFV   +++ ID IV+          I  A     C+     +   V+++
Sbjct  988   RTQFQSVKKSVFVSPRQIIHIDDIVLYRQSGGSPPAISMAPARAKCSPTLRRIPDVVLIS  1047

Query  917   TWKHGFQG----ACPDKSAILAESQVIQESLQIPGTGLNLVYHSSRAAGYLSTIQLQLTP  972
              W++   G       D S I+ +S+ I ESL I GT + LVY S+R+    ST+ + L  
Sbjct  1048  NWQYTSDGIETDETSDSSRIVVDSRSIFESLPIQGTDVRLVYDSARSPAAPSTMLIGLLY  1107

Query  973   EVIPPTLNLIHLRITIEGILFEKTFEADPVIKFTYAWNRLNVYRQRVYGVTTAMVKVGYE  1032
             + +   L  +H+ I I G  F++       + + +AW+++N YRQ   G+    V+VGYE
Sbjct  1108  DRVDKELRKVHINIRIAGRRFDRVLAPRTNLTYVFAWDKMNAYRQSESGLVPVTVRVGYE  1167

Query  1033  YNDC---KDIIWDVQTTKLSGHDMSISEVGGWNLDIHHRYNFHEGILQKGDGS-NIYLKQ  1088
             Y  C    + +W  + +++ G          W LDIHH  +    +++ G+G   +  + 
Sbjct  1168  YQGCDRTSERVWQTRRSQMMGATARKMIGTMWTLDIHHHLDIVNNVVEMGNGGYRLITES  1227

Query  1089  KPRVILTTMGDGHQRSLDCYDCDRQAEASNQRLLAPVALATASDGSIFVGDFNLVRKILV  1148
             +PRV      DG +R ++C  C+ + ++ +  L  P  +  A DGS+ +GD N++R++  
Sbjct  1228  EPRVSTFAGLDGVKRDVECLKCEGKVDSIS--LFRPTTVVYAQDGSLIIGDHNMIRRVSQ  1285

Query  1149  DGTVRTVVRLNATRVSYRYHIALSPLDGSLYISDPESHQIIRVRDTNDYSEPDHNWETVV  1208
             DG V T++ L     S+ Y+IA+SP+DG++ IS P   Q+ R+  + +  +  +N++ + 
Sbjct  1286  DGQVSTILTLGLADTSHSYYIAVSPVDGTIAISLPLHKQVWRI-SSLEPQDSRNNYDVLA  1344

Query  1209  GSGERCLPGDEAHCGDGALARDAKLAYPKGVAVSADNVLYFADGTNIRMVDRDGIITTVI  1268
             G G  C    ++ CGDGALA++A+L +PKG++      LY AD   IR++D  G I + I
Sbjct  1345  GDGTVCASAVDS-CGDGALAQNAQLIFPKGISFDKMGNLYLADSRRIRVIDTTGHIRS-I  1402

Query  1269  GNHMHKSHWKPI-PCEGTLNVEEVHLRWPTELAINPLDNSLHMIDDHMVLQLAPDGRVKV  1327
             G      H  PI  C     + ++ + WPT L I+P+  S+ ++D ++V ++     V  
Sbjct  1403  GETTPDQH--PIRTCAQITKLVDLQMEWPTSLTIDPITGSVLVLDTNVVYEIDVVHDVVT  1460

Query  1328  VA-GRPLHC--ASPSSSFDTELATHATLVM--PQSIAFGPSGNLYIAESDSQRINRVRVI  1382
             +A G P  C  A+ +SS   +   H   ++   + I  G  G +Y+ ESD +R+N+VR +
Sbjct  1461  IALGSPTTCDLANATSSASAKSLDHRRHLIQNARDITVGTDGAIYVVESDGRRLNQVRKL  1520

Query  1383  GTD-GKISPYAGAESKCNCLERGCDCFDA---DHYLASTSKFNTISAVAVSPDGVVHIGD  1438
              +D    S   G +S C+C    C C DA       AS +  ++  AV VSP G V I D
Sbjct  1521  SSDRSTFSILTGGKSPCSCDVAACGCDDAVSLRDVAASQAHLSSPYAVCVSPSGDVIIAD  1580

Query  1439  QANYRIRSVMASIPDASG-AREYEIYSPDTQEIYVFNRFGQHVATKNILTGEIVYQFTYN  1497
               N +I+ V A +    G +R YE+   + QE Y FNR GQH +T +++TG   + F+Y 
Sbjct  1581  SGNSKIKKVSARMAKYDGRSRTYEVTDAERQEKYTFNRHGQHSSTVSLITGRTFFNFSYQ  1640

Query  1498  VNTSNGKLSTVTDAAGNKVFLLRDYSSQVNSIENTKGQKCRLRMS----RMKMLHELSTP  1553
             V++    +S +  A+G  + +L+   S  + +E T GQ+  L MS     ++ + +  + 
Sbjct  1641  VDSPISMISEIRAASGVVLRVLKRNDSLFD-LETTLGQRTTLTMSAYDGTLEQVSKRDSA  1699

Query  1554  DNYNVTFDYHGPTGLLKTKLDSTGRSYVYNYDEFGRLTSAVTPTGKVISLTFDLS---LK  1610
              + + T  ++   GLL +++D    +  + YDE+GR           I L  D     L 
Sbjct  1700  TSRDATKLFY-KKGLLTSRID-VATAVGFEYDEYGR----------AIGLKRDREYWRLG  1747

Query  1611  GAVVKVGQNNRKPI--------SMLIKGSSVVTKVGEAEQRTTVLSDGSVGQVTPWAHTV  1662
                + +G  N + +          L +G+  V     A  R   L +      +P    +
Sbjct  1748  EETISMGSVNTEVLLNGQRFQQVRLGEGNLAVHSTNGATTRLISLRNEGYSLASP----L  1803

Query  1663  STDTLPYSVLAEIEPLLGESYPVPAKQRTEIAG-------DLANRFEWRYFLRKFQGNKY  1715
              T TL Y   + I    GE  P+ +++RT++         +L  R++WR+  R+   +  
Sbjct  1804  GTSTL-YDKSSSIPDSNGE--PLISRRRTKVPAIGNPQRRELTTRWDWRHVARRGDDSDG  1860

Query  1716  RSESKTVAQVGRKLRINGDILLSLEYDRETNSVAVFM----DDDAELLNVTYDRTARPVK  1771
                 + VA+      ING  + S+EYD ++N   + +    DD   LL + Y  + R  +
Sbjct  1861  SLGRRKVAE------INGVNMFSMEYDVKSNQDTLRLGSTTDDAQALLFIDYTSSGRIRR  1914

Query  1772  W-GPRNGIFSGVELEYDRFSRLTSWTWGDISETYGFDRAGRLYEIKYSDGTSMVYAFKDM  1830
                P +   + + + +D   R +  TWG       +D + RL E    DG  +       
Sbjct  1915  ISAPEDSQMAEMNITWDGAGRKSEVTWGSWKIRLTYDNSNRLTEHAI-DGARVPIKMSYA  1973

Query  1831  FSSLPLKVTTPRGSDYLLQYDEAGALQSLTTPRGHIHAFSLQTSLGFYKY--QYYSPMNR  1888
              +S         G+ + +QYD    ++ + +      +FS   +LG  ++  +  + +N 
Sbjct  1974  GASRRPNEIQHDGAKWNIQYDNYDRIKEVISKSQEATSFS-SIALGGDEWVLKRRTSLNS  2032

Query  1889  HPYEILYNDDGQILAKVYPHQSGKVAYVYDHTGKLETTLAGLSSIHYTYQETTSLVHSID  1948
              P  +  + +G++L    P ++        +  + +  + G ++     +ETT +     
Sbjct  2033  KPSLVRLSREGKVLESTTPDEN-------HYWLERKDPITGRTTEILNDEETTVVTCWSP  2085

Query  1949  INEP------NFEMRIEYKYHAGIVKDEKIKFGSKSGLD-NARYRYQYDGNARISGIEVD  2001
                P      N +     + H    K   I   + S     + + Y+YD   R++ I+  
Sbjct  2086  EGAPMCSRSRNLQENTTMQGHLVARKSVTIMTPTSSEPSITSSFTYEYDDMLRVTTIQPV  2145

Query  2002  INGKQLPQLRLKYNQNLGILEGVGDLRIYRNLFN-----RSVMQDSSKQFFTVTDYDEHG  2056
             I    L  ++L Y++  G +  +   +  R+          +M ++SK      D+ +  
Sbjct  2146  IEQSVLESIQLSYDERRGHVAAINGFKWARDASTSRCQGHGLMYETSK----ANDHRQVV  2201

Query  2057  RVKTVLMNIR-SLDVFRMELEYDNRNRIKMRKLSIGKDAMEKKEWTKMEKITYNADGHVL  2115
               K +  + R S+ + R     D   R     L I     ++ +  K+ + T++A G   
Sbjct  2202  ERKLIFGDARASIKIIR-----DKAGRASESHLEISSSGTQRNQ--KITR-TFDAAGR--  2251

Query  2116  EVADTENNWQYAYDENGNVIGVTEHNEKIALGYDSGDRVVQYGDVEFNSYDGRGFVVIRG  2175
              VA  E N Q       N     E      + ++ G  +  + D+ +   D  G+VV R 
Sbjct  2252  -VASVEQNDQEPVRIIWNSDARVEKINDRVVEWNRGGALKTFQDISYQ-VDSIGWVVKRD  2309

Query  2176  EHK-YRYNSRGQLIHASEHKKFQIWYFYDDRGRLVAWNDDRENITQFFYANPKTPDLITH  2234
                 + Y+ +G+L+ A    + +I  FYD   R+V   + ++ I  F+Y    TP L++ 
Sbjct  2310  NTTVFGYDGKGRLVSA-RSSQLRINIFYDREDRVVQIQNSKDFI-HFYYGYIDTPKLVS-  2366

Query  2235  IHFPKSSKTFRFLYDSRNFLMTVETSE-QRFYVATDQNGSPLALFDTNGNLIKEMRRTPF  2293
              HF K+ K     YD  +    +++ +  R+ + TD+  +  A+   + N+++ + R+ F
Sbjct  2367  -HFSKNGKISTLFYDDDSVPFAMQSDDGTRYALLTDETSTIKAIIG-DSNVLRIIDRSVF  2424

Query  2294  GKIIKDTNPDF-YLPIDFHGGLLDPNTKLVYLNK-RLYDPTVGQWMTPAWE-----QMAN  2346
             G ++  ++    +LPI + GG+      +  LN  R  D    ++M+ + E     ++  
Sbjct  2425  GALLPSSSSSHPFLPIGYLGGIEISEISVSILNNGRPLDLYSERYMSISPEAVVRLELNE  2484

Query  2347  ELTTPTDIFIYRFRNNDPINFKQNVEYMTDLASWLKLYGYDISAMLGSEYMKQMVYQPSA  2406
             + +   D+      +  P   +   E   D  +W  L G                     
Sbjct  2485  KFSNSIDLMALEI-DRQPFRVENVPE---DFETWFSLAGL--------------------  2520

Query  2407  TITSPQLTPDFGV-MSGLQCIVNRVHEKFSDLGFVPKPLLKLEPKTRNLLPRVAHRRAV-  2464
                SP L P   + +     IV+R+   F      P+ L  L   T  L  R+A   ++ 
Sbjct  2521  ---SPNLLPSAHLGLPASSAIVHRLLSSF------PRKLRPLTHLTTVLPTRLASDISLT  2571

Query  2465  --------------FGEGILVSR--VGGRSLVSVVDGVNSVVQDVVTSVFNNSYFLPLHF  2508
                           F   ++++     G  +V ++  + S  ++V++ +F+    L    
Sbjct  2572  SPTSETSWSIDDVGFSNLLILNEDATTGEVMVEMLSDLKSEEREVISKLFDGVKSL----  2627

Query  2509  SVHDQDVFYFVKDNALKIRDDMEELRRLGGMFNVSTHETTEHGAGTWKE-LRLHNPDAAV  2567
                D   +  V    L         R       +S+   +       K+ + L N  + +
Sbjct  2628  ---DFATWGLVPTRHL--------WRAPNSKLELSSTSFSHFTMAVNKDSVELRNGKSKI  2676

Query  2568  VIKYGADPEQERHRILKHAHKRAVERAWEIEKQLVMAGFQGRGDWSKEEKDELISRGTVS  2627
             V+ +  +  +   +I++    R     W  E++   AG +    WS  E  EL S+G+VS
Sbjct  2677  VVHFSENKAEIVKKIVEELKTRENIAVWRAERKRAEAGEKTWRQWSDRETRELTSKGSVS  2736

Query  2628  GYEGVDIHSVHRYPQLA  2644
             GY+ +++   H+   LA
Sbjct  2737  GYD-IEMKPAHQSGLLA  2752



Lambda      K        H
   0.315    0.132    0.397 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 43955775900


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Oct 18, 2022  4:55 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_050469446.1 peptidyl-prolyl cis-trans isomerase FKBP8-like
[Bombus huntii]

Length=382
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7K3D4_DROME  unnamed protein product                                 243     3e-77
Q8I4V8_PLAF7  unnamed protein product                                 91.3    1e-20
FKB59_DROME  unnamed protein product                                  89.7    2e-19


>Q7K3D4_DROME unnamed protein product
Length=397

 Score = 243 bits (621),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 141/337 (42%), Positives = 202/337 (60%), Gaps = 11/337 (3%)

Query  55   DILGNGQLKKKVIKSGKNGT--RPNRSDICTLKIIGKLKDGTTVEEYEDLKIQLGDVEVI  112
            DILGN QL K+ IK     +  RP R ++ T+   GKL +GT VE   + +  +GD EVI
Sbjct  59   DILGNKQLIKRTIKKAPQDSFRRPIRGELVTVNFTGKLDNGTVVENELNFQCHVGDYEVI  118

Query  113  QGLDLAIALMDVNEVAEIEIDPRFAYGSLG------KEPNIPPNATILYTVELKSSELEE  166
            QGLD+ + ++ V EV+++ +D RF YGSLG       E  +PP+A + Y +EL   + EE
Sbjct  119  QGLDMVLPMLQVGEVSQVSVDSRFGYGSLGLKKEGESEYLVPPDAHLTYEIELLDIKYEE  178

Query  167  ETETLHVNQRKEIGNKKRERGNWWFTRNEPTLAIQCYRRALEFLLPTESRTSYQNEMEDT  226
              +       ++ G +K+ER N+++ R+E T AI  YRRAL+FL   +     + + ED 
Sbjct  179  FADLKSFEILRKYGTRKKERANFFYKRSEFTTAIHLYRRALDFLDNRDGDPDSEFDKEDL  238

Query  227  -TTDAELQALLEDRMKVYNNLAAAQMKTQAYDAALKSVESVLSCQPQNVKALFRKGKILH  285
              ++++ Q LLEDR+ VYNNLA  Q+K  AYDAAL+SVE VL CQP N KAL+RKG+IL 
Sbjct  239  ELSNSDTQTLLEDRLIVYNNLAMTQIKIAAYDAALQSVEHVLRCQPNNSKALYRKGRILE  298

Query  286  YKGEHALAYQTLLQAAKLEPETKAIQSELAILKEKNAKDAQHEKNLYRKMLG-AHKNDNN  344
             K +   A + L + A LEPE +A+QS+LA L  K  ++  +EK +Y+KMLG A K + N
Sbjct  299  GKADTQGAIKLLQKVATLEPENRAVQSDLARLFIKARREEHNEKEMYQKMLGQAKKMEQN  358

Query  345  YQKNTKEQKSKNSS-KLTWSLIGGATAAILSVFLYRF  380
                 K+    NS  KL   L+G     +  V +YR+
Sbjct  359  TATRQKQPLVDNSKLKLLGYLMGTILIGVAGVAIYRY  395


>Q8I4V8_PLAF7 unnamed protein product
Length=304

 Score = 91.3 bits (225),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 82/285 (29%), Positives = 132/285 (46%), Gaps = 22/285 (8%)

Query  52   EWIDILGNGQLKKKVIKSGKNGTR--PNRSDICTLKIIGKLKD-GTTVEEYED----LKI  104
            E +++  +G + K ++K G  G    P + +  T+  +GKL+  G   +   D     K 
Sbjct  8    EKVELTADGGVIKTILKKGDEGEENIPKKGNEVTVHYVGKLESTGKVFDSSFDRNVPFKF  67

Query  105  QLGDVEVIQGLDLAIALMDVNEVAEIEIDPRFAYGSLGKEPNIPPNATILYTVELKSSEL  164
             L   EVI+G D+ ++ M  NE   + I+  + YG  G   +IP N+ +L+ +EL S   
Sbjct  68   HLEQGEVIKGWDICVSSMRKNEKCLVRIESMYGYGDEGCGESIPGNSVLLFEIELLSFRE  127

Query  165  EEETETLHVNQRK-EIGNKKRERGNWWFTRNEPTLAIQCYRRALEFLLPTESRTSYQNEM  223
             +++   + ++ K +     +E GN +F +NE   AI  Y+ AL+F + TE        +
Sbjct  128  AKKSIYDYTDEEKVQSAFDIKEEGNEFFKKNEINEAIVKYKEALDFFIHTEEWD--DQIL  185

Query  224  EDTTTDAELQALLEDRMKVYNNLAAAQMKTQAYDAALKSVESVLSCQPQNVKALFRKGKI  283
             D   + E+   L        NLA    K + Y  A+     VL     NVKAL++ G  
Sbjct  186  LDKKKNIEISCNL--------NLATCYNKNKDYPKAIDHASKVLKIDKNNVKALYKLGVA  237

Query  284  LHYKGEHALAYQTLLQAAKLEPETKAIQS--ELAI--LKEKNAKD  324
              Y G    A + L +AA L P    I++  EL +  LKE   KD
Sbjct  238  NMYFGFLEEAKENLYKAASLNPNNLDIRNSYELCVNKLKEARKKD  282


>FKB59_DROME unnamed protein product
Length=439

 Score = 89.7 bits (221),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 75/282 (27%), Positives = 136/282 (48%), Gaps = 21/282 (7%)

Query  59   NGQLKKKVIKSGKNGTRPNRSDICTLKIIGKLKDGTTVEEYEDLKIQLGD---VEVIQGL  115
            +G + + ++++      P+        I G   +G   E+  D++   G+   + +I G+
Sbjct  129  DGSIDRTILEASDKKRTPSDGAFVKAHISGSF-EGRVFED-RDVEFDYGEGKAIGIIDGV  186

Query  116  DLAIALMDVNEVAEIEIDPRFAYGSLGKEP-NIPPNATILYTVELKSSELEEETETLHVN  174
            ++A+  M+V E + I+I  ++A+G+ G E   IPPNAT+ YTV+L       E   L   
Sbjct  187  EIALEKMNVGETSRIKIQAKYAFGAKGNEEFKIPPNATVEYTVKLVDCGKGLEEWKLSDE  246

Query  175  QRKEIGNKKRERGNWWFTRNEPTLAIQCYRRALEFLLPTESRTSYQNEMEDTTTDAELQA  234
            +R       +E+G  +F +    LAI+ Y +  + +LPT   T + NE        E++ 
Sbjct  247  ERLAEAKVYKEKGTNYFKKENWALAIKMYTKC-KNILPT---TVHTNE--------EVKK  294

Query  235  LLEDRMKVYNNLAAAQMKTQAYDAALKSVESVLSCQPQNVKALFRKGKILHYKGEHALAY  294
            +   ++  ++N+A    K+  +  A +    VL+    NVKAL+R+G+      E   A 
Sbjct  295  I---KVATHSNIALCHQKSNDHFEAKQECNEVLALDKNNVKALYRRGQCNLTINELEDAL  351

Query  295  QTLLQAAKLEPETKAIQSELAILKEKNAKDAQHEKNLYRKML  336
            +   +  +LEP  KA  +++ I K+K  +    EK LY  M 
Sbjct  352  EDFQKVIQLEPGNKAAANQVIICKQKLKESKNKEKKLYANMF  393


 Score = 73.2 bits (178),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/110 (32%), Positives = 60/110 (55%), Gaps = 4/110 (4%)

Query  54   IDILGNGQLKKKVIKSGKNGTRPNRSDICTLKIIGKLKDGT----TVEEYEDLKIQLGDV  109
            ID+ G+G + K+++K G     P+     +L   G+L DGT    ++   E  +  LG  
Sbjct  7    IDLSGDGGVLKEILKEGTGTETPHSGCTVSLHYTGRLVDGTEFDSSLSRNEPFEFSLGKG  66

Query  110  EVIQGLDLAIALMDVNEVAEIEIDPRFAYGSLGKEPNIPPNATILYTVEL  159
             VI+  D+ +A M + E   +   P +AYG+ G  P IPP+AT+++ +E+
Sbjct  67   NVIKAFDMGVATMKLGERCFLTCAPNYAYGAAGSPPAIPPDATLIFELEM  116



Lambda      K        H
   0.312    0.129    0.360 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4048251568


Query= XP_050469447.1 teneurin-m isoform X5 [Bombus huntii]

Length=2600
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TENM_DROME  unnamed protein product                                   3878    0.0  
TENA_DROME  unnamed protein product                                   1118    0.0  
H1ZUX0_CAEEL  unnamed protein product                                 798     0.0  


>TENM_DROME unnamed protein product
Length=2731

 Score = 3878 bits (10057),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1853/2666 (70%), Positives = 2173/2666 (82%), Gaps = 124/2666 (5%)

Query  16    LLKRPSMDYNEYTYCYGGGRGCLLDNSAPRGPPDVPPRNPTMSRV-NGRLPGSHAASDHE  74
             L  RP    N       G +G LL+   P  PPDVPPRNPTMSR+ NGRL       ++ 
Sbjct  81    LAHRPPDTANNTAQRTHGRQGFLLEGVTPTAPPDVPPRNPTMSRMQNGRL-----TVNNP  135

Query  75    RDPDLQPSCLVRTSSGGFYSIPKIPKNEYN--------NKNQSTGNSPIKVEL-------  119
              D D +PSCLVRT SG  Y    IP    N         K+ S  ++P K  L       
Sbjct  136   NDADFEPSCLVRTPSGNVY----IPSGNLNINKGSPIDFKSGSACSTPTKDTLKGYERST  191

Query  120   QNNMDRVPLPYGHAPSMIPMRRQSIRCHFVKG-VDWCS--W-------KLIAMILLMVSL  169
             Q  M  V LP     + +P    S   +F K  V  CS  W        L A +++++ L
Sbjct  192   QGCMGPV-LPQRSVMNGLPAHHYSAPMNFRKDLVARCSSPWFGIGSISVLFAFVVMLILL  250

Query  170   CITAAL-------CYVIV-----------------SSIVNRSYQSTKACAVLVGENSDTK  205
               T  +       C V+V                 S + N S ++     + + +     
Sbjct  251   TTTGVIKWNQSPPCSVLVGNEASEVTAAKSTNTDLSKLHNSSVRAKNGQGIGLAQGQSGL  310

Query  206   PLSSDGNK------TSSSATASSSQSSG----------------------------RTRQ  231
               +  G+       T ++AT++S  + G                             +  
Sbjct  311   GAAGVGSGGGSSAATVTTATSNSGTAQGLQSTSASAEATSSAATSSSQSSLTPSLSSSLA  370

Query  232   QASSGGARTFPARSFPPDGTTFAQVGLGQKLSKEIPPYSYWNMQFYQSEAAYVRFDYNIP  291
              A++GGARTFPARSFPPDGTTF Q+ LGQKL+KEI PYSYWNMQFYQSE AYV+FDY IP
Sbjct  371   NANNGGARTFPARSFPPDGTTFGQITLGQKLTKEIQPYSYWNMQFYQSEPAYVKFDYTIP  430

Query  292   RGASIGVYARRNALPTHTQYDLLEVLSGFKA--RTTRASHVSVIPSIKKEVTHYMEPGHW  349
             RGASIGVY RRNALPTHTQY   EVLSGF A  RT RA+H+S    I +EVT YMEPGHW
Sbjct  431   RGASIGVYGRRNALPTHTQYHFKEVLSGFSASTRTARAAHLS----ITREVTRYMEPGHW  486

Query  350   FLSLYNDDGDPQEVSFIAMIAEDMTHNCPNGCSGKGECLLGHCQCNPGFGGEDCSESVCP  409
             F+SLYNDDGD QE++F A +AEDMT NCPNGCSG G+CLLGHCQCNPGFGG+DCSESVCP
Sbjct  487   FVSLYNDDGDVQELTFYAAVAEDMTQNCPNGCSGNGQCLLGHCQCNPGFGGDDCSESVCP  546

Query  410   VLCSQRGEYINGECQCNPGWKGKECSLRHDECEVPDCNGHGHCTNGKCNCVRGYKGKYCE  469
             VLCSQ GEY NGEC CNPGWKGKECSLRHDECEV DC+GHGHC +GKC C+RGYKGK+CE
Sbjct  547   VLCSQHGEYTNGECICNPGWKGKECSLRHDECEVADCSGHGHCVSGKCQCMRGYKGKFCE  606

Query  470   EVDCPHPTCSGHGFCAEGTCICKKGWKGADCSQMDKEALQCLPDCSGHGNFDLETQTCLC  529
             EVDCPHP CSGHGFCA+GTCICKKGWKG DC+ MD++ALQCLPDCSGHG FDL+TQTC C
Sbjct  607   EVDCPHPNCSGHGFCADGTCICKKGWKGPDCATMDQDALQCLPDCSGHGTFDLDTQTCTC  666

Query  530   EPMWSGDDCSKELCDLDCGPHGHCVDNACDCLPGWSGELCNLKQCDPRCNEHGQCKNGTC  589
             E  WSGDDCSKELCDLDCG HG C  +AC C P W GE CN + CD RCNEHGQCKNGTC
Sbjct  667   EAKWSGDDCSKELCDLDCGQHGRCEGDACACDPEWGGEYCNTRLCDVRCNEHGQCKNGTC  726

Query  590   LCVTGWNGKHCTMEGCPNSCSGHGQCRVGNDGQWECRCYDGWDGKDCNVLLEQNCNDGRD  649
             LCVTGWNGKHCT+EGCPNSC+GHGQCRV  +GQWECRCY+GWDG DC + LE NC D +D
Sbjct  727   LCVTGWNGKHCTIEGCPNSCAGHGQCRVSGEGQWECRCYEGWDGPDCGIALELNCGDSKD  786

Query  650   NDKDGLIDCADPECCSNHICRSSQLCVSAPKPIDILLRKQPPAITASFFERMKFLIDEGS  709
             NDKDGL+DC DPECC++H+C++SQLCVSAPKPID+LLRKQPPAITASFFERMKFLIDE S
Sbjct  787   NDKDGLVDCEDPECCASHVCKTSQLCVSAPKPIDVLLRKQPPAITASFFERMKFLIDESS  846

Query  710   LQNYARQETFNESMFWNHFNTSRSAVVRGRVVTHLGTGLMGVRVSTSTPLEGFTLTRDDG  769
             LQNYA+ ETFNES         RSAV+RGRVVT LG GL+GVRVST+T LEGFTLTRDDG
Sbjct  847   LQNYAKLETFNES---------RSAVIRGRVVTSLGMGLVGVRVSTTTLLEGFTLTRDDG  897

Query  770   WFDLLVNGGGAVTLQFGRSPFKPQSHIVFVPWNEVVIIDKIVMSTAEEKQTS-HIPYACA  828
             WFDL+VNGGGAVTLQFGR+PF+PQS IV VPWNEVVIID +VMS +EEK  +    + C 
Sbjct  898   WFDLMVNGGGAVTLQFGRAPFRPQSRIVQVPWNEVVIIDLVVMSMSEEKGLAVTTTHTCF  957

Query  829   AHDYDLMKPVVLATWKHGFQGACPDKSAILAESQVIQESLQIPGTGLNLVYHSSRAAGYL  888
             AHDYDLMKPVVLA+WKHGFQGACPD+SAILAESQVIQESLQIPGTGLNLVYHSSRAAGYL
Sbjct  958   AHDYDLMKPVVLASWKHGFQGACPDRSAILAESQVIQESLQIPGTGLNLVYHSSRAAGYL  1017

Query  889   STIQLQLTPEVIPPTLNLIHLRITIEGILFEKTFEADPVIKFTYAWNRLNVYRQRVYGVT  948
             STI+LQLTP+VIP +L+LIHLRITIEGILFE+ FEADP IKFTYAWNRLN+YRQRVYGVT
Sbjct  1018  STIKLQLTPDVIPTSLHLIHLRITIEGILFERIFEADPGIKFTYAWNRLNIYRQRVYGVT  1077

Query  949   TAMVKVGYEYNDCKDIIWDVQTTKLSGHDMSISEVGGWNLDIHHRYNFHEGILQKGDGSN  1008
             TA+VKVGY+Y DC DI+WD+QTTKLSGHDMSISEVGGWNLDIHHRYNFHEGILQKGDGSN
Sbjct  1078  TAVVKVGYQYTDCTDIVWDIQTTKLSGHDMSISEVGGWNLDIHHRYNFHEGILQKGDGSN  1137

Query  1009  IYLKQKPRVILTTMGDGHQRSLDCYDCDRQAEASNQRLLAPVALATASDGSIFVGDFNLV  1068
             IYL+ KPR+ILTTMGDGHQR L+C DCD QA  + QRLLAPVALA A DGS+FVGDFN +
Sbjct  1138  IYLRNKPRIILTTMGDGHQRPLECPDCDGQA--TKQRLLAPVALAAAPDGSLFVGDFNYI  1195

Query  1069  RKILVDGTVRTVVRLNATRVSYRYHIALSPLDGSLYISDPESHQIIRVRDTNDYSEPDHN  1128
             R+I+ DG++RTVV+LNATRVSYRYH+ALSPLDG+LY+SDPESHQIIRVRDTNDYS+P+ N
Sbjct  1196  RRIMTDGSIRTVVKLNATRVSYRYHMALSPLDGTLYVSDPESHQIIRVRDTNDYSQPELN  1255

Query  1129  WETVVGSGERCLPGDEAHCGDGALARDAKLAYPKGVAVSADNVLYFADGTNIRMVDRDGI  1188
             WE VVGSGERCLPGDEAHCGDGALA+DAKLAYPKG+A+S+DN+LYFADGTNIRMVDRDGI
Sbjct  1256  WEAVVGSGERCLPGDEAHCGDGALAKDAKLAYPKGIAISSDNILYFADGTNIRMVDRDGI  1315

Query  1189  ITTVIGNHMHKSHWKPIPCEGTLNVEEVHLRWPTELAINPLDNSLHMIDDHMVLQLAPDG  1248
             ++T+IGNHMHKSHWKPIPCEGTL +EE+HLRWPTELA++P+DN+LH+IDDHM+L++ PDG
Sbjct  1316  VSTLIGNHMHKSHWKPIPCEGTLKLEEMHLRWPTELAVSPMDNTLHIIDDHMILRMTPDG  1375

Query  1249  RVKVVAGRPLHCASPSSSFDTELATHATLVMPQSIAFGPSGNLYIAESDSQRINRVRVIG  1308
             RV+V++GRPLHCA+ S+++DT+LATHATLVMPQSIAFGP G LY+AESDSQRINRVRVIG
Sbjct  1376  RVRVISGRPLHCATASTAYDTDLATHATLVMPQSIAFGPLGELYVAESDSQRINRVRVIG  1435

Query  1309  TDGKISPYAGAESKCNCLERGCDCFDADHYLASTSKFNTISAVAVSPDGVVHIGDQANYR  1368
             TDG+I+P+AGAESKCNCLERGCDCF+A+HYLA+++KFNTI+A+AV+PD  VHI DQANYR
Sbjct  1436  TDGRIAPFAGAESKCNCLERGCDCFEAEHYLATSAKFNTIAALAVTPDSHVHIADQANYR  1495

Query  1369  IRSVMASIPDASGAREYEIYSPDTQEIYVFNRFGQHVATKNILTGEIVYQFTYNVNTSNG  1428
             IRSVM+SIP+AS +REYEIY+PD QEIY+FNRFGQHV+T+NILTGE  Y FTYNVNTSNG
Sbjct  1496  IRSVMSSIPEASPSREYEIYAPDMQEIYIFNRFGQHVSTRNILTGETTYVFTYNVNTSNG  1555

Query  1429  KLSTVTDAAGNKVFLLRDYSSQVNSIENTKGQKCRLRMSRMKMLHELSTPDNYNVTFDYH  1488
             KLSTVTDAAGNKVFLLRDY+SQVNSIENTKGQKCRLRM+RMKMLHELSTPDNYNVT++YH
Sbjct  1556  KLSTVTDAAGNKVFLLRDYTSQVNSIENTKGQKCRLRMTRMKMLHELSTPDNYNVTYEYH  1615

Query  1489  GPTGLLKTKLDSTGRSYVYNYDEFGRLTSAVTPTGKVISLTFDLSLKGAVVKVGQNNRKP  1548
             GPTGLL+TKLDSTGRSYVYNYDEFGRLTSAVTPTG+VI L+FDLS+KGA VKV +N +K 
Sbjct  1616  GPTGLLRTKLDSTGRSYVYNYDEFGRLTSAVTPTGRVIELSFDLSVKGAQVKVSENAQKE  1675

Query  1549  ISMLIKGSSVVTKVGEAEQRTTVLSDGSVGQVTPWAHTVSTDTLPYSVLAEIEPLLGESY  1608
             +S+LI+G++V+ + G AE RTTV  DGS   +TPW H +  +  PY++LAE  PLLGESY
Sbjct  1676  MSLLIQGATVIVRNGAAESRTTVDMDGSTTSITPWGHNLQMEVAPYTILAEQSPLLGESY  1735

Query  1609  PVPAKQRTEIAGDLANRFEWRYFLRKFQ----GNKYRSESKTVAQVGRKLRINGDILLSL  1664
             PVPAKQRTEIAGDLANRFEWRYF+R+ Q    G + +   + V +VGRKLR+NGD +L+L
Sbjct  1736  PVPAKQRTEIAGDLANRFEWRYFVRRQQPLQAGKQSKGPPRPVTEVGRKLRVNGDNVLTL  1795

Query  1665  EYDRETNSVAVFMDDDAELLNVTYDRTARPVKWGPRNGIFSGVELEYDRFSRLTSWTWGD  1724
             EYDRET SV V +DD  ELLNVTYDRT+RP+ + P++G ++ V+LEYDRF RL SW WG 
Sbjct  1796  EYDRETQSVVVMVDDKQELLNVTYDRTSRPISFRPQSGDYADVDLEYDRFGRLVSWKWGV  1855

Query  1725  ISETYGFDRAGRLYEIKYSDGTSMVYAFKDMFSSLPLKVTTPRGSDYLLQYDEAGALQSL  1784
             + E Y FDR GRL EIKY DG++MVYAFKDMF SLPLKVTTPR SDYLLQYD+AGALQSL
Sbjct  1856  LQEAYSFDRNGRLNEIKYGDGSTMVYAFKDMFGSLPLKVTTPRRSDYLLQYDDAGALQSL  1915

Query  1785  TTPRGHIHAFSLQTSLGFYKYQYYSPMNRHPYEILYNDDGQILAKVYPHQSGKVAYVYDH  1844
             TTPRGHIHAFSLQTSLGF+KYQYYSP+NRHP+EILYND+GQILAK++PHQSGKVA+V+D 
Sbjct  1916  TTPRGHIHAFSLQTSLGFFKYQYYSPINRHPFEILYNDEGQILAKIHPHQSGKVAFVHDT  1975

Query  1845  TGKLETTLAGLSSIHYTYQETTSLVHSIDINEPNFEMRIEYKYHAGIVKDEKIKFGSKSG  1904
              G+LET LAGLSS HYTYQ+TTSLV S+++ EP FE+R E+KYHAGI+KDEK++FGSK+ 
Sbjct  1976  AGRLETILAGLSSTHYTYQDTTSLVKSVEVQEPGFELRREFKYHAGILKDEKLRFGSKNS  2035

Query  1905  LDNARYRYQYDGNARISGIEVDINGKQLPQLRLKYNQNLGILEGVGDLRIYRNLFNRSVM  1964
             L +ARY+Y YDGNAR+SGIE+ I+ K+LP  R KY+QNLG LE V DL+I RN FNR+V+
Sbjct  2036  LASARYKYAYDGNARLSGIEMAIDDKELPTTRYKYSQNLGQLEVVQDLKITRNAFNRTVI  2095

Query  1965  QDSSKQFFTVTDYDEHGRVKTVLMNIRSLDVFRMELEYDNRNRIKMRKLSIGKDAMEKKE  2024
             QDS+KQFF + DYD+HGRVK+VLMN++++DVFR+EL+YD RNRIK +K + G+       
Sbjct  2096  QDSAKQFFAIVDYDQHGRVKSVLMNVKNIDVFRLELDYDLRNRIKSQKTTFGRS------  2149

Query  2025  WTKMEKITYNADGHVLEVADTENNWQYAYDENGNVIGVTEHNEKIALGYDSGDRVVQYGD  2084
              T  +KI YNADGHV+EV  T NNW+Y +DENGN +GV +  EK  LGYD GDRV++ GD
Sbjct  2150  -TAFDKINYNADGHVVEVLGT-NNWKYLFDENGNTVGVVDQGEKFNLGYDIGDRVIKVGD  2207

Query  2085  VEFNSYDGRGFVVIRGEHKYRYNSRGQLIHASEHKKFQIWYFYDDRGRLVAWNDDRENIT  2144
             VEFN+YD RGFVV RGE KYRYN+RGQLIH+ E ++FQ WY+YDDR RLVAW+D++ N T
Sbjct  2208  VEFNNYDARGFVVKRGEQKYRYNNRGQLIHSFERERFQSWYYYDDRSRLVAWHDNKGNTT  2267

Query  2145  QFFYANPKTPDLITHIHFPKSSKTFRFLYDSRNFLMTVETSEQRFYVATDQNGSPLALFD  2204
             Q++YANP+TP L+TH+HFPK S+T +  YD R+ L+ +E  +QR+YVATDQNGSPLA FD
Sbjct  2268  QYYYANPRTPHLVTHVHFPKISRTMKLFYDDRDMLIALEHEDQRYYVATDQNGSPLAFFD  2327

Query  2205  TNGNLIKEMRRTPFGKIIKDTNPDFYLPIDFHGGLLDPNTKLVYLNKRLYDPTVGQWMTP  2264
              NG+++KEM+RTPFG+IIKDT P+F++PIDFHGGL+DP+TKLVY  +R YDP VGQWMTP
Sbjct  2328  QNGSIVKEMKRTPFGRIIKDTKPEFFVPIDFHGGLIDPHTKLVYTEQRQYDPHVGQWMTP  2387

Query  2265  AWEQMANELTTPTDIFIYRFRNNDPINFKQNVEYMTDLASWLKLYGYDISAMLGSEYMKQ  2324
              WE +A E++ PTD+FIYR+ NNDPIN  +   YM DL SWL+L+GYD++ M  S Y K 
Sbjct  2388  LWETLATEMSHPTDVFIYRYHNNDPINPNKPQNYMIDLDSWLQLFGYDLNNMQSSRYTKL  2447

Query  2325  MVYQPSATITSPQLTPDFGVMSGLQCIVNRVHEKFSDLGFVPKPLLKLEPKTRNLLPRVA  2384
               Y P A+I S  L PDFGV+SGL+CIV +  EKFSD  FVPKPLLK+EPK RNLLPRV+
Sbjct  2448  AQYTPQASIKSNTLAPDFGVISGLECIVEKTSEKFSDFDFVPKPLLKMEPKMRNLLPRVS  2507

Query  2385  HRRAVFGEGILVSRVGGRSLVSVVDGVNSVVQDVVTSVFNNSYFLPLHFSVHDQDVFYFV  2444
             +RR VFGEG+L+SR+GGR+LVSVVDG NSVVQDVV+SVFNNSYFL LHFS+HDQDVFYFV
Sbjct  2508  YRRGVFGEGVLLSRIGGRALVSVVDGSNSVVQDVVSSVFNNSYFLDLHFSIHDQDVFYFV  2567

Query  2445  KDNALKIRDDMEELRRLGGMFNVSTHETTEHGAGTWKELRLHNPDAAVVIKYGADPEQER  2504
             KDN LK+RDD EELRRLGGMFN+STHE ++HG    KELRLH PDA V+IKYG DPEQER
Sbjct  2568  KDNVLKLRDDNEELRRLGGMFNISTHEISDHGGSAAKELRLHGPDAVVIIKYGVDPEQER  2627

Query  2505  HRILKHAHKRAVERAWEIEKQLVMAGFQGRGDWSKEEKDELISRGTVSGYEGVDIHSVHR  2564
             HRILKHAHKRAVERAWE+EKQLV AGFQGRGDW++EEK+EL+  G V G+ G+DIHS+H+
Sbjct  2628  HRILKHAHKRAVERAWELEKQLVAAGFQGRGDWTEEEKEELVQHGDVDGWNGIDIHSIHK  2687

Query  2565  YPQLADDPGNVAFTRDTKRKRRKSGN  2590
             YPQLADDPGNVAF RD KRKRRK+G+
Sbjct  2688  YPQLADDPGNVAFQRDAKRKRRKTGS  2713


>TENA_DROME unnamed protein product
Length=3004

 Score = 1118 bits (2893),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 514/1029 (50%), Positives = 698/1029 (68%), Gaps = 45/1029 (4%)

Query  335   SIKKEVTHYMEPGHWFLSLYNDDGDPQEVSFIAMIAEDMTHNCPNGCSGKGECLLGHCQC  394
             ++   +  Y++ G WF+S+YND+     VS +A  AE ++  CPN CSG+G C LG C C
Sbjct  518   TVNVSLLQYLDTGLWFISVYNDELVAHSVSLLAEEAEGVSTTCPNDCSGRGSCYLGKCDC  577

Query  395   NPGFGGEDCSESVCPVLCSQRGEYINGECQCNPGWKGKECSLRHDECEVPDCNGHGHCTN  454
               G+ G DCS+SVCPVLCS  G Y  G C C  GWKG EC +   ECEVP+C+ HG C  
Sbjct  578   IDGYQGVDCSKSVCPVLCSAHGHYGGGVCHCEEGWKGAECDIPVGECEVPNCSSHGRCIE  637

Query  455   GKCNCVRGYKGKYCEEVDCPHPTCSGHGFCAEGTCICKKGWKGADCSQMDKEALQCLPDC  514
             G+C+C RG+KG YC++ DC  P CSGHG C  G C CK GW+G DC  +D++  QCLP C
Sbjct  638   GECHCERGWKGPYCDQHDCLDPLCSGHGTCVAGQCYCKAGWQGEDCGTIDQQVYQCLPGC  697

Query  515   SGHGNFDLETQTCLCEPMWSGDDCSKELCDLDCGPHGHCVDNACDCLPGWSGELCNLKQC  574
             S HG +DLET  C+CE  W+G DCS+ +C LDCG +G C    C C  GW+G LC+   C
Sbjct  698   SEHGTYDLETGQCVCERHWTGPDCSQAVCSLDCGRNGVCESGKCRCNSGWTGNLCDQLPC  757

Query  575   DPRCNEHGQCKNGTCLCVTGWNGKHCTMEGCPNSCSGHGQCRVGNDGQWECRCYDGWDGK  634
             D RC+EHGQCKNGTC+C  GWNG+HCT+ GC N CS HGQC + N G++ C C +GW G+
Sbjct  758   DSRCSEHGQCKNGTCVCSQGWNGRHCTLPGCENGCSRHGQCTLEN-GEYRCDCIEGWAGR  816

Query  635   DCNVLLEQNCNDGRDNDKDGLIDCADPECCSNHICRSSQLCVSAPKPIDILLRKQPPAIT  694
             DC++ LE NC D  DND DG+ DC+D ECCS+  C    +C+S+  P+++LLRKQPP++T
Sbjct  817   DCSIALELNCKDNIDNDGDGMTDCSDSECCSHPACSEHIMCLSSNDPVEVLLRKQPPSVT  876

Query  695   ASFFERMKFLIDEGSLQNYARQETFNESMFWNHFNTSRSAVVRGRVVTHLGTGLMGVRVS  754
             ASF++R+KFLI+E S+Q+YA  + ++E         +R +V+RG+V+T  G G++G+RVS
Sbjct  877   ASFYQRVKFLIEENSVQSYAHMDEYSE---------NRVSVMRGQVITPQGLGIVGIRVS  927

Query  755   TSTPLE-GFTLTRDDGWFDLLVNGGGAVTLQFGRSPFKPQSHIVFVPWNEVVIIDKIVMS  813
                    GFTLTR  GWFD+LVNGGGAVTLQF RSPF+P +  VFVPWN +V++  + M 
Sbjct  928   VDRDSRFGFTLTRQGGWFDVLVNGGGAVTLQFQRSPFRPLTRTVFVPWNRIVVLPPVQMQ  987

Query  814   TAEEKQTS-----------------HIPY-----------ACAAHDYDLMKPVVLATWKH  845
              +++ +T+                  I Y            C  HD++ ++P +++TW  
Sbjct  988   LSDDDETTSRNIKVAPLNPALTFLNSIHYHTADEANDASKVCMDHDHEKLRPQLISTWMP  1047

Query  846   GFQGACPDKSAILAESQVIQESLQIPGTGLNLVYHSSRAAGYLSTIQLQLTPEVIPPTLN  905
                GA P K  I AE+Q++QES+QIPG+ L+L Y SS+A+GYLS ++++LT E IPPTL 
Sbjct  1048  NGVGAMPGKRVIFAETQIVQESIQIPGSDLHLTYQSSQASGYLSIVRMRLTGETIPPTLT  1107

Query  906   LIHLRITIEGILFEKTFEADPVIKFTYAWNRLNVYRQRVYGVTTAMVKVGYEYNDCKDII  965
              +H+ + IEG L  KT+EADP +  T+AWN+ NVYRQ+VYGVT A + VGY+++ C+  +
Sbjct  1108  HVHVGVEIEGALHVKTYEADPSLVHTFAWNKRNVYRQKVYGVTVARISVGYQHSTCQSPV  1167

Query  966   WDVQTTKLSGHDMSISEVGGWNLDIHHRYNFHEGILQKGDGSNIYLKQKPRVILTTMGDG  1025
             W  QT KL G+D+ IS++GGW LDIHH YNFHEGILQKGDGS +++K+ PR +   MG G
Sbjct  1168  WIAQTAKLQGYDVDISDIGGWGLDIHHHYNFHEGILQKGDGSTLHMKEYPRTVKVVMGTG  1227

Query  1026  HQRSLDCYD-CDRQAEASNQRLLAPVALATASDGSIFVGDFNLVRKILVDGTVRTVVRLN  1084
              QR L C D C+    A + +LL P+ALAT  DGS++VGDFNLVR+I  DG V T+++L+
Sbjct  1228  LQRPLTCPDYCN--GVAKDAKLLTPIALATGPDGSLYVGDFNLVRRITPDGKVYTILQLS  1285

Query  1085  ATRVSYRYHIALSPLDGSLYISDPESHQIIRVRDTNDYSEPDHNWETVVGSGERCLPGDE  1144
             AT+VSY+Y++A+SP DG LYISDPE HQI+R+       +P  N + VVGSG+RC+PGDE
Sbjct  1286  ATQVSYQYYLAVSPADGHLYISDPERHQILRLVRLEKVKDPSINSDPVVGSGQRCIPGDE  1345

Query  1145  AHCGDGALARDAKLAYPKGVAVSADNVLYFADGTNIRMVDRDGIITTVIGNHMHKSHWKP  1204
              +CGDG  A  A+L++PKG+A++AD  +Y ADGTNIR VD  G+I T+IG+H H +HW P
Sbjct  1346  GNCGDGGPALLARLSHPKGLAIAADRTMYIADGTNIRAVDPKGVIHTLIGHHGHHNHWSP  1405

Query  1205  IPCEGTLNVEEVHLRWPTELAINPLDNSLHMIDDHMVLQLAPDGRVKVVAGRPLHCASPS  1264
              PC GTL   +  L+WPT LA++PLD SLH IDD +VL+L  D +++VVAG PLHC++  
Sbjct  1406  APCSGTLMANQAQLQWPTGLALSPLDGSLHFIDDRLVLRLTSDMKIRVVAGTPLHCSNGG  1465

Query  1265  SSFDT-ELATHATLVMPQSIAFGPSGNLYIAESDSQRINRVRVIGTDGKISPYAGAESKC  1323
                   +      L    ++AF P GNLYIA+SDS+R+N +RV+ T G +  +AG +   
Sbjct  1466  QDGRVNKTGADNVLGTVLAMAFSPFGNLYIADSDSRRVNSIRVVDTAGNMRYFAGKQEGT  1525

Query  1324  NCLERGCDC  1332
                 + CDC
Sbjct  1526  G--SQTCDC  1532


 Score = 728 bits (1880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/1321 (32%), Positives = 699/1321 (53%), Gaps = 106/1321 (8%)

Query  1334  DADHYLASTSKFNTISAVAVSPDGVVHIGDQANYRIRSVMASIPDASGAREYEIYSPDTQ  1393
             +A+  L+S ++F  ISA+AV+ DGV+++ DQ +  + ++   +P      E+ I  P + 
Sbjct  1677  NAETLLSSNARFQAISAIAVAQDGVINVADQGSLHVLALEHYLPSHDENGEFHIPFPPSS  1736

Query  1394  EIYVFNRFGQHVATKNILTGEIVYQFTYNVNTSNGKLSTVTDAAGNKVFLLRDYSSQVNS  1453
             EIYVFNR+GQHVATK++ +G+  Y F Y+ NTS G+LSTVTDA+GNK+  LRDYS+ V+S
Sbjct  1737  EIYVFNRYGQHVATKDLTSGKTRYSFLYSKNTSFGRLSTVTDASGNKIQFLRDYSNVVSS  1796

Query  1454  IENTKGQKCRLRMSRMKMLHELSTPDNYNVTFDYHGPTGLLKTKLDSTGRSYVYNYDEFG  1513
             IENT+  K  ++++ + ++ +LS      +  DY   TGLL ++  S G +Y+Y YDEFG
Sbjct  1797  IENTQDHKSEIQINGIGIMTKLSEKGRQEIELDYDSNTGLLNSR-SSGGETYIYQYDEFG  1855

Query  1514  RLTSAVTPTGKVISLTFDLS-LKGAVVKVGQN-----NRKPIS-----MLIKGS--SVVT  1560
             R+T  + P+G+++ +T  L+  +G  V V  +     +R+ I+     +L+ G   S   
Sbjct  1856  RVTGMILPSGEIVRITSQLADSQGLTVYVHASVESLFSRERIAGEANELLVLGGVRSTFL  1915

Query  1561  KVGEAEQRTTVLSDGSVGQVTPWAHTVSTDTLPYSVLAEIEPLLGESYPVPAK-------  1613
             K G+A     + ++ ++       H  +   +  S +A   PLL  + PV A+       
Sbjct  1916  KRGQAHADAELKANNTL-----VIHGDNGVVVEASAVAR-HPLLEAALPVEAEMLAMWSH  1969

Query  1614  QRTEIAGDLANRFEWRYFLRKFQGNKYRSESKTVAQVGRKLRINGDILLSLEYDRETNSV  1673
             Q   +   L N     Y L        R+  +T   + R++ +N   ++ +E+D+ TN  
Sbjct  1970  QSVTMGEGLTNSMYSVYSLV----GDVRNPQQT---LNREIWVNQSRVIGVEFDQFTNRE  2022

Query  1674  AVFMDDDAELLNVTYDRTARPVKWGPRNGIFSGVELEYDRFSRLTSWTWGDISETYGFDR  1733
               +      +L V YD++  P  + P NG    V + YDRF+R+  W WG     Y +DR
Sbjct  2023  TFYDARRTPILIVAYDQSGLPKSYYPTNGY--PVNITYDRFNRVEGWAWGPAELKYSYDR  2080

Query  1734  AGRLYEIKYSDGTSMVYAFKDMFSSLPLKVTTPRGSDYLLQYDEAGALQSLTTPRGHIHA  1793
              G L EI       + + + D      + + + R   ++LQYD+AG L+ +  P G  H+
Sbjct  2081  HGLLSEITSQQDGIVSFVYNDWNLVSEIGLASQR--KFVLQYDDAGGLRHVVLPSGTRHS  2138

Query  1794  FSLQTSLGFYKYQYYSPMNRHPYEILYNDDGQILAKVYPHQSGKVAYVYDHTGKLETTLA  1853
             FS+QTS+GF +  Y  P +   Y   Y+  G +L  + P    ++ Y Y+  G+L   + 
Sbjct  2139  FSMQTSIGFIRCTYTPPGSTRAYLQHYSHAGALLQTILPGDGARIVYRYNAAGQLTEVVH  2198

Query  1854  GLSSIHYTYQETTSLVHSIDINEPNFEMRIEYKYHAGIVKDEKIKFGSKSGLDNARYRYQ  1913
             G     + Y E T +  ++   E   E R +++Y AG++ +E+I + +K+GL NA++ Y+
Sbjct  2199  GDGRSEFQYNEATGMPSTVSHTERELEYRWDFEYAAGLLAEERIDYVAKTGLSNAKFSYE  2258

Query  1914  YDGNARISGIEVDINGKQLPQLRLKYNQNLGILEGVGDLRIYRNLFNRSVMQDSSKQFFT  1973
             YD   R+  ++  I G+ LP     Y+   G    +G  R  +   N++ + D +  F  
Sbjct  2259  YDSQLRVVALQGRIGGQSLPTQAFAYDPRTGRPSLIGQFRFSQPAQNQTQLHDGTASFTR  2318

Query  1974  VTDYDEHGRVKT--VLMNIRSLDVFRMELEYDNRNRIKMRKLSIGKDAMEKKEWTKMEKI  2031
               D    GR +T  + + I  L+VFRME  Y    RI   +       M    +T ++  
Sbjct  2319  TVD----GRFQTQRMALAIHRLEVFRMEFSYGVHGRISQTRTYTRN--MAVNSYTNVKNY  2372

Query  2032  TYNADGHVLEVADTENNWQYAYDENGNVIGVTEHNEKIALGYDSGDRVVQYGDVEFNSYD  2091
             T++ DG ++ V + +  W + YD+NGN++ +T     I + Y++ DR+V++G+ ++  YD
Sbjct  2373  TWDCDGQLVGV-EAQEPWGFRYDDNGNLLSLTYRGNTIPMEYNAQDRIVKFGEGQYK-YD  2430

Query  2092  GRGFVVIRG-EHKYRYNSRGQLIHASEHKKFQIWYFYDDRGRLVAWNDDRENITQFFYAN  2150
              RG V     E ++ YN++G L+ AS+  +F + Y+YD   RL    D+  N+TQFFY N
Sbjct  2431  ARGLVAQNAREERFHYNTQGLLVRASKRGRFDVRYYYDHLKRLTTRKDNFGNVTQFFYTN  2490

Query  2151  PKTPDLITHIHFPKSSKTFRFLYDSRNFLMTVETSEQRFYVATDQNGSPLALFDTNGNLI  2210
              + P  ++ I+ P+  K     YD    L+  +    ++YVATDQ+G+PL LF+  G  I
Sbjct  2491  QQRPYEVSQIYSPRDGKLMSLTYDDVGHLIYAQVYRHKYYVATDQSGTPLMLFNQYGEGI  2550

Query  2211  KEMRRTPFGKIIKDTNPDFYLPIDFHGGLLDPNTKLVYL-NKRLYDPTVGQWMTPAWEQM  2269
             +E+ R+PFG I+ D+NP  YLPIDF GG+LD  T LV++ + R+YDP +GQWM+P W+++
Sbjct  2551  REIMRSPFGHIVYDSNPYLYLPIDFCGGILDQVTTLVHMGDGRVYDPLIGQWMSPDWQRV  2610

Query  2270  ANELTTPTDIFIYRFRNNDPINFKQNVEYMTDLASWLKLYGYDISAMLGSEYMKQMVYQP  2329
             A  + TPT + +YRF  NDPIN      Y  D A+W++  GY++  ++    + + ++QP
Sbjct  2611  AERIITPTRLHLYRFNGNDPINVGHERHYPEDFAAWMRTLGYNVGNLV--PQLARDLWQP  2668

Query  2330  SATITSPQLT-------------PDFGVMSGLQCIVN-RVHEKFSDLGFVPKPLLK---L  2372
              A    P                P   V SG    +N R    F  L   P+  LK   +
Sbjct  2669  PALWGRPPANPVALNLRRPFDNIPTMAVESGFLAHLNVRRMSDFEQLSAPPRSALKCDVM  2728

Query  2373  EPKTRNLLPRVAHRRAVFGEGILVSRVG-GRSLVSVVDGVNSVVQDVVTSVFNNSYFLPL  2431
             +P  + +    +     FG+GI+VSR   G+++VS V   N++ +DV TSVFN S  LP 
Sbjct  2729  DPSPKTI---GSDTEPPFGKGIVVSRTADGQAIVSSVPAANAIYRDVYTSVFNRSKLLPF  2785

Query  2432  HFSVHD--QDVFYFVKDNALKIRDDMEELRRLGGMFNVSTHETTEHG-------------  2476
              F VH+  QD F+FVK++A +  +D ++L+RL G  N + HE T                
Sbjct  2786  TFVVHNAQQDSFFFVKEDAWRATEDRQQLKRLQGQVNTTFHEITREATVGSGPAGAANGG  2845

Query  2477  ------------------AGTWKELRLHNPDAAVVIKYGADPEQERHRILKHAHKRAVER  2518
                                G + ++++H   A + ++YG    +E+ R++ HA   AV +
Sbjct  2846  AGSSSSSSSSSGGGSSSNTGNYLDVKIHGAHAIINLRYGTTVAKEQQRLMHHAKLTAVRK  2905

Query  2519  AWEIEKQLVMAGFQGRGDWSKEEKDELISRGTVSGYEGVDIHSVHRYPQLADDPGNVAFT  2578
             AW  EK+ + +G     +WS++E DE++ +   + YEG  IH V+ YP+LA+DP N+ F 
Sbjct  2906  AWHREKEALRSGLTTALEWSQQETDEILKQSYANNYEGEYIHDVNLYPELAEDPYNIKFV  2965

Query  2579  R  2579
             +
Sbjct  2966  K  2966


 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 35/54 (65%), Gaps = 0/54 (0%)

Query  266  IPPYSYWNMQFYQSEAAYVRFDYNIPRGASIGVYARRNALPTHTQYDLLEVLSG  319
            IP Y +W ++F     A++RF++ +P GA   VY+RRN  P+ TQ+D +E + G
Sbjct  367  IPAYQFWTLEFRNKHPAFIRFNFTLPWGAHFAVYSRRNVAPSVTQHDFVEFIKG  420


 Score = 33.1 bits (74),  Expect = 4.1, Method: Compositional matrix adjust.
 Identities = 15/42 (36%), Positives = 23/42 (55%), Gaps = 0/42 (0%)

Query  155  CSWKLIAMILLMVSLCITAALCYVIVSSIVNRSYQSTKACAV  196
            CSWK +++ L+ VS+ +TA L Y    S +  +  ST    V
Sbjct  162  CSWKCLSIALIFVSVVLTAMLAYFAAVSSMKPNMDSTNCILV  203


>H1ZUX0_CAEEL unnamed protein product
Length=2837

 Score = 798 bits (2060),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 667/2537 (26%), Positives = 1138/2537 (45%), Gaps = 344/2537 (14%)

Query  244   RSFPPDGTTFAQVGLGQKLSKEIPPYSYWNMQFYQSEAAYVRFDYNIPRGASIGVYARRN  303
             R+ PP       + LG+++  E  P S    +   ++ + +RF+  +  GA + +     
Sbjct  423   RALPP------AISLGERVDVEFFPKSMATTELTVTKPSRIRFNATVGSGAQLVLLMSAG  476

Query  304   ALPTHTQYDLL---------------EVLSGFKARTTRA--------SHVSVIPSIKKEV  340
               P+ + +D L                ++  F +R+ R+         ++ ++       
Sbjct  477   VHPSLSLHDALFPIRADRIRDSKSPTHIVEEFGSRSRRSLGASSSRHRNIEILSPRSATF  536

Query  341   THYMEPGHWFLSLYNDDGDPQEVSFIAMIAEDMTHN---------------------CPN  379
               ++  G  +L+  N+    + +SF+A   +  T                       C +
Sbjct  537   EQFVLEGRHYLTFINERSRVEPISFVAEELQRPTTPPKTSSSGTSGAKEHPLASVLVCES  596

Query  380   GCSGKGECLLGHCQCNPGFGGEDCSESVCPVLCSQRGEYINGECQCNPGWKGKECSLRHD  439
              C+ +GEC+ G C C PGF G  C E+VCPV+CS  G +  G C C  G+KGKEC +RH+
Sbjct  597   NCNQRGECVHGKCHCAPGFTGRTCDEAVCPVVCSGNGVFSGGICVCKSGFKGKECEMRHN  656

Query  440   ECEVPDCNGHGHC-TNGKCNCVRGYKGKYCEEVDCPHPTCSGHGFCAEGTCICKKGWKGA  498
              CEV DCNG G C T+G+C C  G+ G+ CE   CPH +C   G C  GTC C  GW+G 
Sbjct  657   WCEVADCNGRGRCDTDGRCRCNPGWTGEACELRACPHASCHDRGVCVNGTCYCMDGWRGN  716

Query  499   DC--------------------------SQMDKEALQCLPD-------------------  513
             DC                          S+  K  ++  P                    
Sbjct  717   DCSVFADAIVHVPQAQSPPRRGQEPTESSKTRKAQVKPTPTSEKKKESRELQKPIIATVQ  776

Query  514   --------CSGHGNFDLETQTCLCEPMWSGDDCSKELCDLDCGPHGHCVDN-ACDCLPGW  564
                     CS HG   L    C CE  W   DCS++ C      +G C+D+ +C C  GW
Sbjct  777   VPTESSHPCSAHGQ--LIDDICQCESGWDSVDCSQQACQC---VNGDCLDDGSCQCWKGW  831

Query  565   SGELCNLKQCDPRCNEHGQC-KNGTCLCVTGWNGKHCTMEGCPNSCSGHGQCRVGN-DGQ  622
              G  C  K+C   C + G+C  +G+C C +GWNG++C ++GCPN CSG G+C +     +
Sbjct  832   RGSNCTDKKCAIGCEDRGKCASDGSCKCSSGWNGENCAIDGCPNQCSGKGECGMDRRSSE  891

Query  623   WECRCYDGWDGKDCNVLLEQNCNDGRDNDKDGLIDCADPECCSNHICRSSQLCVSAPKPI  682
             W CRC  G  G DC+V +E +C+DG DND DGLIDC DPECCS+  C S  +C +A  PI
Sbjct  892   WSCRCQAGSTGVDCSVSVEMHCDDGLDNDSDGLIDCDDPECCSSSSCSSESVCSTAASPI  951

Query  683   DILLRKQPPAITASFFERMKFLIDEGSLQNYARQETFNESMFWNHFNTSRSAVVRGRVV-  741
             ++L+R  PP   A+F +R+ FLI E S+Q+Y     FNE++          +V+RGRV+ 
Sbjct  952   EVLMR-MPPIFNANFAQRVGFLIMEKSVQSYTDSSQFNENLI---------SVIRGRVMW  1001

Query  742   -------THLGT-------GLMGVRVSTST-PLEGFTLTRDDGWFDLLVNGGGAVTLQFG  786
                      L T        L+GVRVS +  PL GFTLTR+DG+FDL VNG  +VTLQF 
Sbjct  1002  GGSPTGSDDLSTYSNKSTVPLVGVRVSDAAHPLYGFTLTREDGYFDLTVNGARSVTLQFL  1061

Query  787   RSPFKPQSHIVFVPWNEVVIIDKIVMSTAEEKQTSHIPYA-----CAAHDYDLMKPVVLA  841
             R+ F+     VFV   +++ ID IV+          I  A     C+     +   V+++
Sbjct  1062  RTQFQSVKKSVFVSPRQIIHIDDIVLYRQSGGSPPAISMAPARAKCSPTLRRIPDVVLIS  1121

Query  842   TWKHGFQG----ACPDKSAILAESQVIQESLQIPGTGLNLVYHSSRAAGYLSTIQLQLTP  897
              W++   G       D S I+ +S+ I ESL I GT + LVY S+R+    ST+ + L  
Sbjct  1122  NWQYTSDGIETDETSDSSRIVVDSRSIFESLPIQGTDVRLVYDSARSPAAPSTMLIGLLY  1181

Query  898   EVIPPTLNLIHLRITIEGILFEKTFEADPVIKFTYAWNRLNVYRQRVYGVTTAMVKVGYE  957
             + +   L  +H+ I I G  F++       + + +AW+++N YRQ   G+    V+VGYE
Sbjct  1182  DRVDKELRKVHINIRIAGRRFDRVLAPRTNLTYVFAWDKMNAYRQSESGLVPVTVRVGYE  1241

Query  958   YNDC---KDIIWDVQTTKLSGHDMSISEVGGWNLDIHHRYNFHEGILQKGDGS-NIYLKQ  1013
             Y  C    + +W  + +++ G          W LDIHH  +    +++ G+G   +  + 
Sbjct  1242  YQGCDRTSERVWQTRRSQMMGATARKMIGTMWTLDIHHHLDIVNNVVEMGNGGYRLITES  1301

Query  1014  KPRVILTTMGDGHQRSLDCYDCDRQAEASNQRLLAPVALATASDGSIFVGDFNLVRKILV  1073
             +PRV      DG +R ++C  C+ + ++ +  L  P  +  A DGS+ +GD N++R++  
Sbjct  1302  EPRVSTFAGLDGVKRDVECLKCEGKVDSIS--LFRPTTVVYAQDGSLIIGDHNMIRRVSQ  1359

Query  1074  DGTVRTVVRLNATRVSYRYHIALSPLDGSLYISDPESHQIIRVRDTNDYSEPDHNWETVV  1133
             DG V T++ L     S+ Y+IA+SP+DG++ IS P   Q+ R+  + +  +  +N++ + 
Sbjct  1360  DGQVSTILTLGLADTSHSYYIAVSPVDGTIAISLPLHKQVWRI-SSLEPQDSRNNYDVLA  1418

Query  1134  GSGERCLPGDEAHCGDGALARDAKLAYPKGVAVSADNVLYFADGTNIRMVDRDGIITTVI  1193
             G G  C    ++ CGDGALA++A+L +PKG++      LY AD   IR++D  G I + I
Sbjct  1419  GDGTVCASAVDS-CGDGALAQNAQLIFPKGISFDKMGNLYLADSRRIRVIDTTGHIRS-I  1476

Query  1194  GNHMHKSHWKPI-PCEGTLNVEEVHLRWPTELAINPLDNSLHMIDDHMVLQLAPDGRVKV  1252
             G      H  PI  C     + ++ + WPT L I+P+  S+ ++D ++V ++     V  
Sbjct  1477  GETTPDQH--PIRTCAQITKLVDLQMEWPTSLTIDPITGSVLVLDTNVVYEIDVVHDVVT  1534

Query  1253  VA-GRPLHC--ASPSSSFDTELATHATLVM--PQSIAFGPSGNLYIAESDSQRINRVRVI  1307
             +A G P  C  A+ +SS   +   H   ++   + I  G  G +Y+ ESD +R+N+VR +
Sbjct  1535  IALGSPTTCDLANATSSASAKSLDHRRHLIQNARDITVGTDGAIYVVESDGRRLNQVRKL  1594

Query  1308  GTD-GKISPYAGAESKCNCLERGCDCFDA---DHYLASTSKFNTISAVAVSPDGVVHIGD  1363
              +D    S   G +S C+C    C C DA       AS +  ++  AV VSP G V I D
Sbjct  1595  SSDRSTFSILTGGKSPCSCDVAACGCDDAVSLRDVAASQAHLSSPYAVCVSPSGDVIIAD  1654

Query  1364  QANYRIRSVMASIPDASG-AREYEIYSPDTQEIYVFNRFGQHVATKNILTGEIVYQFTYN  1422
               N +I+ V A +    G +R YE+   + QE Y FNR GQH +T +++TG   + F+Y 
Sbjct  1655  SGNSKIKKVSARMAKYDGRSRTYEVTDAERQEKYTFNRHGQHSSTVSLITGRTFFNFSYQ  1714

Query  1423  VNTSNGKLSTVTDAAGNKVFLLRDYSSQVNSIENTKGQKCRLRMS----RMKMLHELSTP  1478
             V++    +S +  A+G  + +L+   S  + +E T GQ+  L MS     ++ + +  + 
Sbjct  1715  VDSPISMISEIRAASGVVLRVLKRNDSLFD-LETTLGQRTTLTMSAYDGTLEQVSKRDSA  1773

Query  1479  DNYNVTFDYHGPTGLLKTKLDSTGRSYVYNYDEFGRLTSAVTPTGKVISLTFDLS---LK  1535
              + + T  ++   GLL +++D    +  + YDE+GR           I L  D     L 
Sbjct  1774  TSRDATKLFY-KKGLLTSRID-VATAVGFEYDEYGR----------AIGLKRDREYWRLG  1821

Query  1536  GAVVKVGQNNRKPI--------SMLIKGSSVVTKVGEAEQRTTVLSDGSVGQVTPWAHTV  1587
                + +G  N + +          L +G+  V     A  R   L +      +P    +
Sbjct  1822  EETISMGSVNTEVLLNGQRFQQVRLGEGNLAVHSTNGATTRLISLRNEGYSLASP----L  1877

Query  1588  STDTLPYSVLAEIEPLLGESYPVPAKQRTEIAG-------DLANRFEWRYFLRKFQGNKY  1640
              T TL Y   + I    GE  P+ +++RT++         +L  R++WR+  R+   +  
Sbjct  1878  GTSTL-YDKSSSIPDSNGE--PLISRRRTKVPAIGNPQRRELTTRWDWRHVARRGDDSDG  1934

Query  1641  RSESKTVAQVGRKLRINGDILLSLEYDRETNSVAVFM----DDDAELLNVTYDRTARPVK  1696
                 + VA+      ING  + S+EYD ++N   + +    DD   LL + Y  + R  +
Sbjct  1935  SLGRRKVAE------INGVNMFSMEYDVKSNQDTLRLGSTTDDAQALLFIDYTSSGRIRR  1988

Query  1697  W-GPRNGIFSGVELEYDRFSRLTSWTWGDISETYGFDRAGRLYEIKYSDGTSMVYAFKDM  1755
                P +   + + + +D   R +  TWG       +D + RL E    DG  +       
Sbjct  1989  ISAPEDSQMAEMNITWDGAGRKSEVTWGSWKIRLTYDNSNRLTEHAI-DGARVPIKMSYA  2047

Query  1756  FSSLPLKVTTPRGSDYLLQYDEAGALQSLTTPRGHIHAFSLQTSLGFYKY--QYYSPMNR  1813
              +S         G+ + +QYD    ++ + +      +FS   +LG  ++  +  + +N 
Sbjct  2048  GASRRPNEIQHDGAKWNIQYDNYDRIKEVISKSQEATSFS-SIALGGDEWVLKRRTSLNS  2106

Query  1814  HPYEILYNDDGQILAKVYPHQSGKVAYVYDHTGKLETTLAGLSSIHYTYQETTSLVHSID  1873
              P  +  + +G++L    P ++        +  + +  + G ++     +ETT +     
Sbjct  2107  KPSLVRLSREGKVLESTTPDEN-------HYWLERKDPITGRTTEILNDEETTVVTCWSP  2159

Query  1874  INEP------NFEMRIEYKYHAGIVKDEKIKFGSKSGLD-NARYRYQYDGNARISGIEVD  1926
                P      N +     + H    K   I   + S     + + Y+YD   R++ I+  
Sbjct  2160  EGAPMCSRSRNLQENTTMQGHLVARKSVTIMTPTSSEPSITSSFTYEYDDMLRVTTIQPV  2219

Query  1927  INGKQLPQLRLKYNQNLGILEGVGDLRIYRNLFN-----RSVMQDSSKQFFTVTDYDEHG  1981
             I    L  ++L Y++  G +  +   +  R+          +M ++SK      D+ +  
Sbjct  2220  IEQSVLESIQLSYDERRGHVAAINGFKWARDASTSRCQGHGLMYETSK----ANDHRQVV  2275

Query  1982  RVKTVLMNIR-SLDVFRMELEYDNRNRIKMRKLSIGKDAMEKKEWTKMEKITYNADGHVL  2040
               K +  + R S+ + R     D   R     L I     ++ +  K+ + T++A G   
Sbjct  2276  ERKLIFGDARASIKIIR-----DKAGRASESHLEISSSGTQRNQ--KITR-TFDAAGR--  2325

Query  2041  EVADTENNWQYAYDENGNVIGVTEHNEKIALGYDSGDRVVQYGDVEFNSYDGRGFVVIRG  2100
              VA  E N Q       N     E      + ++ G  +  + D+ +   D  G+VV R 
Sbjct  2326  -VASVEQNDQEPVRIIWNSDARVEKINDRVVEWNRGGALKTFQDISYQ-VDSIGWVVKRD  2383

Query  2101  EHK-YRYNSRGQLIHASEHKKFQIWYFYDDRGRLVAWNDDRENITQFFYANPKTPDLITH  2159
                 + Y+ +G+L+ A    + +I  FYD   R+V   + ++ I  F+Y    TP L++ 
Sbjct  2384  NTTVFGYDGKGRLVSA-RSSQLRINIFYDREDRVVQIQNSKDFI-HFYYGYIDTPKLVS-  2440

Query  2160  IHFPKSSKTFRFLYDSRNFLMTVETSE-QRFYVATDQNGSPLALFDTNGNLIKEMRRTPF  2218
              HF K+ K     YD  +    +++ +  R+ + TD+  +  A+   + N+++ + R+ F
Sbjct  2441  -HFSKNGKISTLFYDDDSVPFAMQSDDGTRYALLTDETSTIKAIIG-DSNVLRIIDRSVF  2498

Query  2219  GKIIKDTNPDF-YLPIDFHGGLLDPNTKLVYLNK-RLYDPTVGQWMTPAWE-----QMAN  2271
             G ++  ++    +LPI + GG+      +  LN  R  D    ++M+ + E     ++  
Sbjct  2499  GALLPSSSSSHPFLPIGYLGGIEISEISVSILNNGRPLDLYSERYMSISPEAVVRLELNE  2558

Query  2272  ELTTPTDIFIYRFRNNDPINFKQNVEYMTDLASWLKLYGYDISAMLGSEYMKQMVYQPSA  2331
             + +   D+      +  P   +   E   D  +W  L G                     
Sbjct  2559  KFSNSIDLMALEI-DRQPFRVENVPE---DFETWFSLAGL--------------------  2594

Query  2332  TITSPQLTPDFGV-MSGLQCIVNRVHEKFSDLGFVPKPLLKLEPKTRNLLPRVAHRRAV-  2389
                SP L P   + +     IV+R+   F      P+ L  L   T  L  R+A   ++ 
Sbjct  2595  ---SPNLLPSAHLGLPASSAIVHRLLSSF------PRKLRPLTHLTTVLPTRLASDISLT  2645

Query  2390  --------------FGEGILVSR--VGGRSLVSVVDGVNSVVQDVVTSVFNNSYFLPLHF  2433
                           F   ++++     G  +V ++  + S  ++V++ +F+    L    
Sbjct  2646  SPTSETSWSIDDVGFSNLLILNEDATTGEVMVEMLSDLKSEEREVISKLFDGVKSL----  2701

Query  2434  SVHDQDVFYFVKDNALKIRDDMEELRRLGGMFNVSTHETTEHGAGTWKE-LRLHNPDAAV  2492
                D   +  V    L         R       +S+   +       K+ + L N  + +
Sbjct  2702  ---DFATWGLVPTRHL--------WRAPNSKLELSSTSFSHFTMAVNKDSVELRNGKSKI  2750

Query  2493  VIKYGADPEQERHRILKHAHKRAVERAWEIEKQLVMAGFQGRGDWSKEEKDELISRGTVS  2552
             V+ +  +  +   +I++    R     W  E++   AG +    WS  E  EL S+G+VS
Sbjct  2751  VVHFSENKAEIVKKIVEELKTRENIAVWRAERKRAEAGEKTWRQWSDRETRELTSKGSVS  2810

Query  2553  GYEGVDIHSVHRYPQLA  2569
             GY+ +++   H+   LA
Sbjct  2811  GYD-IEMKPAHQSGLLA  2826



Lambda      K        H
   0.312    0.129    0.360 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4048251568


Query= XP_050469448.1 teneurin-m isoform X6 [Bombus huntii]

Length=2577
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TENM_DROME  unnamed protein product                                   3876    0.0  
TENA_DROME  unnamed protein product                                   1119    0.0  
TEN1_CAEEL  unnamed protein product                                   798     0.0  


>TENM_DROME unnamed protein product
Length=2731

 Score = 3876 bits (10051),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1847/2644 (70%), Positives = 2166/2644 (82%), Gaps = 124/2644 (5%)

Query  15    LLDNSAPRGPPDVPPRNPTMSRV-NGRLPGSHAASDHERDPDLQPSCLVRTSSGGFYSIP  73
             LL+   P  PPDVPPRNPTMSR+ NGRL       ++  D D +PSCLVRT SG  Y   
Sbjct  103   LLEGVTPTAPPDVPPRNPTMSRMQNGRL-----TVNNPNDADFEPSCLVRTPSGNVY---  154

Query  74    KIPKNEYN--------NKNQSTGNSPIKVEL-------QNNMDRVPLPYGHAPSMIPMRR  118
              IP    N         K+ S  ++P K  L       Q  M  V LP     + +P   
Sbjct  155   -IPSGNLNINKGSPIDFKSGSACSTPTKDTLKGYERSTQGCMGPV-LPQRSVMNGLPAHH  212

Query  119   QSIRCHFVKG-VDWCS--W-------KLIAMILLMVSLCITAAL-------CYVIV----  157
              S   +F K  V  CS  W        L A +++++ L  T  +       C V+V    
Sbjct  213   YSAPMNFRKDLVARCSSPWFGIGSISVLFAFVVMLILLTTTGVIKWNQSPPCSVLVGNEA  272

Query  158   -------------SSIVNRSYQSTKACAVLVGENSDTKPLSSDGNK------TSSSATAS  198
                          S + N S ++     + + +       +  G+       T ++AT++
Sbjct  273   SEVTAAKSTNTDLSKLHNSSVRAKNGQGIGLAQGQSGLGAAGVGSGGGSSAATVTTATSN  332

Query  199   SSQSSG----------------------------RTRQQASSGGARTFPARSFPPDGTTF  230
             S  + G                             +   A++GGARTFPARSFPPDGTTF
Sbjct  333   SGTAQGLQSTSASAEATSSAATSSSQSSLTPSLSSSLANANNGGARTFPARSFPPDGTTF  392

Query  231   AQVGLGQKLSKEIPPYSYWNMQFYQSEAAYVRFDYNIPRGASIGVYARRNALPTHTQYDL  290
              Q+ LGQKL+KEI PYSYWNMQFYQSE AYV+FDY IPRGASIGVY RRNALPTHTQY  
Sbjct  393   GQITLGQKLTKEIQPYSYWNMQFYQSEPAYVKFDYTIPRGASIGVYGRRNALPTHTQYHF  452

Query  291   LEVLSGFKA--RTTRASHVSVIPSIKKEVTHYMEPGHWFLSLYNDDGDPQEVSFIAMIAE  348
              EVLSGF A  RT RA+H+S    I +EVT YMEPGHWF+SLYNDDGD QE++F A +AE
Sbjct  453   KEVLSGFSASTRTARAAHLS----ITREVTRYMEPGHWFVSLYNDDGDVQELTFYAAVAE  508

Query  349   DMTHNCPNGCSGKGECLLGHCQCNPGFGGEDCSESVCPVLCSQRGEYINGECQCNPGWKG  408
             DMT NCPNGCSG G+CLLGHCQCNPGFGG+DCSESVCPVLCSQ GEY NGEC CNPGWKG
Sbjct  509   DMTQNCPNGCSGNGQCLLGHCQCNPGFGGDDCSESVCPVLCSQHGEYTNGECICNPGWKG  568

Query  409   KECSLRHDECEVPDCNGHGHCTNGKCNCVRGYKGKYCEEVDCPHPTCSGHGFCAEGTCIC  468
             KECSLRHDECEV DC+GHGHC +GKC C+RGYKGK+CEEVDCPHP CSGHGFCA+GTCIC
Sbjct  569   KECSLRHDECEVADCSGHGHCVSGKCQCMRGYKGKFCEEVDCPHPNCSGHGFCADGTCIC  628

Query  469   KKGWKGADCSQMDKEALQCLPDCSGHGNFDLETQTCLCEPMWSGDDCSKELCDLDCGPHG  528
             KKGWKG DC+ MD++ALQCLPDCSGHG FDL+TQTC CE  WSGDDCSKELCDLDCG HG
Sbjct  629   KKGWKGPDCATMDQDALQCLPDCSGHGTFDLDTQTCTCEAKWSGDDCSKELCDLDCGQHG  688

Query  529   HCVDNACDCLPGWSGELCNLKQCDPRCNEHGQCKNGTCLCVTGWNGKHCTMEGCPNSCSG  588
              C  +AC C P W GE CN + CD RCNEHGQCKNGTCLCVTGWNGKHCT+EGCPNSC+G
Sbjct  689   RCEGDACACDPEWGGEYCNTRLCDVRCNEHGQCKNGTCLCVTGWNGKHCTIEGCPNSCAG  748

Query  589   HGQCRVGNDGQWECRCYDGWDGKDCNVLLEQNCNDGRDNDKDGLIDCADPECCSNHICRS  648
             HGQCRV  +GQWECRCY+GWDG DC + LE NC D +DNDKDGL+DC DPECC++H+C++
Sbjct  749   HGQCRVSGEGQWECRCYEGWDGPDCGIALELNCGDSKDNDKDGLVDCEDPECCASHVCKT  808

Query  649   SQLCVSAPKPIDILLRKQPPAITASFFERMKFLIDEGSLQNYARQETFNESMFWNHFNTS  708
             SQLCVSAPKPID+LLRKQPPAITASFFERMKFLIDE SLQNYA+ ETFNES         
Sbjct  809   SQLCVSAPKPIDVLLRKQPPAITASFFERMKFLIDESSLQNYAKLETFNES---------  859

Query  709   RSAVVRGRVVTHLGTGLMGVRVSTSTPLEGFTLTRDDGWFDLLVNGGGAVTLQFGRSPFK  768
             RSAV+RGRVVT LG GL+GVRVST+T LEGFTLTRDDGWFDL+VNGGGAVTLQFGR+PF+
Sbjct  860   RSAVIRGRVVTSLGMGLVGVRVSTTTLLEGFTLTRDDGWFDLMVNGGGAVTLQFGRAPFR  919

Query  769   PQSHIVFVPWNEVVIIDKIVMSTAEEKQTS-HIPYACAAHDYDLMKPVVLATWKHGFQGA  827
             PQS IV VPWNEVVIID +VMS +EEK  +    + C AHDYDLMKPVVLA+WKHGFQGA
Sbjct  920   PQSRIVQVPWNEVVIIDLVVMSMSEEKGLAVTTTHTCFAHDYDLMKPVVLASWKHGFQGA  979

Query  828   CPDKSAILAESQVIQESLQIPGTGLNLVYHSSRAAGYLSTIQLQLTPEVIPPTLNLIHLR  887
             CPD+SAILAESQVIQESLQIPGTGLNLVYHSSRAAGYLSTI+LQLTP+VIP +L+LIHLR
Sbjct  980   CPDRSAILAESQVIQESLQIPGTGLNLVYHSSRAAGYLSTIKLQLTPDVIPTSLHLIHLR  1039

Query  888   ITIEGILFEKTFEADPVIKFTYAWNRLNVYRQRVYGVTTAMVKVGYEYNDCKDIIWDVQT  947
             ITIEGILFE+ FEADP IKFTYAWNRLN+YRQRVYGVTTA+VKVGY+Y DC DI+WD+QT
Sbjct  1040  ITIEGILFERIFEADPGIKFTYAWNRLNIYRQRVYGVTTAVVKVGYQYTDCTDIVWDIQT  1099

Query  948   TKLSGHDMSISEVGGWNLDIHHRYNFHEGILQKGDGSNIYLKQKPRVILTTMGDGHQRSL  1007
             TKLSGHDMSISEVGGWNLDIHHRYNFHEGILQKGDGSNIYL+ KPR+ILTTMGDGHQR L
Sbjct  1100  TKLSGHDMSISEVGGWNLDIHHRYNFHEGILQKGDGSNIYLRNKPRIILTTMGDGHQRPL  1159

Query  1008  DCYDCDRQAEASNQRLLAPVALATASDGSIFVGDFNLVRKILVDGTVRTVVRLNATRVSY  1067
             +C DCD QA  + QRLLAPVALA A DGS+FVGDFN +R+I+ DG++RTVV+LNATRVSY
Sbjct  1160  ECPDCDGQA--TKQRLLAPVALAAAPDGSLFVGDFNYIRRIMTDGSIRTVVKLNATRVSY  1217

Query  1068  RYHIALSPLDGSLYISDPESHQIIRVRDTNDYSEPDHNWETVVGSGERCLPGDEAHCGDG  1127
             RYH+ALSPLDG+LY+SDPESHQIIRVRDTNDYS+P+ NWE VVGSGERCLPGDEAHCGDG
Sbjct  1218  RYHMALSPLDGTLYVSDPESHQIIRVRDTNDYSQPELNWEAVVGSGERCLPGDEAHCGDG  1277

Query  1128  ALARDAKLAYPKGVAVSADNVLYFADGTNIRMVDRDGIITTVIGNHMHKSHWKPIPCEGT  1187
             ALA+DAKLAYPKG+A+S+DN+LYFADGTNIRMVDRDGI++T+IGNHMHKSHWKPIPCEGT
Sbjct  1278  ALAKDAKLAYPKGIAISSDNILYFADGTNIRMVDRDGIVSTLIGNHMHKSHWKPIPCEGT  1337

Query  1188  LNVEEVHLRWPTELAINPLDNSLHMIDDHMVLQLAPDGRVKVVAGRPLHCASPSSSFDTE  1247
             L +EE+HLRWPTELA++P+DN+LH+IDDHM+L++ PDGRV+V++GRPLHCA+ S+++DT+
Sbjct  1338  LKLEEMHLRWPTELAVSPMDNTLHIIDDHMILRMTPDGRVRVISGRPLHCATASTAYDTD  1397

Query  1248  LATHATLVMPQSIAFGPSGNLYIAESDSQRINRVRVIGTDGKISPYAGAESKCNCLERGC  1307
             LATHATLVMPQSIAFGP G LY+AESDSQRINRVRVIGTDG+I+P+AGAESKCNCLERGC
Sbjct  1398  LATHATLVMPQSIAFGPLGELYVAESDSQRINRVRVIGTDGRIAPFAGAESKCNCLERGC  1457

Query  1308  DCFDADHYLASTSKFNTISAVAVSPDGVVHIGDQANYRIRSVMASIPDASGAREYEIYSP  1367
             DCF+A+HYLA+++KFNTI+A+AV+PD  VHI DQANYRIRSVM+SIP+AS +REYEIY+P
Sbjct  1458  DCFEAEHYLATSAKFNTIAALAVTPDSHVHIADQANYRIRSVMSSIPEASPSREYEIYAP  1517

Query  1368  DTQEIYVFNRFGQHVATKNILTGEIVYQFTYNVNTSNGKLSTVTDAAGNKVFLLRDYSSQ  1427
             D QEIY+FNRFGQHV+T+NILTGE  Y FTYNVNTSNGKLSTVTDAAGNKVFLLRDY+SQ
Sbjct  1518  DMQEIYIFNRFGQHVSTRNILTGETTYVFTYNVNTSNGKLSTVTDAAGNKVFLLRDYTSQ  1577

Query  1428  VNSIENTKGQKCRLRMSRMKMLHELSTPDNYNVTFDYHGPTGLLKTKLDSTGRSYVYNYD  1487
             VNSIENTKGQKCRLRM+RMKMLHELSTPDNYNVT++YHGPTGLL+TKLDSTGRSYVYNYD
Sbjct  1578  VNSIENTKGQKCRLRMTRMKMLHELSTPDNYNVTYEYHGPTGLLRTKLDSTGRSYVYNYD  1637

Query  1488  EFGRLTSAVTPTGKVISLTFDLSLKGAVVKVGQNNRKPISMLIKGSSVVTKVGEAEQRTT  1547
             EFGRLTSAVTPTG+VI L+FDLS+KGA VKV +N +K +S+LI+G++V+ + G AE RTT
Sbjct  1638  EFGRLTSAVTPTGRVIELSFDLSVKGAQVKVSENAQKEMSLLIQGATVIVRNGAAESRTT  1697

Query  1548  VLSDGSVGQVTPWAHTVSTDTLPYSVLAEIEPLLGESYPVPAKQRTEIAGDLANRFEWRY  1607
             V  DGS   +TPW H +  +  PY++LAE  PLLGESYPVPAKQRTEIAGDLANRFEWRY
Sbjct  1698  VDMDGSTTSITPWGHNLQMEVAPYTILAEQSPLLGESYPVPAKQRTEIAGDLANRFEWRY  1757

Query  1608  FLRKFQ----GNKYRSESKTVAQVGRKLRINGDILLSLEYDRETNSVAVFMDDDAELLNV  1663
             F+R+ Q    G + +   + V +VGRKLR+NGD +L+LEYDRET SV V +DD  ELLNV
Sbjct  1758  FVRRQQPLQAGKQSKGPPRPVTEVGRKLRVNGDNVLTLEYDRETQSVVVMVDDKQELLNV  1817

Query  1664  TYDRTARPVKWGPRNGIFSGVELEYDRFSRLTSWTWGDISETYGFDRAGRLYEIKYSDGT  1723
             TYDRT+RP+ + P++G ++ V+LEYDRF RL SW WG + E Y FDR GRL EIKY DG+
Sbjct  1818  TYDRTSRPISFRPQSGDYADVDLEYDRFGRLVSWKWGVLQEAYSFDRNGRLNEIKYGDGS  1877

Query  1724  SMVYAFKDMFSSLPLKVTTPRGSDYLLQYDEAGALQSLTTPRGHIHAFSLQTSLGFYKYQ  1783
             +MVYAFKDMF SLPLKVTTPR SDYLLQYD+AGALQSLTTPRGHIHAFSLQTSLGF+KYQ
Sbjct  1878  TMVYAFKDMFGSLPLKVTTPRRSDYLLQYDDAGALQSLTTPRGHIHAFSLQTSLGFFKYQ  1937

Query  1784  YYSPMNRHPYEILYNDDGQILAKVYPHQSGKVAYVYDHTGKLETTLAGLSSIHYTYQETT  1843
             YYSP+NRHP+EILYND+GQILAK++PHQSGKVA+V+D  G+LET LAGLSS HYTYQ+TT
Sbjct  1938  YYSPINRHPFEILYNDEGQILAKIHPHQSGKVAFVHDTAGRLETILAGLSSTHYTYQDTT  1997

Query  1844  SLVHSIDINEPNFEMRIEYKYHAGIVKDEKIKFGSKSGLDNARYRYQYDGNARISGIEVD  1903
             SLV S+++ EP FE+R E+KYHAGI+KDEK++FGSK+ L +ARY+Y YDGNAR+SGIE+ 
Sbjct  1998  SLVKSVEVQEPGFELRREFKYHAGILKDEKLRFGSKNSLASARYKYAYDGNARLSGIEMA  2057

Query  1904  INGKQLPQLRLKYNQNLGILEGVGDLRIYRNLFNRSVMQDSSKQFFTVTDYDEHGRVKTV  1963
             I+ K+LP  R KY+QNLG LE V DL+I RN FNR+V+QDS+KQFF + DYD+HGRVK+V
Sbjct  2058  IDDKELPTTRYKYSQNLGQLEVVQDLKITRNAFNRTVIQDSAKQFFAIVDYDQHGRVKSV  2117

Query  1964  LMNIRSLDVFRMELEYDNRNRIKMRKLSIGKDAMEKKEWTKMEKITYNADGHVLEVADTE  2023
             LMN++++DVFR+EL+YD RNRIK +K + G+        T  +KI YNADGHV+EV  T 
Sbjct  2118  LMNVKNIDVFRLELDYDLRNRIKSQKTTFGRS-------TAFDKINYNADGHVVEVLGT-  2169

Query  2024  NNWQYAYDENGNVIGVTEHNEKIALGYDSGDRVVQYGDVEFNSYDGRGFVVIRGEHKYRY  2083
             NNW+Y +DENGN +GV +  EK  LGYD GDRV++ GDVEFN+YD RGFVV RGE KYRY
Sbjct  2170  NNWKYLFDENGNTVGVVDQGEKFNLGYDIGDRVIKVGDVEFNNYDARGFVVKRGEQKYRY  2229

Query  2084  NSRGQLIHASEHKKFQIWYFYDDRGRLVAWNDDRENITQFFYANPKTPDLITHIHFPKSS  2143
             N+RGQLIH+ E ++FQ WY+YDDR RLVAW+D++ N TQ++YANP+TP L+TH+HFPK S
Sbjct  2230  NNRGQLIHSFERERFQSWYYYDDRSRLVAWHDNKGNTTQYYYANPRTPHLVTHVHFPKIS  2289

Query  2144  KTFRFLYDSRNFLMTVETSEQRFYVATDQNGSPLALFDTNGNLIKEMRRTPFGKIIKDTN  2203
             +T +  YD R+ L+ +E  +QR+YVATDQNGSPLA FD NG+++KEM+RTPFG+IIKDT 
Sbjct  2290  RTMKLFYDDRDMLIALEHEDQRYYVATDQNGSPLAFFDQNGSIVKEMKRTPFGRIIKDTK  2349

