BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= NP_001267818.1 acyl-CoA delta-9 desaturase [Bombus terrestris]

Length=351
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9U972_DROME  unnamed protein product                                 473     7e-168
Q94541_DROME  unnamed protein product                                 471     2e-167
Q7K4Y0_DROME  unnamed protein product                                 471     3e-167


>Q9U972_DROME unnamed protein product
Length=383

 Score = 473 bits (1217),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 219/352 (62%), Positives = 274/352 (78%), Gaps = 5/352 (1%)

Query  4    NITSSPTGVLFEG--ETLDES-SRVIDAPKTKYKR--QIVWRNVIIFAYLHIGAVYGLYL  58
             +    TGVLFE   ET D    + I   K   KR  ++VWRN+I+F Y H+ A+YG YL
Sbjct  32   KLQEDSTGVLFESDVETTDGGLVKDITVMKKAEKRRLKLVWRNIIVFGYFHLAALYGAYL  91

Query  59   ALTSAKWATLLFALCLHLFSALGITAGAHRLWAHRSYKAKWPLQLFLMIGNTIAFQDAAI  118
             +TSAKW T + A  L++ S LGITAGAHRLWAHRSYKAKWPL++ L+I NTIAFQDAA 
Sbjct  92   MVTSAKWQTCILAYFLYVISGLGITAGAHRLWAHRSYKAKWPLRVILVIFNTIAFQDAAY  151

Query  119  DWARDHRLHHKYSETNADPHNAKRGFFFAHVGWLLCRKHPDIRAKGKGIDLSDLKNNPIL  178
             WARDHR+HHKYSET+ADPHNA RGFFF+HVGWLLC+KHP+++AKGKG+DLSDL+ +PIL
Sbjct  152  HWARDHRVHHKYSETDADPHNATRGFFFSHVGWLLCKKHPEVKAKGKGVDLSDLRADPIL  211

Query  179  SFQKKYYAILMPLLCFIVPTLIPVYCWDESWGNAYFVPTVLRYVYTLNMTWLVNSAAHMF  238
             FQKKYY ILMP+ CFI+PT++P+Y W ES+ NA+FV T+ R+ + LN+TWLVNSAAH F
Sbjct  212  MFQKKYYMILMPIACFIIPTVVPMYAWGESFMNAWFVATMFRWCFILNVTWLVNSAAHKF  271

Query  239  GNKPYDKYINPVENKMVAITALGEGWHNYHHVFPWDYKTAELGNYKVNITTLFIDACSKL  298
            G +PYDK+INP EN  VAI A GEGWHNYHHVFPWDYKTAE G Y +N TT FID  +K+
Sbjct  272  GGRPYDKFINPSENISVAILAFGEGWHNYHHVFPWDYKTAEFGKYSLNFTTAFIDFFAKI  331

Query  299  GLAYDMKIVPQDLVRKRVERTGDGSHNVWGWGDKDQTQQDRDVTMVVNLKKD  350
            G AYD+K V  D+++KRV+RTGDG+H  WGWGD DQ +++ +  ++ + K +
Sbjct  332  GWAYDLKTVSTDIIKKRVKRTGDGTHATWGWGDVDQPKEEIEDAVITHKKSE  383


>Q94541_DROME unnamed protein product
Length=383

 Score = 471 bits (1213),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 220/352 (63%), Positives = 274/352 (78%), Gaps = 5/352 (1%)

Query  4    NITSSPTGVLFEG--ETLDES-SRVIDAPKTKYKR--QIVWRNVIIFAYLHIGAVYGLYL  58
             +    TGVLFE   ET D    + I   K   KR  ++VWRN+I F YLH+ A+YG YL
Sbjct  32   KLQEDSTGVLFECDVETTDGGLVKDITVMKKAEKRLLKLVWRNIIAFGYLHLAALYGAYL  91

Query  59   ALTSAKWATLLFALCLHLFSALGITAGAHRLWAHRSYKAKWPLQLFLMIGNTIAFQDAAI  118
             +TSAKW T + A  L++ S LGITAGAHRLWAHRSYKAKWPL++ L+I NTIAFQDAA 
Sbjct  92   MVTSAKWQTCILAYFLYVISGLGITAGAHRLWAHRSYKAKWPLRVILVIFNTIAFQDAAY  151

Query  119  DWARDHRLHHKYSETNADPHNAKRGFFFAHVGWLLCRKHPDIRAKGKGIDLSDLKNNPIL  178
             WARDHR+HHKYSET+ADPHNA RGFFF+HVGWLLC+KHP+++AKGKG+DLSDL+ +PIL
Sbjct  152  HWARDHRVHHKYSETDADPHNATRGFFFSHVGWLLCKKHPEVKAKGKGVDLSDLRADPIL  211

Query  179  SFQKKYYAILMPLLCFIVPTLIPVYCWDESWGNAYFVPTVLRYVYTLNMTWLVNSAAHMF  238
             FQKKYY ILMP+ CFI+PT++P+Y W ES+ NA+FV T+ R+ + LN+TWLVNSAAH F
Sbjct  212  MFQKKYYMILMPIACFIIPTVVPMYAWGESFMNAWFVATMFRWCFILNVTWLVNSAAHKF  271

Query  239  GNKPYDKYINPVENKMVAITALGEGWHNYHHVFPWDYKTAELGNYKVNITTLFIDACSKL  298
            G +PYDK+INP EN  VAI A GEGWHNYHHVFPWDYKTAE G Y +N TT FID  +K+
Sbjct  272  GGRPYDKFINPSENISVAILAFGEGWHNYHHVFPWDYKTAEFGKYSLNFTTAFIDFFAKI  331