Query  2204  PDFYLPIDFHGGLLDPNTKLVYLNKRLYDPTVGQWMTPAWEQMANELTTPTDIFIYRFRN  2263
             P+F++PIDFHGGL+DP+TKLVY  +R YDP VGQWMTP WE +A E++ PTD+FIYR+ N
Sbjct  2350  PEFFVPIDFHGGLIDPHTKLVYTEQRQYDPHVGQWMTPLWETLATEMSHPTDVFIYRYHN  2409

Query  2264  NDPINFKQNVEYMTDLASWLKLYGYDISAMLGSEYMKQMVYQPSATITSPQLTPDFGVMS  2323
             NDPIN  +   YM DL SWL+L+GYD++ M  S Y K   Y P A+I S  L PDFGV+S
Sbjct  2410  NDPINPNKPQNYMIDLDSWLQLFGYDLNNMQSSRYTKLAQYTPQASIKSNTLAPDFGVIS  2469

Query  2324  GLQCIVNRVHEKFSDLGFVPKPLLKLEPKTRNLLPRVAHRRAVFGEGILVSRVGGRSLVS  2383
             GL+CIV +  EKFSD  FVPKPLLK+EPK RNLLPRV++RR VFGEG+L+SR+GGR+LVS
Sbjct  2470  GLECIVEKTSEKFSDFDFVPKPLLKMEPKMRNLLPRVSYRRGVFGEGVLLSRIGGRALVS  2529

Query  2384  VVDGVNSVVQDVVTSVFNNSYFLPLHFSVHDQDVFYFVKDNALKIRDDMEELRRLGGMFN  2443
             VVDG NSVVQDVV+SVFNNSYFL LHFS+HDQDVFYFVKDN LK+RDD EELRRLGGMFN
Sbjct  2530  VVDGSNSVVQDVVSSVFNNSYFLDLHFSIHDQDVFYFVKDNVLKLRDDNEELRRLGGMFN  2589

Query  2444  VSTHETTEHGAGTWKELRLHNPDAAVVIKYGADPEQERHRILKHAHKRAVERAWEIEKQL  2503
             +STHE ++HG    KELRLH PDA V+IKYG DPEQERHRILKHAHKRAVERAWE+EKQL
Sbjct  2590  ISTHEISDHGGSAAKELRLHGPDAVVIIKYGVDPEQERHRILKHAHKRAVERAWELEKQL  2649

Query  2504  VMAGFQGRGDWSKEEKDELISRGTVSGYEGVDIHSVHRYPQLADDPGNVAFTRDTKRKRR  2563
             V AGFQGRGDW++EEK+EL+  G V G+ G+DIHS+H+YPQLADDPGNVAF RD KRKRR
Sbjct  2650  VAAGFQGRGDWTEEEKEELVQHGDVDGWNGIDIHSIHKYPQLADDPGNVAFQRDAKRKRR  2709

Query  2564  KSGN  2567
             K+G+
Sbjct  2710  KTGS  2713


>TENA_DROME unnamed protein product
Length=3004

 Score = 1119 bits (2894),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 514/1029 (50%), Positives = 698/1029 (68%), Gaps = 45/1029 (4%)

Query  312   SIKKEVTHYMEPGHWFLSLYNDDGDPQEVSFIAMIAEDMTHNCPNGCSGKGECLLGHCQC  371
             ++   +  Y++ G WF+S+YND+     VS +A  AE ++  CPN CSG+G C LG C C
Sbjct  518   TVNVSLLQYLDTGLWFISVYNDELVAHSVSLLAEEAEGVSTTCPNDCSGRGSCYLGKCDC  577

Query  372   NPGFGGEDCSESVCPVLCSQRGEYINGECQCNPGWKGKECSLRHDECEVPDCNGHGHCTN  431
               G+ G DCS+SVCPVLCS  G Y  G C C  GWKG EC +   ECEVP+C+ HG C  
Sbjct  578   IDGYQGVDCSKSVCPVLCSAHGHYGGGVCHCEEGWKGAECDIPVGECEVPNCSSHGRCIE  637

Query  432   GKCNCVRGYKGKYCEEVDCPHPTCSGHGFCAEGTCICKKGWKGADCSQMDKEALQCLPDC  491
             G+C+C RG+KG YC++ DC  P CSGHG C  G C CK GW+G DC  +D++  QCLP C
Sbjct  638   GECHCERGWKGPYCDQHDCLDPLCSGHGTCVAGQCYCKAGWQGEDCGTIDQQVYQCLPGC  697

Query  492   SGHGNFDLETQTCLCEPMWSGDDCSKELCDLDCGPHGHCVDNACDCLPGWSGELCNLKQC  551
             S HG +DLET  C+CE  W+G DCS+ +C LDCG +G C    C C  GW+G LC+   C
Sbjct  698   SEHGTYDLETGQCVCERHWTGPDCSQAVCSLDCGRNGVCESGKCRCNSGWTGNLCDQLPC  757

Query  552   DPRCNEHGQCKNGTCLCVTGWNGKHCTMEGCPNSCSGHGQCRVGNDGQWECRCYDGWDGK  611
             D RC+EHGQCKNGTC+C  GWNG+HCT+ GC N CS HGQC + N G++ C C +GW G+
Sbjct  758   DSRCSEHGQCKNGTCVCSQGWNGRHCTLPGCENGCSRHGQCTLEN-GEYRCDCIEGWAGR  816

Query  612   DCNVLLEQNCNDGRDNDKDGLIDCADPECCSNHICRSSQLCVSAPKPIDILLRKQPPAIT  671
             DC++ LE NC D  DND DG+ DC+D ECCS+  C    +C+S+  P+++LLRKQPP++T
Sbjct  817   DCSIALELNCKDNIDNDGDGMTDCSDSECCSHPACSEHIMCLSSNDPVEVLLRKQPPSVT  876

Query  672   ASFFERMKFLIDEGSLQNYARQETFNESMFWNHFNTSRSAVVRGRVVTHLGTGLMGVRVS  731
             ASF++R+KFLI+E S+Q+YA  + ++E         +R +V+RG+V+T  G G++G+RVS
Sbjct  877   ASFYQRVKFLIEENSVQSYAHMDEYSE---------NRVSVMRGQVITPQGLGIVGIRVS  927

Query  732   TSTPLE-GFTLTRDDGWFDLLVNGGGAVTLQFGRSPFKPQSHIVFVPWNEVVIIDKIVMS  790
                    GFTLTR  GWFD+LVNGGGAVTLQF RSPF+P +  VFVPWN +V++  + M 
Sbjct  928   VDRDSRFGFTLTRQGGWFDVLVNGGGAVTLQFQRSPFRPLTRTVFVPWNRIVVLPPVQMQ  987

Query  791   TAEEKQTS-----------------HIPY-----------ACAAHDYDLMKPVVLATWKH  822
              +++ +T+                  I Y            C  HD++ ++P +++TW  
Sbjct  988   LSDDDETTSRNIKVAPLNPALTFLNSIHYHTADEANDASKVCMDHDHEKLRPQLISTWMP  1047

Query  823   GFQGACPDKSAILAESQVIQESLQIPGTGLNLVYHSSRAAGYLSTIQLQLTPEVIPPTLN  882
                GA P K  I AE+Q++QES+QIPG+ L+L Y SS+A+GYLS ++++LT E IPPTL 
Sbjct  1048  NGVGAMPGKRVIFAETQIVQESIQIPGSDLHLTYQSSQASGYLSIVRMRLTGETIPPTLT  1107

Query  883   LIHLRITIEGILFEKTFEADPVIKFTYAWNRLNVYRQRVYGVTTAMVKVGYEYNDCKDII  942
              +H+ + IEG L  KT+EADP +  T+AWN+ NVYRQ+VYGVT A + VGY+++ C+  +
Sbjct  1108  HVHVGVEIEGALHVKTYEADPSLVHTFAWNKRNVYRQKVYGVTVARISVGYQHSTCQSPV  1167

Query  943   WDVQTTKLSGHDMSISEVGGWNLDIHHRYNFHEGILQKGDGSNIYLKQKPRVILTTMGDG  1002
             W  QT KL G+D+ IS++GGW LDIHH YNFHEGILQKGDGS +++K+ PR +   MG G
Sbjct  1168  WIAQTAKLQGYDVDISDIGGWGLDIHHHYNFHEGILQKGDGSTLHMKEYPRTVKVVMGTG  1227

Query  1003  HQRSLDCYD-CDRQAEASNQRLLAPVALATASDGSIFVGDFNLVRKILVDGTVRTVVRLN  1061
              QR L C D C+    A + +LL P+ALAT  DGS++VGDFNLVR+I  DG V T+++L+
Sbjct  1228  LQRPLTCPDYCN--GVAKDAKLLTPIALATGPDGSLYVGDFNLVRRITPDGKVYTILQLS  1285

Query  1062  ATRVSYRYHIALSPLDGSLYISDPESHQIIRVRDTNDYSEPDHNWETVVGSGERCLPGDE  1121
             AT+VSY+Y++A+SP DG LYISDPE HQI+R+       +P  N + VVGSG+RC+PGDE
Sbjct  1286  ATQVSYQYYLAVSPADGHLYISDPERHQILRLVRLEKVKDPSINSDPVVGSGQRCIPGDE  1345

Query  1122  AHCGDGALARDAKLAYPKGVAVSADNVLYFADGTNIRMVDRDGIITTVIGNHMHKSHWKP  1181
              +CGDG  A  A+L++PKG+A++AD  +Y ADGTNIR VD  G+I T+IG+H H +HW P
Sbjct  1346  GNCGDGGPALLARLSHPKGLAIAADRTMYIADGTNIRAVDPKGVIHTLIGHHGHHNHWSP  1405

Query  1182  IPCEGTLNVEEVHLRWPTELAINPLDNSLHMIDDHMVLQLAPDGRVKVVAGRPLHCASPS  1241
              PC GTL   +  L+WPT LA++PLD SLH IDD +VL+L  D +++VVAG PLHC++  
Sbjct  1406  APCSGTLMANQAQLQWPTGLALSPLDGSLHFIDDRLVLRLTSDMKIRVVAGTPLHCSNGG  1465

Query  1242  SSFDT-ELATHATLVMPQSIAFGPSGNLYIAESDSQRINRVRVIGTDGKISPYAGAESKC  1300
                   +      L    ++AF P GNLYIA+SDS+R+N +RV+ T G +  +AG +   
Sbjct  1466  QDGRVNKTGADNVLGTVLAMAFSPFGNLYIADSDSRRVNSIRVVDTAGNMRYFAGKQEGT  1525

Query  1301  NCLERGCDC  1309
                 + CDC
Sbjct  1526  G--SQTCDC  1532


 Score = 728 bits (1879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/1321 (32%), Positives = 699/1321 (53%), Gaps = 106/1321 (8%)

Query  1311  DADHYLASTSKFNTISAVAVSPDGVVHIGDQANYRIRSVMASIPDASGAREYEIYSPDTQ  1370
             +A+  L+S ++F  ISA+AV+ DGV+++ DQ +  + ++   +P      E+ I  P + 
Sbjct  1677  NAETLLSSNARFQAISAIAVAQDGVINVADQGSLHVLALEHYLPSHDENGEFHIPFPPSS  1736

Query  1371  EIYVFNRFGQHVATKNILTGEIVYQFTYNVNTSNGKLSTVTDAAGNKVFLLRDYSSQVNS  1430
             EIYVFNR+GQHVATK++ +G+  Y F Y+ NTS G+LSTVTDA+GNK+  LRDYS+ V+S
Sbjct  1737  EIYVFNRYGQHVATKDLTSGKTRYSFLYSKNTSFGRLSTVTDASGNKIQFLRDYSNVVSS  1796

Query  1431  IENTKGQKCRLRMSRMKMLHELSTPDNYNVTFDYHGPTGLLKTKLDSTGRSYVYNYDEFG  1490
             IENT+  K  ++++ + ++ +LS      +  DY   TGLL ++  S G +Y+Y YDEFG
Sbjct  1797  IENTQDHKSEIQINGIGIMTKLSEKGRQEIELDYDSNTGLLNSR-SSGGETYIYQYDEFG  1855

Query  1491  RLTSAVTPTGKVISLTFDLS-LKGAVVKVGQN-----NRKPIS-----MLIKGS--SVVT  1537
             R+T  + P+G+++ +T  L+  +G  V V  +     +R+ I+     +L+ G   S   
Sbjct  1856  RVTGMILPSGEIVRITSQLADSQGLTVYVHASVESLFSRERIAGEANELLVLGGVRSTFL  1915

Query  1538  KVGEAEQRTTVLSDGSVGQVTPWAHTVSTDTLPYSVLAEIEPLLGESYPVPAK-------  1590
             K G+A     + ++ ++       H  +   +  S +A   PLL  + PV A+       
Sbjct  1916  KRGQAHADAELKANNTL-----VIHGDNGVVVEASAVAR-HPLLEAALPVEAEMLAMWSH  1969

Query  1591  QRTEIAGDLANRFEWRYFLRKFQGNKYRSESKTVAQVGRKLRINGDILLSLEYDRETNSV  1650
             Q   +   L N     Y L        R+  +T   + R++ +N   ++ +E+D+ TN  
Sbjct  1970  QSVTMGEGLTNSMYSVYSLV----GDVRNPQQT---LNREIWVNQSRVIGVEFDQFTNRE  2022

Query  1651  AVFMDDDAELLNVTYDRTARPVKWGPRNGIFSGVELEYDRFSRLTSWTWGDISETYGFDR  1710
               +      +L V YD++  P  + P NG    V + YDRF+R+  W WG     Y +DR
Sbjct  2023  TFYDARRTPILIVAYDQSGLPKSYYPTNGY--PVNITYDRFNRVEGWAWGPAELKYSYDR  2080

Query  1711  AGRLYEIKYSDGTSMVYAFKDMFSSLPLKVTTPRGSDYLLQYDEAGALQSLTTPRGHIHA  1770
              G L EI       + + + D      + + + R   ++LQYD+AG L+ +  P G  H+
Sbjct  2081  HGLLSEITSQQDGIVSFVYNDWNLVSEIGLASQR--KFVLQYDDAGGLRHVVLPSGTRHS  2138

Query  1771  FSLQTSLGFYKYQYYSPMNRHPYEILYNDDGQILAKVYPHQSGKVAYVYDHTGKLETTLA  1830
             FS+QTS+GF +  Y  P +   Y   Y+  G +L  + P    ++ Y Y+  G+L   + 
Sbjct  2139  FSMQTSIGFIRCTYTPPGSTRAYLQHYSHAGALLQTILPGDGARIVYRYNAAGQLTEVVH  2198

Query  1831  GLSSIHYTYQETTSLVHSIDINEPNFEMRIEYKYHAGIVKDEKIKFGSKSGLDNARYRYQ  1890
             G     + Y E T +  ++   E   E R +++Y AG++ +E+I + +K+GL NA++ Y+
Sbjct  2199  GDGRSEFQYNEATGMPSTVSHTERELEYRWDFEYAAGLLAEERIDYVAKTGLSNAKFSYE  2258

Query  1891  YDGNARISGIEVDINGKQLPQLRLKYNQNLGILEGVGDLRIYRNLFNRSVMQDSSKQFFT  1950
             YD   R+  ++  I G+ LP     Y+   G    +G  R  +   N++ + D +  F  
Sbjct  2259  YDSQLRVVALQGRIGGQSLPTQAFAYDPRTGRPSLIGQFRFSQPAQNQTQLHDGTASFTR  2318

Query  1951  VTDYDEHGRVKT--VLMNIRSLDVFRMELEYDNRNRIKMRKLSIGKDAMEKKEWTKMEKI  2008
               D    GR +T  + + I  L+VFRME  Y    RI   +       M    +T ++  
Sbjct  2319  TVD----GRFQTQRMALAIHRLEVFRMEFSYGVHGRISQTRTYTRN--MAVNSYTNVKNY  2372

Query  2009  TYNADGHVLEVADTENNWQYAYDENGNVIGVTEHNEKIALGYDSGDRVVQYGDVEFNSYD  2068
             T++ DG ++ V + +  W + YD+NGN++ +T     I + Y++ DR+V++G+ ++  YD
Sbjct  2373  TWDCDGQLVGV-EAQEPWGFRYDDNGNLLSLTYRGNTIPMEYNAQDRIVKFGEGQYK-YD  2430

Query  2069  GRGFVVIRG-EHKYRYNSRGQLIHASEHKKFQIWYFYDDRGRLVAWNDDRENITQFFYAN  2127
              RG V     E ++ YN++G L+ AS+  +F + Y+YD   RL    D+  N+TQFFY N
Sbjct  2431  ARGLVAQNAREERFHYNTQGLLVRASKRGRFDVRYYYDHLKRLTTRKDNFGNVTQFFYTN  2490

Query  2128  PKTPDLITHIHFPKSSKTFRFLYDSRNFLMTVETSEQRFYVATDQNGSPLALFDTNGNLI  2187
              + P  ++ I+ P+  K     YD    L+  +    ++YVATDQ+G+PL LF+  G  I
Sbjct  2491  QQRPYEVSQIYSPRDGKLMSLTYDDVGHLIYAQVYRHKYYVATDQSGTPLMLFNQYGEGI  2550

Query  2188  KEMRRTPFGKIIKDTNPDFYLPIDFHGGLLDPNTKLVYL-NKRLYDPTVGQWMTPAWEQM  2246
             +E+ R+PFG I+ D+NP  YLPIDF GG+LD  T LV++ + R+YDP +GQWM+P W+++
Sbjct  2551  REIMRSPFGHIVYDSNPYLYLPIDFCGGILDQVTTLVHMGDGRVYDPLIGQWMSPDWQRV  2610

Query  2247  ANELTTPTDIFIYRFRNNDPINFKQNVEYMTDLASWLKLYGYDISAMLGSEYMKQMVYQP  2306
             A  + TPT + +YRF  NDPIN      Y  D A+W++  GY++  ++    + + ++QP
Sbjct  2611  AERIITPTRLHLYRFNGNDPINVGHERHYPEDFAAWMRTLGYNVGNLV--PQLARDLWQP  2668

Query  2307  SATITSPQLT-------------PDFGVMSGLQCIVN-RVHEKFSDLGFVPKPLLK---L  2349
              A    P                P   V SG    +N R    F  L   P+  LK   +
Sbjct  2669  PALWGRPPANPVALNLRRPFDNIPTMAVESGFLAHLNVRRMSDFEQLSAPPRSALKCDVM  2728

Query  2350  EPKTRNLLPRVAHRRAVFGEGILVSRVG-GRSLVSVVDGVNSVVQDVVTSVFNNSYFLPL  2408
             +P  + +    +     FG+GI+VSR   G+++VS V   N++ +DV TSVFN S  LP 
Sbjct  2729  DPSPKTI---GSDTEPPFGKGIVVSRTADGQAIVSSVPAANAIYRDVYTSVFNRSKLLPF  2785

Query  2409  HFSVHD--QDVFYFVKDNALKIRDDMEELRRLGGMFNVSTHETTEHG-------------  2453
              F VH+  QD F+FVK++A +  +D ++L+RL G  N + HE T                
Sbjct  2786  TFVVHNAQQDSFFFVKEDAWRATEDRQQLKRLQGQVNTTFHEITREATVGSGPAGAANGG  2845

Query  2454  ------------------AGTWKELRLHNPDAAVVIKYGADPEQERHRILKHAHKRAVER  2495
                                G + ++++H   A + ++YG    +E+ R++ HA   AV +
Sbjct  2846  AGSSSSSSSSSGGGSSSNTGNYLDVKIHGAHAIINLRYGTTVAKEQQRLMHHAKLTAVRK  2905

Query  2496  AWEIEKQLVMAGFQGRGDWSKEEKDELISRGTVSGYEGVDIHSVHRYPQLADDPGNVAFT  2555
             AW  EK+ + +G     +WS++E DE++ +   + YEG  IH V+ YP+LA+DP N+ F 
Sbjct  2906  AWHREKEALRSGLTTALEWSQQETDEILKQSYANNYEGEYIHDVNLYPELAEDPYNIKFV  2965

Query  2556  R  2556
             +
Sbjct  2966  K  2966


 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 35/54 (65%), Gaps = 0/54 (0%)

Query  243  IPPYSYWNMQFYQSEAAYVRFDYNIPRGASIGVYARRNALPTHTQYDLLEVLSG  296
            IP Y +W ++F     A++RF++ +P GA   VY+RRN  P+ TQ+D +E + G
Sbjct  367  IPAYQFWTLEFRNKHPAFIRFNFTLPWGAHFAVYSRRNVAPSVTQHDFVEFIKG  420


 Score = 33.1 bits (74),  Expect = 4.2, Method: Compositional matrix adjust.
 Identities = 15/42 (36%), Positives = 23/42 (55%), Gaps = 0/42 (0%)

Query  132  CSWKLIAMILLMVSLCITAALCYVIVSSIVNRSYQSTKACAV  173
            CSWK +++ L+ VS+ +TA L Y    S +  +  ST    V
Sbjct  162  CSWKCLSIALIFVSVVLTAMLAYFAAVSSMKPNMDSTNCILV  203


>TEN1_CAEEL unnamed protein product
Length=2684

 Score = 798 bits (2060),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 667/2537 (26%), Positives = 1138/2537 (45%), Gaps = 344/2537 (14%)

Query  221   RSFPPDGTTFAQVGLGQKLSKEIPPYSYWNMQFYQSEAAYVRFDYNIPRGASIGVYARRN  280
             R+ PP       + LG+++  E  P S    +   ++ + +RF+  +  GA + +     
Sbjct  270   RALPP------AISLGERVDVEFFPKSMATTELTVTKPSRIRFNATVGSGAQLVLLMSAG  323

Query  281   ALPTHTQYDLL---------------EVLSGFKARTTRA--------SHVSVIPSIKKEV  317
               P+ + +D L                ++  F +R+ R+         ++ ++       
Sbjct  324   VHPSLSLHDALFPIRADRIRDSKSPTHIVEEFGSRSRRSLGASSSRHRNIEILSPRSATF  383

Query  318   THYMEPGHWFLSLYNDDGDPQEVSFIAMIAEDMTHN---------------------CPN  356
               ++  G  +L+  N+    + +SF+A   +  T                       C +
Sbjct  384   EQFVLEGRHYLTFINERSRVEPISFVAEELQRPTTPPKTSSSGTSGAKEHPLASVLVCES  443

Query  357   GCSGKGECLLGHCQCNPGFGGEDCSESVCPVLCSQRGEYINGECQCNPGWKGKECSLRHD  416
              C+ +GEC+ G C C PGF G  C E+VCPV+CS  G +  G C C  G+KGKEC +RH+
Sbjct  444   NCNQRGECVHGKCHCAPGFTGRTCDEAVCPVVCSGNGVFSGGICVCKSGFKGKECEMRHN  503

Query  417   ECEVPDCNGHGHC-TNGKCNCVRGYKGKYCEEVDCPHPTCSGHGFCAEGTCICKKGWKGA  475
              CEV DCNG G C T+G+C C  G+ G+ CE   CPH +C   G C  GTC C  GW+G 
Sbjct  504   WCEVADCNGRGRCDTDGRCRCNPGWTGEACELRACPHASCHDRGVCVNGTCYCMDGWRGN  563

Query  476   DC--------------------------SQMDKEALQCLPD-------------------  490
             DC                          S+  K  ++  P                    
Sbjct  564   DCSVFADAIVHVPQAQSPPRRGQEPTESSKTRKAQVKPTPTSEKKKESRELQKPIIATVQ  623

Query  491   --------CSGHGNFDLETQTCLCEPMWSGDDCSKELCDLDCGPHGHCVDN-ACDCLPGW  541
                     CS HG   L    C CE  W   DCS++ C      +G C+D+ +C C  GW
Sbjct  624   VPTESSHPCSAHGQ--LIDDICQCESGWDSVDCSQQACQC---VNGDCLDDGSCQCWKGW  678

Query  542   SGELCNLKQCDPRCNEHGQC-KNGTCLCVTGWNGKHCTMEGCPNSCSGHGQCRVGN-DGQ  599
              G  C  K+C   C + G+C  +G+C C +GWNG++C ++GCPN CSG G+C +     +
Sbjct  679   RGSNCTDKKCAIGCEDRGKCASDGSCKCSSGWNGENCAIDGCPNQCSGKGECGMDRRSSE  738

Query  600   WECRCYDGWDGKDCNVLLEQNCNDGRDNDKDGLIDCADPECCSNHICRSSQLCVSAPKPI  659
             W CRC  G  G DC+V +E +C+DG DND DGLIDC DPECCS+  C S  +C +A  PI
Sbjct  739   WSCRCQAGSTGVDCSVSVEMHCDDGLDNDSDGLIDCDDPECCSSSSCSSESVCSTAASPI  798

Query  660   DILLRKQPPAITASFFERMKFLIDEGSLQNYARQETFNESMFWNHFNTSRSAVVRGRVV-  718
             ++L+R  PP   A+F +R+ FLI E S+Q+Y     FNE++          +V+RGRV+ 
Sbjct  799   EVLMR-MPPIFNANFAQRVGFLIMEKSVQSYTDSSQFNENLI---------SVIRGRVMW  848

Query  719   -------THLGT-------GLMGVRVSTST-PLEGFTLTRDDGWFDLLVNGGGAVTLQFG  763
                      L T        L+GVRVS +  PL GFTLTR+DG+FDL VNG  +VTLQF 
Sbjct  849   GGSPTGSDDLSTYSNKSTVPLVGVRVSDAAHPLYGFTLTREDGYFDLTVNGARSVTLQFL  908

Query  764   RSPFKPQSHIVFVPWNEVVIIDKIVMSTAEEKQTSHIPYA-----CAAHDYDLMKPVVLA  818
             R+ F+     VFV   +++ ID IV+          I  A     C+     +   V+++
Sbjct  909   RTQFQSVKKSVFVSPRQIIHIDDIVLYRQSGGSPPAISMAPARAKCSPTLRRIPDVVLIS  968

Query  819   TWKHGFQG----ACPDKSAILAESQVIQESLQIPGTGLNLVYHSSRAAGYLSTIQLQLTP  874
              W++   G       D S I+ +S+ I ESL I GT + LVY S+R+    ST+ + L  
Sbjct  969   NWQYTSDGIETDETSDSSRIVVDSRSIFESLPIQGTDVRLVYDSARSPAAPSTMLIGLLY  1028

Query  875   EVIPPTLNLIHLRITIEGILFEKTFEADPVIKFTYAWNRLNVYRQRVYGVTTAMVKVGYE  934
             + +   L  +H+ I I G  F++       + + +AW+++N YRQ   G+    V+VGYE
Sbjct  1029  DRVDKELRKVHINIRIAGRRFDRVLAPRTNLTYVFAWDKMNAYRQSESGLVPVTVRVGYE  1088

Query  935   YNDC---KDIIWDVQTTKLSGHDMSISEVGGWNLDIHHRYNFHEGILQKGDGS-NIYLKQ  990
             Y  C    + +W  + +++ G          W LDIHH  +    +++ G+G   +  + 
Sbjct  1089  YQGCDRTSERVWQTRRSQMMGATARKMIGTMWTLDIHHHLDIVNNVVEMGNGGYRLITES  1148

Query  991   KPRVILTTMGDGHQRSLDCYDCDRQAEASNQRLLAPVALATASDGSIFVGDFNLVRKILV  1050
             +PRV      DG +R ++C  C+ + ++ +  L  P  +  A DGS+ +GD N++R++  
Sbjct  1149  EPRVSTFAGLDGVKRDVECLKCEGKVDSIS--LFRPTTVVYAQDGSLIIGDHNMIRRVSQ  1206

Query  1051  DGTVRTVVRLNATRVSYRYHIALSPLDGSLYISDPESHQIIRVRDTNDYSEPDHNWETVV  1110
             DG V T++ L     S+ Y+IA+SP+DG++ IS P   Q+ R+  + +  +  +N++ + 
Sbjct  1207  DGQVSTILTLGLADTSHSYYIAVSPVDGTIAISLPLHKQVWRI-SSLEPQDSRNNYDVLA  1265

Query  1111  GSGERCLPGDEAHCGDGALARDAKLAYPKGVAVSADNVLYFADGTNIRMVDRDGIITTVI  1170
             G G  C    ++ CGDGALA++A+L +PKG++      LY AD   IR++D  G I + I
Sbjct  1266  GDGTVCASAVDS-CGDGALAQNAQLIFPKGISFDKMGNLYLADSRRIRVIDTTGHIRS-I  1323

Query  1171  GNHMHKSHWKPI-PCEGTLNVEEVHLRWPTELAINPLDNSLHMIDDHMVLQLAPDGRVKV  1229
             G      H  PI  C     + ++ + WPT L I+P+  S+ ++D ++V ++     V  
Sbjct  1324  GETTPDQH--PIRTCAQITKLVDLQMEWPTSLTIDPITGSVLVLDTNVVYEIDVVHDVVT  1381

Query  1230  VA-GRPLHC--ASPSSSFDTELATHATLVM--PQSIAFGPSGNLYIAESDSQRINRVRVI  1284
             +A G P  C  A+ +SS   +   H   ++   + I  G  G +Y+ ESD +R+N+VR +
Sbjct  1382  IALGSPTTCDLANATSSASAKSLDHRRHLIQNARDITVGTDGAIYVVESDGRRLNQVRKL  1441

Query  1285  GTD-GKISPYAGAESKCNCLERGCDCFDA---DHYLASTSKFNTISAVAVSPDGVVHIGD  1340
              +D    S   G +S C+C    C C DA       AS +  ++  AV VSP G V I D
Sbjct  1442  SSDRSTFSILTGGKSPCSCDVAACGCDDAVSLRDVAASQAHLSSPYAVCVSPSGDVIIAD  1501

Query  1341  QANYRIRSVMASIPDASG-AREYEIYSPDTQEIYVFNRFGQHVATKNILTGEIVYQFTYN  1399
               N +I+ V A +    G +R YE+   + QE Y FNR GQH +T +++TG   + F+Y 
Sbjct  1502  SGNSKIKKVSARMAKYDGRSRTYEVTDAERQEKYTFNRHGQHSSTVSLITGRTFFNFSYQ  1561

Query  1400  VNTSNGKLSTVTDAAGNKVFLLRDYSSQVNSIENTKGQKCRLRMS----RMKMLHELSTP  1455
             V++    +S +  A+G  + +L+   S  + +E T GQ+  L MS     ++ + +  + 
Sbjct  1562  VDSPISMISEIRAASGVVLRVLKRNDSLFD-LETTLGQRTTLTMSAYDGTLEQVSKRDSA  1620

Query  1456  DNYNVTFDYHGPTGLLKTKLDSTGRSYVYNYDEFGRLTSAVTPTGKVISLTFDLS---LK  1512
              + + T  ++   GLL +++D    +  + YDE+GR           I L  D     L 
Sbjct  1621  TSRDATKLFY-KKGLLTSRID-VATAVGFEYDEYGR----------AIGLKRDREYWRLG  1668

Query  1513  GAVVKVGQNNRKPI--------SMLIKGSSVVTKVGEAEQRTTVLSDGSVGQVTPWAHTV  1564
                + +G  N + +          L +G+  V     A  R   L +      +P    +
Sbjct  1669  EETISMGSVNTEVLLNGQRFQQVRLGEGNLAVHSTNGATTRLISLRNEGYSLASP----L  1724

Query  1565  STDTLPYSVLAEIEPLLGESYPVPAKQRTEIAG-------DLANRFEWRYFLRKFQGNKY  1617
              T TL Y   + I    GE  P+ +++RT++         +L  R++WR+  R+   +  
Sbjct  1725  GTSTL-YDKSSSIPDSNGE--PLISRRRTKVPAIGNPQRRELTTRWDWRHVARRGDDSDG  1781

Query  1618  RSESKTVAQVGRKLRINGDILLSLEYDRETNSVAVFM----DDDAELLNVTYDRTARPVK  1673
                 + VA+      ING  + S+EYD ++N   + +    DD   LL + Y  + R  +
Sbjct  1782  SLGRRKVAE------INGVNMFSMEYDVKSNQDTLRLGSTTDDAQALLFIDYTSSGRIRR  1835

Query  1674  W-GPRNGIFSGVELEYDRFSRLTSWTWGDISETYGFDRAGRLYEIKYSDGTSMVYAFKDM  1732
                P +   + + + +D   R +  TWG       +D + RL E    DG  +       
Sbjct  1836  ISAPEDSQMAEMNITWDGAGRKSEVTWGSWKIRLTYDNSNRLTEHAI-DGARVPIKMSYA  1894

Query  1733  FSSLPLKVTTPRGSDYLLQYDEAGALQSLTTPRGHIHAFSLQTSLGFYKY--QYYSPMNR  1790
              +S         G+ + +QYD    ++ + +      +FS   +LG  ++  +  + +N 
Sbjct  1895  GASRRPNEIQHDGAKWNIQYDNYDRIKEVISKSQEATSFS-SIALGGDEWVLKRRTSLNS  1953

Query  1791  HPYEILYNDDGQILAKVYPHQSGKVAYVYDHTGKLETTLAGLSSIHYTYQETTSLVHSID  1850
              P  +  + +G++L    P ++        +  + +  + G ++     +ETT +     
Sbjct  1954  KPSLVRLSREGKVLESTTPDEN-------HYWLERKDPITGRTTEILNDEETTVVTCWSP  2006

Query  1851  INEP------NFEMRIEYKYHAGIVKDEKIKFGSKSGLD-NARYRYQYDGNARISGIEVD  1903
                P      N +     + H    K   I   + S     + + Y+YD   R++ I+  
Sbjct  2007  EGAPMCSRSRNLQENTTMQGHLVARKSVTIMTPTSSEPSITSSFTYEYDDMLRVTTIQPV  2066

Query  1904  INGKQLPQLRLKYNQNLGILEGVGDLRIYRNLFN-----RSVMQDSSKQFFTVTDYDEHG  1958
             I    L  ++L Y++  G +  +   +  R+          +M ++SK      D+ +  
Sbjct  2067  IEQSVLESIQLSYDERRGHVAAINGFKWARDASTSRCQGHGLMYETSK----ANDHRQVV  2122

Query  1959  RVKTVLMNIR-SLDVFRMELEYDNRNRIKMRKLSIGKDAMEKKEWTKMEKITYNADGHVL  2017
               K +  + R S+ + R     D   R     L I     ++ +  K+ + T++A G   
Sbjct  2123  ERKLIFGDARASIKIIR-----DKAGRASESHLEISSSGTQRNQ--KITR-TFDAAGR--  2172

Query  2018  EVADTENNWQYAYDENGNVIGVTEHNEKIALGYDSGDRVVQYGDVEFNSYDGRGFVVIRG  2077
              VA  E N Q       N     E      + ++ G  +  + D+ +   D  G+VV R 
Sbjct  2173  -VASVEQNDQEPVRIIWNSDARVEKINDRVVEWNRGGALKTFQDISYQ-VDSIGWVVKRD  2230

Query  2078  EHK-YRYNSRGQLIHASEHKKFQIWYFYDDRGRLVAWNDDRENITQFFYANPKTPDLITH  2136
                 + Y+ +G+L+ A    + +I  FYD   R+V   + ++ I  F+Y    TP L++ 
Sbjct  2231  NTTVFGYDGKGRLVSA-RSSQLRINIFYDREDRVVQIQNSKDFI-HFYYGYIDTPKLVS-  2287

Query  2137  IHFPKSSKTFRFLYDSRNFLMTVETSE-QRFYVATDQNGSPLALFDTNGNLIKEMRRTPF  2195
              HF K+ K     YD  +    +++ +  R+ + TD+  +  A+   + N+++ + R+ F
Sbjct  2288  -HFSKNGKISTLFYDDDSVPFAMQSDDGTRYALLTDETSTIKAIIG-DSNVLRIIDRSVF  2345

Query  2196  GKIIKDTNPDF-YLPIDFHGGLLDPNTKLVYLNK-RLYDPTVGQWMTPAWE-----QMAN  2248
             G ++  ++    +LPI + GG+      +  LN  R  D    ++M+ + E     ++  
Sbjct  2346  GALLPSSSSSHPFLPIGYLGGIEISEISVSILNNGRPLDLYSERYMSISPEAVVRLELNE  2405

Query  2249  ELTTPTDIFIYRFRNNDPINFKQNVEYMTDLASWLKLYGYDISAMLGSEYMKQMVYQPSA  2308
             + +   D+      +  P   +   E   D  +W  L G                     
Sbjct  2406  KFSNSIDLMALEI-DRQPFRVENVPE---DFETWFSLAGL--------------------  2441

Query  2309  TITSPQLTPDFGV-MSGLQCIVNRVHEKFSDLGFVPKPLLKLEPKTRNLLPRVAHRRAV-  2366
                SP L P   + +     IV+R+   F      P+ L  L   T  L  R+A   ++ 
Sbjct  2442  ---SPNLLPSAHLGLPASSAIVHRLLSSF------PRKLRPLTHLTTVLPTRLASDISLT  2492

Query  2367  --------------FGEGILVSR--VGGRSLVSVVDGVNSVVQDVVTSVFNNSYFLPLHF  2410
                           F   ++++     G  +V ++  + S  ++V++ +F+    L    
Sbjct  2493  SPTSETSWSIDDVGFSNLLILNEDATTGEVMVEMLSDLKSEEREVISKLFDGVKSL----  2548

Query  2411  SVHDQDVFYFVKDNALKIRDDMEELRRLGGMFNVSTHETTEHGAGTWKE-LRLHNPDAAV  2469
                D   +  V    L         R       +S+   +       K+ + L N  + +
Sbjct  2549  ---DFATWGLVPTRHL--------WRAPNSKLELSSTSFSHFTMAVNKDSVELRNGKSKI  2597

Query  2470  VIKYGADPEQERHRILKHAHKRAVERAWEIEKQLVMAGFQGRGDWSKEEKDELISRGTVS  2529
             V+ +  +  +   +I++    R     W  E++   AG +    WS  E  EL S+G+VS
Sbjct  2598  VVHFSENKAEIVKKIVEELKTRENIAVWRAERKRAEAGEKTWRQWSDRETRELTSKGSVS  2657

Query  2530  GYEGVDIHSVHRYPQLA  2546
             GY+ +++   H+   LA
Sbjct  2658  GYD-IEMKPAHQSGLLA  2673



Lambda      K        H
   0.312    0.129    0.360 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4048251568


Query= XP_050469449.1 teneurin-m isoform X7 [Bombus huntii]

Length=2569
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TENM_DROME  unnamed protein product                                   3876    0.0  
TENA_DROME  unnamed protein product                                   1119    0.0  
H1ZUX0_CAEEL  unnamed protein product                                 796     0.0  


>TENM_DROME unnamed protein product
Length=2731

 Score = 3876 bits (10051),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1848/2646 (70%), Positives = 2167/2646 (82%), Gaps = 124/2646 (5%)

Query  5     GCLLDNSAPRGPPDVPPRNPTMSRV-NGRLPGSHAASDHERDPDLQPSCLVRTSSGGFYS  63
             G LL+   P  PPDVPPRNPTMSR+ NGRL       ++  D D +PSCLVRT SG  Y 
Sbjct  101   GFLLEGVTPTAPPDVPPRNPTMSRMQNGRL-----TVNNPNDADFEPSCLVRTPSGNVY-  154

Query  64    IPKIPKNEYN--------NKNQSTGNSPIKVEL-------QNNMDRVPLPYGHAPSMIPM  108
                IP    N         K+ S  ++P K  L       Q  M  V LP     + +P 
Sbjct  155   ---IPSGNLNINKGSPIDFKSGSACSTPTKDTLKGYERSTQGCMGPV-LPQRSVMNGLPA  210

Query  109   RRQSIRCHFVKG-VDWCS--W-------KLIAMILLMVSLCITAAL-------CYVIV--  149
                S   +F K  V  CS  W        L A +++++ L  T  +       C V+V  
Sbjct  211   HHYSAPMNFRKDLVARCSSPWFGIGSISVLFAFVVMLILLTTTGVIKWNQSPPCSVLVGN  270

Query  150   ---------------SSIVNRSYQSTKACAVLVGENSDTKPLSSDGNK------TSSSAT  188
                            S + N S ++     + + +       +  G+       T ++AT
Sbjct  271   EASEVTAAKSTNTDLSKLHNSSVRAKNGQGIGLAQGQSGLGAAGVGSGGGSSAATVTTAT  330

Query  189   ASSSQSSG----------------------------RTRQQASSGGARTFPARSFPPDGT  220
             ++S  + G                             +   A++GGARTFPARSFPPDGT
Sbjct  331   SNSGTAQGLQSTSASAEATSSAATSSSQSSLTPSLSSSLANANNGGARTFPARSFPPDGT  390

Query  221   TFAQVGLGQKLSKEIPPYSYWNMQFYQSEAAYVRFDYNIPRGASIGVYARRNALPTHTQY  280
             TF Q+ LGQKL+KEI PYSYWNMQFYQSE AYV+FDY IPRGASIGVY RRNALPTHTQY
Sbjct  391   TFGQITLGQKLTKEIQPYSYWNMQFYQSEPAYVKFDYTIPRGASIGVYGRRNALPTHTQY  450

Query  281   DLLEVLSGFKA--RTTRASHVSVIPSIKKEVTHYMEPGHWFLSLYNDDGDPQEVSFIAMI  338
                EVLSGF A  RT RA+H+S    I +EVT YMEPGHWF+SLYNDDGD QE++F A +
Sbjct  451   HFKEVLSGFSASTRTARAAHLS----ITREVTRYMEPGHWFVSLYNDDGDVQELTFYAAV  506

Query  339   AEDMTHNCPNGCSGKGECLLGHCQCNPGFGGEDCSESVCPVLCSQRGEYINGECQCNPGW  398
             AEDMT NCPNGCSG G+CLLGHCQCNPGFGG+DCSESVCPVLCSQ GEY NGEC CNPGW
Sbjct  507   AEDMTQNCPNGCSGNGQCLLGHCQCNPGFGGDDCSESVCPVLCSQHGEYTNGECICNPGW  566

Query  399   KGKECSLRHDECEVPDCNGHGHCTNGKCNCVRGYKGKYCEEVDCPHPTCSGHGFCAEGTC  458
             KGKECSLRHDECEV DC+GHGHC +GKC C+RGYKGK+CEEVDCPHP CSGHGFCA+GTC
Sbjct  567   KGKECSLRHDECEVADCSGHGHCVSGKCQCMRGYKGKFCEEVDCPHPNCSGHGFCADGTC  626

Query  459   ICKKGWKGADCSQMDKEALQCLPDCSGHGNFDLETQTCLCEPMWSGDDCSKELCDLDCGP  518
             ICKKGWKG DC+ MD++ALQCLPDCSGHG FDL+TQTC CE  WSGDDCSKELCDLDCG 
Sbjct  627   ICKKGWKGPDCATMDQDALQCLPDCSGHGTFDLDTQTCTCEAKWSGDDCSKELCDLDCGQ  686

Query  519   HGHCVDNACDCLPGWSGELCNLKQCDPRCNEHGQCKNGTCLCVTGWNGKHCTMEGCPNSC  578
             HG C  +AC C P W GE CN + CD RCNEHGQCKNGTCLCVTGWNGKHCT+EGCPNSC
Sbjct  687   HGRCEGDACACDPEWGGEYCNTRLCDVRCNEHGQCKNGTCLCVTGWNGKHCTIEGCPNSC  746

Query  579   SGHGQCRVGNDGQWECRCYDGWDGKDCNVLLEQNCNDGRDNDKDGLIDCADPECCSNHIC  638
             +GHGQCRV  +GQWECRCY+GWDG DC + LE NC D +DNDKDGL+DC DPECC++H+C
Sbjct  747   AGHGQCRVSGEGQWECRCYEGWDGPDCGIALELNCGDSKDNDKDGLVDCEDPECCASHVC  806

Query  639   RSSQLCVSAPKPIDILLRKQPPAITASFFERMKFLIDEGSLQNYARQETFNESMFWNHFN  698
             ++SQLCVSAPKPID+LLRKQPPAITASFFERMKFLIDE SLQNYA+ ETFNES       
Sbjct  807   KTSQLCVSAPKPIDVLLRKQPPAITASFFERMKFLIDESSLQNYAKLETFNES-------  859

Query  699   TSRSAVVRGRVVTHLGTGLMGVRVSTSTPLEGFTLTRDDGWFDLLVNGGGAVTLQFGRSP  758
               RSAV+RGRVVT LG GL+GVRVST+T LEGFTLTRDDGWFDL+VNGGGAVTLQFGR+P
Sbjct  860   --RSAVIRGRVVTSLGMGLVGVRVSTTTLLEGFTLTRDDGWFDLMVNGGGAVTLQFGRAP  917

Query  759   FKPQSHIVFVPWNEVVIIDKIVMSTAEEKQTS-HIPYACAAHDYDLMKPVVLATWKHGFQ  817
             F+PQS IV VPWNEVVIID +VMS +EEK  +    + C AHDYDLMKPVVLA+WKHGFQ
Sbjct  918   FRPQSRIVQVPWNEVVIIDLVVMSMSEEKGLAVTTTHTCFAHDYDLMKPVVLASWKHGFQ  977

Query  818   GACPDKSAILAESQVIQESLQIPGTGLNLVYHSSRAAGYLSTIQLQLTPEVIPPTLNLIH  877
             GACPD+SAILAESQVIQESLQIPGTGLNLVYHSSRAAGYLSTI+LQLTP+VIP +L+LIH
Sbjct  978   GACPDRSAILAESQVIQESLQIPGTGLNLVYHSSRAAGYLSTIKLQLTPDVIPTSLHLIH  1037

Query  878   LRITIEGILFEKTFEADPVIKFTYAWNRLNVYRQRVYGVTTAMVKVGYEYNDCKDIIWDV  937
             LRITIEGILFE+ FEADP IKFTYAWNRLN+YRQRVYGVTTA+VKVGY+Y DC DI+WD+
Sbjct  1038  LRITIEGILFERIFEADPGIKFTYAWNRLNIYRQRVYGVTTAVVKVGYQYTDCTDIVWDI  1097

Query  938   QTTKLSGHDMSISEVGGWNLDIHHRYNFHEGILQKGDGSNIYLKQKPRVILTTMGDGHQR  997
             QTTKLSGHDMSISEVGGWNLDIHHRYNFHEGILQKGDGSNIYL+ KPR+ILTTMGDGHQR
Sbjct  1098  QTTKLSGHDMSISEVGGWNLDIHHRYNFHEGILQKGDGSNIYLRNKPRIILTTMGDGHQR  1157

Query  998   SLDCYDCDRQAEASNQRLLAPVALATASDGSIFVGDFNLVRKILVDGTVRTVVRLNATRV  1057
              L+C DCD QA  + QRLLAPVALA A DGS+FVGDFN +R+I+ DG++RTVV+LNATRV
Sbjct  1158  PLECPDCDGQA--TKQRLLAPVALAAAPDGSLFVGDFNYIRRIMTDGSIRTVVKLNATRV  1215

Query  1058  SYRYHIALSPLDGSLYISDPESHQIIRVRDTNDYSEPDHNWETVVGSGERCLPGDEAHCG  1117
             SYRYH+ALSPLDG+LY+SDPESHQIIRVRDTNDYS+P+ NWE VVGSGERCLPGDEAHCG
Sbjct  1216  SYRYHMALSPLDGTLYVSDPESHQIIRVRDTNDYSQPELNWEAVVGSGERCLPGDEAHCG  1275

Query  1118  DGALARDAKLAYPKGVAVSADNVLYFADGTNIRMVDRDGIITTVIGNHMHKSHWKPIPCE  1177
             DGALA+DAKLAYPKG+A+S+DN+LYFADGTNIRMVDRDGI++T+IGNHMHKSHWKPIPCE
Sbjct  1276  DGALAKDAKLAYPKGIAISSDNILYFADGTNIRMVDRDGIVSTLIGNHMHKSHWKPIPCE  1335

Query  1178  GTLNVEEVHLRWPTELAINPLDNSLHMIDDHMVLQLAPDGRVKVVAGRPLHCASPSSSFD  1237
             GTL +EE+HLRWPTELA++P+DN+LH+IDDHM+L++ PDGRV+V++GRPLHCA+ S+++D
Sbjct  1336  GTLKLEEMHLRWPTELAVSPMDNTLHIIDDHMILRMTPDGRVRVISGRPLHCATASTAYD  1395

Query  1238  TELATHATLVMPQSIAFGPSGNLYIAESDSQRINRVRVIGTDGKISPYAGAESKCNCLER  1297
             T+LATHATLVMPQSIAFGP G LY+AESDSQRINRVRVIGTDG+I+P+AGAESKCNCLER
Sbjct  1396  TDLATHATLVMPQSIAFGPLGELYVAESDSQRINRVRVIGTDGRIAPFAGAESKCNCLER  1455

Query  1298  GCDCFDADHYLASTSKFNTISAVAVSPDGVVHIGDQANYRIRSVMASIPDASGAREYEIY  1357
             GCDCF+A+HYLA+++KFNTI+A+AV+PD  VHI DQANYRIRSVM+SIP+AS +REYEIY
Sbjct  1456  GCDCFEAEHYLATSAKFNTIAALAVTPDSHVHIADQANYRIRSVMSSIPEASPSREYEIY  1515

Query  1358  SPDTQEIYVFNRFGQHVATKNILTGEIVYQFTYNVNTSNGKLSTVTDAAGNKVFLLRDYS  1417
             +PD QEIY+FNRFGQHV+T+NILTGE  Y FTYNVNTSNGKLSTVTDAAGNKVFLLRDY+
Sbjct  1516  APDMQEIYIFNRFGQHVSTRNILTGETTYVFTYNVNTSNGKLSTVTDAAGNKVFLLRDYT  1575

Query  1418  SQVNSIENTKGQKCRLRMSRMKMLHELSTPDNYNVTFDYHGPTGLLKTKLDSTGRSYVYN  1477
             SQVNSIENTKGQKCRLRM+RMKMLHELSTPDNYNVT++YHGPTGLL+TKLDSTGRSYVYN
Sbjct  1576  SQVNSIENTKGQKCRLRMTRMKMLHELSTPDNYNVTYEYHGPTGLLRTKLDSTGRSYVYN  1635

Query  1478  YDEFGRLTSAVTPTGKVISLTFDLSLKGAVVKVGQNNRKPISMLIKGSSVVTKVGEAEQR  1537
             YDEFGRLTSAVTPTG+VI L+FDLS+KGA VKV +N +K +S+LI+G++V+ + G AE R
Sbjct  1636  YDEFGRLTSAVTPTGRVIELSFDLSVKGAQVKVSENAQKEMSLLIQGATVIVRNGAAESR  1695

Query  1538  TTVLSDGSVGQVTPWAHTVSTDTLPYSVLAEIEPLLGESYPVPAKQRTEIAGDLANRFEW  1597
             TTV  DGS   +TPW H +  +  PY++LAE  PLLGESYPVPAKQRTEIAGDLANRFEW
Sbjct  1696  TTVDMDGSTTSITPWGHNLQMEVAPYTILAEQSPLLGESYPVPAKQRTEIAGDLANRFEW  1755

Query  1598  RYFLRKFQ----GNKYRSESKTVAQVGRKLRINGDILLSLEYDRETNSVAVFMDDDAELL  1653
             RYF+R+ Q    G + +   + V +VGRKLR+NGD +L+LEYDRET SV V +DD  ELL
Sbjct  1756  RYFVRRQQPLQAGKQSKGPPRPVTEVGRKLRVNGDNVLTLEYDRETQSVVVMVDDKQELL  1815

Query  1654  NVTYDRTARPVKWGPRNGIFSGVELEYDRFSRLTSWTWGDISETYGFDRAGRLYEIKYSD  1713
             NVTYDRT+RP+ + P++G ++ V+LEYDRF RL SW WG + E Y FDR GRL EIKY D
Sbjct  1816  NVTYDRTSRPISFRPQSGDYADVDLEYDRFGRLVSWKWGVLQEAYSFDRNGRLNEIKYGD  1875

Query  1714  GTSMVYAFKDMFSSLPLKVTTPRGSDYLLQYDEAGALQSLTTPRGHIHAFSLQTSLGFYK  1773
             G++MVYAFKDMF SLPLKVTTPR SDYLLQYD+AGALQSLTTPRGHIHAFSLQTSLGF+K
Sbjct  1876  GSTMVYAFKDMFGSLPLKVTTPRRSDYLLQYDDAGALQSLTTPRGHIHAFSLQTSLGFFK  1935

Query  1774  YQYYSPMNRHPYEILYNDDGQILAKVYPHQSGKVAYVYDHTGKLETTLAGLSSIHYTYQE  1833
             YQYYSP+NRHP+EILYND+GQILAK++PHQSGKVA+V+D  G+LET LAGLSS HYTYQ+
Sbjct  1936  YQYYSPINRHPFEILYNDEGQILAKIHPHQSGKVAFVHDTAGRLETILAGLSSTHYTYQD  1995

Query  1834  TTSLVHSIDINEPNFEMRIEYKYHAGIVKDEKIKFGSKSGLDNARYRYQYDGNARISGIE  1893
             TTSLV S+++ EP FE+R E+KYHAGI+KDEK++FGSK+ L +ARY+Y YDGNAR+SGIE
Sbjct  1996  TTSLVKSVEVQEPGFELRREFKYHAGILKDEKLRFGSKNSLASARYKYAYDGNARLSGIE  2055

Query  1894  VDINGKQLPQLRLKYNQNLGILEGVGDLRIYRNLFNRSVMQDSSKQFFTVTDYDEHGRVK  1953
             + I+ K+LP  R KY+QNLG LE V DL+I RN FNR+V+QDS+KQFF + DYD+HGRVK
Sbjct  2056  MAIDDKELPTTRYKYSQNLGQLEVVQDLKITRNAFNRTVIQDSAKQFFAIVDYDQHGRVK  2115

Query  1954  TVLMNIRSLDVFRMELEYDNRNRIKMRKLSIGKDAMEKKEWTKMEKITYNADGHVLEVAD  2013
             +VLMN++++DVFR+EL+YD RNRIK +K + G+        T  +KI YNADGHV+EV  
Sbjct  2116  SVLMNVKNIDVFRLELDYDLRNRIKSQKTTFGRS-------TAFDKINYNADGHVVEVLG  2168

Query  2014  TENNWQYAYDENGNVIGVTEHNEKIALGYDSGDRVVQYGDVEFNSYDGRGFVVIRGEHKY  2073
             T NNW+Y +DENGN +GV +  EK  LGYD GDRV++ GDVEFN+YD RGFVV RGE KY
Sbjct  2169  T-NNWKYLFDENGNTVGVVDQGEKFNLGYDIGDRVIKVGDVEFNNYDARGFVVKRGEQKY  2227

Query  2074  RYNSRGQLIHASEHKKFQIWYFYDDRGRLVAWNDDRENITQFFYANPKTPDLITHIHFPK  2133
             RYN+RGQLIH+ E ++FQ WY+YDDR RLVAW+D++ N TQ++YANP+TP L+TH+HFPK
Sbjct  2228  RYNNRGQLIHSFERERFQSWYYYDDRSRLVAWHDNKGNTTQYYYANPRTPHLVTHVHFPK  2287

Query  2134  SSKTFRFLYDSRNFLMTVETSEQRFYVATDQNGSPLALFDTNGNLIKEMRRTPFGKIIKD  2193
              S+T +  YD R+ L+ +E  +QR+YVATDQNGSPLA FD NG+++KEM+RTPFG+IIKD
Sbjct  2288  ISRTMKLFYDDRDMLIALEHEDQRYYVATDQNGSPLAFFDQNGSIVKEMKRTPFGRIIKD  2347

Query  2194  TNPDFYLPIDFHGGLLDPNTKLVYLNKRLYDPTVGQWMTPAWEQMANELTTPTDIFIYRF  2253
             T P+F++PIDFHGGL+DP+TKLVY  +R YDP VGQWMTP WE +A E++ PTD+FIYR+
Sbjct  2348  TKPEFFVPIDFHGGLIDPHTKLVYTEQRQYDPHVGQWMTPLWETLATEMSHPTDVFIYRY  2407

Query  2254  RNNDPINFKQNVEYMTDLASWLKLYGYDISAMLGSEYMKQMVYQPSATITSPQLTPDFGV  2313
              NNDPIN  +   YM DL SWL+L+GYD++ M  S Y K   Y P A+I S  L PDFGV
Sbjct  2408  HNNDPINPNKPQNYMIDLDSWLQLFGYDLNNMQSSRYTKLAQYTPQASIKSNTLAPDFGV  2467

Query  2314  MSGLQCIVNRVHEKFSDLGFVPKPLLKLEPKTRNLLPRVAHRRAVFGEGILVSRVGGRSL  2373
             +SGL+CIV +  EKFSD  FVPKPLLK+EPK RNLLPRV++RR VFGEG+L+SR+GGR+L
Sbjct  2468  ISGLECIVEKTSEKFSDFDFVPKPLLKMEPKMRNLLPRVSYRRGVFGEGVLLSRIGGRAL  2527

Query  2374  VSVVDGVNSVVQDVVTSVFNNSYFLPLHFSVHDQDVFYFVKDNALKIRDDMEELRRLGGM  2433
             VSVVDG NSVVQDVV+SVFNNSYFL LHFS+HDQDVFYFVKDN LK+RDD EELRRLGGM
Sbjct  2528  VSVVDGSNSVVQDVVSSVFNNSYFLDLHFSIHDQDVFYFVKDNVLKLRDDNEELRRLGGM  2587

Query  2434  FNVSTHETTEHGAGTWKELRLHNPDAAVVIKYGADPEQERHRILKHAHKRAVERAWEIEK  2493
             FN+STHE ++HG    KELRLH PDA V+IKYG DPEQERHRILKHAHKRAVERAWE+EK
Sbjct  2588  FNISTHEISDHGGSAAKELRLHGPDAVVIIKYGVDPEQERHRILKHAHKRAVERAWELEK  2647

Query  2494  QLVMAGFQGRGDWSKEEKDELISRGTVSGYEGVDIHSVHRYPQLADDPGNVAFTRDTKRK  2553
             QLV AGFQGRGDW++EEK+EL+  G V G+ G+DIHS+H+YPQLADDPGNVAF RD KRK
Sbjct  2648  QLVAAGFQGRGDWTEEEKEELVQHGDVDGWNGIDIHSIHKYPQLADDPGNVAFQRDAKRK  2707

Query  2554  RRKSGN  2559
             RRK+G+
Sbjct  2708  RRKTGS  2713


>TENA_DROME unnamed protein product
Length=3004

 Score = 1119 bits (2895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 514/1029 (50%), Positives = 698/1029 (68%), Gaps = 45/1029 (4%)

Query  304   SIKKEVTHYMEPGHWFLSLYNDDGDPQEVSFIAMIAEDMTHNCPNGCSGKGECLLGHCQC  363
             ++   +  Y++ G WF+S+YND+     VS +A  AE ++  CPN CSG+G C LG C C
Sbjct  518   TVNVSLLQYLDTGLWFISVYNDELVAHSVSLLAEEAEGVSTTCPNDCSGRGSCYLGKCDC  577

Query  364   NPGFGGEDCSESVCPVLCSQRGEYINGECQCNPGWKGKECSLRHDECEVPDCNGHGHCTN  423
               G+ G DCS+SVCPVLCS  G Y  G C C  GWKG EC +   ECEVP+C+ HG C  
Sbjct  578   IDGYQGVDCSKSVCPVLCSAHGHYGGGVCHCEEGWKGAECDIPVGECEVPNCSSHGRCIE  637

Query  424   GKCNCVRGYKGKYCEEVDCPHPTCSGHGFCAEGTCICKKGWKGADCSQMDKEALQCLPDC  483
             G+C+C RG+KG YC++ DC  P CSGHG C  G C CK GW+G DC  +D++  QCLP C
Sbjct  638   GECHCERGWKGPYCDQHDCLDPLCSGHGTCVAGQCYCKAGWQGEDCGTIDQQVYQCLPGC  697

Query  484   SGHGNFDLETQTCLCEPMWSGDDCSKELCDLDCGPHGHCVDNACDCLPGWSGELCNLKQC  543
             S HG +DLET  C+CE  W+G DCS+ +C LDCG +G C    C C  GW+G LC+   C
Sbjct  698   SEHGTYDLETGQCVCERHWTGPDCSQAVCSLDCGRNGVCESGKCRCNSGWTGNLCDQLPC  757

Query  544   DPRCNEHGQCKNGTCLCVTGWNGKHCTMEGCPNSCSGHGQCRVGNDGQWECRCYDGWDGK  603
             D RC+EHGQCKNGTC+C  GWNG+HCT+ GC N CS HGQC + N G++ C C +GW G+
Sbjct  758   DSRCSEHGQCKNGTCVCSQGWNGRHCTLPGCENGCSRHGQCTLEN-GEYRCDCIEGWAGR  816

Query  604   DCNVLLEQNCNDGRDNDKDGLIDCADPECCSNHICRSSQLCVSAPKPIDILLRKQPPAIT  663
             DC++ LE NC D  DND DG+ DC+D ECCS+  C    +C+S+  P+++LLRKQPP++T
Sbjct  817   DCSIALELNCKDNIDNDGDGMTDCSDSECCSHPACSEHIMCLSSNDPVEVLLRKQPPSVT  876

Query  664   ASFFERMKFLIDEGSLQNYARQETFNESMFWNHFNTSRSAVVRGRVVTHLGTGLMGVRVS  723
             ASF++R+KFLI+E S+Q+YA  + ++E         +R +V+RG+V+T  G G++G+RVS
Sbjct  877   ASFYQRVKFLIEENSVQSYAHMDEYSE---------NRVSVMRGQVITPQGLGIVGIRVS  927

Query  724   TSTPLE-GFTLTRDDGWFDLLVNGGGAVTLQFGRSPFKPQSHIVFVPWNEVVIIDKIVMS  782
                    GFTLTR  GWFD+LVNGGGAVTLQF RSPF+P +  VFVPWN +V++  + M 
Sbjct  928   VDRDSRFGFTLTRQGGWFDVLVNGGGAVTLQFQRSPFRPLTRTVFVPWNRIVVLPPVQMQ  987

Query  783   TAEEKQTS-----------------HIPY-----------ACAAHDYDLMKPVVLATWKH  814
              +++ +T+                  I Y            C  HD++ ++P +++TW  
Sbjct  988   LSDDDETTSRNIKVAPLNPALTFLNSIHYHTADEANDASKVCMDHDHEKLRPQLISTWMP  1047

Query  815   GFQGACPDKSAILAESQVIQESLQIPGTGLNLVYHSSRAAGYLSTIQLQLTPEVIPPTLN  874
                GA P K  I AE+Q++QES+QIPG+ L+L Y SS+A+GYLS ++++LT E IPPTL 
Sbjct  1048  NGVGAMPGKRVIFAETQIVQESIQIPGSDLHLTYQSSQASGYLSIVRMRLTGETIPPTLT  1107

Query  875   LIHLRITIEGILFEKTFEADPVIKFTYAWNRLNVYRQRVYGVTTAMVKVGYEYNDCKDII  934
              +H+ + IEG L  KT+EADP +  T+AWN+ NVYRQ+VYGVT A + VGY+++ C+  +
Sbjct  1108  HVHVGVEIEGALHVKTYEADPSLVHTFAWNKRNVYRQKVYGVTVARISVGYQHSTCQSPV  1167

Query  935   WDVQTTKLSGHDMSISEVGGWNLDIHHRYNFHEGILQKGDGSNIYLKQKPRVILTTMGDG  994
             W  QT KL G+D+ IS++GGW LDIHH YNFHEGILQKGDGS +++K+ PR +   MG G
Sbjct  1168  WIAQTAKLQGYDVDISDIGGWGLDIHHHYNFHEGILQKGDGSTLHMKEYPRTVKVVMGTG  1227

Query  995   HQRSLDCYD-CDRQAEASNQRLLAPVALATASDGSIFVGDFNLVRKILVDGTVRTVVRLN  1053
              QR L C D C+    A + +LL P+ALAT  DGS++VGDFNLVR+I  DG V T+++L+
Sbjct  1228  LQRPLTCPDYCN--GVAKDAKLLTPIALATGPDGSLYVGDFNLVRRITPDGKVYTILQLS  1285

Query  1054  ATRVSYRYHIALSPLDGSLYISDPESHQIIRVRDTNDYSEPDHNWETVVGSGERCLPGDE  1113
             AT+VSY+Y++A+SP DG LYISDPE HQI+R+       +P  N + VVGSG+RC+PGDE
Sbjct  1286  ATQVSYQYYLAVSPADGHLYISDPERHQILRLVRLEKVKDPSINSDPVVGSGQRCIPGDE  1345

Query  1114  AHCGDGALARDAKLAYPKGVAVSADNVLYFADGTNIRMVDRDGIITTVIGNHMHKSHWKP  1173
              +CGDG  A  A+L++PKG+A++AD  +Y ADGTNIR VD  G+I T+IG+H H +HW P
Sbjct  1346  GNCGDGGPALLARLSHPKGLAIAADRTMYIADGTNIRAVDPKGVIHTLIGHHGHHNHWSP  1405

Query  1174  IPCEGTLNVEEVHLRWPTELAINPLDNSLHMIDDHMVLQLAPDGRVKVVAGRPLHCASPS  1233
              PC GTL   +  L+WPT LA++PLD SLH IDD +VL+L  D +++VVAG PLHC++  
Sbjct  1406  APCSGTLMANQAQLQWPTGLALSPLDGSLHFIDDRLVLRLTSDMKIRVVAGTPLHCSNGG  1465

Query  1234  SSFDT-ELATHATLVMPQSIAFGPSGNLYIAESDSQRINRVRVIGTDGKISPYAGAESKC  1292
                   +      L    ++AF P GNLYIA+SDS+R+N +RV+ T G +  +AG +   
Sbjct  1466  QDGRVNKTGADNVLGTVLAMAFSPFGNLYIADSDSRRVNSIRVVDTAGNMRYFAGKQEGT  1525

Query  1293  NCLERGCDC  1301
                 + CDC
Sbjct  1526  G--SQTCDC  1532


 Score = 729 bits (1881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/1321 (32%), Positives = 699/1321 (53%), Gaps = 106/1321 (8%)

Query  1303  DADHYLASTSKFNTISAVAVSPDGVVHIGDQANYRIRSVMASIPDASGAREYEIYSPDTQ  1362
             +A+  L+S ++F  ISA+AV+ DGV+++ DQ +  + ++   +P      E+ I  P + 
Sbjct  1677  NAETLLSSNARFQAISAIAVAQDGVINVADQGSLHVLALEHYLPSHDENGEFHIPFPPSS  1736

Query  1363  EIYVFNRFGQHVATKNILTGEIVYQFTYNVNTSNGKLSTVTDAAGNKVFLLRDYSSQVNS  1422
             EIYVFNR+GQHVATK++ +G+  Y F Y+ NTS G+LSTVTDA+GNK+  LRDYS+ V+S
Sbjct  1737  EIYVFNRYGQHVATKDLTSGKTRYSFLYSKNTSFGRLSTVTDASGNKIQFLRDYSNVVSS  1796

Query  1423  IENTKGQKCRLRMSRMKMLHELSTPDNYNVTFDYHGPTGLLKTKLDSTGRSYVYNYDEFG  1482
             IENT+  K  ++++ + ++ +LS      +  DY   TGLL ++  S G +Y+Y YDEFG
Sbjct  1797  IENTQDHKSEIQINGIGIMTKLSEKGRQEIELDYDSNTGLLNSR-SSGGETYIYQYDEFG  1855

Query  1483  RLTSAVTPTGKVISLTFDLS-LKGAVVKVGQN-----NRKPIS-----MLIKGS--SVVT  1529
             R+T  + P+G+++ +T  L+  +G  V V  +     +R+ I+     +L+ G   S   
Sbjct  1856  RVTGMILPSGEIVRITSQLADSQGLTVYVHASVESLFSRERIAGEANELLVLGGVRSTFL  1915

Query  1530  KVGEAEQRTTVLSDGSVGQVTPWAHTVSTDTLPYSVLAEIEPLLGESYPVPAK-------  1582
             K G+A     + ++ ++       H  +   +  S +A   PLL  + PV A+       
Sbjct  1916  KRGQAHADAELKANNTL-----VIHGDNGVVVEASAVAR-HPLLEAALPVEAEMLAMWSH  1969

Query  1583  QRTEIAGDLANRFEWRYFLRKFQGNKYRSESKTVAQVGRKLRINGDILLSLEYDRETNSV  1642
             Q   +   L N     Y L        R+  +T   + R++ +N   ++ +E+D+ TN  
Sbjct  1970  QSVTMGEGLTNSMYSVYSLV----GDVRNPQQT---LNREIWVNQSRVIGVEFDQFTNRE  2022

Query  1643  AVFMDDDAELLNVTYDRTARPVKWGPRNGIFSGVELEYDRFSRLTSWTWGDISETYGFDR  1702
               +      +L V YD++  P  + P NG    V + YDRF+R+  W WG     Y +DR
Sbjct  2023  TFYDARRTPILIVAYDQSGLPKSYYPTNGY--PVNITYDRFNRVEGWAWGPAELKYSYDR  2080

Query  1703  AGRLYEIKYSDGTSMVYAFKDMFSSLPLKVTTPRGSDYLLQYDEAGALQSLTTPRGHIHA  1762
              G L EI       + + + D      + + + R   ++LQYD+AG L+ +  P G  H+
Sbjct  2081  HGLLSEITSQQDGIVSFVYNDWNLVSEIGLASQR--KFVLQYDDAGGLRHVVLPSGTRHS  2138

Query  1763  FSLQTSLGFYKYQYYSPMNRHPYEILYNDDGQILAKVYPHQSGKVAYVYDHTGKLETTLA  1822
             FS+QTS+GF +  Y  P +   Y   Y+  G +L  + P    ++ Y Y+  G+L   + 
Sbjct  2139  FSMQTSIGFIRCTYTPPGSTRAYLQHYSHAGALLQTILPGDGARIVYRYNAAGQLTEVVH  2198

Query  1823  GLSSIHYTYQETTSLVHSIDINEPNFEMRIEYKYHAGIVKDEKIKFGSKSGLDNARYRYQ  1882
             G     + Y E T +  ++   E   E R +++Y AG++ +E+I + +K+GL NA++ Y+
Sbjct  2199  GDGRSEFQYNEATGMPSTVSHTERELEYRWDFEYAAGLLAEERIDYVAKTGLSNAKFSYE  2258

Query  1883  YDGNARISGIEVDINGKQLPQLRLKYNQNLGILEGVGDLRIYRNLFNRSVMQDSSKQFFT  1942
             YD   R+  ++  I G+ LP     Y+   G    +G  R  +   N++ + D +  F  
Sbjct  2259  YDSQLRVVALQGRIGGQSLPTQAFAYDPRTGRPSLIGQFRFSQPAQNQTQLHDGTASFTR  2318

Query  1943  VTDYDEHGRVKT--VLMNIRSLDVFRMELEYDNRNRIKMRKLSIGKDAMEKKEWTKMEKI  2000
               D    GR +T  + + I  L+VFRME  Y    RI   +       M    +T ++  
Sbjct  2319  TVD----GRFQTQRMALAIHRLEVFRMEFSYGVHGRISQTRTYTRN--MAVNSYTNVKNY  2372

Query  2001  TYNADGHVLEVADTENNWQYAYDENGNVIGVTEHNEKIALGYDSGDRVVQYGDVEFNSYD  2060
             T++ DG ++ V + +  W + YD+NGN++ +T     I + Y++ DR+V++G+ ++  YD
Sbjct  2373  TWDCDGQLVGV-EAQEPWGFRYDDNGNLLSLTYRGNTIPMEYNAQDRIVKFGEGQYK-YD  2430

Query  2061  GRGFVVIRG-EHKYRYNSRGQLIHASEHKKFQIWYFYDDRGRLVAWNDDRENITQFFYAN  2119
              RG V     E ++ YN++G L+ AS+  +F + Y+YD   RL    D+  N+TQFFY N
Sbjct  2431  ARGLVAQNAREERFHYNTQGLLVRASKRGRFDVRYYYDHLKRLTTRKDNFGNVTQFFYTN  2490

Query  2120  PKTPDLITHIHFPKSSKTFRFLYDSRNFLMTVETSEQRFYVATDQNGSPLALFDTNGNLI  2179
              + P  ++ I+ P+  K     YD    L+  +    ++YVATDQ+G+PL LF+  G  I
Sbjct  2491  QQRPYEVSQIYSPRDGKLMSLTYDDVGHLIYAQVYRHKYYVATDQSGTPLMLFNQYGEGI  2550

Query  2180  KEMRRTPFGKIIKDTNPDFYLPIDFHGGLLDPNTKLVYL-NKRLYDPTVGQWMTPAWEQM  2238
             +E+ R+PFG I+ D+NP  YLPIDF GG+LD  T LV++ + R+YDP +GQWM+P W+++
Sbjct  2551  REIMRSPFGHIVYDSNPYLYLPIDFCGGILDQVTTLVHMGDGRVYDPLIGQWMSPDWQRV  2610

Query  2239  ANELTTPTDIFIYRFRNNDPINFKQNVEYMTDLASWLKLYGYDISAMLGSEYMKQMVYQP  2298
             A  + TPT + +YRF  NDPIN      Y  D A+W++  GY++  ++    + + ++QP
Sbjct  2611  AERIITPTRLHLYRFNGNDPINVGHERHYPEDFAAWMRTLGYNVGNLV--PQLARDLWQP  2668

Query  2299  SATITSPQLT-------------PDFGVMSGLQCIVN-RVHEKFSDLGFVPKPLLK---L  2341
              A    P                P   V SG    +N R    F  L   P+  LK   +
Sbjct  2669  PALWGRPPANPVALNLRRPFDNIPTMAVESGFLAHLNVRRMSDFEQLSAPPRSALKCDVM  2728

Query  2342  EPKTRNLLPRVAHRRAVFGEGILVSRVG-GRSLVSVVDGVNSVVQDVVTSVFNNSYFLPL  2400
             +P  + +    +     FG+GI+VSR   G+++VS V   N++ +DV TSVFN S  LP 
Sbjct  2729  DPSPKTI---GSDTEPPFGKGIVVSRTADGQAIVSSVPAANAIYRDVYTSVFNRSKLLPF  2785

Query  2401  HFSVHD--QDVFYFVKDNALKIRDDMEELRRLGGMFNVSTHETTEHG-------------  2445
              F VH+  QD F+FVK++A +  +D ++L+RL G  N + HE T                
Sbjct  2786  TFVVHNAQQDSFFFVKEDAWRATEDRQQLKRLQGQVNTTFHEITREATVGSGPAGAANGG  2845

Query  2446  ------------------AGTWKELRLHNPDAAVVIKYGADPEQERHRILKHAHKRAVER  2487
                                G + ++++H   A + ++YG    +E+ R++ HA   AV +
Sbjct  2846  AGSSSSSSSSSGGGSSSNTGNYLDVKIHGAHAIINLRYGTTVAKEQQRLMHHAKLTAVRK  2905

Query  2488  AWEIEKQLVMAGFQGRGDWSKEEKDELISRGTVSGYEGVDIHSVHRYPQLADDPGNVAFT  2547
             AW  EK+ + +G     +WS++E DE++ +   + YEG  IH V+ YP+LA+DP N+ F 
Sbjct  2906  AWHREKEALRSGLTTALEWSQQETDEILKQSYANNYEGEYIHDVNLYPELAEDPYNIKFV  2965

Query  2548  R  2548
             +
Sbjct  2966  K  2966


 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 35/54 (65%), Gaps = 0/54 (0%)

Query  235  IPPYSYWNMQFYQSEAAYVRFDYNIPRGASIGVYARRNALPTHTQYDLLEVLSG  288
            IP Y +W ++F     A++RF++ +P GA   VY+RRN  P+ TQ+D +E + G
Sbjct  367  IPAYQFWTLEFRNKHPAFIRFNFTLPWGAHFAVYSRRNVAPSVTQHDFVEFIKG  420


 Score = 33.1 bits (74),  Expect = 4.1, Method: Compositional matrix adjust.
 Identities = 15/42 (36%), Positives = 23/42 (55%), Gaps = 0/42 (0%)

Query  124  CSWKLIAMILLMVSLCITAALCYVIVSSIVNRSYQSTKACAV  165
            CSWK +++ L+ VS+ +TA L Y    S +  +  ST    V
Sbjct  162  CSWKCLSIALIFVSVVLTAMLAYFAAVSSMKPNMDSTNCILV  203


>H1ZUX0_CAEEL unnamed protein product
Length=2837

 Score = 796 bits (2057),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 667/2537 (26%), Positives = 1138/2537 (45%), Gaps = 344/2537 (14%)

Query  213   RSFPPDGTTFAQVGLGQKLSKEIPPYSYWNMQFYQSEAAYVRFDYNIPRGASIGVYARRN  272
             R+ PP       + LG+++  E  P S    +   ++ + +RF+  +  GA + +     
Sbjct  423   RALPP------AISLGERVDVEFFPKSMATTELTVTKPSRIRFNATVGSGAQLVLLMSAG  476

Query  273   ALPTHTQYDLL---------------EVLSGFKARTTRA--------SHVSVIPSIKKEV  309
               P+ + +D L                ++  F +R+ R+         ++ ++       
Sbjct  477   VHPSLSLHDALFPIRADRIRDSKSPTHIVEEFGSRSRRSLGASSSRHRNIEILSPRSATF  536

Query  310   THYMEPGHWFLSLYNDDGDPQEVSFIAMIAEDMTHN---------------------CPN  348
               ++  G  +L+  N+    + +SF+A   +  T                       C +
Sbjct  537   EQFVLEGRHYLTFINERSRVEPISFVAEELQRPTTPPKTSSSGTSGAKEHPLASVLVCES  596

Query  349   GCSGKGECLLGHCQCNPGFGGEDCSESVCPVLCSQRGEYINGECQCNPGWKGKECSLRHD  408
              C+ +GEC+ G C C PGF G  C E+VCPV+CS  G +  G C C  G+KGKEC +RH+
Sbjct  597   NCNQRGECVHGKCHCAPGFTGRTCDEAVCPVVCSGNGVFSGGICVCKSGFKGKECEMRHN  656

Query  409   ECEVPDCNGHGHC-TNGKCNCVRGYKGKYCEEVDCPHPTCSGHGFCAEGTCICKKGWKGA  467
              CEV DCNG G C T+G+C C  G+ G+ CE   CPH +C   G C  GTC C  GW+G 
Sbjct  657   WCEVADCNGRGRCDTDGRCRCNPGWTGEACELRACPHASCHDRGVCVNGTCYCMDGWRGN  716

Query  468   DC--------------------------SQMDKEALQCLPD-------------------  482
             DC                          S+  K  ++  P                    
Sbjct  717   DCSVFADAIVHVPQAQSPPRRGQEPTESSKTRKAQVKPTPTSEKKKESRELQKPIIATVQ  776

Query  483   --------CSGHGNFDLETQTCLCEPMWSGDDCSKELCDLDCGPHGHCVDN-ACDCLPGW  533
                     CS HG   L    C CE  W   DCS++ C      +G C+D+ +C C  GW
Sbjct  777   VPTESSHPCSAHGQ--LIDDICQCESGWDSVDCSQQACQC---VNGDCLDDGSCQCWKGW  831

Query  534   SGELCNLKQCDPRCNEHGQC-KNGTCLCVTGWNGKHCTMEGCPNSCSGHGQCRVGN-DGQ  591
              G  C  K+C   C + G+C  +G+C C +GWNG++C ++GCPN CSG G+C +     +
Sbjct  832   RGSNCTDKKCAIGCEDRGKCASDGSCKCSSGWNGENCAIDGCPNQCSGKGECGMDRRSSE  891

Query  592   WECRCYDGWDGKDCNVLLEQNCNDGRDNDKDGLIDCADPECCSNHICRSSQLCVSAPKPI  651
             W CRC  G  G DC+V +E +C+DG DND DGLIDC DPECCS+  C S  +C +A  PI
Sbjct  892   WSCRCQAGSTGVDCSVSVEMHCDDGLDNDSDGLIDCDDPECCSSSSCSSESVCSTAASPI  951

Query  652   DILLRKQPPAITASFFERMKFLIDEGSLQNYARQETFNESMFWNHFNTSRSAVVRGRVV-  710
             ++L+R  PP   A+F +R+ FLI E S+Q+Y     FNE++          +V+RGRV+ 
Sbjct  952   EVLMR-MPPIFNANFAQRVGFLIMEKSVQSYTDSSQFNENLI---------SVIRGRVMW  1001

Query  711   -------THLGT-------GLMGVRVSTST-PLEGFTLTRDDGWFDLLVNGGGAVTLQFG  755
                      L T        L+GVRVS +  PL GFTLTR+DG+FDL VNG  +VTLQF 
Sbjct  1002  GGSPTGSDDLSTYSNKSTVPLVGVRVSDAAHPLYGFTLTREDGYFDLTVNGARSVTLQFL  1061

Query  756   RSPFKPQSHIVFVPWNEVVIIDKIVMSTAEEKQTSHIPYA-----CAAHDYDLMKPVVLA  810
             R+ F+     VFV   +++ ID IV+          I  A     C+     +   V+++
Sbjct  1062  RTQFQSVKKSVFVSPRQIIHIDDIVLYRQSGGSPPAISMAPARAKCSPTLRRIPDVVLIS  1121

Query  811   TWKHGFQG----ACPDKSAILAESQVIQESLQIPGTGLNLVYHSSRAAGYLSTIQLQLTP  866
              W++   G       D S I+ +S+ I ESL I GT + LVY S+R+    ST+ + L  
Sbjct  1122  NWQYTSDGIETDETSDSSRIVVDSRSIFESLPIQGTDVRLVYDSARSPAAPSTMLIGLLY  1181

Query  867   EVIPPTLNLIHLRITIEGILFEKTFEADPVIKFTYAWNRLNVYRQRVYGVTTAMVKVGYE  926
             + +   L  +H+ I I G  F++       + + +AW+++N YRQ   G+    V+VGYE
Sbjct  1182  DRVDKELRKVHINIRIAGRRFDRVLAPRTNLTYVFAWDKMNAYRQSESGLVPVTVRVGYE  1241

Query  927   YNDC---KDIIWDVQTTKLSGHDMSISEVGGWNLDIHHRYNFHEGILQKGDGS-NIYLKQ  982
             Y  C    + +W  + +++ G          W LDIHH  +    +++ G+G   +  + 
Sbjct  1242  YQGCDRTSERVWQTRRSQMMGATARKMIGTMWTLDIHHHLDIVNNVVEMGNGGYRLITES  1301

Query  983   KPRVILTTMGDGHQRSLDCYDCDRQAEASNQRLLAPVALATASDGSIFVGDFNLVRKILV  1042
             +PRV      DG +R ++C  C+ + ++ +  L  P  +  A DGS+ +GD N++R++  
Sbjct  1302  EPRVSTFAGLDGVKRDVECLKCEGKVDSIS--LFRPTTVVYAQDGSLIIGDHNMIRRVSQ  1359

Query  1043  DGTVRTVVRLNATRVSYRYHIALSPLDGSLYISDPESHQIIRVRDTNDYSEPDHNWETVV  1102
             DG V T++ L     S+ Y+IA+SP+DG++ IS P   Q+ R+  + +  +  +N++ + 
Sbjct  1360  DGQVSTILTLGLADTSHSYYIAVSPVDGTIAISLPLHKQVWRI-SSLEPQDSRNNYDVLA  1418

Query  1103  GSGERCLPGDEAHCGDGALARDAKLAYPKGVAVSADNVLYFADGTNIRMVDRDGIITTVI  1162
             G G  C    ++ CGDGALA++A+L +PKG++      LY AD   IR++D  G I + I
Sbjct  1419  GDGTVCASAVDS-CGDGALAQNAQLIFPKGISFDKMGNLYLADSRRIRVIDTTGHIRS-I  1476

Query  1163  GNHMHKSHWKPI-PCEGTLNVEEVHLRWPTELAINPLDNSLHMIDDHMVLQLAPDGRVKV  1221
             G      H  PI  C     + ++ + WPT L I+P+  S+ ++D ++V ++     V  
Sbjct  1477  GETTPDQH--PIRTCAQITKLVDLQMEWPTSLTIDPITGSVLVLDTNVVYEIDVVHDVVT  1534

Query  1222  VA-GRPLHC--ASPSSSFDTELATHATLVM--PQSIAFGPSGNLYIAESDSQRINRVRVI  1276
             +A G P  C  A+ +SS   +   H   ++   + I  G  G +Y+ ESD +R+N+VR +
Sbjct  1535  IALGSPTTCDLANATSSASAKSLDHRRHLIQNARDITVGTDGAIYVVESDGRRLNQVRKL  1594

Query  1277  GTD-GKISPYAGAESKCNCLERGCDCFDA---DHYLASTSKFNTISAVAVSPDGVVHIGD  1332
              +D    S   G +S C+C    C C DA       AS +  ++  AV VSP G V I D
Sbjct  1595  SSDRSTFSILTGGKSPCSCDVAACGCDDAVSLRDVAASQAHLSSPYAVCVSPSGDVIIAD  1654

Query  1333  QANYRIRSVMASIPDASG-AREYEIYSPDTQEIYVFNRFGQHVATKNILTGEIVYQFTYN  1391
               N +I+ V A +    G +R YE+   + QE Y FNR GQH +T +++TG   + F+Y 
Sbjct  1655  SGNSKIKKVSARMAKYDGRSRTYEVTDAERQEKYTFNRHGQHSSTVSLITGRTFFNFSYQ  1714

Query  1392  VNTSNGKLSTVTDAAGNKVFLLRDYSSQVNSIENTKGQKCRLRMS----RMKMLHELSTP  1447
             V++    +S +  A+G  + +L+   S  + +E T GQ+  L MS     ++ + +  + 
Sbjct  1715  VDSPISMISEIRAASGVVLRVLKRNDSLFD-LETTLGQRTTLTMSAYDGTLEQVSKRDSA  1773

Query  1448  DNYNVTFDYHGPTGLLKTKLDSTGRSYVYNYDEFGRLTSAVTPTGKVISLTFDLS---LK  1504
              + + T  ++   GLL +++D    +  + YDE+GR           I L  D     L 
Sbjct  1774  TSRDATKLFY-KKGLLTSRID-VATAVGFEYDEYGR----------AIGLKRDREYWRLG  1821

Query  1505  GAVVKVGQNNRKPI--------SMLIKGSSVVTKVGEAEQRTTVLSDGSVGQVTPWAHTV  1556
                + +G  N + +          L +G+  V     A  R   L +      +P    +
Sbjct  1822  EETISMGSVNTEVLLNGQRFQQVRLGEGNLAVHSTNGATTRLISLRNEGYSLASP----L  1877

Query  1557  STDTLPYSVLAEIEPLLGESYPVPAKQRTEIAG-------DLANRFEWRYFLRKFQGNKY  1609
              T TL Y   + I    GE  P+ +++RT++         +L  R++WR+  R+   +  
Sbjct  1878  GTSTL-YDKSSSIPDSNGE--PLISRRRTKVPAIGNPQRRELTTRWDWRHVARRGDDSDG  1934

Query  1610  RSESKTVAQVGRKLRINGDILLSLEYDRETNSVAVFM----DDDAELLNVTYDRTARPVK  1665
                 + VA+      ING  + S+EYD ++N   + +    DD   LL + Y  + R  +
Sbjct  1935  SLGRRKVAE------INGVNMFSMEYDVKSNQDTLRLGSTTDDAQALLFIDYTSSGRIRR  1988

Query  1666  W-GPRNGIFSGVELEYDRFSRLTSWTWGDISETYGFDRAGRLYEIKYSDGTSMVYAFKDM  1724
                P +   + + + +D   R +  TWG       +D + RL E    DG  +       
Sbjct  1989  ISAPEDSQMAEMNITWDGAGRKSEVTWGSWKIRLTYDNSNRLTEHAI-DGARVPIKMSYA  2047

Query  1725  FSSLPLKVTTPRGSDYLLQYDEAGALQSLTTPRGHIHAFSLQTSLGFYKY--QYYSPMNR  1782
              +S         G+ + +QYD    ++ + +      +FS   +LG  ++  +  + +N 
Sbjct  2048  GASRRPNEIQHDGAKWNIQYDNYDRIKEVISKSQEATSFS-SIALGGDEWVLKRRTSLNS  2106

Query  1783  HPYEILYNDDGQILAKVYPHQSGKVAYVYDHTGKLETTLAGLSSIHYTYQETTSLVHSID  1842
              P  +  + +G++L    P ++        +  + +  + G ++     +ETT +     
Sbjct  2107  KPSLVRLSREGKVLESTTPDEN-------HYWLERKDPITGRTTEILNDEETTVVTCWSP  2159

Query  1843  INEP------NFEMRIEYKYHAGIVKDEKIKFGSKSGLD-NARYRYQYDGNARISGIEVD  1895
                P      N +     + H    K   I   + S     + + Y+YD   R++ I+  
Sbjct  2160  EGAPMCSRSRNLQENTTMQGHLVARKSVTIMTPTSSEPSITSSFTYEYDDMLRVTTIQPV  2219

Query  1896  INGKQLPQLRLKYNQNLGILEGVGDLRIYRNLFN-----RSVMQDSSKQFFTVTDYDEHG  1950
             I    L  ++L Y++  G +  +   +  R+          +M ++SK      D+ +  
Sbjct  2220  IEQSVLESIQLSYDERRGHVAAINGFKWARDASTSRCQGHGLMYETSK----ANDHRQVV  2275

Query  1951  RVKTVLMNIR-SLDVFRMELEYDNRNRIKMRKLSIGKDAMEKKEWTKMEKITYNADGHVL  2009
               K +  + R S+ + R     D   R     L I     ++ +  K+ + T++A G   
Sbjct  2276  ERKLIFGDARASIKIIR-----DKAGRASESHLEISSSGTQRNQ--KITR-TFDAAGR--  2325

Query  2010  EVADTENNWQYAYDENGNVIGVTEHNEKIALGYDSGDRVVQYGDVEFNSYDGRGFVVIRG  2069
              VA  E N Q       N     E      + ++ G  +  + D+ +   D  G+VV R 
Sbjct  2326  -VASVEQNDQEPVRIIWNSDARVEKINDRVVEWNRGGALKTFQDISYQ-VDSIGWVVKRD  2383

Query  2070  EHK-YRYNSRGQLIHASEHKKFQIWYFYDDRGRLVAWNDDRENITQFFYANPKTPDLITH  2128
                 + Y+ +G+L+ A    + +I  FYD   R+V   + ++ I  F+Y    TP L++ 
Sbjct  2384  NTTVFGYDGKGRLVSA-RSSQLRINIFYDREDRVVQIQNSKDFI-HFYYGYIDTPKLVS-  2440

Query  2129  IHFPKSSKTFRFLYDSRNFLMTVETSE-QRFYVATDQNGSPLALFDTNGNLIKEMRRTPF  2187
              HF K+ K     YD  +    +++ +  R+ + TD+  +  A+   + N+++ + R+ F
Sbjct  2441  -HFSKNGKISTLFYDDDSVPFAMQSDDGTRYALLTDETSTIKAIIG-DSNVLRIIDRSVF  2498

Query  2188  GKIIKDTNPDF-YLPIDFHGGLLDPNTKLVYLNK-RLYDPTVGQWMTPAWE-----QMAN  2240
             G ++  ++    +LPI + GG+      +  LN  R  D    ++M+ + E     ++  
Sbjct  2499  GALLPSSSSSHPFLPIGYLGGIEISEISVSILNNGRPLDLYSERYMSISPEAVVRLELNE  2558

Query  2241  ELTTPTDIFIYRFRNNDPINFKQNVEYMTDLASWLKLYGYDISAMLGSEYMKQMVYQPSA  2300
             + +   D+      +  P   +   E   D  +W  L G                     
Sbjct  2559  KFSNSIDLMALEI-DRQPFRVENVPE---DFETWFSLAGL--------------------  2594

Query  2301  TITSPQLTPDFGV-MSGLQCIVNRVHEKFSDLGFVPKPLLKLEPKTRNLLPRVAHRRAV-  2358
                SP L P   + +     IV+R+   F      P+ L  L   T  L  R+A   ++ 
Sbjct  2595  ---SPNLLPSAHLGLPASSAIVHRLLSSF------PRKLRPLTHLTTVLPTRLASDISLT  2645

Query  2359  --------------FGEGILVSR--VGGRSLVSVVDGVNSVVQDVVTSVFNNSYFLPLHF  2402
                           F   ++++     G  +V ++  + S  ++V++ +F+    L    
Sbjct  2646  SPTSETSWSIDDVGFSNLLILNEDATTGEVMVEMLSDLKSEEREVISKLFDGVKSL----  2701

Query  2403  SVHDQDVFYFVKDNALKIRDDMEELRRLGGMFNVSTHETTEHGAGTWKE-LRLHNPDAAV  2461
                D   +  V    L         R       +S+   +       K+ + L N  + +
Sbjct  2702  ---DFATWGLVPTRHL--------WRAPNSKLELSSTSFSHFTMAVNKDSVELRNGKSKI  2750

Query  2462  VIKYGADPEQERHRILKHAHKRAVERAWEIEKQLVMAGFQGRGDWSKEEKDELISRGTVS  2521
             V+ +  +  +   +I++    R     W  E++   AG +    WS  E  EL S+G+VS
Sbjct  2751  VVHFSENKAEIVKKIVEELKTRENIAVWRAERKRAEAGEKTWRQWSDRETRELTSKGSVS  2810

Query  2522  GYEGVDIHSVHRYPQLA  2538
             GY+ +++   H+   LA
Sbjct  2811  GYD-IEMKPAHQSGLLA  2826



Lambda      K        H
   0.312    0.129    0.360 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4048251568


Query= XP_050469450.1 uncharacterized protein LOC126863391 [Bombus huntii]

Length=1784
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8IR42_DROME  unnamed protein product                                 416     7e-126
Q9U6W3_DROME  unnamed protein product                                 236     3e-68 
Q54CF8_DICDI  unnamed protein product                                 32.7    3.9   


>Q8IR42_DROME unnamed protein product
Length=827

 Score = 416 bits (1070),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 227/669 (34%), Positives = 372/669 (56%), Gaps = 18/669 (3%)

Query  531   CQQHGKIFLRQLRGYKLWALQMLDSSAKIPSGLLRGNVNQLGDFDECLGVMAHVKLNEKT  590
             C++    FL  L  + LWAL+M DSS K+ SG+L GN+NQ GDFD+CLG+   +  ++  
Sbjct  154   CRRQMHQFLNALDNFDLWALKMHDSSGKLNSGILNGNINQPGDFDQCLGIQQRMNQDQDA  213

Query  591   IR-------VQGKYCLANIDLYPSHPDMKLP--VNMMQARSFIRGSMYDPGHFIPKFTTV  641
              +       ++G+YCLA       H   +L     ++Q+    +    DPGH +P+++ +
Sbjct  214   GQDQDGDSIIRGQYCLAYAQPVLPHNSKRLKSFFKLIQSHGPFKSEFNDPGHRVPRYSLI  273

Query  642   NWAVCLPAACSAEDARIVVEEALNDYNSTVGITFMVDVNPNMCYVKQKSRSYSKETIGVL  701
             NW +C+P+ CSA D    V E L +  ++ GITF V V P MC V+ + R + + T   +
Sbjct  274   NWGLCVPSGCSARDVEYSVAEYLGNQTASTGITFNVRVEPQMCQVRDQ-RPWDRNTTWAV  332

Query  702   YFYAMIVCLVAVATTRDYLVVSEGKGNYSERIIMSFSLRRTLRSLFSKGSSYVDITCIHG  761
              F+ +++ +  ++T  D    S+ K N       +FSL + LR LFS  S+  DI  +HG
Sbjct  333   RFFLLVLSVAVLSTIYDRSTKSQPKQN---PWFTAFSLDKNLRWLFSTSSAPGDIEAVHG  389

Query  762   IRTLVTIMLYIGHQIIPISMLPFSNRIELTEVANSPISSIMRVSMVYTDAFLLLSGVLAA  821
             IR L  IML   H+ + +   P++NR  ++E    P + I R + +YTD FLL SG+L +
Sbjct  390   IRFLNAIMLIFSHKSMAMFFNPYNNRTAMSESLGQPWTVIGRAASLYTDPFLLFSGMLTS  449

Query  822   FNMAHEFITRGEIRWFCRFIARYIRLTPALLAVVFWYAFIMEHIGSGPQWNSVIVPNAEL  881
             +++    + +  IR    +I+R +R+ P L A++ +  +++   GSGPQWN V+  +A++
Sbjct  450   YSLFGRLMKQQPIRLKNEYISRLMRIVPPLAALILFCTYVLPLWGSGPQWNLVVGHHADI  509

Query  882   CKSNAWTNLLYIQNFFPFEEMCATHTHQLALDMQLSLLAPMLVFFLECRPIIGILVIFFF  941
             CK N W NLL+I N+F F EMC THTH L +D +L  +AP+L+  L   P  G+  +   
Sbjct  510   CKKNWWRNLLFIHNYFGFSEMCLTHTHHLGIDTELFAVAPLLILALWRWPRRGLFALLLL  569

Query  942   VLLSATLRYVATMSNYLSVVVFHGMSLKHLYRTANLVYALPLHRATPYIFGVGLGVLLRH  1001
               +    RY  T+ N LS  ++ G +++ L+RTA+ +Y+ P HR+T YI G+ LG +LR 
Sbjct  570   CTVGTAARYYTTIVNQLSNYIYFGTNIQRLFRTADYMYSFPPHRSTVYIMGILLGYVLRK  629

Query  1002  TGKDVRIHKVLVILGWLIAMALGSWSLFSPWHLARRDYVYDAEEATNYVVISPVFWTLAL  1061
               ++ R+  + + LGWL+A      SL  P  +   +YVY++  A  Y   +P+ W L  
Sbjct  630   Y-QNARLSSLQLRLGWLVATVCVLASLLGPAPMGDINYVYNSTHAAIYAAFAPIAWCLFF  688

Query  1062  CWLIFACYTNHGGILNRFLSNYWLLLFSRISYAVYLTQFAVFFYNVGTTRHSSEFH--LH  1119
              W++F  +  +   L +  +     + +++SYA+YLTQF VFF+NVG  RH   ++  + 
Sbjct  689   SWIVFVSHNGYTNKLTKLFAWRGFQVSTKLSYAIYLTQFPVFFFNVGRRRHIHHYYNFVS  748

Query  1120  RGLDLLEAATVIIISIILTLFFDIPMQEIKNVLMESTDSLNAEVSISEKSAIVESSISEI  1179
               LD  E  ++ + S+ LT+ FD P Q +K +L++   +  A+V    K+   ES  +  
Sbjct  749   IILDTNEFISIFLASVALTVLFDAPFQNLKKLLIKRPTA--AKVVKDSKAKAAESQDATT  806

Query  1180  SKTSKAPKS  1188
             +  +  P S
Sbjct  807   TTLASQPSS  815


>Q9U6W3_DROME unnamed protein product
Length=377

 Score = 236 bits (601),  Expect = 3e-68, Method: Composition-based stats.
 Identities = 126/390 (32%), Positives = 208/390 (53%), Gaps = 29/390 (7%)

Query  801   IMRVSMVYTDAFLLLSGVLAAFNMAHEFITRGEIRWFCRFIARYIRLTPALLAVVFWYAF  860
             I R + +YTD FLL SG+L ++++    + +  IR    +I+R +R+ P L A++ +  +
Sbjct  3     IGRAASLYTDPFLLFSGMLTSYSLFGRLMKQQPIRLKNEYISRLMRIVPPLAALILFCTY  62

Query  861   IMEHIGSGPQWNSVIVPNAELCKSNAWTNLLYIQNFFPFEEMCATHTHQLALDMQLSLLA  920
             ++   GSGPQWN V+  +A++CK N W NLL+I N+F F EMC THTH L +D +L  +A
Sbjct  63    VLPLWGSGPQWNLVVGHHADICKKNWWRNLLFIHNYFGFSEMCLTHTHHLGIDTELFAVA  122

Query  921   PMLVFFLECRPIIGILVIFFFVLLSATLRYVATMSNYLSVVVFHGMSLKHLYRTANLVYA  980
             P+L+  L                            +  S        ++ L+RTA+ +Y+
Sbjct  123   PLLILAL------------------------WRGQDVASSPCCCSARIQRLFRTADYMYS  158

Query  981   LPLHRATPYIFGVGLGVLLRHTGKDVRIHKVLVILGWLIAMALGSWSLFSPWHLARRDYV  1040
              P HR+T YI G+ LG +LR   ++ R+  + + LGWL+A      SL  P  +   +YV
Sbjct  159   FPPHRSTVYIMGILLGYVLRKY-QNARLSSLQLRLGWLVATVCVLASLLGPAPMGDINYV  217

Query  1041  YDAEEATNYVVISPVFWTLALCWLIFACYTNHGGILNRFLSNYWLLLFSRISYAVYLTQF  1100
             Y++  A  Y   +P+ W L   W++F  +  +   L +  +     + +++SYA+YLTQF
Sbjct  218   YNSTHAAIYAAFAPIAWCLFFSWIVFVSHNGYTNKLTKLFAWRGFQVSTKLSYAIYLTQF  277

Query  1101  AVFFYNVGTTRHSSEFH--LHRGLDLLEAATVIIISIILTLFFDIPMQEIKNVLMESTDS  1158
              VFF+NVG  RH   ++  +   LD  E  ++ + S+ LT+FFD P Q +K +L++   +
Sbjct  278   PVFFFNVGRRRHIHHYYNFVSIILDTNEFISIFLASVALTVFFDAPFQNLKKLLIKRPTA  337

Query  1159  LNAEVSISEKSAIVESSISEISKTSKAPKS  1188
               A+V    K+   ES  +  +  +  P S
Sbjct  338   --AKVVKDSKAKAAESQDATTTTLASQPSS  365


>Q54CF8_DICDI unnamed protein product
Length=3071

 Score = 32.7 bits (73),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 0/50 (0%)

Query  259   KETMKSKKQEKIEDDEDEDEDEDEDEDEDEDEDEDEDEDEDEDEDEDEDE  308
             K+  KSK  EK +DDE   +DE   +DE   +DE   +DE    +E++DE
Sbjct  1946  KDNEKSKDDEKSKDDEKSKDDEKSQDDEKSKDDEKSKDDEKSKLEENQDE  1995



Lambda      K        H
   0.312    0.129    0.360 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4048251568


Query= XP_050469451.1 phosphatidylinositol 4-phosphate 3-kinase C2
domain-containing subunit beta isoform X1 [Bombus huntii]

Length=1780
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VTN5_DROME  unnamed protein product                                 1451    0.0  
Q7JNX6_DROME  unnamed protein product                                 1451    0.0  
Q7K3H0_DROME  unnamed protein product                                 1447    0.0  


>Q9VTN5_DROME unnamed protein product
Length=1876

 Score = 1451 bits (3757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 773/1569 (49%), Positives = 1017/1569 (65%), Gaps = 109/1569 (7%)

Query  291   NNNLIDLSSFDQVDDKTNVRVSVLEAFDPLL---VKIEDQNDSTQGHKD----------E  337
              N+LIDL+  D        RVSVLEAFDPLL      +  +DST  + +          +
Sbjct  334   GNDLIDLNHEDYS------RVSVLEAFDPLLNDNTGNDTASDSTSYYAEYDPFDFLYSGD  387

Query  338   IQSQVSGSVYDPFDPFDYMYST----------------NESVNSDPVYVAV-EKSAK---  377
               +Q S  +Y+  + +D   +T                  S +S    VA  E+S K   
Sbjct  388   AATQYSDPMYEAVNRWDKTVATVSPNVGLIGWRQDFLSQPSTSSSQYGVAPPEESLKLAE  447

Query  378   ----------------------SPAVSPAAPPPLPPRNSSAWNTIERRRTSLDRRKRQTR  415
                                   + A  P + PP     + ++ +       LDRRK  TR
Sbjct  448   NGSGTISPPPPLPPRNQQCYESNQAAMPVSRPPQSSVLTDSYTSSIPANVVLDRRKTCTR  507

Query  416   LYENVTVRKTRPSLHDCDLRAFYDMIKSVRSEFPFNDPSTNIGHVISPMMESLYPEGTSI  475
             LYE ++ ++T     D +L  FY M+K VR+ +P +D  TN+GHV++      Y   TSI
Sbjct  508   LYELISDQRT----DDPELLEFYHMVKEVRARYPHDDAPTNVGHVVAAEFNYHYMMDTSI  563

Query  476   KLVVHPQLMDSDENTPS--------------ISFTCDVNCSVEHVILNVACSLEDEDIVN  521
             K++VHP L     N  +              ++FTCD++  V  V+     SLE +    
Sbjct  564   KVIVHPALNTLQSNVLAASMGKEQVKGYGMPVTFTCDIDSVVAQVVAQALASLEGQVKGT  623

Query  522   IEKYCLRVWGLAEYFASNTTLAQYEYIHQCIKLEKDIELAI-LTKAQIKRSITRTLQDDN  580
             +  Y ++  GL E+ A    L+Q E +H   +LEKD+ L + L+ A   ++I RT +DD 
Sbjct  624   VTDYAVKPIGLLEWLAPTLRLSQLECVHNSFQLEKDVHLGLCLSTAANMQAIARTERDDE  683

Query  581   RDQCLKLEDILPNEPVQPISYDTLLILLETVEKEMERVETAAIHLATTNHGSSLLPQLQP  640
              D  L  E +LPNE VQ ++YD ++IL+ET+E E++++E+AA  +     G S++     
Sbjct  684   HDADLLPEHLLPNEVVQIVTYDNMMILIETLEMEIDKLESAADGVP----GRSVV---SC  736

Query  641   RSVVQAVKAVCALMGNIETFEITEAVDNFVNACCQFLPQVHTTNIECKKPEILHEDGDYS  700
               VVQAVKA+CAL+G+I+T EI   V + +   C+   + ++T      PEI+ + GDY+
Sbjct  737   SGVVQAVKAICALLGSIDTMEIARCVAD-LKRICEVEQKKYSTG--ASNPEIVSDYGDYA  793

Query  701   VVTLRTK-FPDVIASHCRKIRDAIQDLVETYCHAFRVDFELNSRGEIPTNTLISSEVLDT  759
              V LR +   + I   C ++RDA+Q+LVE Y + FRV F + +  +  T  +  S V   
Sbjct  794   QVVLRPRSMLEQIKVKCNELRDAVQELVELYANVFRVAFSVKT-PDYSTTPIPISCVSKP  852

Query  760   ILVRVGALHRLPGSWKHDDYIIAAQIFHGTRPVGNP-VLSEPMAVSSNFHPRILFNSWLE  818
             I+V +  LHR   +WK DDY +  QI +GTR +  P VL+     S    PR+ F++WL 
Sbjct  853   IVVCISCLHRPLPNWKFDDYSLCVQIVYGTRLLSKPNVLTCSNDTSGGLFPRLNFSAWLT  912

Query  819   FRGISVCQVPREARLVLVLYGRTLQPTDHESNS--SAENTMQKEELGWGAIQFFDYEGVM  876
             F    +C +PREARL  VLYG+    ++ E N+  + E      ELGW +IQ FD++ VM
Sbjct  913   FDQHPICTLPREARLTFVLYGKQAA-SEGEPNADQNGERRQVTTELGWCSIQLFDFKRVM  971

Query  877   SQGSFFLSLWPAIADKRLGPAPAAGIHPHGDTHAIIGVELPDYGGRVLFPTELR-DYDVE  935
               G + LSLWP + DK LGPAPA G HP  D   ++ +E+P YGGR+ FP          
Sbjct  972   ICGPYLLSLWPPMTDKMLGPAPARGCHPQPDFCPVLSIEVPPYGGRIEFPEHQEVPKPAP  1031

Query  936   SLDFNSLDQNTQELLIDITQQTTFSRPLVEEREILWEKRHYLHNRPEALPKVLLAAHSWD  995
               DF SLD N QE L+D T +  ++    E RE+ WEKR YL + P ALPKVL AAHSWD
Sbjct  1032  HYDFASLDANLQEELLD-TAELGYTG-ATERREVFWEKRLYLQSYPNALPKVLHAAHSWD  1089

Query  996   WACLPDLHASLRIWSPLPPVQALQLLLPCFPDMKVREMAVGWIRELSNDELVDYLPQLLQ  1055
             +A L DLHA L  W+PL P+Q+L+LLLP +PD KVRE AV WI ++ ND+LVD+LPQL+Q
Sbjct  1090  YANLIDLHALLHSWAPLSPLQSLELLLPRYPDAKVREKAVEWISKMPNDQLVDFLPQLVQ  1149

Query  1056  ALKHETYETSPLTKFLLERALLSPRVAHHIYWLLTQALPGQSPQNSAETT----PEDDKN  1111
             +LKH+TYE S + +FLL + L SPR AHH+YWLL  +LP   P NS          D+  
Sbjct  1150  SLKHDTYEGSAMARFLLSKCLESPRFAHHMYWLLVHSLP-DDPHNSIGAAMVDQEYDESQ  1208

Query  1112  ISSARYHRRLQLMLRALLAVIGDALRNSFLTQQLLVKNLYEVAENIKQTKESLRLDALKI  1171
             ++  RY+RR ++MLRAL+A+ G+ +   F+ Q  + + L  +AE++K+ KES+R  +L  
Sbjct  1209  VTQVRYYRRNKMMLRALMAICGEKMLQRFMYQHRMCQKLTTIAESVKEAKESMRQKSLAA  1268

Query  1172  GLQNIHCQLMEDDGTCLPLSPSKQVFGINVQSCSYFPSFTLPLKINFISCDDVICPAIFK  1231
             G+  +H  L+E   TCLPL P  +V G++V++CSYF S TLPLKINF+  D    PAIFK
Sbjct  1269  GMDEVHQDLLEQP-TCLPLGPELEVTGVSVRNCSYFNSNTLPLKINFVGPDAESLPAIFK  1327

Query  1232  VGDDLQQDMLTLQMMRIMDKLWLKEGLDLKMVTFACVPTGYKRGMIEMVTNAETLRKIQV  1291
              GDDLQQD LT+Q++RIM+K+WL E LDLKMVTF CVPTGYK GMIE+V+ AETLRKIQV
Sbjct  1328  CGDDLQQDQLTIQLIRIMNKMWLAERLDLKMVTFNCVPTGYKSGMIELVSEAETLRKIQV  1387

Query  1292  EFGLTGSFKDRPIAEWLAKHNPSELEYERAVENFTASCAGYSVATYILGICDRHNDNIML  1351
             E GLTGSFKDRPIAEWL K NPS LEY+ AV NFT SCAGYSVATY+LGICDRHNDNIML
Sbjct  1388  ECGLTGSFKDRPIAEWLGKQNPSPLEYQSAVRNFTLSCAGYSVATYVLGICDRHNDNIML  1447

Query  1352  KTSGHLFHIDFGKFLGDAQMFGNFKRDRTPFVLTSDMAYVINGGDKPSAKFHHFVDLCCQ  1411
             KTSGHLFHIDFGKFLGDAQMFGNFKRDRTPFVLTSDMAYVINGGDKPS  FH+FVDLCC+
Sbjct  1448  KTSGHLFHIDFGKFLGDAQMFGNFKRDRTPFVLTSDMAYVINGGDKPSTDFHYFVDLCCR  1507

Query  1412  AFNVVRKHGNLILHLFGLMTSSGIPGVTVDAVSYVQKALLPEQTNPEAAATFARMIESSL  1471
             AFN+VRK+ +L+LH    M ++G+PGV  +AV YV++ALLP Q+NPEAAATFA+MI+SSL
Sbjct  1508  AFNIVRKNADLLLHTLAHMATAGMPGVNSNAVQYVRRALLPSQSNPEAAATFAKMIQSSL  1567

Query  1472  KSWFTQFNFFLHNLAQLRFSGDHNDGALLSFIPRTYTMQQEGQLTSVQVHGYQKRYDPEK  1531
             KSWFTQFNFFLHNLAQ+RF+ D   G LLSF+PR YTMQQ+G+L  V+V  +QK Y  EK
Sbjct  1568  KSWFTQFNFFLHNLAQMRFTPDEGSGELLSFVPRKYTMQQDGRLKIVKVVCFQKHYSMEK  1627

Query  1532  YYMYILRIQRKGHADPTYLFRSYKEFCEFYQKLCIHFPLAKLASLPSGISVGRSNIKQVA  1591
             +YMYIL + R G  DPT+LFRSY+EF EF+QKLC+HFPL KL SLP+G+ VGRSNIK VA
Sbjct  1628  FYMYILEVTRHGQPDPTHLFRSYREFTEFHQKLCMHFPLVKLHSLPAGVHVGRSNIKSVA  1687

Query  1592  DKRRADIEKFLVSLFKMAPEISQSDLVYTFFHPLLRDQQNADIHLRKVKVGNWWAEKRVR  1651
             +KR   I++FL SLF  + EI+ S+LVYTFFHPLLRDQQ A + + K+K      ++  R
Sbjct  1688  EKRLPLIQRFLKSLFDASEEIAHSELVYTFFHPLLRDQQEAKLGMPKIKEVK---QQPSR  1744

Query  1652  DNVQN-GQIKMSLHYTRGAFYVMVYHARGLPKVANCQEPNTYVKVYLKPDPTKKTKRKTK  1710
             DN    GQI++SL Y RG   VM++HA+GLP +   QEPNTYVK YLKPDP K+TKRKTK
Sbjct  1745  DNPHEIGQIRLSLQYQRGVLTVMIHHAKGLPMLQGGQEPNTYVKCYLKPDPKKETKRKTK  1804

Query  1711  VVKKNCHPSFMEMLEYRMALDVIKERTLEATIWNHDTLQENEFLGGIRLPLGRIDLTTET  1770
             VV+K C PSFME LEYRM L++I+ER L+ T+W+HDTLQENE LGG  + L + DL  E 
Sbjct  1805  VVRKTCVPSFMETLEYRMPLNIIQERRLQVTVWSHDTLQENELLGGFDMDLSKYDLRQEL  1864

Query  1771  IEWFSLGSI  1779
             ++W+ LG++
Sbjct  1865  VDWYRLGAV  1873


 Score = 38.9 bits (89),  Expect = 0.048, Method: Compositional matrix adjust.
 Identities = 34/126 (27%), Positives = 53/126 (42%), Gaps = 24/126 (19%)

Query  14   AVIDYERQFQEDLELAQAMSLESLALEKFKLQKQRSDFNNIQQQCVPQSDGNSTVHSSSS  73
            A IDY++QFQ+DL  A A+SLE  AL+ ++  K+                G+    SS+ 
Sbjct  5    AHIDYDKQFQDDLAKATALSLEQHALDDYRRNKKY---------------GSGYQQSSTV  49

Query  74   ERDNTQQTEKFQCRSRPRPGSCNTNQSRNAVILAPPPVPSRRNSTTATTSQEHTVDLITF  133
               + Q  ++ Q   +PR      +   + V ++P      R      T      DLI F
Sbjct  50   AGRDYQAAQRSQSLHQPR-----RHSEVHQVAISPENAERSRTPPAQGTDN----DLICF  100

Query  134  TSPVKQ  139
             SP  +
Sbjct  101  ASPTSK  106


>Q7JNX6_DROME unnamed protein product
Length=1876

 Score = 1451 bits (3755),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 779/1599 (49%), Positives = 1030/1599 (64%), Gaps = 116/1599 (7%)

Query  262   TPSICGVQKPTFCMDDEQLNVLKVIEKKPNNNLIDLSSFDQVDDKTNVRVSVLEAFDPLL  321
              PS  GV   +   ++   +V      +  N+LIDL+  D        RVSVLEAFDPLL
Sbjct  310   VPSTVGVSSSSHTGNNGHSSV-----PRRGNDLIDLNHEDYS------RVSVLEAFDPLL  358

Query  322   ---VKIEDQNDSTQGHKD----------EIQSQVSGSVYDPFDPFDYMYST---------  359
                   +  +DST  + +          +  +Q S  +Y+  + +D   +T         
Sbjct  359   NDNTGNDTASDSTSYYAEYDPFDFLYSGDAATQYSDPMYEAVNRWDKTVATVSPNVGLIG  418

Query  360   -------NESVNSDPVYVAV-EKSAK-------------------------SPAVSPAAP  386
                      S +S    VA  E+S K                         + A  P + 
Sbjct  419   WRQDFLSQPSTSSSQYGVAPPEESLKLAENGSGTISPPPPLPPRNQQCYESNQAAMPVSR  478

Query  387   PPLPPRNSSAWNTIERRRTSLDRRKRQTRLYENVTVRKTRPSLHDCDLRAFYDMIKSVRS  446
             PP     + ++ +       LDRRK  TRLYE ++ ++T     D +L  FY M+K VR+
Sbjct  479   PPQSSVLTDSYTSSIPANVVLDRRKTCTRLYELISDQRT----DDPELLEFYHMVKEVRA  534

Query  447   EFPFNDPSTNIGHVISPMMESLYPEGTSIKLVVHPQL-----------MDSDE----NTP  491
              +P +D  TN+GHV++      Y   TSIK++VHP L           M  ++      P
Sbjct  535   RYPHDDAPTNVGHVVAAEFNYHYMMDTSIKVIVHPALNTLQSTVLAASMGKEQVKGYGMP  594

Query  492   SISFTCDVNCSVEHVILNVACSLEDEDIVNIEKYCLRVWGLAEYFASNTTLAQYEYIHQC  551
              ++FTCD++  V  V+     SLE +    +  Y ++  GL E+ A  + L+Q E +H  
Sbjct  595   -VTFTCDIDSVVAQVVAQALASLEGQVKGTVTDYAVKPIGLLEWLAPTSRLSQLECVHNS  653

Query  552   IKLEKDIELAI-LTKAQIKRSITRTLQDDNRDQCLKLEDILPNEPVQPISYDTLLILLET  610
              +LEKD+ L + L+ A   ++I RT +DD  D  L  E +LPNE VQ ++YD ++IL+ET
Sbjct  654   FQLEKDVHLGLCLSTAANMQAIARTERDDEHDADLLPEHLLPNEVVQIVTYDNMMILIET  713

Query  611   VEKEMERVETAAIHLATTNHGSSLLPQLQPRSVVQAVKAVCALMGNIETFEITEAVDNFV  670
             +E E++++E+AA  +     G S++       VVQAVKA+CAL+G+I+T EI   V + +
Sbjct  714   LEMEIDKLESAADGVP----GRSVV---SCSGVVQAVKAICALLGSIDTMEIARCVAD-L  765

Query  671   NACCQFLPQVHTTNIECKKPEILHEDGDYSVVTLRTK-FPDVIASHCRKIRDAIQDLVET  729
                C+   + ++T      PEI+ + GDY+ V LR +   + I   C ++RDA+Q+LVE 
Sbjct  766   KRICEVEQKKYSTG--ASNPEIVSDYGDYAQVVLRPRSMLEQIKVKCNELRDAVQELVEL  823

Query  730   YCHAFRVDFELNSRGEIPTNTLISSEVLDTILVRVGALHRLPGSWKHDDYIIAAQIFHGT  789
             Y + FRV F + +  +  T  +  S V   I+V +  LHR   +WK DDY +  QI +GT
Sbjct  824   YANVFRVAFSVKT-PDYSTTPIPISCVSKPIVVCISCLHRPLPNWKFDDYSLCVQIVYGT  882

Query  790   RPVGNP-VLSEPMAVSSNFHPRILFNSWLEFRGISVCQVPREARLVLVLYGRTLQPTDHE  848
             R +  P VL+     S    PR+ F++WL F    +C +PREARL  VLYG+    ++ E
Sbjct  883   RLLSKPNVLTCSNDTSGGLFPRLNFSAWLTFDQHPICTLPREARLTFVLYGKQAA-SEGE  941

Query  849   SNS--SAENTMQKEELGWGAIQFFDYEGVMSQGSFFLSLWPAIADKRLGPAPAAGIHPHG  906
              N+  + E      ELGW +IQ FD++ VM  G + LSLWP + DK LGPAPA G HP  
Sbjct  942   PNADQNGERRQVTTELGWCSIQLFDFKRVMICGPYLLSLWPPMTDKMLGPAPARGCHPQP  1001

Query  907   DTHAIIGVELPDYGGRVLFPTELR-DYDVESLDFNSLDQNTQELLIDITQQTTFSRPLVE  965
             D   ++ +E+P YGGR+ FP            DF SLD N QE L+D T +  ++    E
Sbjct  1002  DFCPVLSIEVPPYGGRIEFPEHQEVPKPAPHYDFASLDANLQEELLD-TAELGYTG-ATE  1059

Query  966   EREILWEKRHYLHNRPEALPKVLLAAHSWDWACLPDLHASLRIWSPLPPVQALQLLLPCF  1025
              RE+ WEKR YL + P ALPKVL AAHSWD+A L DLHA L  W+PL P+Q+L+LLLP +
Sbjct  1060  RREVFWEKRLYLQSYPNALPKVLHAAHSWDYANLIDLHALLHSWAPLSPLQSLELLLPRY  1119

Query  1026  PDMKVREMAVGWIRELSNDELVDYLPQLLQALKHETYETSPLTKFLLERALLSPRVAHHI  1085
             PD KVRE AV WI ++ ND+LVD+LPQL+Q+LKH+TYE S + +FLL + L SPR AHH+
Sbjct  1120  PDAKVREKAVEWISKMPNDQLVDFLPQLVQSLKHDTYEGSAMARFLLSKCLESPRFAHHM  1179

Query  1086  YWLLTQALPGQSPQNSAETT----PEDDKNISSARYHRRLQLMLRALLAVIGDALRNSFL  1141
             YWLL  +LP   P NS          D+  ++  RY+RR ++MLRAL+A+ G+ +   F+
Sbjct  1180  YWLLVHSLP-DDPHNSIGAAMVDQEYDESQVTQVRYYRRNKMMLRALMAICGEKMLQRFM  1238

Query  1142  TQQLLVKNLYEVAENIKQTKESLRLDALKIGLQNIHCQLMEDDGTCLPLSPSKQVFGINV  1201
              Q  + + L  +AE++K+ KES+R  +L  G+  +H  L+E   TCLPL P  +V G++V
Sbjct  1239  YQHRMCQKLTTIAESVKEAKESMRQKSLAAGMDEVHQDLLEQP-TCLPLGPELEVTGVSV  1297

Query  1202  QSCSYFPSFTLPLKINFISCDDVICPAIFKVGDDLQQDMLTLQMMRIMDKLWLKEGLDLK  1261
             ++CSYF S TLPLKINF+  D    PAIFK GDDLQQD LT+Q++RIM+K+WL E LDLK
Sbjct  1298  RNCSYFNSNTLPLKINFVGPDAESLPAIFKCGDDLQQDQLTIQLIRIMNKMWLAERLDLK  1357

Query  1262  MVTFACVPTGYKRGMIEMVTNAETLRKIQVEFGLTGSFKDRPIAEWLAKHNPSELEYERA  1321
             MVTF CVPTGYK GMIE+V+ AETLRKIQVE GLTGSFKDRPIAEWL K NPS LEY+ A
Sbjct  1358  MVTFNCVPTGYKSGMIELVSEAETLRKIQVECGLTGSFKDRPIAEWLGKQNPSPLEYQSA  1417

Query  1322  VENFTASCAGYSVATYILGICDRHNDNIMLKTSGHLFHIDFGKFLGDAQMFGNFKRDRTP  1381
             V NFT SCAGYSVATY+LGICDRHNDNIMLKTSGHLFHIDFGKFLGDAQMFGNFKRDRTP
Sbjct  1418  VRNFTLSCAGYSVATYVLGICDRHNDNIMLKTSGHLFHIDFGKFLGDAQMFGNFKRDRTP  1477

Query  1382  FVLTSDMAYVINGGDKPSAKFHHFVDLCCQAFNVVRKHGNLILHLFGLMTSSGIPGVTVD  1441
             FVLTSDMAYVINGGDKPS  FH+FVDLCC+AFN+VRK+ +L+LH    M ++G+PGV  +
Sbjct  1478  FVLTSDMAYVINGGDKPSTDFHYFVDLCCRAFNIVRKNADLLLHTLAHMATAGMPGVNSN  1537

Query  1442  AVSYVQKALLPEQTNPEAAATFARMIESSLKSWFTQFNFFLHNLAQLRFSGDHNDGALLS  1501
             AV YV++ALLP Q+NPEAAATFA+MI+SSLKSWFTQFNFFLHNLAQ+RF+ D   G LLS
Sbjct  1538  AVQYVRRALLPSQSNPEAAATFAKMIQSSLKSWFTQFNFFLHNLAQMRFTPDEGSGELLS  1597

Query  1502  FIPRTYTMQQEGQLTSVQVHGYQKRYDPEKYYMYILRIQRKGHADPTYLFRSYKEFCEFY  1561
             F+PR YTMQQ+G+L  V+V  +QK Y  EK+YMYIL + R G  DPT+LFRSY+EF EF+
Sbjct  1598  FVPRKYTMQQDGRLKIVKVVCFQKHYSMEKFYMYILEVTRHGQPDPTHLFRSYREFTEFH  1657

Query  1562  QKLCIHFPLAKLASLPSGISVGRSNIKQVADKRRADIEKFLVSLFKMAPEISQSDLVYTF  1621
             QKLC+HFPL KL SLP+G+ VGRSNIK VA+KR   I++FL SLF  + EI+ S+LVYTF
Sbjct  1658  QKLCMHFPLVKLHSLPAGVHVGRSNIKSVAEKRLPLIQRFLKSLFDASEEIAHSELVYTF  1717

Query  1622  FHPLLRDQQNADIHLRKVKVGNWWAEKRVRDNVQN-GQIKMSLHYTRGAFYVMVYHARGL  1680
             FHPLLRDQQ A + + K+K      ++  RDN    GQI++SL Y RG   VM++HA+GL
Sbjct  1718  FHPLLRDQQEAKLGMPKIKEVK---QQPSRDNPHEIGQIRLSLQYQRGVLTVMIHHAKGL  1774

Query  1681  PKVANCQEPNTYVKVYLKPDPTKKTKRKTKVVKKNCHPSFMEMLEYRMALDVIKERTLEA  1740
             P +   QEPNTYVK YLKPDP K+TKRKTKVV+K C PSFME LEYRM L++I+ER L+ 
Sbjct  1775  PMLQGGQEPNTYVKCYLKPDPKKETKRKTKVVRKTCVPSFMETLEYRMPLNIIQERRLQV  1834

Query  1741  TIWNHDTLQENEFLGGIRLPLGRIDLTTETIEWFSLGSI  1779
             T+W+HDTLQENE LGG  + L + DL  E ++W+ LG++
Sbjct  1835  TVWSHDTLQENELLGGFDMDLSKYDLRQELVDWYRLGAV  1873


 Score = 38.9 bits (89),  Expect = 0.050, Method: Compositional matrix adjust.
 Identities = 34/126 (27%), Positives = 53/126 (42%), Gaps = 24/126 (19%)

Query  14   AVIDYERQFQEDLELAQAMSLESLALEKFKLQKQRSDFNNIQQQCVPQSDGNSTVHSSSS  73
            A IDY++QFQ+DL  A A+SLE  AL+ ++  K+                G+    SS+ 
Sbjct  5    AHIDYDKQFQDDLAKATALSLEQHALDDYRRNKKY---------------GSGYQQSSTV  49

Query  74   ERDNTQQTEKFQCRSRPRPGSCNTNQSRNAVILAPPPVPSRRNSTTATTSQEHTVDLITF  133
               + Q  ++ Q   +PR      +   + V ++P      R      T      DLI F
Sbjct  50   AGRDYQAAQRSQSLHQPR-----RHSEVHQVAISPENAERSRTPPAQGTDN----DLICF  100

Query  134  TSPVKQ  139
             SP  +
Sbjct  101  ASPTSK  106


>Q7K3H0_DROME unnamed protein product
Length=1876

 Score = 1447 bits (3747),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 778/1599 (49%), Positives = 1029/1599 (64%), Gaps = 116/1599 (7%)

Query  262   TPSICGVQKPTFCMDDEQLNVLKVIEKKPNNNLIDLSSFDQVDDKTNVRVSVLEAFDPLL  321
              PS  GV   +   ++   +V      +  N+LIDL+  D        RVSVLEAFDPLL
Sbjct  310   VPSTVGVSSSSHTGNNGHSSV-----PRRGNDLIDLNHEDYS------RVSVLEAFDPLL  358

Query  322   ---VKIEDQNDSTQGHKD----------EIQSQVSGSVYDPFDPFDYMYST---------  359
                   +  +DST  + +          +  +Q S  +Y+  + +D   +T         
Sbjct  359   NDNTGNDTASDSTSYYAEYDPFDFLYSGDAATQYSDPMYEAVNRWDKTVATVSPNVGLIG  418

Query  360   -------NESVNSDPVYVAV-EKSAK-------------------------SPAVSPAAP  386
                      S +S    VA  E+S K                         + A  P + 
Sbjct  419   WRQDFLSQPSTSSSQYGVAPPEESLKLAENGSGTISPPPPLPPRNQQCYESNQAAMPVSR  478

Query  387   PPLPPRNSSAWNTIERRRTSLDRRKRQTRLYENVTVRKTRPSLHDCDLRAFYDMIKSVRS  446
             PP     + ++ +       LDRRK  TRLYE ++ ++T     D +L  FY M+K VR+
Sbjct  479   PPQSSVLTDSYTSSIPANVVLDRRKTCTRLYELISDQRT----DDPELLEFYHMVKEVRA  534

Query  447   EFPFNDPSTNIGHVISPMMESLYPEGTSIKLVVHPQL-----------MDSDE----NTP  491
              +P +D  TN+GHV++      Y   TSIK++VHP L           M  ++      P
Sbjct  535   RYPHDDAPTNVGHVVAAEFNYHYMMDTSIKVIVHPALNTLQSTVLAASMGKEQVKGYGMP  594

Query  492   SISFTCDVNCSVEHVILNVACSLEDEDIVNIEKYCLRVWGLAEYFASNTTLAQYEYIHQC  551
              ++FTCD++  V  V+     SLE +    +  Y ++  GL E+ A  + L+Q E +H  
Sbjct  595   -VTFTCDIDSVVAQVVAQALASLEGQVKGTVTDYAVKPIGLLEWLAPTSRLSQLECVHNS  653

Query  552   IKLEKDIELAI-LTKAQIKRSITRTLQDDNRDQCLKLEDILPNEPVQPISYDTLLILLET  610
              +LEKD+ L + L+ A   ++I RT +DD  D  L  E +LPNE V  ++YD ++IL+ET
Sbjct  654   FQLEKDVHLGLCLSTAANMQAIARTERDDEHDADLLPEHLLPNEVVPIVTYDNMMILIET  713

Query  611   VEKEMERVETAAIHLATTNHGSSLLPQLQPRSVVQAVKAVCALMGNIETFEITEAVDNFV  670
             +E E++++E+AA  +     G S++       VVQAVKA+CAL+G+I+T EI   V + +
Sbjct  714   LEMEIDKLESAADGVP----GRSVV---SCSGVVQAVKAICALLGSIDTMEIARCVAD-L  765

Query  671   NACCQFLPQVHTTNIECKKPEILHEDGDYSVVTLRTK-FPDVIASHCRKIRDAIQDLVET  729
                C+   + ++T      PEI+ + GDY+ V LR +   + I   C ++RDA+Q+LVE 
Sbjct  766   KRICEVEQKKYSTG--ASNPEIVSDYGDYAQVVLRPRSMLEQIKVKCNELRDAVQELVEL  823

Query  730   YCHAFRVDFELNSRGEIPTNTLISSEVLDTILVRVGALHRLPGSWKHDDYIIAAQIFHGT  789
             Y + FRV F + +  +  T  +  S V   I+V +  LHR   +WK DDY +  QI +GT
Sbjct  824   YANVFRVAFSVKT-PDYSTTPIPISCVSKPIVVCISCLHRPLPNWKFDDYSLCVQIVYGT  882

Query  790   RPVGNP-VLSEPMAVSSNFHPRILFNSWLEFRGISVCQVPREARLVLVLYGRTLQPTDHE  848
             R +  P VL+     S    PR+ F++WL F    +C +PREARL  VLYG+    ++ E
Sbjct  883   RLLSKPNVLTCSNDTSGGLFPRLNFSAWLTFDQHPICTLPREARLTFVLYGKQAA-SEGE  941

Query  849   SNS--SAENTMQKEELGWGAIQFFDYEGVMSQGSFFLSLWPAIADKRLGPAPAAGIHPHG  906
              N+  + E      ELGW +IQ FD++ VM  G + LSLWP + DK LGPAPA G HP  
Sbjct  942   PNADQNGERRQVTTELGWCSIQLFDFKRVMICGPYLLSLWPPMTDKMLGPAPARGCHPQP  1001

Query  907   DTHAIIGVELPDYGGRVLFPTELR-DYDVESLDFNSLDQNTQELLIDITQQTTFSRPLVE  965
             D   ++ +E+P YGGR+ FP            DF SLD N QE L+D T +  ++    E
Sbjct  1002  DFCPVLSIEVPPYGGRIEFPEHQEVPKPAPHYDFASLDANLQEELLD-TAELGYTG-ATE  1059

Query  966   EREILWEKRHYLHNRPEALPKVLLAAHSWDWACLPDLHASLRIWSPLPPVQALQLLLPCF  1025
              RE+ WEKR YL + P ALPKVL AAHSWD+A L DLHA L  W+PL P+Q+L+LLLP +
Sbjct  1060  RREVFWEKRLYLQSYPNALPKVLHAAHSWDYANLIDLHALLHSWAPLSPLQSLELLLPRY  1119

Query  1026  PDMKVREMAVGWIRELSNDELVDYLPQLLQALKHETYETSPLTKFLLERALLSPRVAHHI  1085
             PD KVRE AV WI ++ ND+LVD+LPQL+Q+LKH+TYE S + +FLL + L SPR AHH+
Sbjct  1120  PDAKVREKAVEWISKMPNDQLVDFLPQLVQSLKHDTYEGSAMARFLLSKCLESPRFAHHM  1179

Query  1086  YWLLTQALPGQSPQNSAETT----PEDDKNISSARYHRRLQLMLRALLAVIGDALRNSFL  1141
             YWLL  +LP   P NS          D+  ++  RY+RR ++MLRAL+A+ G+ +   F+
Sbjct  1180  YWLLVHSLP-DDPHNSIGAAMVDQEYDESQVTQVRYYRRNKMMLRALMAICGEKMLQRFM  1238

Query  1142  TQQLLVKNLYEVAENIKQTKESLRLDALKIGLQNIHCQLMEDDGTCLPLSPSKQVFGINV  1201
              Q  + + L  +AE++K+ KES+R  +L  G+  +H  L+E   TCLPL P  +V G++V
Sbjct  1239  YQHRMCQKLTTIAESVKEAKESMRQKSLAAGMDEVHQDLLEQP-TCLPLGPELEVTGVSV  1297

Query  1202  QSCSYFPSFTLPLKINFISCDDVICPAIFKVGDDLQQDMLTLQMMRIMDKLWLKEGLDLK  1261
             ++CSYF S TLPLKINF+  D    PAIFK GDDLQQD LT+Q++RIM+K+WL E LDLK
Sbjct  1298  RNCSYFNSNTLPLKINFVGPDAESLPAIFKCGDDLQQDQLTIQLIRIMNKMWLAERLDLK  1357

Query  1262  MVTFACVPTGYKRGMIEMVTNAETLRKIQVEFGLTGSFKDRPIAEWLAKHNPSELEYERA  1321
             MVTF CVPTGYK GMIE+V+ AETLRKIQVE GLTGSFKDRPIAEWL K NPS LEY+ A
Sbjct  1358  MVTFNCVPTGYKSGMIELVSEAETLRKIQVECGLTGSFKDRPIAEWLGKQNPSPLEYQSA  1417

Query  1322  VENFTASCAGYSVATYILGICDRHNDNIMLKTSGHLFHIDFGKFLGDAQMFGNFKRDRTP  1381
             V NFT SCAGYSVATY+LGICDRHNDNIMLKTSGHLFHIDFGKFLGDAQMFGNFKRDRTP
Sbjct  1418  VRNFTLSCAGYSVATYVLGICDRHNDNIMLKTSGHLFHIDFGKFLGDAQMFGNFKRDRTP  1477

Query  1382  FVLTSDMAYVINGGDKPSAKFHHFVDLCCQAFNVVRKHGNLILHLFGLMTSSGIPGVTVD  1441
             FVLTSDMAYVINGGDKPS  FH+FVDLCC+AFN+VRK+ +L+LH    M ++G+PGV  +
Sbjct  1478  FVLTSDMAYVINGGDKPSTDFHYFVDLCCRAFNIVRKNADLLLHTLAHMATAGMPGVNSN  1537

Query  1442  AVSYVQKALLPEQTNPEAAATFARMIESSLKSWFTQFNFFLHNLAQLRFSGDHNDGALLS  1501
             AV YV++ALLP Q+NPEAAATFA+MI+SSLKSWFTQFNFFLHNLAQ+RF+ D   G LLS
Sbjct  1538  AVQYVRRALLPSQSNPEAAATFAKMIQSSLKSWFTQFNFFLHNLAQMRFTPDEGSGELLS  1597

Query  1502  FIPRTYTMQQEGQLTSVQVHGYQKRYDPEKYYMYILRIQRKGHADPTYLFRSYKEFCEFY  1561
             F+PR YTMQQ+G+L  V+V  +QK Y  EK+YMYIL + R G  DPT+LFRSY+EF EF+
Sbjct  1598  FVPRKYTMQQDGRLKIVKVVCFQKHYSMEKFYMYILEVTRHGQPDPTHLFRSYREFTEFH  1657

Query  1562  QKLCIHFPLAKLASLPSGISVGRSNIKQVADKRRADIEKFLVSLFKMAPEISQSDLVYTF  1621
             QKLC+HFPL KL SLP+G+ VGRSNIK VA+KR   I++FL SLF  + EI+ S+LVYTF
Sbjct  1658  QKLCMHFPLVKLHSLPAGVHVGRSNIKSVAEKRLPLIQRFLKSLFDASEEIAHSELVYTF  1717

Query  1622  FHPLLRDQQNADIHLRKVKVGNWWAEKRVRDNVQN-GQIKMSLHYTRGAFYVMVYHARGL  1680
             FHPLLRDQQ A + + K+K      ++  RDN    GQI++SL Y RG   VM++HA+GL
Sbjct  1718  FHPLLRDQQEAKLGMPKIKEVK---QQPSRDNPHEIGQIRLSLQYQRGVLTVMIHHAKGL  1774

Query  1681  PKVANCQEPNTYVKVYLKPDPTKKTKRKTKVVKKNCHPSFMEMLEYRMALDVIKERTLEA  1740
             P +   QEPNTYVK YLKPDP K+TKRKTKVV+K C PSFME LEYRM L++I+ER L+ 
Sbjct  1775  PMLQGGQEPNTYVKCYLKPDPKKETKRKTKVVRKTCVPSFMETLEYRMPLNIIQERRLQV  1834

Query  1741  TIWNHDTLQENEFLGGIRLPLGRIDLTTETIEWFSLGSI  1779
             T+W+HDTLQENE LGG  + L + DL  E ++W+ LG++
Sbjct  1835  TVWSHDTLQENELLGGFDMDLSKYDLRQELVDWYRLGAV  1873


 Score = 38.9 bits (89),  Expect = 0.049, Method: Compositional matrix adjust.
 Identities = 34/126 (27%), Positives = 53/126 (42%), Gaps = 24/126 (19%)

Query  14   AVIDYERQFQEDLELAQAMSLESLALEKFKLQKQRSDFNNIQQQCVPQSDGNSTVHSSSS  73
            A IDY++QFQ+DL  A A+SLE  AL+ ++  K+                G+    SS+ 
Sbjct  5    AHIDYDKQFQDDLAKATALSLEQHALDDYRRNKKY---------------GSGYQQSSTV  49

Query  74   ERDNTQQTEKFQCRSRPRPGSCNTNQSRNAVILAPPPVPSRRNSTTATTSQEHTVDLITF  133
               + Q  ++ Q   +PR      +   + V ++P      R      T      DLI F
Sbjct  50   AGRDYQAAQRSQSLHQPR-----RHSEVHQVAISPENAERSRTPPAQGTDN----DLICF  100

Query  134  TSPVKQ  139
             SP  +
Sbjct  101  ASPTSK  106



Lambda      K        H
   0.312    0.129    0.360 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4048251568


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Oct 18, 2022  4:55 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_050469452.1 phosphatidylinositol 4-phosphate 3-kinase C2
domain-containing subunit beta isoform X2 [Bombus huntii]

Length=1779
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VTN5_DROME  unnamed protein product                                 1451    0.0  
Q7JNX6_DROME  unnamed protein product                                 1451    0.0  
Q7K3H0_DROME  unnamed protein product                                 1447    0.0  


>Q9VTN5_DROME unnamed protein product
Length=1876

 Score = 1451 bits (3757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 773/1569 (49%), Positives = 1017/1569 (65%), Gaps = 109/1569 (7%)

Query  290   NNNLIDLSSFDQVDDKTNVRVSVLEAFDPLL---VKIEDQNDSTQGHKD----------E  336
              N+LIDL+  D        RVSVLEAFDPLL      +  +DST  + +          +
Sbjct  334   GNDLIDLNHEDYS------RVSVLEAFDPLLNDNTGNDTASDSTSYYAEYDPFDFLYSGD  387

Query  337   IQSQVSGSVYDPFDPFDYMYST----------------NESVNSDPVYVAV-EKSAK---  376
               +Q S  +Y+  + +D   +T                  S +S    VA  E+S K   
Sbjct  388   AATQYSDPMYEAVNRWDKTVATVSPNVGLIGWRQDFLSQPSTSSSQYGVAPPEESLKLAE  447

Query  377   ----------------------SPAVSPAAPPPLPPRNSSAWNTIERRRTSLDRRKRQTR  414
                                   + A  P + PP     + ++ +       LDRRK  TR
Sbjct  448   NGSGTISPPPPLPPRNQQCYESNQAAMPVSRPPQSSVLTDSYTSSIPANVVLDRRKTCTR  507

Query  415   LYENVTVRKTRPSLHDCDLRAFYDMIKSVRSEFPFNDPSTNIGHVISPMMESLYPEGTSI  474
             LYE ++ ++T     D +L  FY M+K VR+ +P +D  TN+GHV++      Y   TSI
Sbjct  508   LYELISDQRT----DDPELLEFYHMVKEVRARYPHDDAPTNVGHVVAAEFNYHYMMDTSI  563

Query  475   KLVVHPQLMDSDENTPS--------------ISFTCDVNCSVEHVILNVACSLEDEDIVN  520
             K++VHP L     N  +              ++FTCD++  V  V+     SLE +    
Sbjct  564   KVIVHPALNTLQSNVLAASMGKEQVKGYGMPVTFTCDIDSVVAQVVAQALASLEGQVKGT  623

Query  521   IEKYCLRVWGLAEYFASNTTLAQYEYIHQCIKLEKDIELAI-LTKAQIKRSITRTLQDDN  579
             +  Y ++  GL E+ A    L+Q E +H   +LEKD+ L + L+ A   ++I RT +DD 
Sbjct  624   VTDYAVKPIGLLEWLAPTLRLSQLECVHNSFQLEKDVHLGLCLSTAANMQAIARTERDDE  683

Query  580   RDQCLKLEDILPNEPVQPISYDTLLILLETVEKEMERVETAAIHLATTNHGSSLLPQLQP  639
              D  L  E +LPNE VQ ++YD ++IL+ET+E E++++E+AA  +     G S++     
Sbjct  684   HDADLLPEHLLPNEVVQIVTYDNMMILIETLEMEIDKLESAADGVP----GRSVV---SC  736

Query  640   RSVVQAVKAVCALMGNIETFEITEAVDNFVNACCQFLPQVHTTNIECKKPEILHEDGDYS  699
               VVQAVKA+CAL+G+I+T EI   V + +   C+   + ++T      PEI+ + GDY+
Sbjct  737   SGVVQAVKAICALLGSIDTMEIARCVAD-LKRICEVEQKKYSTG--ASNPEIVSDYGDYA  793

Query  700   VVTLRTK-FPDVIASHCRKIRDAIQDLVETYCHAFRVDFELNSRGEIPTNTLISSEVLDT  758
              V LR +   + I   C ++RDA+Q+LVE Y + FRV F + +  +  T  +  S V   
Sbjct  794   QVVLRPRSMLEQIKVKCNELRDAVQELVELYANVFRVAFSVKT-PDYSTTPIPISCVSKP  852

Query  759   ILVRVGALHRLPGSWKHDDYIIAAQIFHGTRPVGNP-VLSEPMAVSSNFHPRILFNSWLE  817
             I+V +  LHR   +WK DDY +  QI +GTR +  P VL+     S    PR+ F++WL 
Sbjct  853   IVVCISCLHRPLPNWKFDDYSLCVQIVYGTRLLSKPNVLTCSNDTSGGLFPRLNFSAWLT  912

Query  818   FRGISVCQVPREARLVLVLYGRTLQPTDHESNS--SAENTMQKEELGWGAIQFFDYEGVM  875
             F    +C +PREARL  VLYG+    ++ E N+  + E      ELGW +IQ FD++ VM
Sbjct  913   FDQHPICTLPREARLTFVLYGKQAA-SEGEPNADQNGERRQVTTELGWCSIQLFDFKRVM  971

Query  876   SQGSFFLSLWPAIADKRLGPAPAAGIHPHGDTHAIIGVELPDYGGRVLFPTELR-DYDVE  934
               G + LSLWP + DK LGPAPA G HP  D   ++ +E+P YGGR+ FP          
Sbjct  972   ICGPYLLSLWPPMTDKMLGPAPARGCHPQPDFCPVLSIEVPPYGGRIEFPEHQEVPKPAP  1031

Query  935   SLDFNSLDQNTQELLIDITQQTTFSRPLVEEREILWEKRHYLHNRPEALPKVLLAAHSWD  994
               DF SLD N QE L+D T +  ++    E RE+ WEKR YL + P ALPKVL AAHSWD
Sbjct  1032  HYDFASLDANLQEELLD-TAELGYTG-ATERREVFWEKRLYLQSYPNALPKVLHAAHSWD  1089

Query  995   WACLPDLHASLRIWSPLPPVQALQLLLPCFPDMKVREMAVGWIRELSNDELVDYLPQLLQ  1054
             +A L DLHA L  W+PL P+Q+L+LLLP +PD KVRE AV WI ++ ND+LVD+LPQL+Q
Sbjct  1090  YANLIDLHALLHSWAPLSPLQSLELLLPRYPDAKVREKAVEWISKMPNDQLVDFLPQLVQ  1149

Query  1055  ALKHETYETSPLTKFLLERALLSPRVAHHIYWLLTQALPGQSPQNSAETT----PEDDKN  1110
             +LKH+TYE S + +FLL + L SPR AHH+YWLL  +LP   P NS          D+  
Sbjct  1150  SLKHDTYEGSAMARFLLSKCLESPRFAHHMYWLLVHSLP-DDPHNSIGAAMVDQEYDESQ  1208

Query  1111  ISSARYHRRLQLMLRALLAVIGDALRNSFLTQQLLVKNLYEVAENIKQTKESLRLDALKI  1170
             ++  RY+RR ++MLRAL+A+ G+ +   F+ Q  + + L  +AE++K+ KES+R  +L  
Sbjct  1209  VTQVRYYRRNKMMLRALMAICGEKMLQRFMYQHRMCQKLTTIAESVKEAKESMRQKSLAA  1268

Query  1171  GLQNIHCQLMEDDGTCLPLSPSKQVFGINVQSCSYFPSFTLPLKINFISCDDVICPAIFK  1230
             G+  +H  L+E   TCLPL P  +V G++V++CSYF S TLPLKINF+  D    PAIFK
Sbjct  1269  GMDEVHQDLLEQP-TCLPLGPELEVTGVSVRNCSYFNSNTLPLKINFVGPDAESLPAIFK  1327

Query  1231  VGDDLQQDMLTLQMMRIMDKLWLKEGLDLKMVTFACVPTGYKRGMIEMVTNAETLRKIQV  1290
              GDDLQQD LT+Q++RIM+K+WL E LDLKMVTF CVPTGYK GMIE+V+ AETLRKIQV
Sbjct  1328  CGDDLQQDQLTIQLIRIMNKMWLAERLDLKMVTFNCVPTGYKSGMIELVSEAETLRKIQV  1387

Query  1291  EFGLTGSFKDRPIAEWLAKHNPSELEYERAVENFTASCAGYSVATYILGICDRHNDNIML  1350
             E GLTGSFKDRPIAEWL K NPS LEY+ AV NFT SCAGYSVATY+LGICDRHNDNIML
Sbjct  1388  ECGLTGSFKDRPIAEWLGKQNPSPLEYQSAVRNFTLSCAGYSVATYVLGICDRHNDNIML  1447

Query  1351  KTSGHLFHIDFGKFLGDAQMFGNFKRDRTPFVLTSDMAYVINGGDKPSAKFHHFVDLCCQ  1410
             KTSGHLFHIDFGKFLGDAQMFGNFKRDRTPFVLTSDMAYVINGGDKPS  FH+FVDLCC+
Sbjct  1448  KTSGHLFHIDFGKFLGDAQMFGNFKRDRTPFVLTSDMAYVINGGDKPSTDFHYFVDLCCR  1507

Query  1411  AFNVVRKHGNLILHLFGLMTSSGIPGVTVDAVSYVQKALLPEQTNPEAAATFARMIESSL  1470
             AFN+VRK+ +L+LH    M ++G+PGV  +AV YV++ALLP Q+NPEAAATFA+MI+SSL
Sbjct  1508  AFNIVRKNADLLLHTLAHMATAGMPGVNSNAVQYVRRALLPSQSNPEAAATFAKMIQSSL  1567

Query  1471  KSWFTQFNFFLHNLAQLRFSGDHNDGALLSFIPRTYTMQQEGQLTSVQVHGYQKRYDPEK  1530
             KSWFTQFNFFLHNLAQ+RF+ D   G LLSF+PR YTMQQ+G+L  V+V  +QK Y  EK
Sbjct  1568  KSWFTQFNFFLHNLAQMRFTPDEGSGELLSFVPRKYTMQQDGRLKIVKVVCFQKHYSMEK  1627

Query  1531  YYMYILRIQRKGHADPTYLFRSYKEFCEFYQKLCIHFPLAKLASLPSGISVGRSNIKQVA  1590
             +YMYIL + R G  DPT+LFRSY+EF EF+QKLC+HFPL KL SLP+G+ VGRSNIK VA
Sbjct  1628  FYMYILEVTRHGQPDPTHLFRSYREFTEFHQKLCMHFPLVKLHSLPAGVHVGRSNIKSVA  1687

Query  1591  DKRRADIEKFLVSLFKMAPEISQSDLVYTFFHPLLRDQQNADIHLRKVKVGNWWAEKRVR  1650
             +KR   I++FL SLF  + EI+ S+LVYTFFHPLLRDQQ A + + K+K      ++  R
Sbjct  1688  EKRLPLIQRFLKSLFDASEEIAHSELVYTFFHPLLRDQQEAKLGMPKIKEVK---QQPSR  1744

Query  1651  DNVQN-GQIKMSLHYTRGAFYVMVYHARGLPKVANCQEPNTYVKVYLKPDPTKKTKRKTK  1709
             DN    GQI++SL Y RG   VM++HA+GLP +   QEPNTYVK YLKPDP K+TKRKTK
Sbjct  1745  DNPHEIGQIRLSLQYQRGVLTVMIHHAKGLPMLQGGQEPNTYVKCYLKPDPKKETKRKTK  1804

Query  1710  VVKKNCHPSFMEMLEYRMALDVIKERTLEATIWNHDTLQENEFLGGIRLPLGRIDLTTET  1769
             VV+K C PSFME LEYRM L++I+ER L+ T+W+HDTLQENE LGG  + L + DL  E 
Sbjct  1805  VVRKTCVPSFMETLEYRMPLNIIQERRLQVTVWSHDTLQENELLGGFDMDLSKYDLRQEL  1864

Query  1770  IEWFSLGSI  1778
             ++W+ LG++
Sbjct  1865  VDWYRLGAV  1873


 Score = 38.9 bits (89),  Expect = 0.048, Method: Compositional matrix adjust.
 Identities = 34/126 (27%), Positives = 53/126 (42%), Gaps = 24/126 (19%)

Query  14   AVIDYERQFQEDLELAQAMSLESLALEKFKLQKQRSDFNNIQQQCVPQSDGNSTVHSSSS  73
            A IDY++QFQ+DL  A A+SLE  AL+ ++  K+                G+    SS+ 
Sbjct  5    AHIDYDKQFQDDLAKATALSLEQHALDDYRRNKKY---------------GSGYQQSSTV  49

Query  74   ERDNTQQTEKFQCRSRPRPGSCNTNQSRNAVILAPPPVPSRRNSTTATTSQEHTVDLITF  133
               + Q  ++ Q   +PR      +   + V ++P      R      T      DLI F
Sbjct  50   AGRDYQAAQRSQSLHQPR-----RHSEVHQVAISPENAERSRTPPAQGTDN----DLICF  100

Query  134  TSPVKQ  139
             SP  +
Sbjct  101  ASPTSK  106


>Q7JNX6_DROME unnamed protein product
Length=1876

 Score = 1451 bits (3755),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 779/1599 (49%), Positives = 1030/1599 (64%), Gaps = 116/1599 (7%)

Query  261   TPSICGVQKPTFCMDDEQLNVLKVIEKKPNNNLIDLSSFDQVDDKTNVRVSVLEAFDPLL  320
              PS  GV   +   ++   +V      +  N+LIDL+  D        RVSVLEAFDPLL
Sbjct  310   VPSTVGVSSSSHTGNNGHSSV-----PRRGNDLIDLNHEDYS------RVSVLEAFDPLL  358

Query  321   ---VKIEDQNDSTQGHKD----------EIQSQVSGSVYDPFDPFDYMYST---------  358
                   +  +DST  + +          +  +Q S  +Y+  + +D   +T         
Sbjct  359   NDNTGNDTASDSTSYYAEYDPFDFLYSGDAATQYSDPMYEAVNRWDKTVATVSPNVGLIG  418

Query  359   -------NESVNSDPVYVAV-EKSAK-------------------------SPAVSPAAP  385
                      S +S    VA  E+S K                         + A  P + 
Sbjct  419   WRQDFLSQPSTSSSQYGVAPPEESLKLAENGSGTISPPPPLPPRNQQCYESNQAAMPVSR  478

Query  386   PPLPPRNSSAWNTIERRRTSLDRRKRQTRLYENVTVRKTRPSLHDCDLRAFYDMIKSVRS  445
             PP     + ++ +       LDRRK  TRLYE ++ ++T     D +L  FY M+K VR+
Sbjct  479   PPQSSVLTDSYTSSIPANVVLDRRKTCTRLYELISDQRT----DDPELLEFYHMVKEVRA  534

Query  446   EFPFNDPSTNIGHVISPMMESLYPEGTSIKLVVHPQL-----------MDSDE----NTP  490
              +P +D  TN+GHV++      Y   TSIK++VHP L           M  ++      P
Sbjct  535   RYPHDDAPTNVGHVVAAEFNYHYMMDTSIKVIVHPALNTLQSTVLAASMGKEQVKGYGMP  594

Query  491   SISFTCDVNCSVEHVILNVACSLEDEDIVNIEKYCLRVWGLAEYFASNTTLAQYEYIHQC  550
              ++FTCD++  V  V+     SLE +    +  Y ++  GL E+ A  + L+Q E +H  
Sbjct  595   -VTFTCDIDSVVAQVVAQALASLEGQVKGTVTDYAVKPIGLLEWLAPTSRLSQLECVHNS  653

Query  551   IKLEKDIELAI-LTKAQIKRSITRTLQDDNRDQCLKLEDILPNEPVQPISYDTLLILLET  609
              +LEKD+ L + L+ A   ++I RT +DD  D  L  E +LPNE VQ ++YD ++IL+ET
Sbjct  654   FQLEKDVHLGLCLSTAANMQAIARTERDDEHDADLLPEHLLPNEVVQIVTYDNMMILIET  713

Query  610   VEKEMERVETAAIHLATTNHGSSLLPQLQPRSVVQAVKAVCALMGNIETFEITEAVDNFV  669
             +E E++++E+AA  +     G S++       VVQAVKA+CAL+G+I+T EI   V + +
Sbjct  714   LEMEIDKLESAADGVP----GRSVV---SCSGVVQAVKAICALLGSIDTMEIARCVAD-L  765

Query  670   NACCQFLPQVHTTNIECKKPEILHEDGDYSVVTLRTK-FPDVIASHCRKIRDAIQDLVET  728
                C+   + ++T      PEI+ + GDY+ V LR +   + I   C ++RDA+Q+LVE 
Sbjct  766   KRICEVEQKKYSTG--ASNPEIVSDYGDYAQVVLRPRSMLEQIKVKCNELRDAVQELVEL  823

Query  729   YCHAFRVDFELNSRGEIPTNTLISSEVLDTILVRVGALHRLPGSWKHDDYIIAAQIFHGT  788
             Y + FRV F + +  +  T  +  S V   I+V +  LHR   +WK DDY +  QI +GT
Sbjct  824   YANVFRVAFSVKT-PDYSTTPIPISCVSKPIVVCISCLHRPLPNWKFDDYSLCVQIVYGT  882

Query  789   RPVGNP-VLSEPMAVSSNFHPRILFNSWLEFRGISVCQVPREARLVLVLYGRTLQPTDHE  847
             R +  P VL+     S    PR+ F++WL F    +C +PREARL  VLYG+    ++ E
Sbjct  883   RLLSKPNVLTCSNDTSGGLFPRLNFSAWLTFDQHPICTLPREARLTFVLYGKQAA-SEGE  941

Query  848   SNS--SAENTMQKEELGWGAIQFFDYEGVMSQGSFFLSLWPAIADKRLGPAPAAGIHPHG  905
              N+  + E      ELGW +IQ FD++ VM  G + LSLWP + DK LGPAPA G HP  
Sbjct  942   PNADQNGERRQVTTELGWCSIQLFDFKRVMICGPYLLSLWPPMTDKMLGPAPARGCHPQP  1001

Query  906   DTHAIIGVELPDYGGRVLFPTELR-DYDVESLDFNSLDQNTQELLIDITQQTTFSRPLVE  964
             D   ++ +E+P YGGR+ FP            DF SLD N QE L+D T +  ++    E
Sbjct  1002  DFCPVLSIEVPPYGGRIEFPEHQEVPKPAPHYDFASLDANLQEELLD-TAELGYTG-ATE  1059

Query  965   EREILWEKRHYLHNRPEALPKVLLAAHSWDWACLPDLHASLRIWSPLPPVQALQLLLPCF  1024
              RE+ WEKR YL + P ALPKVL AAHSWD+A L DLHA L  W+PL P+Q+L+LLLP +
Sbjct  1060  RREVFWEKRLYLQSYPNALPKVLHAAHSWDYANLIDLHALLHSWAPLSPLQSLELLLPRY  1119

Query  1025  PDMKVREMAVGWIRELSNDELVDYLPQLLQALKHETYETSPLTKFLLERALLSPRVAHHI  1084
             PD KVRE AV WI ++ ND+LVD+LPQL+Q+LKH+TYE S + +FLL + L SPR AHH+
Sbjct  1120  PDAKVREKAVEWISKMPNDQLVDFLPQLVQSLKHDTYEGSAMARFLLSKCLESPRFAHHM  1179

Query  1085  YWLLTQALPGQSPQNSAETT----PEDDKNISSARYHRRLQLMLRALLAVIGDALRNSFL  1140
             YWLL  +LP   P NS          D+  ++  RY+RR ++MLRAL+A+ G+ +   F+
Sbjct  1180  YWLLVHSLP-DDPHNSIGAAMVDQEYDESQVTQVRYYRRNKMMLRALMAICGEKMLQRFM  1238

Query  1141  TQQLLVKNLYEVAENIKQTKESLRLDALKIGLQNIHCQLMEDDGTCLPLSPSKQVFGINV  1200
              Q  + + L  +AE++K+ KES+R  +L  G+  +H  L+E   TCLPL P  +V G++V
Sbjct  1239  YQHRMCQKLTTIAESVKEAKESMRQKSLAAGMDEVHQDLLEQP-TCLPLGPELEVTGVSV  1297

Query  1201  QSCSYFPSFTLPLKINFISCDDVICPAIFKVGDDLQQDMLTLQMMRIMDKLWLKEGLDLK  1260
             ++CSYF S TLPLKINF+  D    PAIFK GDDLQQD LT+Q++RIM+K+WL E LDLK
Sbjct  1298  RNCSYFNSNTLPLKINFVGPDAESLPAIFKCGDDLQQDQLTIQLIRIMNKMWLAERLDLK  1357

Query  1261  MVTFACVPTGYKRGMIEMVTNAETLRKIQVEFGLTGSFKDRPIAEWLAKHNPSELEYERA  1320
             MVTF CVPTGYK GMIE+V+ AETLRKIQVE GLTGSFKDRPIAEWL K NPS LEY+ A
Sbjct  1358  MVTFNCVPTGYKSGMIELVSEAETLRKIQVECGLTGSFKDRPIAEWLGKQNPSPLEYQSA  1417

Query  1321  VENFTASCAGYSVATYILGICDRHNDNIMLKTSGHLFHIDFGKFLGDAQMFGNFKRDRTP  1380
             V NFT SCAGYSVATY+LGICDRHNDNIMLKTSGHLFHIDFGKFLGDAQMFGNFKRDRTP
Sbjct  1418  VRNFTLSCAGYSVATYVLGICDRHNDNIMLKTSGHLFHIDFGKFLGDAQMFGNFKRDRTP  1477

Query  1381  FVLTSDMAYVINGGDKPSAKFHHFVDLCCQAFNVVRKHGNLILHLFGLMTSSGIPGVTVD  1440
             FVLTSDMAYVINGGDKPS  FH+FVDLCC+AFN+VRK+ +L+LH    M ++G+PGV  +
Sbjct  1478  FVLTSDMAYVINGGDKPSTDFHYFVDLCCRAFNIVRKNADLLLHTLAHMATAGMPGVNSN  1537

Query  1441  AVSYVQKALLPEQTNPEAAATFARMIESSLKSWFTQFNFFLHNLAQLRFSGDHNDGALLS  1500
             AV YV++ALLP Q+NPEAAATFA+MI+SSLKSWFTQFNFFLHNLAQ+RF+ D   G LLS
Sbjct  1538  AVQYVRRALLPSQSNPEAAATFAKMIQSSLKSWFTQFNFFLHNLAQMRFTPDEGSGELLS  1597

Query  1501  FIPRTYTMQQEGQLTSVQVHGYQKRYDPEKYYMYILRIQRKGHADPTYLFRSYKEFCEFY  1560
             F+PR YTMQQ+G+L  V+V  +QK Y  EK+YMYIL + R G  DPT+LFRSY+EF EF+
Sbjct  1598  FVPRKYTMQQDGRLKIVKVVCFQKHYSMEKFYMYILEVTRHGQPDPTHLFRSYREFTEFH  1657

Query  1561  QKLCIHFPLAKLASLPSGISVGRSNIKQVADKRRADIEKFLVSLFKMAPEISQSDLVYTF  1620
             QKLC+HFPL KL SLP+G+ VGRSNIK VA+KR   I++FL SLF  + EI+ S+LVYTF
Sbjct  1658  QKLCMHFPLVKLHSLPAGVHVGRSNIKSVAEKRLPLIQRFLKSLFDASEEIAHSELVYTF  1717

Query  1621  FHPLLRDQQNADIHLRKVKVGNWWAEKRVRDNVQN-GQIKMSLHYTRGAFYVMVYHARGL  1679
             FHPLLRDQQ A + + K+K      ++  RDN    GQI++SL Y RG   VM++HA+GL
Sbjct  1718  FHPLLRDQQEAKLGMPKIKEVK---QQPSRDNPHEIGQIRLSLQYQRGVLTVMIHHAKGL  1774

Query  1680  PKVANCQEPNTYVKVYLKPDPTKKTKRKTKVVKKNCHPSFMEMLEYRMALDVIKERTLEA  1739
             P +   QEPNTYVK YLKPDP K+TKRKTKVV+K C PSFME LEYRM L++I+ER L+ 
Sbjct  1775  PMLQGGQEPNTYVKCYLKPDPKKETKRKTKVVRKTCVPSFMETLEYRMPLNIIQERRLQV  1834

Query  1740  TIWNHDTLQENEFLGGIRLPLGRIDLTTETIEWFSLGSI  1778
             T+W+HDTLQENE LGG  + L + DL  E ++W+ LG++
Sbjct  1835  TVWSHDTLQENELLGGFDMDLSKYDLRQELVDWYRLGAV  1873


 Score = 38.9 bits (89),  Expect = 0.051, Method: Compositional matrix adjust.
 Identities = 34/126 (27%), Positives = 53/126 (42%), Gaps = 24/126 (19%)

Query  14   AVIDYERQFQEDLELAQAMSLESLALEKFKLQKQRSDFNNIQQQCVPQSDGNSTVHSSSS  73
            A IDY++QFQ+DL  A A+SLE  AL+ ++  K+                G+    SS+ 
Sbjct  5    AHIDYDKQFQDDLAKATALSLEQHALDDYRRNKKY---------------GSGYQQSSTV  49

Query  74   ERDNTQQTEKFQCRSRPRPGSCNTNQSRNAVILAPPPVPSRRNSTTATTSQEHTVDLITF  133
               + Q  ++ Q   +PR      +   + V ++P      R      T      DLI F
Sbjct  50   AGRDYQAAQRSQSLHQPR-----RHSEVHQVAISPENAERSRTPPAQGTDN----DLICF  100

Query  134  TSPVKQ  139
             SP  +
Sbjct  101  ASPTSK  106


>Q7K3H0_DROME unnamed protein product
Length=1876

 Score = 1447 bits (3747),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 778/1599 (49%), Positives = 1029/1599 (64%), Gaps = 116/1599 (7%)

Query  261   TPSICGVQKPTFCMDDEQLNVLKVIEKKPNNNLIDLSSFDQVDDKTNVRVSVLEAFDPLL  320
              PS  GV   +   ++   +V      +  N+LIDL+  D        RVSVLEAFDPLL
Sbjct  310   VPSTVGVSSSSHTGNNGHSSV-----PRRGNDLIDLNHEDYS------RVSVLEAFDPLL  358

Query  321   ---VKIEDQNDSTQGHKD----------EIQSQVSGSVYDPFDPFDYMYST---------  358
                   +  +DST  + +          +  +Q S  +Y+  + +D   +T         
Sbjct  359   NDNTGNDTASDSTSYYAEYDPFDFLYSGDAATQYSDPMYEAVNRWDKTVATVSPNVGLIG  418

Query  359   -------NESVNSDPVYVAV-EKSAK-------------------------SPAVSPAAP  385
                      S +S    VA  E+S K                         + A  P + 
Sbjct  419   WRQDFLSQPSTSSSQYGVAPPEESLKLAENGSGTISPPPPLPPRNQQCYESNQAAMPVSR  478

Query  386   PPLPPRNSSAWNTIERRRTSLDRRKRQTRLYENVTVRKTRPSLHDCDLRAFYDMIKSVRS  445
             PP     + ++ +       LDRRK  TRLYE ++ ++T     D +L  FY M+K VR+
Sbjct  479   PPQSSVLTDSYTSSIPANVVLDRRKTCTRLYELISDQRT----DDPELLEFYHMVKEVRA  534

Query  446   EFPFNDPSTNIGHVISPMMESLYPEGTSIKLVVHPQL-----------MDSDE----NTP  490
              +P +D  TN+GHV++      Y   TSIK++VHP L           M  ++      P
Sbjct  535   RYPHDDAPTNVGHVVAAEFNYHYMMDTSIKVIVHPALNTLQSTVLAASMGKEQVKGYGMP  594

Query  491   SISFTCDVNCSVEHVILNVACSLEDEDIVNIEKYCLRVWGLAEYFASNTTLAQYEYIHQC  550
              ++FTCD++  V  V+     SLE +    +  Y ++  GL E+ A  + L+Q E +H  
Sbjct  595   -VTFTCDIDSVVAQVVAQALASLEGQVKGTVTDYAVKPIGLLEWLAPTSRLSQLECVHNS  653

Query  551   IKLEKDIELAI-LTKAQIKRSITRTLQDDNRDQCLKLEDILPNEPVQPISYDTLLILLET  609
              +LEKD+ L + L+ A   ++I RT +DD  D  L  E +LPNE V  ++YD ++IL+ET
Sbjct  654   FQLEKDVHLGLCLSTAANMQAIARTERDDEHDADLLPEHLLPNEVVPIVTYDNMMILIET  713

Query  610   VEKEMERVETAAIHLATTNHGSSLLPQLQPRSVVQAVKAVCALMGNIETFEITEAVDNFV  669
             +E E++++E+AA  +     G S++       VVQAVKA+CAL+G+I+T EI   V + +
Sbjct  714   LEMEIDKLESAADGVP----GRSVV---SCSGVVQAVKAICALLGSIDTMEIARCVAD-L  765

Query  670   NACCQFLPQVHTTNIECKKPEILHEDGDYSVVTLRTK-FPDVIASHCRKIRDAIQDLVET  728
                C+   + ++T      PEI+ + GDY+ V LR +   + I   C ++RDA+Q+LVE 
Sbjct  766   KRICEVEQKKYSTG--ASNPEIVSDYGDYAQVVLRPRSMLEQIKVKCNELRDAVQELVEL  823

Query  729   YCHAFRVDFELNSRGEIPTNTLISSEVLDTILVRVGALHRLPGSWKHDDYIIAAQIFHGT  788
             Y + FRV F + +  +  T  +  S V   I+V +  LHR   +WK DDY +  QI +GT
Sbjct  824   YANVFRVAFSVKT-PDYSTTPIPISCVSKPIVVCISCLHRPLPNWKFDDYSLCVQIVYGT  882

Query  789   RPVGNP-VLSEPMAVSSNFHPRILFNSWLEFRGISVCQVPREARLVLVLYGRTLQPTDHE  847
             R +  P VL+     S    PR+ F++WL F    +C +PREARL  VLYG+    ++ E
Sbjct  883   RLLSKPNVLTCSNDTSGGLFPRLNFSAWLTFDQHPICTLPREARLTFVLYGKQAA-SEGE  941

Query  848   SNS--SAENTMQKEELGWGAIQFFDYEGVMSQGSFFLSLWPAIADKRLGPAPAAGIHPHG  905
              N+  + E      ELGW +IQ FD++ VM  G + LSLWP + DK LGPAPA G HP  
Sbjct  942   PNADQNGERRQVTTELGWCSIQLFDFKRVMICGPYLLSLWPPMTDKMLGPAPARGCHPQP  1001

Query  906   DTHAIIGVELPDYGGRVLFPTELR-DYDVESLDFNSLDQNTQELLIDITQQTTFSRPLVE  964
             D   ++ +E+P YGGR+ FP            DF SLD N QE L+D T +  ++    E
Sbjct  1002  DFCPVLSIEVPPYGGRIEFPEHQEVPKPAPHYDFASLDANLQEELLD-TAELGYTG-ATE  1059

Query  965   EREILWEKRHYLHNRPEALPKVLLAAHSWDWACLPDLHASLRIWSPLPPVQALQLLLPCF  1024
              RE+ WEKR YL + P ALPKVL AAHSWD+A L DLHA L  W+PL P+Q+L+LLLP +
Sbjct  1060  RREVFWEKRLYLQSYPNALPKVLHAAHSWDYANLIDLHALLHSWAPLSPLQSLELLLPRY  1119

Query  1025  PDMKVREMAVGWIRELSNDELVDYLPQLLQALKHETYETSPLTKFLLERALLSPRVAHHI  1084
             PD KVRE AV WI ++ ND+LVD+LPQL+Q+LKH+TYE S + +FLL + L SPR AHH+
Sbjct  1120  PDAKVREKAVEWISKMPNDQLVDFLPQLVQSLKHDTYEGSAMARFLLSKCLESPRFAHHM  1179

Query  1085  YWLLTQALPGQSPQNSAETT----PEDDKNISSARYHRRLQLMLRALLAVIGDALRNSFL  1140
             YWLL  +LP   P NS          D+  ++  RY+RR ++MLRAL+A+ G+ +   F+
Sbjct  1180  YWLLVHSLP-DDPHNSIGAAMVDQEYDESQVTQVRYYRRNKMMLRALMAICGEKMLQRFM  1238

Query  1141  TQQLLVKNLYEVAENIKQTKESLRLDALKIGLQNIHCQLMEDDGTCLPLSPSKQVFGINV  1200
              Q  + + L  +AE++K+ KES+R  +L  G+  +H  L+E   TCLPL P  +V G++V
Sbjct  1239  YQHRMCQKLTTIAESVKEAKESMRQKSLAAGMDEVHQDLLEQP-TCLPLGPELEVTGVSV  1297

Query  1201  QSCSYFPSFTLPLKINFISCDDVICPAIFKVGDDLQQDMLTLQMMRIMDKLWLKEGLDLK  1260
             ++CSYF S TLPLKINF+  D    PAIFK GDDLQQD LT+Q++RIM+K+WL E LDLK
Sbjct  1298  RNCSYFNSNTLPLKINFVGPDAESLPAIFKCGDDLQQDQLTIQLIRIMNKMWLAERLDLK  1357

Query  1261  MVTFACVPTGYKRGMIEMVTNAETLRKIQVEFGLTGSFKDRPIAEWLAKHNPSELEYERA  1320
             MVTF CVPTGYK GMIE+V+ AETLRKIQVE GLTGSFKDRPIAEWL K NPS LEY+ A
Sbjct  1358  MVTFNCVPTGYKSGMIELVSEAETLRKIQVECGLTGSFKDRPIAEWLGKQNPSPLEYQSA  1417

Query  1321  VENFTASCAGYSVATYILGICDRHNDNIMLKTSGHLFHIDFGKFLGDAQMFGNFKRDRTP  1380
             V NFT SCAGYSVATY+LGICDRHNDNIMLKTSGHLFHIDFGKFLGDAQMFGNFKRDRTP
Sbjct  1418  VRNFTLSCAGYSVATYVLGICDRHNDNIMLKTSGHLFHIDFGKFLGDAQMFGNFKRDRTP  1477

Query  1381  FVLTSDMAYVINGGDKPSAKFHHFVDLCCQAFNVVRKHGNLILHLFGLMTSSGIPGVTVD  1440
             FVLTSDMAYVINGGDKPS  FH+FVDLCC+AFN+VRK+ +L+LH    M ++G+PGV  +
Sbjct  1478  FVLTSDMAYVINGGDKPSTDFHYFVDLCCRAFNIVRKNADLLLHTLAHMATAGMPGVNSN  1537

Query  1441  AVSYVQKALLPEQTNPEAAATFARMIESSLKSWFTQFNFFLHNLAQLRFSGDHNDGALLS  1500
             AV YV++ALLP Q+NPEAAATFA+MI+SSLKSWFTQFNFFLHNLAQ+RF+ D   G LLS
Sbjct  1538  AVQYVRRALLPSQSNPEAAATFAKMIQSSLKSWFTQFNFFLHNLAQMRFTPDEGSGELLS  1597

Query  1501  FIPRTYTMQQEGQLTSVQVHGYQKRYDPEKYYMYILRIQRKGHADPTYLFRSYKEFCEFY  1560
             F+PR YTMQQ+G+L  V+V  +QK Y  EK+YMYIL + R G  DPT+LFRSY+EF EF+
Sbjct  1598  FVPRKYTMQQDGRLKIVKVVCFQKHYSMEKFYMYILEVTRHGQPDPTHLFRSYREFTEFH  1657

Query  1561  QKLCIHFPLAKLASLPSGISVGRSNIKQVADKRRADIEKFLVSLFKMAPEISQSDLVYTF  1620
             QKLC+HFPL KL SLP+G+ VGRSNIK VA+KR   I++FL SLF  + EI+ S+LVYTF
Sbjct  1658  QKLCMHFPLVKLHSLPAGVHVGRSNIKSVAEKRLPLIQRFLKSLFDASEEIAHSELVYTF  1717

Query  1621  FHPLLRDQQNADIHLRKVKVGNWWAEKRVRDNVQN-GQIKMSLHYTRGAFYVMVYHARGL  1679
             FHPLLRDQQ A + + K+K      ++  RDN    GQI++SL Y RG   VM++HA+GL
Sbjct  1718  FHPLLRDQQEAKLGMPKIKEVK---QQPSRDNPHEIGQIRLSLQYQRGVLTVMIHHAKGL  1774

Query  1680  PKVANCQEPNTYVKVYLKPDPTKKTKRKTKVVKKNCHPSFMEMLEYRMALDVIKERTLEA  1739
             P +   QEPNTYVK YLKPDP K+TKRKTKVV+K C PSFME LEYRM L++I+ER L+ 
Sbjct  1775  PMLQGGQEPNTYVKCYLKPDPKKETKRKTKVVRKTCVPSFMETLEYRMPLNIIQERRLQV  1834

Query  1740  TIWNHDTLQENEFLGGIRLPLGRIDLTTETIEWFSLGSI  1778
             T+W+HDTLQENE LGG  + L + DL  E ++W+ LG++
Sbjct  1835  TVWSHDTLQENELLGGFDMDLSKYDLRQELVDWYRLGAV  1873


 Score = 38.9 bits (89),  Expect = 0.051, Method: Compositional matrix adjust.
 Identities = 34/126 (27%), Positives = 53/126 (42%), Gaps = 24/126 (19%)

Query  14   AVIDYERQFQEDLELAQAMSLESLALEKFKLQKQRSDFNNIQQQCVPQSDGNSTVHSSSS  73
            A IDY++QFQ+DL  A A+SLE  AL+ ++  K+                G+    SS+ 
Sbjct  5    AHIDYDKQFQDDLAKATALSLEQHALDDYRRNKKY---------------GSGYQQSSTV  49

Query  74   ERDNTQQTEKFQCRSRPRPGSCNTNQSRNAVILAPPPVPSRRNSTTATTSQEHTVDLITF  133
               + Q  ++ Q   +PR      +   + V ++P      R      T      DLI F
Sbjct  50   AGRDYQAAQRSQSLHQPR-----RHSEVHQVAISPENAERSRTPPAQGTDN----DLICF  100

Query  134  TSPVKQ  139
             SP  +
Sbjct  101  ASPTSK  106



Lambda      K        H
   0.319    0.134    0.404 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 23657709084


Query= XP_050469453.1 phosphatidylinositol 4-phosphate 3-kinase C2
domain-containing subunit beta isoform X3 [Bombus huntii]

Length=1763
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VTN5_DROME  unnamed protein product                                 1452    0.0  
Q7JNX6_DROME  unnamed protein product                                 1451    0.0  
Q7K3H0_DROME  unnamed protein product                                 1448    0.0  


>Q9VTN5_DROME unnamed protein product
Length=1876

 Score = 1452 bits (3759),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 773/1569 (49%), Positives = 1017/1569 (65%), Gaps = 109/1569 (7%)

Query  274   NNNLIDLSSFDQVDDKTNVRVSVLEAFDPLL---VKIEDQNDSTQGHKD----------E  320
              N+LIDL+  D        RVSVLEAFDPLL      +  +DST  + +          +
Sbjct  334   GNDLIDLNHEDYS------RVSVLEAFDPLLNDNTGNDTASDSTSYYAEYDPFDFLYSGD  387

Query  321   IQSQVSGSVYDPFDPFDYMYST----------------NESVNSDPVYVAV-EKSAK---  360
               +Q S  +Y+  + +D   +T                  S +S    VA  E+S K   
Sbjct  388   AATQYSDPMYEAVNRWDKTVATVSPNVGLIGWRQDFLSQPSTSSSQYGVAPPEESLKLAE  447

Query  361   ----------------------SPAVSPAAPPPLPPRNSSAWNTIERRRTSLDRRKRQTR  398
                                   + A  P + PP     + ++ +       LDRRK  TR
Sbjct  448   NGSGTISPPPPLPPRNQQCYESNQAAMPVSRPPQSSVLTDSYTSSIPANVVLDRRKTCTR  507

Query  399   LYENVTVRKTRPSLHDCDLRAFYDMIKSVRSEFPFNDPSTNIGHVISPMMESLYPEGTSI  458
             LYE ++ ++T     D +L  FY M+K VR+ +P +D  TN+GHV++      Y   TSI
Sbjct  508   LYELISDQRT----DDPELLEFYHMVKEVRARYPHDDAPTNVGHVVAAEFNYHYMMDTSI  563

Query  459   KLVVHPQLMDSDENTPS--------------ISFTCDVNCSVEHVILNVACSLEDEDIVN  504
             K++VHP L     N  +              ++FTCD++  V  V+     SLE +    
Sbjct  564   KVIVHPALNTLQSNVLAASMGKEQVKGYGMPVTFTCDIDSVVAQVVAQALASLEGQVKGT  623

Query  505   IEKYCLRVWGLAEYFASNTTLAQYEYIHQCIKLEKDIELAI-LTKAQIKRSITRTLQDDN  563
             +  Y ++  GL E+ A    L+Q E +H   +LEKD+ L + L+ A   ++I RT +DD 
Sbjct  624   VTDYAVKPIGLLEWLAPTLRLSQLECVHNSFQLEKDVHLGLCLSTAANMQAIARTERDDE  683

Query  564   RDQCLKLEDILPNEPVQPISYDTLLILLETVEKEMERVETAAIHLATTNHGSSLLPQLQP  623
              D  L  E +LPNE VQ ++YD ++IL+ET+E E++++E+AA  +     G S++     
Sbjct  684   HDADLLPEHLLPNEVVQIVTYDNMMILIETLEMEIDKLESAADGVP----GRSVV---SC  736

Query  624   RSVVQAVKAVCALMGNIETFEITEAVDNFVNACCQFLPQVHTTNIECKKPEILHEDGDYS  683
               VVQAVKA+CAL+G+I+T EI   V + +   C+   + ++T      PEI+ + GDY+
Sbjct  737   SGVVQAVKAICALLGSIDTMEIARCVAD-LKRICEVEQKKYSTG--ASNPEIVSDYGDYA  793

Query  684   VVTLRTK-FPDVIASHCRKIRDAIQDLVETYCHAFRVDFELNSRGEIPTNTLISSEVLDT  742
              V LR +   + I   C ++RDA+Q+LVE Y + FRV F + +  +  T  +  S V   
Sbjct  794   QVVLRPRSMLEQIKVKCNELRDAVQELVELYANVFRVAFSVKT-PDYSTTPIPISCVSKP  852

Query  743   ILVRVGALHRLPGSWKHDDYIIAAQIFHGTRPVGNP-VLSEPMAVSSNFHPRILFNSWLE  801
             I+V +  LHR   +WK DDY +  QI +GTR +  P VL+     S    PR+ F++WL 
Sbjct  853   IVVCISCLHRPLPNWKFDDYSLCVQIVYGTRLLSKPNVLTCSNDTSGGLFPRLNFSAWLT  912

Query  802   FRGISVCQVPREARLVLVLYGRTLQPTDHESNS--SAENTMQKEELGWGAIQFFDYEGVM  859
             F    +C +PREARL  VLYG+    ++ E N+  + E      ELGW +IQ FD++ VM
Sbjct  913   FDQHPICTLPREARLTFVLYGKQAA-SEGEPNADQNGERRQVTTELGWCSIQLFDFKRVM  971

Query  860   SQGSFFLSLWPAIADKRLGPAPAAGIHPHGDTHAIIGVELPDYGGRVLFPTELR-DYDVE  918
               G + LSLWP + DK LGPAPA G HP  D   ++ +E+P YGGR+ FP          
Sbjct  972   ICGPYLLSLWPPMTDKMLGPAPARGCHPQPDFCPVLSIEVPPYGGRIEFPEHQEVPKPAP  1031

Query  919   SLDFNSLDQNTQELLIDITQQTTFSRPLVEEREILWEKRHYLHNRPEALPKVLLAAHSWD  978
               DF SLD N QE L+D T +  ++    E RE+ WEKR YL + P ALPKVL AAHSWD
Sbjct  1032  HYDFASLDANLQEELLD-TAELGYTG-ATERREVFWEKRLYLQSYPNALPKVLHAAHSWD  1089

Query  979   WACLPDLHASLRIWSPLPPVQALQLLLPCFPDMKVREMAVGWIRELSNDELVDYLPQLLQ  1038
             +A L DLHA L  W+PL P+Q+L+LLLP +PD KVRE AV WI ++ ND+LVD+LPQL+Q
Sbjct  1090  YANLIDLHALLHSWAPLSPLQSLELLLPRYPDAKVREKAVEWISKMPNDQLVDFLPQLVQ  1149

Query  1039  ALKHETYETSPLTKFLLERALLSPRVAHHIYWLLTQALPGQSPQNSAETT----PEDDKN  1094
             +LKH+TYE S + +FLL + L SPR AHH+YWLL  +LP   P NS          D+  
Sbjct  1150  SLKHDTYEGSAMARFLLSKCLESPRFAHHMYWLLVHSLP-DDPHNSIGAAMVDQEYDESQ  1208

Query  1095  ISSARYHRRLQLMLRALLAVIGDALRNSFLTQQLLVKNLYEVAENIKQTKESLRLDALKI  1154
             ++  RY+RR ++MLRAL+A+ G+ +   F+ Q  + + L  +AE++K+ KES+R  +L  
Sbjct  1209  VTQVRYYRRNKMMLRALMAICGEKMLQRFMYQHRMCQKLTTIAESVKEAKESMRQKSLAA  1268

Query  1155  GLQNIHCQLMEDDGTCLPLSPSKQVFGINVQSCSYFPSFTLPLKINFISCDDVICPAIFK  1214
             G+  +H  L+E   TCLPL P  +V G++V++CSYF S TLPLKINF+  D    PAIFK
Sbjct  1269  GMDEVHQDLLEQP-TCLPLGPELEVTGVSVRNCSYFNSNTLPLKINFVGPDAESLPAIFK  1327

Query  1215  VGDDLQQDMLTLQMMRIMDKLWLKEGLDLKMVTFACVPTGYKRGMIEMVTNAETLRKIQV  1274
              GDDLQQD LT+Q++RIM+K+WL E LDLKMVTF CVPTGYK GMIE+V+ AETLRKIQV
Sbjct  1328  CGDDLQQDQLTIQLIRIMNKMWLAERLDLKMVTFNCVPTGYKSGMIELVSEAETLRKIQV  1387

Query  1275  EFGLTGSFKDRPIAEWLAKHNPSELEYERAVENFTASCAGYSVATYILGICDRHNDNIML  1334
             E GLTGSFKDRPIAEWL K NPS LEY+ AV NFT SCAGYSVATY+LGICDRHNDNIML
Sbjct  1388  ECGLTGSFKDRPIAEWLGKQNPSPLEYQSAVRNFTLSCAGYSVATYVLGICDRHNDNIML  1447

Query  1335  KTSGHLFHIDFGKFLGDAQMFGNFKRDRTPFVLTSDMAYVINGGDKPSAKFHHFVDLCCQ  1394
             KTSGHLFHIDFGKFLGDAQMFGNFKRDRTPFVLTSDMAYVINGGDKPS  FH+FVDLCC+
Sbjct  1448  KTSGHLFHIDFGKFLGDAQMFGNFKRDRTPFVLTSDMAYVINGGDKPSTDFHYFVDLCCR  1507

Query  1395  AFNVVRKHGNLILHLFGLMTSSGIPGVTVDAVSYVQKALLPEQTNPEAAATFARMIESSL  1454
             AFN+VRK+ +L+LH    M ++G+PGV  +AV YV++ALLP Q+NPEAAATFA+MI+SSL
Sbjct  1508  AFNIVRKNADLLLHTLAHMATAGMPGVNSNAVQYVRRALLPSQSNPEAAATFAKMIQSSL  1567

Query  1455  KSWFTQFNFFLHNLAQLRFSGDHNDGALLSFIPRTYTMQQEGQLTSVQVHGYQKRYDPEK  1514
             KSWFTQFNFFLHNLAQ+RF+ D   G LLSF+PR YTMQQ+G+L  V+V  +QK Y  EK
Sbjct  1568  KSWFTQFNFFLHNLAQMRFTPDEGSGELLSFVPRKYTMQQDGRLKIVKVVCFQKHYSMEK  1627

Query  1515  YYMYILRIQRKGHADPTYLFRSYKEFCEFYQKLCIHFPLAKLASLPSGISVGRSNIKQVA  1574
             +YMYIL + R G  DPT+LFRSY+EF EF+QKLC+HFPL KL SLP+G+ VGRSNIK VA
Sbjct  1628  FYMYILEVTRHGQPDPTHLFRSYREFTEFHQKLCMHFPLVKLHSLPAGVHVGRSNIKSVA  1687

Query  1575  DKRRADIEKFLVSLFKMAPEISQSDLVYTFFHPLLRDQQNADIHLRKVKVGNWWAEKRVR  1634
             +KR   I++FL SLF  + EI+ S+LVYTFFHPLLRDQQ A + + K+K      ++  R
Sbjct  1688  EKRLPLIQRFLKSLFDASEEIAHSELVYTFFHPLLRDQQEAKLGMPKIKEVK---QQPSR  1744

Query  1635  DNVQN-GQIKMSLHYTRGAFYVMVYHARGLPKVANCQEPNTYVKVYLKPDPTKKTKRKTK  1693
             DN    GQI++SL Y RG   VM++HA+GLP +   QEPNTYVK YLKPDP K+TKRKTK
Sbjct  1745  DNPHEIGQIRLSLQYQRGVLTVMIHHAKGLPMLQGGQEPNTYVKCYLKPDPKKETKRKTK  1804

Query  1694  VVKKNCHPSFMEMLEYRMALDVIKERTLEATIWNHDTLQENEFLGGIRLPLGRIDLTTET  1753
             VV+K C PSFME LEYRM L++I+ER L+ T+W+HDTLQENE LGG  + L + DL  E 
Sbjct  1805  VVRKTCVPSFMETLEYRMPLNIIQERRLQVTVWSHDTLQENELLGGFDMDLSKYDLRQEL  1864

Query  1754  IEWFSLGSI  1762
             ++W+ LG++
Sbjct  1865  VDWYRLGAV  1873


 Score = 38.9 bits (89),  Expect = 0.048, Method: Compositional matrix adjust.
 Identities = 34/126 (27%), Positives = 53/126 (42%), Gaps = 24/126 (19%)

Query  14   AVIDYERQFQEDLELAQAMSLESLALEKFKLQKQRSDFNNIQQQCVPQSDGNSTVHSSSS  73
            A IDY++QFQ+DL  A A+SLE  AL+ ++  K+                G+    SS+ 
Sbjct  5    AHIDYDKQFQDDLAKATALSLEQHALDDYRRNKKY---------------GSGYQQSSTV  49

Query  74   ERDNTQQTEKFQCRSRPRPGSCNTNQSRNAVILAPPPVPSRRNSTTATTSQEHTVDLITF  133
               + Q  ++ Q   +PR      +   + V ++P      R      T      DLI F
Sbjct  50   AGRDYQAAQRSQSLHQPR-----RHSEVHQVAISPENAERSRTPPAQGTDN----DLICF  100

Query  134  TSPVKQ  139
             SP  +
Sbjct  101  ASPTSK  106


>Q7JNX6_DROME unnamed protein product
Length=1876

 Score = 1451 bits (3757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 779/1599 (49%), Positives = 1030/1599 (64%), Gaps = 116/1599 (7%)

Query  245   TPSICGVQKPTFCMDDEQLNVLKVIEKKPNNNLIDLSSFDQVDDKTNVRVSVLEAFDPLL  304
              PS  GV   +   ++   +V      +  N+LIDL+  D        RVSVLEAFDPLL
Sbjct  310   VPSTVGVSSSSHTGNNGHSSV-----PRRGNDLIDLNHEDYS------RVSVLEAFDPLL  358

Query  305   ---VKIEDQNDSTQGHKD----------EIQSQVSGSVYDPFDPFDYMYST---------  342
                   +  +DST  + +          +  +Q S  +Y+  + +D   +T         
Sbjct  359   NDNTGNDTASDSTSYYAEYDPFDFLYSGDAATQYSDPMYEAVNRWDKTVATVSPNVGLIG  418

Query  343   -------NESVNSDPVYVAV-EKSAK-------------------------SPAVSPAAP  369
                      S +S    VA  E+S K                         + A  P + 
Sbjct  419   WRQDFLSQPSTSSSQYGVAPPEESLKLAENGSGTISPPPPLPPRNQQCYESNQAAMPVSR  478

Query  370   PPLPPRNSSAWNTIERRRTSLDRRKRQTRLYENVTVRKTRPSLHDCDLRAFYDMIKSVRS  429
             PP     + ++ +       LDRRK  TRLYE ++ ++T     D +L  FY M+K VR+
Sbjct  479   PPQSSVLTDSYTSSIPANVVLDRRKTCTRLYELISDQRT----DDPELLEFYHMVKEVRA  534

Query  430   EFPFNDPSTNIGHVISPMMESLYPEGTSIKLVVHPQL-----------MDSDE----NTP  474
              +P +D  TN+GHV++      Y   TSIK++VHP L           M  ++      P
Sbjct  535   RYPHDDAPTNVGHVVAAEFNYHYMMDTSIKVIVHPALNTLQSTVLAASMGKEQVKGYGMP  594

Query  475   SISFTCDVNCSVEHVILNVACSLEDEDIVNIEKYCLRVWGLAEYFASNTTLAQYEYIHQC  534
              ++FTCD++  V  V+     SLE +    +  Y ++  GL E+ A  + L+Q E +H  
Sbjct  595   -VTFTCDIDSVVAQVVAQALASLEGQVKGTVTDYAVKPIGLLEWLAPTSRLSQLECVHNS  653

Query  535   IKLEKDIELAI-LTKAQIKRSITRTLQDDNRDQCLKLEDILPNEPVQPISYDTLLILLET  593
              +LEKD+ L + L+ A   ++I RT +DD  D  L  E +LPNE VQ ++YD ++IL+ET
Sbjct  654   FQLEKDVHLGLCLSTAANMQAIARTERDDEHDADLLPEHLLPNEVVQIVTYDNMMILIET  713

Query  594   VEKEMERVETAAIHLATTNHGSSLLPQLQPRSVVQAVKAVCALMGNIETFEITEAVDNFV  653
             +E E++++E+AA  +     G S++       VVQAVKA+CAL+G+I+T EI   V + +
Sbjct  714   LEMEIDKLESAADGVP----GRSVV---SCSGVVQAVKAICALLGSIDTMEIARCVAD-L  765

Query  654   NACCQFLPQVHTTNIECKKPEILHEDGDYSVVTLRTK-FPDVIASHCRKIRDAIQDLVET  712
                C+   + ++T      PEI+ + GDY+ V LR +   + I   C ++RDA+Q+LVE 
Sbjct  766   KRICEVEQKKYSTG--ASNPEIVSDYGDYAQVVLRPRSMLEQIKVKCNELRDAVQELVEL  823

Query  713   YCHAFRVDFELNSRGEIPTNTLISSEVLDTILVRVGALHRLPGSWKHDDYIIAAQIFHGT  772
             Y + FRV F + +  +  T  +  S V   I+V +  LHR   +WK DDY +  QI +GT
Sbjct  824   YANVFRVAFSVKT-PDYSTTPIPISCVSKPIVVCISCLHRPLPNWKFDDYSLCVQIVYGT  882

Query  773   RPVGNP-VLSEPMAVSSNFHPRILFNSWLEFRGISVCQVPREARLVLVLYGRTLQPTDHE  831
             R +  P VL+     S    PR+ F++WL F    +C +PREARL  VLYG+    ++ E
Sbjct  883   RLLSKPNVLTCSNDTSGGLFPRLNFSAWLTFDQHPICTLPREARLTFVLYGKQAA-SEGE  941

Query  832   SNS--SAENTMQKEELGWGAIQFFDYEGVMSQGSFFLSLWPAIADKRLGPAPAAGIHPHG  889
              N+  + E      ELGW +IQ FD++ VM  G + LSLWP + DK LGPAPA G HP  
Sbjct  942   PNADQNGERRQVTTELGWCSIQLFDFKRVMICGPYLLSLWPPMTDKMLGPAPARGCHPQP  1001

Query  890   DTHAIIGVELPDYGGRVLFPTELR-DYDVESLDFNSLDQNTQELLIDITQQTTFSRPLVE  948
             D   ++ +E+P YGGR+ FP            DF SLD N QE L+D T +  ++    E
Sbjct  1002  DFCPVLSIEVPPYGGRIEFPEHQEVPKPAPHYDFASLDANLQEELLD-TAELGYTG-ATE  1059

Query  949   EREILWEKRHYLHNRPEALPKVLLAAHSWDWACLPDLHASLRIWSPLPPVQALQLLLPCF  1008
              RE+ WEKR YL + P ALPKVL AAHSWD+A L DLHA L  W+PL P+Q+L+LLLP +
Sbjct  1060  RREVFWEKRLYLQSYPNALPKVLHAAHSWDYANLIDLHALLHSWAPLSPLQSLELLLPRY  1119

Query  1009  PDMKVREMAVGWIRELSNDELVDYLPQLLQALKHETYETSPLTKFLLERALLSPRVAHHI  1068
             PD KVRE AV WI ++ ND+LVD+LPQL+Q+LKH+TYE S + +FLL + L SPR AHH+
Sbjct  1120  PDAKVREKAVEWISKMPNDQLVDFLPQLVQSLKHDTYEGSAMARFLLSKCLESPRFAHHM  1179

Query  1069  YWLLTQALPGQSPQNSAETT----PEDDKNISSARYHRRLQLMLRALLAVIGDALRNSFL  1124
             YWLL  +LP   P NS          D+  ++  RY+RR ++MLRAL+A+ G+ +   F+
Sbjct  1180  YWLLVHSLP-DDPHNSIGAAMVDQEYDESQVTQVRYYRRNKMMLRALMAICGEKMLQRFM  1238

Query  1125  TQQLLVKNLYEVAENIKQTKESLRLDALKIGLQNIHCQLMEDDGTCLPLSPSKQVFGINV  1184
              Q  + + L  +AE++K+ KES+R  +L  G+  +H  L+E   TCLPL P  +V G++V
Sbjct  1239  YQHRMCQKLTTIAESVKEAKESMRQKSLAAGMDEVHQDLLEQP-TCLPLGPELEVTGVSV  1297

Query  1185  QSCSYFPSFTLPLKINFISCDDVICPAIFKVGDDLQQDMLTLQMMRIMDKLWLKEGLDLK  1244
             ++CSYF S TLPLKINF+  D    PAIFK GDDLQQD LT+Q++RIM+K+WL E LDLK
Sbjct  1298  RNCSYFNSNTLPLKINFVGPDAESLPAIFKCGDDLQQDQLTIQLIRIMNKMWLAERLDLK  1357

Query  1245  MVTFACVPTGYKRGMIEMVTNAETLRKIQVEFGLTGSFKDRPIAEWLAKHNPSELEYERA  1304
             MVTF CVPTGYK GMIE+V+ AETLRKIQVE GLTGSFKDRPIAEWL K NPS LEY+ A
Sbjct  1358  MVTFNCVPTGYKSGMIELVSEAETLRKIQVECGLTGSFKDRPIAEWLGKQNPSPLEYQSA  1417

Query  1305  VENFTASCAGYSVATYILGICDRHNDNIMLKTSGHLFHIDFGKFLGDAQMFGNFKRDRTP  1364
             V NFT SCAGYSVATY+LGICDRHNDNIMLKTSGHLFHIDFGKFLGDAQMFGNFKRDRTP
Sbjct  1418  VRNFTLSCAGYSVATYVLGICDRHNDNIMLKTSGHLFHIDFGKFLGDAQMFGNFKRDRTP  1477

Query  1365  FVLTSDMAYVINGGDKPSAKFHHFVDLCCQAFNVVRKHGNLILHLFGLMTSSGIPGVTVD  1424
             FVLTSDMAYVINGGDKPS  FH+FVDLCC+AFN+VRK+ +L+LH    M ++G+PGV  +
Sbjct  1478  FVLTSDMAYVINGGDKPSTDFHYFVDLCCRAFNIVRKNADLLLHTLAHMATAGMPGVNSN  1537

Query  1425  AVSYVQKALLPEQTNPEAAATFARMIESSLKSWFTQFNFFLHNLAQLRFSGDHNDGALLS  1484
             AV YV++ALLP Q+NPEAAATFA+MI+SSLKSWFTQFNFFLHNLAQ+RF+ D   G LLS
Sbjct  1538  AVQYVRRALLPSQSNPEAAATFAKMIQSSLKSWFTQFNFFLHNLAQMRFTPDEGSGELLS  1597

Query  1485  FIPRTYTMQQEGQLTSVQVHGYQKRYDPEKYYMYILRIQRKGHADPTYLFRSYKEFCEFY  1544
             F+PR YTMQQ+G+L  V+V  +QK Y  EK+YMYIL + R G  DPT+LFRSY+EF EF+
Sbjct  1598  FVPRKYTMQQDGRLKIVKVVCFQKHYSMEKFYMYILEVTRHGQPDPTHLFRSYREFTEFH  1657

Query  1545  QKLCIHFPLAKLASLPSGISVGRSNIKQVADKRRADIEKFLVSLFKMAPEISQSDLVYTF  1604
             QKLC+HFPL KL SLP+G+ VGRSNIK VA+KR   I++FL SLF  + EI+ S+LVYTF
Sbjct  1658  QKLCMHFPLVKLHSLPAGVHVGRSNIKSVAEKRLPLIQRFLKSLFDASEEIAHSELVYTF  1717

Query  1605  FHPLLRDQQNADIHLRKVKVGNWWAEKRVRDNVQN-GQIKMSLHYTRGAFYVMVYHARGL  1663
             FHPLLRDQQ A + + K+K      ++  RDN    GQI++SL Y RG   VM++HA+GL
Sbjct  1718  FHPLLRDQQEAKLGMPKIKEVK---QQPSRDNPHEIGQIRLSLQYQRGVLTVMIHHAKGL  1774

Query  1664  PKVANCQEPNTYVKVYLKPDPTKKTKRKTKVVKKNCHPSFMEMLEYRMALDVIKERTLEA  1723
             P +   QEPNTYVK YLKPDP K+TKRKTKVV+K C PSFME LEYRM L++I+ER L+ 
Sbjct  1775  PMLQGGQEPNTYVKCYLKPDPKKETKRKTKVVRKTCVPSFMETLEYRMPLNIIQERRLQV  1834

Query  1724  TIWNHDTLQENEFLGGIRLPLGRIDLTTETIEWFSLGSI  1762
             T+W+HDTLQENE LGG  + L + DL  E ++W+ LG++
Sbjct  1835  TVWSHDTLQENELLGGFDMDLSKYDLRQELVDWYRLGAV  1873


 Score = 38.9 bits (89),  Expect = 0.048, Method: Compositional matrix adjust.
 Identities = 34/126 (27%), Positives = 53/126 (42%), Gaps = 24/126 (19%)

Query  14   AVIDYERQFQEDLELAQAMSLESLALEKFKLQKQRSDFNNIQQQCVPQSDGNSTVHSSSS  73
            A IDY++QFQ+DL  A A+SLE  AL+ ++  K+                G+    SS+ 
Sbjct  5    AHIDYDKQFQDDLAKATALSLEQHALDDYRRNKKY---------------GSGYQQSSTV  49

Query  74   ERDNTQQTEKFQCRSRPRPGSCNTNQSRNAVILAPPPVPSRRNSTTATTSQEHTVDLITF  133
               + Q  ++ Q   +PR      +   + V ++P      R      T      DLI F
Sbjct  50   AGRDYQAAQRSQSLHQPR-----RHSEVHQVAISPENAERSRTPPAQGTDN----DLICF  100

Query  134  TSPVKQ  139
             SP  +
Sbjct  101  ASPTSK  106


>Q7K3H0_DROME unnamed protein product
Length=1876

 Score = 1448 bits (3749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 778/1599 (49%), Positives = 1029/1599 (64%), Gaps = 116/1599 (7%)

Query  245   TPSICGVQKPTFCMDDEQLNVLKVIEKKPNNNLIDLSSFDQVDDKTNVRVSVLEAFDPLL  304
              PS  GV   +   ++   +V      +  N+LIDL+  D        RVSVLEAFDPLL
Sbjct  310   VPSTVGVSSSSHTGNNGHSSV-----PRRGNDLIDLNHEDYS------RVSVLEAFDPLL  358

Query  305   ---VKIEDQNDSTQGHKD----------EIQSQVSGSVYDPFDPFDYMYST---------  342
                   +  +DST  + +          +  +Q S  +Y+  + +D   +T         
Sbjct  359   NDNTGNDTASDSTSYYAEYDPFDFLYSGDAATQYSDPMYEAVNRWDKTVATVSPNVGLIG  418

Query  343   -------NESVNSDPVYVAV-EKSAK-------------------------SPAVSPAAP  369
                      S +S    VA  E+S K                         + A  P + 
Sbjct  419   WRQDFLSQPSTSSSQYGVAPPEESLKLAENGSGTISPPPPLPPRNQQCYESNQAAMPVSR  478

Query  370   PPLPPRNSSAWNTIERRRTSLDRRKRQTRLYENVTVRKTRPSLHDCDLRAFYDMIKSVRS  429
             PP     + ++ +       LDRRK  TRLYE ++ ++T     D +L  FY M+K VR+
Sbjct  479   PPQSSVLTDSYTSSIPANVVLDRRKTCTRLYELISDQRT----DDPELLEFYHMVKEVRA  534

Query  430   EFPFNDPSTNIGHVISPMMESLYPEGTSIKLVVHPQL-----------MDSDE----NTP  474
              +P +D  TN+GHV++      Y   TSIK++VHP L           M  ++      P
Sbjct  535   RYPHDDAPTNVGHVVAAEFNYHYMMDTSIKVIVHPALNTLQSTVLAASMGKEQVKGYGMP  594

Query  475   SISFTCDVNCSVEHVILNVACSLEDEDIVNIEKYCLRVWGLAEYFASNTTLAQYEYIHQC  534
              ++FTCD++  V  V+     SLE +    +  Y ++  GL E+ A  + L+Q E +H  
Sbjct  595   -VTFTCDIDSVVAQVVAQALASLEGQVKGTVTDYAVKPIGLLEWLAPTSRLSQLECVHNS  653

Query  535   IKLEKDIELAI-LTKAQIKRSITRTLQDDNRDQCLKLEDILPNEPVQPISYDTLLILLET  593
              +LEKD+ L + L+ A   ++I RT +DD  D  L  E +LPNE V  ++YD ++IL+ET
Sbjct  654   FQLEKDVHLGLCLSTAANMQAIARTERDDEHDADLLPEHLLPNEVVPIVTYDNMMILIET  713

Query  594   VEKEMERVETAAIHLATTNHGSSLLPQLQPRSVVQAVKAVCALMGNIETFEITEAVDNFV  653
             +E E++++E+AA  +     G S++       VVQAVKA+CAL+G+I+T EI   V + +
Sbjct  714   LEMEIDKLESAADGVP----GRSVV---SCSGVVQAVKAICALLGSIDTMEIARCVAD-L  765

Query  654   NACCQFLPQVHTTNIECKKPEILHEDGDYSVVTLRTK-FPDVIASHCRKIRDAIQDLVET  712
                C+   + ++T      PEI+ + GDY+ V LR +   + I   C ++RDA+Q+LVE 
Sbjct  766   KRICEVEQKKYSTG--ASNPEIVSDYGDYAQVVLRPRSMLEQIKVKCNELRDAVQELVEL  823

Query  713   YCHAFRVDFELNSRGEIPTNTLISSEVLDTILVRVGALHRLPGSWKHDDYIIAAQIFHGT  772
             Y + FRV F + +  +  T  +  S V   I+V +  LHR   +WK DDY +  QI +GT
Sbjct  824   YANVFRVAFSVKT-PDYSTTPIPISCVSKPIVVCISCLHRPLPNWKFDDYSLCVQIVYGT  882

Query  773   RPVGNP-VLSEPMAVSSNFHPRILFNSWLEFRGISVCQVPREARLVLVLYGRTLQPTDHE  831
             R +  P VL+     S    PR+ F++WL F    +C +PREARL  VLYG+    ++ E
Sbjct  883   RLLSKPNVLTCSNDTSGGLFPRLNFSAWLTFDQHPICTLPREARLTFVLYGKQAA-SEGE  941

Query  832   SNS--SAENTMQKEELGWGAIQFFDYEGVMSQGSFFLSLWPAIADKRLGPAPAAGIHPHG  889
              N+  + E      ELGW +IQ FD++ VM  G + LSLWP + DK LGPAPA G HP  
Sbjct  942   PNADQNGERRQVTTELGWCSIQLFDFKRVMICGPYLLSLWPPMTDKMLGPAPARGCHPQP  1001

Query  890   DTHAIIGVELPDYGGRVLFPTELR-DYDVESLDFNSLDQNTQELLIDITQQTTFSRPLVE  948
             D   ++ +E+P YGGR+ FP            DF SLD N QE L+D T +  ++    E
Sbjct  1002  DFCPVLSIEVPPYGGRIEFPEHQEVPKPAPHYDFASLDANLQEELLD-TAELGYTG-ATE  1059

Query  949   EREILWEKRHYLHNRPEALPKVLLAAHSWDWACLPDLHASLRIWSPLPPVQALQLLLPCF  1008
              RE+ WEKR YL + P ALPKVL AAHSWD+A L DLHA L  W+PL P+Q+L+LLLP +
Sbjct  1060  RREVFWEKRLYLQSYPNALPKVLHAAHSWDYANLIDLHALLHSWAPLSPLQSLELLLPRY  1119

Query  1009  PDMKVREMAVGWIRELSNDELVDYLPQLLQALKHETYETSPLTKFLLERALLSPRVAHHI  1068
             PD KVRE AV WI ++ ND+LVD+LPQL+Q+LKH+TYE S + +FLL + L SPR AHH+
Sbjct  1120  PDAKVREKAVEWISKMPNDQLVDFLPQLVQSLKHDTYEGSAMARFLLSKCLESPRFAHHM  1179

Query  1069  YWLLTQALPGQSPQNSAETT----PEDDKNISSARYHRRLQLMLRALLAVIGDALRNSFL  1124
             YWLL  +LP   P NS          D+  ++  RY+RR ++MLRAL+A+ G+ +   F+
Sbjct  1180  YWLLVHSLP-DDPHNSIGAAMVDQEYDESQVTQVRYYRRNKMMLRALMAICGEKMLQRFM  1238

Query  1125  TQQLLVKNLYEVAENIKQTKESLRLDALKIGLQNIHCQLMEDDGTCLPLSPSKQVFGINV  1184
              Q  + + L  +AE++K+ KES+R  +L  G+  +H  L+E   TCLPL P  +V G++V
Sbjct  1239  YQHRMCQKLTTIAESVKEAKESMRQKSLAAGMDEVHQDLLEQP-TCLPLGPELEVTGVSV  1297

Query  1185  QSCSYFPSFTLPLKINFISCDDVICPAIFKVGDDLQQDMLTLQMMRIMDKLWLKEGLDLK  1244
             ++CSYF S TLPLKINF+  D    PAIFK GDDLQQD LT+Q++RIM+K+WL E LDLK
Sbjct  1298  RNCSYFNSNTLPLKINFVGPDAESLPAIFKCGDDLQQDQLTIQLIRIMNKMWLAERLDLK  1357

Query  1245  MVTFACVPTGYKRGMIEMVTNAETLRKIQVEFGLTGSFKDRPIAEWLAKHNPSELEYERA  1304
             MVTF CVPTGYK GMIE+V+ AETLRKIQVE GLTGSFKDRPIAEWL K NPS LEY+ A
Sbjct  1358  MVTFNCVPTGYKSGMIELVSEAETLRKIQVECGLTGSFKDRPIAEWLGKQNPSPLEYQSA  1417

Query  1305  VENFTASCAGYSVATYILGICDRHNDNIMLKTSGHLFHIDFGKFLGDAQMFGNFKRDRTP  1364
             V NFT SCAGYSVATY+LGICDRHNDNIMLKTSGHLFHIDFGKFLGDAQMFGNFKRDRTP
Sbjct  1418  VRNFTLSCAGYSVATYVLGICDRHNDNIMLKTSGHLFHIDFGKFLGDAQMFGNFKRDRTP  1477

Query  1365  FVLTSDMAYVINGGDKPSAKFHHFVDLCCQAFNVVRKHGNLILHLFGLMTSSGIPGVTVD  1424
             FVLTSDMAYVINGGDKPS  FH+FVDLCC+AFN+VRK+ +L+LH    M ++G+PGV  +
Sbjct  1478  FVLTSDMAYVINGGDKPSTDFHYFVDLCCRAFNIVRKNADLLLHTLAHMATAGMPGVNSN  1537

Query  1425  AVSYVQKALLPEQTNPEAAATFARMIESSLKSWFTQFNFFLHNLAQLRFSGDHNDGALLS  1484
             AV YV++ALLP Q+NPEAAATFA+MI+SSLKSWFTQFNFFLHNLAQ+RF+ D   G LLS
Sbjct  1538  AVQYVRRALLPSQSNPEAAATFAKMIQSSLKSWFTQFNFFLHNLAQMRFTPDEGSGELLS  1597

Query  1485  FIPRTYTMQQEGQLTSVQVHGYQKRYDPEKYYMYILRIQRKGHADPTYLFRSYKEFCEFY  1544
             F+PR YTMQQ+G+L  V+V  +QK Y  EK+YMYIL + R G  DPT+LFRSY+EF EF+
Sbjct  1598  FVPRKYTMQQDGRLKIVKVVCFQKHYSMEKFYMYILEVTRHGQPDPTHLFRSYREFTEFH  1657

Query  1545  QKLCIHFPLAKLASLPSGISVGRSNIKQVADKRRADIEKFLVSLFKMAPEISQSDLVYTF  1604
             QKLC+HFPL KL SLP+G+ VGRSNIK VA+KR   I++FL SLF  + EI+ S+LVYTF
Sbjct  1658  QKLCMHFPLVKLHSLPAGVHVGRSNIKSVAEKRLPLIQRFLKSLFDASEEIAHSELVYTF  1717

Query  1605  FHPLLRDQQNADIHLRKVKVGNWWAEKRVRDNVQN-GQIKMSLHYTRGAFYVMVYHARGL  1663
             FHPLLRDQQ A + + K+K      ++  RDN    GQI++SL Y RG   VM++HA+GL
Sbjct  1718  FHPLLRDQQEAKLGMPKIKEVK---QQPSRDNPHEIGQIRLSLQYQRGVLTVMIHHAKGL  1774

Query  1664  PKVANCQEPNTYVKVYLKPDPTKKTKRKTKVVKKNCHPSFMEMLEYRMALDVIKERTLEA  1723
             P +   QEPNTYVK YLKPDP K+TKRKTKVV+K C PSFME LEYRM L++I+ER L+ 
Sbjct  1775  PMLQGGQEPNTYVKCYLKPDPKKETKRKTKVVRKTCVPSFMETLEYRMPLNIIQERRLQV  1834

Query  1724  TIWNHDTLQENEFLGGIRLPLGRIDLTTETIEWFSLGSI  1762
             T+W+HDTLQENE LGG  + L + DL  E ++W+ LG++
Sbjct  1835  TVWSHDTLQENELLGGFDMDLSKYDLRQELVDWYRLGAV  1873


 Score = 38.9 bits (89),  Expect = 0.048, Method: Compositional matrix adjust.
 Identities = 34/126 (27%), Positives = 53/126 (42%), Gaps = 24/126 (19%)

Query  14   AVIDYERQFQEDLELAQAMSLESLALEKFKLQKQRSDFNNIQQQCVPQSDGNSTVHSSSS  73
            A IDY++QFQ+DL  A A+SLE  AL+ ++  K+                G+    SS+ 
Sbjct  5    AHIDYDKQFQDDLAKATALSLEQHALDDYRRNKKY---------------GSGYQQSSTV  49

Query  74   ERDNTQQTEKFQCRSRPRPGSCNTNQSRNAVILAPPPVPSRRNSTTATTSQEHTVDLITF  133
               + Q  ++ Q   +PR      +   + V ++P      R      T      DLI F
Sbjct  50   AGRDYQAAQRSQSLHQPR-----RHSEVHQVAISPENAERSRTPPAQGTDN----DLICF  100

Query  134  TSPVKQ  139
             SP  +
Sbjct  101  ASPTSK  106



Lambda      K        H
   0.319    0.134    0.404 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 23657709084


Query= XP_050469454.1 phosphatidylinositol 4-phosphate 3-kinase C2
domain-containing subunit beta isoform X4 [Bombus huntii]

Length=1762
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VTN5_DROME  unnamed protein product                                 1452    0.0  
Q7JNX6_DROME  unnamed protein product                                 1451    0.0  
Q7K3H0_DROME  unnamed protein product                                 1448    0.0  


>Q9VTN5_DROME unnamed protein product
Length=1876

 Score = 1452 bits (3760),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 773/1569 (49%), Positives = 1017/1569 (65%), Gaps = 109/1569 (7%)

Query  273   NNNLIDLSSFDQVDDKTNVRVSVLEAFDPLL---VKIEDQNDSTQGHKD----------E  319
              N+LIDL+  D        RVSVLEAFDPLL      +  +DST  + +          +
Sbjct  334   GNDLIDLNHEDYS------RVSVLEAFDPLLNDNTGNDTASDSTSYYAEYDPFDFLYSGD  387

Query  320   IQSQVSGSVYDPFDPFDYMYST----------------NESVNSDPVYVAV-EKSAK---  359
               +Q S  +Y+  + +D   +T                  S +S    VA  E+S K   
Sbjct  388   AATQYSDPMYEAVNRWDKTVATVSPNVGLIGWRQDFLSQPSTSSSQYGVAPPEESLKLAE  447

Query  360   ----------------------SPAVSPAAPPPLPPRNSSAWNTIERRRTSLDRRKRQTR  397
                                   + A  P + PP     + ++ +       LDRRK  TR
Sbjct  448   NGSGTISPPPPLPPRNQQCYESNQAAMPVSRPPQSSVLTDSYTSSIPANVVLDRRKTCTR  507

Query  398   LYENVTVRKTRPSLHDCDLRAFYDMIKSVRSEFPFNDPSTNIGHVISPMMESLYPEGTSI  457
             LYE ++ ++T     D +L  FY M+K VR+ +P +D  TN+GHV++      Y   TSI
Sbjct  508   LYELISDQRT----DDPELLEFYHMVKEVRARYPHDDAPTNVGHVVAAEFNYHYMMDTSI  563

Query  458   KLVVHPQLMDSDENTPS--------------ISFTCDVNCSVEHVILNVACSLEDEDIVN  503
             K++VHP L     N  +              ++FTCD++  V  V+     SLE +    
Sbjct  564   KVIVHPALNTLQSNVLAASMGKEQVKGYGMPVTFTCDIDSVVAQVVAQALASLEGQVKGT  623

Query  504   IEKYCLRVWGLAEYFASNTTLAQYEYIHQCIKLEKDIELAI-LTKAQIKRSITRTLQDDN  562
             +  Y ++  GL E+ A    L+Q E +H   +LEKD+ L + L+ A   ++I RT +DD 
Sbjct  624   VTDYAVKPIGLLEWLAPTLRLSQLECVHNSFQLEKDVHLGLCLSTAANMQAIARTERDDE  683

Query  563   RDQCLKLEDILPNEPVQPISYDTLLILLETVEKEMERVETAAIHLATTNHGSSLLPQLQP  622
              D  L  E +LPNE VQ ++YD ++IL+ET+E E++++E+AA  +     G S++     
Sbjct  684   HDADLLPEHLLPNEVVQIVTYDNMMILIETLEMEIDKLESAADGVP----GRSVV---SC  736

Query  623   RSVVQAVKAVCALMGNIETFEITEAVDNFVNACCQFLPQVHTTNIECKKPEILHEDGDYS  682
               VVQAVKA+CAL+G+I+T EI   V + +   C+   + ++T      PEI+ + GDY+
Sbjct  737   SGVVQAVKAICALLGSIDTMEIARCVAD-LKRICEVEQKKYSTG--ASNPEIVSDYGDYA  793

Query  683   VVTLRTK-FPDVIASHCRKIRDAIQDLVETYCHAFRVDFELNSRGEIPTNTLISSEVLDT  741
              V LR +   + I   C ++RDA+Q+LVE Y + FRV F + +  +  T  +  S V   
Sbjct  794   QVVLRPRSMLEQIKVKCNELRDAVQELVELYANVFRVAFSVKT-PDYSTTPIPISCVSKP  852

Query  742   ILVRVGALHRLPGSWKHDDYIIAAQIFHGTRPVGNP-VLSEPMAVSSNFHPRILFNSWLE  800
             I+V +  LHR   +WK DDY +  QI +GTR +  P VL+     S    PR+ F++WL 
Sbjct  853   IVVCISCLHRPLPNWKFDDYSLCVQIVYGTRLLSKPNVLTCSNDTSGGLFPRLNFSAWLT  912

Query  801   FRGISVCQVPREARLVLVLYGRTLQPTDHESNS--SAENTMQKEELGWGAIQFFDYEGVM  858
             F    +C +PREARL  VLYG+    ++ E N+  + E      ELGW +IQ FD++ VM
Sbjct  913   FDQHPICTLPREARLTFVLYGKQAA-SEGEPNADQNGERRQVTTELGWCSIQLFDFKRVM  971

Query  859   SQGSFFLSLWPAIADKRLGPAPAAGIHPHGDTHAIIGVELPDYGGRVLFPTELR-DYDVE  917
               G + LSLWP + DK LGPAPA G HP  D   ++ +E+P YGGR+ FP          
Sbjct  972   ICGPYLLSLWPPMTDKMLGPAPARGCHPQPDFCPVLSIEVPPYGGRIEFPEHQEVPKPAP  1031

Query  918   SLDFNSLDQNTQELLIDITQQTTFSRPLVEEREILWEKRHYLHNRPEALPKVLLAAHSWD  977
               DF SLD N QE L+D T +  ++    E RE+ WEKR YL + P ALPKVL AAHSWD
Sbjct  1032  HYDFASLDANLQEELLD-TAELGYTG-ATERREVFWEKRLYLQSYPNALPKVLHAAHSWD  1089

Query  978   WACLPDLHASLRIWSPLPPVQALQLLLPCFPDMKVREMAVGWIRELSNDELVDYLPQLLQ  1037
             +A L DLHA L  W+PL P+Q+L+LLLP +PD KVRE AV WI ++ ND+LVD+LPQL+Q
Sbjct  1090  YANLIDLHALLHSWAPLSPLQSLELLLPRYPDAKVREKAVEWISKMPNDQLVDFLPQLVQ  1149

Query  1038  ALKHETYETSPLTKFLLERALLSPRVAHHIYWLLTQALPGQSPQNSAETT----PEDDKN  1093
             +LKH+TYE S + +FLL + L SPR AHH+YWLL  +LP   P NS          D+  
Sbjct  1150  SLKHDTYEGSAMARFLLSKCLESPRFAHHMYWLLVHSLP-DDPHNSIGAAMVDQEYDESQ  1208

Query  1094  ISSARYHRRLQLMLRALLAVIGDALRNSFLTQQLLVKNLYEVAENIKQTKESLRLDALKI  1153
             ++  RY+RR ++MLRAL+A+ G+ +   F+ Q  + + L  +AE++K+ KES+R  +L  
Sbjct  1209  VTQVRYYRRNKMMLRALMAICGEKMLQRFMYQHRMCQKLTTIAESVKEAKESMRQKSLAA  1268

Query  1154  GLQNIHCQLMEDDGTCLPLSPSKQVFGINVQSCSYFPSFTLPLKINFISCDDVICPAIFK  1213
             G+  +H  L+E   TCLPL P  +V G++V++CSYF S TLPLKINF+  D    PAIFK
Sbjct  1269  GMDEVHQDLLEQP-TCLPLGPELEVTGVSVRNCSYFNSNTLPLKINFVGPDAESLPAIFK  1327

Query  1214  VGDDLQQDMLTLQMMRIMDKLWLKEGLDLKMVTFACVPTGYKRGMIEMVTNAETLRKIQV  1273
              GDDLQQD LT+Q++RIM+K+WL E LDLKMVTF CVPTGYK GMIE+V+ AETLRKIQV
Sbjct  1328  CGDDLQQDQLTIQLIRIMNKMWLAERLDLKMVTFNCVPTGYKSGMIELVSEAETLRKIQV  1387

Query  1274  EFGLTGSFKDRPIAEWLAKHNPSELEYERAVENFTASCAGYSVATYILGICDRHNDNIML  1333
             E GLTGSFKDRPIAEWL K NPS LEY+ AV NFT SCAGYSVATY+LGICDRHNDNIML
Sbjct  1388  ECGLTGSFKDRPIAEWLGKQNPSPLEYQSAVRNFTLSCAGYSVATYVLGICDRHNDNIML  1447

Query  1334  KTSGHLFHIDFGKFLGDAQMFGNFKRDRTPFVLTSDMAYVINGGDKPSAKFHHFVDLCCQ  1393
             KTSGHLFHIDFGKFLGDAQMFGNFKRDRTPFVLTSDMAYVINGGDKPS  FH+FVDLCC+
Sbjct  1448  KTSGHLFHIDFGKFLGDAQMFGNFKRDRTPFVLTSDMAYVINGGDKPSTDFHYFVDLCCR  1507

Query  1394  AFNVVRKHGNLILHLFGLMTSSGIPGVTVDAVSYVQKALLPEQTNPEAAATFARMIESSL  1453
             AFN+VRK+ +L+LH    M ++G+PGV  +AV YV++ALLP Q+NPEAAATFA+MI+SSL
Sbjct  1508  AFNIVRKNADLLLHTLAHMATAGMPGVNSNAVQYVRRALLPSQSNPEAAATFAKMIQSSL  1567

Query  1454  KSWFTQFNFFLHNLAQLRFSGDHNDGALLSFIPRTYTMQQEGQLTSVQVHGYQKRYDPEK  1513
             KSWFTQFNFFLHNLAQ+RF+ D   G LLSF+PR YTMQQ+G+L  V+V  +QK Y  EK
Sbjct  1568  KSWFTQFNFFLHNLAQMRFTPDEGSGELLSFVPRKYTMQQDGRLKIVKVVCFQKHYSMEK  1627

Query  1514  YYMYILRIQRKGHADPTYLFRSYKEFCEFYQKLCIHFPLAKLASLPSGISVGRSNIKQVA  1573
             +YMYIL + R G  DPT+LFRSY+EF EF+QKLC+HFPL KL SLP+G+ VGRSNIK VA
Sbjct  1628  FYMYILEVTRHGQPDPTHLFRSYREFTEFHQKLCMHFPLVKLHSLPAGVHVGRSNIKSVA  1687

Query  1574  DKRRADIEKFLVSLFKMAPEISQSDLVYTFFHPLLRDQQNADIHLRKVKVGNWWAEKRVR  1633
             +KR   I++FL SLF  + EI+ S+LVYTFFHPLLRDQQ A + + K+K      ++  R
Sbjct  1688  EKRLPLIQRFLKSLFDASEEIAHSELVYTFFHPLLRDQQEAKLGMPKIKEVK---QQPSR  1744

Query  1634  DNVQN-GQIKMSLHYTRGAFYVMVYHARGLPKVANCQEPNTYVKVYLKPDPTKKTKRKTK  1692
             DN    GQI++SL Y RG   VM++HA+GLP +   QEPNTYVK YLKPDP K+TKRKTK
Sbjct  1745  DNPHEIGQIRLSLQYQRGVLTVMIHHAKGLPMLQGGQEPNTYVKCYLKPDPKKETKRKTK  1804

Query  1693  VVKKNCHPSFMEMLEYRMALDVIKERTLEATIWNHDTLQENEFLGGIRLPLGRIDLTTET  1752
             VV+K C PSFME LEYRM L++I+ER L+ T+W+HDTLQENE LGG  + L + DL  E 
Sbjct  1805  VVRKTCVPSFMETLEYRMPLNIIQERRLQVTVWSHDTLQENELLGGFDMDLSKYDLRQEL  1864

Query  1753  IEWFSLGSI  1761
             ++W+ LG++
Sbjct  1865  VDWYRLGAV  1873


 Score = 38.9 bits (89),  Expect = 0.047, Method: Compositional matrix adjust.
 Identities = 34/126 (27%), Positives = 53/126 (42%), Gaps = 24/126 (19%)

Query  14   AVIDYERQFQEDLELAQAMSLESLALEKFKLQKQRSDFNNIQQQCVPQSDGNSTVHSSSS  73
            A IDY++QFQ+DL  A A+SLE  AL+ ++  K+                G+    SS+ 
Sbjct  5    AHIDYDKQFQDDLAKATALSLEQHALDDYRRNKKY---------------GSGYQQSSTV  49

Query  74   ERDNTQQTEKFQCRSRPRPGSCNTNQSRNAVILAPPPVPSRRNSTTATTSQEHTVDLITF  133
               + Q  ++ Q   +PR      +   + V ++P      R      T      DLI F
Sbjct  50   AGRDYQAAQRSQSLHQPR-----RHSEVHQVAISPENAERSRTPPAQGTDN----DLICF  100

Query  134  TSPVKQ  139
             SP  +
Sbjct  101  ASPTSK  106


>Q7JNX6_DROME unnamed protein product
Length=1876

 Score = 1451 bits (3756),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 779/1599 (49%), Positives = 1030/1599 (64%), Gaps = 116/1599 (7%)

Query  244   TPSICGVQKPTFCMDDEQLNVLKVIEKKPNNNLIDLSSFDQVDDKTNVRVSVLEAFDPLL  303
              PS  GV   +   ++   +V      +  N+LIDL+  D        RVSVLEAFDPLL
Sbjct  310   VPSTVGVSSSSHTGNNGHSSV-----PRRGNDLIDLNHEDYS------RVSVLEAFDPLL  358

Query  304   ---VKIEDQNDSTQGHKD----------EIQSQVSGSVYDPFDPFDYMYST---------  341
                   +  +DST  + +          +  +Q S  +Y+  + +D   +T         
Sbjct  359   NDNTGNDTASDSTSYYAEYDPFDFLYSGDAATQYSDPMYEAVNRWDKTVATVSPNVGLIG  418

Query  342   -------NESVNSDPVYVAV-EKSAK-------------------------SPAVSPAAP  368
                      S +S    VA  E+S K                         + A  P + 
Sbjct  419   WRQDFLSQPSTSSSQYGVAPPEESLKLAENGSGTISPPPPLPPRNQQCYESNQAAMPVSR  478

Query  369   PPLPPRNSSAWNTIERRRTSLDRRKRQTRLYENVTVRKTRPSLHDCDLRAFYDMIKSVRS  428
             PP     + ++ +       LDRRK  TRLYE ++ ++T     D +L  FY M+K VR+
Sbjct  479   PPQSSVLTDSYTSSIPANVVLDRRKTCTRLYELISDQRT----DDPELLEFYHMVKEVRA  534

Query  429   EFPFNDPSTNIGHVISPMMESLYPEGTSIKLVVHPQL-----------MDSDE----NTP  473
              +P +D  TN+GHV++      Y   TSIK++VHP L           M  ++      P
Sbjct  535   RYPHDDAPTNVGHVVAAEFNYHYMMDTSIKVIVHPALNTLQSTVLAASMGKEQVKGYGMP  594

Query  474   SISFTCDVNCSVEHVILNVACSLEDEDIVNIEKYCLRVWGLAEYFASNTTLAQYEYIHQC  533
              ++FTCD++  V  V+     SLE +    +  Y ++  GL E+ A  + L+Q E +H  
Sbjct  595   -VTFTCDIDSVVAQVVAQALASLEGQVKGTVTDYAVKPIGLLEWLAPTSRLSQLECVHNS  653

Query  534   IKLEKDIELAI-LTKAQIKRSITRTLQDDNRDQCLKLEDILPNEPVQPISYDTLLILLET  592
              +LEKD+ L + L+ A   ++I RT +DD  D  L  E +LPNE VQ ++YD ++IL+ET
Sbjct  654   FQLEKDVHLGLCLSTAANMQAIARTERDDEHDADLLPEHLLPNEVVQIVTYDNMMILIET  713

Query  593   VEKEMERVETAAIHLATTNHGSSLLPQLQPRSVVQAVKAVCALMGNIETFEITEAVDNFV  652
             +E E++++E+AA  +     G S++       VVQAVKA+CAL+G+I+T EI   V + +
Sbjct  714   LEMEIDKLESAADGVP----GRSVV---SCSGVVQAVKAICALLGSIDTMEIARCVAD-L  765

Query  653   NACCQFLPQVHTTNIECKKPEILHEDGDYSVVTLRTK-FPDVIASHCRKIRDAIQDLVET  711
                C+   + ++T      PEI+ + GDY+ V LR +   + I   C ++RDA+Q+LVE 
Sbjct  766   KRICEVEQKKYSTG--ASNPEIVSDYGDYAQVVLRPRSMLEQIKVKCNELRDAVQELVEL  823

Query  712   YCHAFRVDFELNSRGEIPTNTLISSEVLDTILVRVGALHRLPGSWKHDDYIIAAQIFHGT  771
             Y + FRV F + +  +  T  +  S V   I+V +  LHR   +WK DDY +  QI +GT
Sbjct  824   YANVFRVAFSVKT-PDYSTTPIPISCVSKPIVVCISCLHRPLPNWKFDDYSLCVQIVYGT  882

Query  772   RPVGNP-VLSEPMAVSSNFHPRILFNSWLEFRGISVCQVPREARLVLVLYGRTLQPTDHE  830
             R +  P VL+     S    PR+ F++WL F    +C +PREARL  VLYG+    ++ E
Sbjct  883   RLLSKPNVLTCSNDTSGGLFPRLNFSAWLTFDQHPICTLPREARLTFVLYGKQAA-SEGE  941

Query  831   SNS--SAENTMQKEELGWGAIQFFDYEGVMSQGSFFLSLWPAIADKRLGPAPAAGIHPHG  888
              N+  + E      ELGW +IQ FD++ VM  G + LSLWP + DK LGPAPA G HP  
Sbjct  942   PNADQNGERRQVTTELGWCSIQLFDFKRVMICGPYLLSLWPPMTDKMLGPAPARGCHPQP  1001

Query  889   DTHAIIGVELPDYGGRVLFPTELR-DYDVESLDFNSLDQNTQELLIDITQQTTFSRPLVE  947
             D   ++ +E+P YGGR+ FP            DF SLD N QE L+D T +  ++    E
Sbjct  1002  DFCPVLSIEVPPYGGRIEFPEHQEVPKPAPHYDFASLDANLQEELLD-TAELGYTG-ATE  1059

Query  948   EREILWEKRHYLHNRPEALPKVLLAAHSWDWACLPDLHASLRIWSPLPPVQALQLLLPCF  1007
              RE+ WEKR YL + P ALPKVL AAHSWD+A L DLHA L  W+PL P+Q+L+LLLP +
Sbjct  1060  RREVFWEKRLYLQSYPNALPKVLHAAHSWDYANLIDLHALLHSWAPLSPLQSLELLLPRY  1119

Query  1008  PDMKVREMAVGWIRELSNDELVDYLPQLLQALKHETYETSPLTKFLLERALLSPRVAHHI  1067
             PD KVRE AV WI ++ ND+LVD+LPQL+Q+LKH+TYE S + +FLL + L SPR AHH+
Sbjct  1120  PDAKVREKAVEWISKMPNDQLVDFLPQLVQSLKHDTYEGSAMARFLLSKCLESPRFAHHM  1179

Query  1068  YWLLTQALPGQSPQNSAETT----PEDDKNISSARYHRRLQLMLRALLAVIGDALRNSFL  1123
             YWLL  +LP   P NS          D+  ++  RY+RR ++MLRAL+A+ G+ +   F+
Sbjct  1180  YWLLVHSLP-DDPHNSIGAAMVDQEYDESQVTQVRYYRRNKMMLRALMAICGEKMLQRFM  1238

Query  1124  TQQLLVKNLYEVAENIKQTKESLRLDALKIGLQNIHCQLMEDDGTCLPLSPSKQVFGINV  1183
              Q  + + L  +AE++K+ KES+R  +L  G+  +H  L+E   TCLPL P  +V G++V
Sbjct  1239  YQHRMCQKLTTIAESVKEAKESMRQKSLAAGMDEVHQDLLEQP-TCLPLGPELEVTGVSV  1297

Query  1184  QSCSYFPSFTLPLKINFISCDDVICPAIFKVGDDLQQDMLTLQMMRIMDKLWLKEGLDLK  1243
             ++CSYF S TLPLKINF+  D    PAIFK GDDLQQD LT+Q++RIM+K+WL E LDLK
Sbjct  1298  RNCSYFNSNTLPLKINFVGPDAESLPAIFKCGDDLQQDQLTIQLIRIMNKMWLAERLDLK  1357

Query  1244  MVTFACVPTGYKRGMIEMVTNAETLRKIQVEFGLTGSFKDRPIAEWLAKHNPSELEYERA  1303
             MVTF CVPTGYK GMIE+V+ AETLRKIQVE GLTGSFKDRPIAEWL K NPS LEY+ A
Sbjct  1358  MVTFNCVPTGYKSGMIELVSEAETLRKIQVECGLTGSFKDRPIAEWLGKQNPSPLEYQSA  1417

Query  1304  VENFTASCAGYSVATYILGICDRHNDNIMLKTSGHLFHIDFGKFLGDAQMFGNFKRDRTP  1363
             V NFT SCAGYSVATY+LGICDRHNDNIMLKTSGHLFHIDFGKFLGDAQMFGNFKRDRTP
Sbjct  1418  VRNFTLSCAGYSVATYVLGICDRHNDNIMLKTSGHLFHIDFGKFLGDAQMFGNFKRDRTP  1477

Query  1364  FVLTSDMAYVINGGDKPSAKFHHFVDLCCQAFNVVRKHGNLILHLFGLMTSSGIPGVTVD  1423
             FVLTSDMAYVINGGDKPS  FH+FVDLCC+AFN+VRK+ +L+LH    M ++G+PGV  +
Sbjct  1478  FVLTSDMAYVINGGDKPSTDFHYFVDLCCRAFNIVRKNADLLLHTLAHMATAGMPGVNSN  1537

Query  1424  AVSYVQKALLPEQTNPEAAATFARMIESSLKSWFTQFNFFLHNLAQLRFSGDHNDGALLS  1483
             AV YV++ALLP Q+NPEAAATFA+MI+SSLKSWFTQFNFFLHNLAQ+RF+ D   G LLS
Sbjct  1538  AVQYVRRALLPSQSNPEAAATFAKMIQSSLKSWFTQFNFFLHNLAQMRFTPDEGSGELLS  1597

Query  1484  FIPRTYTMQQEGQLTSVQVHGYQKRYDPEKYYMYILRIQRKGHADPTYLFRSYKEFCEFY  1543
             F+PR YTMQQ+G+L  V+V  +QK Y  EK+YMYIL + R G  DPT+LFRSY+EF EF+
Sbjct  1598  FVPRKYTMQQDGRLKIVKVVCFQKHYSMEKFYMYILEVTRHGQPDPTHLFRSYREFTEFH  1657

Query  1544  QKLCIHFPLAKLASLPSGISVGRSNIKQVADKRRADIEKFLVSLFKMAPEISQSDLVYTF  1603
             QKLC+HFPL KL SLP+G+ VGRSNIK VA+KR   I++FL SLF  + EI+ S+LVYTF
Sbjct  1658  QKLCMHFPLVKLHSLPAGVHVGRSNIKSVAEKRLPLIQRFLKSLFDASEEIAHSELVYTF  1717

Query  1604  FHPLLRDQQNADIHLRKVKVGNWWAEKRVRDNVQN-GQIKMSLHYTRGAFYVMVYHARGL  1662
             FHPLLRDQQ A + + K+K      ++  RDN    GQI++SL Y RG   VM++HA+GL
Sbjct  1718  FHPLLRDQQEAKLGMPKIKEVK---QQPSRDNPHEIGQIRLSLQYQRGVLTVMIHHAKGL  1774

Query  1663  PKVANCQEPNTYVKVYLKPDPTKKTKRKTKVVKKNCHPSFMEMLEYRMALDVIKERTLEA  1722
             P +   QEPNTYVK YLKPDP K+TKRKTKVV+K C PSFME LEYRM L++I+ER L+ 
Sbjct  1775  PMLQGGQEPNTYVKCYLKPDPKKETKRKTKVVRKTCVPSFMETLEYRMPLNIIQERRLQV  1834

Query  1723  TIWNHDTLQENEFLGGIRLPLGRIDLTTETIEWFSLGSI  1761
             T+W+HDTLQENE LGG  + L + DL  E ++W+ LG++
Sbjct  1835  TVWSHDTLQENELLGGFDMDLSKYDLRQELVDWYRLGAV  1873


 Score = 38.9 bits (89),  Expect = 0.048, Method: Compositional matrix adjust.
 Identities = 34/126 (27%), Positives = 53/126 (42%), Gaps = 24/126 (19%)

Query  14   AVIDYERQFQEDLELAQAMSLESLALEKFKLQKQRSDFNNIQQQCVPQSDGNSTVHSSSS  73
            A IDY++QFQ+DL  A A+SLE  AL+ ++  K+                G+    SS+ 
Sbjct  5    AHIDYDKQFQDDLAKATALSLEQHALDDYRRNKKY---------------GSGYQQSSTV  49

Query  74   ERDNTQQTEKFQCRSRPRPGSCNTNQSRNAVILAPPPVPSRRNSTTATTSQEHTVDLITF  133
               + Q  ++ Q   +PR      +   + V ++P      R      T      DLI F
Sbjct  50   AGRDYQAAQRSQSLHQPR-----RHSEVHQVAISPENAERSRTPPAQGTDN----DLICF  100

Query  134  TSPVKQ  139
             SP  +
Sbjct  101  ASPTSK  106


>Q7K3H0_DROME unnamed protein product
Length=1876

 Score = 1448 bits (3749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 778/1599 (49%), Positives = 1029/1599 (64%), Gaps = 116/1599 (7%)

Query  244   TPSICGVQKPTFCMDDEQLNVLKVIEKKPNNNLIDLSSFDQVDDKTNVRVSVLEAFDPLL  303
              PS  GV   +   ++   +V      +  N+LIDL+  D        RVSVLEAFDPLL
Sbjct  310   VPSTVGVSSSSHTGNNGHSSV-----PRRGNDLIDLNHEDYS------RVSVLEAFDPLL  358

Query  304   ---VKIEDQNDSTQGHKD----------EIQSQVSGSVYDPFDPFDYMYST---------  341
                   +  +DST  + +          +  +Q S  +Y+  + +D   +T         
Sbjct  359   NDNTGNDTASDSTSYYAEYDPFDFLYSGDAATQYSDPMYEAVNRWDKTVATVSPNVGLIG  418

Query  342   -------NESVNSDPVYVAV-EKSAK-------------------------SPAVSPAAP  368
                      S +S    VA  E+S K                         + A  P + 
Sbjct  419   WRQDFLSQPSTSSSQYGVAPPEESLKLAENGSGTISPPPPLPPRNQQCYESNQAAMPVSR  478

Query  369   PPLPPRNSSAWNTIERRRTSLDRRKRQTRLYENVTVRKTRPSLHDCDLRAFYDMIKSVRS  428
             PP     + ++ +       LDRRK  TRLYE ++ ++T     D +L  FY M+K VR+
Sbjct  479   PPQSSVLTDSYTSSIPANVVLDRRKTCTRLYELISDQRT----DDPELLEFYHMVKEVRA  534

Query  429   EFPFNDPSTNIGHVISPMMESLYPEGTSIKLVVHPQL-----------MDSDE----NTP  473
              +P +D  TN+GHV++      Y   TSIK++VHP L           M  ++      P
Sbjct  535   RYPHDDAPTNVGHVVAAEFNYHYMMDTSIKVIVHPALNTLQSTVLAASMGKEQVKGYGMP  594

Query  474   SISFTCDVNCSVEHVILNVACSLEDEDIVNIEKYCLRVWGLAEYFASNTTLAQYEYIHQC  533
              ++FTCD++  V  V+     SLE +    +  Y ++  GL E+ A  + L+Q E +H  
Sbjct  595   -VTFTCDIDSVVAQVVAQALASLEGQVKGTVTDYAVKPIGLLEWLAPTSRLSQLECVHNS  653

Query  534   IKLEKDIELAI-LTKAQIKRSITRTLQDDNRDQCLKLEDILPNEPVQPISYDTLLILLET  592
              +LEKD+ L + L+ A   ++I RT +DD  D  L  E +LPNE V  ++YD ++IL+ET
Sbjct  654   FQLEKDVHLGLCLSTAANMQAIARTERDDEHDADLLPEHLLPNEVVPIVTYDNMMILIET  713

Query  593   VEKEMERVETAAIHLATTNHGSSLLPQLQPRSVVQAVKAVCALMGNIETFEITEAVDNFV  652
             +E E++++E+AA  +     G S++       VVQAVKA+CAL+G+I+T EI   V + +
Sbjct  714   LEMEIDKLESAADGVP----GRSVV---SCSGVVQAVKAICALLGSIDTMEIARCVAD-L  765

Query  653   NACCQFLPQVHTTNIECKKPEILHEDGDYSVVTLRTK-FPDVIASHCRKIRDAIQDLVET  711
                C+   + ++T      PEI+ + GDY+ V LR +   + I   C ++RDA+Q+LVE 
Sbjct  766   KRICEVEQKKYSTG--ASNPEIVSDYGDYAQVVLRPRSMLEQIKVKCNELRDAVQELVEL  823

Query  712   YCHAFRVDFELNSRGEIPTNTLISSEVLDTILVRVGALHRLPGSWKHDDYIIAAQIFHGT  771
             Y + FRV F + +  +  T  +  S V   I+V +  LHR   +WK DDY +  QI +GT
Sbjct  824   YANVFRVAFSVKT-PDYSTTPIPISCVSKPIVVCISCLHRPLPNWKFDDYSLCVQIVYGT  882

Query  772   RPVGNP-VLSEPMAVSSNFHPRILFNSWLEFRGISVCQVPREARLVLVLYGRTLQPTDHE  830
             R +  P VL+     S    PR+ F++WL F    +C +PREARL  VLYG+    ++ E
Sbjct  883   RLLSKPNVLTCSNDTSGGLFPRLNFSAWLTFDQHPICTLPREARLTFVLYGKQAA-SEGE  941

Query  831   SNS--SAENTMQKEELGWGAIQFFDYEGVMSQGSFFLSLWPAIADKRLGPAPAAGIHPHG  888
              N+  + E      ELGW +IQ FD++ VM  G + LSLWP + DK LGPAPA G HP  
Sbjct  942   PNADQNGERRQVTTELGWCSIQLFDFKRVMICGPYLLSLWPPMTDKMLGPAPARGCHPQP  1001

Query  889   DTHAIIGVELPDYGGRVLFPTELR-DYDVESLDFNSLDQNTQELLIDITQQTTFSRPLVE  947
             D   ++ +E+P YGGR+ FP            DF SLD N QE L+D T +  ++    E
Sbjct  1002  DFCPVLSIEVPPYGGRIEFPEHQEVPKPAPHYDFASLDANLQEELLD-TAELGYTG-ATE  1059

Query  948   EREILWEKRHYLHNRPEALPKVLLAAHSWDWACLPDLHASLRIWSPLPPVQALQLLLPCF  1007
              RE+ WEKR YL + P ALPKVL AAHSWD+A L DLHA L  W+PL P+Q+L+LLLP +
Sbjct  1060  RREVFWEKRLYLQSYPNALPKVLHAAHSWDYANLIDLHALLHSWAPLSPLQSLELLLPRY  1119

Query  1008  PDMKVREMAVGWIRELSNDELVDYLPQLLQALKHETYETSPLTKFLLERALLSPRVAHHI  1067
             PD KVRE AV WI ++ ND+LVD+LPQL+Q+LKH+TYE S + +FLL + L SPR AHH+
Sbjct  1120  PDAKVREKAVEWISKMPNDQLVDFLPQLVQSLKHDTYEGSAMARFLLSKCLESPRFAHHM  1179

Query  1068  YWLLTQALPGQSPQNSAETT----PEDDKNISSARYHRRLQLMLRALLAVIGDALRNSFL  1123
             YWLL  +LP   P NS          D+  ++  RY+RR ++MLRAL+A+ G+ +   F+
Sbjct  1180  YWLLVHSLP-DDPHNSIGAAMVDQEYDESQVTQVRYYRRNKMMLRALMAICGEKMLQRFM  1238

Query  1124  TQQLLVKNLYEVAENIKQTKESLRLDALKIGLQNIHCQLMEDDGTCLPLSPSKQVFGINV  1183
              Q  + + L  +AE++K+ KES+R  +L  G+  +H  L+E   TCLPL P  +V G++V
Sbjct  1239  YQHRMCQKLTTIAESVKEAKESMRQKSLAAGMDEVHQDLLEQP-TCLPLGPELEVTGVSV  1297

Query  1184  QSCSYFPSFTLPLKINFISCDDVICPAIFKVGDDLQQDMLTLQMMRIMDKLWLKEGLDLK  1243
             ++CSYF S TLPLKINF+  D    PAIFK GDDLQQD LT+Q++RIM+K+WL E LDLK
Sbjct  1298  RNCSYFNSNTLPLKINFVGPDAESLPAIFKCGDDLQQDQLTIQLIRIMNKMWLAERLDLK  1357

Query  1244  MVTFACVPTGYKRGMIEMVTNAETLRKIQVEFGLTGSFKDRPIAEWLAKHNPSELEYERA  1303
             MVTF CVPTGYK GMIE+V+ AETLRKIQVE GLTGSFKDRPIAEWL K NPS LEY+ A
Sbjct  1358  MVTFNCVPTGYKSGMIELVSEAETLRKIQVECGLTGSFKDRPIAEWLGKQNPSPLEYQSA  1417

Query  1304  VENFTASCAGYSVATYILGICDRHNDNIMLKTSGHLFHIDFGKFLGDAQMFGNFKRDRTP  1363
             V NFT SCAGYSVATY+LGICDRHNDNIMLKTSGHLFHIDFGKFLGDAQMFGNFKRDRTP
Sbjct  1418  VRNFTLSCAGYSVATYVLGICDRHNDNIMLKTSGHLFHIDFGKFLGDAQMFGNFKRDRTP  1477

Query  1364  FVLTSDMAYVINGGDKPSAKFHHFVDLCCQAFNVVRKHGNLILHLFGLMTSSGIPGVTVD  1423
             FVLTSDMAYVINGGDKPS  FH+FVDLCC+AFN+VRK+ +L+LH    M ++G+PGV  +
Sbjct  1478  FVLTSDMAYVINGGDKPSTDFHYFVDLCCRAFNIVRKNADLLLHTLAHMATAGMPGVNSN  1537

Query  1424  AVSYVQKALLPEQTNPEAAATFARMIESSLKSWFTQFNFFLHNLAQLRFSGDHNDGALLS  1483
             AV YV++ALLP Q+NPEAAATFA+MI+SSLKSWFTQFNFFLHNLAQ+RF+ D   G LLS
Sbjct  1538  AVQYVRRALLPSQSNPEAAATFAKMIQSSLKSWFTQFNFFLHNLAQMRFTPDEGSGELLS  1597

Query  1484  FIPRTYTMQQEGQLTSVQVHGYQKRYDPEKYYMYILRIQRKGHADPTYLFRSYKEFCEFY  1543
             F+PR YTMQQ+G+L  V+V  +QK Y  EK+YMYIL + R G  DPT+LFRSY+EF EF+
Sbjct  1598  FVPRKYTMQQDGRLKIVKVVCFQKHYSMEKFYMYILEVTRHGQPDPTHLFRSYREFTEFH  1657

Query  1544  QKLCIHFPLAKLASLPSGISVGRSNIKQVADKRRADIEKFLVSLFKMAPEISQSDLVYTF  1603
             QKLC+HFPL KL SLP+G+ VGRSNIK VA+KR   I++FL SLF  + EI+ S+LVYTF
Sbjct  1658  QKLCMHFPLVKLHSLPAGVHVGRSNIKSVAEKRLPLIQRFLKSLFDASEEIAHSELVYTF  1717

Query  1604  FHPLLRDQQNADIHLRKVKVGNWWAEKRVRDNVQN-GQIKMSLHYTRGAFYVMVYHARGL  1662
             FHPLLRDQQ A + + K+K      ++  RDN    GQI++SL Y RG   VM++HA+GL
Sbjct  1718  FHPLLRDQQEAKLGMPKIKEVK---QQPSRDNPHEIGQIRLSLQYQRGVLTVMIHHAKGL  1774

Query  1663  PKVANCQEPNTYVKVYLKPDPTKKTKRKTKVVKKNCHPSFMEMLEYRMALDVIKERTLEA  1722
             P +   QEPNTYVK YLKPDP K+TKRKTKVV+K C PSFME LEYRM L++I+ER L+ 
Sbjct  1775  PMLQGGQEPNTYVKCYLKPDPKKETKRKTKVVRKTCVPSFMETLEYRMPLNIIQERRLQV  1834

Query  1723  TIWNHDTLQENEFLGGIRLPLGRIDLTTETIEWFSLGSI  1761
             T+W+HDTLQENE LGG  + L + DL  E ++W+ LG++
Sbjct  1835  TVWSHDTLQENELLGGFDMDLSKYDLRQELVDWYRLGAV  1873


 Score = 38.9 bits (89),  Expect = 0.049, Method: Compositional matrix adjust.
 Identities = 34/126 (27%), Positives = 53/126 (42%), Gaps = 24/126 (19%)

Query  14   AVIDYERQFQEDLELAQAMSLESLALEKFKLQKQRSDFNNIQQQCVPQSDGNSTVHSSSS  73
            A IDY++QFQ+DL  A A+SLE  AL+ ++  K+                G+    SS+ 
Sbjct  5    AHIDYDKQFQDDLAKATALSLEQHALDDYRRNKKY---------------GSGYQQSSTV  49

Query  74   ERDNTQQTEKFQCRSRPRPGSCNTNQSRNAVILAPPPVPSRRNSTTATTSQEHTVDLITF  133
               + Q  ++ Q   +PR      +   + V ++P      R      T      DLI F
Sbjct  50   AGRDYQAAQRSQSLHQPR-----RHSEVHQVAISPENAERSRTPPAQGTDN----DLICF  100

Query  134  TSPVKQ  139
             SP  +
Sbjct  101  ASPTSK  106



Lambda      K        H
   0.319    0.134    0.404 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 23657709084


Query= XP_050469455.1 uncharacterized protein LOC126863393 isoform X1
[Bombus huntii]

Length=1079
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O96395_DROME  unnamed protein product                                 79.3    8e-15
M9PF60_DROME  unnamed protein product                                 79.0    9e-15
M9PD94_DROME  unnamed protein product                                 70.9    4e-12


>O96395_DROME unnamed protein product
Length=583

 Score = 79.3 bits (194),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 83/368 (23%), Positives = 138/368 (38%), Gaps = 84/368 (23%)

Query  736   HICGVCDQSFANRSDAITHVRMHKTE-------------------TTILRHNKHKMMRCK  776
             H+C  C + F   +   TH R H  E                   + +  H++ K  +C 
Sbjct  272   HLCDFCGRGFRTNAQLTTHRRRHTGERPFKCPLCPKAYTHGPTLKSHMHTHDEEKGHKCP  331

Query  777   RCHEIVEARF-VKAHVCKSTKQYIHKCYVCNSTFRTEKLLVRHLESH-DQSEFNIENITK  834
             +C +    R  ++AH+ + T +  +KC  C  TF     L  H   H ++  F  E   K
Sbjct  332   QCDKTFYTRGNLRAHIQRHTGERPYKCPDCPQTFAKNSGLKLHSRLHKEERPFKCELCGK  391

Query  835   GESQK---LTNTNTSQNSKGTVYSKSDKLLKVENNRIMKLENSRTGISIEKIGATKGRED  891
             G  Q    +T+       +       DK    E + +MK + + +GI             
Sbjct  392   GFVQNQHLITHLRVHNGDRQFKCPDCDKSF-FEKSNMMKHQRTHSGI-------------  437

Query  892   TVSGAEKLKETYTCFVCDKIFTDEEILKDHLQKHCDDMSEGDQSPGKEQYQCAICGDSLE  951
                      + + C  C + F+    LK HL+ H           G++ Y+C  CG    
Sbjct  438   ---------KPFKCEECGQAFSHNHHLKSHLRIHT----------GEKPYKCDQCGKGFS  478

Query  952   SEDALEAHVEKHLFDEEDDNPNLISIGSENDKSKDEIYQCLQCTEVFNSEMLLEMHMQAH  1011
             +  +L  H   H+    D+N              D  ++C QC + ++++  L  H + H
Sbjct  479   ANQSLMKHTLWHV----DNN--------------DRPFKCSQCPKAYDTQQSLRGHEKTH  520

Query  1012  EEEAAIAEWEKQGIKTYEFQCMICDELFETEEDLSEHLDIHNETTHVCQLCDKPFFSLED  1071
             +             KT   QC  CD  F  ++ L +H+  H    H C  C + FFS + 
Sbjct  521   KNPDEP--------KTLH-QCPHCDVRFALKKTLDKHITSHKIRPHPCPQCPEGFFSQKS  571

Query  1072  LQKHVATH  1079
             L+KH+  H
Sbjct  572   LKKHLRLH  579


>M9PF60_DROME unnamed protein product
Length=571

 Score = 79.0 bits (193),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 83/368 (23%), Positives = 138/368 (38%), Gaps = 84/368 (23%)

Query  736   HICGVCDQSFANRSDAITHVRMHKTE-------------------TTILRHNKHKMMRCK  776
             H+C  C + F   +   TH R H  E                   + +  H++ K  +C 
Sbjct  260   HLCDFCGRGFRTNAQLTTHRRRHTGERPFKCPLCPKAYTHGPTLKSHMHTHDEEKGHKCP  319

Query  777   RCHEIVEARF-VKAHVCKSTKQYIHKCYVCNSTFRTEKLLVRHLESH-DQSEFNIENITK  834
             +C +    R  ++AH+ + T +  +KC  C  TF     L  H   H ++  F  E   K
Sbjct  320   QCDKTFYTRGNLRAHIQRHTGERPYKCPDCPQTFAKNSGLKLHSRLHKEERPFKCELCGK  379

Query  835   GESQK---LTNTNTSQNSKGTVYSKSDKLLKVENNRIMKLENSRTGISIEKIGATKGRED  891
             G  Q    +T+       +       DK    E + +MK + + +GI             
Sbjct  380   GFVQNQHLITHLRVHNGDRQFKCPDCDKSF-FEKSNMMKHQRTHSGI-------------  425

Query  892   TVSGAEKLKETYTCFVCDKIFTDEEILKDHLQKHCDDMSEGDQSPGKEQYQCAICGDSLE  951
                      + + C  C + F+    LK HL+ H           G++ Y+C  CG    
Sbjct  426   ---------KPFKCEECGQAFSHNHHLKSHLRIH----------TGEKPYKCDQCGKGFS  466

Query  952   SEDALEAHVEKHLFDEEDDNPNLISIGSENDKSKDEIYQCLQCTEVFNSEMLLEMHMQAH  1011
             +  +L  H   H+    D+N              D  ++C QC + ++++  L  H + H
Sbjct  467   ANQSLMKHTLWHV----DNN--------------DRPFKCSQCPKAYDTQQSLRGHEKTH  508

Query  1012  EEEAAIAEWEKQGIKTYEFQCMICDELFETEEDLSEHLDIHNETTHVCQLCDKPFFSLED  1071
             +             KT   QC  CD  F  ++ L +H+  H    H C  C + FFS + 
Sbjct  509   KNPDEP--------KTLH-QCPHCDVRFALKKTLDKHITSHKIRPHPCPQCPEGFFSQKS  559

Query  1072  LQKHVATH  1079
             L+KH+  H
Sbjct  560   LKKHLRLH  567


>M9PD94_DROME unnamed protein product
Length=907

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 78/344 (23%), Positives = 134/344 (39%), Gaps = 76/344 (22%)

Query  738   CGVCDQSFANRSDAITHVRMHKTETTILRHNKHKMMRCKRCHEIVEAR-FVKAHVCKSTK  796
             C +C ++FA +     H R H  ET           RC+ C +    +  +  HV K T 
Sbjct  307   CTICQKTFARKEHLDNHFRSHTGETPF---------RCQYCAKTFTRKEHMVNHVRKHTG  357

Query  797   QYIHKCYVCNSTFRTEKLLVRHLESH-DQSEFNIENITKGESQKLTNTN-TSQNSKGTVY  854
             Q  H+C VC   +  ++ L  H+ SH +++ F  E   K  S+K   TN    ++ G   
Sbjct  358   QTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTAGETP  417

Query  855   SKSDKLLKVENNRIMKLENSRTGISIEKIGATKGREDTVSGAEKLKETYTCFVCDKIFTD  914
              + D   K    +   L + R     +  G +  R               C  C K FT 
Sbjct  418   HRCDFCSKTFTRKEHLLNHVR-----QHTGESPHR---------------CSYCMKTFTR  457

Query  915   EEILKDHLQKHCDDMSEGDQSPGKEQYQCAICGDSLESEDALEAHVEKHLFDEEDDNPNL  974
             +E L +H+++H           G+  ++C  C  +   ++ L  HV +H           
Sbjct  458   KEHLVNHIRQH----------TGESPHKCTYCTKTFTRKEHLTNHVRQH-----------  496

Query  975   ISIGSENDKSKDEIYQCLQCTEVFNSEMLLEMHMQAHEEEAAIAEWEKQGIKTYEFQCMI  1034
                      + D  ++C  C + F  +  L  H++ H  ++               +C  
Sbjct  497   ---------TGDSPHRCSYCKKTFTRKEHLTNHVRLHTGDSP-------------HKCEY  534

Query  1035  CDELFETEEDLSEHLDIH-NETTHVCQLCDKPFFSLEDLQKHVA  1077
             C + F  +E L+ H+  H ++  H C +C+KPF   E L  H++
Sbjct  535   CQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMS  578


 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 81/379 (21%), Positives = 140/379 (37%), Gaps = 82/379 (22%)

Query  736   HICGVCDQSFANRSDAITHVRMHK---------------TETTILRHNK----HKMMRCK  776
             H+C +C + F  R   I H R H                T   + RH K      M  C 
Sbjct  221   HVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTCI  280

Query  777   RCHEIVE-----ARFVKAHVCKSTKQYIHKCYVCNSTFRTEKLLVRHLESH-DQSEFNIE  830
              C  +        R +K H   ST +    C +C  TF  ++ L  H  SH  ++ F  +
Sbjct  281   VCFNVFANNTSLERHMKRH---STDKPF-ACTICQKTFARKEHLDNHFRSHTGETPFRCQ  336

Query  831   NITKGESQKLTNTNTSQNSKGTVYSKSDKLLKVENNR-----IMKLENSRTGISIEKIGA  885
                K  ++K    N  +   G    + D   K    +      M+   + T    E  G 
Sbjct  337   YCAKTFTRKEHMVNHVRKHTGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGK  396

Query  886   TKGREDTVSG---AEKLKET-YTCFVCDKIFTDEEILKDHLQKHCDDMSEGDQSPGKEQY  941
             +  R++  +         ET + C  C K FT +E L +H+++H           G+  +
Sbjct  397   SFSRKEHFTNHILWHTAGETPHRCDFCSKTFTRKEHLLNHVRQH----------TGESPH  446

Query  942   QCAICGDSLESEDALEAHVEKHLFDEEDDNPNLISIGSENDKSKDEIYQCLQCTEVFNSE  1001
             +C+ C  +   ++ L  H+ +H                    + +  ++C  CT+ F  +
Sbjct  447   RCSYCMKTFTRKEHLVNHIRQH--------------------TGESPHKCTYCTKTFTRK  486

Query  1002  MLLEMHMQAHEEEAAIAEWEKQGIKTYEFQCMICDELFETEEDLSEHLDIH-NETTHVCQ  1060
               L  H++ H  ++               +C  C + F  +E L+ H+ +H  ++ H C+
Sbjct  487   EHLTNHVRQHTGDSP-------------HRCSYCKKTFTRKEHLTNHVRLHTGDSPHKCE  533

Query  1061  LCDKPFFSLEDLQKHVATH  1079
              C K F   E L  H+  H
Sbjct  534   YCQKTFTRKEHLNNHMRQH  552


 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 46/186 (25%), Positives = 66/186 (35%), Gaps = 44/186 (24%)

Query  895   GAEKLKETYTCFVCDKIFTDEEILKDHLQKHCDDMSEGDQSPGKEQYQCAICGDSLESED  954
             G      T+ C +C K+F     L  H + H +          ++ + C +CG    +  
Sbjct  213   GTPIATGTHVCDICGKMFQFRYQLIVHRRYHSE----------RKPFMCQVCGQGFTTSQ  262

Query  955   ALEAHVEKHLFDEEDDNPNLISIGSENDKSKDEIYQCLQCTEVFNSEMLLEMHMQAHEEE  1014
              L  H +             I IG         ++ C+ C  VF +   LE HM+ H  +
Sbjct  263   DLTRHGK-------------IHIGGP-------MFTCIVCFNVFANNTSLERHMKRHSTD  302

Query  1015  AAIAEWEKQGIKTYEFQCMICDELFETEEDLSEHLDIH-NETTHVCQLCDKPFFSLEDLQ  1073
                            F C IC + F  +E L  H   H  ET   CQ C K F   E + 
Sbjct  303   KP-------------FACTICQKTFARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEHMV  349

Query  1074  KHVATH  1079
              HV  H
Sbjct  350   NHVRKH  355


 Score = 33.1 bits (74),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 44/209 (21%), Positives = 77/209 (37%), Gaps = 23/209 (11%)

Query  736  HICGVCDQSFANRSDAITHVRMHKTETTILRHNKHKMMRCKRCHEIVEARFVKAHVCKST  795
            H C  C ++F  +     HVR H  ++       H+   CK+         +  HV   T
Sbjct  474  HKCTYCTKTFTRKEHLTNHVRQHTGDS------PHRCSYCKK--TFTRKEHLTNHVRLHT  525

Query  796  KQYIHKCYVCNSTFRTEKLLVRHLESHDQSE---FNIENITKGESQKLTNTNTSQNSKGT  852
                HKC  C  TF  ++ L  H+  H        N+ N      + L N  +  ++   
Sbjct  526  GDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGDR  585

Query  853  VYS--KSDKLLKVENNRIMKLENSRTGISIEKIGAT---------KGREDTVSGAEKLKE  901
             ++     K   ++ N +    +   G  +E+  A          KG   +   +   ++
Sbjct  586  PFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSGEK  645

Query  902  TYTCFVCDKIFTDEEILKDHLQ-KHCDDM  929
             + C +C K F +   LK H++  H D M
Sbjct  646  PHACTLCSKAFVERGNLKRHMKMNHPDAM  674



Lambda      K        H
   0.319    0.134    0.404 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 23657709084


Query= XP_050469456.1 uncharacterized protein LOC126863393 isoform X2
[Bombus huntii]

Length=1033
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O96395_DROME  unnamed protein product                                 79.0    9e-15
M9PF60_DROME  unnamed protein product                                 78.6    1e-14
M9PD94_DROME  unnamed protein product                                 70.5    6e-12


>O96395_DROME unnamed protein product
Length=583

 Score = 79.0 bits (193),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 83/368 (23%), Positives = 138/368 (38%), Gaps = 84/368 (23%)

Query  690   HICGVCDQSFANRSDAITHVRMHKTE-------------------TTILRHNKHKMMRCK  730
             H+C  C + F   +   TH R H  E                   + +  H++ K  +C 
Sbjct  272   HLCDFCGRGFRTNAQLTTHRRRHTGERPFKCPLCPKAYTHGPTLKSHMHTHDEEKGHKCP  331

Query  731   RCHEIVEARF-VKAHVCKSTKQYIHKCYVCNSTFRTEKLLVRHLESH-DQSEFNIENITK  788
             +C +    R  ++AH+ + T +  +KC  C  TF     L  H   H ++  F  E   K
Sbjct  332   QCDKTFYTRGNLRAHIQRHTGERPYKCPDCPQTFAKNSGLKLHSRLHKEERPFKCELCGK  391

Query  789   GESQK---LTNTNTSQNSKGTVYSKSDKLLKVENNRIMKLENSRTGISIEKIGATKGRED  845
             G  Q    +T+       +       DK    E + +MK + + +GI             
Sbjct  392   GFVQNQHLITHLRVHNGDRQFKCPDCDKSF-FEKSNMMKHQRTHSGI-------------  437

Query  846   TVSGAEKLKETYTCFVCDKIFTDEEILKDHLQKHCDDMSEGDQSPGKEQYQCAICGDSLE  905
                      + + C  C + F+    LK HL+ H           G++ Y+C  CG    
Sbjct  438   ---------KPFKCEECGQAFSHNHHLKSHLRIH----------TGEKPYKCDQCGKGFS  478

Query  906   SEDALEAHVEKHLFDEEDDNPNLISIGSENDKSKDEIYQCLQCTEVFNSEMLLEMHMQAH  965
             +  +L  H   H+    D+N              D  ++C QC + ++++  L  H + H
Sbjct  479   ANQSLMKHTLWHV----DNN--------------DRPFKCSQCPKAYDTQQSLRGHEKTH  520

Query  966   EEEAAIAEWEKQGIKTYEFQCMICDELFETEEDLSEHLDIHNETTHVCQLCDKPFFSLED  1025
             +             KT   QC  CD  F  ++ L +H+  H    H C  C + FFS + 
Sbjct  521   KNPDEP--------KTLH-QCPHCDVRFALKKTLDKHITSHKIRPHPCPQCPEGFFSQKS  571

Query  1026  LQKHVATH  1033
             L+KH+  H
Sbjct  572   LKKHLRLH  579


>M9PF60_DROME unnamed protein product
Length=571

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 83/368 (23%), Positives = 138/368 (38%), Gaps = 84/368 (23%)

Query  690   HICGVCDQSFANRSDAITHVRMHKTE-------------------TTILRHNKHKMMRCK  730
             H+C  C + F   +   TH R H  E                   + +  H++ K  +C 
Sbjct  260   HLCDFCGRGFRTNAQLTTHRRRHTGERPFKCPLCPKAYTHGPTLKSHMHTHDEEKGHKCP  319

Query  731   RCHEIVEARF-VKAHVCKSTKQYIHKCYVCNSTFRTEKLLVRHLESH-DQSEFNIENITK  788
             +C +    R  ++AH+ + T +  +KC  C  TF     L  H   H ++  F  E   K
Sbjct  320   QCDKTFYTRGNLRAHIQRHTGERPYKCPDCPQTFAKNSGLKLHSRLHKEERPFKCELCGK  379

Query  789   GESQK---LTNTNTSQNSKGTVYSKSDKLLKVENNRIMKLENSRTGISIEKIGATKGRED  845
             G  Q    +T+       +       DK    E + +MK + + +GI             
Sbjct  380   GFVQNQHLITHLRVHNGDRQFKCPDCDKSF-FEKSNMMKHQRTHSGI-------------  425

Query  846   TVSGAEKLKETYTCFVCDKIFTDEEILKDHLQKHCDDMSEGDQSPGKEQYQCAICGDSLE  905
                      + + C  C + F+    LK HL+ H           G++ Y+C  CG    
Sbjct  426   ---------KPFKCEECGQAFSHNHHLKSHLRIH----------TGEKPYKCDQCGKGFS  466

Query  906   SEDALEAHVEKHLFDEEDDNPNLISIGSENDKSKDEIYQCLQCTEVFNSEMLLEMHMQAH  965
             +  +L  H   H+    D+N              D  ++C QC + ++++  L  H + H
Sbjct  467   ANQSLMKHTLWHV----DNN--------------DRPFKCSQCPKAYDTQQSLRGHEKTH  508

Query  966   EEEAAIAEWEKQGIKTYEFQCMICDELFETEEDLSEHLDIHNETTHVCQLCDKPFFSLED  1025
             +             KT   QC  CD  F  ++ L +H+  H    H C  C + FFS + 
Sbjct  509   KNPDEP--------KTLH-QCPHCDVRFALKKTLDKHITSHKIRPHPCPQCPEGFFSQKS  559

Query  1026  LQKHVATH  1033
             L+KH+  H
Sbjct  560   LKKHLRLH  567


>M9PD94_DROME unnamed protein product
Length=907

 Score = 70.5 bits (171),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 78/344 (23%), Positives = 134/344 (39%), Gaps = 76/344 (22%)

Query  692   CGVCDQSFANRSDAITHVRMHKTETTILRHNKHKMMRCKRCHEIVEAR-FVKAHVCKSTK  750
             C +C ++FA +     H R H  ET           RC+ C +    +  +  HV K T 
Sbjct  307   CTICQKTFARKEHLDNHFRSHTGETPF---------RCQYCAKTFTRKEHMVNHVRKHTG  357

Query  751   QYIHKCYVCNSTFRTEKLLVRHLESH-DQSEFNIENITKGESQKLTNTN-TSQNSKGTVY  808
             Q  H+C VC   +  ++ L  H+ SH +++ F  E   K  S+K   TN    ++ G   
Sbjct  358   QTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTAGETP  417

Query  809   SKSDKLLKVENNRIMKLENSRTGISIEKIGATKGREDTVSGAEKLKETYTCFVCDKIFTD  868
              + D   K    +   L + R     +  G +  R               C  C K FT 
Sbjct  418   HRCDFCSKTFTRKEHLLNHVR-----QHTGESPHR---------------CSYCMKTFTR  457

Query  869   EEILKDHLQKHCDDMSEGDQSPGKEQYQCAICGDSLESEDALEAHVEKHLFDEEDDNPNL  928
             +E L +H+++H           G+  ++C  C  +   ++ L  HV +H           
Sbjct  458   KEHLVNHIRQH----------TGESPHKCTYCTKTFTRKEHLTNHVRQH-----------  496

Query  929   ISIGSENDKSKDEIYQCLQCTEVFNSEMLLEMHMQAHEEEAAIAEWEKQGIKTYEFQCMI  988
                      + D  ++C  C + F  +  L  H++ H  ++               +C  
Sbjct  497   ---------TGDSPHRCSYCKKTFTRKEHLTNHVRLHTGDSP-------------HKCEY  534

Query  989   CDELFETEEDLSEHLDIH-NETTHVCQLCDKPFFSLEDLQKHVA  1031
             C + F  +E L+ H+  H ++  H C +C+KPF   E L  H++
Sbjct  535   CQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMS  578


 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 81/379 (21%), Positives = 140/379 (37%), Gaps = 82/379 (22%)

Query  690   HICGVCDQSFANRSDAITHVRMHK---------------TETTILRHNK----HKMMRCK  730
             H+C +C + F  R   I H R H                T   + RH K      M  C 
Sbjct  221   HVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTCI  280

Query  731   RCHEIVE-----ARFVKAHVCKSTKQYIHKCYVCNSTFRTEKLLVRHLESH-DQSEFNIE  784
              C  +        R +K H   ST +    C +C  TF  ++ L  H  SH  ++ F  +
Sbjct  281   VCFNVFANNTSLERHMKRH---STDKPF-ACTICQKTFARKEHLDNHFRSHTGETPFRCQ  336

Query  785   NITKGESQKLTNTNTSQNSKGTVYSKSDKLLKVENNR-----IMKLENSRTGISIEKIGA  839
                K  ++K    N  +   G    + D   K    +      M+   + T    E  G 
Sbjct  337   YCAKTFTRKEHMVNHVRKHTGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGK  396

Query  840   TKGREDTVSG---AEKLKET-YTCFVCDKIFTDEEILKDHLQKHCDDMSEGDQSPGKEQY  895
             +  R++  +         ET + C  C K FT +E L +H+++H           G+  +
Sbjct  397   SFSRKEHFTNHILWHTAGETPHRCDFCSKTFTRKEHLLNHVRQH----------TGESPH  446

Query  896   QCAICGDSLESEDALEAHVEKHLFDEEDDNPNLISIGSENDKSKDEIYQCLQCTEVFNSE  955
             +C+ C  +   ++ L  H+ +H                    + +  ++C  CT+ F  +
Sbjct  447   RCSYCMKTFTRKEHLVNHIRQH--------------------TGESPHKCTYCTKTFTRK  486

Query  956   MLLEMHMQAHEEEAAIAEWEKQGIKTYEFQCMICDELFETEEDLSEHLDIH-NETTHVCQ  1014
               L  H++ H  ++               +C  C + F  +E L+ H+ +H  ++ H C+
Sbjct  487   EHLTNHVRQHTGDSP-------------HRCSYCKKTFTRKEHLTNHVRLHTGDSPHKCE  533

Query  1015  LCDKPFFSLEDLQKHVATH  1033
              C K F   E L  H+  H
Sbjct  534   YCQKTFTRKEHLNNHMRQH  552


 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 46/186 (25%), Positives = 66/186 (35%), Gaps = 44/186 (24%)

Query  849   GAEKLKETYTCFVCDKIFTDEEILKDHLQKHCDDMSEGDQSPGKEQYQCAICGDSLESED  908
             G      T+ C +C K+F     L  H + H +          ++ + C +CG    +  
Sbjct  213   GTPIATGTHVCDICGKMFQFRYQLIVHRRYHSE----------RKPFMCQVCGQGFTTSQ  262

Query  909   ALEAHVEKHLFDEEDDNPNLISIGSENDKSKDEIYQCLQCTEVFNSEMLLEMHMQAHEEE  968
              L  H +             I IG         ++ C+ C  VF +   LE HM+ H  +
Sbjct  263   DLTRHGK-------------IHIGGP-------MFTCIVCFNVFANNTSLERHMKRHSTD  302

Query  969   AAIAEWEKQGIKTYEFQCMICDELFETEEDLSEHLDIH-NETTHVCQLCDKPFFSLEDLQ  1027
                            F C IC + F  +E L  H   H  ET   CQ C K F   E + 
Sbjct  303   KP-------------FACTICQKTFARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEHMV  349

Query  1028  KHVATH  1033
              HV  H
Sbjct  350   NHVRKH  355


 Score = 32.7 bits (73),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 44/209 (21%), Positives = 77/209 (37%), Gaps = 23/209 (11%)

Query  690  HICGVCDQSFANRSDAITHVRMHKTETTILRHNKHKMMRCKRCHEIVEARFVKAHVCKST  749
            H C  C ++F  +     HVR H  ++       H+   CK+         +  HV   T
Sbjct  474  HKCTYCTKTFTRKEHLTNHVRQHTGDS------PHRCSYCKK--TFTRKEHLTNHVRLHT  525

Query  750  KQYIHKCYVCNSTFRTEKLLVRHLESHDQSE---FNIENITKGESQKLTNTNTSQNSKGT  806
                HKC  C  TF  ++ L  H+  H        N+ N      + L N  +  ++   
Sbjct  526  GDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGDR  585

Query  807  VYS--KSDKLLKVENNRIMKLENSRTGISIEKIGAT---------KGREDTVSGAEKLKE  855
             ++     K   ++ N +    +   G  +E+  A          KG   +   +   ++
Sbjct  586  PFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSGEK  645

Query  856  TYTCFVCDKIFTDEEILKDHLQ-KHCDDM  883
             + C +C K F +   LK H++  H D M
Sbjct  646  PHACTLCSKAFVERGNLKRHMKMNHPDAM  674



Lambda      K        H
   0.319    0.134    0.404 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 23657709084


Query= XP_050469457.1 polycomb protein Sfmbt-like isoform X1 [Bombus
huntii]

Length=960
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SMBT_DROME  unnamed protein product                                   616     0.0  
LIN61_CAEEL  unnamed protein product                                  172     8e-45
Q9VB52_DROME  unnamed protein product                                 135     8e-32


>SMBT_DROME unnamed protein product
Length=1220

 Score = 616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/511 (59%), Positives = 368/511 (72%), Gaps = 19/511 (4%)

Query  274   PVMPEDLPVRRKRTAEMAGSYDWTPQLTEPGFCAAPVSCFKHAPISEIWDNITVGMKVEV  333
             P M + + +RR R  +   SYDW P+L++  F AAPV+CF HAP  E+WDN+ VGMKVEV
Sbjct  517   PQMEKIISIRR-RMYDPTHSYDWLPRLSKENFNAAPVTCFPHAPGCEVWDNLGVGMKVEV  575

Query  334   ENTDCD--EVCE--AFPDSFWVATVLRISGYRALLRYEGFGLNDDKDFWVSLCSNDIHPV  389
             ENTDCD  EV +    P SFWVAT+L I GY+AL+ YEGF   D  DFWV+LC+ ++H V
Sbjct  576   ENTDCDSIEVIQPGQTPTSFWVATILEIKGYKALMSYEGFD-TDSHDFWVNLCNAEVHSV  634

Query  390   GWCATIGKPLIPPNTIADKYKDWKDFLMKRLTGARTLPTNFYNKVNDSMKSRFRCGFHLE  449
             GWCAT GKPLIPP TI  KYKDWKDFL+ RL+GARTLP+NFYNK+NDS++SRFR G +LE
Sbjct  635   GWCATRGKPLIPPRTIEHKYKDWKDFLVGRLSGARTLPSNFYNKINDSLQSRFRLGLNLE  694

Query  450   VVDKNRISQVKVATIQKIVGKRLHVRYYDSPPEDNGFWCHEDSPLIHPVGWAKRVGQTLD  509
              VDK+RISQV++AT+ KIVGKRL +RY+DS   D+GFWCHEDSP+IHPVGWA  VG  L 
Sbjct  695   CVDKDRISQVRLATVTKIVGKRLFLRYFDS---DDGFWCHEDSPIIHPVGWATTVGHNLA  751

Query  510   AYPEYLERVSKSK-----LCEDDATEDLFYV--PKNHHVHLGYT--FREGMKIEAIDPLN  560
             A  +YLER+   +     + EDDAT +LF +    + +   G T  F EGMK+EA+DPLN
Sbjct  752   APQDYLERMLAGREAMIEVHEDDATIELFKMNFTFDEYYSDGKTNSFVEGMKLEAVDPLN  811

Query  561   LSAICAATIMQVLKEDYIMIRIDSYDEDASGADWFCYHSCSPCIFPIGFCSQHGLPLTPP  620
             LS+IC AT+M VLK  Y+MIRIDSY  DASG+DWFCYH  SPCIFP GFCS + + +TPP
Sbjct  812   LSSICPATVMAVLKFGYMMIRIDSYQPDASGSDWFCYHEKSPCIFPAGFCSVNNISVTPP  871

Query  621   KGYDPTTFTWDTYLTETNTIPAPVQLFNREIPQHGFIEGMRLEAADLMDPRLVCVATITR  680
              GYD  TFTW+ YL +T  + A   LF+R IP HGF  GM LE ADLMDPRLVCVAT+ R
Sbjct  872   NGYDSRTFTWEGYLRDTGAVAAGQHLFHRIIPDHGFEVGMSLECADLMDPRLVCVATVAR  931

Query  681   VIGRLLRVHFDGWEDEYDQWLDCQSPDIYPVGWCDLVDHKLEG-PRVLNKNTSPTVKSPR  739
             V+GRLL+VHFDGW DEYDQWLDC+S DIYPVGWC LV+HKLEG PRV ++        P+
Sbjct  932   VVGRLLKVHFDGWTDEYDQWLDCESADIYPVGWCVLVNHKLEGPPRVAHQQAPKPAPKPK  991

Query  740   GLKRKAKRKVKKSNKVSCAKNILPRHSERIS  770
               +++  +K     K     N     S  I+
Sbjct  992   IQRKRKPKKGAAGGKTPTDNNTQSVKSRTIA  1022


 Score = 111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/150 (39%), Positives = 81/150 (54%), Gaps = 12/150 (8%)

Query  64   ENIRNHQIAPTTMVRYLPPQFPNECSEPDEAVEAVDSQEIQQEYDSQSERQEMTEYLTLE  123
            + + +H++  TT+V  +     N       + E   S+++Q+ Y +           T  
Sbjct  221  DGLLHHKLLGTTLVPAMGTLNGNAFGNIMVSTENTSSKQMQRTYSTAKGANSTATTATCS  280

Query  124  DYIGDEEREQVVNNAATQTTQDNRNRKIKPIKHPGLVLKTPIAYQPHTDLNFIPIRKDGI  183
                   R Q             + RKI+P+  PGLVLKTPIAY+ + D + IPI+KDG+
Sbjct  281  ASTSSALRSQ------------RKTRKIEPVNRPGLVLKTPIAYRGNIDPSVIPIQKDGM  328

Query  184  AVCEKCGAIGVKHAFYTKERRFCSRACARS  213
            AVC++CGAIGVKH FYTK RRFCS ACAR 
Sbjct  329  AVCKRCGAIGVKHTFYTKSRRFCSMACARG  358


>LIN61_CAEEL unnamed protein product
Length=612

 Score = 172 bits (435),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 143/506 (28%), Positives = 241/506 (48%), Gaps = 63/506 (12%)

Query  273  EPVMPEDLPVRR---KRTAEMAGSYDWTP---QLTEPGFCAAPVSCFKHAPISEIWDNIT  326
            E  M E L + R   K   ++  +Y W     Q  +      PV  F         + + 
Sbjct  119  EYTMSEFLKIVRANKKSDRKLDKTYLWESYLHQFEKGKTSFIPVEAFNRNLTVNFNECVK  178

Query  327  VGMKVEVENTDCDEVCEAFPDSFWVATVLRISGYRALLRYEGFGLNDDKDFWVSLCSNDI  386
             G+  E    D D+ C++     W A + ++ GYR L ++ G     D  FW+++ S+D+
Sbjct  179  EGVIFETVVHDYDKNCDSIQVR-WFARIEKVCGYRVLAQFIG----ADTKFWLNILSDDM  233

Query  387  HPVGWCATIGKP------LIPPNTIADKYK-DWKDFLMKRLTGARTLPTNFYNKVNDSM-  438
              +   A +  P        PP  I ++Y+ D  +++   + G     T+   K ++   
Sbjct  234  FGLA-NAAMSDPNMDKIVYAPPLAINEEYQNDMVNYVNNCIDGEIVGQTSLSPKFDEGKA  292

Query  439  ---KSRFRCGFHLEVVDKNRISQVKVATIQKIVGKRLHVR-----YYDSPPEDNG-----  485
               K RF+ G  LE+++ +  ++++VA IQ+I G+R++V      + +S P+ +      
Sbjct  293  LLSKHRFKVGQRLELLNYSNSTEIRVARIQEICGRRMNVSITKKDFPESLPDADDDRQVF  352

Query  486  -----FWCHEDSPLIHPVGWAKRVGQTLDAYPEYLERVSKS----------KLCEDDATE  530
                 +W  E S  I PVG+A   G  L+A  EY+E  +K           +   DD T 
Sbjct  353  SSGSQYWIDEGSFFIFPVGFAAVNGYQLNAKKEYIEHTNKIAQAIKNGENPRYDSDDVTF  412

Query  531  D-LFYVPKNHHVHLGYTFREGMKIEAIDPL--NLSAICAATIMQVLK-EDYIMIRIDSYD  586
            D L   P +  +      + G K E IDPL    + +  A+I++  K E Y+++ +D  D
Sbjct  413  DQLAKDPIDPMIWR--KVKVGQKFELIDPLAQQFNNLHVASILKFCKTEGYLIVGMDGPD  470

Query  587  EDASGADWFCYHSCSPCIFPIGFCSQHGLPLTPPKGYDPTTFTWDTYLTETNTIPAPVQL  646
               +  D F  H  +  +FP+G+  ++ L L PP  +   TF WD YL + +    P+ L
Sbjct  471  ---ALEDSFPIHINNTFMFPVGYAEKYNLELVPPDEF-KGTFRWDEYLEKESAETLPLDL  526

Query  647  FNREIPQH----GFIEGMRLEAADLMDPRLVCVATITRVIGRLLRVHFDGWEDEYDQWLD  702
            F + +P       F  G+RLEAAD+ + + +C AT+  V GRL+ V+FDGW++E+D+  D
Sbjct  527  F-KPMPSQERLDKFKVGLRLEAADMCENQFICPATVKSVHGRLINVNFDGWDEEFDELYD  585

Query  703  CQSPDIYPVGWCDLVDHKLEGPRVLN  728
              S DI P+GWC+   + L+ P+  N
Sbjct  586  VDSHDILPIGWCEAHSYVLQPPKKYN  611


>Q9VB52_DROME unnamed protein product
Length=1477

 Score = 135 bits (339),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 94/293 (32%), Positives = 135/293 (46%), Gaps = 22/293 (8%)

Query  442   FRCGFHLEVVDKNRISQVKVATIQKIVGKRLHVRYYDSPPEDNGFWCHEDSPLIHPVGWA  501
             F  G  LE +D    S   V +I ++ G RL + + D       FW + DS  I P GW 
Sbjct  850   FEIGMKLEAIDPENCSLFCVCSIVEVRGYRLKLSF-DGYSSMYDFWVNADSQDIFPPGWC  908

Query  502   KRVGQTLDAYPEY-LERVSKS----KLCEDDATEDLF-YVPKNHHVHLGYTFREGMKIEA  555
                 + L A  +Y  ER S S    K     A   LF ++     + +   F  GM +EA
Sbjct  909   DETARVLQAPKDYNSERFSWSRYLVKTGGKAAPRALFGHLNMQQQMDVRNGFAVGMHLEA  968

Query  556   IDPLNLSAICAATIMQVLKEDYIMIRIDSYDEDASGADWFCY----HSCSPCIFPIGFCS  611
              D  +   IC AT+  +L E  I +  D +D+        CY    H  SP I P G+  
Sbjct  969   EDLNDTGKICVATVTDILDE-RIRVHFDGWDD--------CYDLWVHITSPYIHPCGWHE  1019

Query  612   QHGLPLTPPKGYDPTTFTWDTYLTETNTIPAPVQLFNREIPQHGFIEGMRLEAADLMDPR  671
                  + PP  Y  + F WD Y++E   + A  +LF    P   + E M+LE  D  +P 
Sbjct  1020  GRQQLIVPP-DYQKSAFIWDDYISEVGGMAASKELFTPRQPME-YQERMKLEVVDQRNPC  1077

Query  672   LVCVATITRVIGRLLRVHFDGWEDEYDQWLDCQSPDIYPVGWCDLVDHKLEGP  724
             L+  AT+    G  +++H D W  EY  WL+  SPD++P+GWC+   H+LE P
Sbjct  1078  LIRPATVVTRKGYRVQLHLDCWPTEYYFWLEDDSPDLHPIGWCEATSHELETP  1130


 Score = 120 bits (300),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 120/461 (26%), Positives = 197/461 (43%), Gaps = 74/461 (16%)

Query  183   IAVCEKCGAIGVKHAFYTKERRFCSRACARSSEHTAPTADSTYSPSHSVEAHASVNSTSP  242
             + +C++C   G    F      FCS  C R S+                     +  ++ 
Sbjct  727   LYLCQRCNFHGPAADFLAPH--FCSVGCVRRSQKR------------------RLPQSTQ  766

Query  243   NESKLTKNVIVQEET---DIKESFELEKEKVISEPVMPEDLPVRRKRTAEMAGSYDWTPQ  299
              ESK+++  + Q      D+ +  +   +   S   + E L  R+K        + W+  
Sbjct  767   KESKISRTQLEQTAGTAPDLPQKRQTNYKPHKSLSAIQEQLQQRQKDKPRKP--FRWSEY  824

Query  300   LTEPGF-CAAPVSCFKHA-PISEIWDNITVGMKVE-VENTDCDEVCEAFPDSFWVATVLR  356
             L   G   AAP+  F +  PIS   +   +GMK+E ++  +C   C        V +++ 
Sbjct  825   LKSKGKDVAAPIHLFLNPFPISP--NCFEIGMKLEAIDPENCSLFC--------VCSIVE  874

Query  357   ISGYRALLRYEGFGLNDDKDFWVSLCSNDIHPVGWCATIGKPLIPPNTIADKYKDWKDFL  416
             + GYR  L ++G+  +   DFWV+  S DI P GWC    + L  P     +   W  +L
Sbjct  875   VRGYRLKLSFDGY--SSMYDFWVNADSQDIFPPGWCDETARVLQAPKDYNSERFSWSRYL  932

Query  417   MKRLTGARTLPTNFYNKVNDS----MKSRFRCGFHLEVVDKNRISQVKVATIQKIVGKRL  472
             +K  TG +  P   +  +N      +++ F  G HLE  D N   ++ VAT+  I+ +R+
Sbjct  933   VK--TGGKAAPRALFGHLNMQQQMDVRNGFAVGMHLEAEDLNDTGKICVATVTDILDERI  990

Query  473   HVRYYDSPPEDNGFWCHEDSPLIHPVGWAKRVGQTLDAYPEYLERVSKSKLCEDD-----  527
              V ++D   +    W H  SP IHP GW +   Q L   P+Y     KS    DD     
Sbjct  991   RV-HFDGWDDCYDLWVHITSPYIHPCGWHEG-RQQLIVPPDY----QKSAFIWDDYISEV  1044

Query  528   ----ATEDLFYVPKNHHVHLGYTFREGMKIEAIDPLNLSAICAATIMQVLKEDY-IMIRI  582
                 A+++LF  P+         ++E MK+E +D  N   I  AT+  V ++ Y + + +
Sbjct  1045  GGMAASKELF-TPRQ-----PMEYQERMKLEVVDQRNPCLIRPATV--VTRKGYRVQLHL  1096

Query  583   DSYDEDASGADWFCYHSCSPCIFPIGFCSQHGLPLTPPKGY  623
             D +  +     +F     SP + PIG+C      L  P GY
Sbjct  1097  DCWPTEY----YFWLEDDSPDLHPIGWCEATSHELETPPGY  1133



Lambda      K        H
   0.319    0.134    0.404 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 23657709084


Query= XP_050469458.1 polycomb protein Sfmbt-like isoform X2 [Bombus
huntii]

Length=959
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SMBT_DROME  unnamed protein product                                   616     0.0  
LIN61_CAEEL  unnamed protein product                                  172     7e-45
Q9VB52_DROME  unnamed protein product                                 135     7e-32


>SMBT_DROME unnamed protein product
Length=1220

 Score = 616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/511 (59%), Positives = 368/511 (72%), Gaps = 19/511 (4%)

Query  273   PVMPEDLPVRRKRTAEMAGSYDWTPQLTEPGFCAAPVSCFKHAPISEIWDNITVGMKVEV  332
             P M + + +RR R  +   SYDW P+L++  F AAPV+CF HAP  E+WDN+ VGMKVEV
Sbjct  517   PQMEKIISIRR-RMYDPTHSYDWLPRLSKENFNAAPVTCFPHAPGCEVWDNLGVGMKVEV  575

Query  333   ENTDCD--EVCE--AFPDSFWVATVLRISGYRALLRYEGFGLNDDKDFWVSLCSNDIHPV  388
             ENTDCD  EV +    P SFWVAT+L I GY+AL+ YEGF   D  DFWV+LC+ ++H V
Sbjct  576   ENTDCDSIEVIQPGQTPTSFWVATILEIKGYKALMSYEGFD-TDSHDFWVNLCNAEVHSV  634

Query  389   GWCATIGKPLIPPNTIADKYKDWKDFLMKRLTGARTLPTNFYNKVNDSMKSRFRCGFHLE  448
             GWCAT GKPLIPP TI  KYKDWKDFL+ RL+GARTLP+NFYNK+NDS++SRFR G +LE
Sbjct  635   GWCATRGKPLIPPRTIEHKYKDWKDFLVGRLSGARTLPSNFYNKINDSLQSRFRLGLNLE  694

Query  449   VVDKNRISQVKVATIQKIVGKRLHVRYYDSPPEDNGFWCHEDSPLIHPVGWAKRVGQTLD  508
              VDK+RISQV++AT+ KIVGKRL +RY+DS   D+GFWCHEDSP+IHPVGWA  VG  L 
Sbjct  695   CVDKDRISQVRLATVTKIVGKRLFLRYFDS---DDGFWCHEDSPIIHPVGWATTVGHNLA  751

Query  509   AYPEYLERVSKSK-----LCEDDATEDLFYV--PKNHHVHLGYT--FREGMKIEAIDPLN  559
             A  +YLER+   +     + EDDAT +LF +    + +   G T  F EGMK+EA+DPLN
Sbjct  752   APQDYLERMLAGREAMIEVHEDDATIELFKMNFTFDEYYSDGKTNSFVEGMKLEAVDPLN  811

Query  560   LSAICAATIMQVLKEDYIMIRIDSYDEDASGADWFCYHSCSPCIFPIGFCSQHGLPLTPP  619
             LS+IC AT+M VLK  Y+MIRIDSY  DASG+DWFCYH  SPCIFP GFCS + + +TPP
Sbjct  812   LSSICPATVMAVLKFGYMMIRIDSYQPDASGSDWFCYHEKSPCIFPAGFCSVNNISVTPP  871

Query  620   KGYDPTTFTWDTYLTETNTIPAPVQLFNREIPQHGFIEGMRLEAADLMDPRLVCVATITR  679
              GYD  TFTW+ YL +T  + A   LF+R IP HGF  GM LE ADLMDPRLVCVAT+ R
Sbjct  872   NGYDSRTFTWEGYLRDTGAVAAGQHLFHRIIPDHGFEVGMSLECADLMDPRLVCVATVAR  931

Query  680   VIGRLLRVHFDGWEDEYDQWLDCQSPDIYPVGWCDLVDHKLEG-PRVLNKNTSPTVKSPR  738
             V+GRLL+VHFDGW DEYDQWLDC+S DIYPVGWC LV+HKLEG PRV ++        P+
Sbjct  932   VVGRLLKVHFDGWTDEYDQWLDCESADIYPVGWCVLVNHKLEGPPRVAHQQAPKPAPKPK  991

Query  739   GLKRKAKRKVKKSNKVSCAKNILPRHSERIS  769
               +++  +K     K     N     S  I+
Sbjct  992   IQRKRKPKKGAAGGKTPTDNNTQSVKSRTIA  1022


 Score = 110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/150 (39%), Positives = 81/150 (54%), Gaps = 12/150 (8%)

Query  63   ENIRNHQIAPTTMVRYLPPQFPNECSEPDEAVEAVDSQEIQQEYDSQSERQEMTEYLTLE  122
            + + +H++  TT+V  +     N       + E   S+++Q+ Y +           T  
Sbjct  221  DGLLHHKLLGTTLVPAMGTLNGNAFGNIMVSTENTSSKQMQRTYSTAKGANSTATTATCS  280

Query  123  DYIGDEEREQVVNNAATQTTQDNRNRKIKPIKHPGLVLKTPIAYQPHTDLNFIPIRKDGI  182
                   R Q             + RKI+P+  PGLVLKTPIAY+ + D + IPI+KDG+
Sbjct  281  ASTSSALRSQ------------RKTRKIEPVNRPGLVLKTPIAYRGNIDPSVIPIQKDGM  328

Query  183  AVCEKCGAIGVKHAFYTKERRFCSRACARS  212
            AVC++CGAIGVKH FYTK RRFCS ACAR 
Sbjct  329  AVCKRCGAIGVKHTFYTKSRRFCSMACARG  358


>LIN61_CAEEL unnamed protein product
Length=612

 Score = 172 bits (436),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 143/506 (28%), Positives = 242/506 (48%), Gaps = 63/506 (12%)

Query  272  EPVMPEDLPVRR---KRTAEMAGSYDWTP---QLTEPGFCAAPVSCFKHAPISEIWDNIT  325
            E  M E L + R   K   ++  +Y W     Q  +      PV  F         + + 
Sbjct  119  EYTMSEFLKIVRANKKSDRKLDKTYLWESYLHQFEKGKTSFIPVEAFNRNLTVNFNECVK  178

Query  326  VGMKVEVENTDCDEVCEAFPDSFWVATVLRISGYRALLRYEGFGLNDDKDFWVSLCSNDI  385
             G+  E    D D+ C++     W A + ++ GYR L ++ G     D  FW+++ S+D+
Sbjct  179  EGVIFETVVHDYDKNCDSIQVR-WFARIEKVCGYRVLAQFIG----ADTKFWLNILSDDM  233

Query  386  HPVGWCATIGKPLI------PPNTIADKYK-DWKDFLMKRLTGARTLPTNFYNKVNDSM-  437
              +   A +  P +      PP  I ++Y+ D  +++   + G     T+   K ++   
Sbjct  234  FGLA-NAAMSDPNMDKIVYAPPLAINEEYQNDMVNYVNNCIDGEIVGQTSLSPKFDEGKA  292

Query  438  ---KSRFRCGFHLEVVDKNRISQVKVATIQKIVGKRLHVR-----YYDSPPEDNG-----  484
               K RF+ G  LE+++ +  ++++VA IQ+I G+R++V      + +S P+ +      
Sbjct  293  LLSKHRFKVGQRLELLNYSNSTEIRVARIQEICGRRMNVSITKKDFPESLPDADDDRQVF  352

Query  485  -----FWCHEDSPLIHPVGWAKRVGQTLDAYPEYLERVSKS----------KLCEDDATE  529
                 +W  E S  I PVG+A   G  L+A  EY+E  +K           +   DD T 
Sbjct  353  SSGSQYWIDEGSFFIFPVGFAAVNGYQLNAKKEYIEHTNKIAQAIKNGENPRYDSDDVTF  412

Query  530  D-LFYVPKNHHVHLGYTFREGMKIEAIDPL--NLSAICAATIMQVLK-EDYIMIRIDSYD  585
            D L   P +  +      + G K E IDPL    + +  A+I++  K E Y+++ +D  D
Sbjct  413  DQLAKDPIDPMIWR--KVKVGQKFELIDPLAQQFNNLHVASILKFCKTEGYLIVGMDGPD  470

Query  586  EDASGADWFCYHSCSPCIFPIGFCSQHGLPLTPPKGYDPTTFTWDTYLTETNTIPAPVQL  645
               +  D F  H  +  +FP+G+  ++ L L PP  +   TF WD YL + +    P+ L
Sbjct  471  ---ALEDSFPIHINNTFMFPVGYAEKYNLELVPPDEF-KGTFRWDEYLEKESAETLPLDL  526

Query  646  FNREIPQH----GFIEGMRLEAADLMDPRLVCVATITRVIGRLLRVHFDGWEDEYDQWLD  701
            F + +P       F  G+RLEAAD+ + + +C AT+  V GRL+ V+FDGW++E+D+  D
Sbjct  527  F-KPMPSQERLDKFKVGLRLEAADMCENQFICPATVKSVHGRLINVNFDGWDEEFDELYD  585

Query  702  CQSPDIYPVGWCDLVDHKLEGPRVLN  727
              S DI P+GWC+   + L+ P+  N
Sbjct  586  VDSHDILPIGWCEAHSYVLQPPKKYN  611


>Q9VB52_DROME unnamed protein product
Length=1477

 Score = 135 bits (339),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 94/293 (32%), Positives = 135/293 (46%), Gaps = 22/293 (8%)

Query  441   FRCGFHLEVVDKNRISQVKVATIQKIVGKRLHVRYYDSPPEDNGFWCHEDSPLIHPVGWA  500
             F  G  LE +D    S   V +I ++ G RL + + D       FW + DS  I P GW 
Sbjct  850   FEIGMKLEAIDPENCSLFCVCSIVEVRGYRLKLSF-DGYSSMYDFWVNADSQDIFPPGWC  908

Query  501   KRVGQTLDAYPEY-LERVSKS----KLCEDDATEDLF-YVPKNHHVHLGYTFREGMKIEA  554
                 + L A  +Y  ER S S    K     A   LF ++     + +   F  GM +EA
Sbjct  909   DETARVLQAPKDYNSERFSWSRYLVKTGGKAAPRALFGHLNMQQQMDVRNGFAVGMHLEA  968

Query  555   IDPLNLSAICAATIMQVLKEDYIMIRIDSYDEDASGADWFCY----HSCSPCIFPIGFCS  610
              D  +   IC AT+  +L E  I +  D +D+        CY    H  SP I P G+  
Sbjct  969   EDLNDTGKICVATVTDILDE-RIRVHFDGWDD--------CYDLWVHITSPYIHPCGWHE  1019

Query  611   QHGLPLTPPKGYDPTTFTWDTYLTETNTIPAPVQLFNREIPQHGFIEGMRLEAADLMDPR  670
                  + PP  Y  + F WD Y++E   + A  +LF    P   + E M+LE  D  +P 
Sbjct  1020  GRQQLIVPP-DYQKSAFIWDDYISEVGGMAASKELFTPRQPME-YQERMKLEVVDQRNPC  1077

Query  671   LVCVATITRVIGRLLRVHFDGWEDEYDQWLDCQSPDIYPVGWCDLVDHKLEGP  723
             L+  AT+    G  +++H D W  EY  WL+  SPD++P+GWC+   H+LE P
Sbjct  1078  LIRPATVVTRKGYRVQLHLDCWPTEYYFWLEDDSPDLHPIGWCEATSHELETP  1130


 Score = 120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 120/461 (26%), Positives = 197/461 (43%), Gaps = 74/461 (16%)

Query  182   IAVCEKCGAIGVKHAFYTKERRFCSRACARSSEHTAPTADSTYSPSHSVEAHASVNSTSP  241
             + +C++C   G    F      FCS  C R S+                     +  ++ 
Sbjct  727   LYLCQRCNFHGPAADFLAPH--FCSVGCVRRSQKR------------------RLPQSTQ  766

Query  242   NESKLTKNVIVQEET---DIKESFELEKEKVISEPVMPEDLPVRRKRTAEMAGSYDWTPQ  298
              ESK+++  + Q      D+ +  +   +   S   + E L  R+K        + W+  
Sbjct  767   KESKISRTQLEQTAGTAPDLPQKRQTNYKPHKSLSAIQEQLQQRQKDKPRKP--FRWSEY  824

Query  299   LTEPGF-CAAPVSCFKHA-PISEIWDNITVGMKVE-VENTDCDEVCEAFPDSFWVATVLR  355
             L   G   AAP+  F +  PIS   +   +GMK+E ++  +C   C        V +++ 
Sbjct  825   LKSKGKDVAAPIHLFLNPFPISP--NCFEIGMKLEAIDPENCSLFC--------VCSIVE  874

Query  356   ISGYRALLRYEGFGLNDDKDFWVSLCSNDIHPVGWCATIGKPLIPPNTIADKYKDWKDFL  415
             + GYR  L ++G+  +   DFWV+  S DI P GWC    + L  P     +   W  +L
Sbjct  875   VRGYRLKLSFDGY--SSMYDFWVNADSQDIFPPGWCDETARVLQAPKDYNSERFSWSRYL  932

Query  416   MKRLTGARTLPTNFYNKVNDS----MKSRFRCGFHLEVVDKNRISQVKVATIQKIVGKRL  471
             +K  TG +  P   +  +N      +++ F  G HLE  D N   ++ VAT+  I+ +R+
Sbjct  933   VK--TGGKAAPRALFGHLNMQQQMDVRNGFAVGMHLEAEDLNDTGKICVATVTDILDERI  990

Query  472   HVRYYDSPPEDNGFWCHEDSPLIHPVGWAKRVGQTLDAYPEYLERVSKSKLCEDD-----  526
              V ++D   +    W H  SP IHP GW +   Q L   P+Y     KS    DD     
Sbjct  991   RV-HFDGWDDCYDLWVHITSPYIHPCGWHEG-RQQLIVPPDY----QKSAFIWDDYISEV  1044

Query  527   ----ATEDLFYVPKNHHVHLGYTFREGMKIEAIDPLNLSAICAATIMQVLKEDY-IMIRI  581
                 A+++LF  P+         ++E MK+E +D  N   I  AT+  V ++ Y + + +
Sbjct  1045  GGMAASKELF-TPRQ-----PMEYQERMKLEVVDQRNPCLIRPATV--VTRKGYRVQLHL  1096

Query  582   DSYDEDASGADWFCYHSCSPCIFPIGFCSQHGLPLTPPKGY  622
             D +  +     +F     SP + PIG+C      L  P GY
Sbjct  1097  DCWPTEY----YFWLEDDSPDLHPIGWCEATSHELETPPGY  1133



Lambda      K        H
   0.319    0.134    0.404 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 23657709084


Query= XP_050469459.1 polycomb protein Sfmbt-like isoform X3 [Bombus
huntii]

Length=952
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SMBT_DROME  unnamed protein product                                   616     0.0  
LIN61_CAEEL  unnamed protein product                                  172     8e-45
Q9VB52_DROME  unnamed protein product                                 135     7e-32


>SMBT_DROME unnamed protein product
Length=1220

 Score = 616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/511 (59%), Positives = 368/511 (72%), Gaps = 19/511 (4%)

Query  266   PVMPEDLPVRRKRTAEMAGSYDWTPQLTEPGFCAAPVSCFKHAPISEIWDNITVGMKVEV  325
             P M + + +RR R  +   SYDW P+L++  F AAPV+CF HAP  E+WDN+ VGMKVEV
Sbjct  517   PQMEKIISIRR-RMYDPTHSYDWLPRLSKENFNAAPVTCFPHAPGCEVWDNLGVGMKVEV  575

Query  326   ENTDCD--EVCE--AFPDSFWVATVLRISGYRALLRYEGFGLNDDKDFWVSLCSNDIHPV  381
             ENTDCD  EV +    P SFWVAT+L I GY+AL+ YEGF   D  DFWV+LC+ ++H V
Sbjct  576   ENTDCDSIEVIQPGQTPTSFWVATILEIKGYKALMSYEGFD-TDSHDFWVNLCNAEVHSV  634

Query  382   GWCATIGKPLIPPNTIADKYKDWKDFLMKRLTGARTLPTNFYNKVNDSMKSRFRCGFHLE  441
             GWCAT GKPLIPP TI  KYKDWKDFL+ RL+GARTLP+NFYNK+NDS++SRFR G +LE
Sbjct  635   GWCATRGKPLIPPRTIEHKYKDWKDFLVGRLSGARTLPSNFYNKINDSLQSRFRLGLNLE  694

Query  442   VVDKNRISQVKVATIQKIVGKRLHVRYYDSPPEDNGFWCHEDSPLIHPVGWAKRVGQTLD  501
              VDK+RISQV++AT+ KIVGKRL +RY+DS   D+GFWCHEDSP+IHPVGWA  VG  L 
Sbjct  695   CVDKDRISQVRLATVTKIVGKRLFLRYFDS---DDGFWCHEDSPIIHPVGWATTVGHNLA  751

Query  502   AYPEYLERVSKSK-----LCEDDATEDLFYV--PKNHHVHLGYT--FREGMKIEAIDPLN  552
             A  +YLER+   +     + EDDAT +LF +    + +   G T  F EGMK+EA+DPLN
Sbjct  752   APQDYLERMLAGREAMIEVHEDDATIELFKMNFTFDEYYSDGKTNSFVEGMKLEAVDPLN  811

Query  553   LSAICAATIMQVLKEDYIMIRIDSYDEDASGADWFCYHSCSPCIFPIGFCSQHGLPLTPP  612
             LS+IC AT+M VLK  Y+MIRIDSY  DASG+DWFCYH  SPCIFP GFCS + + +TPP
Sbjct  812   LSSICPATVMAVLKFGYMMIRIDSYQPDASGSDWFCYHEKSPCIFPAGFCSVNNISVTPP  871

Query  613   KGYDPTTFTWDTYLTETNTIPAPVQLFNREIPQHGFIEGMRLEAADLMDPRLVCVATITR  672
              GYD  TFTW+ YL +T  + A   LF+R IP HGF  GM LE ADLMDPRLVCVAT+ R
Sbjct  872   NGYDSRTFTWEGYLRDTGAVAAGQHLFHRIIPDHGFEVGMSLECADLMDPRLVCVATVAR  931

Query  673   VIGRLLRVHFDGWEDEYDQWLDCQSPDIYPVGWCDLVDHKLEG-PRVLNKNTSPTVKSPR  731
             V+GRLL+VHFDGW DEYDQWLDC+S DIYPVGWC LV+HKLEG PRV ++        P+
Sbjct  932   VVGRLLKVHFDGWTDEYDQWLDCESADIYPVGWCVLVNHKLEGPPRVAHQQAPKPAPKPK  991

Query  732   GLKRKAKRKVKKSNKVSCAKNILPRHSERIS  762
               +++  +K     K     N     S  I+
Sbjct  992   IQRKRKPKKGAAGGKTPTDNNTQSVKSRTIA  1022


 Score = 111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/150 (39%), Positives = 81/150 (54%), Gaps = 12/150 (8%)

Query  56   ENIRNHQIAPTTMVRYLPPQFPNECSEPDEAVEAVDSQEIQQEYDSQSERQEMTEYLTLE  115
            + + +H++  TT+V  +     N       + E   S+++Q+ Y +           T  
Sbjct  221  DGLLHHKLLGTTLVPAMGTLNGNAFGNIMVSTENTSSKQMQRTYSTAKGANSTATTATCS  280

Query  116  DYIGDEEREQVVNNAATQTTQDNRNRKIKPIKHPGLVLKTPIAYQPHTDLNFIPIRKDGI  175
                   R Q             + RKI+P+  PGLVLKTPIAY+ + D + IPI+KDG+
Sbjct  281  ASTSSALRSQ------------RKTRKIEPVNRPGLVLKTPIAYRGNIDPSVIPIQKDGM  328

Query  176  AVCEKCGAIGVKHAFYTKERRFCSRACARS  205
            AVC++CGAIGVKH FYTK RRFCS ACAR 
Sbjct  329  AVCKRCGAIGVKHTFYTKSRRFCSMACARG  358


>LIN61_CAEEL unnamed protein product
Length=612

 Score = 172 bits (435),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 143/506 (28%), Positives = 242/506 (48%), Gaps = 63/506 (12%)

Query  265  EPVMPEDLPVRR---KRTAEMAGSYDWTP---QLTEPGFCAAPVSCFKHAPISEIWDNIT  318
            E  M E L + R   K   ++  +Y W     Q  +      PV  F         + + 
Sbjct  119  EYTMSEFLKIVRANKKSDRKLDKTYLWESYLHQFEKGKTSFIPVEAFNRNLTVNFNECVK  178

Query  319  VGMKVEVENTDCDEVCEAFPDSFWVATVLRISGYRALLRYEGFGLNDDKDFWVSLCSNDI  378
             G+  E    D D+ C++     W A + ++ GYR L ++ G     D  FW+++ S+D+
Sbjct  179  EGVIFETVVHDYDKNCDSIQVR-WFARIEKVCGYRVLAQFIG----ADTKFWLNILSDDM  233

Query  379  HPVGWCATIGKPLI------PPNTIADKYK-DWKDFLMKRLTGARTLPTNFYNKVNDSM-  430
              +   A +  P +      PP  I ++Y+ D  +++   + G     T+   K ++   
Sbjct  234  FGLA-NAAMSDPNMDKIVYAPPLAINEEYQNDMVNYVNNCIDGEIVGQTSLSPKFDEGKA  292

Query  431  ---KSRFRCGFHLEVVDKNRISQVKVATIQKIVGKRLHVR-----YYDSPPEDNG-----  477
               K RF+ G  LE+++ +  ++++VA IQ+I G+R++V      + +S P+ +      
Sbjct  293  LLSKHRFKVGQRLELLNYSNSTEIRVARIQEICGRRMNVSITKKDFPESLPDADDDRQVF  352

Query  478  -----FWCHEDSPLIHPVGWAKRVGQTLDAYPEYLERVSKS----------KLCEDDATE  522
                 +W  E S  I PVG+A   G  L+A  EY+E  +K           +   DD T 
Sbjct  353  SSGSQYWIDEGSFFIFPVGFAAVNGYQLNAKKEYIEHTNKIAQAIKNGENPRYDSDDVTF  412

Query  523  D-LFYVPKNHHVHLGYTFREGMKIEAIDPL--NLSAICAATIMQVLK-EDYIMIRIDSYD  578
            D L   P +  +      + G K E IDPL    + +  A+I++  K E Y+++ +D  D
Sbjct  413  DQLAKDPIDPMIWR--KVKVGQKFELIDPLAQQFNNLHVASILKFCKTEGYLIVGMDGPD  470

Query  579  EDASGADWFCYHSCSPCIFPIGFCSQHGLPLTPPKGYDPTTFTWDTYLTETNTIPAPVQL  638
               +  D F  H  +  +FP+G+  ++ L L PP  +   TF WD YL + +    P+ L
Sbjct  471  ---ALEDSFPIHINNTFMFPVGYAEKYNLELVPPDEF-KGTFRWDEYLEKESAETLPLDL  526

Query  639  FNREIPQH----GFIEGMRLEAADLMDPRLVCVATITRVIGRLLRVHFDGWEDEYDQWLD  694
            F + +P       F  G+RLEAAD+ + + +C AT+  V GRL+ V+FDGW++E+D+  D
Sbjct  527  F-KPMPSQERLDKFKVGLRLEAADMCENQFICPATVKSVHGRLINVNFDGWDEEFDELYD  585

Query  695  CQSPDIYPVGWCDLVDHKLEGPRVLN  720
              S DI P+GWC+   + L+ P+  N
Sbjct  586  VDSHDILPIGWCEAHSYVLQPPKKYN  611


>Q9VB52_DROME unnamed protein product
Length=1477

 Score = 135 bits (339),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 94/293 (32%), Positives = 135/293 (46%), Gaps = 22/293 (8%)

Query  434   FRCGFHLEVVDKNRISQVKVATIQKIVGKRLHVRYYDSPPEDNGFWCHEDSPLIHPVGWA  493
             F  G  LE +D    S   V +I ++ G RL + + D       FW + DS  I P GW 
Sbjct  850   FEIGMKLEAIDPENCSLFCVCSIVEVRGYRLKLSF-DGYSSMYDFWVNADSQDIFPPGWC  908

Query  494   KRVGQTLDAYPEY-LERVSKS----KLCEDDATEDLF-YVPKNHHVHLGYTFREGMKIEA  547
                 + L A  +Y  ER S S    K     A   LF ++     + +   F  GM +EA
Sbjct  909   DETARVLQAPKDYNSERFSWSRYLVKTGGKAAPRALFGHLNMQQQMDVRNGFAVGMHLEA  968

Query  548   IDPLNLSAICAATIMQVLKEDYIMIRIDSYDEDASGADWFCY----HSCSPCIFPIGFCS  603
              D  +   IC AT+  +L E  I +  D +D+        CY    H  SP I P G+  
Sbjct  969   EDLNDTGKICVATVTDILDE-RIRVHFDGWDD--------CYDLWVHITSPYIHPCGWHE  1019

Query  604   QHGLPLTPPKGYDPTTFTWDTYLTETNTIPAPVQLFNREIPQHGFIEGMRLEAADLMDPR  663
                  + PP  Y  + F WD Y++E   + A  +LF    P   + E M+LE  D  +P 
Sbjct  1020  GRQQLIVPP-DYQKSAFIWDDYISEVGGMAASKELFTPRQPME-YQERMKLEVVDQRNPC  1077

Query  664   LVCVATITRVIGRLLRVHFDGWEDEYDQWLDCQSPDIYPVGWCDLVDHKLEGP  716
             L+  AT+    G  +++H D W  EY  WL+  SPD++P+GWC+   H+LE P
Sbjct  1078  LIRPATVVTRKGYRVQLHLDCWPTEYYFWLEDDSPDLHPIGWCEATSHELETP  1130


 Score = 120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 116/455 (25%), Positives = 194/455 (43%), Gaps = 62/455 (14%)

Query  175   IAVCEKCGAIGVKHAFYTKERRFCSRACARSSEHTAPTADSTYSPSHSVEAHASVNSTSP  234
             + +C++C   G    F      FCS  C R S+                     +  ++ 
Sbjct  727   LYLCQRCNFHGPAADFLAPH--FCSVGCVRRSQKR------------------RLPQSTQ  766

Query  235   NESKLTKNVIVQEET---DIKESFELEKEKVISEPVMPEDLPVRRKRTAEMAGSYDWTPQ  291
              ESK+++  + Q      D+ +  +   +   S   + E L  R+K        + W+  
Sbjct  767   KESKISRTQLEQTAGTAPDLPQKRQTNYKPHKSLSAIQEQLQQRQKDKPRKP--FRWSEY  824

Query  292   LTEPGF-CAAPVSCFKHA-PISEIWDNITVGMKVE-VENTDCDEVCEAFPDSFWVATVLR  348
             L   G   AAP+  F +  PIS   +   +GMK+E ++  +C   C        V +++ 
Sbjct  825   LKSKGKDVAAPIHLFLNPFPISP--NCFEIGMKLEAIDPENCSLFC--------VCSIVE  874

Query  349   ISGYRALLRYEGFGLNDDKDFWVSLCSNDIHPVGWCATIGKPLIPPNTIADKYKDWKDFL  408
             + GYR  L ++G+  +   DFWV+  S DI P GWC    + L  P     +   W  +L
Sbjct  875   VRGYRLKLSFDGY--SSMYDFWVNADSQDIFPPGWCDETARVLQAPKDYNSERFSWSRYL  932

Query  409   MKRLTGARTLPTNFYNKVNDS----MKSRFRCGFHLEVVDKNRISQVKVATIQKIVGKRL  464
             +K  TG +  P   +  +N      +++ F  G HLE  D N   ++ VAT+  I+ +R+
Sbjct  933   VK--TGGKAAPRALFGHLNMQQQMDVRNGFAVGMHLEAEDLNDTGKICVATVTDILDERI  990

Query  465   HVRYYDSPPEDNGFWCHEDSPLIHPVGWAKRVGQTLDAYPEYLERVSKSKLCEDDATEDL  524
              V ++D   +    W H  SP IHP GW +   Q L   P+Y     KS    DD   ++
Sbjct  991   RV-HFDGWDDCYDLWVHITSPYIHPCGWHEG-RQQLIVPPDY----QKSAFIWDDYISEV  1044

Query  525   FYVPKNHHVHL---GYTFREGMKIEAIDPLNLSAICAATIMQVLKEDY-IMIRIDSYDED  580
               +  +  +        ++E MK+E +D  N   I  AT+  V ++ Y + + +D +  +
Sbjct  1045  GGMAASKELFTPRQPMEYQERMKLEVVDQRNPCLIRPATV--VTRKGYRVQLHLDCWPTE  1102

Query  581   ASGADWFCYHSCSPCIFPIGFCSQHGLPLTPPKGY  615
                  +F     SP + PIG+C      L  P GY
Sbjct  1103  Y----YFWLEDDSPDLHPIGWCEATSHELETPPGY  1133



Lambda      K        H
   0.319    0.134    0.404 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 23657709084


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Oct 18, 2022  4:55 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_050469460.1 eukaryotic translation initiation factor 3 subunit I
isoform X1 [Bombus huntii]

Length=326
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

EIF3I_DICDI  unnamed protein product                                  267     5e-88
Q383W8_TRYB2  unnamed protein product                                 233     9e-75
Q4Q127_LEIMA  unnamed protein product                                 164     3e-47


>EIF3I_DICDI unnamed protein product
Length=331

 Score = 267 bits (683),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 128/322 (40%), Positives = 200/322 (62%), Gaps = 3/322 (1%)

Query  1    MKPLMLHGHERAITQIKYNREGDLLFSSSKDKKPNVWYSLNGERLGSFNGHNGSVWCIDI  60
            M+P+ L  HER ITQ+ +NREGDLLF ++KDK  ++WY+ NGER+GS+    G V+ ID+
Sbjct  1    MRPISLRLHERPITQVLFNREGDLLFVAAKDKLVSLWYTTNGERIGSYQC-GGVVYSIDV  59

Query  61   NWDTTRFLSGSGDNSLRVWDCQTGKEIGLLHTNSSVRTCSFSYSANLAVYSTDKALGHQC  120
            + D+   ++ S D   RVWD  +G+++       S R+  FS      +  TD+ +G Q 
Sbjct  60   SQDSKYLITASADAKARVWDVSSGRQLDSTDFEVSARSIEFSQGDKQILVVTDQVMGCQA  119

Query  121  EMFIIDIKNVDAVLSQADAISRIAVNGPKITAILWGALDETIITGHEDGEITLWDVRTRK  180
            ++ + D    +  + + +    +     KIT   WG L++TI    EDG + ++    R+
Sbjct  120  KIHVFDFDKDE--VRKLNKSYTLPSPQCKITQATWGPLNKTIFASCEDGAVRIYCTEKRE  177

Query  181  KMTSVRSHKSQINDMQFNKDGTMFVTASKDNTAKLFDSESLMLLKTYKTERPVNSATISP  240
             + ++  H   +  +++ K   MF+T SKD TAKL+D+++L LL+T+ T RP+N+A ISP
Sbjct  178  LIKTILDHNKLVTRIEWTKHRIMFMTCSKDGTAKLYDTKTLKLLRTFDTGRPINAAGISP  237

Query  241  IFDHVVLGGGQDAMDVTTTSTRQGKFDSRFFHLVFEEEFARLKGHFGPINSLAFHPNGRS  300
            +  HV+LGGGQ A  VTTT     +F  RFFH+V+ EE   L GH GP++S+ F P+G++
Sbjct  238  LKPHVILGGGQSAESVTTTKVDASQFKVRFFHIVYGEELGGLIGHIGPVHSICFTPDGKT  297

Query  301  FSTGGEDGYVRINTFDQSYFDF  322
            F+TGGE+G V++N  D+SYF+F
Sbjct  298  FATGGEEGLVQVNHLDESYFEF  319


>Q383W8_TRYB2 unnamed protein product
Length=342

 Score = 233 bits (595),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 116/327 (35%), Positives = 194/327 (59%), Gaps = 10/327 (3%)

Query  1    MKPLMLHGHERAITQIKYNREGDLLFSSSKDKKPNVWYSLNGERLGSFNGHNGSVWCIDI  60
            ++ + LHGH + +T IK+NREGDLLFS++K+   +VWY+  GERLG+++GH+    C D+
Sbjct  3    IQGMALHGHMKPVTMIKFNREGDLLFSTAKEPNVSVWYTKTGERLGTYDGHSAISAC-DV  61

Query  61   NWDTTRFLSGSGDNSLRVWDCQTGKEIGLLHTNSSVRTCSFSYSANLAVYSTDKALGHQC  120
            N  +T  ++G  D   ++W  +TG+E+  +   +  R   FS+  NL + ST + +G + 
Sbjct  62   NNYSTLLVTGGMDFKAKLWCVETGEELANIMLRTPARAVGFSHDDNLLMVSTSRKMGQKS  121

Query  121  EMFIIDIK--------NVDAVLSQADAISRIAVNGPKITAILWGALDETIITGHEDGEIT  172
             + + ++         ++  V +  +  +        +T  +WG  ++TI     DG + 
Sbjct  122  AVQLYNLPFLPPKDGYSIHPVNTVFNPCTEFVSENDDVTFAIWGPTNDTIYYSTSDGSVA  181

Query  173  LWDVRTRKKMTSVRSHKSQINDMQFNKDGTMFVTASKDNTAKLFDSESLMLLKTYKTERP  232
            + DV T   + + + H+  IN + F+ +    +TASKD TA+L DS  L +++TY ++ P
Sbjct  182  ILDVETMSTVCTHKPHEETINRISFDSNYYTLITASKDKTARLLDSRDLSVVQTYTSDVP  241

Query  233  VNSATISPIFDHVVLGGGQDAMDVTTTSTRQGKFDSRFFHLVFEEEFARLKGHFGPINSL  292
            VN A+ISP  DHV++GGG DA DVTT    Q  F+ +F+H V E++  +++ HFG INS+
Sbjct  242  VNDASISPRGDHVIIGGGMDAQDVTTQG-GQTTFEVKFYHKVHEKQLGQVRCHFGTINSV  300

Query  293  AFHPNGRSFSTGGEDGYVRINTFDQSY  319
             F P+GR F++G  DG V+++ FD  Y
Sbjct  301  CFFPDGRGFASGAFDGLVKLHRFDDKY  327


>Q4Q127_LEIMA unnamed protein product
Length=419

 Score = 164 bits (416),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 106/343 (31%), Positives = 176/343 (51%), Gaps = 29/343 (8%)

Query  1    MKPLMLHGHERAITQIKYNREGDLLFSSSKDKKPNV--WYSLNGERLGSFNG--------  50
            ++ + LHGH + +T +K+NR+GDLLFSS+KD   +   W    G+  GS+          
Sbjct  70   LEGVALHGHMKGVTMLKFNRDGDLLFSSAKDTNCSACCWQVKTGKLFGSYTTVGQVEGRT  129

Query  51   HNGSVWCIDINWDTTRFLSGSGDNSLRVWDCQTGKEIGLLHTN-SSVRTCSFSYSANLAV  109
            ++ ++  +D+N ++T   + S    + +W  ++G  +G +  + SS  +  FS+   L +
Sbjct  130  YDAAMVALDVNRESTLLATASAGEEVLLWSVESGALLGSVSRSLSSGASVGFSHDDTLMM  189

Query  110  YSTDKALGHQCEMFIIDIKNVDAVLSQA-DAISRIAV---------NGPKITAILWGALD  159
             +T    G       I + NV   + +A + I+ +               IT   WG  +
Sbjct  190  VATK---GRSSTNSAIQVYNVPFTVPKAGEDIAPVKTPFTTFSTFETPDTITWAAWGPTN  246

Query  160  ETIITGHEDGEITLWDVRTRKKMTSVRSHKSQ---INDMQFNKDGTMFVTASKDNTAKLF  216
            ETI    E G + + DV   K + S + H+ +   IN   ++ +     TAS D T+ L 
Sbjct  247  ETIYYS-EGGYMNILDVEANKVIRSRQIHEDENEVINRFSWDPNYLALATASTDKTSHLI  305

Query  217  DSESLMLLKTYKTERPVNSATISPIFDHVVLGGGQDAMDVTTTSTRQGKFDSRFFHLVFE  276
            D   L  ++ Y+++ PVN  +ISP  DHV+LGGG DA  VTT    Q  F+ +FFH V  
Sbjct  306  DFRDLATIQVYRSDVPVNDVSISPNADHVILGGGMDAASVTTQG-GQSIFEVKFFHKVHG  364

Query  277  EEFARLKGHFGPINSLAFHPNGRSFSTGGEDGYVRINTFDQSY  319
             +  +L+ HFG IN+++FHP+GR F++   DG +++  F  SY
Sbjct  365  HQLGQLRCHFGTINAMSFHPDGRGFASASYDGLIKMYRFGDSY  407



Lambda      K        H
   0.319    0.134    0.407 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3252957642


Query= XP_050469461.1 polycomb protein Sfmbt-like isoform X4 [Bombus
huntii]

Length=951
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SMBT_DROME  unnamed protein product                                   615     0.0  
LIN61_CAEEL  unnamed protein product                                  172     9e-45
Q9VB52_DROME  unnamed protein product                                 135     7e-32


>SMBT_DROME unnamed protein product
Length=1220

 Score = 615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/511 (59%), Positives = 368/511 (72%), Gaps = 19/511 (4%)

Query  265   PVMPEDLPVRRKRTAEMAGSYDWTPQLTEPGFCAAPVSCFKHAPISEIWDNITVGMKVEV  324
             P M + + +RR R  +   SYDW P+L++  F AAPV+CF HAP  E+WDN+ VGMKVEV
Sbjct  517   PQMEKIISIRR-RMYDPTHSYDWLPRLSKENFNAAPVTCFPHAPGCEVWDNLGVGMKVEV  575

Query  325   ENTDCD--EVCE--AFPDSFWVATVLRISGYRALLRYEGFGLNDDKDFWVSLCSNDIHPV  380
             ENTDCD  EV +    P SFWVAT+L I GY+AL+ YEGF   D  DFWV+LC+ ++H V
Sbjct  576   ENTDCDSIEVIQPGQTPTSFWVATILEIKGYKALMSYEGFD-TDSHDFWVNLCNAEVHSV  634

Query  381   GWCATIGKPLIPPNTIADKYKDWKDFLMKRLTGARTLPTNFYNKVNDSMKSRFRCGFHLE  440
             GWCAT GKPLIPP TI  KYKDWKDFL+ RL+GARTLP+NFYNK+NDS++SRFR G +LE
Sbjct  635   GWCATRGKPLIPPRTIEHKYKDWKDFLVGRLSGARTLPSNFYNKINDSLQSRFRLGLNLE  694

Query  441   VVDKNRISQVKVATIQKIVGKRLHVRYYDSPPEDNGFWCHEDSPLIHPVGWAKRVGQTLD  500
              VDK+RISQV++AT+ KIVGKRL +RY+DS   D+GFWCHEDSP+IHPVGWA  VG  L 
Sbjct  695   CVDKDRISQVRLATVTKIVGKRLFLRYFDS---DDGFWCHEDSPIIHPVGWATTVGHNLA  751

Query  501   AYPEYLERVSKSK-----LCEDDATEDLFYV--PKNHHVHLGYT--FREGMKIEAIDPLN  551
             A  +YLER+   +     + EDDAT +LF +    + +   G T  F EGMK+EA+DPLN
Sbjct  752   APQDYLERMLAGREAMIEVHEDDATIELFKMNFTFDEYYSDGKTNSFVEGMKLEAVDPLN  811

Query  552   LSAICAATIMQVLKEDYIMIRIDSYDEDASGADWFCYHSCSPCIFPIGFCSQHGLPLTPP  611
             LS+IC AT+M VLK  Y+MIRIDSY  DASG+DWFCYH  SPCIFP GFCS + + +TPP
Sbjct  812   LSSICPATVMAVLKFGYMMIRIDSYQPDASGSDWFCYHEKSPCIFPAGFCSVNNISVTPP  871

Query  612   KGYDPTTFTWDTYLTETNTIPAPVQLFNREIPQHGFIEGMRLEAADLMDPRLVCVATITR  671
              GYD  TFTW+ YL +T  + A   LF+R IP HGF  GM LE ADLMDPRLVCVAT+ R
Sbjct  872   NGYDSRTFTWEGYLRDTGAVAAGQHLFHRIIPDHGFEVGMSLECADLMDPRLVCVATVAR  931

Query  672   VIGRLLRVHFDGWEDEYDQWLDCQSPDIYPVGWCDLVDHKLEG-PRVLNKNTSPTVKSPR  730
             V+GRLL+VHFDGW DEYDQWLDC+S DIYPVGWC LV+HKLEG PRV ++        P+
Sbjct  932   VVGRLLKVHFDGWTDEYDQWLDCESADIYPVGWCVLVNHKLEGPPRVAHQQAPKPAPKPK  991

Query  731   GLKRKAKRKVKKSNKVSCAKNILPRHSERIS  761
               +++  +K     K     N     S  I+
Sbjct  992   IQRKRKPKKGAAGGKTPTDNNTQSVKSRTIA  1022


 Score = 111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/150 (39%), Positives = 81/150 (54%), Gaps = 12/150 (8%)

Query  55   ENIRNHQIAPTTMVRYLPPQFPNECSEPDEAVEAVDSQEIQQEYDSQSERQEMTEYLTLE  114
            + + +H++  TT+V  +     N       + E   S+++Q+ Y +           T  
Sbjct  221  DGLLHHKLLGTTLVPAMGTLNGNAFGNIMVSTENTSSKQMQRTYSTAKGANSTATTATCS  280

Query  115  DYIGDEEREQVVNNAATQTTQDNRNRKIKPIKHPGLVLKTPIAYQPHTDLNFIPIRKDGI  174
                   R Q             + RKI+P+  PGLVLKTPIAY+ + D + IPI+KDG+
Sbjct  281  ASTSSALRSQ------------RKTRKIEPVNRPGLVLKTPIAYRGNIDPSVIPIQKDGM  328

Query  175  AVCEKCGAIGVKHAFYTKERRFCSRACARS  204
            AVC++CGAIGVKH FYTK RRFCS ACAR 
Sbjct  329  AVCKRCGAIGVKHTFYTKSRRFCSMACARG  358


>LIN61_CAEEL unnamed protein product
Length=612

 Score = 172 bits (435),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 143/506 (28%), Positives = 242/506 (48%), Gaps = 63/506 (12%)

Query  264  EPVMPEDLPVRR---KRTAEMAGSYDWTP---QLTEPGFCAAPVSCFKHAPISEIWDNIT  317
            E  M E L + R   K   ++  +Y W     Q  +      PV  F         + + 
Sbjct  119  EYTMSEFLKIVRANKKSDRKLDKTYLWESYLHQFEKGKTSFIPVEAFNRNLTVNFNECVK  178

Query  318  VGMKVEVENTDCDEVCEAFPDSFWVATVLRISGYRALLRYEGFGLNDDKDFWVSLCSNDI  377
             G+  E    D D+ C++     W A + ++ GYR L ++ G     D  FW+++ S+D+
Sbjct  179  EGVIFETVVHDYDKNCDSIQVR-WFARIEKVCGYRVLAQFIG----ADTKFWLNILSDDM  233

Query  378  HPVGWCATIGKPLI------PPNTIADKYK-DWKDFLMKRLTGARTLPTNFYNKVNDSM-  429
              +   A +  P +      PP  I ++Y+ D  +++   + G     T+   K ++   
Sbjct  234  FGLA-NAAMSDPNMDKIVYAPPLAINEEYQNDMVNYVNNCIDGEIVGQTSLSPKFDEGKA  292

Query  430  ---KSRFRCGFHLEVVDKNRISQVKVATIQKIVGKRLHVR-----YYDSPPEDNG-----  476
               K RF+ G  LE+++ +  ++++VA IQ+I G+R++V      + +S P+ +      
Sbjct  293  LLSKHRFKVGQRLELLNYSNSTEIRVARIQEICGRRMNVSITKKDFPESLPDADDDRQVF  352

Query  477  -----FWCHEDSPLIHPVGWAKRVGQTLDAYPEYLERVSKS----------KLCEDDATE  521
                 +W  E S  I PVG+A   G  L+A  EY+E  +K           +   DD T 
Sbjct  353  SSGSQYWIDEGSFFIFPVGFAAVNGYQLNAKKEYIEHTNKIAQAIKNGENPRYDSDDVTF  412

Query  522  D-LFYVPKNHHVHLGYTFREGMKIEAIDPL--NLSAICAATIMQVLK-EDYIMIRIDSYD  577
            D L   P +  +      + G K E IDPL    + +  A+I++  K E Y+++ +D  D
Sbjct  413  DQLAKDPIDPMIWR--KVKVGQKFELIDPLAQQFNNLHVASILKFCKTEGYLIVGMDGPD  470

Query  578  EDASGADWFCYHSCSPCIFPIGFCSQHGLPLTPPKGYDPTTFTWDTYLTETNTIPAPVQL  637
               +  D F  H  +  +FP+G+  ++ L L PP  +   TF WD YL + +    P+ L
Sbjct  471  ---ALEDSFPIHINNTFMFPVGYAEKYNLELVPPDEF-KGTFRWDEYLEKESAETLPLDL  526

Query  638  FNREIPQH----GFIEGMRLEAADLMDPRLVCVATITRVIGRLLRVHFDGWEDEYDQWLD  693
            F + +P       F  G+RLEAAD+ + + +C AT+  V GRL+ V+FDGW++E+D+  D
Sbjct  527  F-KPMPSQERLDKFKVGLRLEAADMCENQFICPATVKSVHGRLINVNFDGWDEEFDELYD  585

Query  694  CQSPDIYPVGWCDLVDHKLEGPRVLN  719
              S DI P+GWC+   + L+ P+  N
Sbjct  586  VDSHDILPIGWCEAHSYVLQPPKKYN  611


>Q9VB52_DROME unnamed protein product
Length=1477

 Score = 135 bits (339),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 94/293 (32%), Positives = 135/293 (46%), Gaps = 22/293 (8%)

Query  433   FRCGFHLEVVDKNRISQVKVATIQKIVGKRLHVRYYDSPPEDNGFWCHEDSPLIHPVGWA  492
             F  G  LE +D    S   V +I ++ G RL + + D       FW + DS  I P GW 
Sbjct  850   FEIGMKLEAIDPENCSLFCVCSIVEVRGYRLKLSF-DGYSSMYDFWVNADSQDIFPPGWC  908

Query  493   KRVGQTLDAYPEY-LERVSKS----KLCEDDATEDLF-YVPKNHHVHLGYTFREGMKIEA  546
                 + L A  +Y  ER S S    K     A   LF ++     + +   F  GM +EA
Sbjct  909   DETARVLQAPKDYNSERFSWSRYLVKTGGKAAPRALFGHLNMQQQMDVRNGFAVGMHLEA  968

Query  547   IDPLNLSAICAATIMQVLKEDYIMIRIDSYDEDASGADWFCY----HSCSPCIFPIGFCS  602
              D  +   IC AT+  +L E  I +  D +D+        CY    H  SP I P G+  
Sbjct  969   EDLNDTGKICVATVTDILDE-RIRVHFDGWDD--------CYDLWVHITSPYIHPCGWHE  1019

Query  603   QHGLPLTPPKGYDPTTFTWDTYLTETNTIPAPVQLFNREIPQHGFIEGMRLEAADLMDPR  662
                  + PP  Y  + F WD Y++E   + A  +LF    P   + E M+LE  D  +P 
Sbjct  1020  GRQQLIVPP-DYQKSAFIWDDYISEVGGMAASKELFTPRQPME-YQERMKLEVVDQRNPC  1077

Query  663   LVCVATITRVIGRLLRVHFDGWEDEYDQWLDCQSPDIYPVGWCDLVDHKLEGP  715
             L+  AT+    G  +++H D W  EY  WL+  SPD++P+GWC+   H+LE P
Sbjct  1078  LIRPATVVTRKGYRVQLHLDCWPTEYYFWLEDDSPDLHPIGWCEATSHELETP  1130


 Score = 119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 116/455 (25%), Positives = 194/455 (43%), Gaps = 62/455 (14%)

Query  174   IAVCEKCGAIGVKHAFYTKERRFCSRACARSSEHTAPTADSTYSPSHSVEAHASVNSTSP  233
             + +C++C   G    F      FCS  C R S+                     +  ++ 
Sbjct  727   LYLCQRCNFHGPAADFLAPH--FCSVGCVRRSQKR------------------RLPQSTQ  766

Query  234   NESKLTKNVIVQEET---DIKESFELEKEKVISEPVMPEDLPVRRKRTAEMAGSYDWTPQ  290
              ESK+++  + Q      D+ +  +   +   S   + E L  R+K        + W+  
Sbjct  767   KESKISRTQLEQTAGTAPDLPQKRQTNYKPHKSLSAIQEQLQQRQKDKPRKP--FRWSEY  824

Query  291   LTEPGF-CAAPVSCFKHA-PISEIWDNITVGMKVE-VENTDCDEVCEAFPDSFWVATVLR  347
             L   G   AAP+  F +  PIS   +   +GMK+E ++  +C   C        V +++ 
Sbjct  825   LKSKGKDVAAPIHLFLNPFPISP--NCFEIGMKLEAIDPENCSLFC--------VCSIVE  874

Query  348   ISGYRALLRYEGFGLNDDKDFWVSLCSNDIHPVGWCATIGKPLIPPNTIADKYKDWKDFL  407
             + GYR  L ++G+  +   DFWV+  S DI P GWC    + L  P     +   W  +L
Sbjct  875   VRGYRLKLSFDGY--SSMYDFWVNADSQDIFPPGWCDETARVLQAPKDYNSERFSWSRYL  932

Query  408   MKRLTGARTLPTNFYNKVNDS----MKSRFRCGFHLEVVDKNRISQVKVATIQKIVGKRL  463
             +K  TG +  P   +  +N      +++ F  G HLE  D N   ++ VAT+  I+ +R+
Sbjct  933   VK--TGGKAAPRALFGHLNMQQQMDVRNGFAVGMHLEAEDLNDTGKICVATVTDILDERI  990

Query  464   HVRYYDSPPEDNGFWCHEDSPLIHPVGWAKRVGQTLDAYPEYLERVSKSKLCEDDATEDL  523
              V ++D   +    W H  SP IHP GW +   Q L   P+Y     KS    DD   ++
Sbjct  991   RV-HFDGWDDCYDLWVHITSPYIHPCGWHEG-RQQLIVPPDY----QKSAFIWDDYISEV  1044

Query  524   FYVPKNHHVHL---GYTFREGMKIEAIDPLNLSAICAATIMQVLKEDY-IMIRIDSYDED  579
               +  +  +        ++E MK+E +D  N   I  AT+  V ++ Y + + +D +  +
Sbjct  1045  GGMAASKELFTPRQPMEYQERMKLEVVDQRNPCLIRPATV--VTRKGYRVQLHLDCWPTE  1102

Query  580   ASGADWFCYHSCSPCIFPIGFCSQHGLPLTPPKGY  614
                  +F     SP + PIG+C      L  P GY
Sbjct  1103  Y----YFWLEDDSPDLHPIGWCEATSHELETPPGY  1133



Lambda      K        H
   0.319    0.134    0.407 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3252957642


Query= XP_050469462.1 protein PALS2 isoform X1 [Bombus huntii]

Length=605
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VIJ4_DROME  unnamed protein product                                 653     0.0  
Q8SXI6_DROME  unnamed protein product                                 648     0.0  
Q7KT16_DROME  unnamed protein product                                 647     0.0  


>Q9VIJ4_DROME unnamed protein product
Length=615

 Score = 653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/601 (55%), Positives = 422/601 (70%), Gaps = 46/601 (8%)

Query  33   STSAAFMHVRDNLEELGKVADDTDLLFLKGLLDSPVVTSLVKVQERLEDP-------PLH  85
            S +AAF +  D          D D +FLKGLL S   T   ++     +P       P H
Sbjct  33   SDNAAFRNSTD--------LSDHDEIFLKGLLRSNSNTPHKELMLNPTEPQPVPLFLPAH  84

Query  86   V--EPVCSSICDIVDEVCHALRSSRDENARELVRLLRGSHLKALLETHD---AVVERKEA  140
            +  +P+C       D++      SR   +REL +LL   H +ALL  HD   A+ E++  
Sbjct  85   LNNKPIC-------DDIIRKFSPSRRLESRELAKLLAQPHFRALLRAHDEIGALYEQRLK  137

Query  141  PSKPEPSQLTMPTNERT----------------EAVRMVGLRRQPNEPLGLTVQVDESGN  184
             +    SQL + +  +T                E ++MVGLRR P++PLGLTV++DE   
Sbjct  138  AAGGSTSQLEIASQRQTGGYLFTEDVLNTKMPVETIKMVGLRRDPSKPLGLTVELDEFKQ  197

Query  185  LIIARILGGSTAARQGLLRTGEVILEVNGKEVHNPEELQEAIHEAKENLSLKLAPGIASD  244
            L++ARIL G    +Q +L  G+VILEVNG  V  P+ELQ  +  AKENL+LK+ P +  +
Sbjct  198  LVVARILAGGVIDKQSMLHVGDVILEVNGTPVRTPDELQVEVSRAKENLTLKIGPNVDEE  257

Query  245  GNRPVKSTCYMRALFDYDPSEDTLLPCVEIGLPFQKGDVLQIVDQADPNWWQARRVEGEG  304
              +  + TCYMRALF Y+PSED+LLPC +IGLPF+ GD+LQI++  DPNWWQA+ +  E 
Sbjct  258  I-KSGRYTCYMRALFTYNPSEDSLLPCRDIGLPFKSGDILQIINVKDPNWWQAKNITAES  316

Query  305  LGPPGLIPSLELEERRKAFVPPEADFVHKISICGTKISKKKKRKMYQSKSNGEFDSAELL  364
                GLIPS ELEERRKAFV PEAD+VHKI ICGT+ISK+K++ MY+S +N EFD AELL
Sbjct  317  -DKIGLIPSQELEERRKAFVAPEADYVHKIGICGTRISKRKRKTMYRSVANCEFDKAELL  375

Query  365  LYEEVARMPPFRRKTLALVGPRGVGRRTLKNRLINSDPEKFGTIVPYTSRPPRVLEEDGK  424
            LYEEV RMPPFRRKTL L+G  GVGRRTLKNRLINSD +KFG ++P+TSRP R LEE+G 
Sbjct  376  LYEEVTRMPPFRRKTLVLIGVSGVGRRTLKNRLINSDVDKFGAVIPHTSRPKRALEENGS  435

Query  425  SYWFTDRDCMETDIREHRYLEYGEHGGHLYGTKLDSVRELIRAGKMCVLDCSPAALKILH  484
            SYWF DR+ ME  +R + +LEYGEH G+LYGT L S++++I +G+MC+LDC+P ALKILH
Sbjct  436  SYWFMDREEMEEAVRNNEFLEYGEHNGNLYGTHLQSIKDVINSGRMCILDCAPNALKILH  495

Query  485  NSTEFMPYVIFIAAPGMEQLKWLYDLARSTGTSSRNLTFDRQSSIRYSSRRARTLESLAS  544
            NS E MP+VIF+AAPGMEQLK +Y   R+TG S+RNL+FDRQSSIR+SSRRARTLESLAS
Sbjct  496  NSQELMPFVIFVAAPGMEQLKTIYADRRATG-SNRNLSFDRQSSIRFSSRRARTLESLAS  554

Query  545  LYEEDDLKATLEESAALQRAYEKYIDLVIVNEDFDNTFRQVIAALDALATEHQWVPVNWI  604
            LYE+DDL AT+EES+ +QR YEKY D+VIVNEDFD TFRQV+  LD ++ E QWVPVNWI
Sbjct  555  LYEDDDLVATVEESSFVQRKYEKYFDMVIVNEDFDETFRQVVETLDQMSHEEQWVPVNWI  614

Query  605  Y  605
            Y
Sbjct  615  Y  615


>Q8SXI6_DROME unnamed protein product
Length=636

 Score = 648 bits (1672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/621 (54%), Positives = 423/621 (68%), Gaps = 65/621 (10%)

Query  33   STSAAFMHVRDNLEELGKVADDTDLLFLKGLLDSPVVTSLVKVQERLEDP-------PLH  85
            S +AAF +  D          D D +FLKGLL S   T   ++     +P       P H
Sbjct  33   SDNAAFRNSTD--------LSDHDEIFLKGLLGSSSNTPHKELMLNPTEPQPVPLFLPAH  84

Query  86   V--EPVCSSICDIVDEVCHALRSSRDENARELVRLLRGSHLKALLETHD---AVVERKEA  140
            +  +P+C       D++      SR   +REL +LL   H +ALL  HD   A+ E++  
Sbjct  85   LNNKPIC-------DDIIRKFSPSRRLESRELAKLLAQPHFRALLRAHDEIGALYEQRLK  137

Query  141  PSKPEPSQLTMPTNERT----------------EAVRMVGLRRQPNEPLGLTVQVDESGN  184
             +    SQL + +  +T                E ++MVGLRR P++PLGLTV++DE   
Sbjct  138  AAGGSTSQLEIASQRQTGGYLFTEDVLNTKMPVETIKMVGLRRDPSKPLGLTVELDEFKQ  197

Query  185  LIIARILGGSTAARQGLLRTGEVILEVNGKEVHNPEELQEAIHEAKENLSLKLAPGIASD  244
            L++ARIL G    +Q +L  G+VILEVNG  V  P+ELQ  +  AKENL+LK+ P +  +
Sbjct  198  LVVARILAGGVIDKQSMLHVGDVILEVNGTPVRTPDELQVEVSRAKENLTLKIGPNVDEE  257

Query  245  ---GNRPV-----------------KSTCYMRALFDYDPSEDTLLPCVEIGLPFQKGDVL  284
               G   V                 K TCYMRALF Y+PSED+LLPC +IGLPF+ GD+L
Sbjct  258  IKSGRYTVSGGQVKQNGIASLETGKKLTCYMRALFTYNPSEDSLLPCRDIGLPFKSGDIL  317

Query  285  QIVDQADPNWWQARRVEGEGLGPPGLIPSLELEERRKAFVPPEADFVHKISICGTKISKK  344
            QI++  DPNWWQA+ +  E     GLIPS ELEERRKAFV PEAD+VHKI ICGT+ISK+
Sbjct  318  QIINVKDPNWWQAKNITAES-DKIGLIPSQELEERRKAFVAPEADYVHKIGICGTRISKR  376

Query  345  KKRKMYQSKSNGEFDSAELLLYEEVARMPPFRRKTLALVGPRGVGRRTLKNRLINSDPEK  404
            K++ MY+S +N EFD AELLLYEEV RMPPFRRKTL L+G  GVGRRTLKNRLINSD +K
Sbjct  377  KRKTMYRSVANCEFDKAELLLYEEVTRMPPFRRKTLVLIGVSGVGRRTLKNRLINSDVDK  436

Query  405  FGTIVPYTSRPPRVLEEDGKSYWFTDRDCMETDIREHRYLEYGEHGGHLYGTKLDSVREL  464
            FG ++P+TSRP R LEE+G SYWF DR+ ME  +R + +LEYGEH G+LYGT L S++++
Sbjct  437  FGAVIPHTSRPKRALEENGSSYWFMDREEMEEAVRNNEFLEYGEHNGNLYGTHLQSIKDV  496

Query  465  IRAGKMCVLDCSPAALKILHNSTEFMPYVIFIAAPGMEQLKWLYDLARSTGTSSRNLTFD  524
            I +G+MC+LDC+P ALKILHNS E MP+VIF+AAPGMEQLK +Y   R+TG S+RNL+FD
Sbjct  497  INSGRMCILDCAPNALKILHNSQELMPFVIFVAAPGMEQLKTIYADRRATG-SNRNLSFD  555

Query  525  RQSSIRYSSRRARTLESLASLYEEDDLKATLEESAALQRAYEKYIDLVIVNEDFDNTFRQ  584
            RQSSIR+SSRRARTLESLASLYE+DDL AT+EES+ +QR YEKY D+VIVNEDFD TFRQ
Sbjct  556  RQSSIRFSSRRARTLESLASLYEDDDLVATVEESSFVQRKYEKYFDMVIVNEDFDETFRQ  615

Query  585  VIAALDALATEHQWVPVNWIY  605
            V+  LD ++ E QWVPVNWIY
Sbjct  616  VVETLDQMSHEEQWVPVNWIY  636


>Q7KT16_DROME unnamed protein product
Length=636

 Score = 647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/621 (54%), Positives = 423/621 (68%), Gaps = 65/621 (10%)

Query  33   STSAAFMHVRDNLEELGKVADDTDLLFLKGLLDSPVVTSLVKVQERLEDP-------PLH  85
            S +AAF +  D          D D +FLKGLL S   T   ++     +P       P H
Sbjct  33   SDNAAFRNSTD--------LSDHDEIFLKGLLRSNSNTPHKELMLNPTEPQPVPLFLPAH  84

Query  86   V--EPVCSSICDIVDEVCHALRSSRDENARELVRLLRGSHLKALLETHD---AVVERKEA  140
            +  +P+C       D++      SR   +REL +LL   H +ALL  HD   A+ E++  
Sbjct  85   LNNKPIC-------DDIIRKFSPSRRLESRELAKLLAQPHFRALLRAHDEIGALYEQRLK  137

Query  141  PSKPEPSQLTMPTNERT----------------EAVRMVGLRRQPNEPLGLTVQVDESGN  184
             +    SQL + +  +T                E ++MVGLRR P++PLGLTV++DE   
Sbjct  138  AAGGSTSQLEIASQRQTGGYLFTEDVLNTKMPVETIKMVGLRRDPSKPLGLTVELDEFKQ  197

Query  185  LIIARILGGSTAARQGLLRTGEVILEVNGKEVHNPEELQEAIHEAKENLSLKLAPGIASD  244
            L++ARIL G    +Q +L  G+VILEVNG  V  P+ELQ  +  AKENL+LK+ P +  +
Sbjct  198  LVVARILAGGVIDKQSMLHVGDVILEVNGTPVRTPDELQVEVSRAKENLTLKIGPNVDEE  257

Query  245  ---GNRPV-----------------KSTCYMRALFDYDPSEDTLLPCVEIGLPFQKGDVL  284
               G   V                 K TCYMRALF Y+PSED+LLPC +IGLPF+ GD+L
Sbjct  258  IKSGRYTVSGGQVKQNGIASLETGKKLTCYMRALFTYNPSEDSLLPCRDIGLPFKSGDIL  317

Query  285  QIVDQADPNWWQARRVEGEGLGPPGLIPSLELEERRKAFVPPEADFVHKISICGTKISKK  344
            QI++  DPNWWQA+ +  E     GLIPS ELEERRKAFV PEAD+VHKI ICGT+ISK+
Sbjct  318  QIINVKDPNWWQAKNITAES-DKIGLIPSQELEERRKAFVAPEADYVHKIGICGTRISKR  376

Query  345  KKRKMYQSKSNGEFDSAELLLYEEVARMPPFRRKTLALVGPRGVGRRTLKNRLINSDPEK  404
            K++ MY+S +N EFD AELLLYEEV RMPPFRRKTL L+G  GVGRRTLKNRLINSD +K
Sbjct  377  KRKTMYRSVANCEFDKAELLLYEEVTRMPPFRRKTLVLIGVSGVGRRTLKNRLINSDVDK  436

Query  405  FGTIVPYTSRPPRVLEEDGKSYWFTDRDCMETDIREHRYLEYGEHGGHLYGTKLDSVREL  464
            FG ++P+TSRP R LEE+G SYWF DR+ ME  +R + +LEYGEH G+LYGT L S++++
Sbjct  437  FGAVIPHTSRPKRALEENGSSYWFMDREEMEEAVRNNEFLEYGEHNGNLYGTHLQSIKDV  496

Query  465  IRAGKMCVLDCSPAALKILHNSTEFMPYVIFIAAPGMEQLKWLYDLARSTGTSSRNLTFD  524
            I +G+MC+LDC+P ALKILHNS E MP+VIF+AAPGMEQLK +Y   R+TG S+RNL+FD
Sbjct  497  INSGRMCILDCAPNALKILHNSQELMPFVIFVAAPGMEQLKTIYADRRATG-SNRNLSFD  555

Query  525  RQSSIRYSSRRARTLESLASLYEEDDLKATLEESAALQRAYEKYIDLVIVNEDFDNTFRQ  584
            RQSSIR+SSRRARTLESLASLYE+DDL AT+EES+ +QR YEKY D+VIVNEDFD TFRQ
Sbjct  556  RQSSIRFSSRRARTLESLASLYEDDDLVATVEESSFVQRKYEKYFDMVIVNEDFDETFRQ  615

Query  585  VIAALDALATEHQWVPVNWIY  605
            V+  LD ++ E QWVPVNWIY
Sbjct  616  VVETLDQMSHEEQWVPVNWIY  636



Lambda      K        H
   0.319    0.134    0.407 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3252957642


Query= XP_050469463.1 protein PALS2 isoform X2 [Bombus huntii]

Length=602
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VIJ4_DROME  unnamed protein product                                 659     0.0  
Q8SXI6_DROME  unnamed protein product                                 654     0.0  
Q7KT16_DROME  unnamed protein product                                 653     0.0  


>Q9VIJ4_DROME unnamed protein product
Length=615

 Score = 659 bits (1701),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/626 (54%), Positives = 435/626 (69%), Gaps = 50/626 (8%)

Query  5    GRKEKIEDRRLLASIDAVNGTKLYQIENAAFMHVRDNLEELGKVADDTDLLFLKGLLDSP  64
             R++K+E   LLA  + VNG      +NAAF +  D          D D +FLKGLL S 
Sbjct  12   ARQDKVE---LLARNNKVNGEDDTS-DNAAFRNSTD--------LSDHDEIFLKGLLRSN  59

Query  65   VVTSLVKVQERLEDP-------PLHV--EPVCSSICDIVDEVCHALRSSRDENARELVRL  115
              T   ++     +P       P H+  +P+C       D++      SR   +REL +L
Sbjct  60   SNTPHKELMLNPTEPQPVPLFLPAHLNNKPIC-------DDIIRKFSPSRRLESRELAKL  112

Query  116  LRGSHLKALLETHD---AVVERKEAPSKPEPSQLTMPTNERT----------------EA  156
            L   H +ALL  HD   A+ E++   +    SQL + +  +T                E 
Sbjct  113  LAQPHFRALLRAHDEIGALYEQRLKAAGGSTSQLEIASQRQTGGYLFTEDVLNTKMPVET  172

Query  157  VRMVGLRRQPNEPLGLTVQVDESGNLIIARILGGSTAARQGLLRTGEVILEVNGKEVHNP  216
            ++MVGLRR P++PLGLTV++DE   L++ARIL G    +Q +L  G+VILEVNG  V  P
Sbjct  173  IKMVGLRRDPSKPLGLTVELDEFKQLVVARILAGGVIDKQSMLHVGDVILEVNGTPVRTP  232

Query  217  EELQEAIHEAKENLSLKLAPGIASDGNRPVKSTCYMRALFDYDPSEDTLLPCVEIGLPFQ  276
            +ELQ  +  AKENL+LK+ P +  +  +  + TCYMRALF Y+PSED+LLPC +IGLPF+
Sbjct  233  DELQVEVSRAKENLTLKIGPNVDEEI-KSGRYTCYMRALFTYNPSEDSLLPCRDIGLPFK  291

Query  277  KGDVLQIVDQADPNWWQARRVEGEGLGPPGLIPSLELEERRKAFVPPEADFVHKISICGT  336
             GD+LQI++  DPNWWQA+ +  E     GLIPS ELEERRKAFV PEAD+VHKI ICGT
Sbjct  292  SGDILQIINVKDPNWWQAKNITAES-DKIGLIPSQELEERRKAFVAPEADYVHKIGICGT  350

Query  337  KISKKKKRKMYQSKSNGEFDSAELLLYEEVARMPPFRRKTLALVGPRGVGRRTLKNRLIN  396
            +ISK+K++ MY+S +N EFD AELLLYEEV RMPPFRRKTL L+G  GVGRRTLKNRLIN
Sbjct  351  RISKRKRKTMYRSVANCEFDKAELLLYEEVTRMPPFRRKTLVLIGVSGVGRRTLKNRLIN  410

Query  397  SDPEKFGTIVPYTSRPPRVLEEDGKSYWFTDRDCMETDIREHRYLEYGEHGGHLYGTKLD  456
            SD +KFG ++P+TSRP R LEE+G SYWF DR+ ME  +R + +LEYGEH G+LYGT L 
Sbjct  411  SDVDKFGAVIPHTSRPKRALEENGSSYWFMDREEMEEAVRNNEFLEYGEHNGNLYGTHLQ  470

Query  457  SVRELIRAGKMCVLDCSPAALKILHNSTEFMPYVIFIAAPGMEQLKWLYDLARSTGTSSR  516
            S++++I +G+MC+LDC+P ALKILHNS E MP+VIF+AAPGMEQLK +Y   R+TG S+R
Sbjct  471  SIKDVINSGRMCILDCAPNALKILHNSQELMPFVIFVAAPGMEQLKTIYADRRATG-SNR  529

Query  517  NLTFDRQSSIRYSSRRARTLESLASLYEEDDLKATLEESAALQRAYEKYIDLVIVNEDFD  576
            NL+FDRQSSIR+SSRRARTLESLASLYE+DDL AT+EES+ +QR YEKY D+VIVNEDFD
Sbjct  530  NLSFDRQSSIRFSSRRARTLESLASLYEDDDLVATVEESSFVQRKYEKYFDMVIVNEDFD  589

Query  577  NTFRQVIAALDALATEHQWVPVNWIY  602
             TFRQV+  LD ++ E QWVPVNWIY
Sbjct  590  ETFRQVVETLDQMSHEEQWVPVNWIY  615


>Q8SXI6_DROME unnamed protein product
Length=636

 Score = 654 bits (1686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/646 (53%), Positives = 436/646 (67%), Gaps = 69/646 (11%)

Query  5    GRKEKIEDRRLLASIDAVNGTKLYQIENAAFMHVRDNLEELGKVADDTDLLFLKGLLDSP  64
             R++K+E   LLA  + VNG      +NAAF +  D          D D +FLKGLL S 
Sbjct  12   ARQDKVE---LLARNNKVNGEDDTS-DNAAFRNSTD--------LSDHDEIFLKGLLGSS  59

Query  65   VVTSLVKVQERLEDP-------PLHV--EPVCSSICDIVDEVCHALRSSRDENARELVRL  115
              T   ++     +P       P H+  +P+C       D++      SR   +REL +L
Sbjct  60   SNTPHKELMLNPTEPQPVPLFLPAHLNNKPIC-------DDIIRKFSPSRRLESRELAKL  112

Query  116  LRGSHLKALLETHD---AVVERKEAPSKPEPSQLTMPTNERT----------------EA  156
            L   H +ALL  HD   A+ E++   +    SQL + +  +T                E 
Sbjct  113  LAQPHFRALLRAHDEIGALYEQRLKAAGGSTSQLEIASQRQTGGYLFTEDVLNTKMPVET  172

Query  157  VRMVGLRRQPNEPLGLTVQVDESGNLIIARILGGSTAARQGLLRTGEVILEVNGKEVHNP  216
            ++MVGLRR P++PLGLTV++DE   L++ARIL G    +Q +L  G+VILEVNG  V  P
Sbjct  173  IKMVGLRRDPSKPLGLTVELDEFKQLVVARILAGGVIDKQSMLHVGDVILEVNGTPVRTP  232

Query  217  EELQEAIHEAKENLSLKLAPGIASD---GNRPV-----------------KSTCYMRALF  256
            +ELQ  +  AKENL+LK+ P +  +   G   V                 K TCYMRALF
Sbjct  233  DELQVEVSRAKENLTLKIGPNVDEEIKSGRYTVSGGQVKQNGIASLETGKKLTCYMRALF  292

Query  257  DYDPSEDTLLPCVEIGLPFQKGDVLQIVDQADPNWWQARRVEGEGLGPPGLIPSLELEER  316
             Y+PSED+LLPC +IGLPF+ GD+LQI++  DPNWWQA+ +  E     GLIPS ELEER
Sbjct  293  TYNPSEDSLLPCRDIGLPFKSGDILQIINVKDPNWWQAKNITAES-DKIGLIPSQELEER  351

Query  317  RKAFVPPEADFVHKISICGTKISKKKKRKMYQSKSNGEFDSAELLLYEEVARMPPFRRKT  376
            RKAFV PEAD+VHKI ICGT+ISK+K++ MY+S +N EFD AELLLYEEV RMPPFRRKT
Sbjct  352  RKAFVAPEADYVHKIGICGTRISKRKRKTMYRSVANCEFDKAELLLYEEVTRMPPFRRKT  411

Query  377  LALVGPRGVGRRTLKNRLINSDPEKFGTIVPYTSRPPRVLEEDGKSYWFTDRDCMETDIR  436
            L L+G  GVGRRTLKNRLINSD +KFG ++P+TSRP R LEE+G SYWF DR+ ME  +R
Sbjct  412  LVLIGVSGVGRRTLKNRLINSDVDKFGAVIPHTSRPKRALEENGSSYWFMDREEMEEAVR  471

Query  437  EHRYLEYGEHGGHLYGTKLDSVRELIRAGKMCVLDCSPAALKILHNSTEFMPYVIFIAAP  496
             + +LEYGEH G+LYGT L S++++I +G+MC+LDC+P ALKILHNS E MP+VIF+AAP
Sbjct  472  NNEFLEYGEHNGNLYGTHLQSIKDVINSGRMCILDCAPNALKILHNSQELMPFVIFVAAP  531

Query  497  GMEQLKWLYDLARSTGTSSRNLTFDRQSSIRYSSRRARTLESLASLYEEDDLKATLEESA  556
            GMEQLK +Y   R+TG S+RNL+FDRQSSIR+SSRRARTLESLASLYE+DDL AT+EES+
Sbjct  532  GMEQLKTIYADRRATG-SNRNLSFDRQSSIRFSSRRARTLESLASLYEDDDLVATVEESS  590

Query  557  ALQRAYEKYIDLVIVNEDFDNTFRQVIAALDALATEHQWVPVNWIY  602
             +QR YEKY D+VIVNEDFD TFRQV+  LD ++ E QWVPVNWIY
Sbjct  591  FVQRKYEKYFDMVIVNEDFDETFRQVVETLDQMSHEEQWVPVNWIY  636


>Q7KT16_DROME unnamed protein product
Length=636

 Score = 653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/646 (53%), Positives = 436/646 (67%), Gaps = 69/646 (11%)

Query  5    GRKEKIEDRRLLASIDAVNGTKLYQIENAAFMHVRDNLEELGKVADDTDLLFLKGLLDSP  64
             R++K+E   LLA  + VNG      +NAAF +  D          D D +FLKGLL S 
Sbjct  12   ARQDKVE---LLARNNKVNGEDDTS-DNAAFRNSTD--------LSDHDEIFLKGLLRSN  59

Query  65   VVTSLVKVQERLEDP-------PLHV--EPVCSSICDIVDEVCHALRSSRDENARELVRL  115
              T   ++     +P       P H+  +P+C       D++      SR   +REL +L
Sbjct  60   SNTPHKELMLNPTEPQPVPLFLPAHLNNKPIC-------DDIIRKFSPSRRLESRELAKL  112

Query  116  LRGSHLKALLETHD---AVVERKEAPSKPEPSQLTMPTNERT----------------EA  156
            L   H +ALL  HD   A+ E++   +    SQL + +  +T                E 
Sbjct  113  LAQPHFRALLRAHDEIGALYEQRLKAAGGSTSQLEIASQRQTGGYLFTEDVLNTKMPVET  172

Query  157  VRMVGLRRQPNEPLGLTVQVDESGNLIIARILGGSTAARQGLLRTGEVILEVNGKEVHNP  216
            ++MVGLRR P++PLGLTV++DE   L++ARIL G    +Q +L  G+VILEVNG  V  P
Sbjct  173  IKMVGLRRDPSKPLGLTVELDEFKQLVVARILAGGVIDKQSMLHVGDVILEVNGTPVRTP  232

Query  217  EELQEAIHEAKENLSLKLAPGIASD---GNRPV-----------------KSTCYMRALF  256
            +ELQ  +  AKENL+LK+ P +  +   G   V                 K TCYMRALF
Sbjct  233  DELQVEVSRAKENLTLKIGPNVDEEIKSGRYTVSGGQVKQNGIASLETGKKLTCYMRALF  292

Query  257  DYDPSEDTLLPCVEIGLPFQKGDVLQIVDQADPNWWQARRVEGEGLGPPGLIPSLELEER  316
             Y+PSED+LLPC +IGLPF+ GD+LQI++  DPNWWQA+ +  E     GLIPS ELEER
Sbjct  293  TYNPSEDSLLPCRDIGLPFKSGDILQIINVKDPNWWQAKNITAES-DKIGLIPSQELEER  351

Query  317  RKAFVPPEADFVHKISICGTKISKKKKRKMYQSKSNGEFDSAELLLYEEVARMPPFRRKT  376
            RKAFV PEAD+VHKI ICGT+ISK+K++ MY+S +N EFD AELLLYEEV RMPPFRRKT
Sbjct  352  RKAFVAPEADYVHKIGICGTRISKRKRKTMYRSVANCEFDKAELLLYEEVTRMPPFRRKT  411

Query  377  LALVGPRGVGRRTLKNRLINSDPEKFGTIVPYTSRPPRVLEEDGKSYWFTDRDCMETDIR  436
            L L+G  GVGRRTLKNRLINSD +KFG ++P+TSRP R LEE+G SYWF DR+ ME  +R
Sbjct  412  LVLIGVSGVGRRTLKNRLINSDVDKFGAVIPHTSRPKRALEENGSSYWFMDREEMEEAVR  471

Query  437  EHRYLEYGEHGGHLYGTKLDSVRELIRAGKMCVLDCSPAALKILHNSTEFMPYVIFIAAP  496
             + +LEYGEH G+LYGT L S++++I +G+MC+LDC+P ALKILHNS E MP+VIF+AAP
Sbjct  472  NNEFLEYGEHNGNLYGTHLQSIKDVINSGRMCILDCAPNALKILHNSQELMPFVIFVAAP  531

Query  497  GMEQLKWLYDLARSTGTSSRNLTFDRQSSIRYSSRRARTLESLASLYEEDDLKATLEESA  556
            GMEQLK +Y   R+TG S+RNL+FDRQSSIR+SSRRARTLESLASLYE+DDL AT+EES+
Sbjct  532  GMEQLKTIYADRRATG-SNRNLSFDRQSSIRFSSRRARTLESLASLYEDDDLVATVEESS  590

Query  557  ALQRAYEKYIDLVIVNEDFDNTFRQVIAALDALATEHQWVPVNWIY  602
             +QR YEKY D+VIVNEDFD TFRQV+  LD ++ E QWVPVNWIY
Sbjct  591  FVQRKYEKYFDMVIVNEDFDETFRQVVETLDQMSHEEQWVPVNWIY  636



Lambda      K        H
   0.319    0.134    0.407 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3252957642


Query= XP_050469464.1 protein PALS2 isoform X3 [Bombus huntii]

Length=580
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9PDB2_DROME  unnamed protein product                                 600     0.0  
Q9VIJ4_DROME  unnamed protein product                                 593     0.0  
Q8SXI6_DROME  unnamed protein product                                 588     0.0  


>M9PDB2_DROME unnamed protein product
Length=611

 Score = 600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/596 (52%), Positives = 398/596 (67%), Gaps = 65/596 (11%)

Query  33   STSAAFMHVRDNLEELGKVADDTDLLFLKGLLDSPVVTSLVKVQERLEDP-------PLH  85
            S +AAF +  D          D D +FLKGLL S   T   ++     +P       P H
Sbjct  33   SDNAAFRNSTD--------LSDHDEIFLKGLLRSNSNTPHKELMLNPTEPQPVPLFLPAH  84

Query  86   V--EPVCSSICDIVDEVCHALRSSRDENARELVRLLRGSHLKALLETHD---AVVERKEA  140
            +  +P+C       D++      SR   +REL +LL   H +ALL  HD   A+ E++  
Sbjct  85   LNNKPIC-------DDIIRKFSPSRRLESRELAKLLAQPHFRALLRAHDEIGALYEQRLK  137

Query  141  PSKPEPSQLTMPTNERT----------------EAVRMVGLRRQPNEPLGLTVQVDESGN  184
             +    SQL + +  +T                E ++MVGLRR P++PLGLTV++DE   
Sbjct  138  AAGGSTSQLEIASQRQTGGYLFTEDVLNTKMPVETIKMVGLRRDPSKPLGLTVELDEFKQ  197

Query  185  LIIARILGGSTAARQGLLRTGEVILEVNGKEVHNPEELQEAIHEAKENLSLKLAPGIASD  244
            L++ARIL G    +Q +L  G+VILEVNG  V  P+ELQ  +  AKENL+LK+ P +  +
Sbjct  198  LVVARILAGGVIDKQSMLHVGDVILEVNGTPVRTPDELQVEVSRAKENLTLKIGPNVDEE  257

Query  245  ---GNRPV-----------------KSTCYMRALFDYDPSEDTLLPCVEIGLPFQKGDVL  284
               G   V                 K TCYMRALF Y+PSED+LLPC +IGLPF+ GD+L
Sbjct  258  IKSGRYTVSGGQVKQNGIASLETGKKLTCYMRALFTYNPSEDSLLPCRDIGLPFKSGDIL  317

Query  285  QIVDQADPNWWQARRVEGEGLGPPGLIPSLELEERRKAFVPPEADFVHKISICGTKISKK  344
            QI++  DPNWWQA+ +  E     GLIPS ELEERRKAFV PEAD+VHKI ICGT+ISK+
Sbjct  318  QIINVKDPNWWQAKNITAES-DKIGLIPSQELEERRKAFVAPEADYVHKIGICGTRISKR  376

Query  345  KKRKMYQSKSNGEFDSAELLLYEEVARMPPFRRKTLALVGPRGVGRRTLKNRLINSDPEK  404
            K++ MY+S +N EFD AELLLYEEV RMPPFRRKTL L+G  GVGRRTLKNRLINSD +K
Sbjct  377  KRKTMYRSVANCEFDKAELLLYEEVTRMPPFRRKTLVLIGVSGVGRRTLKNRLINSDVDK  436

Query  405  FGTIVPYTSRPPRVLEEDGKSYWFTDRDCMETDIREHRYLEYGEHGGHLYGTKLDSVREL  464
            FG ++P+TSRP R LEE+G SYWF DR+ ME  +R + +LEYGEH G+LYGT L S++++
Sbjct  437  FGAVIPHTSRPKRALEENGSSYWFMDREEMEEAVRNNEFLEYGEHNGNLYGTHLQSIKDV  496

Query  465  IRAGKMCVLDCSPAALKILHNSTEFMPYVIFIAAPGMEQLKWLYDLARSTGTSSRNLTED  524
            I +G+MC+LDC+P ALKILHNS E MP+VIF+AAPGMEQLK +Y   R+TG S+RNL++D
Sbjct  497  INSGRMCILDCAPNALKILHNSQELMPFVIFVAAPGMEQLKTIYADRRATG-SNRNLSDD  555

Query  525  DLKATLEESAALQRAYEKYIDLVIVNEDFDNTFRQVIAALDALATEHQWVPVNWIY  580
            DL AT+EES+ +QR YEKY D+VIVNEDFD TFRQV+  LD ++ E QWVPVNWIY
Sbjct  556  DLVATVEESSFVQRKYEKYFDMVIVNEDFDETFRQVVETLDQMSHEEQWVPVNWIY  611


>Q9VIJ4_DROME unnamed protein product
Length=615

 Score = 593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/601 (51%), Positives = 397/601 (66%), Gaps = 71/601 (12%)

Query  33   STSAAFMHVRDNLEELGKVADDTDLLFLKGLLDSPVVTSLVKVQERLEDP-------PLH  85
            S +AAF +  D          D D +FLKGLL S   T   ++     +P       P H
Sbjct  33   SDNAAFRNSTD--------LSDHDEIFLKGLLRSNSNTPHKELMLNPTEPQPVPLFLPAH  84

Query  86   V--EPVCSSICDIVDEVCHALRSSRDENARELVRLLRGSHLKALLETHD---AVVERKEA  140
            +  +P+C       D++      SR   +REL +LL   H +ALL  HD   A+ E++  
Sbjct  85   LNNKPIC-------DDIIRKFSPSRRLESRELAKLLAQPHFRALLRAHDEIGALYEQRLK  137

Query  141  PSKPEPSQLTMPTNERT----------------EAVRMVGLRRQPNEPLGLTVQVDESGN  184
             +    SQL + +  +T                E ++MVGLRR P++PLGLTV++DE   
Sbjct  138  AAGGSTSQLEIASQRQTGGYLFTEDVLNTKMPVETIKMVGLRRDPSKPLGLTVELDEFKQ  197

Query  185  LIIARILGGSTAARQGLLRTGEVILEVNGKEVHNPEELQEAIHEAKENLSLKLAPGIASD  244
            L++ARIL G    +Q +L  G+VILEVNG  V  P+ELQ  +  AKENL+LK+ P +  +
Sbjct  198  LVVARILAGGVIDKQSMLHVGDVILEVNGTPVRTPDELQVEVSRAKENLTLKIGPNVDEE  257

Query  245  GNRPVKSTCYMRALFDYDPSEDTLLPCVEIGLPFQKGDVLQIVDQADPNWWQARRVEGEG  304
              +  + TCYMRALF Y+PSED+LLPC +IGLPF+ GD+LQI++  DPNWWQA+ +  E 
Sbjct  258  I-KSGRYTCYMRALFTYNPSEDSLLPCRDIGLPFKSGDILQIINVKDPNWWQAKNITAES  316

Query  305  LGPPGLIPSLELEERRKAFVPPEADFVHKISICGTKISKKKKRKMYQSKSNGEFDSAELL  364
                GLIPS ELEERRKAFV PEAD+VHKI ICGT+ISK+K++ MY+S +N EFD AELL
Sbjct  317  -DKIGLIPSQELEERRKAFVAPEADYVHKIGICGTRISKRKRKTMYRSVANCEFDKAELL  375

Query  365  LYEEVARMPPFRRKTLALVGPRGVGRRTLKNRLINSDPEKFGTIVPYTSRPPRVLEEDGK  424
            LYEEV RMPPFRRKTL L+G  GVGRRTLKNRLINSD +KFG ++P+TSRP R LEE+G 
Sbjct  376  LYEEVTRMPPFRRKTLVLIGVSGVGRRTLKNRLINSDVDKFGAVIPHTSRPKRALEENGS  435

Query  425  SYWFTDRDCMETDIREHRYLEYGEHGGHLYGTKLDSVRELIRAGKMCVLDCSPAALKILH  484
            SYWF DR+ ME  +R + +LEYGEH G+LYGT L S++++I +G+MC+LDC+P ALKILH
Sbjct  436  SYWFMDREEMEEAVRNNEFLEYGEHNGNLYGTHLQSIKDVINSGRMCILDCAPNALKILH  495

Query  485  NSTEFMPYVIFIAAPGMEQLKWLYDLARSTGTSSRNLT----------------------  522
            NS E MP+VIF+AAPGMEQLK +Y   R+TG S+RNL+                      
Sbjct  496  NSQELMPFVIFVAAPGMEQLKTIYADRRATG-SNRNLSFDRQSSIRFSSRRARTLESLAS  554

Query  523  ---EDDLKATLEESAALQRAYEKYIDLVIVNEDFDNTFRQVIAALDALATEHQWVPVNWI  579
               +DDL AT+EES+ +QR YEKY D+VIVNEDFD TFRQV+  LD ++ E QWVPVNWI
Sbjct  555  LYEDDDLVATVEESSFVQRKYEKYFDMVIVNEDFDETFRQVVETLDQMSHEEQWVPVNWI  614

Query  580  Y  580
            Y
Sbjct  615  Y  615


>Q8SXI6_DROME unnamed protein product
Length=636

 Score = 588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/621 (50%), Positives = 398/621 (64%), Gaps = 90/621 (14%)

Query  33   STSAAFMHVRDNLEELGKVADDTDLLFLKGLLDSPVVTSLVKVQERLEDP-------PLH  85
            S +AAF +  D          D D +FLKGLL S   T   ++     +P       P H
Sbjct  33   SDNAAFRNSTD--------LSDHDEIFLKGLLGSSSNTPHKELMLNPTEPQPVPLFLPAH  84

Query  86   V--EPVCSSICDIVDEVCHALRSSRDENARELVRLLRGSHLKALLETHD---AVVERKEA  140
            +  +P+C       D++      SR   +REL +LL   H +ALL  HD   A+ E++  
Sbjct  85   LNNKPIC-------DDIIRKFSPSRRLESRELAKLLAQPHFRALLRAHDEIGALYEQRLK  137

Query  141  PSKPEPSQLTMPTNERT----------------EAVRMVGLRRQPNEPLGLTVQVDESGN  184
             +    SQL + +  +T                E ++MVGLRR P++PLGLTV++DE   
Sbjct  138  AAGGSTSQLEIASQRQTGGYLFTEDVLNTKMPVETIKMVGLRRDPSKPLGLTVELDEFKQ  197

Query  185  LIIARILGGSTAARQGLLRTGEVILEVNGKEVHNPEELQEAIHEAKENLSLKLAPGIASD  244
            L++ARIL G    +Q +L  G+VILEVNG  V  P+ELQ  +  AKENL+LK+ P +  +
Sbjct  198  LVVARILAGGVIDKQSMLHVGDVILEVNGTPVRTPDELQVEVSRAKENLTLKIGPNVDEE  257

Query  245  ---GNRPV-----------------KSTCYMRALFDYDPSEDTLLPCVEIGLPFQKGDVL  284
               G   V                 K TCYMRALF Y+PSED+LLPC +IGLPF+ GD+L
Sbjct  258  IKSGRYTVSGGQVKQNGIASLETGKKLTCYMRALFTYNPSEDSLLPCRDIGLPFKSGDIL  317

Query  285  QIVDQADPNWWQARRVEGEGLGPPGLIPSLELEERRKAFVPPEADFVHKISICGTKISKK  344
            QI++  DPNWWQA+ +  E     GLIPS ELEERRKAFV PEAD+VHKI ICGT+ISK+
Sbjct  318  QIINVKDPNWWQAKNITAES-DKIGLIPSQELEERRKAFVAPEADYVHKIGICGTRISKR  376

Query  345  KKRKMYQSKSNGEFDSAELLLYEEVARMPPFRRKTLALVGPRGVGRRTLKNRLINSDPEK  404
            K++ MY+S +N EFD AELLLYEEV RMPPFRRKTL L+G  GVGRRTLKNRLINSD +K
Sbjct  377  KRKTMYRSVANCEFDKAELLLYEEVTRMPPFRRKTLVLIGVSGVGRRTLKNRLINSDVDK  436

Query  405  FGTIVPYTSRPPRVLEEDGKSYWFTDRDCMETDIREHRYLEYGEHGGHLYGTKLDSVREL  464
            FG ++P+TSRP R LEE+G SYWF DR+ ME  +R + +LEYGEH G+LYGT L S++++
Sbjct  437  FGAVIPHTSRPKRALEENGSSYWFMDREEMEEAVRNNEFLEYGEHNGNLYGTHLQSIKDV  496

Query  465  IRAGKMCVLDCSPAALKILHNSTEFMPYVIFIAAPGMEQLKWLYDLARSTGTSSRNLT--  522
            I +G+MC+LDC+P ALKILHNS E MP+VIF+AAPGMEQLK +Y   R+TG S+RNL+  
Sbjct  497  INSGRMCILDCAPNALKILHNSQELMPFVIFVAAPGMEQLKTIYADRRATG-SNRNLSFD  555

Query  523  -----------------------EDDLKATLEESAALQRAYEKYIDLVIVNEDFDNTFRQ  559
                                   +DDL AT+EES+ +QR YEKY D+VIVNEDFD TFRQ
Sbjct  556  RQSSIRFSSRRARTLESLASLYEDDDLVATVEESSFVQRKYEKYFDMVIVNEDFDETFRQ  615

Query  560  VIAALDALATEHQWVPVNWIY  580
            V+  LD ++ E QWVPVNWIY
Sbjct  616  VVETLDQMSHEEQWVPVNWIY  636



Lambda      K        H
   0.319    0.134    0.407 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3252957642


Query= XP_050469465.1 protein PALS2 isoform X4 [Bombus huntii]

Length=570
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VIJ4_DROME  unnamed protein product                                 646     0.0  
Q8MR96_DROME  unnamed protein product                                 644     0.0  
Q8SXI6_DROME  unnamed protein product                                 640     0.0  


>Q9VIJ4_DROME unnamed protein product
Length=615

 Score = 646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/541 (58%), Positives = 399/541 (74%), Gaps = 29/541 (5%)

Query  49   LHVEPVCSSICDIVDEVCHALRSSRDENARELVRLLRGSHLKALLETHD---AVVERKEA  105
            L+ +P+C       D++      SR   +REL +LL   H +ALL  HD   A+ E++  
Sbjct  85   LNNKPIC-------DDIIRKFSPSRRLESRELAKLLAQPHFRALLRAHDEIGALYEQRLK  137

Query  106  PSKPEPSQLTMPTNERT----------------EAVRMVGLRRQPNEPLGLTVQVDESGN  149
             +    SQL + +  +T                E ++MVGLRR P++PLGLTV++DE   
Sbjct  138  AAGGSTSQLEIASQRQTGGYLFTEDVLNTKMPVETIKMVGLRRDPSKPLGLTVELDEFKQ  197

Query  150  LIIARILGGSTAARQGLLRTGEVILEVNGKEVHNPEELQEAIHEAKENLSLKLAPGIASD  209
            L++ARIL G    +Q +L  G+VILEVNG  V  P+ELQ  +  AKENL+LK+ P +  +
Sbjct  198  LVVARILAGGVIDKQSMLHVGDVILEVNGTPVRTPDELQVEVSRAKENLTLKIGPNVDEE  257

Query  210  GNRPVKSTCYMRALFDYDPSEDTLLPCVEIGLPFQKGDVLQIVDQADPNWWQARRVEGEG  269
              +  + TCYMRALF Y+PSED+LLPC +IGLPF+ GD+LQI++  DPNWWQA+ +  E 
Sbjct  258  I-KSGRYTCYMRALFTYNPSEDSLLPCRDIGLPFKSGDILQIINVKDPNWWQAKNITAES  316

Query  270  LGPPGLIPSLELEERRKAFVPPEADFVHKISICGTKISKKKKRKMYQSKSNGEFDSAELL  329
                GLIPS ELEERRKAFV PEAD+VHKI ICGT+ISK+K++ MY+S +N EFD AELL
Sbjct  317  -DKIGLIPSQELEERRKAFVAPEADYVHKIGICGTRISKRKRKTMYRSVANCEFDKAELL  375

Query  330  LYEEVARMPPFRRKTLALVGPRGVGRRTLKNRLINSDPEKFGTIVPYTSRPPRVLEEDGK  389
            LYEEV RMPPFRRKTL L+G  GVGRRTLKNRLINSD +KFG ++P+TSRP R LEE+G 
Sbjct  376  LYEEVTRMPPFRRKTLVLIGVSGVGRRTLKNRLINSDVDKFGAVIPHTSRPKRALEENGS  435

Query  390  SYWFTDRDCMETDIREHRYLEYGEHGGHLYGTKLDSVRELIRAGKMCVLDCSPAALKILH  449
            SYWF DR+ ME  +R + +LEYGEH G+LYGT L S++++I +G+MC+LDC+P ALKILH
Sbjct  436  SYWFMDREEMEEAVRNNEFLEYGEHNGNLYGTHLQSIKDVINSGRMCILDCAPNALKILH  495

Query  450  NSTEFMPYVIFIAAPGMEQLKWLYDLARSTGTSSRNLTFDRQSSIRYSSRRARTLESLAS  509
            NS E MP+VIF+AAPGMEQLK +Y   R+TG S+RNL+FDRQSSIR+SSRRARTLESLAS
Sbjct  496  NSQELMPFVIFVAAPGMEQLKTIYADRRATG-SNRNLSFDRQSSIRFSSRRARTLESLAS  554

Query  510  LYEEDDLKATLEESAALQRAYEKYIDLVIVNEDFDNTFRQVIAALDALATEHQWVPVNWI  569
            LYE+DDL AT+EES+ +QR YEKY D+VIVNEDFD TFRQV+  LD ++ E QWVPVNWI
Sbjct  555  LYEDDDLVATVEESSFVQRKYEKYFDMVIVNEDFDETFRQVVETLDQMSHEEQWVPVNWI  614

Query  570  Y  570
            Y
Sbjct  615  Y  615


>Q8MR96_DROME unnamed protein product
Length=548

 Score = 644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/541 (58%), Positives = 399/541 (74%), Gaps = 29/541 (5%)

Query  49   LHVEPVCSSICDIVDEVCHALRSSRDENARELVRLLRGSHLKALLETHD---AVVERKEA  105
            L+ +P+C       D++      SR   +REL +LL   H +ALL  HD   A+ E++  
Sbjct  18   LNNKPIC-------DDIIRKFSPSRRLESRELAKLLAQPHFRALLRAHDEIGALYEQRLK  70

Query  106  PSKPEPSQLTMPTNERT----------------EAVRMVGLRRQPNEPLGLTVQVDESGN  149
             +    SQL + +  +T                E ++MVGLRR P++PLGLTV++DE   
Sbjct  71   AAGGSTSQLEIASQRQTGGYLFTEDVLNTKMPVETIKMVGLRRDPSKPLGLTVELDEFKQ  130

Query  150  LIIARILGGSTAARQGLLRTGEVILEVNGKEVHNPEELQEAIHEAKENLSLKLAPGIASD  209
            L++ARIL G    +Q +L  G+VILEVNG  V  P+ELQ  +  AKENL+LK+ P +  +
Sbjct  131  LVVARILAGGVIDKQSMLHVGDVILEVNGTPVRTPDELQVEVSRAKENLTLKIGPNVDEE  190

Query  210  GNRPVKSTCYMRALFDYDPSEDTLLPCVEIGLPFQKGDVLQIVDQADPNWWQARRVEGEG  269
              +  + TCYMRALF Y+PSED+LLPC +IGLPF+ GD+LQI++  DPNWWQA+ +  E 
Sbjct  191  I-KSGRYTCYMRALFTYNPSEDSLLPCRDIGLPFKSGDILQIINVKDPNWWQAKNITAES  249

Query  270  LGPPGLIPSLELEERRKAFVPPEADFVHKISICGTKISKKKKRKMYQSKSNGEFDSAELL  329
                GLIPS ELEERRKAFV PEAD+VHKI ICGT+ISK+K++ MY+S +N EFD AELL
Sbjct  250  -DKIGLIPSQELEERRKAFVAPEADYVHKIGICGTRISKRKRKTMYRSVANCEFDKAELL  308

Query  330  LYEEVARMPPFRRKTLALVGPRGVGRRTLKNRLINSDPEKFGTIVPYTSRPPRVLEEDGK  389
            LYEEV RMPPFRRKTL L+G  GVGRRTLKNRLINSD +KFG ++P+TSRP R LEE+G 
Sbjct  309  LYEEVTRMPPFRRKTLVLIGVSGVGRRTLKNRLINSDVDKFGAVIPHTSRPKRALEENGS  368

Query  390  SYWFTDRDCMETDIREHRYLEYGEHGGHLYGTKLDSVRELIRAGKMCVLDCSPAALKILH  449
            SYWF DR+ ME  +R + +LEYGEH G+LYGT L S++++I +G+MC+LDC+P ALKILH
Sbjct  369  SYWFMDREEMEEAVRNNEFLEYGEHNGNLYGTHLQSIKDVINSGRMCILDCAPNALKILH  428

Query  450  NSTEFMPYVIFIAAPGMEQLKWLYDLARSTGTSSRNLTFDRQSSIRYSSRRARTLESLAS  509
            NS E MP+VIF+AAPGMEQLK +Y   R+TG S+RNL+FDRQSSIR+SSRRARTLESLAS
Sbjct  429  NSQELMPFVIFVAAPGMEQLKTIYADRRATG-SNRNLSFDRQSSIRFSSRRARTLESLAS  487

Query  510  LYEEDDLKATLEESAALQRAYEKYIDLVIVNEDFDNTFRQVIAALDALATEHQWVPVNWI  569
            LYE+DDL AT+EES+ +QR YEKY D+VIVNEDFD TFRQV+  LD ++ E QWVPVNWI
Sbjct  488  LYEDDDLVATVEESSFVQRKYEKYFDMVIVNEDFDETFRQVVETLDQMSHEEQWVPVNWI  547

Query  570  Y  570
            Y
Sbjct  548  Y  548


>Q8SXI6_DROME unnamed protein product
Length=636

 Score = 640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/561 (57%), Positives = 400/561 (71%), Gaps = 48/561 (9%)

Query  49   LHVEPVCSSICDIVDEVCHALRSSRDENARELVRLLRGSHLKALLETHD---AVVERKEA  105
            L+ +P+C       D++      SR   +REL +LL   H +ALL  HD   A+ E++  
Sbjct  85   LNNKPIC-------DDIIRKFSPSRRLESRELAKLLAQPHFRALLRAHDEIGALYEQRLK  137

Query  106  PSKPEPSQLTMPTNERT----------------EAVRMVGLRRQPNEPLGLTVQVDESGN  149
             +    SQL + +  +T                E ++MVGLRR P++PLGLTV++DE   
Sbjct  138  AAGGSTSQLEIASQRQTGGYLFTEDVLNTKMPVETIKMVGLRRDPSKPLGLTVELDEFKQ  197

Query  150  LIIARILGGSTAARQGLLRTGEVILEVNGKEVHNPEELQEAIHEAKENLSLKLAPGIASD  209
            L++ARIL G    +Q +L  G+VILEVNG  V  P+ELQ  +  AKENL+LK+ P +  +
Sbjct  198  LVVARILAGGVIDKQSMLHVGDVILEVNGTPVRTPDELQVEVSRAKENLTLKIGPNVDEE  257

Query  210  ---GNRPV-----------------KSTCYMRALFDYDPSEDTLLPCVEIGLPFQKGDVL  249
               G   V                 K TCYMRALF Y+PSED+LLPC +IGLPF+ GD+L
Sbjct  258  IKSGRYTVSGGQVKQNGIASLETGKKLTCYMRALFTYNPSEDSLLPCRDIGLPFKSGDIL  317

Query  250  QIVDQADPNWWQARRVEGEGLGPPGLIPSLELEERRKAFVPPEADFVHKISICGTKISKK  309
            QI++  DPNWWQA+ +  E     GLIPS ELEERRKAFV PEAD+VHKI ICGT+ISK+
Sbjct  318  QIINVKDPNWWQAKNITAES-DKIGLIPSQELEERRKAFVAPEADYVHKIGICGTRISKR  376

Query  310  KKRKMYQSKSNGEFDSAELLLYEEVARMPPFRRKTLALVGPRGVGRRTLKNRLINSDPEK  369
            K++ MY+S +N EFD AELLLYEEV RMPPFRRKTL L+G  GVGRRTLKNRLINSD +K
Sbjct  377  KRKTMYRSVANCEFDKAELLLYEEVTRMPPFRRKTLVLIGVSGVGRRTLKNRLINSDVDK  436

Query  370  FGTIVPYTSRPPRVLEEDGKSYWFTDRDCMETDIREHRYLEYGEHGGHLYGTKLDSVREL  429
            FG ++P+TSRP R LEE+G SYWF DR+ ME  +R + +LEYGEH G+LYGT L S++++
Sbjct  437  FGAVIPHTSRPKRALEENGSSYWFMDREEMEEAVRNNEFLEYGEHNGNLYGTHLQSIKDV  496

Query  430  IRAGKMCVLDCSPAALKILHNSTEFMPYVIFIAAPGMEQLKWLYDLARSTGTSSRNLTFD  489
            I +G+MC+LDC+P ALKILHNS E MP+VIF+AAPGMEQLK +Y   R+TG S+RNL+FD
Sbjct  497  INSGRMCILDCAPNALKILHNSQELMPFVIFVAAPGMEQLKTIYADRRATG-SNRNLSFD  555

Query  490  RQSSIRYSSRRARTLESLASLYEEDDLKATLEESAALQRAYEKYIDLVIVNEDFDNTFRQ  549
            RQSSIR+SSRRARTLESLASLYE+DDL AT+EES+ +QR YEKY D+VIVNEDFD TFRQ
Sbjct  556  RQSSIRFSSRRARTLESLASLYEDDDLVATVEESSFVQRKYEKYFDMVIVNEDFDETFRQ  615

Query  550  VIAALDALATEHQWVPVNWIY  570
            V+  LD ++ E QWVPVNWIY
Sbjct  616  VVETLDQMSHEEQWVPVNWIY  636



Lambda      K        H
   0.319    0.134    0.407 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3252957642


Query= XP_050469466.1 protein PALS2 isoform X5 [Bombus huntii]

Length=547
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VIJ4_DROME  unnamed protein product                                 646     0.0  
Q8MR96_DROME  unnamed protein product                                 645     0.0  
Q8SXI6_DROME  unnamed protein product                                 641     0.0  


>Q9VIJ4_DROME unnamed protein product
Length=615

 Score = 646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/541 (58%), Positives = 399/541 (74%), Gaps = 29/541 (5%)

Query  26   LHVEPVCSSICDIVDEVCHALRSSRDENARELVRLLRGSHLKALLETHD---AVVERKEA  82
            L+ +P+C       D++      SR   +REL +LL   H +ALL  HD   A+ E++  
Sbjct  85   LNNKPIC-------DDIIRKFSPSRRLESRELAKLLAQPHFRALLRAHDEIGALYEQRLK  137

Query  83   PSKPEPSQLTMPTNERT----------------EAVRMVGLRRQPNEPLGLTVQVDESGN  126
             +    SQL + +  +T                E ++MVGLRR P++PLGLTV++DE   
Sbjct  138  AAGGSTSQLEIASQRQTGGYLFTEDVLNTKMPVETIKMVGLRRDPSKPLGLTVELDEFKQ  197

Query  127  LIIARILGGSTAARQGLLRTGEVILEVNGKEVHNPEELQEAIHEAKENLSLKLAPGIASD  186
            L++ARIL G    +Q +L  G+VILEVNG  V  P+ELQ  +  AKENL+LK+ P +  +
Sbjct  198  LVVARILAGGVIDKQSMLHVGDVILEVNGTPVRTPDELQVEVSRAKENLTLKIGPNVDEE  257

Query  187  GNRPVKSTCYMRALFDYDPSEDTLLPCVEIGLPFQKGDVLQIVDQADPNWWQARRVEGEG  246
              +  + TCYMRALF Y+PSED+LLPC +IGLPF+ GD+LQI++  DPNWWQA+ +  E 
Sbjct  258  I-KSGRYTCYMRALFTYNPSEDSLLPCRDIGLPFKSGDILQIINVKDPNWWQAKNITAES  316

Query  247  LGPPGLIPSLELEERRKAFVPPEADFVHKISICGTKISKKKKRKMYQSKSNGEFDSAELL  306
                GLIPS ELEERRKAFV PEAD+VHKI ICGT+ISK+K++ MY+S +N EFD AELL
Sbjct  317  -DKIGLIPSQELEERRKAFVAPEADYVHKIGICGTRISKRKRKTMYRSVANCEFDKAELL  375

Query  307  LYEEVARMPPFRRKTLALVGPRGVGRRTLKNRLINSDPEKFGTIVPYTSRPPRVLEEDGK  366
            LYEEV RMPPFRRKTL L+G  GVGRRTLKNRLINSD +KFG ++P+TSRP R LEE+G 
Sbjct  376  LYEEVTRMPPFRRKTLVLIGVSGVGRRTLKNRLINSDVDKFGAVIPHTSRPKRALEENGS  435

Query  367  SYWFTDRDCMETDIREHRYLEYGEHGGHLYGTKLDSVRELIRAGKMCVLDCSPAALKILH  426
            SYWF DR+ ME  +R + +LEYGEH G+LYGT L S++++I +G+MC+LDC+P ALKILH
Sbjct  436  SYWFMDREEMEEAVRNNEFLEYGEHNGNLYGTHLQSIKDVINSGRMCILDCAPNALKILH  495

Query  427  NSTEFMPYVIFIAAPGMEQLKWLYDLARSTGTSSRNLTFDRQSSIRYSSRRARTLESLAS  486
            NS E MP+VIF+AAPGMEQLK +Y   R+TG S+RNL+FDRQSSIR+SSRRARTLESLAS
Sbjct  496  NSQELMPFVIFVAAPGMEQLKTIYADRRATG-SNRNLSFDRQSSIRFSSRRARTLESLAS  554

Query  487  LYEEDDLKATLEESAALQRAYEKYIDLVIVNEDFDNTFRQVIAALDALATEHQWVPVNWI  546
            LYE+DDL AT+EES+ +QR YEKY D+VIVNEDFD TFRQV+  LD ++ E QWVPVNWI
Sbjct  555  LYEDDDLVATVEESSFVQRKYEKYFDMVIVNEDFDETFRQVVETLDQMSHEEQWVPVNWI  614

Query  547  Y  547
            Y
Sbjct  615  Y  615


>Q8MR96_DROME unnamed protein product
Length=548

 Score = 645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/541 (58%), Positives = 399/541 (74%), Gaps = 29/541 (5%)

Query  26   LHVEPVCSSICDIVDEVCHALRSSRDENARELVRLLRGSHLKALLETHD---AVVERKEA  82
            L+ +P+C       D++      SR   +REL +LL   H +ALL  HD   A+ E++  
Sbjct  18   LNNKPIC-------DDIIRKFSPSRRLESRELAKLLAQPHFRALLRAHDEIGALYEQRLK  70

Query  83   PSKPEPSQLTMPTNERT----------------EAVRMVGLRRQPNEPLGLTVQVDESGN  126
             +    SQL + +  +T                E ++MVGLRR P++PLGLTV++DE   
Sbjct  71   AAGGSTSQLEIASQRQTGGYLFTEDVLNTKMPVETIKMVGLRRDPSKPLGLTVELDEFKQ  130

Query  127  LIIARILGGSTAARQGLLRTGEVILEVNGKEVHNPEELQEAIHEAKENLSLKLAPGIASD  186
            L++ARIL G    +Q +L  G+VILEVNG  V  P+ELQ  +  AKENL+LK+ P +  +
Sbjct  131  LVVARILAGGVIDKQSMLHVGDVILEVNGTPVRTPDELQVEVSRAKENLTLKIGPNVDEE  190

Query  187  GNRPVKSTCYMRALFDYDPSEDTLLPCVEIGLPFQKGDVLQIVDQADPNWWQARRVEGEG  246
              +  + TCYMRALF Y+PSED+LLPC +IGLPF+ GD+LQI++  DPNWWQA+ +  E 
Sbjct  191  -IKSGRYTCYMRALFTYNPSEDSLLPCRDIGLPFKSGDILQIINVKDPNWWQAKNITAES  249

Query  247  LGPPGLIPSLELEERRKAFVPPEADFVHKISICGTKISKKKKRKMYQSKSNGEFDSAELL  306
                GLIPS ELEERRKAFV PEAD+VHKI ICGT+ISK+K++ MY+S +N EFD AELL
Sbjct  250  -DKIGLIPSQELEERRKAFVAPEADYVHKIGICGTRISKRKRKTMYRSVANCEFDKAELL  308

Query  307  LYEEVARMPPFRRKTLALVGPRGVGRRTLKNRLINSDPEKFGTIVPYTSRPPRVLEEDGK  366
            LYEEV RMPPFRRKTL L+G  GVGRRTLKNRLINSD +KFG ++P+TSRP R LEE+G 
Sbjct  309  LYEEVTRMPPFRRKTLVLIGVSGVGRRTLKNRLINSDVDKFGAVIPHTSRPKRALEENGS  368

Query  367  SYWFTDRDCMETDIREHRYLEYGEHGGHLYGTKLDSVRELIRAGKMCVLDCSPAALKILH  426
            SYWF DR+ ME  +R + +LEYGEH G+LYGT L S++++I +G+MC+LDC+P ALKILH
Sbjct  369  SYWFMDREEMEEAVRNNEFLEYGEHNGNLYGTHLQSIKDVINSGRMCILDCAPNALKILH  428

Query  427  NSTEFMPYVIFIAAPGMEQLKWLYDLARSTGTSSRNLTFDRQSSIRYSSRRARTLESLAS  486
            NS E MP+VIF+AAPGMEQLK +Y   R+TG S+RNL+FDRQSSIR+SSRRARTLESLAS
Sbjct  429  NSQELMPFVIFVAAPGMEQLKTIYADRRATG-SNRNLSFDRQSSIRFSSRRARTLESLAS  487

Query  487  LYEEDDLKATLEESAALQRAYEKYIDLVIVNEDFDNTFRQVIAALDALATEHQWVPVNWI  546
            LYE+DDL AT+EES+ +QR YEKY D+VIVNEDFD TFRQV+  LD ++ E QWVPVNWI
Sbjct  488  LYEDDDLVATVEESSFVQRKYEKYFDMVIVNEDFDETFRQVVETLDQMSHEEQWVPVNWI  547

Query  547  Y  547
            Y
Sbjct  548  Y  548


>Q8SXI6_DROME unnamed protein product
Length=636

 Score = 641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/561 (57%), Positives = 400/561 (71%), Gaps = 48/561 (9%)

Query  26   LHVEPVCSSICDIVDEVCHALRSSRDENARELVRLLRGSHLKALLETHD---AVVERKEA  82
            L+ +P+C       D++      SR   +REL +LL   H +ALL  HD   A+ E++  
Sbjct  85   LNNKPIC-------DDIIRKFSPSRRLESRELAKLLAQPHFRALLRAHDEIGALYEQRLK  137

Query  83   PSKPEPSQLTMPTNERT----------------EAVRMVGLRRQPNEPLGLTVQVDESGN  126
             +    SQL + +  +T                E ++MVGLRR P++PLGLTV++DE   
Sbjct  138  AAGGSTSQLEIASQRQTGGYLFTEDVLNTKMPVETIKMVGLRRDPSKPLGLTVELDEFKQ  197

Query  127  LIIARILGGSTAARQGLLRTGEVILEVNGKEVHNPEELQEAIHEAKENLSLKLAPGIASD  186
            L++ARIL G    +Q +L  G+VILEVNG  V  P+ELQ  +  AKENL+LK+ P +  +
Sbjct  198  LVVARILAGGVIDKQSMLHVGDVILEVNGTPVRTPDELQVEVSRAKENLTLKIGPNVDEE  257

Query  187  ---GNRPV-----------------KSTCYMRALFDYDPSEDTLLPCVEIGLPFQKGDVL  226
               G   V                 K TCYMRALF Y+PSED+LLPC +IGLPF+ GD+L
Sbjct  258  IKSGRYTVSGGQVKQNGIASLETGKKLTCYMRALFTYNPSEDSLLPCRDIGLPFKSGDIL  317

Query  227  QIVDQADPNWWQARRVEGEGLGPPGLIPSLELEERRKAFVPPEADFVHKISICGTKISKK  286
            QI++  DPNWWQA+ +  E     GLIPS ELEERRKAFV PEAD+VHKI ICGT+ISK+
Sbjct  318  QIINVKDPNWWQAKNITAES-DKIGLIPSQELEERRKAFVAPEADYVHKIGICGTRISKR  376

Query  287  KKRKMYQSKSNGEFDSAELLLYEEVARMPPFRRKTLALVGPRGVGRRTLKNRLINSDPEK  346
            K++ MY+S +N EFD AELLLYEEV RMPPFRRKTL L+G  GVGRRTLKNRLINSD +K
Sbjct  377  KRKTMYRSVANCEFDKAELLLYEEVTRMPPFRRKTLVLIGVSGVGRRTLKNRLINSDVDK  436

Query  347  FGTIVPYTSRPPRVLEEDGKSYWFTDRDCMETDIREHRYLEYGEHGGHLYGTKLDSVREL  406
            FG ++P+TSRP R LEE+G SYWF DR+ ME  +R + +LEYGEH G+LYGT L S++++
Sbjct  437  FGAVIPHTSRPKRALEENGSSYWFMDREEMEEAVRNNEFLEYGEHNGNLYGTHLQSIKDV  496

Query  407  IRAGKMCVLDCSPAALKILHNSTEFMPYVIFIAAPGMEQLKWLYDLARSTGTSSRNLTFD  466
            I +G+MC+LDC+P ALKILHNS E MP+VIF+AAPGMEQLK +Y   R+TG S+RNL+FD
Sbjct  497  INSGRMCILDCAPNALKILHNSQELMPFVIFVAAPGMEQLKTIYADRRATG-SNRNLSFD  555

Query  467  RQSSIRYSSRRARTLESLASLYEEDDLKATLEESAALQRAYEKYIDLVIVNEDFDNTFRQ  526
            RQSSIR+SSRRARTLESLASLYE+DDL AT+EES+ +QR YEKY D+VIVNEDFD TFRQ
Sbjct  556  RQSSIRFSSRRARTLESLASLYEDDDLVATVEESSFVQRKYEKYFDMVIVNEDFDETFRQ  615

Query  527  VIAALDALATEHQWVPVNWIY  547
            V+  LD ++ E QWVPVNWIY
Sbjct  616  VVETLDQMSHEEQWVPVNWIY  636



Lambda      K        H
   0.319    0.134    0.407 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3252957642


Query= XP_050469467.1 MAGUK p55 subfamily member 2 isoform X6 [Bombus
huntii]

Length=455
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VIJ4_DROME  unnamed protein product                                 625     0.0  
Q8MR96_DROME  unnamed protein product                                 624     0.0  
Q8SXI6_DROME  unnamed protein product                                 620     0.0  


>Q9VIJ4_DROME unnamed protein product
Length=615

 Score = 625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/452 (65%), Positives = 362/452 (80%), Gaps = 9/452 (2%)

Query  7    TEAVRMVGLRRQPNEPLGLTVQVDESGNLIIARILGGSTAARQGLLRTGEVILEVNGKEV  66
             E ++MVGLRR P++PLGLTV++DE   L++ARIL G    +Q +L  G+VILEVNG  V
Sbjct  170  VETIKMVGLRRDPSKPLGLTVELDEFKQLVVARILAGGVIDKQSMLHVGDVILEVNGTPV  229

Query  67   HNPEELQEAIHEAKENLSLKLAPGIASDGNRPVKS---TCYMRALFDYDPSEDTLLPCVE  123
              P+ELQ  +  AKENL+LK+ P +  +    +KS   TCYMRALF Y+PSED+LLPC +
Sbjct  230  RTPDELQVEVSRAKENLTLKIGPNVDEE----IKSGRYTCYMRALFTYNPSEDSLLPCRD  285

Query  124  IGLPFQKGDVLQIVDQADPNWWQARRVEGEGLGPPGLIPSLELEERRKAFVPPEADFVHK  183
            IGLPF+ GD+LQI++  DPNWWQA+ +  E     GLIPS ELEERRKAFV PEAD+VHK
Sbjct  286  IGLPFKSGDILQIINVKDPNWWQAKNITAES-DKIGLIPSQELEERRKAFVAPEADYVHK  344

Query  184  ISICGTKISKKKKRKMYQSKSNGEFDSAELLLYEEVARMPPFRRKTLALVGPRGVGRRTL  243
            I ICGT+ISK+K++ MY+S +N EFD AELLLYEEV RMPPFRRKTL L+G  GVGRRTL
Sbjct  345  IGICGTRISKRKRKTMYRSVANCEFDKAELLLYEEVTRMPPFRRKTLVLIGVSGVGRRTL  404

Query  244  KNRLINSDPEKFGTIVPYTSRPPRVLEEDGKSYWFTDRDCMETDIREHRYLEYGEHGGHL  303
            KNRLINSD +KFG ++P+TSRP R LEE+G SYWF DR+ ME  +R + +LEYGEH G+L
Sbjct  405  KNRLINSDVDKFGAVIPHTSRPKRALEENGSSYWFMDREEMEEAVRNNEFLEYGEHNGNL  464

Query  304  YGTKLDSVRELIRAGKMCVLDCSPAALKILHNSTEFMPYVIFIAAPGMEQLKWLYDLARS  363
            YGT L S++++I +G+MC+LDC+P ALKILHNS E MP+VIF+AAPGMEQLK +Y   R+
Sbjct  465  YGTHLQSIKDVINSGRMCILDCAPNALKILHNSQELMPFVIFVAAPGMEQLKTIYADRRA  524

Query  364  TGTSSRNLTFDRQSSIRYSSRRARTLESLASLYEEDDLKATLEESAALQRAYEKYIDLVI  423
            TG S+RNL+FDRQSSIR+SSRRARTLESLASLYE+DDL AT+EES+ +QR YEKY D+VI
Sbjct  525  TG-SNRNLSFDRQSSIRFSSRRARTLESLASLYEDDDLVATVEESSFVQRKYEKYFDMVI  583

Query  424  VNEDFDNTFRQVIAALDALATEHQWVPVNWIY  455
            VNEDFD TFRQV+  LD ++ E QWVPVNWIY
Sbjct  584  VNEDFDETFRQVVETLDQMSHEEQWVPVNWIY  615


>Q8MR96_DROME unnamed protein product
Length=548

 Score = 624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/452 (65%), Positives = 362/452 (80%), Gaps = 9/452 (2%)

Query  7    TEAVRMVGLRRQPNEPLGLTVQVDESGNLIIARILGGSTAARQGLLRTGEVILEVNGKEV  66
             E ++MVGLRR P++PLGLTV++DE   L++ARIL G    +Q +L  G+VILEVNG  V
Sbjct  103  VETIKMVGLRRDPSKPLGLTVELDEFKQLVVARILAGGVIDKQSMLHVGDVILEVNGTPV  162

Query  67   HNPEELQEAIHEAKENLSLKLAPGIASDGNRPVKS---TCYMRALFDYDPSEDTLLPCVE  123
              P+ELQ  +  AKENL+LK+ P +  +    +KS   TCYMRALF Y+PSED+LLPC +
Sbjct  163  RTPDELQVEVSRAKENLTLKIGPNVDEE----IKSGRYTCYMRALFTYNPSEDSLLPCRD  218

Query  124  IGLPFQKGDVLQIVDQADPNWWQARRVEGEGLGPPGLIPSLELEERRKAFVPPEADFVHK  183
            IGLPF+ GD+LQI++  DPNWWQA+ +  E     GLIPS ELEERRKAFV PEAD+VHK
Sbjct  219  IGLPFKSGDILQIINVKDPNWWQAKNITAES-DKIGLIPSQELEERRKAFVAPEADYVHK  277

Query  184  ISICGTKISKKKKRKMYQSKSNGEFDSAELLLYEEVARMPPFRRKTLALVGPRGVGRRTL  243
            I ICGT+ISK+K++ MY+S +N EFD AELLLYEEV RMPPFRRKTL L+G  GVGRRTL
Sbjct  278  IGICGTRISKRKRKTMYRSVANCEFDKAELLLYEEVTRMPPFRRKTLVLIGVSGVGRRTL  337

Query  244  KNRLINSDPEKFGTIVPYTSRPPRVLEEDGKSYWFTDRDCMETDIREHRYLEYGEHGGHL  303
            KNRLINSD +KFG ++P+TSRP R LEE+G SYWF DR+ ME  +R + +LEYGEH G+L
Sbjct  338  KNRLINSDVDKFGAVIPHTSRPKRALEENGSSYWFMDREEMEEAVRNNEFLEYGEHNGNL  397

Query  304  YGTKLDSVRELIRAGKMCVLDCSPAALKILHNSTEFMPYVIFIAAPGMEQLKWLYDLARS  363
            YGT L S++++I +G+MC+LDC+P ALKILHNS E MP+VIF+AAPGMEQLK +Y   R+
Sbjct  398  YGTHLQSIKDVINSGRMCILDCAPNALKILHNSQELMPFVIFVAAPGMEQLKTIYADRRA  457

Query  364  TGTSSRNLTFDRQSSIRYSSRRARTLESLASLYEEDDLKATLEESAALQRAYEKYIDLVI  423
            TG S+RNL+FDRQSSIR+SSRRARTLESLASLYE+DDL AT+EES+ +QR YEKY D+VI
Sbjct  458  TG-SNRNLSFDRQSSIRFSSRRARTLESLASLYEDDDLVATVEESSFVQRKYEKYFDMVI  516

Query  424  VNEDFDNTFRQVIAALDALATEHQWVPVNWIY  455
            VNEDFD TFRQV+  LD ++ E QWVPVNWIY
Sbjct  517  VNEDFDETFRQVVETLDQMSHEEQWVPVNWIY  548


>Q8SXI6_DROME unnamed protein product
Length=636

 Score = 620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/469 (63%), Positives = 362/469 (77%), Gaps = 22/469 (5%)

Query  7    TEAVRMVGLRRQPNEPLGLTVQVDESGNLIIARILGGSTAARQGLLRTGEVILEVNGKEV  66
             E ++MVGLRR P++PLGLTV++DE   L++ARIL G    +Q +L  G+VILEVNG  V
Sbjct  170  VETIKMVGLRRDPSKPLGLTVELDEFKQLVVARILAGGVIDKQSMLHVGDVILEVNGTPV  229

Query  67   HNPEELQEAIHEAKENLSLKLAPGIASD---GNRPV-----------------KSTCYMR  106
              P+ELQ  +  AKENL+LK+ P +  +   G   V                 K TCYMR
Sbjct  230  RTPDELQVEVSRAKENLTLKIGPNVDEEIKSGRYTVSGGQVKQNGIASLETGKKLTCYMR  289

Query  107  ALFDYDPSEDTLLPCVEIGLPFQKGDVLQIVDQADPNWWQARRVEGEGLGPPGLIPSLEL  166
            ALF Y+PSED+LLPC +IGLPF+ GD+LQI++  DPNWWQA+ +  E     GLIPS EL
Sbjct  290  ALFTYNPSEDSLLPCRDIGLPFKSGDILQIINVKDPNWWQAKNITAES-DKIGLIPSQEL  348

Query  167  EERRKAFVPPEADFVHKISICGTKISKKKKRKMYQSKSNGEFDSAELLLYEEVARMPPFR  226
            EERRKAFV PEAD+VHKI ICGT+ISK+K++ MY+S +N EFD AELLLYEEV RMPPFR
Sbjct  349  EERRKAFVAPEADYVHKIGICGTRISKRKRKTMYRSVANCEFDKAELLLYEEVTRMPPFR  408

Query  227  RKTLALVGPRGVGRRTLKNRLINSDPEKFGTIVPYTSRPPRVLEEDGKSYWFTDRDCMET  286
            RKTL L+G  GVGRRTLKNRLINSD +KFG ++P+TSRP R LEE+G SYWF DR+ ME 
Sbjct  409  RKTLVLIGVSGVGRRTLKNRLINSDVDKFGAVIPHTSRPKRALEENGSSYWFMDREEMEE  468

Query  287  DIREHRYLEYGEHGGHLYGTKLDSVRELIRAGKMCVLDCSPAALKILHNSTEFMPYVIFI  346
             +R + +LEYGEH G+LYGT L S++++I +G+MC+LDC+P ALKILHNS E MP+VIF+
Sbjct  469  AVRNNEFLEYGEHNGNLYGTHLQSIKDVINSGRMCILDCAPNALKILHNSQELMPFVIFV  528

Query  347  AAPGMEQLKWLYDLARSTGTSSRNLTFDRQSSIRYSSRRARTLESLASLYEEDDLKATLE  406
            AAPGMEQLK +Y   R+TG S+RNL+FDRQSSIR+SSRRARTLESLASLYE+DDL AT+E
Sbjct  529  AAPGMEQLKTIYADRRATG-SNRNLSFDRQSSIRFSSRRARTLESLASLYEDDDLVATVE  587

Query  407  ESAALQRAYEKYIDLVIVNEDFDNTFRQVIAALDALATEHQWVPVNWIY  455
            ES+ +QR YEKY D+VIVNEDFD TFRQV+  LD ++ E QWVPVNWIY
Sbjct  588  ESSFVQRKYEKYFDMVIVNEDFDETFRQVVETLDQMSHEEQWVPVNWIY  636



Lambda      K        H
   0.319    0.134    0.407 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3252957642


Query= XP_050469468.1 MAGUK p55 subfamily member 2 isoform X6 [Bombus
huntii]

Length=455
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VIJ4_DROME  unnamed protein product                                 625     0.0  
Q8MR96_DROME  unnamed protein product                                 624     0.0  
Q8SXI6_DROME  unnamed protein product                                 620     0.0  


>Q9VIJ4_DROME unnamed protein product
Length=615

 Score = 625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/452 (65%), Positives = 362/452 (80%), Gaps = 9/452 (2%)

Query  7    TEAVRMVGLRRQPNEPLGLTVQVDESGNLIIARILGGSTAARQGLLRTGEVILEVNGKEV  66
             E ++MVGLRR P++PLGLTV++DE   L++ARIL G    +Q +L  G+VILEVNG  V
Sbjct  170  VETIKMVGLRRDPSKPLGLTVELDEFKQLVVARILAGGVIDKQSMLHVGDVILEVNGTPV  229

Query  67   HNPEELQEAIHEAKENLSLKLAPGIASDGNRPVKS---TCYMRALFDYDPSEDTLLPCVE  123
              P+ELQ  +  AKENL+LK+ P +  +    +KS   TCYMRALF Y+PSED+LLPC +
Sbjct  230  RTPDELQVEVSRAKENLTLKIGPNVDEE----IKSGRYTCYMRALFTYNPSEDSLLPCRD  285

Query  124  IGLPFQKGDVLQIVDQADPNWWQARRVEGEGLGPPGLIPSLELEERRKAFVPPEADFVHK  183
            IGLPF+ GD+LQI++  DPNWWQA+ +  E     GLIPS ELEERRKAFV PEAD+VHK
Sbjct  286  IGLPFKSGDILQIINVKDPNWWQAKNITAES-DKIGLIPSQELEERRKAFVAPEADYVHK  344

Query  184  ISICGTKISKKKKRKMYQSKSNGEFDSAELLLYEEVARMPPFRRKTLALVGPRGVGRRTL  243
            I ICGT+ISK+K++ MY+S +N EFD AELLLYEEV RMPPFRRKTL L+G  GVGRRTL
Sbjct  345  IGICGTRISKRKRKTMYRSVANCEFDKAELLLYEEVTRMPPFRRKTLVLIGVSGVGRRTL  404

Query  244  KNRLINSDPEKFGTIVPYTSRPPRVLEEDGKSYWFTDRDCMETDIREHRYLEYGEHGGHL  303
            KNRLINSD +KFG ++P+TSRP R LEE+G SYWF DR+ ME  +R + +LEYGEH G+L
Sbjct  405  KNRLINSDVDKFGAVIPHTSRPKRALEENGSSYWFMDREEMEEAVRNNEFLEYGEHNGNL  464

Query  304  YGTKLDSVRELIRAGKMCVLDCSPAALKILHNSTEFMPYVIFIAAPGMEQLKWLYDLARS  363
            YGT L S++++I +G+MC+LDC+P ALKILHNS E MP+VIF+AAPGMEQLK +Y   R+
Sbjct  465  YGTHLQSIKDVINSGRMCILDCAPNALKILHNSQELMPFVIFVAAPGMEQLKTIYADRRA  524

Query  364  TGTSSRNLTFDRQSSIRYSSRRARTLESLASLYEEDDLKATLEESAALQRAYEKYIDLVI  423
            TG S+RNL+FDRQSSIR+SSRRARTLESLASLYE+DDL AT+EES+ +QR YEKY D+VI
Sbjct  525  TG-SNRNLSFDRQSSIRFSSRRARTLESLASLYEDDDLVATVEESSFVQRKYEKYFDMVI  583

Query  424  VNEDFDNTFRQVIAALDALATEHQWVPVNWIY  455
            VNEDFD TFRQV+  LD ++ E QWVPVNWIY
Sbjct  584  VNEDFDETFRQVVETLDQMSHEEQWVPVNWIY  615


>Q8MR96_DROME unnamed protein product
Length=548

 Score = 624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/452 (65%), Positives = 362/452 (80%), Gaps = 9/452 (2%)

Query  7    TEAVRMVGLRRQPNEPLGLTVQVDESGNLIIARILGGSTAARQGLLRTGEVILEVNGKEV  66
             E ++MVGLRR P++PLGLTV++DE   L++ARIL G    +Q +L  G+VILEVNG  V
Sbjct  103  VETIKMVGLRRDPSKPLGLTVELDEFKQLVVARILAGGVIDKQSMLHVGDVILEVNGTPV  162

Query  67   HNPEELQEAIHEAKENLSLKLAPGIASDGNRPVKS---TCYMRALFDYDPSEDTLLPCVE  123
              P+ELQ  +  AKENL+LK+ P +  +    +KS   TCYMRALF Y+PSED+LLPC +
Sbjct  163  RTPDELQVEVSRAKENLTLKIGPNVDEE----IKSGRYTCYMRALFTYNPSEDSLLPCRD  218

Query  124  IGLPFQKGDVLQIVDQADPNWWQARRVEGEGLGPPGLIPSLELEERRKAFVPPEADFVHK  183
            IGLPF+ GD+LQI++  DPNWWQA+ +  E     GLIPS ELEERRKAFV PEAD+VHK
Sbjct  219  IGLPFKSGDILQIINVKDPNWWQAKNITAES-DKIGLIPSQELEERRKAFVAPEADYVHK  277

Query  184  ISICGTKISKKKKRKMYQSKSNGEFDSAELLLYEEVARMPPFRRKTLALVGPRGVGRRTL  243
            I ICGT+ISK+K++ MY+S +N EFD AELLLYEEV RMPPFRRKTL L+G  GVGRRTL
Sbjct  278  IGICGTRISKRKRKTMYRSVANCEFDKAELLLYEEVTRMPPFRRKTLVLIGVSGVGRRTL  337

Query  244  KNRLINSDPEKFGTIVPYTSRPPRVLEEDGKSYWFTDRDCMETDIREHRYLEYGEHGGHL  303
            KNRLINSD +KFG ++P+TSRP R LEE+G SYWF DR+ ME  +R + +LEYGEH G+L
Sbjct  338  KNRLINSDVDKFGAVIPHTSRPKRALEENGSSYWFMDREEMEEAVRNNEFLEYGEHNGNL  397

Query  304  YGTKLDSVRELIRAGKMCVLDCSPAALKILHNSTEFMPYVIFIAAPGMEQLKWLYDLARS  363
            YGT L S++++I +G+MC+LDC+P ALKILHNS E MP+VIF+AAPGMEQLK +Y   R+
Sbjct  398  YGTHLQSIKDVINSGRMCILDCAPNALKILHNSQELMPFVIFVAAPGMEQLKTIYADRRA  457

Query  364  TGTSSRNLTFDRQSSIRYSSRRARTLESLASLYEEDDLKATLEESAALQRAYEKYIDLVI  423
            TG S+RNL+FDRQSSIR+SSRRARTLESLASLYE+DDL AT+EES+ +QR YEKY D+VI
Sbjct  458  TG-SNRNLSFDRQSSIRFSSRRARTLESLASLYEDDDLVATVEESSFVQRKYEKYFDMVI  516

Query  424  VNEDFDNTFRQVIAALDALATEHQWVPVNWIY  455
            VNEDFD TFRQV+  LD ++ E QWVPVNWIY
Sbjct  517  VNEDFDETFRQVVETLDQMSHEEQWVPVNWIY  548


>Q8SXI6_DROME unnamed protein product
Length=636

 Score = 620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/469 (63%), Positives = 362/469 (77%), Gaps = 22/469 (5%)

Query  7    TEAVRMVGLRRQPNEPLGLTVQVDESGNLIIARILGGSTAARQGLLRTGEVILEVNGKEV  66
             E ++MVGLRR P++PLGLTV++DE   L++ARIL G    +Q +L  G+VILEVNG  V
Sbjct  170  VETIKMVGLRRDPSKPLGLTVELDEFKQLVVARILAGGVIDKQSMLHVGDVILEVNGTPV  229

Query  67   HNPEELQEAIHEAKENLSLKLAPGIASD---GNRPV-----------------KSTCYMR  106
              P+ELQ  +  AKENL+LK+ P +  +   G   V                 K TCYMR
Sbjct  230  RTPDELQVEVSRAKENLTLKIGPNVDEEIKSGRYTVSGGQVKQNGIASLETGKKLTCYMR  289

Query  107  ALFDYDPSEDTLLPCVEIGLPFQKGDVLQIVDQADPNWWQARRVEGEGLGPPGLIPSLEL  166
            ALF Y+PSED+LLPC +IGLPF+ GD+LQI++  DPNWWQA+ +  E     GLIPS EL
Sbjct  290  ALFTYNPSEDSLLPCRDIGLPFKSGDILQIINVKDPNWWQAKNITAES-DKIGLIPSQEL  348

Query  167  EERRKAFVPPEADFVHKISICGTKISKKKKRKMYQSKSNGEFDSAELLLYEEVARMPPFR  226
            EERRKAFV PEAD+VHKI ICGT+ISK+K++ MY+S +N EFD AELLLYEEV RMPPFR
Sbjct  349  EERRKAFVAPEADYVHKIGICGTRISKRKRKTMYRSVANCEFDKAELLLYEEVTRMPPFR  408

Query  227  RKTLALVGPRGVGRRTLKNRLINSDPEKFGTIVPYTSRPPRVLEEDGKSYWFTDRDCMET  286
            RKTL L+G  GVGRRTLKNRLINSD +KFG ++P+TSRP R LEE+G SYWF DR+ ME 
Sbjct  409  RKTLVLIGVSGVGRRTLKNRLINSDVDKFGAVIPHTSRPKRALEENGSSYWFMDREEMEE  468

Query  287  DIREHRYLEYGEHGGHLYGTKLDSVRELIRAGKMCVLDCSPAALKILHNSTEFMPYVIFI  346
             +R + +LEYGEH G+LYGT L S++++I +G+MC+LDC+P ALKILHNS E MP+VIF+
Sbjct  469  AVRNNEFLEYGEHNGNLYGTHLQSIKDVINSGRMCILDCAPNALKILHNSQELMPFVIFV  528

Query  347  AAPGMEQLKWLYDLARSTGTSSRNLTFDRQSSIRYSSRRARTLESLASLYEEDDLKATLE  406
            AAPGMEQLK +Y   R+TG S+RNL+FDRQSSIR+SSRRARTLESLASLYE+DDL AT+E
Sbjct  529  AAPGMEQLKTIYADRRATG-SNRNLSFDRQSSIRFSSRRARTLESLASLYEDDDLVATVE  587

Query  407  ESAALQRAYEKYIDLVIVNEDFDNTFRQVIAALDALATEHQWVPVNWIY  455
            ES+ +QR YEKY D+VIVNEDFD TFRQV+  LD ++ E QWVPVNWIY
Sbjct  588  ESSFVQRKYEKYFDMVIVNEDFDETFRQVVETLDQMSHEEQWVPVNWIY  636



Lambda      K        H
   0.319    0.134    0.407 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3252957642


Query= XP_050469469.1 helix-loop-helix protein 11 isoform X1 [Bombus
huntii]

Length=534
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q86PC0_DROME  unnamed protein product                                 185     7e-52
Q9V406_DROME  unnamed protein product                                 185     5e-51
LIN32_CAEEL  unnamed protein product                                  51.6    1e-07


>Q86PC0_DROME unnamed protein product
Length=543

 Score = 185 bits (470),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 126/288 (44%), Positives = 164/288 (57%), Gaps = 59/288 (20%)

Query  74   ALSNGNSTSNVGRVTPRSHMEQEKRMRREIANSNERRRMQSINAGFQSLRTLLPHHEGEK  133
            ALS+G+ +        +  ++ EKRMRREIANSNERRRMQSINAGFQSLR+LLP HEGEK
Sbjct  78   ALSDGDGSG-------KPLVDSEKRMRREIANSNERRRMQSINAGFQSLRSLLPRHEGEK  130

Query  134  LSKAAILQQTAEYIYQLEQEKTQLLSQNCQLKRLVNQHE---------------------  172
            LSKAAILQQT +YI +LE +KTQLL+QN +LKR V +HE                     
Sbjct  131  LSKAAILQQTFQYIVELENQKTQLLTQNSELKRQVGEHEAGGSGDGGGTNSGGNYNDSNA  190

Query  173  -GGD---VPIKKRK-PDNQGGVVVSLPMHVSESGDEGLGSMSPEPLSVIT--------VT  219
             GG+   V IKKRK  DN    V+++   +S+S DEGLGSMSPEP++++T        ++
Sbjct  191  SGGNSTAVAIKKRKLTDN----VINIQA-ISDSSDEGLGSMSPEPMTLLTAGGAAATKLS  245

Query  220  TEGHSVVNSEVVELRRQLERERHARLHLEKQMRAIQSQLYP----------ERFRDNQLI  269
                 +   E+ E ++QLE+ER  R  LE +++ I+ QLY                    
Sbjct  246  NAATLLAAKELHESKKQLEKERSLRRLLEDELQMIKRQLYSVATAPPGTAVAAASGGSSG  305

Query  270  TYQPHEVIEHTDNVIAQETEEAVAALQVVSVVSLAPV-GTTQTVDTSS  316
             Y P EVIEHTDN +  E  E +     VS V +  + G  Q V  SS
Sbjct  306  AYIPREVIEHTDNFVRSEDLEELGG--TVSYVEIDEMTGQQQVVVCSS  351


>Q9V406_DROME unnamed protein product
Length=631

 Score = 185 bits (469),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 126/288 (44%), Positives = 164/288 (57%), Gaps = 59/288 (20%)

Query  74   ALSNGNSTSNVGRVTPRSHMEQEKRMRREIANSNERRRMQSINAGFQSLRTLLPHHEGEK  133
            ALS+G+ +        +  ++ EKRMRREIANSNERRRMQSINAGFQSLR+LLP HEGEK
Sbjct  78   ALSDGDGSG-------KPLVDSEKRMRREIANSNERRRMQSINAGFQSLRSLLPRHEGEK  130

Query  134  LSKAAILQQTAEYIYQLEQEKTQLLSQNCQLKRLVNQHE---------------------  172
            LSKAAILQQT +YI +LE +KTQLL+QN +LKR V +HE                     
Sbjct  131  LSKAAILQQTFQYIVELENQKTQLLTQNSELKRQVGEHEAGGSGDGGGTNSGGNYNDSNA  190

Query  173  -GGD---VPIKKRK-PDNQGGVVVSLPMHVSESGDEGLGSMSPEPLSVIT--------VT  219
             GG+   V IKKRK  DN    V+++   +S+S DEGLGSMSPEP++++T        ++
Sbjct  191  SGGNSTAVAIKKRKLTDN----VINIQA-ISDSSDEGLGSMSPEPMTLLTAGGAAATKLS  245

Query  220  TEGHSVVNSEVVELRRQLERERHARLHLEKQMRAIQSQLYP----------ERFRDNQLI  269
                 +   E+ E ++QLE+ER  R  LE +++ I+ QLY                    
Sbjct  246  NAATLLAAKELHESKKQLEKERSLRRLLEDELQMIKRQLYSVATAPPGTAVAAASGGSSG  305

Query  270  TYQPHEVIEHTDNVIAQETEEAVAALQVVSVVSLAPV-GTTQTVDTSS  316
             Y P EVIEHTDN +  E  E +     VS V +  + G  Q V  SS
Sbjct  306  AYIPREVIEHTDNFVRSEDLEELGG--TVSYVEIDEMTGQQQVVVCSS  351


>LIN32_CAEEL unnamed protein product
Length=142

 Score = 51.6 bits (122),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 34/56 (61%), Gaps = 1/56 (2%)

Query  98   RMRREIANSNERRRMQSINAGFQSLRTLLPHHE-GEKLSKAAILQQTAEYIYQLEQ  152
            RMRR  AN  ERRRM ++N  +  LR +LP  + G+KLSK   LQ   +YI  L Q
Sbjct  71   RMRRSAANERERRRMNTLNVAYDELREVLPEIDSGKKLSKFETLQMAQKYIECLSQ  126



Lambda      K        H
   0.319    0.134    0.407 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3252957642


Query= XP_050469470.1 eukaryotic translation initiation factor 3 subunit I
isoform X2 [Bombus huntii]

Length=326
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

EIF3I_DICDI  unnamed protein product                                  267     5e-88
Q383W8_TRYB2  unnamed protein product                                 233     9e-75
Q4Q127_LEIMA  unnamed protein product                                 164     3e-47


>EIF3I_DICDI unnamed protein product
Length=331

 Score = 267 bits (683),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 128/322 (40%), Positives = 200/322 (62%), Gaps = 3/322 (1%)

Query  1    MKPLMLHGHERAITQIKYNREGDLLFSSSKDKKPNVWYSLNGERLGSFNGHNGSVWCIDI  60
            M+P+ L  HER ITQ+ +NREGDLLF ++KDK  ++WY+ NGER+GS+    G V+ ID+
Sbjct  1    MRPISLRLHERPITQVLFNREGDLLFVAAKDKLVSLWYTTNGERIGSYQC-GGVVYSIDV  59

Query  61   NWDTTRFLSGSGDNSLRVWDCQTGKEIGLLHTNSSVRTCSFSYSANLAVYSTDKALGHQC  120
            + D+   ++ S D   RVWD  +G+++       S R+  FS      +  TD+ +G Q 
Sbjct  60   SQDSKYLITASADAKARVWDVSSGRQLDSTDFEVSARSIEFSQGDKQILVVTDQVMGCQA  119

Query  121  EMFIIDIKNVDAVLSQADAISRIAVNGPKITAILWGALDETIITGHEDGEITLWDVRTRK  180
            ++ + D    +  + + +    +     KIT   WG L++TI    EDG + ++    R+
Sbjct  120  KIHVFDFDKDE--VRKLNKSYTLPSPQCKITQATWGPLNKTIFASCEDGAVRIYCTEKRE  177

Query  181  KMTSVRSHKSQINDMQFNKDGTMFVTASKDNTAKLFDSESLMLLKTYKTERPVNSATISP  240
             + ++  H   +  +++ K   MF+T SKD TAKL+D+++L LL+T+ T RP+N+A ISP
Sbjct  178  LIKTILDHNKLVTRIEWTKHRIMFMTCSKDGTAKLYDTKTLKLLRTFDTGRPINAAGISP  237

Query  241  IFDHVVLGGGQDAMDVTTTSTRQGKFDSRFFHLVFEEEFARLKGHFGPINSLAFHPNGRS  300
            +  HV+LGGGQ A  VTTT     +F  RFFH+V+ EE   L GH GP++S+ F P+G++
Sbjct  238  LKPHVILGGGQSAESVTTTKVDASQFKVRFFHIVYGEELGGLIGHIGPVHSICFTPDGKT  297

Query  301  FSTGGEDGYVRINTFDQSYFDF  322
            F+TGGE+G V++N  D+SYF+F
Sbjct  298  FATGGEEGLVQVNHLDESYFEF  319


>Q383W8_TRYB2 unnamed protein product
Length=342

 Score = 233 bits (595),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 116/327 (35%), Positives = 194/327 (59%), Gaps = 10/327 (3%)

Query  1    MKPLMLHGHERAITQIKYNREGDLLFSSSKDKKPNVWYSLNGERLGSFNGHNGSVWCIDI  60
            ++ + LHGH + +T IK+NREGDLLFS++K+   +VWY+  GERLG+++GH+    C D+
Sbjct  3    IQGMALHGHMKPVTMIKFNREGDLLFSTAKEPNVSVWYTKTGERLGTYDGHSAISAC-DV  61

Query  61   NWDTTRFLSGSGDNSLRVWDCQTGKEIGLLHTNSSVRTCSFSYSANLAVYSTDKALGHQC  120
            N  +T  ++G  D   ++W  +TG+E+  +   +  R   FS+  NL + ST + +G + 
Sbjct  62   NNYSTLLVTGGMDFKAKLWCVETGEELANIMLRTPARAVGFSHDDNLLMVSTSRKMGQKS  121

Query  121  EMFIIDIK--------NVDAVLSQADAISRIAVNGPKITAILWGALDETIITGHEDGEIT  172
             + + ++         ++  V +  +  +        +T  +WG  ++TI     DG + 
Sbjct  122  AVQLYNLPFLPPKDGYSIHPVNTVFNPCTEFVSENDDVTFAIWGPTNDTIYYSTSDGSVA  181

Query  173  LWDVRTRKKMTSVRSHKSQINDMQFNKDGTMFVTASKDNTAKLFDSESLMLLKTYKTERP  232
            + DV T   + + + H+  IN + F+ +    +TASKD TA+L DS  L +++TY ++ P
Sbjct  182  ILDVETMSTVCTHKPHEETINRISFDSNYYTLITASKDKTARLLDSRDLSVVQTYTSDVP  241

Query  233  VNSATISPIFDHVVLGGGQDAMDVTTTSTRQGKFDSRFFHLVFEEEFARLKGHFGPINSL  292
            VN A+ISP  DHV++GGG DA DVTT    Q  F+ +F+H V E++  +++ HFG INS+
Sbjct  242  VNDASISPRGDHVIIGGGMDAQDVTTQG-GQTTFEVKFYHKVHEKQLGQVRCHFGTINSV  300

Query  293  AFHPNGRSFSTGGEDGYVRINTFDQSY  319
             F P+GR F++G  DG V+++ FD  Y
Sbjct  301  CFFPDGRGFASGAFDGLVKLHRFDDKY  327


>Q4Q127_LEIMA unnamed protein product
Length=419

 Score = 164 bits (416),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 106/343 (31%), Positives = 176/343 (51%), Gaps = 29/343 (8%)

Query  1    MKPLMLHGHERAITQIKYNREGDLLFSSSKDKKPNV--WYSLNGERLGSFNG--------  50
            ++ + LHGH + +T +K+NR+GDLLFSS+KD   +   W    G+  GS+          
Sbjct  70   LEGVALHGHMKGVTMLKFNRDGDLLFSSAKDTNCSACCWQVKTGKLFGSYTTVGQVEGRT  129

Query  51   HNGSVWCIDINWDTTRFLSGSGDNSLRVWDCQTGKEIGLLHTN-SSVRTCSFSYSANLAV  109
            ++ ++  +D+N ++T   + S    + +W  ++G  +G +  + SS  +  FS+   L +
Sbjct  130  YDAAMVALDVNRESTLLATASAGEEVLLWSVESGALLGSVSRSLSSGASVGFSHDDTLMM  189

Query  110  YSTDKALGHQCEMFIIDIKNVDAVLSQA-DAISRIAV---------NGPKITAILWGALD  159
             +T    G       I + NV   + +A + I+ +               IT   WG  +
Sbjct  190  VATK---GRSSTNSAIQVYNVPFTVPKAGEDIAPVKTPFTTFSTFETPDTITWAAWGPTN  246

Query  160  ETIITGHEDGEITLWDVRTRKKMTSVRSHKSQ---INDMQFNKDGTMFVTASKDNTAKLF  216
            ETI    E G + + DV   K + S + H+ +   IN   ++ +     TAS D T+ L 
Sbjct  247  ETIYYS-EGGYMNILDVEANKVIRSRQIHEDENEVINRFSWDPNYLALATASTDKTSHLI  305

Query  217  DSESLMLLKTYKTERPVNSATISPIFDHVVLGGGQDAMDVTTTSTRQGKFDSRFFHLVFE  276
            D   L  ++ Y+++ PVN  +ISP  DHV+LGGG DA  VTT    Q  F+ +FFH V  
Sbjct  306  DFRDLATIQVYRSDVPVNDVSISPNADHVILGGGMDAASVTTQG-GQSIFEVKFFHKVHG  364

Query  277  EEFARLKGHFGPINSLAFHPNGRSFSTGGEDGYVRINTFDQSY  319
             +  +L+ HFG IN+++FHP+GR F++   DG +++  F  SY
Sbjct  365  HQLGQLRCHFGTINAMSFHPDGRGFASASYDGLIKMYRFGDSY  407



Lambda      K        H
   0.319    0.134    0.407 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3252957642


Query= XP_050469471.1 helix-loop-helix protein 11 isoform X2 [Bombus
huntii]

Length=533
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q86PC0_DROME  unnamed protein product                                 185     7e-52
Q9V406_DROME  unnamed protein product                                 185     4e-51
LIN32_CAEEL  unnamed protein product                                  51.6    1e-07


>Q86PC0_DROME unnamed protein product
Length=543

 Score = 185 bits (470),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 126/288 (44%), Positives = 164/288 (57%), Gaps = 59/288 (20%)

Query  73   ALSNGNSTSNVGRVTPRSHMEQEKRMRREIANSNERRRMQSINAGFQSLRTLLPHHEGEK  132
            ALS+G+ +        +  ++ EKRMRREIANSNERRRMQSINAGFQSLR+LLP HEGEK
Sbjct  78   ALSDGDGSG-------KPLVDSEKRMRREIANSNERRRMQSINAGFQSLRSLLPRHEGEK  130

Query  133  LSKAAILQQTAEYIYQLEQEKTQLLSQNCQLKRLVNQHE---------------------  171
            LSKAAILQQT +YI +LE +KTQLL+QN +LKR V +HE                     
Sbjct  131  LSKAAILQQTFQYIVELENQKTQLLTQNSELKRQVGEHEAGGSGDGGGTNSGGNYNDSNA  190

Query  172  -GGD---VPIKKRK-PDNQGGVVVSLPMHVSESGDEGLGSMSPEPLSVIT--------VT  218
             GG+   V IKKRK  DN    V+++   +S+S DEGLGSMSPEP++++T        ++
Sbjct  191  SGGNSTAVAIKKRKLTDN----VINIQA-ISDSSDEGLGSMSPEPMTLLTAGGAAATKLS  245

Query  219  TEGHSVVNSEVVELRRQLERERHARLHLEKQMRAIQSQLYP----------ERFRDNQLI  268
                 +   E+ E ++QLE+ER  R  LE +++ I+ QLY                    
Sbjct  246  NAATLLAAKELHESKKQLEKERSLRRLLEDELQMIKRQLYSVATAPPGTAVAAASGGSSG  305

Query  269  TYQPHEVIEHTDNVIAQETEEAVAALQVVSVVSLAPV-GTTQTVDTSS  315
             Y P EVIEHTDN +  E  E +     VS V +  + G  Q V  SS
Sbjct  306  AYIPREVIEHTDNFVRSEDLEELGG--TVSYVEIDEMTGQQQVVVCSS  351


>Q9V406_DROME unnamed protein product
Length=631

 Score = 185 bits (469),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 126/288 (44%), Positives = 164/288 (57%), Gaps = 59/288 (20%)

Query  73   ALSNGNSTSNVGRVTPRSHMEQEKRMRREIANSNERRRMQSINAGFQSLRTLLPHHEGEK  132
            ALS+G+ +        +  ++ EKRMRREIANSNERRRMQSINAGFQSLR+LLP HEGEK
Sbjct  78   ALSDGDGSG-------KPLVDSEKRMRREIANSNERRRMQSINAGFQSLRSLLPRHEGEK  130

Query  133  LSKAAILQQTAEYIYQLEQEKTQLLSQNCQLKRLVNQHE---------------------  171
            LSKAAILQQT +YI +LE +KTQLL+QN +LKR V +HE                     
Sbjct  131  LSKAAILQQTFQYIVELENQKTQLLTQNSELKRQVGEHEAGGSGDGGGTNSGGNYNDSNA  190

Query  172  -GGD---VPIKKRK-PDNQGGVVVSLPMHVSESGDEGLGSMSPEPLSVIT--------VT  218
             GG+   V IKKRK  DN    V+++   +S+S DEGLGSMSPEP++++T        ++
Sbjct  191  SGGNSTAVAIKKRKLTDN----VINIQA-ISDSSDEGLGSMSPEPMTLLTAGGAAATKLS  245

Query  219  TEGHSVVNSEVVELRRQLERERHARLHLEKQMRAIQSQLYP----------ERFRDNQLI  268
                 +   E+ E ++QLE+ER  R  LE +++ I+ QLY                    
Sbjct  246  NAATLLAAKELHESKKQLEKERSLRRLLEDELQMIKRQLYSVATAPPGTAVAAASGGSSG  305

Query  269  TYQPHEVIEHTDNVIAQETEEAVAALQVVSVVSLAPV-GTTQTVDTSS  315
             Y P EVIEHTDN +  E  E +     VS V +  + G  Q V  SS
Sbjct  306  AYIPREVIEHTDNFVRSEDLEELGG--TVSYVEIDEMTGQQQVVVCSS  351


>LIN32_CAEEL unnamed protein product
Length=142

 Score = 51.6 bits (122),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 34/56 (61%), Gaps = 1/56 (2%)

Query  97   RMRREIANSNERRRMQSINAGFQSLRTLLPHHE-GEKLSKAAILQQTAEYIYQLEQ  151
            RMRR  AN  ERRRM ++N  +  LR +LP  + G+KLSK   LQ   +YI  L Q
Sbjct  71   RMRRSAANERERRRMNTLNVAYDELREVLPEIDSGKKLSKFETLQMAQKYIECLSQ  126



Lambda      K        H
   0.319    0.134    0.407 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3252957642


Query= XP_050469472.1 probable cytochrome P450 6a13 isoform X1 [Bombus
huntii]

Length=515
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

C6A13_DROME  unnamed protein product                                  382     4e-128
CP6A2_DROME  unnamed protein product                                  367     7e-122
CP6A8_DROME  unnamed protein product                                  361     2e-119


>C6A13_DROME unnamed protein product
Length=493

 Score = 382 bits (981),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 204/512 (40%), Positives = 298/512 (58%), Gaps = 26/512 (5%)

Query  1    MWSILEQFLLPGLLLGIIYCFFTSTFDFWKNRGVPFRKPIVLFGNFASLLLFQKSLPEGI  60
            M ++L      GLLL   Y      + +W  RGV   +P+   GN + L          +
Sbjct  1    MLTLLVLVFTVGLLL---YVKLRWHYSYWSRRGVAGERPVYFRGNMSGLGRDLHWTDINL  57

Query  61   KDMYEWFKDERYFGAFRVMSPVLILRDPDLVKDICVKSFVCFTNRGIPVNSQNS-LSAHL  119
            +   ++   ERY G F  M+  L + D +L++DI ++ F  F +RG+  N ++  L+ +L
Sbjct  58   RIYRKFRGVERYCGYFTFMTKSLFIMDLELIRDIMIRDFSSFADRGLFHNVRDDPLTGNL  117

Query  120  FNLEGKRWKSLRSKLTPAFSSGKLKRMFYLLAECGEEFQKLIDASSETHRPFEIRELAAK  179
              L+G  W+ LR  LT  F+SGK+K MF  + E GE   KL  A        E ++L A+
Sbjct  118  LFLDGPEWRWLRQNLTQVFTSGKMKFMFPNMVEVGE---KLTQACRLQVGEIEAKDLCAR  174

Query  180  FTIDVIGSCAFGIQINALTDEESEFHRAAKKLSKPSYTATLWRMLRTAMPKLYKFLDVQV  239
            FT DVIGSCAFG++ N+L D ES+F R  + +++    + L +    A P+L + L  ++
Sbjct  175  FTTDVIGSCAFGLECNSLQDPESQFRRMGRSVTQEPLHSVLVQAFMFAQPELARKLRFRL  234

Query  240  IDPEVSKFFKNVVSQMINEREKHGIKRHDFMDLLIELKNKGTLDECGSGQVCNDEDEKIT  299
              PEVS+FF + V Q ++ R +  I R+D + LL+EL  +G  D     Q          
Sbjct  235  FRPEVSEFFLDTVRQTLDYRRRENIHRNDLIQLLMELGEEGVKDALSFEQ----------  284

Query  300  EEIELDENSIAAQAFVFFAAGYETSSNTIAFCLHELALNTEIQEKTRRDIQDAIDSRNGK  359
                     IAAQA VFF AG++TSS T++FCL+ELALN ++QE+ R ++   +   N K
Sbjct  285  ---------IAAQALVFFLAGFDTSSTTMSFCLYELALNPDVQERLRVEVLAVLKRNNQK  335

Query  360  LSYDAIQDMKYLDMVIAETLRKYPPAPMLSRRCEHQYQIPGSKVELPVGMRVIIPIYGFH  419
            L+YD++Q+M YLD V+AETLRKYP  P L RR   +YQIP S + L  G ++IIP++  H
Sbjct  336  LTYDSVQEMPYLDQVVAETLRKYPILPHLLRRSTKEYQIPNSNLILEPGSKIIIPVHSIH  395

Query  420  HDPDYYPDPATFDPERFTEENKRTRHPYTYLPFGEGPRNCIGMRFALLQIKVGVISFLRK  479
            HDP+ YPDP  FDP RF  E  + RHP+ YLPFGEGPRNCIG RF  LQ+KVG++  LR 
Sbjct  396  HDPELYPDPEKFDPSRFEPEEIKARHPFAYLPFGEGPRNCIGERFGKLQVKVGLVYLLRD  455

Query  480  HRVETCERTITPIKFSRRSLVTTSEKGFWLKI  511
             +    E+T  P+KFS R+ + ++++G  L++
Sbjct  456  FKFSRSEKTQIPLKFSSRNFLISTQEGVHLRM  487


>CP6A2_DROME unnamed protein product
Length=506

 Score = 367 bits (941),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 202/518 (39%), Positives = 306/518 (59%), Gaps = 30/518 (6%)

Query  8    FLLPGLLLGI---IYCFFTSTFDFWKNRGVPFRKPIVLFGNFASLLLFQKS--LPEGIKD  62
            F+L  LL+ I   +   +   F++W  RGVP   P  L+GN      F+K+  + +   D
Sbjct  2    FVLIYLLIAISSLLAYLYHRNFNYWNRRGVPHDAPHPLYGNMVG---FRKNRVMHDFFYD  58

Query  63   MYEWFKDERY--FGAFRVMSPVLILRDPDLVKDICVKSFVCFTNRGIPVNSQNS-LSAHL  119
             Y  ++   +   G + +  P   + D  L K+I +K F  F +RG   N ++  L+ HL
Sbjct  59   YYNKYRKSGFPFVGFYFLHKPAAFIVDTQLAKNILIKDFSNFADRGQFHNGRDDPLTQHL  118

Query  120  FNLEGKRWKSLRSKLTPAFSSGKLKRMFYLLAECGEEFQKLIDA---SSETHRPFEIREL  176
            FNL+GK+WK +R +LTP F+SGK+K MF  + +  EEF K+I     +++     EI+EL
Sbjct  119  FNLDGKKWKDMRQRLTPTFTSGKMKFMFPTVIKVSEEFVKVITEQVPAAQNGAVLEIKEL  178

Query  177  AAKFTIDVIGSCAFGIQINALTDEESEFHRAAKKLSKPSYTATLWRMLRTAMPKLYKFLD  236
             A+FT DVIG+CAFGI+ N L    S+F    +K+        L  M   + PKL   L 
Sbjct  179  MARFTTDVIGTCAFGIECNTLRTPVSDFRTMGQKVFTDMRHGKLLTMFVFSFPKLASRLR  238

Query  237  VQVIDPEVSKFFKNVVSQMINEREKHGIKRHDFMDLLIELKNKG--TLDECGSGQVCNDE  294
            ++++  +V +FF  +V+  I  RE+   KR+DFM+LLIELK KG  TLD   +G+V    
Sbjct  239  MRMMPEDVHQFFMRLVNDTIALRERENFKRNDFMNLLIELKQKGRVTLD---NGEVIEG-  294

Query  295  DEKITEEIELDENSIAAQAFVFFAAGYETSSNTIAFCLHELALNTEIQEKTRRDIQDAID  354
                     +D   +AAQ FVF+ AG+ETSS+T+++CL+ELA N +IQ++ R +IQ  ++
Sbjct  295  ---------MDIGELAAQVFVFYVAGFETSSSTMSYCLYELAQNQDIQDRLRNEIQTVLE  345

Query  355  SRNGKLSYDAIQDMKYLDMVIAETLRKYPPAPMLSRRCEHQYQIPG-SKVELPVGMRVII  413
             + G+L+Y++I+ M YL+ VI+ETLR Y   P L R+  + Y +PG  K+ +  G +VII
Sbjct  346  EQEGQLTYESIKAMTYLNQVISETLRLYTLVPHLERKALNDYVVPGHEKLVIEKGTQVII  405

Query  414  PIYGFHHDPDYYPDPATFDPERFTEENKRTRHPYTYLPFGEGPRNCIGMRFALLQIKVGV  473
            P   +H D D YP+P TFDPERF+ E    R    +LPFG+GPRNCIGMRF  +Q ++G+
Sbjct  406  PACAYHRDEDLYPNPETFDPERFSPEKVAARESVEWLPFGDGPRNCIGMRFGQMQARIGL  465

Query  474  ISFLRKHRVETCERTITPIKFSRRSLVTTSEKGFWLKI  511
               + + RV  C+ T  P+K+S  S+V  +  G +L++
Sbjct  466  AQIISRFRVSVCDTTEIPLKYSPMSIVLGTVGGIYLRV  503


>CP6A8_DROME unnamed protein product
Length=506

 Score = 361 bits (926),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 190/502 (38%), Positives = 291/502 (58%), Gaps = 16/502 (3%)

Query  14   LLGIIYCFFTSTFDFWKNRGVPFRKPIVLFGNFASLLLFQKSLPEGIKDMYEWFKDER--  71
            LL I+  +      ++K RG+PF  P ++ GN   L    K++ E  +D Y  F++ +  
Sbjct  14   LLAILTYYIHRKLTYFKRRGIPFVAPHLIRGNMEELQK-TKNIHEIFQDHYNKFRESKAP  72

Query  72   YFGAFRVMSPVLILRDPDLVKDICVKSFVCFTNRGIPVNSQNS-LSAHLFNLEGKRWKSL  130
            + G F   SP   + D +L K I +K F  F+N+GI  N ++  +SAHLFNL+G +W+ L
Sbjct  73   FVGFFFFQSPAAFVIDLELAKQILIKDFSNFSNKGIFYNEKDDPISAHLFNLDGAQWRLL  132

Query  131  RSKLTPAFSSGKLKRMFYLLAECGEEFQKLIDASSETHRPFEIRELAAKFTIDVIGSCAF  190
            R+KL+  F+SGK+K M+  +     EF  ++      +   EIR+L A+FT+DVIG+CAF
Sbjct  133  RNKLSSTFTSGKMKLMYPTVVSVANEFMTVMHEKVPKNSVLEIRDLVARFTVDVIGTCAF  192

Query  191  GIQINALTDEESEFHRAAKKLSKPSYTATLWRMLRTAMPKLYKFLDVQVIDPEVSKFFKN  250
            GIQ N+L DE++EF    K+        TL      + PKL + L +    P + +F+  
Sbjct  193  GIQCNSLRDEKAEFLYFGKRSLVDKRHGTLLNGFMRSYPKLARKLGMVRTAPHIQEFYSR  252

Query  251  VVSQMINEREKHGIKRHDFMDLLIELKNKGTLDECGSGQVCNDEDEKITEEIELDENSIA  310
            +V++ +  REK  IKR+DFMD+LIELKN+  +           E+  +   + ++E  + 
Sbjct  253  IVTETVAVREKEHIKRNDFMDMLIELKNQKEM---------TLENGDVVRGLTMEE--VL  301

Query  311  AQAFVFFAAGYETSSNTIAFCLHELALNTEIQEKTRRDIQDAIDSRNGKLSYDAIQDMKY  370
            AQAFVFF AG+ETSS+T+ F L+ELA N +IQ+K R ++++ I+  +   +Y+  +D+KY
Sbjct  302  AQAFVFFIAGFETSSSTMGFALYELAKNPDIQDKVRAEVEEVIEQHDQNFTYECTKDLKY  361

Query  371  LDMVIAETLRKYPPAPMLSRRCEHQYQIPGS-KVELPVGMRVIIPIYGFHHDPDYYPDPA  429
            L+ V+ ETLR Y   P L R    +Y +PG     +  G  VIIP    HHDP  YP+P 
Sbjct  362  LNQVLDETLRLYTIVPNLDRMAAKRYVVPGHPNFVIEAGQSVIIPSSAIHHDPSIYPEPF  421

Query  430  TFDPERFTEENKRTRHPYTYLPFGEGPRNCIGMRFALLQIKVGVISFLRKHRVETCERTI  489
             F PERF+ E    R    +LPFG+GPRNCIG+RF  +Q ++G+   +R  +  TC +T 
Sbjct  422  EFRPERFSPEESAGRPSVAWLPFGDGPRNCIGLRFGQMQARIGLALLIRNFKFSTCSKTP  481

Query  490  TPIKFSRRSLVTTSEKGFWLKI  511
             P+ +  +S V   + G +LK+
Sbjct  482  NPLVYDPKSFVLGVKDGIYLKV  503



Lambda      K        H
   0.319    0.134    0.407 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3252957642


Query= XP_050469473.1 cytochrome P450 6k1-like isoform X2 [Bombus huntii]

Length=441
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

C6A13_DROME  unnamed protein product                                  290     3e-93
CP6A2_DROME  unnamed protein product                                  269     4e-85
CP6G2_DROME  unnamed protein product                                  246     4e-76


>C6A13_DROME unnamed protein product
Length=493

 Score = 290 bits (742),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 170/493 (34%), Positives = 252/493 (51%), Gaps = 62/493 (13%)

Query  1    MWSILEQFLLPGLLLGIIYCFFTSTFDFWKNRGVPFRKPIVLFGNFASLLLFQKSLPEGI  60
            M ++L      GLLL   Y      + +W  RGV   +P+   GN + L          +
Sbjct  1    MLTLLVLVFTVGLLL---YVKLRWHYSYWSRRGVAGERPVYFRGNMSGLGRDLHWTDINL  57

Query  61   KDMYEWFKDERYFGAFRVMSPVLILRDPDLVKDICVKSFVCFTNRGIPVNSQNS-LSAHL  119
            +   ++   ERY G F  M+  L + D +L++DI ++ F  F +RG+  N ++  L+ +L
Sbjct  58   RIYRKFRGVERYCGYFTFMTKSLFIMDLELIRDIMIRDFSSFADRGLFHNVRDDPLTGNL  117

Query  120  FNLEGKRWKSLRSKLTPAFSSGKLKRMFYLLAECGEEFQKLIDASSETHRPFEIRELAAK  179
              L+G  W+ LR  LT  F+SGK+K MF  + E GE   KL  A        E ++L A+
Sbjct  118  LFLDGPEWRWLRQNLTQVFTSGKMKFMFPNMVEVGE---KLTQACRLQVGEIEAKDLCAR  174

Query  180  FTIDVIGSCAFGIQINALTDEESEFHRAAKKLSKPSYTATLWRMLRTAMPKLYKFLDVQV  239
            FT DVIGSCAFG++ N+L D ES+F R  + +++    + L +    A P+L + L  ++
Sbjct  175  FTTDVIGSCAFGLECNSLQDPESQFRRMGRSVTQEPLHSVLVQAFMFAQPELARKLRFRL  234

Query  240  IDPEVSKFFKNVVSQMINEREKHGIKRHDFMDLLIELKNKGTLDECGSGQVCN-------  292
              PEVS+FF + V Q ++ R +  I R+D + LL+EL  +G  D     Q+         
Sbjct  235  FRPEVSEFFLDTVRQTLDYRRRENIHRNDLIQLLMELGEEGVKDALSFEQIAAQALVFFL  294

Query  293  ---------------------DEDEKITEEI---------------------------ET  304
                                 D  E++  E+                           ET
Sbjct  295  AGFDTSSTTMSFCLYELALNPDVQERLRVEVLAVLKRNNQKLTYDSVQEMPYLDQVVAET  354

Query  305  LRKYPPAPMLSRRCEHQYQIPGSKVELPVGMRVIIPIYGFHHDPDYYPDPATFDPERFTE  364
            LRKYP  P L RR   +YQIP S + L  G ++IIP++  HHDP+ YPDP  FDP RF  
Sbjct  355  LRKYPILPHLLRRSTKEYQIPNSNLILEPGSKIIIPVHSIHHDPELYPDPEKFDPSRFEP  414

Query  365  ENKRTRHPYTYLPFGEGPRNCIGMRFALLQIKVGVISFLRKHRVETCERTITPIKFSRRS  424
            E  + RHP+ YLPFGEGPRNCIG RF  LQ+KVG++  LR  +    E+T  P+KFS R+
Sbjct  415  EEIKARHPFAYLPFGEGPRNCIGERFGKLQVKVGLVYLLRDFKFSRSEKTQIPLKFSSRN  474

Query  425  LVTTSEKGFWLKI  437
             + ++++G  L++
Sbjct  475  FLISTQEGVHLRM  487


>CP6A2_DROME unnamed protein product
Length=506

 Score = 269 bits (688),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 170/505 (34%), Positives = 254/505 (50%), Gaps = 78/505 (15%)

Query  8    FLLPGLLLGI---IYCFFTSTFDFWKNRGVPFRKPIVLFGNFASLLLFQKS--LPEGIKD  62
            F+L  LL+ I   +   +   F++W  RGVP   P  L+GN      F+K+  + +   D
Sbjct  2    FVLIYLLIAISSLLAYLYHRNFNYWNRRGVPHDAPHPLYGNMVG---FRKNRVMHDFFYD  58

Query  63   MYEWFKDERY--FGAFRVMSPVLILRDPDLVKDICVKSFVCFTNRGIPVNSQNS-LSAHL  119
             Y  ++   +   G + +  P   + D  L K+I +K F  F +RG   N ++  L+ HL
Sbjct  59   YYNKYRKSGFPFVGFYFLHKPAAFIVDTQLAKNILIKDFSNFADRGQFHNGRDDPLTQHL  118

Query  120  FNLEGKRWKSLRSKLTPAFSSGKLKRMFYLLAECGEEFQKLIDA---SSETHRPFEIREL  176
            FNL+GK+WK +R +LTP F+SGK+K MF  + +  EEF K+I     +++     EI+EL
Sbjct  119  FNLDGKKWKDMRQRLTPTFTSGKMKFMFPTVIKVSEEFVKVITEQVPAAQNGAVLEIKEL  178

Query  177  AAKFTIDVIGSCAFGIQINALTDEESEFHRAAKKLSKPSYTATLWRMLRTAMPKLYKFLD  236
             A+FT DVIG+CAFGI+ N L    S+F    +K+        L  M   + PKL   L 
Sbjct  179  MARFTTDVIGTCAFGIECNTLRTPVSDFRTMGQKVFTDMRHGKLLTMFVFSFPKLASRLR  238

Query  237  VQVIDPEVSKFFKNVVSQMINEREKHGIKRHDFMDLLIELKNKG--TLD-----------  283
            ++++  +V +FF  +V+  I  RE+   KR+DFM+LLIELK KG  TLD           
Sbjct  239  MRMMPEDVHQFFMRLVNDTIALRERENFKRNDFMNLLIELKQKGRVTLDNGEVIEGMDIG  298

Query  284  --------------ECGSGQVC---------NDEDEKITEEIET----------------  304
                          E  S  +           D  +++  EI+T                
Sbjct  299  ELAAQVFVFYVAGFETSSSTMSYCLYELAQNQDIQDRLRNEIQTVLEEQEGQLTYESIKA  358

Query  305  -----------LRKYPPAPMLSRRCEHQYQIPG-SKVELPVGMRVIIPIYGFHHDPDYYP  352
                       LR Y   P L R+  + Y +PG  K+ +  G +VIIP   +H D D YP
Sbjct  359  MTYLNQVISETLRLYTLVPHLERKALNDYVVPGHEKLVIEKGTQVIIPACAYHRDEDLYP  418

Query  353  DPATFDPERFTEENKRTRHPYTYLPFGEGPRNCIGMRFALLQIKVGVISFLRKHRVETCE  412
            +P TFDPERF+ E    R    +LPFG+GPRNCIGMRF  +Q ++G+   + + RV  C+
Sbjct  419  NPETFDPERFSPEKVAARESVEWLPFGDGPRNCIGMRFGQMQARIGLAQIISRFRVSVCD  478

Query  413  RTITPIKFSRRSLVTTSEKGFWLKI  437
             T  P+K+S  S+V  +  G +L++
Sbjct  479  TTEIPLKYSPMSIVLGTVGGIYLRV  503


>CP6G2_DROME unnamed protein product
Length=519

 Score = 246 bits (629),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 157/514 (31%), Positives = 243/514 (47%), Gaps = 87/514 (17%)

Query  8    FLLPGLLLGIIYCFFTSTFDFWKNRGVPFRKPIVLFGNFASLLLFQKSLPEGIKDMYEW-  66
             +L   L+GI +      + +W+  GV   +P  + GN   LL  + S  E I  +Y   
Sbjct  6    LILVASLIGIAFLALQQHYSYWRRMGVREIRPKWIVGNLMGLLNMRMSPAEFISQLYNHP  65

Query  67   -FKDERYFGAFRVMSPVLILRDPDLVKDICVKSFVCFTNR-------GIPVNSQNSLSAH  118
              ++E + G      P L+LRDP++V++I VK F  F+NR       G P+ SQN     
Sbjct  66   DAENEPFVGIHVFHKPALLLRDPEMVRNILVKDFAGFSNRYSSSDPKGDPLGSQN-----  120

Query  119  LFNLEGKRWKSLRSKLTPAFSSGKLKRMFYLLAECGEEFQKLIDAS---SETHRPF--EI  173
            +F L+   WK +R KL+P F+  +LK+MF L+ E G      +      +E  R F  E 
Sbjct  121  IFFLKNPAWKEVRLKLSPFFTGNRLKQMFPLIEEVGASLDAHLRQQPLHNERMRCFDLEA  180

Query  174  RELAAKFTIDVIGSCAFGIQINALTDEESEFHRAAKKLSKPSYTATLWRMLRTAMPKLYK  233
            +EL A +T DVI + A+G+  N+ TD + EF R  + + + +        L   +P L  
Sbjct  181  KELCALYTTDVIATVAYGVSANSFTDPKCEFRRHGRSVFEFNLLRAAEFTLVFFLPHLVP  240

Query  234  FLDVQVIDPEVSKFFKNVVSQMINEREKHGIKRHDFMDLLIELKNKGTLDECGS------  287
            F+  +V+  E ++F +  ++ +++EREK G KR+D +D+LIE +    L +         
Sbjct  241  FVRFKVVPAEATRFLRKTINYVMSEREKSGQKRNDLIDILIEFRRSTQLAKASGIKDQFV  300

Query  288  --GQVC-----------------------------NDEDEKITEEIE-------------  303
              G +                               D  +++ EEI+             
Sbjct  301  FEGDILVAQAVLFFTAGFESSSSTMAFAMYELAKDTDVQQRLREEIKDALVESGGQVTLK  360

Query  304  --------------TLRKYPPAPMLSRRCE--HQYQIP--GSKVELPVGMRVIIPIYGFH  345
                           LR YPP P L R C     Y +     K  +P GM V IP Y  H
Sbjct  361  MIESLEFMQMILLEVLRMYPPLPFLDRECTSGRDYSLAPFHKKFVVPKGMPVYIPCYALH  420

Query  346  HDPDYYPDPATFDPERFTEENKRTRHPYTYLPFGEGPRNCIGMRFALLQIKVGVISFLRK  405
             DP Y+P P  F PERF+ EN++   PYTY+PFG GP  CIG RF  LQ KVG+++ LR 
Sbjct  421  MDPQYFPQPRKFLPERFSPENRKLHTPYTYMPFGLGPHGCIGERFGYLQAKVGLVNLLRN  480

Query  406  HRVETCERTITPIKFSRRSLVTTSEKGFWLKIIQ  439
            H + T ERT   ++   ++++T ++ G  L++++
Sbjct  481  HMITTSERTPHRMQLDPKAIITQAKGGIHLRLVR  514



Lambda      K        H
   0.319    0.134    0.407 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3252957642


Query= XP_050469474.1 protein kinase C and casein kinase substrate in
neurons protein 2 isoform X1 [Bombus huntii]

Length=490
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VDI1_DROME  unnamed protein product                                 669     0.0  
A0A0B4KH28_DROME  unnamed protein product                             665     0.0  
Q09989_CAEEL  unnamed protein product                                 250     4e-77


>Q9VDI1_DROME unnamed protein product
Length=494

 Score = 669 bits (1727),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/501 (65%), Positives = 392/501 (78%), Gaps = 24/501 (5%)

Query  1    MSHHSDDNMLIATSDSFWEPGNYKRTTKRIEDGHKLCDSLIALVQERAEIEKSYAKALKN  60
            MSHHSDD +L A SDSFWEPGNYKRTTKRIEDG+KLC+ L  L+QERA+IEK YAK+L+ 
Sbjct  1    MSHHSDDQLLQAGSDSFWEPGNYKRTTKRIEDGYKLCNDLQQLIQERADIEKGYAKSLRT  60

Query  61   WSKNWNDKIEKGPEYGTTEAAWKGVLVESERLCDLHLRVKENLCNDIIHQVKTWQKETYH  120
            WSK W + IEKGPEYGTTEAAWKGVL ESER+ D+H+++K+NLCND+  Q+KTWQKE YH
Sbjct  61   WSKKWGELIEKGPEYGTTEAAWKGVLTESERISDVHMKIKDNLCNDVNSQIKTWQKENYH  120

Query  121  KSMMTLKERKEMEDAFKKAQKPWAKLLQKVEKAKSEYHNSCKTERTAANMERNASADSSL  180
             ++M +KERK++ED FKKAQKPWAKLL KVEKAK++YH++CKTER+A N ERNA+ADSSL
Sbjct  121  HTLMQIKERKDLEDLFKKAQKPWAKLLAKVEKAKADYHSACKTERSATNQERNANADSSL  180

Query  181  SPDQMARGSENVKKMQDRVQKTKEEVQKAKEKYEAALQEINQYNPKYMEDMTQVFEKCQE  240
            SPDQ       VKKM DRVQKTK++VQK +EKYE A+ EI +YN  Y+EDMT VFEKCQ 
Sbjct  181  SPDQ-------VKKMHDRVQKTKDQVQKCREKYEQAIAEITKYNSVYIEDMTSVFEKCQT  233

Query  241  MEAQRLQFFKDVLFGIHKCLNISQDPILPQIYEEFYHTVNNADHEKDLKWWSNNHGVNMA  300
             E  RLQFFK++LF +H CL++++   LPQIYEEF HT+NNAD +KDLKWWSNNHG+NMA
Sbjct  234  FEKTRLQFFKEILFNVHSCLDLTKVQSLPQIYEEFSHTINNADQQKDLKWWSNNHGINMA  293

Query  301  MNWPQFEDYTEEFRDITKGSKSKEALPAGSITLINQRPVGEDVHEYPPVNNKSKSKPSSR  360
            MNWP F +YTEEFRDI KG+KSKEALPA  ITLINQRPV EDVHEYP  N+  K+  +  
Sbjct  294  MNWPSFVEYTEEFRDIAKGNKSKEALPAAPITLINQRPVAEDVHEYPQTNSLKKNTSTLS  353

Query  361  VISTDGGHGDSKTDTMNSSKHSSE---------------KNNHDGNAVNRTSTMTNGTNV  405
             +S+      S+  T  SS  +SE                      A NR S++TNG N 
Sbjct  354  SVSSRAS-VKSEIATTQSSVTTSEAKTSAAVAGAATATAAATAASAASNRNSSVTNG-NG  411

Query  406  KQESNPFEEEEWDEDSGEPLVDNGEPGVLVRALYDYEGAEADELSFKQGDVFDKLEDEDE  465
            K ++NPF+EEE  ++S   LVDNGEPGV V+ALYDYEGAE+DEL+FKQGDVF+KLEDEDE
Sbjct  412  KVDANPFDEEEEWDESDNVLVDNGEPGVPVKALYDYEGAESDELTFKQGDVFEKLEDEDE  471

Query  466  QGWCKGRKDGRVGLYPANYVE  486
            QGWCKGR +GRVGLYPANYVE
Sbjct  472  QGWCKGRMNGRVGLYPANYVE  492


>A0A0B4KH28_DROME unnamed protein product
Length=495

 Score = 665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/502 (65%), Positives = 392/502 (78%), Gaps = 25/502 (5%)

Query  1    MSHHSDDNMLIATSDSFWEPGNYKRTTKRIEDGHKLCDSLIALVQERAEIEKSYAKALKN  60
            MSHHSDD +L A SDSFWEPGNYKRTTKRIEDG+KLC+ L  L+QERA+IEK YAK+L+ 
Sbjct  1    MSHHSDDQLLQAGSDSFWEPGNYKRTTKRIEDGYKLCNDLQQLIQERADIEKGYAKSLRT  60

Query  61   WSKNWNDKIEKGPEYGTTEAAWKGVLVESERLCDLHLRVKENLCNDIIHQVKTWQKETYH  120
            WSK W + IEKGPEYGTTEAAWKGVL ESER+ D+H+++K+NLCND+  Q+KTWQKE YH
Sbjct  61   WSKKWGELIEKGPEYGTTEAAWKGVLTESERISDVHMKIKDNLCNDVNSQIKTWQKENYH  120

Query  121  KSMMTLKERKEMEDAFKKAQKPWAKLLQKVEKAKSEYHNSCKTERTAANMERNASADSSL  180
             ++M +KERK++ED FKKAQKPWAKLL KVEKAK++YH++CKTER+A N ERNA+ADSSL
Sbjct  121  HTLMQIKERKDLEDLFKKAQKPWAKLLAKVEKAKADYHSACKTERSATNQERNANADSSL  180

Query  181  SPDQMARGSENVKKMQDRVQKTKEEVQKAKEKYEAALQEINQYNPKYMEDMTQVFEKCQE  240
            SPDQ       VKKM DRVQKTK++VQK +EKYE A+ EI +YN  Y+EDMT VFEKCQ 
Sbjct  181  SPDQ-------VKKMHDRVQKTKDQVQKCREKYEQAIAEITKYNSVYIEDMTSVFEKCQT  233

Query  241  MEAQRLQFFKDVLFGIHKCLNISQDPILPQIYEEFYHTVNNADHEKDLKWWSNNHGVNMA  300
             E  RLQFFK++LF +H CL++++   LPQIYEEF HT+NNAD +KDLKWWSNNHG+NMA
Sbjct  234  FEKTRLQFFKEILFNVHSCLDLTKVQSLPQIYEEFSHTINNADQQKDLKWWSNNHGINMA  293

Query  301  MNWPQFEDYTEEFRDITKGSKSKEALPAGSITLINQRPVGEDVH-EYPPVNNKSKSKPSS  359
            MNWP F +YTEEFRDI KG+KSKEALPA  ITLINQRPV EDVH EYP  N+  K+  + 
Sbjct  294  MNWPSFVEYTEEFRDIAKGNKSKEALPAAPITLINQRPVAEDVHQEYPQTNSLKKNTSTL  353

Query  360  RVISTDGGHGDSKTDTMNSSKHSSE---------------KNNHDGNAVNRTSTMTNGTN  404
              +S+      S+  T  SS  +SE                      A NR S++TNG N
Sbjct  354  SSVSSRAS-VKSEIATTQSSVTTSEAKTSAAVAGAATATAAATAASAASNRNSSVTNG-N  411

Query  405  VKQESNPFEEEEWDEDSGEPLVDNGEPGVLVRALYDYEGAEADELSFKQGDVFDKLEDED  464
             K ++NPF+EEE  ++S   LVDNGEPGV V+ALYDYEGAE+DEL+FKQGDVF+KLEDED
Sbjct  412  GKVDANPFDEEEEWDESDNVLVDNGEPGVPVKALYDYEGAESDELTFKQGDVFEKLEDED  471

Query  465  EQGWCKGRKDGRVGLYPANYVE  486
            EQGWCKGR +GRVGLYPANYVE
Sbjct  472  EQGWCKGRMNGRVGLYPANYVE  493


>Q09989_CAEEL unnamed protein product
Length=489

 Score = 250 bits (638),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 159/493 (32%), Positives = 255/493 (52%), Gaps = 42/493 (9%)

Query  17   FWEPGNYKRTTKRIEDGHKLCDSLIALVQERAEIEKSYAKALKNWSKNWNDKIEKGPEYG  76
            FWE G+YK   KR +DG +  D    + +ERAEIE  Y+K L   ++ W   +++    G
Sbjct  10   FWEVGSYKHNVKRFKDGVEQLDDYCKMSRERAEIEAKYSKMLSQHAEKWRAHVDRTVSAG  69

Query  77   TTEAAWKGVLVESERLCDLHLRVKENLCNDIIHQVKTWQKETYHKSMMT-LKERKEMEDA  135
            + +  W  ++ E+  L  +H  +K+ L +DI+++  T++K + H S+    KE +E+ED 
Sbjct  70   SVKTVWNELIGEATALSRVHNSLKDCLIDDIVNETTTYRKNSLHTSVFKGPKEIREIEDH  129

Query  136  FKKAQKPWAKLLQKVEKAKSEYHNSCKTERTAANMERNASADSSLSPDQMARGSENVKKM  195
            F+KAQKPW KL+ K+E  + +Y+N C+ E++A    +N   D+S+SPD          K 
Sbjct  130  FEKAQKPWKKLVDKMEDKRGKYYNVCRQEKSALVNLQNCQTDTSVSPDAAT-------KF  182

Query  196  QDRVQKTKEEVQKAKEKYEAALQEINQYNPKYMEDMTQVFEKCQEMEAQRLQFFKDVLFG  255
            ++R +K KEEVQ+ K  Y+  L  +N+Y   YME M  VF+ CQE E  R QF   ++  
Sbjct  183  RERHEKLKEEVQRTKVDYQKTLTNLNEYKNVYMEAMAHVFKMCQEKEMDRSQFLIGIVQK  242

Query  256  IHK-CLNISQDPILPQIYEEFYHTVNNADHE---KDLKWWSNNHGVNMAMNWPQFEDYTE  311
              +   NI ++  +  ++++   ++ +AD E   +DL  WS+ +GV+    WP F +Y+ 
Sbjct  243  TQRHYANIIRNSQMSGLHQQLEQSIRSADSEAVKRDLAQWSSVNGVDAFSEWPSFVEYSP  302

Query  312  EFRDI-TKGSKSKEALPAGSITLINQRPVGEDVHEYPPVNNKSKSKPSSRVISTDGGHGD  370
            E R+I  +G  +K+   AG + L  Q    ED+      +  S + PS   ++T   H D
Sbjct  303  EIRNIAARGGSTKD---AGGVILTRQINRSEDIP-----STHSNTLPSV-AVNTASSHED  353

Query  371  -----------SKTDTMNSSKHSSEKNNHDGNAVNRTSTMTNGT----NVKQESNPFEEE  415
                       S T T +S KH+S  N +     N T           +   +S P   E
Sbjct  354  VGKSSPKSSSESDTSTFDSRKHNSTANKYKNQPQNTTQIQPPPVGWHPSDGPDSPPLSTE  413

Query  416  EWDEDSGEPL--VDNGEPGVLVRALYDYEGAEADELSFKQGDVFDKLEDEDEQGWCKGRK  473
              D             +P V+   LYDY  AE DE++ ++G++ + L + D  GWC GR 
Sbjct  414  TPDSAKYGDFEEFTTSKPAVV---LYDYAPAEGDEIALRKGEMIEVLTEPDSLGWCTGRV  470

Query  474  DGRVGLYPANYVE  486
             G VGL+PA+YV+
Sbjct  471  SGNVGLFPASYVQ  483



Lambda      K        H
   0.319    0.134    0.407 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3252957642


Query= XP_050469475.1 protein kinase C and casein kinase substrate in
neurons protein 2 isoform X1 [Bombus huntii]

Length=490
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VDI1_DROME  unnamed protein product                                 669     0.0  
A0A0B4KH28_DROME  unnamed protein product                             665     0.0  
Q09989_CAEEL  unnamed protein product                                 250     4e-77


>Q9VDI1_DROME unnamed protein product
Length=494

 Score = 669 bits (1727),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/501 (65%), Positives = 392/501 (78%), Gaps = 24/501 (5%)

Query  1    MSHHSDDNMLIATSDSFWEPGNYKRTTKRIEDGHKLCDSLIALVQERAEIEKSYAKALKN  60
            MSHHSDD +L A SDSFWEPGNYKRTTKRIEDG+KLC+ L  L+QERA+IEK YAK+L+ 
Sbjct  1    MSHHSDDQLLQAGSDSFWEPGNYKRTTKRIEDGYKLCNDLQQLIQERADIEKGYAKSLRT  60

Query  61   WSKNWNDKIEKGPEYGTTEAAWKGVLVESERLCDLHLRVKENLCNDIIHQVKTWQKETYH  120
            WSK W + IEKGPEYGTTEAAWKGVL ESER+ D+H+++K+NLCND+  Q+KTWQKE YH
Sbjct  61   WSKKWGELIEKGPEYGTTEAAWKGVLTESERISDVHMKIKDNLCNDVNSQIKTWQKENYH  120

Query  121  KSMMTLKERKEMEDAFKKAQKPWAKLLQKVEKAKSEYHNSCKTERTAANMERNASADSSL  180
             ++M +KERK++ED FKKAQKPWAKLL KVEKAK++YH++CKTER+A N ERNA+ADSSL
Sbjct  121  HTLMQIKERKDLEDLFKKAQKPWAKLLAKVEKAKADYHSACKTERSATNQERNANADSSL  180

Query  181  SPDQMARGSENVKKMQDRVQKTKEEVQKAKEKYEAALQEINQYNPKYMEDMTQVFEKCQE  240
            SPDQ       VKKM DRVQKTK++VQK +EKYE A+ EI +YN  Y+EDMT VFEKCQ 
Sbjct  181  SPDQ-------VKKMHDRVQKTKDQVQKCREKYEQAIAEITKYNSVYIEDMTSVFEKCQT  233

Query  241  MEAQRLQFFKDVLFGIHKCLNISQDPILPQIYEEFYHTVNNADHEKDLKWWSNNHGVNMA  300
             E  RLQFFK++LF +H CL++++   LPQIYEEF HT+NNAD +KDLKWWSNNHG+NMA
Sbjct  234  FEKTRLQFFKEILFNVHSCLDLTKVQSLPQIYEEFSHTINNADQQKDLKWWSNNHGINMA  293

Query  301  MNWPQFEDYTEEFRDITKGSKSKEALPAGSITLINQRPVGEDVHEYPPVNNKSKSKPSSR  360
            MNWP F +YTEEFRDI KG+KSKEALPA  ITLINQRPV EDVHEYP  N+  K+  +  
Sbjct  294  MNWPSFVEYTEEFRDIAKGNKSKEALPAAPITLINQRPVAEDVHEYPQTNSLKKNTSTLS  353

Query  361  VISTDGGHGDSKTDTMNSSKHSSE---------------KNNHDGNAVNRTSTMTNGTNV  405
             +S+      S+  T  SS  +SE                      A NR S++TNG N 
Sbjct  354  SVSSRAS-VKSEIATTQSSVTTSEAKTSAAVAGAATATAAATAASAASNRNSSVTNG-NG  411

Query  406  KQESNPFEEEEWDEDSGEPLVDNGEPGVLVRALYDYEGAEADELSFKQGDVFDKLEDEDE  465
            K ++NPF+EEE  ++S   LVDNGEPGV V+ALYDYEGAE+DEL+FKQGDVF+KLEDEDE
Sbjct  412  KVDANPFDEEEEWDESDNVLVDNGEPGVPVKALYDYEGAESDELTFKQGDVFEKLEDEDE  471

Query  466  QGWCKGRKDGRVGLYPANYVE  486
            QGWCKGR +GRVGLYPANYVE
Sbjct  472  QGWCKGRMNGRVGLYPANYVE  492


>A0A0B4KH28_DROME unnamed protein product
Length=495

 Score = 665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/502 (65%), Positives = 392/502 (78%), Gaps = 25/502 (5%)

Query  1    MSHHSDDNMLIATSDSFWEPGNYKRTTKRIEDGHKLCDSLIALVQERAEIEKSYAKALKN  60
            MSHHSDD +L A SDSFWEPGNYKRTTKRIEDG+KLC+ L  L+QERA+IEK YAK+L+ 
Sbjct  1    MSHHSDDQLLQAGSDSFWEPGNYKRTTKRIEDGYKLCNDLQQLIQERADIEKGYAKSLRT  60

Query  61   WSKNWNDKIEKGPEYGTTEAAWKGVLVESERLCDLHLRVKENLCNDIIHQVKTWQKETYH  120
            WSK W + IEKGPEYGTTEAAWKGVL ESER+ D+H+++K+NLCND+  Q+KTWQKE YH
Sbjct  61   WSKKWGELIEKGPEYGTTEAAWKGVLTESERISDVHMKIKDNLCNDVNSQIKTWQKENYH  120

Query  121  KSMMTLKERKEMEDAFKKAQKPWAKLLQKVEKAKSEYHNSCKTERTAANMERNASADSSL  180
             ++M +KERK++ED FKKAQKPWAKLL KVEKAK++YH++CKTER+A N ERNA+ADSSL
Sbjct  121  HTLMQIKERKDLEDLFKKAQKPWAKLLAKVEKAKADYHSACKTERSATNQERNANADSSL  180

Query  181  SPDQMARGSENVKKMQDRVQKTKEEVQKAKEKYEAALQEINQYNPKYMEDMTQVFEKCQE  240
            SPDQ       VKKM DRVQKTK++VQK +EKYE A+ EI +YN  Y+EDMT VFEKCQ 
Sbjct  181  SPDQ-------VKKMHDRVQKTKDQVQKCREKYEQAIAEITKYNSVYIEDMTSVFEKCQT  233

Query  241  MEAQRLQFFKDVLFGIHKCLNISQDPILPQIYEEFYHTVNNADHEKDLKWWSNNHGVNMA  300
             E  RLQFFK++LF +H CL++++   LPQIYEEF HT+NNAD +KDLKWWSNNHG+NMA
Sbjct  234  FEKTRLQFFKEILFNVHSCLDLTKVQSLPQIYEEFSHTINNADQQKDLKWWSNNHGINMA  293

Query  301  MNWPQFEDYTEEFRDITKGSKSKEALPAGSITLINQRPVGEDVH-EYPPVNNKSKSKPSS  359
            MNWP F +YTEEFRDI KG+KSKEALPA  ITLINQRPV EDVH EYP  N+  K+  + 
Sbjct  294  MNWPSFVEYTEEFRDIAKGNKSKEALPAAPITLINQRPVAEDVHQEYPQTNSLKKNTSTL  353

Query  360  RVISTDGGHGDSKTDTMNSSKHSSE---------------KNNHDGNAVNRTSTMTNGTN  404
              +S+      S+  T  SS  +SE                      A NR S++TNG N
Sbjct  354  SSVSSRAS-VKSEIATTQSSVTTSEAKTSAAVAGAATATAAATAASAASNRNSSVTNG-N  411

Query  405  VKQESNPFEEEEWDEDSGEPLVDNGEPGVLVRALYDYEGAEADELSFKQGDVFDKLEDED  464
             K ++NPF+EEE  ++S   LVDNGEPGV V+ALYDYEGAE+DEL+FKQGDVF+KLEDED
Sbjct  412  GKVDANPFDEEEEWDESDNVLVDNGEPGVPVKALYDYEGAESDELTFKQGDVFEKLEDED  471

Query  465  EQGWCKGRKDGRVGLYPANYVE  486
            EQGWCKGR +GRVGLYPANYVE
Sbjct  472  EQGWCKGRMNGRVGLYPANYVE  493


>Q09989_CAEEL unnamed protein product
Length=489

 Score = 250 bits (638),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 159/493 (32%), Positives = 255/493 (52%), Gaps = 42/493 (9%)

Query  17   FWEPGNYKRTTKRIEDGHKLCDSLIALVQERAEIEKSYAKALKNWSKNWNDKIEKGPEYG  76
            FWE G+YK   KR +DG +  D    + +ERAEIE  Y+K L   ++ W   +++    G
Sbjct  10   FWEVGSYKHNVKRFKDGVEQLDDYCKMSRERAEIEAKYSKMLSQHAEKWRAHVDRTVSAG  69

Query  77   TTEAAWKGVLVESERLCDLHLRVKENLCNDIIHQVKTWQKETYHKSMMT-LKERKEMEDA  135
            + +  W  ++ E+  L  +H  +K+ L +DI+++  T++K + H S+    KE +E+ED 
Sbjct  70   SVKTVWNELIGEATALSRVHNSLKDCLIDDIVNETTTYRKNSLHTSVFKGPKEIREIEDH  129

Query  136  FKKAQKPWAKLLQKVEKAKSEYHNSCKTERTAANMERNASADSSLSPDQMARGSENVKKM  195
            F+KAQKPW KL+ K+E  + +Y+N C+ E++A    +N   D+S+SPD          K 
Sbjct  130  FEKAQKPWKKLVDKMEDKRGKYYNVCRQEKSALVNLQNCQTDTSVSPDAAT-------KF  182

Query  196  QDRVQKTKEEVQKAKEKYEAALQEINQYNPKYMEDMTQVFEKCQEMEAQRLQFFKDVLFG  255
            ++R +K KEEVQ+ K  Y+  L  +N+Y   YME M  VF+ CQE E  R QF   ++  
Sbjct  183  RERHEKLKEEVQRTKVDYQKTLTNLNEYKNVYMEAMAHVFKMCQEKEMDRSQFLIGIVQK  242

Query  256  IHK-CLNISQDPILPQIYEEFYHTVNNADHE---KDLKWWSNNHGVNMAMNWPQFEDYTE  311
              +   NI ++  +  ++++   ++ +AD E   +DL  WS+ +GV+    WP F +Y+ 
Sbjct  243  TQRHYANIIRNSQMSGLHQQLEQSIRSADSEAVKRDLAQWSSVNGVDAFSEWPSFVEYSP  302

Query  312  EFRDI-TKGSKSKEALPAGSITLINQRPVGEDVHEYPPVNNKSKSKPSSRVISTDGGHGD  370
            E R+I  +G  +K+   AG + L  Q    ED+      +  S + PS   ++T   H D
Sbjct  303  EIRNIAARGGSTKD---AGGVILTRQINRSEDIP-----STHSNTLPSV-AVNTASSHED  353

Query  371  -----------SKTDTMNSSKHSSEKNNHDGNAVNRTSTMTNGT----NVKQESNPFEEE  415
                       S T T +S KH+S  N +     N T           +   +S P   E
Sbjct  354  VGKSSPKSSSESDTSTFDSRKHNSTANKYKNQPQNTTQIQPPPVGWHPSDGPDSPPLSTE  413

Query  416  EWDEDSGEPL--VDNGEPGVLVRALYDYEGAEADELSFKQGDVFDKLEDEDEQGWCKGRK  473
              D             +P V+   LYDY  AE DE++ ++G++ + L + D  GWC GR 
Sbjct  414  TPDSAKYGDFEEFTTSKPAVV---LYDYAPAEGDEIALRKGEMIEVLTEPDSLGWCTGRV  470

Query  474  DGRVGLYPANYVE  486
             G VGL+PA+YV+
Sbjct  471  SGNVGLFPASYVQ  483



Lambda      K        H
   0.319    0.134    0.407 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3252957642


Query= XP_050469476.1 protein kinase C and casein kinase substrate in
neurons protein 2 isoform X1 [Bombus huntii]

Length=490
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VDI1_DROME  unnamed protein product                                 669     0.0  
A0A0B4KH28_DROME  unnamed protein product                             665     0.0  
Q09989_CAEEL  unnamed protein product                                 250     4e-77


>Q9VDI1_DROME unnamed protein product
Length=494

 Score = 669 bits (1727),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/501 (65%), Positives = 392/501 (78%), Gaps = 24/501 (5%)

Query  1    MSHHSDDNMLIATSDSFWEPGNYKRTTKRIEDGHKLCDSLIALVQERAEIEKSYAKALKN  60
            MSHHSDD +L A SDSFWEPGNYKRTTKRIEDG+KLC+ L  L+QERA+IEK YAK+L+ 
Sbjct  1    MSHHSDDQLLQAGSDSFWEPGNYKRTTKRIEDGYKLCNDLQQLIQERADIEKGYAKSLRT  60

Query  61   WSKNWNDKIEKGPEYGTTEAAWKGVLVESERLCDLHLRVKENLCNDIIHQVKTWQKETYH  120
            WSK W + IEKGPEYGTTEAAWKGVL ESER+ D+H+++K+NLCND+  Q+KTWQKE YH
Sbjct  61   WSKKWGELIEKGPEYGTTEAAWKGVLTESERISDVHMKIKDNLCNDVNSQIKTWQKENYH  120

Query  121  KSMMTLKERKEMEDAFKKAQKPWAKLLQKVEKAKSEYHNSCKTERTAANMERNASADSSL  180
             ++M +KERK++ED FKKAQKPWAKLL KVEKAK++YH++CKTER+A N ERNA+ADSSL
Sbjct  121  HTLMQIKERKDLEDLFKKAQKPWAKLLAKVEKAKADYHSACKTERSATNQERNANADSSL  180

Query  181  SPDQMARGSENVKKMQDRVQKTKEEVQKAKEKYEAALQEINQYNPKYMEDMTQVFEKCQE  240
            SPDQ       VKKM DRVQKTK++VQK +EKYE A+ EI +YN  Y+EDMT VFEKCQ 
Sbjct  181  SPDQ-------VKKMHDRVQKTKDQVQKCREKYEQAIAEITKYNSVYIEDMTSVFEKCQT  233

Query  241  MEAQRLQFFKDVLFGIHKCLNISQDPILPQIYEEFYHTVNNADHEKDLKWWSNNHGVNMA  300
             E  RLQFFK++LF +H CL++++   LPQIYEEF HT+NNAD +KDLKWWSNNHG+NMA
Sbjct  234  FEKTRLQFFKEILFNVHSCLDLTKVQSLPQIYEEFSHTINNADQQKDLKWWSNNHGINMA  293

Query  301  MNWPQFEDYTEEFRDITKGSKSKEALPAGSITLINQRPVGEDVHEYPPVNNKSKSKPSSR  360
            MNWP F +YTEEFRDI KG+KSKEALPA  ITLINQRPV EDVHEYP  N+  K+  +  
Sbjct  294  MNWPSFVEYTEEFRDIAKGNKSKEALPAAPITLINQRPVAEDVHEYPQTNSLKKNTSTLS  353

Query  361  VISTDGGHGDSKTDTMNSSKHSSE---------------KNNHDGNAVNRTSTMTNGTNV  405
             +S+      S+  T  SS  +SE                      A NR S++TNG N 
Sbjct  354  SVSSRAS-VKSEIATTQSSVTTSEAKTSAAVAGAATATAAATAASAASNRNSSVTNG-NG  411

Query  406  KQESNPFEEEEWDEDSGEPLVDNGEPGVLVRALYDYEGAEADELSFKQGDVFDKLEDEDE  465
            K ++NPF+EEE  ++S   LVDNGEPGV V+ALYDYEGAE+DEL+FKQGDVF+KLEDEDE
Sbjct  412  KVDANPFDEEEEWDESDNVLVDNGEPGVPVKALYDYEGAESDELTFKQGDVFEKLEDEDE  471

Query  466  QGWCKGRKDGRVGLYPANYVE  486
            QGWCKGR +GRVGLYPANYVE
Sbjct  472  QGWCKGRMNGRVGLYPANYVE  492


>A0A0B4KH28_DROME unnamed protein product
Length=495

 Score = 665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/502 (65%), Positives = 392/502 (78%), Gaps = 25/502 (5%)

Query  1    MSHHSDDNMLIATSDSFWEPGNYKRTTKRIEDGHKLCDSLIALVQERAEIEKSYAKALKN  60
            MSHHSDD +L A SDSFWEPGNYKRTTKRIEDG+KLC+ L  L+QERA+IEK YAK+L+ 
Sbjct  1    MSHHSDDQLLQAGSDSFWEPGNYKRTTKRIEDGYKLCNDLQQLIQERADIEKGYAKSLRT  60

Query  61   WSKNWNDKIEKGPEYGTTEAAWKGVLVESERLCDLHLRVKENLCNDIIHQVKTWQKETYH  120
            WSK W + IEKGPEYGTTEAAWKGVL ESER+ D+H+++K+NLCND+  Q+KTWQKE YH
Sbjct  61   WSKKWGELIEKGPEYGTTEAAWKGVLTESERISDVHMKIKDNLCNDVNSQIKTWQKENYH  120

Query  121  KSMMTLKERKEMEDAFKKAQKPWAKLLQKVEKAKSEYHNSCKTERTAANMERNASADSSL  180
             ++M +KERK++ED FKKAQKPWAKLL KVEKAK++YH++CKTER+A N ERNA+ADSSL
Sbjct  121  HTLMQIKERKDLEDLFKKAQKPWAKLLAKVEKAKADYHSACKTERSATNQERNANADSSL  180

Query  181  SPDQMARGSENVKKMQDRVQKTKEEVQKAKEKYEAALQEINQYNPKYMEDMTQVFEKCQE  240
            SPDQ       VKKM DRVQKTK++VQK +EKYE A+ EI +YN  Y+EDMT VFEKCQ 
Sbjct  181  SPDQ-------VKKMHDRVQKTKDQVQKCREKYEQAIAEITKYNSVYIEDMTSVFEKCQT  233

Query  241  MEAQRLQFFKDVLFGIHKCLNISQDPILPQIYEEFYHTVNNADHEKDLKWWSNNHGVNMA  300
             E  RLQFFK++LF +H CL++++   LPQIYEEF HT+NNAD +KDLKWWSNNHG+NMA
Sbjct  234  FEKTRLQFFKEILFNVHSCLDLTKVQSLPQIYEEFSHTINNADQQKDLKWWSNNHGINMA  293

Query  301  MNWPQFEDYTEEFRDITKGSKSKEALPAGSITLINQRPVGEDVH-EYPPVNNKSKSKPSS  359
            MNWP F +YTEEFRDI KG+KSKEALPA  ITLINQRPV EDVH EYP  N+  K+  + 
Sbjct  294  MNWPSFVEYTEEFRDIAKGNKSKEALPAAPITLINQRPVAEDVHQEYPQTNSLKKNTSTL  353

Query  360  RVISTDGGHGDSKTDTMNSSKHSSE---------------KNNHDGNAVNRTSTMTNGTN  404
              +S+      S+  T  SS  +SE                      A NR S++TNG N
Sbjct  354  SSVSSRAS-VKSEIATTQSSVTTSEAKTSAAVAGAATATAAATAASAASNRNSSVTNG-N  411

Query  405  VKQESNPFEEEEWDEDSGEPLVDNGEPGVLVRALYDYEGAEADELSFKQGDVFDKLEDED  464
             K ++NPF+EEE  ++S   LVDNGEPGV V+ALYDYEGAE+DEL+FKQGDVF+KLEDED
Sbjct  412  GKVDANPFDEEEEWDESDNVLVDNGEPGVPVKALYDYEGAESDELTFKQGDVFEKLEDED  471

Query  465  EQGWCKGRKDGRVGLYPANYVE  486
            EQGWCKGR +GRVGLYPANYVE
Sbjct  472  EQGWCKGRMNGRVGLYPANYVE  493


>Q09989_CAEEL unnamed protein product
Length=489

 Score = 250 bits (638),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 159/493 (32%), Positives = 255/493 (52%), Gaps = 42/493 (9%)

Query  17   FWEPGNYKRTTKRIEDGHKLCDSLIALVQERAEIEKSYAKALKNWSKNWNDKIEKGPEYG  76
            FWE G+YK   KR +DG +  D    + +ERAEIE  Y+K L   ++ W   +++    G
Sbjct  10   FWEVGSYKHNVKRFKDGVEQLDDYCKMSRERAEIEAKYSKMLSQHAEKWRAHVDRTVSAG  69

Query  77   TTEAAWKGVLVESERLCDLHLRVKENLCNDIIHQVKTWQKETYHKSMMT-LKERKEMEDA  135
            + +  W  ++ E+  L  +H  +K+ L +DI+++  T++K + H S+    KE +E+ED 
Sbjct  70   SVKTVWNELIGEATALSRVHNSLKDCLIDDIVNETTTYRKNSLHTSVFKGPKEIREIEDH  129

Query  136  FKKAQKPWAKLLQKVEKAKSEYHNSCKTERTAANMERNASADSSLSPDQMARGSENVKKM  195
            F+KAQKPW KL+ K+E  + +Y+N C+ E++A    +N   D+S+SPD          K 
Sbjct  130  FEKAQKPWKKLVDKMEDKRGKYYNVCRQEKSALVNLQNCQTDTSVSPDAAT-------KF  182

Query  196  QDRVQKTKEEVQKAKEKYEAALQEINQYNPKYMEDMTQVFEKCQEMEAQRLQFFKDVLFG  255
            ++R +K KEEVQ+ K  Y+  L  +N+Y   YME M  VF+ CQE E  R QF   ++  
Sbjct  183  RERHEKLKEEVQRTKVDYQKTLTNLNEYKNVYMEAMAHVFKMCQEKEMDRSQFLIGIVQK  242

Query  256  IHK-CLNISQDPILPQIYEEFYHTVNNADHE---KDLKWWSNNHGVNMAMNWPQFEDYTE  311
              +   NI ++  +  ++++   ++ +AD E   +DL  WS+ +GV+    WP F +Y+ 
Sbjct  243  TQRHYANIIRNSQMSGLHQQLEQSIRSADSEAVKRDLAQWSSVNGVDAFSEWPSFVEYSP  302

Query  312  EFRDI-TKGSKSKEALPAGSITLINQRPVGEDVHEYPPVNNKSKSKPSSRVISTDGGHGD  370
            E R+I  +G  +K+   AG + L  Q    ED+      +  S + PS   ++T   H D
Sbjct  303  EIRNIAARGGSTKD---AGGVILTRQINRSEDIP-----STHSNTLPSV-AVNTASSHED  353

Query  371  -----------SKTDTMNSSKHSSEKNNHDGNAVNRTSTMTNGT----NVKQESNPFEEE  415
                       S T T +S KH+S  N +     N T           +   +S P   E
Sbjct  354  VGKSSPKSSSESDTSTFDSRKHNSTANKYKNQPQNTTQIQPPPVGWHPSDGPDSPPLSTE  413

Query  416  EWDEDSGEPL--VDNGEPGVLVRALYDYEGAEADELSFKQGDVFDKLEDEDEQGWCKGRK  473
              D             +P V+   LYDY  AE DE++ ++G++ + L + D  GWC GR 
Sbjct  414  TPDSAKYGDFEEFTTSKPAVV---LYDYAPAEGDEIALRKGEMIEVLTEPDSLGWCTGRV  470

Query  474  DGRVGLYPANYVE  486
             G VGL+PA+YV+
Sbjct  471  SGNVGLFPASYVQ  483



Lambda      K        H
   0.319    0.134    0.407 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3252957642


Query= XP_050469477.1 protein kinase C and casein kinase substrate in
neurons protein 2 isoform X2 [Bombus huntii]

Length=487
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VDI1_DROME  unnamed protein product                                 670     0.0  
A0A0B4KH28_DROME  unnamed protein product                             665     0.0  
Q09989_CAEEL  unnamed protein product                                 251     1e-77


>Q9VDI1_DROME unnamed protein product
Length=494

 Score = 670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/498 (66%), Positives = 392/498 (79%), Gaps = 21/498 (4%)

Query  1    MSHHSDDNMLIATSDSFWEPGNYKRTTKRIEDGHKLCDSLIALVQERAEIEKSYAKALKN  60
            MSHHSDD +L A SDSFWEPGNYKRTTKRIEDG+KLC+ L  L+QERA+IEK YAK+L+ 
Sbjct  1    MSHHSDDQLLQAGSDSFWEPGNYKRTTKRIEDGYKLCNDLQQLIQERADIEKGYAKSLRT  60

Query  61   WSKNWNDKIEKGPEYGTTEAAWKGVLVESERLCDLHLRVKENLCNDIIHQVKTWQKETYH  120
            WSK W + IEKGPEYGTTEAAWKGVL ESER+ D+H+++K+NLCND+  Q+KTWQKE YH
Sbjct  61   WSKKWGELIEKGPEYGTTEAAWKGVLTESERISDVHMKIKDNLCNDVNSQIKTWQKENYH  120

Query  121  KSMMTLKERKEMEDAFKKAQKPWAKLLQKVEKAKSEYHNSCKTERTAANMERNASADSSL  180
             ++M +KERK++ED FKKAQKPWAKLL KVEKAK++YH++CKTER+A N ERNA+ADSSL
Sbjct  121  HTLMQIKERKDLEDLFKKAQKPWAKLLAKVEKAKADYHSACKTERSATNQERNANADSSL  180

Query  181  SPDQKALLVKKMQDRVQKTKEEVQKAKEKYEAALQEINQYNPKYMEDMTQVFEKCQEMEA  240
            SPDQ    VKKM DRVQKTK++VQK +EKYE A+ EI +YN  Y+EDMT VFEKCQ  E 
Sbjct  181  SPDQ----VKKMHDRVQKTKDQVQKCREKYEQAIAEITKYNSVYIEDMTSVFEKCQTFEK  236

Query  241  QRLQFFKDVLFGIHKCLNISQDPILPQIYEEFYHTVNNADHEKDLKWWSNNHGVNMAMNW  300
             RLQFFK++LF +H CL++++   LPQIYEEF HT+NNAD +KDLKWWSNNHG+NMAMNW
Sbjct  237  TRLQFFKEILFNVHSCLDLTKVQSLPQIYEEFSHTINNADQQKDLKWWSNNHGINMAMNW  296

Query  301  PQFEDYTEEFRDITKGSKSKEALPAGSITLINQRPVGEDVHEYPPVNNKSKSKPSSRVIS  360
            P F +YTEEFRDI KG+KSKEALPA  ITLINQRPV EDVHEYP  N+  K+  +   +S
Sbjct  297  PSFVEYTEEFRDIAKGNKSKEALPAAPITLINQRPVAEDVHEYPQTNSLKKNTSTLSSVS  356

Query  361  TDGGHGDSKTDTMNSSKHSSE---------------KNNHDGNAVNRTSTMTNGTNVKQE  405
            +      S+  T  SS  +SE                      A NR S++TNG N K +
Sbjct  357  SRAS-VKSEIATTQSSVTTSEAKTSAAVAGAATATAAATAASAASNRNSSVTNG-NGKVD  414

Query  406  SNPFEEEEWDEDSGEPLVDNGEPGVLVRALYDYEGAEADELSFKQGDVFDKLEDEDEQGW  465
            +NPF+EEE  ++S   LVDNGEPGV V+ALYDYEGAE+DEL+FKQGDVF+KLEDEDEQGW
Sbjct  415  ANPFDEEEEWDESDNVLVDNGEPGVPVKALYDYEGAESDELTFKQGDVFEKLEDEDEQGW  474

Query  466  CKGRKDGRVGLYPANYVE  483
            CKGR +GRVGLYPANYVE
Sbjct  475  CKGRMNGRVGLYPANYVE  492


>A0A0B4KH28_DROME unnamed protein product
Length=495

 Score = 665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/499 (66%), Positives = 392/499 (79%), Gaps = 22/499 (4%)

Query  1    MSHHSDDNMLIATSDSFWEPGNYKRTTKRIEDGHKLCDSLIALVQERAEIEKSYAKALKN  60
            MSHHSDD +L A SDSFWEPGNYKRTTKRIEDG+KLC+ L  L+QERA+IEK YAK+L+ 
Sbjct  1    MSHHSDDQLLQAGSDSFWEPGNYKRTTKRIEDGYKLCNDLQQLIQERADIEKGYAKSLRT  60

Query  61   WSKNWNDKIEKGPEYGTTEAAWKGVLVESERLCDLHLRVKENLCNDIIHQVKTWQKETYH  120
            WSK W + IEKGPEYGTTEAAWKGVL ESER+ D+H+++K+NLCND+  Q+KTWQKE YH
Sbjct  61   WSKKWGELIEKGPEYGTTEAAWKGVLTESERISDVHMKIKDNLCNDVNSQIKTWQKENYH  120

Query  121  KSMMTLKERKEMEDAFKKAQKPWAKLLQKVEKAKSEYHNSCKTERTAANMERNASADSSL  180
             ++M +KERK++ED FKKAQKPWAKLL KVEKAK++YH++CKTER+A N ERNA+ADSSL
Sbjct  121  HTLMQIKERKDLEDLFKKAQKPWAKLLAKVEKAKADYHSACKTERSATNQERNANADSSL  180

Query  181  SPDQKALLVKKMQDRVQKTKEEVQKAKEKYEAALQEINQYNPKYMEDMTQVFEKCQEMEA  240
            SPDQ    VKKM DRVQKTK++VQK +EKYE A+ EI +YN  Y+EDMT VFEKCQ  E 
Sbjct  181  SPDQ----VKKMHDRVQKTKDQVQKCREKYEQAIAEITKYNSVYIEDMTSVFEKCQTFEK  236

Query  241  QRLQFFKDVLFGIHKCLNISQDPILPQIYEEFYHTVNNADHEKDLKWWSNNHGVNMAMNW  300
             RLQFFK++LF +H CL++++   LPQIYEEF HT+NNAD +KDLKWWSNNHG+NMAMNW
Sbjct  237  TRLQFFKEILFNVHSCLDLTKVQSLPQIYEEFSHTINNADQQKDLKWWSNNHGINMAMNW  296

Query  301  PQFEDYTEEFRDITKGSKSKEALPAGSITLINQRPVGEDVH-EYPPVNNKSKSKPSSRVI  359
            P F +YTEEFRDI KG+KSKEALPA  ITLINQRPV EDVH EYP  N+  K+  +   +
Sbjct  297  PSFVEYTEEFRDIAKGNKSKEALPAAPITLINQRPVAEDVHQEYPQTNSLKKNTSTLSSV  356

Query  360  STDGGHGDSKTDTMNSSKHSSE---------------KNNHDGNAVNRTSTMTNGTNVKQ  404
            S+      S+  T  SS  +SE                      A NR S++TNG N K 
Sbjct  357  SSRAS-VKSEIATTQSSVTTSEAKTSAAVAGAATATAAATAASAASNRNSSVTNG-NGKV  414

Query  405  ESNPFEEEEWDEDSGEPLVDNGEPGVLVRALYDYEGAEADELSFKQGDVFDKLEDEDEQG  464
            ++NPF+EEE  ++S   LVDNGEPGV V+ALYDYEGAE+DEL+FKQGDVF+KLEDEDEQG
Sbjct  415  DANPFDEEEEWDESDNVLVDNGEPGVPVKALYDYEGAESDELTFKQGDVFEKLEDEDEQG  474

Query  465  WCKGRKDGRVGLYPANYVE  483
            WCKGR +GRVGLYPANYVE
Sbjct  475  WCKGRMNGRVGLYPANYVE  493


>Q09989_CAEEL unnamed protein product
Length=489

 Score = 251 bits (640),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 159/490 (32%), Positives = 255/490 (52%), Gaps = 39/490 (8%)

Query  17   FWEPGNYKRTTKRIEDGHKLCDSLIALVQERAEIEKSYAKALKNWSKNWNDKIEKGPEYG  76
            FWE G+YK   KR +DG +  D    + +ERAEIE  Y+K L   ++ W   +++    G
Sbjct  10   FWEVGSYKHNVKRFKDGVEQLDDYCKMSRERAEIEAKYSKMLSQHAEKWRAHVDRTVSAG  69

Query  77   TTEAAWKGVLVESERLCDLHLRVKENLCNDIIHQVKTWQKETYHKSMMT-LKERKEMEDA  135
            + +  W  ++ E+  L  +H  +K+ L +DI+++  T++K + H S+    KE +E+ED 
Sbjct  70   SVKTVWNELIGEATALSRVHNSLKDCLIDDIVNETTTYRKNSLHTSVFKGPKEIREIEDH  129

Query  136  FKKAQKPWAKLLQKVEKAKSEYHNSCKTERTAANMERNASADSSLSPDQKALLVKKMQDR  195
            F+KAQKPW KL+ K+E  + +Y+N C+ E++A    +N   D+S+SPD       K ++R
Sbjct  130  FEKAQKPWKKLVDKMEDKRGKYYNVCRQEKSALVNLQNCQTDTSVSPD----AATKFRER  185

Query  196  VQKTKEEVQKAKEKYEAALQEINQYNPKYMEDMTQVFEKCQEMEAQRLQFFKDVLFGIHK  255
             +K KEEVQ+ K  Y+  L  +N+Y   YME M  VF+ CQE E  R QF   ++    +
Sbjct  186  HEKLKEEVQRTKVDYQKTLTNLNEYKNVYMEAMAHVFKMCQEKEMDRSQFLIGIVQKTQR  245

Query  256  -CLNISQDPILPQIYEEFYHTVNNADHE---KDLKWWSNNHGVNMAMNWPQFEDYTEEFR  311
               NI ++  +  ++++   ++ +AD E   +DL  WS+ +GV+    WP F +Y+ E R
Sbjct  246  HYANIIRNSQMSGLHQQLEQSIRSADSEAVKRDLAQWSSVNGVDAFSEWPSFVEYSPEIR  305

Query  312  DI-TKGSKSKEALPAGSITLINQRPVGEDVHEYPPVNNKSKSKPSSRVISTDGGHGD---  367
            +I  +G  +K+   AG + L  Q    ED+      +  S + PS   ++T   H D   
Sbjct  306  NIAARGGSTKD---AGGVILTRQINRSEDIP-----STHSNTLPSV-AVNTASSHEDVGK  356

Query  368  --------SKTDTMNSSKHSSEKNNHDGNAVNRTSTMTNGT----NVKQESNPFEEEEWD  415
                    S T T +S KH+S  N +     N T           +   +S P   E  D
Sbjct  357  SSPKSSSESDTSTFDSRKHNSTANKYKNQPQNTTQIQPPPVGWHPSDGPDSPPLSTETPD  416

Query  416  EDSGEPL--VDNGEPGVLVRALYDYEGAEADELSFKQGDVFDKLEDEDEQGWCKGRKDGR  473
                         +P V+   LYDY  AE DE++ ++G++ + L + D  GWC GR  G 
Sbjct  417  SAKYGDFEEFTTSKPAVV---LYDYAPAEGDEIALRKGEMIEVLTEPDSLGWCTGRVSGN  473

Query  474  VGLYPANYVE  483
            VGL+PA+YV+
Sbjct  474  VGLFPASYVQ  483



Lambda      K        H
   0.319    0.134    0.407 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3252957642


Query= XP_050469478.1 protein kinase C and casein kinase substrate in
neurons protein 2 isoform X3 [Bombus huntii]

Length=483
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VDI1_DROME  unnamed protein product                                 675     0.0  
A0A0B4KH28_DROME  unnamed protein product                             671     0.0  
Q09989_CAEEL  unnamed protein product                                 256     8e-80


>Q9VDI1_DROME unnamed protein product
Length=494

 Score = 675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/494 (66%), Positives = 392/494 (79%), Gaps = 17/494 (3%)

Query  1    MSHHSDDNMLIATSDSFWEPGNYKRTTKRIEDGHKLCDSLIALVQERAEIEKSYAKALKN  60
            MSHHSDD +L A SDSFWEPGNYKRTTKRIEDG+KLC+ L  L+QERA+IEK YAK+L+ 
Sbjct  1    MSHHSDDQLLQAGSDSFWEPGNYKRTTKRIEDGYKLCNDLQQLIQERADIEKGYAKSLRT  60

Query  61   WSKNWNDKIEKGPEYGTTEAAWKGVLVESERLCDLHLRVKENLCNDIIHQVKTWQKETYH  120
            WSK W + IEKGPEYGTTEAAWKGVL ESER+ D+H+++K+NLCND+  Q+KTWQKE YH
Sbjct  61   WSKKWGELIEKGPEYGTTEAAWKGVLTESERISDVHMKIKDNLCNDVNSQIKTWQKENYH  120

Query  121  KSMMTLKERKEMEDAFKKAQKPWAKLLQKVEKAKSEYHNSCKTERTAANMERNASADSSL  180
             ++M +KERK++ED FKKAQKPWAKLL KVEKAK++YH++CKTER+A N ERNA+ADSSL
Sbjct  121  HTLMQIKERKDLEDLFKKAQKPWAKLLAKVEKAKADYHSACKTERSATNQERNANADSSL  180

Query  181  SPDQVKKMQDRVQKTKEEVQKAKEKYEAALQEINQYNPKYMEDMTQVFEKCQEMEAQRLQ  240
            SPDQVKKM DRVQKTK++VQK +EKYE A+ EI +YN  Y+EDMT VFEKCQ  E  RLQ
Sbjct  181  SPDQVKKMHDRVQKTKDQVQKCREKYEQAIAEITKYNSVYIEDMTSVFEKCQTFEKTRLQ  240

Query  241  FFKDVLFGIHKCLNISQDPILPQIYEEFYHTVNNADHEKDLKWWSNNHGVNMAMNWPQFE  300
            FFK++LF +H CL++++   LPQIYEEF HT+NNAD +KDLKWWSNNHG+NMAMNWP F 
Sbjct  241  FFKEILFNVHSCLDLTKVQSLPQIYEEFSHTINNADQQKDLKWWSNNHGINMAMNWPSFV  300

Query  301  DYTEEFRDITKGSKSKEALPAGSITLINQRPVGEDVHEYPPVNNKSKSKPSSRVISTDGG  360
            +YTEEFRDI KG+KSKEALPA  ITLINQRPV EDVHEYP  N+  K+  +   +S+   
Sbjct  301  EYTEEFRDIAKGNKSKEALPAAPITLINQRPVAEDVHEYPQTNSLKKNTSTLSSVSSRAS  360

Query  361  HGDSKTDTMNSSKHSSE---------------KNNHDGNAVNRTSTMTNGTNVKQESNPF  405
               S+  T  SS  +SE                      A NR S++TNG N K ++NPF
Sbjct  361  -VKSEIATTQSSVTTSEAKTSAAVAGAATATAAATAASAASNRNSSVTNG-NGKVDANPF  418

Query  406  EEEEWDEDSGEPLVDNGEPGVLVRALYDYEGAEADELSFKQGDVFDKLEDEDEQGWCKGR  465
            +EEE  ++S   LVDNGEPGV V+ALYDYEGAE+DEL+FKQGDVF+KLEDEDEQGWCKGR
Sbjct  419  DEEEEWDESDNVLVDNGEPGVPVKALYDYEGAESDELTFKQGDVFEKLEDEDEQGWCKGR  478

Query  466  KDGRVGLYPANYVE  479
             +GRVGLYPANYVE
Sbjct  479  MNGRVGLYPANYVE  492


>A0A0B4KH28_DROME unnamed protein product
Length=495

 Score = 671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/495 (66%), Positives = 392/495 (79%), Gaps = 18/495 (4%)

Query  1    MSHHSDDNMLIATSDSFWEPGNYKRTTKRIEDGHKLCDSLIALVQERAEIEKSYAKALKN  60
            MSHHSDD +L A SDSFWEPGNYKRTTKRIEDG+KLC+ L  L+QERA+IEK YAK+L+ 
Sbjct  1    MSHHSDDQLLQAGSDSFWEPGNYKRTTKRIEDGYKLCNDLQQLIQERADIEKGYAKSLRT  60

Query  61   WSKNWNDKIEKGPEYGTTEAAWKGVLVESERLCDLHLRVKENLCNDIIHQVKTWQKETYH  120
            WSK W + IEKGPEYGTTEAAWKGVL ESER+ D+H+++K+NLCND+  Q+KTWQKE YH
Sbjct  61   WSKKWGELIEKGPEYGTTEAAWKGVLTESERISDVHMKIKDNLCNDVNSQIKTWQKENYH  120

Query  121  KSMMTLKERKEMEDAFKKAQKPWAKLLQKVEKAKSEYHNSCKTERTAANMERNASADSSL  180
             ++M +KERK++ED FKKAQKPWAKLL KVEKAK++YH++CKTER+A N ERNA+ADSSL
Sbjct  121  HTLMQIKERKDLEDLFKKAQKPWAKLLAKVEKAKADYHSACKTERSATNQERNANADSSL  180

Query  181  SPDQVKKMQDRVQKTKEEVQKAKEKYEAALQEINQYNPKYMEDMTQVFEKCQEMEAQRLQ  240
            SPDQVKKM DRVQKTK++VQK +EKYE A+ EI +YN  Y+EDMT VFEKCQ  E  RLQ
Sbjct  181  SPDQVKKMHDRVQKTKDQVQKCREKYEQAIAEITKYNSVYIEDMTSVFEKCQTFEKTRLQ  240

Query  241  FFKDVLFGIHKCLNISQDPILPQIYEEFYHTVNNADHEKDLKWWSNNHGVNMAMNWPQFE  300
            FFK++LF +H CL++++   LPQIYEEF HT+NNAD +KDLKWWSNNHG+NMAMNWP F 
Sbjct  241  FFKEILFNVHSCLDLTKVQSLPQIYEEFSHTINNADQQKDLKWWSNNHGINMAMNWPSFV  300

Query  301  DYTEEFRDITKGSKSKEALPAGSITLINQRPVGEDVH-EYPPVNNKSKSKPSSRVISTDG  359
            +YTEEFRDI KG+KSKEALPA  ITLINQRPV EDVH EYP  N+  K+  +   +S+  
Sbjct  301  EYTEEFRDIAKGNKSKEALPAAPITLINQRPVAEDVHQEYPQTNSLKKNTSTLSSVSSRA  360

Query  360  GHGDSKTDTMNSSKHSSE---------------KNNHDGNAVNRTSTMTNGTNVKQESNP  404
                S+  T  SS  +SE                      A NR S++TNG N K ++NP
Sbjct  361  S-VKSEIATTQSSVTTSEAKTSAAVAGAATATAAATAASAASNRNSSVTNG-NGKVDANP  418

Query  405  FEEEEWDEDSGEPLVDNGEPGVLVRALYDYEGAEADELSFKQGDVFDKLEDEDEQGWCKG  464
            F+EEE  ++S   LVDNGEPGV V+ALYDYEGAE+DEL+FKQGDVF+KLEDEDEQGWCKG
Sbjct  419  FDEEEEWDESDNVLVDNGEPGVPVKALYDYEGAESDELTFKQGDVFEKLEDEDEQGWCKG  478

Query  465  RKDGRVGLYPANYVE  479
            R +GRVGLYPANYVE
Sbjct  479  RMNGRVGLYPANYVE  493


>Q09989_CAEEL unnamed protein product
Length=489

 Score = 256 bits (655),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 159/486 (33%), Positives = 255/486 (52%), Gaps = 35/486 (7%)

Query  17   FWEPGNYKRTTKRIEDGHKLCDSLIALVQERAEIEKSYAKALKNWSKNWNDKIEKGPEYG  76
            FWE G+YK   KR +DG +  D    + +ERAEIE  Y+K L   ++ W   +++    G
Sbjct  10   FWEVGSYKHNVKRFKDGVEQLDDYCKMSRERAEIEAKYSKMLSQHAEKWRAHVDRTVSAG  69

Query  77   TTEAAWKGVLVESERLCDLHLRVKENLCNDIIHQVKTWQKETYHKSMMT-LKERKEMEDA  135
            + +  W  ++ E+  L  +H  +K+ L +DI+++  T++K + H S+    KE +E+ED 
Sbjct  70   SVKTVWNELIGEATALSRVHNSLKDCLIDDIVNETTTYRKNSLHTSVFKGPKEIREIEDH  129

Query  136  FKKAQKPWAKLLQKVEKAKSEYHNSCKTERTAANMERNASADSSLSPDQVKKMQDRVQKT  195
            F+KAQKPW KL+ K+E  + +Y+N C+ E++A    +N   D+S+SPD   K ++R +K 
Sbjct  130  FEKAQKPWKKLVDKMEDKRGKYYNVCRQEKSALVNLQNCQTDTSVSPDAATKFRERHEKL  189

Query  196  KEEVQKAKEKYEAALQEINQYNPKYMEDMTQVFEKCQEMEAQRLQFFKDVLFGIHK-CLN  254
            KEEVQ+ K  Y+  L  +N+Y   YME M  VF+ CQE E  R QF   ++    +   N
Sbjct  190  KEEVQRTKVDYQKTLTNLNEYKNVYMEAMAHVFKMCQEKEMDRSQFLIGIVQKTQRHYAN  249

Query  255  ISQDPILPQIYEEFYHTVNNADHE---KDLKWWSNNHGVNMAMNWPQFEDYTEEFRDI-T  310
            I ++  +  ++++   ++ +AD E   +DL  WS+ +GV+    WP F +Y+ E R+I  
Sbjct  250  IIRNSQMSGLHQQLEQSIRSADSEAVKRDLAQWSSVNGVDAFSEWPSFVEYSPEIRNIAA  309

Query  311  KGSKSKEALPAGSITLINQRPVGEDVHEYPPVNNKSKSKPSSRVISTDGGHGD-------  363
            +G  +K+   AG + L  Q    ED+      +  S + PS   ++T   H D       
Sbjct  310  RGGSTKD---AGGVILTRQINRSEDIP-----STHSNTLPSV-AVNTASSHEDVGKSSPK  360

Query  364  ----SKTDTMNSSKHSSEKNNHDGNAVNRTSTMTNGT----NVKQESNPFEEEEWDEDSG  415
                S T T +S KH+S  N +     N T           +   +S P   E  D    
Sbjct  361  SSSESDTSTFDSRKHNSTANKYKNQPQNTTQIQPPPVGWHPSDGPDSPPLSTETPDSAKY  420

Query  416  EPL--VDNGEPGVLVRALYDYEGAEADELSFKQGDVFDKLEDEDEQGWCKGRKDGRVGLY  473
                     +P V+   LYDY  AE DE++ ++G++ + L + D  GWC GR  G VGL+
Sbjct  421  GDFEEFTTSKPAVV---LYDYAPAEGDEIALRKGEMIEVLTEPDSLGWCTGRVSGNVGLF  477

Query  474  PANYVE  479
            PA+YV+
Sbjct  478  PASYVQ  483



Lambda      K        H
   0.319    0.134    0.407 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3252957642


Query= XP_050469479.1 protein kinase C and casein kinase substrate in
neurons protein 1 isoform X4 [Bombus huntii]

Length=453
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VDI1_DROME  unnamed protein product                                 587     0.0  
A0A0B4KH28_DROME  unnamed protein product                             587     0.0  
Q09989_CAEEL  unnamed protein product                                 234     9e-72


>Q9VDI1_DROME unnamed protein product
Length=494

 Score = 587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/500 (59%), Positives = 356/500 (71%), Gaps = 59/500 (12%)

Query  1    MSHHSDDNMLIATSDSFWEPGNYKRTTKRIEDGHKLCDSLIALVQERAEIEKSYAKALKN  60
            MSHHSDD +L A SDSFWEPGNYKRTTKRIEDG+KLC+ L  L+QERA+IEK YAK+L+ 
Sbjct  1    MSHHSDDQLLQAGSDSFWEPGNYKRTTKRIEDGYKLCNDLQQLIQERADIEKGYAKSLRT  60

Query  61   WSKNWNDKIEKGPEYGTTEAAWKGVLVESERLCDLHLRVKENLCNDIIHQVKTWQKETYH  120
            WSK W + IEKGPEYGTTEAAWKGVL ESER+ D+H+++K+NLCND+  Q+KTWQKE YH
Sbjct  61   WSKKWGELIEKGPEYGTTEAAWKGVLTESERISDVHMKIKDNLCNDVNSQIKTWQKENYH  120

Query  121  KSMMTLKERKEMEDAFKKAQKPWAKLLQKVEKAKSEYHNSCKTERTAANMERNASADSSL  180
             ++M +KERK++ED FKKAQKPWAKLL KVEKAK++YH++CKTER+A N ERNA+ADSSL
Sbjct  121  HTLMQIKERKDLEDLFKKAQKPWAKLLAKVEKAKADYHSACKTERSATNQERNANADSSL  180

Query  181  SPDQMARGSENVKKMQDRVQKTKEEVQKAKEKYEAALQEINQYNPKYMEDMTQVFEKCQE  240
            SPDQ       VKKM DRVQKTK++VQK +EKYE A+ EI +YN  Y+EDMT VFEKCQ 
Sbjct  181  SPDQ-------VKKMHDRVQKTKDQVQKCREKYEQAIAEITKYNSVYIEDMTSVFEKCQT  233

Query  241  MEAQRLQFFKDVLFGIHKCLNISQDPILPQIYEEFYHTVNNADHEKDLKWWSNNHGVNMA  300
             E  RLQFFK++LF +H CL++++   LPQIYEEF HT+NNAD +KDLKWWSNNHG+NMA
Sbjct  234  FEKTRLQFFKEILFNVHSCLDLTKVQSLPQIYEEFSHTINNADQQKDLKWWSNNHGINMA  293

Query  301  MNWPQFEEYP------------------------------------PVNNKSKSKPSSRV  324
            MNWP F EY                                     P  N  K   S+  
Sbjct  294  MNWPSFVEYTEEFRDIAKGNKSKEALPAAPITLINQRPVAEDVHEYPQTNSLKKNTSTLS  353

Query  325  ISTDGGHGDSKTDTMNSSKHSSE---------------KNNHDGNAVNRTSTMTNGTNVK  369
              +      S+  T  SS  +SE                      A NR S++TNG N K
Sbjct  354  SVSSRASVKSEIATTQSSVTTSEAKTSAAVAGAATATAAATAASAASNRNSSVTNG-NGK  412

Query  370  QESNPFEEEEWDEDSGEPLVDNGEPGVLVRALYDYEGAEADELSFKQGDVFDKLEDEDEQ  429
             ++NPF+EEE  ++S   LVDNGEPGV V+ALYDYEGAE+DEL+FKQGDVF+KLEDEDEQ
Sbjct  413  VDANPFDEEEEWDESDNVLVDNGEPGVPVKALYDYEGAESDELTFKQGDVFEKLEDEDEQ  472

Query  430  GWCKGRKDGRVGLYPANYVE  449
            GWCKGR +GRVGLYPANYVE
Sbjct  473  GWCKGRMNGRVGLYPANYVE  492


>A0A0B4KH28_DROME unnamed protein product
Length=495

 Score = 587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/502 (59%), Positives = 360/502 (72%), Gaps = 62/502 (12%)

Query  1    MSHHSDDNMLIATSDSFWEPGNYKRTTKRIEDGHKLCDSLIALVQERAEIEKSYAKALKN  60
            MSHHSDD +L A SDSFWEPGNYKRTTKRIEDG+KLC+ L  L+QERA+IEK YAK+L+ 
Sbjct  1    MSHHSDDQLLQAGSDSFWEPGNYKRTTKRIEDGYKLCNDLQQLIQERADIEKGYAKSLRT  60

Query  61   WSKNWNDKIEKGPEYGTTEAAWKGVLVESERLCDLHLRVKENLCNDIIHQVKTWQKETYH  120
            WSK W + IEKGPEYGTTEAAWKGVL ESER+ D+H+++K+NLCND+  Q+KTWQKE YH
Sbjct  61   WSKKWGELIEKGPEYGTTEAAWKGVLTESERISDVHMKIKDNLCNDVNSQIKTWQKENYH  120

Query  121  KSMMTLKERKEMEDAFKKAQKPWAKLLQKVEKAKSEYHNSCKTERTAANMERNASADSSL  180
             ++M +KERK++ED FKKAQKPWAKLL KVEKAK++YH++CKTER+A N ERNA+ADSSL
Sbjct  121  HTLMQIKERKDLEDLFKKAQKPWAKLLAKVEKAKADYHSACKTERSATNQERNANADSSL  180

Query  181  SPDQMARGSENVKKMQDRVQKTKEEVQKAKEKYEAALQEINQYNPKYMEDMTQVFEKCQE  240
            SPDQ       VKKM DRVQKTK++VQK +EKYE A+ EI +YN  Y+EDMT VFEKCQ 
Sbjct  181  SPDQ-------VKKMHDRVQKTKDQVQKCREKYEQAIAEITKYNSVYIEDMTSVFEKCQT  233

Query  241  MEAQRLQFFKDVLFGIHKCLNISQDPILPQIYEEFYHTVNNADHEKDLKWWSNNHGVNMA  300
             E  RLQFFK++LF +H CL++++   LPQIYEEF HT+NNAD +KDLKWWSNNHG+NMA
Sbjct  234  FEKTRLQFFKEILFNVHSCLDLTKVQSLPQIYEEFSHTINNADQQKDLKWWSNNHGINMA  293

Query  301  MNWPQF--------------------------------------EEYPPVNNKSKSKPSS  322
            MNWP F                                      +EYP  N+  K+  + 
Sbjct  294  MNWPSFVEYTEEFRDIAKGNKSKEALPAAPITLINQRPVAEDVHQEYPQTNSLKKNTSTL  353

Query  323  RVISTDGGHGDSKTDTMNSSKHSSE---------------KNNHDGNAVNRTSTMTNGTN  367
              +S+      S+  T  SS  +SE                      A NR S++TNG N
Sbjct  354  SSVSSRAS-VKSEIATTQSSVTTSEAKTSAAVAGAATATAAATAASAASNRNSSVTNG-N  411

Query  368  VKQESNPFEEEEWDEDSGEPLVDNGEPGVLVRALYDYEGAEADELSFKQGDVFDKLEDED  427
             K ++NPF+EEE  ++S   LVDNGEPGV V+ALYDYEGAE+DEL+FKQGDVF+KLEDED
Sbjct  412  GKVDANPFDEEEEWDESDNVLVDNGEPGVPVKALYDYEGAESDELTFKQGDVFEKLEDED  471

Query  428  EQGWCKGRKDGRVGLYPANYVE  449
            EQGWCKGR +GRVGLYPANYVE
Sbjct  472  EQGWCKGRMNGRVGLYPANYVE  493


>Q09989_CAEEL unnamed protein product
Length=489

 Score = 234 bits (598),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 152/484 (31%), Positives = 240/484 (50%), Gaps = 61/484 (13%)

Query  17   FWEPGNYKRTTKRIEDGHKLCDSLIALVQERAEIEKSYAKALKNWSKNWNDKIEKGPEYG  76
            FWE G+YK   KR +DG +  D    + +ERAEIE  Y+K L   ++ W   +++    G
Sbjct  10   FWEVGSYKHNVKRFKDGVEQLDDYCKMSRERAEIEAKYSKMLSQHAEKWRAHVDRTVSAG  69

Query  77   TTEAAWKGVLVESERLCDLHLRVKENLCNDIIHQVKTWQKETYHKSMMT-LKERKEMEDA  135
            + +  W  ++ E+  L  +H  +K+ L +DI+++  T++K + H S+    KE +E+ED 
Sbjct  70   SVKTVWNELIGEATALSRVHNSLKDCLIDDIVNETTTYRKNSLHTSVFKGPKEIREIEDH  129

Query  136  FKKAQKPWAKLLQKVEKAKSEYHNSCKTERTAANMERNASADSSLSPDQMARGSENVKKM  195
            F+KAQKPW KL+ K+E  + +Y+N C+ E++A    +N   D+S+SPD          K 
Sbjct  130  FEKAQKPWKKLVDKMEDKRGKYYNVCRQEKSALVNLQNCQTDTSVSPDAAT-------KF  182

Query  196  QDRVQKTKEEVQKAKEKYEAALQEINQYNPKYMEDMTQVFEKCQEMEAQRLQFFKDVLFG  255
            ++R +K KEEVQ+ K  Y+  L  +N+Y   YME M  VF+ CQE E  R QF   ++  
Sbjct  183  RERHEKLKEEVQRTKVDYQKTLTNLNEYKNVYMEAMAHVFKMCQEKEMDRSQFLIGIVQK  242

Query  256  IHK-CLNISQDPILPQIYEEFYHTVNNADHE---KDLKWWSNNHGVNMAMNWPQFEEYPP  311
              +   NI ++  +  ++++   ++ +AD E   +DL  WS+ +GV+    WP F EY P
Sbjct  243  TQRHYANIIRNSQMSGLHQQLEQSIRSADSEAVKRDLAQWSSVNGVDAFSEWPSFVEYSP  302

Query  312  ----------------------VNNKSKSKPS-------SRVISTDGGHGD---------  333
                                    N+S+  PS       S  ++T   H D         
Sbjct  303  EIRNIAARGGSTKDAGGVILTRQINRSEDIPSTHSNTLPSVAVNTASSHEDVGKSSPKSS  362

Query  334  --SKTDTMNSSKHSSEKNNHDGNAVNRTSTMTNGT----NVKQESNPFEEEEWDEDSGEP  387
              S T T +S KH+S  N +     N T           +   +S P   E  D      
Sbjct  363  SESDTSTFDSRKHNSTANKYKNQPQNTTQIQPPPVGWHPSDGPDSPPLSTETPDSAKYGD  422

Query  388  L--VDNGEPGVLVRALYDYEGAEADELSFKQGDVFDKLEDEDEQGWCKGRKDGRVGLYPA  445
                   +P V+   LYDY  AE DE++ ++G++ + L + D  GWC GR  G VGL+PA
Sbjct  423  FEEFTTSKPAVV---LYDYAPAEGDEIALRKGEMIEVLTEPDSLGWCTGRVSGNVGLFPA  479

Query  446  NYVE  449
            +YV+
Sbjct  480  SYVQ  483



Lambda      K        H
   0.319    0.134    0.407 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3252957642


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Oct 18, 2022  4:55 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_050469480.1 transcription termination factor 3, mitochondrial
[Bombus huntii]

Length=419
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MTEF3_DROME  unnamed protein product                                  246     4e-78
ELP3_DROME  unnamed protein product                                   34.7    0.15 
FICD_DROME  unnamed protein product                                   33.9    0.29 


>MTEF3_DROME unnamed protein product
Length=354

 Score = 246 bits (627),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 120/274 (44%), Positives = 181/274 (66%), Gaps = 0/274 (0%)

Query  145  TYNFAKFANDSHTIQQLVKLGVELYKLEANKEVLEMFLKLDFERDMKPYIQFLSDCGVKS  204
            ++N A + N+S T+QQ + LGV+L+ +E  K + +  LKLDFE+++KPYI FL D GV  
Sbjct  80   SFNLAAYVNNSSTLQQFLSLGVDLHSIERRKGLGDFVLKLDFEKNVKPYITFLVDQGVSP  139

Query  205  ENLGFFITRYPKVFKENLDDLHTRIRYLRARNFNIQMIQRIVNIHPPWLAFKTQEIDSRL  264
            ++ G   T+ P +FKE+LDDL TR+ YL+++ F+ +  QRI+  +P WL F T+ +D RL
Sbjct  140  DDFGRMFTKNPLLFKEDLDDLQTRVNYLKSKRFSDEARQRILTQNPYWLMFSTRRVDRRL  199

Query  265  GYFQNNFQLNASQTKNLAVKSPKLITYDMKRIRKSTFAVKEEMGFNVPEIHLILLKAPRV  324
            GYFQ  F+L+    + LA + P  ITY+M+ +RKS F +KEEMGFN  E+  ++++ PR+
Sbjct  200  GYFQKEFKLSGHDLRLLATREPNAITYNMEHLRKSVFTLKEEMGFNAKELSDLVVRKPRL  259

Query  325  LIRARTEVVKTFDYLHNYMELSHTIISQEAQALLCRKSRLERRHKFLVELKRNQYDPTKP  384
            L+    ++V+ F Y+H  M L H  I Q  + L  R+ RL  RH+FL  L R QYDP K 
Sbjct  260  LMIPPDDLVERFSYIHQDMGLPHAQIVQCPELLASREFRLRERHEFLKLLGRAQYDPQKD  319

Query  385  LYVSLLKLVKGSDDEFCEKVAKASIQTYNDFLKT  418
            LY+S   +V+G++  F   VAK+ ++T++ FLKT
Sbjct  320  LYISPKTIVEGNNFYFVRNVAKSDLETFDLFLKT  353


>ELP3_DROME unnamed protein product
Length=552

 Score = 34.7 bits (78),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 27/110 (25%), Positives = 52/110 (47%), Gaps = 7/110 (6%)

Query  147  NFAKFANDSHTIQQLVKLGVELYKLEANKEVLEMFLKL---DFERDMKPYIQFLSDCGVK  203
            + A+  N  HT++ + +   +L K    K V  M   L   DFERD++ +I++  +   +
Sbjct  255  DVARDTNRGHTVRAVCE-SFQLGKDAGYKIVTHMMPDLPNVDFERDIEQFIEYFENPAFR  313

Query  204  SENLGFFITRYPKVFKENLDDLHTRIRYLR-ARNFNIQMIQRIVNIHPPW  252
            S+ L  + T    +    L +L    RY     +  + ++ +I+ + PPW
Sbjct  314  SDGLKIYPTLV--IRGTGLYELWKTGRYKSYPPSMLVDLVAKILALVPPW  361


>FICD_DROME unnamed protein product
Length=492

 Score = 33.9 bits (76),  Expect = 0.29, Method: Compositional matrix adjust.
 Identities = 13/32 (41%), Positives = 23/32 (72%), Gaps = 0/32 (0%)

Query  181  FLKLDFERDMKPYIQFLSDCGVKSENLGFFIT  212
            FLKL  E D++P+++F++DC  K+ +L  + T
Sbjct  414  FLKLANEGDIRPFVRFIADCTEKTLDLYLWAT  445



Lambda      K        H
   0.320    0.136    0.387 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4564573412


Query= XP_050469481.1 TBC1 domain family member 13 [Bombus huntii]

Length=396
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VSM8_DROME  unnamed protein product                                 507     4e-180
Q95TT8_DROME  unnamed protein product                                 505     1e-179
Q9VFX6_DROME  unnamed protein product                                 105     2e-24 


>Q9VSM8_DROME unnamed protein product
Length=403

 Score = 507 bits (1305),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 246/403 (61%), Positives = 305/403 (76%), Gaps = 14/403 (3%)

Query  1    MSILRKRLYEFDDALNAEE--IDLINLKRLCFHGIPDEGGLRPLCWKLLLNYLPSTRASW  58
            MSI + R+ EF+D L   +  IDL  L++L F+G+PD    R L WKLLL YL   R+SW
Sbjct  1    MSIFKARVKEFEDVLAGPQDLIDLKQLRKLAFNGVPDVQSFRALSWKLLLGYLGPRRSSW  60

Query  59   SETLIRKRTLYKTFIEDLIVTPGEANS-------DGERVD---VTLHDHPLNLNPDSKWQ  108
            + TL +KR LYK FIE+L++ PG +++       DG++VD   V L DHPL+  P+S W 
Sbjct  61   TTTLAQKRALYKQFIEELVLPPGHSSNRASVDGGDGDKVDSGGVGLQDHPLSEGPESAWN  120

Query  109  TYFKDNEVLLQIDKDVRRLCPDISFFQQGTDYPRKEIVNANGQ--RRLHHRVQHTVLRSA  166
            T+F DNE LLQIDKDVRRLCPDISFFQQ TDYP + +V++ G+  RRLH RV   VL SA
Sbjct  121  TFFNDNEFLLQIDKDVRRLCPDISFFQQPTDYPCEIVVHSKGEHGRRLHERVVPAVLSSA  180

Query  167  NVERKGLGITKIAVSIRKATEDYAPLAEGGEAHWEVLERILFLYAKLNPGQGYVQGMNEI  226
            NVERKGLG+TKI +  +++ E+YA + EG EAHWEV++RILF+YAKLNPGQGYVQGMNEI
Sbjct  181  NVERKGLGMTKINLITKRSVENYAAMEEGQEAHWEVVQRILFIYAKLNPGQGYVQGMNEI  240

Query  227  VGPIYHAFACDPDQNWREHAEADTFFCFTNLMSEIRDFFIKSLDEAEFGINSMMGKLTTQ  286
            VGPIY+  A DPD  +R HAEAD FFCFT LMSEIRDFFIK+LD+AE GI  MM +L+  
Sbjct  241  VGPIYYVMASDPDLTYRAHAEADCFFCFTALMSEIRDFFIKTLDDAEGGIKFMMARLSNM  300

Query  287  VKVNDPEVWMRLHQQELCPQYYSFRWLTLLLSQEFPLPDVMRIWDSLFADENRFSFLIHI  346
            +K  D  ++  L  QEL PQYYSFRWLTLLLSQEFPLPDV+RIWDS+FADE RF FLI I
Sbjct  301  LKSKDLSIYELLRSQELHPQYYSFRWLTLLLSQEFPLPDVLRIWDSVFADEQRFDFLIKI  360

Query  347  CCAMILLLRDQLLAGDFATNVKLLQNFPSVDIQIVLSKAAALA  389
            CC+MIL+ R+ +L  DFA+NVKLLQN+P +DI +V++ A +LA
Sbjct  361  CCSMILIQREAILENDFASNVKLLQNYPPIDINVVIAHAGSLA  403


>Q95TT8_DROME unnamed protein product
Length=403

 Score = 505 bits (1301),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 245/403 (61%), Positives = 305/403 (76%), Gaps = 14/403 (3%)

Query  1    MSILRKRLYEFDDALNAEE--IDLINLKRLCFHGIPDEGGLRPLCWKLLLNYLPSTRASW  58
            MSI + R+ EF+D L   +  IDL  L++L F+G+PD    R L WKLLL YL   R+SW
Sbjct  1    MSIFKARVKEFEDVLAGPQDLIDLKQLRKLAFNGVPDVQSFRALSWKLLLGYLGPRRSSW  60

Query  59   SETLIRKRTLYKTFIEDLIVTPGEANS-------DGERVD---VTLHDHPLNLNPDSKWQ  108
            + TL +KR LYK FIE+L++ PG +++       DG++VD   V L DHPL+  P+S W 
Sbjct  61   TTTLAQKRALYKQFIEELVLPPGHSSNRASVDGGDGDKVDSGGVGLQDHPLSEGPESAWN  120

Query  109  TYFKDNEVLLQIDKDVRRLCPDISFFQQGTDYPRKEIVNANGQ--RRLHHRVQHTVLRSA  166
            T+F DNE LLQIDKDVRRLCPDISFFQQ TDYP + +V++ G+  RRLH RV   VL SA
Sbjct  121  TFFNDNEFLLQIDKDVRRLCPDISFFQQPTDYPCEIVVHSKGEHGRRLHERVVPAVLSSA  180

Query  167  NVERKGLGITKIAVSIRKATEDYAPLAEGGEAHWEVLERILFLYAKLNPGQGYVQGMNEI  226
            NVERKGLG+TKI +  +++ E+YA + EG EAHWEV++RILF+YAKLNPGQGYVQGMNEI
Sbjct  181  NVERKGLGMTKINLITKRSVENYAAMEEGQEAHWEVVQRILFIYAKLNPGQGYVQGMNEI  240

Query  227  VGPIYHAFACDPDQNWREHAEADTFFCFTNLMSEIRDFFIKSLDEAEFGINSMMGKLTTQ  286
            VGPIY+  A DPD  +R HAEAD FFCFT LMSEIRDFFIK+LD+AE GI  MM +L+  
Sbjct  241  VGPIYYVMASDPDLTYRAHAEADCFFCFTALMSEIRDFFIKTLDDAEGGIKFMMARLSNM  300

Query  287  VKVNDPEVWMRLHQQELCPQYYSFRWLTLLLSQEFPLPDVMRIWDSLFADENRFSFLIHI  346
            +K  D  ++  L  QEL PQYYSFRWLTLLLSQEFPLPDV+RIWDS+FADE RF FLI I
Sbjct  301  LKSKDLSIYELLRSQELHPQYYSFRWLTLLLSQEFPLPDVLRIWDSVFADEQRFDFLIKI  360

Query  347  CCAMILLLRDQLLAGDFATNVKLLQNFPSVDIQIVLSKAAALA  389
            CC+MIL+ ++ +L  DFA+NVKLLQN+P +DI +V++ A +LA
Sbjct  361  CCSMILIQKEAILENDFASNVKLLQNYPPIDINVVIAHAGSLA  403


>Q9VFX6_DROME unnamed protein product
Length=654

 Score = 105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 101/408 (25%), Positives = 163/408 (40%), Gaps = 108/408 (26%)

Query  19   EIDLINLKRLCFHGIPDEGGLRPLCWKLLLNYLPSTRASWSETLIRKRTLYKTFIEDLIV  78
            + D  +L++  F G       R + W LLL  L S   SW+   +++R  Y  F  D + 
Sbjct  56   DADPESLRQSAFAGDLKMSKFRSVHWALLLRVLTSEHRSWTSQRLQQRVRYDKFRADYVR  115

Query  79   TPGEANSDGERVDVTLHDHPLNLNPDSKWQTYFKDNEVLLQIDKDVRRLCPDISFFQQGT  138
             P        ++ V  +D PL+ +  S W  YF D ++   I +DV R  P       G 
Sbjct  116  NP-------HQLAVDCNDDPLSQSTQSVWNQYFSDQDLFAVIRQDVVRTFP-------GV  161

Query  139  DYPRKEIVNANGQRRLHHRVQHTVLRSANVERKGLGITKIAVSIRKATEDYAPLAEGGEA  198
            D+ RK                                               PL +    
Sbjct  162  DFFRK-----------------------------------------------PLVQNA--  172

Query  199  HWEVLERILFLYAKLNPGQGYVQGMNEIVGPIYHAFACDPDQ--NWREHA----------  246
                +  ILF YA+ +P   Y QGM+EI+ PI      D     ++ E A          
Sbjct  173  ----MVNILFYYAREHPYMCYRQGMHEILAPIIFVVYSDHQSLLHFSELAKTDINPTLLD  228

Query  247  -------EADTFFCFTNLMSEIRDFF-IKSLDEAEFGINSMMGK------LTTQVKV---  289
                   EADT+  F+ LM+ +  ++ + +L     G      +       +T+ +V   
Sbjct  229  VLDPAYLEADTYSLFSRLMASVESYYRVSNLVSTPGGHIEQRAESPGDNETSTEAEVIGQ  288

Query  290  -----------NDPEVWMRLHQQELCPQYYSFRWLTLLLSQEFPLPDVMRIWDSLFADEN  338
                        D  +   L + E+    +  RWL LL  +EF L D++ +WD++FAD +
Sbjct  289  LNFIRDKILAKQDQHLHHYLQKMEIPLHIFGIRWLRLLFGREFMLLDLLLLWDAIFADSD  348

Query  339  RFSFLIHICCAMILLLRDQLLAGDFATNVKLLQNFP-SVDIQIVLSKA  385
            RF    +I  AM++ +RD+LL  D+ T++  L  +P +VD+ +VL  A
Sbjct  349  RFDLPNYILVAMLVHIRDKLLLSDYTTSLTYLMRYPNNVDVHLVLRHA  396



Lambda      K        H
   0.320    0.136    0.387 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4564573412


Query= XP_050469482.1 lipid droplet-associated hydrolase [Bombus huntii]

Length=309
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

LDAH_DROME  unnamed protein product                                   253     4e-83
E9AFC6_LEIMA  unnamed protein product                                 32.3    0.44 
ENPL_DICDI  unnamed protein product                                   30.8    1.7  


>LDAH_DROME unnamed protein product
Length=307

 Score = 253 bits (646),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 124/308 (40%), Positives = 190/308 (62%), Gaps = 5/308 (2%)

Query  1    MQRAMLQINGIPTQVITEGRWVEEGLAEYGKKDIVLVITGNPGIAEFYEGFIKTIKSRLP  60
            MQ A + IN IPT + T GRW+EE + E   K+IV+ ITGNPG+  FY  F  T++  L 
Sbjct  1    MQEAYVNINSIPTHIFTWGRWIEETITE---KEIVICITGNPGLPGFYTEFAGTLQKEL-  56

Query  61   TEVPVWVVGNAGHVQPPNNLAITMPSNSTWNEHYSLMAQLEHKKDFIKKYVPDDARLHLI  120
             ++PVWV+G+AGH  PP      +P  S   E ++L  Q+ HK  FI+KYVP D ++HLI
Sbjct  57   GDLPVWVIGHAGHDDPPEASIREVPQLSGNEELFNLDGQIRHKIAFIEKYVPSDVKIHLI  116

Query  121  GHSIGSWMILNILRDDIIAKKITKCYLLFPTIEHLATTTNGWIFTKIILRIASFLILIAW  180
            GHSIG+WMIL +L ++ I  +I KCY+LFPT+E +  + NGW+FTK+ + + S    I +
Sbjct  117  GHSIGAWMILQLLENERIRSRIQKCYMLFPTVERMMESPNGWVFTKVAMPLYSVFGYIFF  176

Query  181  T-FQFLPHVLKIFFISMIALLKGVPSKYNNALLQLVNPHVIERIIKMAKEEMEIIKERDD  239
            + F FLP  L++  I +  L+  +P ++    L+   P V E+++ +A +EM  ++    
Sbjct  177  SFFNFLPVWLRLMLIQIYFLIFSIPRQFLGTALKYSKPSVAEKVVFLADDEMARVRGIQR  236

Query  240  DIISKYADKLWLYYGNCDGWTPVKYYEDLKSKHSDLNAELCKHGYDHSFVLQYDKEMGKL  299
            +I+ +  D L  YYG  DGW P+ YY+ LK  +  ++A+L     DH+FVL++ + M  +
Sbjct  237  EIVEQNLDLLKFYYGTTDGWVPISYYDQLKKDYPKVDAQLDTKKIDHAFVLRHSQPMAVI  296

Query  300  VADVINDN  307
            V D+I  +
Sbjct  297  VRDMIQQH  304


>E9AFC6_LEIMA unnamed protein product
Length=453

 Score = 32.3 bits (72),  Expect = 0.44, Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 21/35 (60%), Gaps = 0/35 (0%)

Query  96   LMAQLEHKKDFIKKYVPDDARLHLIGHSIGSWMIL  130
            L+  L + K+ + KY+  + R+HL+GHS G    L
Sbjct  239  LLLALGYDKETVDKYIEKEPRIHLLGHSFGGATCL  273


>ENPL_DICDI unnamed protein product
Length=768

 Score = 30.8 bits (68),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (51%), Gaps = 1/51 (2%)

Query  113  DDARLHLIGHSIGSWMILNILRDDIIAKKITKCYLLFPTIEHLATTTNGWI  163
            D  + +      GS M L  + D    K++TK YLLFP+ +   TT  G++
Sbjct  459  DKTKYNEFFKKFGSSMKLGAIEDQANKKRLTK-YLLFPSSKEELTTFAGYV  508



Lambda      K        H
   0.320    0.136    0.387 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4564573412


Query= XP_050469483.1 endoplasmic reticulum-Golgi intermediate compartment
protein 3 [Bombus huntii]

Length=385
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q57YS9_TRYB2  unnamed protein product                                 208     2e-63
Q8I339_PLAF7  unnamed protein product                                 30.4    3.7  
WDR1_DROME  unnamed protein product                                   30.0    4.0  


>Q57YS9_TRYB2 unnamed protein product
Length=405

 Score = 208 bits (530),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 133/411 (32%), Positives = 210/411 (51%), Gaps = 36/411 (9%)

Query  1    MQILRQLDVHPK--VREEADILVRTFSGAVVTIISTIIMGILFLSEVNYYLTPTLSEELF  58
            M+ L +LDV PK   R E D   RT  G V+++ S +I+  L + E+ Y+L+     E++
Sbjct  1    MKGLSRLDVFPKFDTRFEQDARQRTALGGVLSMASILIITFLVVGEIRYFLSTVEQHEMY  60

Query  59   VDTSRDSKLRINLDIIVPTISCDVLSIDAMDTTGEHHLQIEHNIFKRRLDLNG-KPIEDP  117
            VD      + + ++I  P + CD+++ DA+D  GE+   +  +  K R+D +  KP+   
Sbjct  61   VDPHIGGIMHMKVNITFPRVPCDLMTADAIDAFGEYVENVVTDTAKVRVDSSTLKPLGKA  120

Query  118  QRTNITDTKARSKTTTKTVENTTEKACGDCYGAAGDIIKCCNTCEDVREAYRLKNWALPA  177
            ++  + D K   K  T   E   E  C  CYGA  +  +CC+TC+DVR A+  + W    
Sbjct  121  RQ--LVDLK---KQPTNGNETGNEN-CPTCYGAEKNPGECCHTCDDVRRAFAERQWEFHE  174

Query  178  LGM-IKQCKNDKSVEKMKTAFIQGCQIYGYMEVNRVGGSFHIAPGDSFSVNHVHVHDVKP  236
              + I QC +++      +A  +GC ++    V RV G+ H  PG  F+    H+H  K 
Sbjct  175  DDVSIAQCAHERLKVAADSASAEGCNLHASFSVPRVTGNIHFVPGRMFNFFGQHLHSFKG  234

Query  237  YTSTQFNMTHKIRHLSFGLNIPGKTNPMDGTTVIAMEGAI--------MFYHYIKIVPTT  288
             T  + N++H +  L FG   PG+ NPMDG  ++   G           F +++K+VPT 
Sbjct  235  ETIRKLNLSHIVHALEFGERFPGQNNPMDG--MVNARGVKDPSEPLIGRFTYFVKVVPTL  292

Query  289  YVRVD----GSTFLTNQFSVTRH--ARQVSFFNGESG--------MPGIFFNYELSPLMV  334
            Y  V     G+   +NQ+SVT H      +   GE+         +PG+F +Y++SP+ V
Sbjct  293  YQVVSMANTGNLVESNQYSVTHHFTPSWAAPKEGETDNPNSDPLVVPGVFISYDISPIRV  352

Query  335  KYTE--KTKSFGHFATNACAIIGGVFTVAGLIDSLLYHSVRAIQKKIELGK  383
              T      S  H     CA+ GGV+TV GLIDSL +H ++ +Q+KI  GK
Sbjct  353  SVTRTHPYPSIVHLVLQLCAVGGGVYTVTGLIDSLFFHGIKRVQEKINRGK  403


>Q8I339_PLAF7 unnamed protein product
Length=3313

 Score = 30.4 bits (67),  Expect = 3.7, Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 44/91 (48%), Gaps = 10/91 (11%)

Query  81    DVLSIDAMDTTGEHHLQIEHNIFKRRL-DLNGKPI-EDPQRTNITDT-------KARSKT  131
             ++L+I+   T  EH+ ++ HN +  +  D+N K I  +       DT       K  +++
Sbjct  1631  NILNINKTGTRDEHYYKLFHNTYADKFKDINPKHICMECDIGYYKDTISFQPCKKCPNQS  1690

Query  132   TTKTVENTTEKACGDCY-GAAGDIIKCCNTC  161
             T K   +T+   C  C+ G   +I K C+TC
Sbjct  1691  TNKKYGSTSLNDCNTCHSGYYKNINKTCSTC  1721


>WDR1_DROME unnamed protein product
Length=608

 Score = 30.0 bits (66),  Expect = 4.0, Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 57/145 (39%), Gaps = 20/145 (14%)

Query  111  GKPI---EDPQRTNITDTKARSKTTTKTVENT------TEKACG---------DCYGAAG  152
            G+PI    DP+  N   T   S    + +EN       TE +C            Y A+G
Sbjct  24   GQPIVLGADPKGKNFLYTNGNS-VIIRNIENPAIADVYTEHSCAVNVAKYSPSGFYIASG  82

Query  153  DIIKCCNTCEDVREAYRLKNWALPALGMIKQCKNDKSVEKMKTAFIQGCQIYGYMEVNRV  212
            D        + V + + LKN   P  G IK        +++  A  +G + +G++ ++  
Sbjct  83   DASGKIRIWDTVNKEHLLKNEFQPIAGPIKDISWSPDNQRI-VAVGEGRERFGHVFMSET  141

Query  213  GGSFHIAPGDSFSVNHVHVHDVKPY  237
            G S     G S S+N       +P+
Sbjct  142  GTSVGEISGQSKSINSADFRPARPF  166



Lambda      K        H
   0.320    0.136    0.387 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4564573412


Query= XP_050469484.1 RING finger protein 121 isoform X1 [Bombus huntii]

Length=334
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RN121_CAEEL  unnamed protein product                                  353     9e-121
Q8ILM8_PLAF7  unnamed protein product                                 47.0    1e-05 
HRD1_CAEEL  unnamed protein product                                   42.4    5e-04 


>RN121_CAEEL unnamed protein product
Length=409

 Score = 353 bits (907),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 166/314 (53%), Positives = 218/314 (69%), Gaps = 12/314 (4%)

Query  13   EMTVEEKWMVQHVKMHEQHKGHDDMHLEMVLILFLTLLVAQIILVEWRKLHYKSYQFVTL  72
            E+T EE+W  +H KMHE+HKGH+ MH+EM++I  ++++V QI LV W++ H+KSYQ  TL
Sbjct  96   ELTEEEQWAEEHRKMHEKHKGHEAMHMEMMVIFMISVIVGQIFLVTWKRKHFKSYQMCTL  155

Query  73   IAMWIIPFGLSLKNHWWRFIFIWLVTSCITGLIVRKAVQKPIAGTTPRLVYKWFLFIYKL  132
            I M  IP  +     W+RF+  WLV    +  I  KA  + I+G TPR VYKWFLF++KL
Sbjct  156  IGMLTIPVYVCFNRSWYRFLATWLVFCIFSAFIWLKASAQHISGGTPRFVYKWFLFLHKL  215

Query  133  SYTLGIISYVLMLATFFGLHLVFEVKPQIWLDWGLLLLFYGLYFGVLGRDVAEICADKMA  192
            SY LG++ Y++M+    G H++F V     +D G+L +FYG+Y+GVLGRD A IC  +MA
Sbjct  216  SYVLGVVGYLIMMGALLGFHVLFGVSQPTLMDAGILFMFYGVYYGVLGRDFAHICTARMA  275

Query  193  SHIGYYVPGHMPTRTLEPGVCAVCGNRLLVSE---NEPGVI---------ENTYKLSCEH  240
            S IGYY P  +P + LE GVCAVCG RL  SE   +   V+         E  YKLSC H
Sbjct  276  SRIGYYTPEGLPKKHLEDGVCAVCGGRLDDSEHVHDADAVVTTKMVEDEDEKLYKLSCGH  335

Query  241  VFHEFCIRGWCIVGKKQTCPYCKEKVDLKKMFYNPWERPHVLYGQLLDWVRWLVAWQPLI  300
            VFHEFCIRGW +VGK QTCPYCKE+VDL++MF NPWE+PH+ YG+LLDW+R+LV WQPLI
Sbjct  336  VFHEFCIRGWVVVGKLQTCPYCKERVDLQRMFKNPWEKPHLFYGKLLDWIRYLVCWQPLI  395

Query  301  LFLAQGINWGLGLE  314
            +   QG+   +GLE
Sbjct  396  VTAVQGLTTWMGLE  409


>Q8ILM8_PLAF7 unnamed protein product
Length=510

 Score = 47.0 bits (110),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 11/58 (19%)

Query  209  EPGVCAVCGNRLLVSENEPGVIENTYKLSCEHVFHEFCIRGWCIVGKKQTCPYCKEKV  266
            E G C +C + L          E + KLSC H+FH  C++ W I  ++QTCP C+ ++
Sbjct  294  EAGTCIICRDDLK---------EGSKKLSCSHIFHVDCLKSWFI--QQQTCPICRTEI  340


>HRD1_CAEEL unnamed protein product
Length=610

 Score = 42.4 bits (98),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 26/56 (46%), Gaps = 9/56 (16%)

Query  211  GVCAVCGNRLLVSENEPGVIENTYKLSCEHVFHEFCIRGWCIVGKKQTCPYCKEKV  266
              C +C   + V  +         +L C HVFH  C+R W    ++QTCP C+  +
Sbjct  290  ATCIICREEMTVDASP-------KRLPCSHVFHAHCLRSW--FQRQQTCPTCRTDI  336



Lambda      K        H
   0.320    0.136    0.387 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4564573412


Query= XP_050469485.1 RING finger protein 121 isoform X1 [Bombus huntii]

Length=334
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RN121_CAEEL  unnamed protein product                                  353     9e-121
Q8ILM8_PLAF7  unnamed protein product                                 47.0    1e-05 
HRD1_CAEEL  unnamed protein product                                   42.4    5e-04 


>RN121_CAEEL unnamed protein product
Length=409

 Score = 353 bits (907),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 166/314 (53%), Positives = 218/314 (69%), Gaps = 12/314 (4%)

Query  13   EMTVEEKWMVQHVKMHEQHKGHDDMHLEMVLILFLTLLVAQIILVEWRKLHYKSYQFVTL  72
            E+T EE+W  +H KMHE+HKGH+ MH+EM++I  ++++V QI LV W++ H+KSYQ  TL
Sbjct  96   ELTEEEQWAEEHRKMHEKHKGHEAMHMEMMVIFMISVIVGQIFLVTWKRKHFKSYQMCTL  155

Query  73   IAMWIIPFGLSLKNHWWRFIFIWLVTSCITGLIVRKAVQKPIAGTTPRLVYKWFLFIYKL  132
            I M  IP  +     W+RF+  WLV    +  I  KA  + I+G TPR VYKWFLF++KL
Sbjct  156  IGMLTIPVYVCFNRSWYRFLATWLVFCIFSAFIWLKASAQHISGGTPRFVYKWFLFLHKL  215

Query  133  SYTLGIISYVLMLATFFGLHLVFEVKPQIWLDWGLLLLFYGLYFGVLGRDVAEICADKMA  192
            SY LG++ Y++M+    G H++F V     +D G+L +FYG+Y+GVLGRD A IC  +MA
Sbjct  216  SYVLGVVGYLIMMGALLGFHVLFGVSQPTLMDAGILFMFYGVYYGVLGRDFAHICTARMA  275

Query  193  SHIGYYVPGHMPTRTLEPGVCAVCGNRLLVSE---NEPGVI---------ENTYKLSCEH  240
            S IGYY P  +P + LE GVCAVCG RL  SE   +   V+         E  YKLSC H
Sbjct  276  SRIGYYTPEGLPKKHLEDGVCAVCGGRLDDSEHVHDADAVVTTKMVEDEDEKLYKLSCGH  335

Query  241  VFHEFCIRGWCIVGKKQTCPYCKEKVDLKKMFYNPWERPHVLYGQLLDWVRWLVAWQPLI  300
            VFHEFCIRGW +VGK QTCPYCKE+VDL++MF NPWE+PH+ YG+LLDW+R+LV WQPLI
Sbjct  336  VFHEFCIRGWVVVGKLQTCPYCKERVDLQRMFKNPWEKPHLFYGKLLDWIRYLVCWQPLI  395

Query  301  LFLAQGINWGLGLE  314
            +   QG+   +GLE
Sbjct  396  VTAVQGLTTWMGLE  409


>Q8ILM8_PLAF7 unnamed protein product
Length=510

 Score = 47.0 bits (110),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 11/58 (19%)

Query  209  EPGVCAVCGNRLLVSENEPGVIENTYKLSCEHVFHEFCIRGWCIVGKKQTCPYCKEKV  266
            E G C +C + L          E + KLSC H+FH  C++ W I  ++QTCP C+ ++
Sbjct  294  EAGTCIICRDDLK---------EGSKKLSCSHIFHVDCLKSWFI--QQQTCPICRTEI  340


>HRD1_CAEEL unnamed protein product
Length=610

 Score = 42.4 bits (98),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 26/56 (46%), Gaps = 9/56 (16%)

Query  211  GVCAVCGNRLLVSENEPGVIENTYKLSCEHVFHEFCIRGWCIVGKKQTCPYCKEKV  266
              C +C   + V  +         +L C HVFH  C+R W    ++QTCP C+  +
Sbjct  290  ATCIICREEMTVDASP-------KRLPCSHVFHAHCLRSW--FQRQQTCPTCRTDI  336



Lambda      K        H
   0.320    0.136    0.387 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4564573412


Query= XP_050469486.1 RING finger protein 121 isoform X2 [Bombus huntii]

Length=314
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RN121_CAEEL  unnamed protein product                                  353     6e-121
Q8ILM8_PLAF7  unnamed protein product                                 47.0    1e-05 
HRD1_CAEEL  unnamed protein product                                   42.4    4e-04 


>RN121_CAEEL unnamed protein product
Length=409

 Score = 353 bits (906),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 166/314 (53%), Positives = 218/314 (69%), Gaps = 12/314 (4%)

Query  13   EMTVEEKWMVQHVKMHEQHKGHDDMHLEMVLILFLTLLVAQIILVEWRKLHYKSYQFVTL  72
            E+T EE+W  +H KMHE+HKGH+ MH+EM++I  ++++V QI LV W++ H+KSYQ  TL
Sbjct  96   ELTEEEQWAEEHRKMHEKHKGHEAMHMEMMVIFMISVIVGQIFLVTWKRKHFKSYQMCTL  155

Query  73   IAMWIIPFGLSLKNHWWRFIFIWLVTSCITGLIVRKAVQKPIAGTTPRLVYKWFLFIYKL  132
            I M  IP  +     W+RF+  WLV    +  I  KA  + I+G TPR VYKWFLF++KL
Sbjct  156  IGMLTIPVYVCFNRSWYRFLATWLVFCIFSAFIWLKASAQHISGGTPRFVYKWFLFLHKL  215

Query  133  SYTLGIISYVLMLATFFGLHLVFEVKPQIWLDWGLLLLFYGLYFGVLGRDVAEICADKMA  192
            SY LG++ Y++M+    G H++F V     +D G+L +FYG+Y+GVLGRD A IC  +MA
Sbjct  216  SYVLGVVGYLIMMGALLGFHVLFGVSQPTLMDAGILFMFYGVYYGVLGRDFAHICTARMA  275

Query  193  SHIGYYVPGHMPTRTLEPGVCAVCGNRLLVSE---NEPGVI---------ENTYKLSCEH  240
            S IGYY P  +P + LE GVCAVCG RL  SE   +   V+         E  YKLSC H
Sbjct  276  SRIGYYTPEGLPKKHLEDGVCAVCGGRLDDSEHVHDADAVVTTKMVEDEDEKLYKLSCGH  335

Query  241  VFHEFCIRGWCIVGKKQTCPYCKEKVDLKKMFYNPWERPHVLYGQLLDWVRWLVAWQPLI  300
            VFHEFCIRGW +VGK QTCPYCKE+VDL++MF NPWE+PH+ YG+LLDW+R+LV WQPLI
Sbjct  336  VFHEFCIRGWVVVGKLQTCPYCKERVDLQRMFKNPWEKPHLFYGKLLDWIRYLVCWQPLI  395

Query  301  LFLAQGINWGLGLE  314
            +   QG+   +GLE
Sbjct  396  VTAVQGLTTWMGLE  409


>Q8ILM8_PLAF7 unnamed protein product
Length=510

 Score = 47.0 bits (110),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 11/58 (19%)

Query  209  EPGVCAVCGNRLLVSENEPGVIENTYKLSCEHVFHEFCIRGWCIVGKKQTCPYCKEKV  266
            E G C +C + L          E + KLSC H+FH  C++ W I  ++QTCP C+ ++
Sbjct  294  EAGTCIICRDDLK---------EGSKKLSCSHIFHVDCLKSWFI--QQQTCPICRTEI  340


>HRD1_CAEEL unnamed protein product
Length=610

 Score = 42.4 bits (98),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 26/56 (46%), Gaps = 9/56 (16%)

Query  211  GVCAVCGNRLLVSENEPGVIENTYKLSCEHVFHEFCIRGWCIVGKKQTCPYCKEKV  266
              C +C   + V  +         +L C HVFH  C+R W    ++QTCP C+  +
Sbjct  290  ATCIICREEMTVDASP-------KRLPCSHVFHAHCLRSW--FQRQQTCPTCRTDI  336



Lambda      K        H
   0.320    0.136    0.387 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4564573412


Query= XP_050469487.1 uncharacterized protein LOC126863405 [Bombus huntii]

Length=327
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q07DP5_DROME  unnamed protein product                                 50.8    1e-06
M9PHD8_DROME  unnamed protein product                                 50.8    1e-06
Q9VJD7_DROME  unnamed protein product                                 44.3    1e-04


>Q07DP5_DROME unnamed protein product
Length=1715

 Score = 50.8 bits (120),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 64/152 (42%), Gaps = 3/152 (2%)

Query  128  ANSWTNTVYQR---TNKLYPQTNKFYPRTNVVYPPTNVVYPPTTVVYSPTNVVYPPTNVV  184
            A S  N  YQ     N+   Q N+ Y  +N  Y  +N  Y      Y   N     +N  
Sbjct  208  AQSDLNPGYQDLNIGNQDLNQVNREYQESNNEYQVSNQEYQHLNTEYQELNHGDQDSNDE  267

Query  185  YPQTNCEFPQTNCEFSQTNCKFTQTNCEFTQTNCEFTQTNCEFTQTNCEFTQTNCEFTQT  244
            Y + N     +N E+ ++N     +N E+ + N     +N E+ + N     ++ E+   
Sbjct  268  YQELNHGNQDSNDEYQESNHGNQDSNDEYQELNHSNQDSNDEYQELNHGDQDSSDEYQDL  327

Query  245  NCEFPWTNCEFPWTNCEFPWTNCEYPQMNREY  276
            N     +N E+   N E+  +N EY  +NREY
Sbjct  328  NHVNQDSNHEYQAWNHEYQDSNHEYQALNREY  359


 Score = 45.4 bits (106),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 57/136 (42%), Gaps = 0/136 (0%)

Query  161  NVVYPPTTVVYSPTNVVYPPTNVVYPQTNCEFPQTNCEFSQTNCKFTQTNCEFTQTNCEF  220
            N  Y  +   Y  +N  Y   N  Y + N     +N E+ + N     +N E+ ++N   
Sbjct  230  NREYQESNNEYQVSNQEYQHLNTEYQELNHGDQDSNDEYQELNHGNQDSNDEYQESNHGN  289

Query  221  TQTNCEFTQTNCEFTQTNCEFTQTNCEFPWTNCEFPWTNCEFPWTNCEYPQMNREYPRTN  280
              +N E+ + N     +N E+ + N     ++ E+   N     +N EY   N EY  +N
Sbjct  290  QDSNDEYQELNHSNQDSNDEYQELNHGDQDSSDEYQDLNHVNQDSNHEYQAWNHEYQDSN  349

Query  281  FGCPWMNYEYPWKKPD  296
                 +N EY + + D
Sbjct  350  HEYQALNREYQYPESD  365


 Score = 38.9 bits (89),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 32/144 (22%), Positives = 59/144 (41%), Gaps = 1/144 (1%)

Query  107  VNVWTRELNSWISGFKPRSSNANSWTNTVYQRTNKLYPQTNKFYPRTNVVYPPTNVVYPP  166
            +N+  ++LN     ++  S+N    +N  YQ  N  Y + N     +N  Y   N     
Sbjct  219  LNIGNQDLNQVNREYQ-ESNNEYQVSNQEYQHLNTEYQELNHGDQDSNDEYQELNHGNQD  277

Query  167  TTVVYSPTNVVYPPTNVVYPQTNCEFPQTNCEFSQTNCKFTQTNCEFTQTNCEFTQTNCE  226
            +   Y  +N     +N  Y + N     +N E+ + N     ++ E+   N     +N E
Sbjct  278  SNDEYQESNHGNQDSNDEYQELNHSNQDSNDEYQELNHGDQDSSDEYQDLNHVNQDSNHE  337

Query  227  FTQTNCEFTQTNCEFTQTNCEFPW  250
            +   N E+  +N E+   N E+ +
Sbjct  338  YQAWNHEYQDSNHEYQALNREYQY  361


 Score = 37.7 bits (86),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 31/130 (24%), Positives = 53/130 (41%), Gaps = 7/130 (5%)

Query  175  NVVYPPTNVVYPQTNCEFPQTNCEFSQTNCKFTQTNCEFTQTNCEFTQTNCEFTQTNCEF  234
            N  Y  +N  Y  +N E+   N E+ + N     +N E+ + N     +N E+ ++N   
Sbjct  230  NREYQESNNEYQVSNQEYQHLNTEYQELNHGDQDSNDEYQELNHGNQDSNDEYQESNHGN  289

Query  235  TQTNCEFTQTNCEFPWTNCEFPWTNCEFPWTNCEYPQMNR-------EYPRTNFGCPWMN  287
              +N E+ + N     +N E+   N     ++ EY  +N        EY   N      N
Sbjct  290  QDSNDEYQELNHSNQDSNDEYQELNHGDQDSSDEYQDLNHVNQDSNHEYQAWNHEYQDSN  349

Query  288  YEYPWKKPDY  297
            +EY     +Y
Sbjct  350  HEYQALNREY  359


 Score = 34.3 bits (77),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 19/60 (32%), Positives = 27/60 (45%), Gaps = 7/60 (12%)

Query  238  NCEFTQTNCEFPWTNCEFPWTNCEFPWTNCEYPQMNR-------EYPRTNFGCPWMNYEY  290
            N +  Q N E+  +N E+  +N E+   N EY ++N        EY   N G    N EY
Sbjct  223  NQDLNQVNREYQESNNEYQVSNQEYQHLNTEYQELNHGDQDSNDEYQELNHGNQDSNDEY  282


>M9PHD8_DROME unnamed protein product
Length=1714

 Score = 50.8 bits (120),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 64/152 (42%), Gaps = 3/152 (2%)

Query  128  ANSWTNTVYQR---TNKLYPQTNKFYPRTNVVYPPTNVVYPPTTVVYSPTNVVYPPTNVV  184
            A S  N  YQ     N+   Q N+ Y  +N  Y  +N  Y      Y   N     +N  
Sbjct  207  AQSDLNPGYQDLNIGNQDLNQVNREYQESNNEYQVSNQEYQHLNTEYQELNHGDQDSNDE  266

Query  185  YPQTNCEFPQTNCEFSQTNCKFTQTNCEFTQTNCEFTQTNCEFTQTNCEFTQTNCEFTQT  244
            Y + N     +N E+ ++N     +N E+ + N     +N E+ + N     ++ E+   
Sbjct  267  YQELNHGNQDSNDEYQESNHGNQDSNDEYQELNHSNQDSNDEYQELNHGDQDSSDEYQDL  326

Query  245  NCEFPWTNCEFPWTNCEFPWTNCEYPQMNREY  276
            N     +N E+   N E+  +N EY  +NREY
Sbjct  327  NHVNQDSNHEYQAWNHEYQDSNHEYQALNREY  358


 Score = 45.1 bits (105),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 57/136 (42%), Gaps = 0/136 (0%)

Query  161  NVVYPPTTVVYSPTNVVYPPTNVVYPQTNCEFPQTNCEFSQTNCKFTQTNCEFTQTNCEF  220
            N  Y  +   Y  +N  Y   N  Y + N     +N E+ + N     +N E+ ++N   
Sbjct  229  NREYQESNNEYQVSNQEYQHLNTEYQELNHGDQDSNDEYQELNHGNQDSNDEYQESNHGN  288

Query  221  TQTNCEFTQTNCEFTQTNCEFTQTNCEFPWTNCEFPWTNCEFPWTNCEYPQMNREYPRTN  280
              +N E+ + N     +N E+ + N     ++ E+   N     +N EY   N EY  +N
Sbjct  289  QDSNDEYQELNHSNQDSNDEYQELNHGDQDSSDEYQDLNHVNQDSNHEYQAWNHEYQDSN  348

Query  281  FGCPWMNYEYPWKKPD  296
                 +N EY + + D
Sbjct  349  HEYQALNREYQYPESD  364


 Score = 38.9 bits (89),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 32/144 (22%), Positives = 59/144 (41%), Gaps = 1/144 (1%)

Query  107  VNVWTRELNSWISGFKPRSSNANSWTNTVYQRTNKLYPQTNKFYPRTNVVYPPTNVVYPP  166
            +N+  ++LN     ++  S+N    +N  YQ  N  Y + N     +N  Y   N     
Sbjct  218  LNIGNQDLNQVNREYQ-ESNNEYQVSNQEYQHLNTEYQELNHGDQDSNDEYQELNHGNQD  276

Query  167  TTVVYSPTNVVYPPTNVVYPQTNCEFPQTNCEFSQTNCKFTQTNCEFTQTNCEFTQTNCE  226
            +   Y  +N     +N  Y + N     +N E+ + N     ++ E+   N     +N E
Sbjct  277  SNDEYQESNHGNQDSNDEYQELNHSNQDSNDEYQELNHGDQDSSDEYQDLNHVNQDSNHE  336

Query  227  FTQTNCEFTQTNCEFTQTNCEFPW  250
            +   N E+  +N E+   N E+ +
Sbjct  337  YQAWNHEYQDSNHEYQALNREYQY  360


 Score = 37.7 bits (86),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 31/130 (24%), Positives = 53/130 (41%), Gaps = 7/130 (5%)

Query  175  NVVYPPTNVVYPQTNCEFPQTNCEFSQTNCKFTQTNCEFTQTNCEFTQTNCEFTQTNCEF  234
            N  Y  +N  Y  +N E+   N E+ + N     +N E+ + N     +N E+ ++N   
Sbjct  229  NREYQESNNEYQVSNQEYQHLNTEYQELNHGDQDSNDEYQELNHGNQDSNDEYQESNHGN  288

Query  235  TQTNCEFTQTNCEFPWTNCEFPWTNCEFPWTNCEYPQMNR-------EYPRTNFGCPWMN  287
              +N E+ + N     +N E+   N     ++ EY  +N        EY   N      N
Sbjct  289  QDSNDEYQELNHSNQDSNDEYQELNHGDQDSSDEYQDLNHVNQDSNHEYQAWNHEYQDSN  348

Query  288  YEYPWKKPDY  297
            +EY     +Y
Sbjct  349  HEYQALNREY  358


 Score = 34.3 bits (77),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 19/60 (32%), Positives = 27/60 (45%), Gaps = 7/60 (12%)

Query  238  NCEFTQTNCEFPWTNCEFPWTNCEFPWTNCEYPQMNR-------EYPRTNFGCPWMNYEY  290
            N +  Q N E+  +N E+  +N E+   N EY ++N        EY   N G    N EY
Sbjct  222  NQDLNQVNREYQESNNEYQVSNQEYQHLNTEYQELNHGDQDSNDEYQELNHGNQDSNDEY  281


>Q9VJD7_DROME unnamed protein product
Length=494

 Score = 44.3 bits (103),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 28/71 (39%), Gaps = 0/71 (0%)

Query  133  NTVYQRTNKLYPQTNKFYPRTNVVYPPTNVVYPPTTVVYSPTNVVYPPTNVVYPQTNCEF  192
            N  Y   N  YP  N  YP  N  YP  N  YP     Y   N  YP  N  YP  N  +
Sbjct  124  NGGYTTPNGGYPVNNGGYPVNNGGYPSNNGGYPSNNGGYPVNNGGYPVNNGGYPANNGGY  183

Query  193  PQTNCEFSQTN  203
            P  N  +  TN
Sbjct  184  PANNGGYPTTN  194


 Score = 42.7 bits (99),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 26/64 (41%), Gaps = 0/64 (0%)

Query  133  NTVYQRTNKLYPQTNKFYPRTNVVYPPTNVVYPPTTVVYSPTNVVYPPTNVVYPQTNCEF  192
            N  Y   N  YP  N  YP  N  YP  N  YP     Y   N  YP TNV  P  N   
Sbjct  145  NGGYPSNNGGYPSNNGGYPVNNGGYPVNNGGYPANNGGYPANNGGYPTTNVGNPTNNGGN  204

Query  193  PQTN  196
            P TN
Sbjct  205  PTTN  208


 Score = 42.0 bits (97),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/71 (34%), Positives = 29/71 (41%), Gaps = 0/71 (0%)

Query  231  NCEFTQTNCEFTQTNCEFPWTNCEFPWTNCEFPWTNCEYPQMNREYPRTNFGCPWMNYEY  290
            N  +T  N  +   N  +P  N  +P  N  +P  N  YP  N  YP  N G P  N  Y
Sbjct  124  NGGYTTPNGGYPVNNGGYPVNNGGYPSNNGGYPSNNGGYPVNNGGYPVNNGGYPANNGGY  183

Query  291  PWKKPDYLRTN  301
            P     Y  TN
Sbjct  184  PANNGGYPTTN  194


 Score = 41.6 bits (96),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 46/124 (37%), Gaps = 8/124 (6%)

Query  196  NCEFSQTNCKFTQTNCEFTQTNCEFTQTNCEFTQTNCEFTQTNCEFTQTNCEFPWTNCEF  255
            N  ++  N  +   N  +   N  +   N  +   N  +   N  +   N  +P  N  +
Sbjct  124  NGGYTTPNGGYPVNNGGYPVNNGGYPSNNGGYPSNNGGYPVNNGGYPVNNGGYPANNGGY  183

Query  256  PWTNCEFPWTNCEYPQMNREYPRTNFGCPWMNYEYP--------WKKPDYLRTNPDIVQM  307
            P  N  +P TN   P  N   P TNFG P  N   P           P    +N + +QM
Sbjct  184  PANNGGYPTTNVGNPTNNGGNPTTNFGNPTNNGGNPTTNVGSSELLSPSCGMSNANGLQM  243

Query  308  LETV  311
            +E +
Sbjct  244  VEGI  247


 Score = 39.7 bits (91),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 24/71 (34%), Positives = 27/71 (38%), Gaps = 0/71 (0%)

Query  140  NKLYPQTNKFYPRTNVVYPPTNVVYPPTTVVYSPTNVVYPPTNVVYPQTNCEFPQTNCEF  199
            N  Y   N  YP  N  YP  N  YP     Y   N  YP  N  YP  N  +P  N  +
Sbjct  124  NGGYTTPNGGYPVNNGGYPVNNGGYPSNNGGYPSNNGGYPVNNGGYPVNNGGYPANNGGY  183

Query  200  SQTNCKFTQTN  210
               N  +  TN
Sbjct  184  PANNGGYPTTN  194



Lambda      K        H
   0.320    0.136    0.387 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4564573412


Query= XP_050469488.1 uncharacterized protein LOC126863406 [Bombus huntii]

Length=263


***** No hits found *****



Lambda      K        H
   0.320    0.136    0.387 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4564573412


Query= XP_050469489.1 uncharacterized protein LOC126863407 [Bombus huntii]

Length=192
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VKE2_DROME  unnamed protein product                                 40.0    6e-04
O96967_DROME  unnamed protein product                                 40.0    6e-04
LCP1_DROME  unnamed protein product                                   32.3    0.088


>Q9VKE2_DROME unnamed protein product
Length=477

 Score = 40.0 bits (92),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 32/59 (54%), Gaps = 3/59 (5%)

Query  38   RP-YSFQYQAGRYPGNIDRVHQESGDGAGHVQGSYSFIDPKHKIRTVQYAADE-SGFHA  94
            RP YSF Y         D+  +E  DG   V+G YS I+P    R V+Y AD+ SGF+A
Sbjct  74   RPQYSFAYDVRDSLTGDDKRQEEKRDG-DLVKGQYSLIEPDGTRRIVEYTADDVSGFNA  131


>O96967_DROME unnamed protein product
Length=472

 Score = 40.0 bits (92),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 32/59 (54%), Gaps = 3/59 (5%)

Query  38   RP-YSFQYQAGRYPGNIDRVHQESGDGAGHVQGSYSFIDPKHKIRTVQYAADE-SGFHA  94
            RP YSF Y         D+  +E  DG   V+G YS I+P    R V+Y AD+ SGF+A
Sbjct  74   RPQYSFAYDVRDSLTGDDKRQEEKRDG-DLVKGQYSLIEPDGTRRIVEYTADDVSGFNA  131


>LCP1_DROME unnamed protein product
Length=130

 Score = 32.3 bits (72),  Expect = 0.088, Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 24/36 (67%), Gaps = 0/36 (0%)

Query  60  SGDGAGHVQGSYSFIDPKHKIRTVQYAADESGFHAS  95
           SGD  G++ G++ +I P+ +   V+Y A+E+G+  S
Sbjct  61  SGDAHGNIHGNFGWISPEGEHVEVKYVANENGYQPS  96



Lambda      K        H
   0.320    0.136    0.387 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4564573412


Query= XP_050469490.1 lipid droplet-associated hydrolase [Bombus huntii]

Length=309
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

LDAH_DROME  unnamed protein product                                   253     4e-83
E9AFC6_LEIMA  unnamed protein product                                 32.3    0.44 
ENPL_DICDI  unnamed protein product                                   30.8    1.7  


>LDAH_DROME unnamed protein product
Length=307

 Score = 253 bits (646),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 124/308 (40%), Positives = 190/308 (62%), Gaps = 5/308 (2%)

Query  1    MQRAMLQINGIPTQVITEGRWVEEGLAEYGKKDIVLVITGNPGIAEFYEGFIKTIKSRLP  60
            MQ A + IN IPT + T GRW+EE + E   K+IV+ ITGNPG+  FY  F  T++  L 
Sbjct  1    MQEAYVNINSIPTHIFTWGRWIEETITE---KEIVICITGNPGLPGFYTEFAGTLQKEL-  56

Query  61   TEVPVWVVGNAGHVQPPNNLAITMPSNSTWNEHYSLMAQLEHKKDFIKKYVPDDARLHLI  120
             ++PVWV+G+AGH  PP      +P  S   E ++L  Q+ HK  FI+KYVP D ++HLI
Sbjct  57   GDLPVWVIGHAGHDDPPEASIREVPQLSGNEELFNLDGQIRHKIAFIEKYVPSDVKIHLI  116

Query  121  GHSIGSWMILNILRDDIIAKKITKCYLLFPTIEHLATTTNGWIFTKIILRIASFLILIAW  180
            GHSIG+WMIL +L ++ I  +I KCY+LFPT+E +  + NGW+FTK+ + + S    I +
Sbjct  117  GHSIGAWMILQLLENERIRSRIQKCYMLFPTVERMMESPNGWVFTKVAMPLYSVFGYIFF  176

Query  181  T-FQFLPHVLKIFFISMIALLKGVPSKYNNALLQLVNPHVIERIIKMAKEEMEIIKERDD  239
            + F FLP  L++  I +  L+  +P ++    L+   P V E+++ +A +EM  ++    
Sbjct  177  SFFNFLPVWLRLMLIQIYFLIFSIPRQFLGTALKYSKPSVAEKVVFLADDEMARVRGIQR  236

Query  240  DIISKYADKLWLYYGNCDGWTPVKYYEDLKSKHSDLNAELCKHGYDHSFVLQYDKEMGKL  299
            +I+ +  D L  YYG  DGW P+ YY+ LK  +  ++A+L     DH+FVL++ + M  +
Sbjct  237  EIVEQNLDLLKFYYGTTDGWVPISYYDQLKKDYPKVDAQLDTKKIDHAFVLRHSQPMAVI  296

Query  300  VADVINDN  307
            V D+I  +
Sbjct  297  VRDMIQQH  304


>E9AFC6_LEIMA unnamed protein product
Length=453

 Score = 32.3 bits (72),  Expect = 0.44, Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 21/35 (60%), Gaps = 0/35 (0%)

Query  96   LMAQLEHKKDFIKKYVPDDARLHLIGHSIGSWMIL  130
            L+  L + K+ + KY+  + R+HL+GHS G    L
Sbjct  239  LLLALGYDKETVDKYIEKEPRIHLLGHSFGGATCL  273


>ENPL_DICDI unnamed protein product
Length=768

 Score = 30.8 bits (68),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (51%), Gaps = 1/51 (2%)

Query  113  DDARLHLIGHSIGSWMILNILRDDIIAKKITKCYLLFPTIEHLATTTNGWI  163
            D  + +      GS M L  + D    K++TK YLLFP+ +   TT  G++
Sbjct  459  DKTKYNEFFKKFGSSMKLGAIEDQANKKRLTK-YLLFPSSKEELTTFAGYV  508



Lambda      K        H
   0.320    0.136    0.387 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4564573412


Query= XP_050469491.1 reactive oxygen species modulator 1 [Bombus huntii]

Length=78
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VUM2_DROME  unnamed protein product                                 121     4e-38
Q9U283_CAEEL  unnamed protein product                                 26.6    2.1  
H2KZZ3_CAEEL  unnamed protein product                                 26.6    2.6  


>Q9VUM2_DROME unnamed protein product
Length=79

 Score = 121 bits (304),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 65/70 (93%), Gaps = 0/70 (0%)

Query  9   QQAPSCWDRMKLGFMIGFCVGMASGVLFGGYSVVRYGLRGRELINNVGKAMIQGGGTFGT  68
           QQ P+C+D+MK GF+IGFCVGMASG +FGG+S +RYGLRGRELINNVGK M+QGGGTFGT
Sbjct  10  QQGPTCFDKMKTGFIIGFCVGMASGAVFGGFSALRYGLRGRELINNVGKTMVQGGGTFGT  69

Query  69  FMAIGSGIRC  78
           FMAIG+GIRC
Sbjct  70  FMAIGTGIRC  79


>Q9U283_CAEEL unnamed protein product
Length=343

 Score = 26.6 bits (57),  Expect = 2.1, Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 18/35 (51%), Gaps = 0/35 (0%)

Query  2    PAVPGMYQQAPSCWDRMKLGFMIGFCVGMASGVLF  36
            P + G+ +   S  D  KL   IGF VG+ + VL 
Sbjct  106  PTMDGIAKTIESVADHFKLNQFIGFGVGVGANVLL  140


>H2KZZ3_CAEEL unnamed protein product
Length=473

 Score = 26.6 bits (57),  Expect = 2.6, Method: Composition-based stats.
 Identities = 18/45 (40%), Positives = 23/45 (51%), Gaps = 8/45 (18%)

Query  37   GGYSVVRYGLRGR------ELINNVGKAMIQGG--GTFGTFMAIG  73
            G YSV +Y  RG       + I+  G++   GG  G FGT M IG
Sbjct  88   GPYSVRKYQPRGSPPSDGSDKIHRFGESPTPGGVGGVFGTEMTIG  132



Lambda      K        H
   0.320    0.136    0.387 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4564573412


Query= XP_050469492.1 reactive oxygen species modulator 1 [Bombus huntii]

Length=78
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VUM2_DROME  unnamed protein product                                 121     4e-38
Q9U283_CAEEL  unnamed protein product                                 26.6    2.1  
H2KZZ3_CAEEL  unnamed protein product                                 26.6    2.6  


>Q9VUM2_DROME unnamed protein product
Length=79

 Score = 121 bits (304),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 65/70 (93%), Gaps = 0/70 (0%)

Query  9   QQAPSCWDRMKLGFMIGFCVGMASGVLFGGYSVVRYGLRGRELINNVGKAMIQGGGTFGT  68
           QQ P+C+D+MK GF+IGFCVGMASG +FGG+S +RYGLRGRELINNVGK M+QGGGTFGT
Sbjct  10  QQGPTCFDKMKTGFIIGFCVGMASGAVFGGFSALRYGLRGRELINNVGKTMVQGGGTFGT  69

Query  69  FMAIGSGIRC  78
           FMAIG+GIRC
Sbjct  70  FMAIGTGIRC  79


>Q9U283_CAEEL unnamed protein product
Length=343

 Score = 26.6 bits (57),  Expect = 2.1, Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 18/35 (51%), Gaps = 0/35 (0%)

Query  2    PAVPGMYQQAPSCWDRMKLGFMIGFCVGMASGVLF  36
            P + G+ +   S  D  KL   IGF VG+ + VL 
Sbjct  106  PTMDGIAKTIESVADHFKLNQFIGFGVGVGANVLL  140


>H2KZZ3_CAEEL unnamed protein product
Length=473

 Score = 26.6 bits (57),  Expect = 2.6, Method: Composition-based stats.
 Identities = 18/45 (40%), Positives = 23/45 (51%), Gaps = 8/45 (18%)

Query  37   GGYSVVRYGLRGR------ELINNVGKAMIQGG--GTFGTFMAIG  73
            G YSV +Y  RG       + I+  G++   GG  G FGT M IG
Sbjct  88   GPYSVRKYQPRGSPPSDGSDKIHRFGESPTPGGVGGVFGTEMTIG  132



Lambda      K        H
   0.320    0.136    0.387 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4564573412


Query= XP_050469493.1 reactive oxygen species modulator 1 [Bombus huntii]

Length=78
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VUM2_DROME  unnamed protein product                                 121     4e-38
Q9U283_CAEEL  unnamed protein product                                 26.6    2.1  
H2KZZ3_CAEEL  unnamed protein product                                 26.6    2.6  


>Q9VUM2_DROME unnamed protein product
Length=79

 Score = 121 bits (304),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 65/70 (93%), Gaps = 0/70 (0%)

Query  9   QQAPSCWDRMKLGFMIGFCVGMASGVLFGGYSVVRYGLRGRELINNVGKAMIQGGGTFGT  68
           QQ P+C+D+MK GF+IGFCVGMASG +FGG+S +RYGLRGRELINNVGK M+QGGGTFGT
Sbjct  10  QQGPTCFDKMKTGFIIGFCVGMASGAVFGGFSALRYGLRGRELINNVGKTMVQGGGTFGT  69

Query  69  FMAIGSGIRC  78
           FMAIG+GIRC
Sbjct  70  FMAIGTGIRC  79


>Q9U283_CAEEL unnamed protein product
Length=343

 Score = 26.6 bits (57),  Expect = 2.1, Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 18/35 (51%), Gaps = 0/35 (0%)

Query  2    PAVPGMYQQAPSCWDRMKLGFMIGFCVGMASGVLF  36
            P + G+ +   S  D  KL   IGF VG+ + VL 
Sbjct  106  PTMDGIAKTIESVADHFKLNQFIGFGVGVGANVLL  140


>H2KZZ3_CAEEL unnamed protein product
Length=473

 Score = 26.6 bits (57),  Expect = 2.6, Method: Composition-based stats.
 Identities = 18/45 (40%), Positives = 23/45 (51%), Gaps = 8/45 (18%)

Query  37   GGYSVVRYGLRGR------ELINNVGKAMIQGG--GTFGTFMAIG  73
            G YSV +Y  RG       + I+  G++   GG  G FGT M IG
Sbjct  88   GPYSVRKYQPRGSPPSDGSDKIHRFGESPTPGGVGGVFGTEMTIG  132



Lambda      K        H
   0.320    0.136    0.387 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4564573412


Query= XP_050469494.1 sialin-like [Bombus huntii]

Length=458
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VPX2_DROME  unnamed protein product                                 318     1e-103
Q9VKC9_DROME  unnamed protein product                                 255     1e-79 
Q8MRP7_DROME  unnamed protein product                                 215     4e-64 


>Q9VPX2_DROME unnamed protein product
Length=512

 Score = 318 bits (814),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 175/472 (37%), Positives = 258/472 (55%), Gaps = 21/472 (4%)

Query  7    RFLFAIMLCIANMIIYGLKVNIATAIVGMVKSKK------------------HSNSPGDV  48
            R++ A++  I   I+YGLKVN++ A+V MV                       + S   +
Sbjct  19   RYVLALLGSIGMAIVYGLKVNLSVAMVAMVNHTAIKAHGDGGGHGGHGSVILSNASQVSL  78

Query  49   TYECD--FGDEDVSGVDIDGPFDWTTTEQGLVVSIYFAGYLTGMFPCGYFADRFNTKNVL  106
              EC+   G  +V+    DGPFDW+   QG ++S YF GYL    P  + A+ F+ K V+
Sbjct  79   VEECNPPGGASNVTAKVEDGPFDWSEPLQGTLLSCYFWGYLVSQIPLAHVAENFSAKWVM  138

Query  107  LICVLGNAFLTLLVPVAANVLLI-LYIVRFLTGLVSAAHLPVVNVLVGKWVVYEEKSTWF  165
            L  V  N   TLL PV   +    L ++R L G+   A  P ++V++  W    E+    
Sbjct  139  LFSVAINVVCTLLTPVFTELHYGGLILMRVLEGVGGGASFPAMHVMIASWAPPTERMVMS  198

Query  166  AIIYAGTSLGTVISILSSGLILDWFGWKAVFYIHGTLPLIWCALFYWFFADNPETQKYIS  225
             IIY GTS GT +SIL +G+    +GW++VFY+ G L  IW  L+     DNP  Q++IS
Sbjct  199  TIIYVGTSAGTALSILLAGVCSAQWGWESVFYVMGALSCIWMLLWVILVQDNPNKQRFIS  258

Query  226  EKERQLIVTSYGHRSLESAHMDVPWKAIFTSVPFWALIYTNTFGNFCWYFLLTQLPLYMN  285
             +ERQ+I +S G       H  VPW  +FTSVPFWA++  +T  NF WY  L ++P YM 
Sbjct  259  LEERQMITSSLGTEQKTEHHPAVPWGKVFTSVPFWAILIAHTCSNFGWYMFLIEIPFYMK  318

Query  286  KILRFDIKSNASLSCSPYLINAIVNPLLGKLLDWGRQKNYWRQTGGRKVAVFISCIPPSL  345
            ++L+F++ SNA+LS  PY    I +  LGKLLD  + K     T  RK A  I  + P +
Sbjct  319  QVLKFNVASNAALSALPYFPMIIFSICLGKLLDSLQAKGKITTTVARKTATSICTLIPGV  378

Query  346  CLIIIAYLGCNRVGSTILLILSIVFCGVIFVGHLTNHNDLAPNYAGILMGITNTPGTISA  405
            CL+++ Y+GC    +  ++ + IV  G +F G L+NH D+APN+AG L+ +TNT  T+  
Sbjct  379  CLLVLCYIGCRHYEAVSVMSVGIVAMGSMFSGFLSNHIDIAPNFAGTLVALTNTAATLPG  438

Query  406  FILPALVGALMETGHTMVKWRYVFWINIIAQTSAFVVFVIFGSAEIQPWNQA  457
             ++P  VG + +    +  WR +F + I+     F+VFV  GS   QPWN+A
Sbjct  439  IVVPLFVGFVTKGNQNIGAWRIIFGVTIVLFALEFLVFVFLGSGSEQPWNKA  490


>Q9VKC9_DROME unnamed protein product
Length=496

 Score = 255 bits (652),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 148/454 (33%), Positives = 241/454 (53%), Gaps = 6/454 (1%)

Query  7    RFLFAIMLCIANMIIYGLKVNIATAIVGMVKSKKHSNSPGDVTYECDFGDEDVSGVDIDG  66
            R + AIM  +A +  Y ++V ++ AI  +V  K  ++   +   E D  DE   G  + G
Sbjct  20   RVILAIMGFLAILNAYTMRVCLSQAITVLVVKKNSTDDDSEAICEPDDIDE---GTSVGG  76

Query  67   PFDWTTTEQGLVVSIYFAGYLTGMFPCGYFADRFNTKNVLLICVLGNAFLTLLVPVAANV  126
             F+W+   QGL++S ++ GY+    P G  A++F  K  L + +L  A  T+L P+A N 
Sbjct  77   DFEWSEELQGLILSSFYIGYIVTHIPGGLLAEKFGGKWTLGLGILSTAVFTMLTPLAINK  136

Query  127  LLI--LYIVRFLTGLVSAAHLPVVNVLVGKWVVYEEKSTWFAIIYAGTSLGTVISILSSG  184
                 L + R L GL      P ++VL+  WV   E+    A++  G  +GT++  L SG
Sbjct  137  GDSDWLIVTRVLMGLGEGTTFPALSVLLAAWVPANERGKLGALVLGGGQVGTIMGNLLSG  196

Query  185  LILDWFGWKAVFYIHGTLPLIWCALFYWFFADNPETQKYISEKERQLIVTSYGHRSLESA  244
            + +D +GW+ VFY  G L ++W A+F +    +P +  +I   ER+ +V   G  S    
Sbjct  197  VFIDAYGWEFVFYFFGGLGVVWFAIFMFLCYSDPTSHPFIKPSEREYLVKEIGTISRNED  256

Query  245  HMDVPWKAIFTSVPFWALIYTNTFGNFCWYFLLTQLPLYMNKILRFDIKSNASLSCSPYL  304
                PWKAI T++P +AL+      ++ +Y ++T LP YM  +L+F IK+N   S  PY+
Sbjct  257  LPPTPWKAILTNLPMFALVAAQIGHDWGFYIMVTDLPKYMADVLQFSIKANGLYSSLPYV  316

Query  305  INAIVNPLLGKLLDWGRQKNYWRQTGGRKVAVFISCIPPSLCLIIIAYLGCNRVGSTILL  364
            +  IV+   G + DW  ++     T  RKV   ++   P++ ++  +Y GC+RV   +L 
Sbjct  317  MMWIVSVGSGFVADWMIRRGVLSTTNTRKVMTGLAAFGPAIFMVGASYAGCDRVLVVVLF  376

Query  365  ILSIVFCGVIFVGHLTNHNDLAPNYAGILMGITNTPGTISAFILPALVGALMETGHTMVK  424
             + +   G  + G   +  D++PNYAG LM ITN  G I+  I P LVG +M    ++++
Sbjct  377  TICMGLMGAYYAGMKLSPLDMSPNYAGTLMAITNGIGAITGVITPYLVG-VMTPNASLLE  435

Query  425  WRYVFWINIIAQTSAFVVFVIFGSAEIQPWNQAP  458
            WR VFW+         V++ I+ S E+QP+N AP
Sbjct  436  WRLVFWVAFGVLCFTAVIYCIWASGEVQPFNNAP  469


>Q8MRP7_DROME unnamed protein product
Length=497

 Score = 215 bits (547),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 140/451 (31%), Positives = 229/451 (51%), Gaps = 16/451 (4%)

Query  15   CIANMIIYGLKVNIATAIVGMVKSK----KHSNSPGDVTYECDFGDEDVSGVDIDGPFDW  70
            C+A  + Y  +VN++ A+V M  +     +++ + G    E  F        + +  +++
Sbjct  33   CLA--MSYAWRVNLSVALVAMTDNSTSLAQNNTNTGVAPSEPGF-----DFFNSERYYNF  85

Query  71   TTTEQGLVVSIYFAGYLTGMFPCGYFADRFNTKNVLLICVLGNAFLTLLVPVAANV-LLI  129
            T  E+G + + +F GY+    P GY A R+  K +L+  +   A +T+L P++     + 
Sbjct  86   TQKEKGNLQASFFFGYIVTQVPGGYIAQRYGAKTMLMYGLGIAALITMLSPMSLQFGWVA  145

Query  130  LYIVRFLTGLVSAAHLPVVNVLVGKWVVYEEKSTWFAIIYAGTSLGTVISILSSGLILDW  189
            L ++RF+ GL   A  P  + L+ KW   +E+     + Y+G   GTV+ + +SG I D 
Sbjct  146  LAVMRFVMGLAQGAVHPATHALLAKWSPADERGMLGTLCYSGAQFGTVVMLATSGFIADS  205

Query  190  -FGWKAVFYIHGTLPLIWCALFYWFFADNPETQKYISEKERQLIVTSYGHRSLESAHM--  246
              GW ++FY+ G    IW   +Y F A  PE  + IS  E + I  S     ++SA    
Sbjct  206  VLGWPSIFYLGGACGFIWMVFWYLFSASTPEEHRLISPGELKYITDSRSDGKMQSAEKLA  265

Query  247  DVPWKAIFTSVPFWALIYTNTFGNFCWYFLLTQLPLYMNKILRFDIKSNASLSCSPYLIN  306
              PWKAIF+S+PF +L+  +    F ++ LL Q+P YM KI   DIK  A LS  PY++ 
Sbjct  266  PTPWKAIFSSLPFLSLLVVHCTHIFGYWLLLMQIPTYMKKIYHVDIKKGALLSSLPYMVM  325

Query  307  AIVNPLLGKLLDWGRQKNYWRQTGGRKVAVFISCIPPSLCLIIIAYLGCNRVG-STILLI  365
             +++     L    ++K     +  RK+   I    P L LI + Y+  +    +  LL 
Sbjct  326  LLLSFFFVWLSKVLQKKEGMSLSFNRKIFNSIGHWIPMLSLIALGYVPADNAPLAVTLLT  385

Query  366  LSIVFCGVIFVGHLTNHNDLAPNYAGILMGITNTPGTISAFILPALVGALMETGHTMVKW  425
            L++   G  ++G   NH DL+PNYAG LMGITN    + + I P +VG ++    ++ +W
Sbjct  386  LTVGISGATYLGFQVNHIDLSPNYAGTLMGITNCAANVMSGIAPVIVGQIVVDETSVTEW  445

Query  426  RYVFWINIIAQTSAFVVFVIFGSAEIQPWNQ  456
            R VF +         ++FVIFG  E+Q W+ 
Sbjct  446  RLVFLLAAAFYFLGNLLFVIFGRTEVQWWDS  476



Lambda      K        H
   0.320    0.136    0.387 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4564573412


Query= XP_050469495.1 protein MCM10 homolog [Bombus huntii]

Length=713
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MCM10_DROME  unnamed protein product                                  259     2e-75


>MCM10_DROME unnamed protein product
Length=776

 Score = 259 bits (661),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 138/349 (40%), Positives = 214/349 (61%), Gaps = 36/349 (10%)

Query  70   VYDDTLDSSDDEDRRYFEEQKYSNYGRDIKTLLKKET-------IKKDEDR---------  113
            + +  LDSSDDE+ + F E+KY+ YG DI   LK++        + ++ D+         
Sbjct  80   IKEPELDSSDDEEVKNFLERKYNEYGSDINKRLKQQQENAYESKVAREVDQELKKSIHVV  139

Query  114  ------------PLPRKS--SRTFDFSATKTNKNLNTVTNNAIVTAKDVYSDPFFGLRIV  159
                        P+ R+S  S TF           +T  ++A V+A  V++DP FGLR++
Sbjct  140  TSTPQPLKNPHNPIKRQSAVSTTFQRPPPVAAAVASTSQSSAPVSA--VFTDPVFGLRMI  197

Query  160  NPIISSAELKARMSDKVPVTVSRIKYHLNPEKMEKDWVIAGVLINKSTPKTSQKGSTYAI  219
            NP++SS+ L+ RM+ + PV  S + YH+    + KDWVIAG L++K+  K ++KG  Y+ 
Sbjct  198  NPLVSSSLLQERMTGRKPVPFSGVAYHIERGDLAKDWVIAGALVSKNPVKNTKKGDPYST  257

Query  220  WKISDLSDNMNTVCLFMFSNAYKTLWKTTIGTVIGILNPNVLESK-DNSDLATLSVDNPQ  278
            WK+SDL   + T+ LF+F  A+K+LWKT  G  + +LNP + E +  +SD+A LS+D+ Q
Sbjct  258  WKLSDLRGEVKTISLFLFKEAHKSLWKTAEGLCLAVLNPTIFERRAGSSDVACLSIDSSQ  317

Query  279  RVMILGKSKDMGKCKSRKKNGEPCSSIINLSRCEFCLYHIKQEYKKCSRRAELQAFSNTQ  338
            +VMILG+SKD+G C++ KKNG+ C+S++NL+ C++C++H+KQEY K SRR+ELQ  S T 
Sbjct  318  KVMILGQSKDLGTCRATKKNGDKCTSVVNLTDCDYCIFHVKQEYGKMSRRSELQ--SATA  375

Query  339  KFSIDMLKQKPQQKQKSFFNNMPEFNAVVAVKNKKLEEKDAKRLALLSG  387
               I+ L+ K   K + F+     F AV A K+ KL  K+  RL++L+G
Sbjct  376  GRGINELRNKVLGKNEVFYGGQ-TFTAVPARKSAKLITKERDRLSMLAG  423


 Score = 207 bits (527),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 99/187 (53%), Positives = 130/187 (70%), Gaps = 6/187 (3%)

Query  525  EKLKKGKKRPRESENDERQETKKSNVLSDKFKEMMQTKSAHTDLIEKSYEQEQDKYFNKL  584
            EK     KR +  E+D R+  +KS +     +++M   S+HT+L+E    + Q++YFNKL
Sbjct  596  EKFSSSAKRQKIDEDD-RELMRKSRI-----EKIMAATSSHTNLVEMREREAQEEYFNKL  649

Query  585  EMKERMEEKMLTTYKVPCKAVRCLICKYTSFSASEMCKEQNHPLRVADAVKRFFKCGDCG  644
            E KE MEEKMLTTYK+PCKAV C +CKYT+FSAS+ CKEQ HPL+V DA KRFF+C DCG
Sbjct  650  ERKEAMEEKMLTTYKMPCKAVICQVCKYTAFSASDRCKEQKHPLKVVDAEKRFFQCKDCG  709

Query  645  NRTVSLDRIPSHSCIKCSSSNWTRAAMMDERRTNVSVTTLSIRGDEETFIGSTTKDANLN  704
            NRT ++ ++P  SC  C  S W R AM+ E++      TLS+RGDEETF+G     ANLN
Sbjct  710  NRTTTVFKLPKQSCKNCKGSRWQRTAMIREKKILTGRETLSVRGDEETFMGCLAGSANLN  769

Query  705  LLVPDKD  711
            LLVPD++
Sbjct  770  LLVPDEE  776



Lambda      K        H
   0.320    0.136    0.387 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4564573412


Query= XP_050469496.1 uncharacterized protein LOC126863413 isoform X1
[Bombus huntii]

Length=237
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PRIC1_DROME  unnamed protein product                                  30.8    1.3  
Q54I22_DICDI  unnamed protein product                                 30.0    1.8  
XRCC5_DICDI  unnamed protein product                                  30.0    1.8  


>PRIC1_DROME unnamed protein product
Length=1299

 Score = 30.8 bits (68),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 19/33 (58%), Gaps = 2/33 (6%)

Query  137  RITQDIESGNQIANPNEPLKPLCCGFREFLECS  169
            R+TQD   G Q A P  PL+PL  G  +FL  S
Sbjct  274  RVTQD--QGTQPAAPQVPLQPLTAGDLQFLNLS  304


>Q54I22_DICDI unnamed protein product
Length=331

 Score = 30.0 bits (66),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 15/52 (29%), Positives = 24/52 (46%), Gaps = 3/52 (6%)

Query  157  PLCCGFREFLECSHHTIR---RQCGYDTAQFAKGFLDRMSSSLLKEHCAPYT  205
            P  CG + F+     T+R   +  G   +  A GF+D   S  LK+   P++
Sbjct  199  PTYCGSKAFVTSFGLTLRNRLKDSGVGVSIVAPGFVDTPMSDSLKQDSLPFS  250


>XRCC5_DICDI unnamed protein product
Length=796

 Score = 30.0 bits (66),  Expect = 1.8, Method: Composition-based stats.
 Identities = 16/61 (26%), Positives = 28/61 (46%), Gaps = 11/61 (18%)

Query  44   ERINRNDLSFAVK-----KEELQQLCPD------FEAGMKCIQTYTLDCLQEKQREHFNS  92
            + +NR D+    K     KE + QL  D      ++   +CI+   + C++E + E FN 
Sbjct  653  DMLNRRDMDLVDKAITLMKERILQLVNDSLRDQYYQKAFECIKELRVGCIRESEAEQFNG  712

Query  93   L  93
             
Sbjct  713  F  713



Lambda      K        H
   0.320    0.136    0.387 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4564573412


Query= XP_050469497.1 hemicentin-1-like isoform X1 [Bombus huntii]

Length=988
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q0KI85_DROME  unnamed protein product                                 567     0.0   
Q9VH85_DROME  unnamed protein product                                 488     2e-157
Q59DZ1_DROME  unnamed protein product                                 441     4e-138


>Q0KI85_DROME unnamed protein product
Length=1087

 Score = 567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/655 (47%), Positives = 420/655 (64%), Gaps = 59/655 (9%)

Query  252  PEPKVRWWRGEMLLDSKDEPGEFPSLRRNALIVRELSRADLHAVFTCQASNNNISQPVSA  311
            P P V W     L +S  +   +     + L+VR LSR   HAV+TCQASN +  + V+ 
Sbjct  181  PPPTVIWLMNGQLQNSVVD-YTYDGAINSKLVVRNLSRIHQHAVYTCQASNFH-KKYVAT  238

Query  312  SVAIEMHLKPLSVAILSNEHAPLSAGRKYDINCMTVGSRPPAKLSWYMDGKKLSNYTEKV  371
            ++ I+++L+PL V I  N   P+SA RKY+I C  +GSRPPAK++W+M   +L  +++KV
Sbjct  239  NITIDLYLRPLLVEISFNNQ-PMSADRKYEIECQAIGSRPPAKITWWMGNLELHGHSQKV  297

Query  372  SQDGNMTSSTLILKPTLLDHDKVITCRAENFEIQRGIVEDTWKLNVFFVPILHLELGSNM  431
            S+DGN+++S L + PT  DH K ++CRA N  ++ GI E   KLNVFF+P L L+LGSN+
Sbjct  298  SEDGNVSTSVLSITPTREDHGKALSCRATNELVRNGIRETAMKLNVFFIPTLQLDLGSNL  357

Query  432  NPDDIEEGDDVYFECKVHANPGAYKVIWRHNGNIIQNNAKNGVIVQQYGLALREVNRSQA  491
            NP+DIEEGDDVYFECKVHANP AYKV+W+HN  IIQ+N + GVIV    LAL+ V R QA
Sbjct  358  NPEDIEEGDDVYFECKVHANPAAYKVVWKHNHQIIQHNQRAGVIVSSGDLALQGVTRHQA  417

Query  492  GNYTCIASNVEGDGYSNTVELKIMYKPICLPDQKRIYGVARHEDARVTCSVEAYPSPDSF  551
            GNYTC ASNVEGDG SN VELK+MYKPIC PDQK+IYGVAR+E A + C V+A+P P++F
Sbjct  418  GNYTCTASNVEGDGDSNVVELKVMYKPICRPDQKKIYGVARNEAAEIVCEVDAFPPPENF  477

Query  552  RWTFNNTEEMVDVPQARYKNSTRHSQSILIYRPITEMDYGTVFCWASNTAGQQKNACIFH  611
            +W+FNNT E  D+PQ+ ++  +    S L Y P+ EMD+GT+ CWA N  GQQK  C+FH
Sbjct  478  KWSFNNTAETFDMPQSGFRPHSAQG-STLTYTPVKEMDFGTIMCWADNNVGQQKEPCVFH  536

Query  612  IIPAGKPESLYNCTLSNQTTDSLSVECCVGFDGGQPQHFLLEVFDQHTGVLQANITSEEN  671
            +I AGKPE+  NCT+ NQT+DSL V C  GFDGG  Q FL+E+FDQH+G LQANI S + 
Sbjct  537  LIAAGKPEAPTNCTVVNQTSDSLEVYCIEGFDGGMRQWFLMEIFDQHSGQLQANI-SAKF  595

Query  672  AVFTVHGLQSGKILNMVLYAVNAKGRSEPTLLEGFTLKIAEKQT----------GIPVPF  721
            A  +V GL +G++  + +YAVN +GRS+   L+G+TLK AEKQT            P  F
Sbjct  596  AALSVTGLDAGRLFRIYVYAVNGRGRSDAIALDGYTLKAAEKQTVALTSYKGSAQSPDNF  655

Query  722  EISPLL--GGLIGVVTALLFVTITILIAMKIRNERRTQ------------RPSDLPLK-K  766
            E++P+L  G  +G++ A++ + I  + A+K+R+ +  Q            RP +L +K K
Sbjct  656  ELTPILSIGIFVGILVAIVCIGIGTIAALKLRSHKHQQQQKFVHPNAKFSRPGNLQIKDK  715

Query  767  STAP--SSEDLYDTEDRNPDVVPINK-GSDYQLTGSISGTPLATQNTPDGLTATSLSIQQ  823
             + P   SE++YD  ++NPDVVP N+   +Y+          ATQ TP G  +T+  +  
Sbjct  716  ISLPLSHSEEMYD--EKNPDVVPYNEVDGEYKQKS-------ATQ-TPSGHLSTTSEV--  763

Query  824  VTHLQGLSSYPHEYNNYPALSRIIQTIPSCSARSTNKESSPNLSDEVTYAELCLT  878
                        E +  P  +     + + SA S   +SS +  DE+ YAEL LT
Sbjct  764  ------------EISCKPGSTSGTGIVQANSADSGTYQSSKD--DELHYAELSLT  804


 Score = 154 bits (389),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 101/144 (70%), Gaps = 2/144 (1%)

Query  48   RAVLQGTAELSCDIRPPQQNDSVILVVWYKSDTTPIYSYDMRGKHSEKASHWNNKDHLND  107
            R ++  +A++ CD+   Q +D V+LVVWYK++  PIYSYD RG H+   SHW +++ L D
Sbjct  36   RVLVNSSAQIKCDVGSSQADDKVLLVVWYKNNL-PIYSYDTRGAHAGTPSHWRDEEVLED  94

Query  108  RAFFRTVTEPATLNINHIEERDEGEYRCRVDFAKSPSRNSRINLMVIVPPHKPNIIDERG  167
            RA FRT  EPA L IN ++E+D G +RCRVDF  S +RNS +NL V+VPP +P I +ER 
Sbjct  95   RAVFRTHKEPAELIINPVKEKDAGNFRCRVDFKLSQTRNSNVNLEVVVPPTQPIIFNERR  154

Query  168  T-VPAVAGPYEEGGDMKLQCLVSG  190
              + + AGPYEEGG +++ C+V G
Sbjct  155  LRIDSRAGPYEEGGSLEVTCVVYG  178


 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 77/367 (21%), Positives = 141/367 (38%), Gaps = 46/367 (13%)

Query  259  WRGEMLLDSK------DEPGEFPSLRRNALIVRELSRADLHAVFTCQASNNNISQPVSAS  312
            WR E +L+ +       EP E        LI+  +   D    F C+  +  +SQ  +++
Sbjct  86   WRDEEVLEDRAVFRTHKEPAE--------LIINPVKEKDA-GNFRCRV-DFKLSQTRNSN  135

Query  313  VAIEMHLKPLSVAILSNEH-------APLSAGRKYDINCMTVGSRPPAKLSWYMDGKKLS  365
            V +E+ + P    I +           P   G   ++ C+  G  PP  + W M+G +L 
Sbjct  136  VNLEVVVPPTQPIIFNERRLRIDSRAGPYEEGGSLEVTCVVYGGSPPPTVIWLMNG-QLQ  194

Query  366  NYTEKVSQDGNMTSSTLILKPTLLDHDKVITCRAENFEIQRGIVEDTWKLNVFFVPILHL  425
            N     + DG + S  ++   + +    V TC+A NF   +  V     ++++  P+L +
Sbjct  195  NSVVDYTYDGAINSKLVVRNLSRIHQHAVYTCQASNF--HKKYVATNITIDLYLRPLL-V  251

Query  426  ELGSNMNPDDIEEGDDVYFECKVHANPGAYKVIWRHNGNI-----IQNNAKNGVIVQQYG  480
            E+  N  P   +   ++  EC+   +    K+ W   GN+      Q  +++G +     
Sbjct  252  EISFNNQPMSADRKYEI--ECQAIGSRPPAKITWWM-GNLELHGHSQKVSEDGNVSTSV-  307

Query  481  LALREVNRSQAGNYTCIASN--VEGDGYSNTVELKIMYKP---ICLPDQKRIYGVARHED  535
            L++           +C A+N  V        ++L + + P   + L        +   +D
Sbjct  308  LSITPTREDHGKALSCRATNELVRNGIRETAMKLNVFFIPTLQLDLGSNLNPEDIEEGDD  367

Query  536  ARVTCSVEAYPSPDSFRWTFNNTEEMVDVPQARYKNSTRHSQSILIYRPITEMDYGTVFC  595
                C V A P+     W  N+      + Q   +     S   L  + +T    G   C
Sbjct  368  VYFECKVHANPAAYKVVWKHNH-----QIIQHNQRAGVIVSSGDLALQGVTRHQAGNYTC  422

Query  596  WASNTAG  602
             ASN  G
Sbjct  423  TASNVEG  429


 Score = 32.3 bits (72),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 16/20 (80%), Positives = 18/20 (90%), Gaps = 1/20 (5%)

Query  970   TREIVTVRTPLI-STQESCV  988
             +REIVTVRTPL+ S QESCV
Sbjct  1068  SREIVTVRTPLMYSQQESCV  1087


>Q9VH85_DROME unnamed protein product
Length=939

 Score = 488 bits (1257),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 278/750 (37%), Positives = 417/750 (56%), Gaps = 88/750 (12%)

Query  68   DSVILVVWYKSDT-TPIYSYDMRGKHSEKASHWNNKDHLNDRAFFRTVTEPATLNINHIE  126
            D  +LV+WY+ D  TPIYS D+R   S+    W++     DRA+F    EP  L+I + +
Sbjct  48   DEPVLVLWYRDDKGTPIYSIDIRAGVSKAPKRWSDDSVFGDRAYFIFDKEPGKLSIQNTQ  107

Query  127  ERDEGEYRCRVDFAKSPSRNSRINLMVIVPPHKPNIID----ERGTVPAVAGPYEEGGDM  182
              D G YRCRVDF K+ + NSRI L VI PP +  I D    ER T   V GPY EG  +
Sbjct  108  ASDSGTYRCRVDFLKAQTINSRIRLNVISPPKQVIIRDSSNVERST---VVGPYSEGDIV  164

Query  183  KLQCLVSGVITLRIEQLTWNRGYRPTCNINYLTIIFSTKDERLCTIHDSLEGIDKYSLFH  242
             L+C V G             GY PT  I++                D +E         
Sbjct  165  SLKCQVIG-------------GY-PTPTISWY--------------RDGIE---------  187

Query  243  ELLLSVPCRPEPKVRWWRGEMLLDSKDEPGEFPSLRRNALIVRELSRADLHAVFTCQASN  302
                 +PC    ++    G  +++ +             + +  L R DL++  TC+A +
Sbjct  188  -----IPC----ELSHLAGGKIIECE-------------ITLPSLGREDLNSRLTCRALS  225

Query  303  NNISQPVSASVAIEMHLKPLSVAILSNEHAPLSAGRKYDINCMTVGSRPPAKLSWYMDGK  362
            +  +  V A V I+M+  PL++ +L   H PLSAGR+YD+ C + GSRPPA ++W+ +G 
Sbjct  226  HPRAPIVEAVVQIDMNFAPLNIRLL-GAHQPLSAGRRYDLLCQSAGSRPPAVITWWQNGI  284

Query  363  KLSNYTEKVSQDGNMTSSTLILKPTLLDHDKVITCRAENFEIQRGIVEDTWKLNVFFVPI  422
            +L   TE  S DGN T+STL +  +  D  K ++C+A N  +    +ED WKL++ +VP 
Sbjct  285  RLEKTTETTSSDGNQTTSTLSISLSKSDAGKYLSCKAYNHAVPSEPLEDGWKLDIQYVPE  344

Query  423  LHLELGSNMNPDDIEEGDDVYFECKVHANPGAYKVIWRHNGNIIQNNAKNGVIVQQYGLA  482
             ++ LG++++P  + EG DVYF+C V A+P  +++ WRHN   + +N   GVI+  + L 
Sbjct  345  AYVRLGTSLDPSTLREGTDVYFDCLVMAHPNVFRIEWRHNEQPLSHNISLGVIISNHSLV  404

Query  483  LREVNRSQAGNYTCIASNVEGDGYSNTVELKIMYKPICLPDQKRIYGVARHEDARVTCSV  542
            L+ V R+ AGNY+C+  N EG+G S    L I+Y P C  +QK++YG+A+ EDA+V C+V
Sbjct  405  LQGVTRATAGNYSCVGFNAEGEGISAPFALNILYAPTCAQNQKKVYGIAKQEDAKVMCTV  464

Query  543  EAYPSPDSFRWTFNNTEEMVDVPQARYKNSTRHSQSILIYRPITEMDYGTVFCWASNTAG  602
            +A P    F WTFNN+ E +DV       S   + SI+ Y PITE+DYGT+ C ASN  G
Sbjct  465  DANPREVEFSWTFNNSAESIDVATNHIIRSG--TTSIVTYTPITELDYGTLLCLASNKIG  522

Query  603  QQKNACIFHIIPAGKPESLYNCTLSNQTTDSLSVECCVGFDGGQPQHFLLEVFDQHTGVL  662
            +Q+  C+FHII AG+PE ++NCT++N +  SL+V C  GF+GG PQ F LE+ D +T  +
Sbjct  523  KQRVPCVFHIIAAGRPEKVHNCTVNNISMTSLTVTCSDGFNGGLPQSFNLELLDSYTQEI  582

Query  663  QANITSEENAVFTVHGLQSGKILNMVLYAVNAKGRSEPTLLEGFTLKIAEKQT------G  716
            +ANITS     FTV GL  G I  + +YA N KGRS+P ++    L++ EKQ        
Sbjct  583  KANITSTIPK-FTVPGLSPGSIYRLNIYAFNTKGRSDPAIVNAAMLRMPEKQLTSEQTHN  641

Query  717  IPVPFEISPLLGGLIGVVTALLFVTITILIAMKI----RNERRTQRPSDLPLKKSTAP--  770
            +      SP++   IG+  A+L   + I++A++I     + RR +  S+  + +  +P  
Sbjct  642  LRAELLFSPVMSLTIGLTLAVLVAVLAIILALRIPCTASSRRRQKELSNENISRDESPGP  701

Query  771  -----SSEDLYDTEDRNPDVVPINKGSDYQ  795
                  S+++ D +++NPDVVP +   D Q
Sbjct  702  SDKSSGSKEVDDCDEKNPDVVPESIEPDEQ  731


>Q59DZ1_DROME unnamed protein product
Length=1064

 Score = 441 bits (1135),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 273/777 (35%), Positives = 410/777 (53%), Gaps = 109/777 (14%)

Query  49   AVLQGTAELSCDIRPPQQNDSVILVVWYKSDT-TPIYSYDMRGKHS-EKASHWNNKDHLN  106
            AV   +  L C I  P   D+V +V+W++ +   P+YS+D+R K S E+  HW+  +   
Sbjct  59   AVEGKSVSLPCPITEPL--DNVYMVLWFRDNAGIPLYSFDVRDKESREQPRHWSAPEVFG  116

Query  107  DRAFFRTVTEPATLNINHIEERDEGEYRCRVDFAKSPSRNSRINLMVIVPPHKPNIIDER  166
             RA F   ++PATL    I+  D+G YRCRVDF  S +++ R NL VI+ P +P I+D  
Sbjct  117  SRAKFHFDSQPATL---EIKRHDQGIYRCRVDFRTSQTQSFRFNLSVIILPEQPIIMDRW  173

Query  167  GTV--PAVAGPYEEGGDMKLQCLVSGVITLRIEQLTWNRGYRPTCNINYLTIIFSTKDER  224
            G        GP +EG D+        VIT R+                            
Sbjct  174  GRQLNGTQLGPKQEGDDI--------VITCRV----------------------------  197

Query  225  LCTIHDSLEGIDKYSLFHELLLSVPCRPEPKVRWWRGEMLLDSKDEPGEFPSLRRNALIV  284
                                   V  RP+P+VRW    +L+D+++E      +  N L+ 
Sbjct  198  -----------------------VGGRPQPQVRWLVNGLLVDNQNEHNSGDVIE-NRLLW  233

Query  285  RELSRADLHAVFTCQASNNNISQPVSASVAIEMHLKPLSVAILSNEHAPLSAGRKYDINC  344
              + R DL++VFTCQA N  + +P   S  ++MHLKPL V IL    + + A R+Y+++C
Sbjct  234  PSVQRNDLNSVFTCQALNTQLDKPKEKSFILDMHLKPLVVKILE-PPSSMIADRRYEVSC  292

Query  345  MTVGSRPPAKLSWYMDGKKLSNYTEKVSQDGNMTSSTLILKPTLLDHDKVITCRAENFEI  404
             + GSRP A ++WY   ++L    + +S+  N T S L   PT  D  K ITCRAEN  +
Sbjct  293  ESSGSRPNAIITWYKGKRQLRRTKDDISK--NSTRSELSFVPTTDDDGKSITCRAENPNV  350

Query  405  QRGIVEDTWKLNVFFVPILHLELGSNMNPDDIEEGDDVYFECKVHANPGAYKVIWRHNGN  464
                +E  WKLNV + P++ L LGS + PDDI+EGDDVYFEC V +NP   K++W HNG 
Sbjct  351  NGLYLETMWKLNVVYPPLVTLRLGSTLTPDDIKEGDDVYFECHVQSNPQWRKLLWLHNGI  410

Query  465  IIQNNAKNGVIVQQYGLALREVNRSQAGNYTCIASNVEGDGYSNTVELKIMYKPICL-PD  523
             +++N    VI     L L+++ +  AGNY C A N EG+  SN + L++ Y P+C   D
Sbjct  411  HLEHNTSARVIRSNQSLVLQKITKHYAGNYACSAINDEGETVSNQLPLRVKYTPMCKHAD  470

Query  524  QKRIYGVARHEDARVTCSVEAYPSPDSFRWTFNNTEEMVDVPQARYKNSTRHSQSILIYR  583
            +  + G ++ E   V C ++A P P +FRW FNN+ E +DV   R+  S   S+SIL Y 
Sbjct  471  RVILIGASKDETVEVVCEIQADPPPRTFRWKFNNSGETLDVGSERF--SVNGSRSILKYT  528

Query  584  PITEMDYGTVFCWASNTAGQQKNACIFHIIPAGKPESLYNCTLSNQTTDSLSVECCVGFD  643
            P+T+ DYGT+ CWASN  G Q++ C+F ++ A  P ++ NCT+ N+T  S+ ++C  G+D
Sbjct  529  PVTDQDYGTLSCWASNEVGTQQHPCLFQVVLAALPNAVSNCTVFNRTELSVDIQCIPGYD  588

Query  644  GGQPQHFLLEVFDQHTGVLQANITSEENAVFTVHGL--------QSGKILNMVLYAVNAK  695
            GG PQ F+LE+F   TG+ + N+++ E A+F++  L        Q    L + +Y+ N K
Sbjct  589  GGLPQIFVLEMFSTRTGITRFNLSNAEEALFSLENLDTLTSMMVQENNSLRLRIYSYNQK  648

Query  696  GRSEPTLLEGFTLKIAEKQTGIPVPFEISP-LLGGLIGVVTALLFVTITILIAMKIRNER  754
            GRS   LL  F +     +T   V   +SP ++G ++ ++   + + I I +   + N R
Sbjct  649  GRSAAYLLTDFIIGSTAYKTDDDVTLTLSPVIVGSVLTIIIIGVAIAIRIFVVTFVHNLR  708

Query  755  R-------------TQRPSDL--------PLKKST---APSSEDLYDTEDRNPDVVP  787
            R             T +PSD+        P  + T     SSEDL + E R+PDV+P
Sbjct  709  RNRHHGSKATAAGVTAQPSDVFKGGNLEKPRWQHTDIKTKSSEDLVEDE-RDPDVIP  764



Lambda      K        H
   0.320    0.136    0.387 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4564573412


Query= XP_050469498.1 uncharacterized protein LOC126863418 isoform X2
[Bombus huntii]

Length=988
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q0KI85_DROME  unnamed protein product                                 569     0.0   
Q9VH85_DROME  unnamed protein product                                 489     1e-157
Q59DZ1_DROME  unnamed protein product                                 442     1e-138


>Q0KI85_DROME unnamed protein product
Length=1087

 Score = 569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/655 (47%), Positives = 420/655 (64%), Gaps = 59/655 (9%)

Query  252  PEPKVRWWRGEMLLDSKDEPGEFPSLRRNALIVRELSRADLHAVFTCQASNNNISQPVSA  311
            P P V W     L +S  +   +     + L+VR LSR   HAV+TCQASN +  + V+ 
Sbjct  181  PPPTVIWLMNGQLQNSVVD-YTYDGAINSKLVVRNLSRIHQHAVYTCQASNFH-KKYVAT  238

Query  312  SVAIEMHLKPLSVAILSNEHAPLSAGRKYDINCMTVGSRPPAKLSWYMDGKKLSNYTEKV  371
            ++ I+++L+PL V I  N   P+SA RKY+I C  +GSRPPAK++W+M   +L  +++KV
Sbjct  239  NITIDLYLRPLLVEISFNNQ-PMSADRKYEIECQAIGSRPPAKITWWMGNLELHGHSQKV  297

Query  372  SQDGNMTSSTLILKPTLLDHDKVITCRAENFEIQRGIVEDTWKLNVFFVPILHLELGSNM  431
            S+DGN+++S L + PT  DH K ++CRA N  ++ GI E   KLNVFF+P L L+LGSN+
Sbjct  298  SEDGNVSTSVLSITPTREDHGKALSCRATNELVRNGIRETAMKLNVFFIPTLQLDLGSNL  357

Query  432  NPDDIEEGDDVYFECKVHANPGAYKVIWRHNGNIIQNNAKNGVIVQQYGLALREVNRSQA  491
            NP+DIEEGDDVYFECKVHANP AYKV+W+HN  IIQ+N + GVIV    LAL+ V R QA
Sbjct  358  NPEDIEEGDDVYFECKVHANPAAYKVVWKHNHQIIQHNQRAGVIVSSGDLALQGVTRHQA  417

Query  492  GNYTCIASNVEGDGYSNTVELKIMYKPICLPDQKRIYGVARHEDARVTCSVEAYPSPDSF  551
            GNYTC ASNVEGDG SN VELK+MYKPIC PDQK+IYGVAR+E A + C V+A+P P++F
Sbjct  418  GNYTCTASNVEGDGDSNVVELKVMYKPICRPDQKKIYGVARNEAAEIVCEVDAFPPPENF  477

Query  552  RWTFNNTEEMVDVPQARYKNSTRHSQSILIYRPITEMDYGTVFCWASNTAGQQKNACIFH  611
            +W+FNNT E  D+PQ+ ++  +    S L Y P+ EMD+GT+ CWA N  GQQK  C+FH
Sbjct  478  KWSFNNTAETFDMPQSGFRPHSAQG-STLTYTPVKEMDFGTIMCWADNNVGQQKEPCVFH  536

Query  612  IIPAGKPESLYNCTLSNQTTDSLSVECCVGFDGGQPQHFLLEVFDQHTGVLQANITSEEN  671
            +I AGKPE+  NCT+ NQT+DSL V C  GFDGG  Q FL+E+FDQH+G LQANI S + 
Sbjct  537  LIAAGKPEAPTNCTVVNQTSDSLEVYCIEGFDGGMRQWFLMEIFDQHSGQLQANI-SAKF  595

Query  672  AVFTVHGLQSGKILNMVLYAVNAKGRSEPTLLEGFTLKIAEKQT----------GIPVPF  721
            A  +V GL +G++  + +YAVN +GRS+   L+G+TLK AEKQT            P  F
Sbjct  596  AALSVTGLDAGRLFRIYVYAVNGRGRSDAIALDGYTLKAAEKQTVALTSYKGSAQSPDNF  655

Query  722  EISPLL--GGLIGVVTALLFVTITILIAMKIRNERRTQ------------RPSDLPLK-K  766
            E++P+L  G  +G++ A++ + I  + A+K+R+ +  Q            RP +L +K K
Sbjct  656  ELTPILSIGIFVGILVAIVCIGIGTIAALKLRSHKHQQQQKFVHPNAKFSRPGNLQIKDK  715

Query  767  STAP--SSEDLYDTEDRNPDVVPINK-GSDYQLTGSISGTPLATQNTPDGLTATSLSIQQ  823
             + P   SE++YD  ++NPDVVP N+   +Y+          ATQ TP G  +T+  +  
Sbjct  716  ISLPLSHSEEMYD--EKNPDVVPYNEVDGEYKQKS-------ATQ-TPSGHLSTTSEV--  763

Query  824  VTHLQGLSSYPHEYNNYPALSRIIQTIPSCSARSTNKESSPNLSDEVTYAELCLT  878
                        E +  P  +     + + SA S   +SS +  DE+ YAEL LT
Sbjct  764  ------------EISCKPGSTSGTGIVQANSADSGTYQSSKD--DELHYAELSLT  804


 Score = 154 bits (390),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 101/144 (70%), Gaps = 2/144 (1%)

Query  48   RAVLQGTAELSCDIRPPQQNDSVILVVWYKSDTTPIYSYDMRGKHSEKASHWNNKDHLND  107
            R ++  +A++ CD+   Q +D V+LVVWYK++  PIYSYD RG H+   SHW +++ L D
Sbjct  36   RVLVNSSAQIKCDVGSSQADDKVLLVVWYKNNL-PIYSYDTRGAHAGTPSHWRDEEVLED  94

Query  108  RAFFRTVTEPATLNINHIEERDEGEYRCRVDFAKSPSRNSRINLMVIVPPHKPNIIDERG  167
            RA FRT  EPA L IN ++E+D G +RCRVDF  S +RNS +NL V+VPP +P I +ER 
Sbjct  95   RAVFRTHKEPAELIINPVKEKDAGNFRCRVDFKLSQTRNSNVNLEVVVPPTQPIIFNERR  154

Query  168  T-VPAVAGPYEEGGDMKLQCLVSG  190
              + + AGPYEEGG +++ C+V G
Sbjct  155  LRIDSRAGPYEEGGSLEVTCVVYG  178


 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 77/367 (21%), Positives = 141/367 (38%), Gaps = 46/367 (13%)

Query  259  WRGEMLLDSK------DEPGEFPSLRRNALIVRELSRADLHAVFTCQASNNNISQPVSAS  312
            WR E +L+ +       EP E        LI+  +   D    F C+  +  +SQ  +++
Sbjct  86   WRDEEVLEDRAVFRTHKEPAE--------LIINPVKEKDA-GNFRCRV-DFKLSQTRNSN  135

Query  313  VAIEMHLKPLSVAILSNEH-------APLSAGRKYDINCMTVGSRPPAKLSWYMDGKKLS  365
            V +E+ + P    I +           P   G   ++ C+  G  PP  + W M+G +L 
Sbjct  136  VNLEVVVPPTQPIIFNERRLRIDSRAGPYEEGGSLEVTCVVYGGSPPPTVIWLMNG-QLQ  194

Query  366  NYTEKVSQDGNMTSSTLILKPTLLDHDKVITCRAENFEIQRGIVEDTWKLNVFFVPILHL  425
            N     + DG + S  ++   + +    V TC+A NF   +  V     ++++  P+L +
Sbjct  195  NSVVDYTYDGAINSKLVVRNLSRIHQHAVYTCQASNF--HKKYVATNITIDLYLRPLL-V  251

Query  426  ELGSNMNPDDIEEGDDVYFECKVHANPGAYKVIWRHNGNI-----IQNNAKNGVIVQQYG  480
            E+  N  P   +   ++  EC+   +    K+ W   GN+      Q  +++G +     
Sbjct  252  EISFNNQPMSADRKYEI--ECQAIGSRPPAKITWWM-GNLELHGHSQKVSEDGNVSTSV-  307

Query  481  LALREVNRSQAGNYTCIASN--VEGDGYSNTVELKIMYKP---ICLPDQKRIYGVARHED  535
            L++           +C A+N  V        ++L + + P   + L        +   +D
Sbjct  308  LSITPTREDHGKALSCRATNELVRNGIRETAMKLNVFFIPTLQLDLGSNLNPEDIEEGDD  367

Query  536  ARVTCSVEAYPSPDSFRWTFNNTEEMVDVPQARYKNSTRHSQSILIYRPITEMDYGTVFC  595
                C V A P+     W  N+      + Q   +     S   L  + +T    G   C
Sbjct  368  VYFECKVHANPAAYKVVWKHNH-----QIIQHNQRAGVIVSSGDLALQGVTRHQAGNYTC  422

Query  596  WASNTAG  602
             ASN  G
Sbjct  423  TASNVEG  429


 Score = 32.3 bits (72),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 16/20 (80%), Positives = 18/20 (90%), Gaps = 1/20 (5%)

Query  970   TREIVTVRTPLI-STQESCV  988
             +REIVTVRTPL+ S QESCV
Sbjct  1068  SREIVTVRTPLMYSQQESCV  1087


>Q9VH85_DROME unnamed protein product
Length=939

 Score = 489 bits (1259),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 278/750 (37%), Positives = 417/750 (56%), Gaps = 88/750 (12%)

Query  68   DSVILVVWYKSDT-TPIYSYDMRGKHSEKASHWNNKDHLNDRAFFRTVTEPATLNINHIE  126
            D  +LV+WY+ D  TPIYS D+R   S+    W++     DRA+F    EP  L+I + +
Sbjct  48   DEPVLVLWYRDDKGTPIYSIDIRAGVSKAPKRWSDDSVFGDRAYFIFDKEPGKLSIQNTQ  107

Query  127  ERDEGEYRCRVDFAKSPSRNSRINLMVIVPPHKPNIID----ERGTVPAVAGPYEEGGDM  182
              D G YRCRVDF K+ + NSRI L VI PP +  I D    ER T   V GPY EG  +
Sbjct  108  ASDSGTYRCRVDFLKAQTINSRIRLNVISPPKQVIIRDSSNVERST---VVGPYSEGDIV  164

Query  183  KLQCLVSGVITLRIEQLTWNRGYRPTCNINYLTIIFSTKDERLCTIHDSLEGIDKYSLFH  242
             L+C V G             GY PT  I++                D +E         
Sbjct  165  SLKCQVIG-------------GY-PTPTISWY--------------RDGIE---------  187

Query  243  ELLLSVPCRPEPKVRWWRGEMLLDSKDEPGEFPSLRRNALIVRELSRADLHAVFTCQASN  302
                 +PC    ++    G  +++ +             + +  L R DL++  TC+A +
Sbjct  188  -----IPC----ELSHLAGGKIIECE-------------ITLPSLGREDLNSRLTCRALS  225

Query  303  NNISQPVSASVAIEMHLKPLSVAILSNEHAPLSAGRKYDINCMTVGSRPPAKLSWYMDGK  362
            +  +  V A V I+M+  PL++ +L   H PLSAGR+YD+ C + GSRPPA ++W+ +G 
Sbjct  226  HPRAPIVEAVVQIDMNFAPLNIRLL-GAHQPLSAGRRYDLLCQSAGSRPPAVITWWQNGI  284

Query  363  KLSNYTEKVSQDGNMTSSTLILKPTLLDHDKVITCRAENFEIQRGIVEDTWKLNVFFVPI  422
            +L   TE  S DGN T+STL +  +  D  K ++C+A N  +    +ED WKL++ +VP 
Sbjct  285  RLEKTTETTSSDGNQTTSTLSISLSKSDAGKYLSCKAYNHAVPSEPLEDGWKLDIQYVPE  344

Query  423  LHLELGSNMNPDDIEEGDDVYFECKVHANPGAYKVIWRHNGNIIQNNAKNGVIVQQYGLA  482
             ++ LG++++P  + EG DVYF+C V A+P  +++ WRHN   + +N   GVI+  + L 
Sbjct  345  AYVRLGTSLDPSTLREGTDVYFDCLVMAHPNVFRIEWRHNEQPLSHNISLGVIISNHSLV  404

Query  483  LREVNRSQAGNYTCIASNVEGDGYSNTVELKIMYKPICLPDQKRIYGVARHEDARVTCSV  542
            L+ V R+ AGNY+C+  N EG+G S    L I+Y P C  +QK++YG+A+ EDA+V C+V
Sbjct  405  LQGVTRATAGNYSCVGFNAEGEGISAPFALNILYAPTCAQNQKKVYGIAKQEDAKVMCTV  464

Query  543  EAYPSPDSFRWTFNNTEEMVDVPQARYKNSTRHSQSILIYRPITEMDYGTVFCWASNTAG  602
            +A P    F WTFNN+ E +DV       S   + SI+ Y PITE+DYGT+ C ASN  G
Sbjct  465  DANPREVEFSWTFNNSAESIDVATNHIIRSG--TTSIVTYTPITELDYGTLLCLASNKIG  522

Query  603  QQKNACIFHIIPAGKPESLYNCTLSNQTTDSLSVECCVGFDGGQPQHFLLEVFDQHTGVL  662
            +Q+  C+FHII AG+PE ++NCT++N +  SL+V C  GF+GG PQ F LE+ D +T  +
Sbjct  523  KQRVPCVFHIIAAGRPEKVHNCTVNNISMTSLTVTCSDGFNGGLPQSFNLELLDSYTQEI  582

Query  663  QANITSEENAVFTVHGLQSGKILNMVLYAVNAKGRSEPTLLEGFTLKIAEKQT------G  716
            +ANITS     FTV GL  G I  + +YA N KGRS+P ++    L++ EKQ        
Sbjct  583  KANITSTIPK-FTVPGLSPGSIYRLNIYAFNTKGRSDPAIVNAAMLRMPEKQLTSEQTHN  641

Query  717  IPVPFEISPLLGGLIGVVTALLFVTITILIAMKI----RNERRTQRPSDLPLKKSTAP--  770
            +      SP++   IG+  A+L   + I++A++I     + RR +  S+  + +  +P  
Sbjct  642  LRAELLFSPVMSLTIGLTLAVLVAVLAIILALRIPCTASSRRRQKELSNENISRDESPGP  701

Query  771  -----SSEDLYDTEDRNPDVVPINKGSDYQ  795
                  S+++ D +++NPDVVP +   D Q
Sbjct  702  SDKSSGSKEVDDCDEKNPDVVPESIEPDEQ  731


>Q59DZ1_DROME unnamed protein product
Length=1064

 Score = 442 bits (1138),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 273/777 (35%), Positives = 410/777 (53%), Gaps = 109/777 (14%)

Query  49   AVLQGTAELSCDIRPPQQNDSVILVVWYKSDT-TPIYSYDMRGKHS-EKASHWNNKDHLN  106
            AV   +  L C I  P   D+V +V+W++ +   P+YS+D+R K S E+  HW+  +   
Sbjct  59   AVEGKSVSLPCPITEPL--DNVYMVLWFRDNAGIPLYSFDVRDKESREQPRHWSAPEVFG  116

Query  107  DRAFFRTVTEPATLNINHIEERDEGEYRCRVDFAKSPSRNSRINLMVIVPPHKPNIIDER  166
             RA F   ++PATL    I+  D+G YRCRVDF  S +++ R NL VI+ P +P I+D  
Sbjct  117  SRAKFHFDSQPATL---EIKRHDQGIYRCRVDFRTSQTQSFRFNLSVIILPEQPIIMDRW  173

Query  167  GTV--PAVAGPYEEGGDMKLQCLVSGVITLRIEQLTWNRGYRPTCNINYLTIIFSTKDER  224
            G        GP +EG D+        VIT R+                            
Sbjct  174  GRQLNGTQLGPKQEGDDI--------VITCRV----------------------------  197

Query  225  LCTIHDSLEGIDKYSLFHELLLSVPCRPEPKVRWWRGEMLLDSKDEPGEFPSLRRNALIV  284
                                   V  RP+P+VRW    +L+D+++E      +  N L+ 
Sbjct  198  -----------------------VGGRPQPQVRWLVNGLLVDNQNEHNSGDVIE-NRLLW  233

Query  285  RELSRADLHAVFTCQASNNNISQPVSASVAIEMHLKPLSVAILSNEHAPLSAGRKYDINC  344
              + R DL++VFTCQA N  + +P   S  ++MHLKPL V IL    + + A R+Y+++C
Sbjct  234  PSVQRNDLNSVFTCQALNTQLDKPKEKSFILDMHLKPLVVKILE-PPSSMIADRRYEVSC  292

Query  345  MTVGSRPPAKLSWYMDGKKLSNYTEKVSQDGNMTSSTLILKPTLLDHDKVITCRAENFEI  404