Query  299  GLAYDMKIVPQDLVRKRVERTGDGSHNVWGWGDKDQTQQDRDVTMVVNLKKD  350
            G AYD+K V  D+++KRV+RTGDG+H  WGWGD DQ +++ +  ++ + K +
Sbjct  332  GWAYDLKTVSTDIIKKRVKRTGDGTHATWGWGDVDQPKEEIEDAVITHKKSE  383


>Q7K4Y0_DROME unnamed protein product
Length=383

 Score = 471 bits (1213),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 220/352 (63%), Positives = 274/352 (78%), Gaps = 5/352 (1%)

Query  4    NITSSPTGVLFEG--ETLDES-SRVIDAPKTKYKR--QIVWRNVIIFAYLHIGAVYGLYL  58
             +    TGVLFE   ET D    + I   K   KR  ++VWRN+I F YLH+ A+YG YL
Sbjct  32   KLQEDSTGVLFECDVETTDGGLVKDITVMKKAEKRRLKLVWRNIIAFGYLHLAALYGAYL  91

Query  59   ALTSAKWATLLFALCLHLFSALGITAGAHRLWAHRSYKAKWPLQLFLMIGNTIAFQDAAI  118
             +TSAKW T + A  L++ S LGITAGAHRLWAHRSYKAKWPL++ L+I NTIAFQDAA 
Sbjct  92   MVTSAKWQTCILAYFLYVISGLGITAGAHRLWAHRSYKAKWPLRVILVIFNTIAFQDAAY  151

Query  119  DWARDHRLHHKYSETNADPHNAKRGFFFAHVGWLLCRKHPDIRAKGKGIDLSDLKNNPIL  178
             WARDHR+HHKYSET+ADPHNA RGFFF+HVGWLLC+KHP+++AKGKG+DLSDL+ +PIL
Sbjct  152  HWARDHRVHHKYSETDADPHNATRGFFFSHVGWLLCKKHPEVKAKGKGVDLSDLRADPIL  211

Query  179  SFQKKYYAILMPLLCFIVPTLIPVYCWDESWGNAYFVPTVLRYVYTLNMTWLVNSAAHMF  238
             FQKKYY ILMP+ CFI+PT++P+Y W ES+ NA+FV T+ R+ + LN+TWLVNSAAH F
Sbjct  212  MFQKKYYMILMPIACFIIPTVVPMYAWGESFMNAWFVATMFRWCFILNVTWLVNSAAHKF  271

Query  239  GNKPYDKYINPVENKMVAITALGEGWHNYHHVFPWDYKTAELGNYKVNITTLFIDACSKL  298
            G +PYDK+INP EN  VAI A GEGWHNYHHVFPWDYKTAE G Y +N TT FID  +K+
Sbjct  272  GGRPYDKFINPSENISVAILAFGEGWHNYHHVFPWDYKTAEFGKYSLNFTTAFIDFFAKI  331

Query  299  GLAYDMKIVPQDLVRKRVERTGDGSHNVWGWGDKDQTQQDRDVTMVVNLKKD  350
            G AYD+K V  D+++KRV+RTGDG+H  WGWGD DQ +++ +  ++ + K +
Sbjct  332  GWAYDLKTVSTDIIKKRVKRTGDGTHATWGWGDVDQPKEEIEDAVITHKKSE  383



Lambda      K        H
   0.324    0.138    0.456 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3617638992


Query= NP_001267823.1 venom serine protease precursor [Bombus terrestris]

Length=358
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CFB_TACTR  unnamed protein product                                    182     5e-54
Q9VW19_DROME  unnamed protein product                                 182     9e-54
PPAF1_HOLDI  unnamed protein product                                  178     2e-52


>CFB_TACTR unnamed protein product
Length=400

 Score = 182 bits (463),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 127/370 (34%), Positives = 181/370 (49%), Gaps = 65/370 (18%)

Query  27   QECTTPDNKAGKCLGIRGCKPLLEMLQTQGHAAADFLRQSVCKYENN-NPIVCCPNE---  82
             ECT      G C  +  C  +L  L+             VC +     PIVCCP+    
Sbjct  35   NECTARGGLKGSCKSLIDCPSVLATLKDSFPV--------VCSWNGRFQPIVCCPDAIAP  86

Query  83   -----------ESRE------------DRGILVEY-------EPLRPPHCGFSNVSHTR-  111
                        ++E             R + ++         P+ PP     N +  R 
Sbjct  87   PPVTTTAVTVISTKEPKLPRLHISGCGKRKVKIDITTVGRSGSPILPPISTPQNSTGGRG  146

Query  112  -VVGGNPAVLGAWPWIAALGFRYPRNPALEPLWKCGGSLISSRHVLTAAHCAEIN-----  165
             + GG  A +GAWPW+AA+   + +N  +   + C GS+IS++++L+AAH   I      
Sbjct  147  IIAGGVEAKIGAWPWMAAV---FVKNFGIG-RFHCAGSIISNKYILSAAHAFLIGGRKLT  202

Query  166  -ELYVVRIGDLNLVRNDDGAHPVQIEIESKIIHPDYISGVTKHDIAILKLVEEVPFSEYV  224
                 VR+G   + R  +  +PV+      IIHP Y+     +DIAI++L EE+ F++ V
Sbjct  203  PTRLAVRVGGHYIKRGQE--YPVK----DVIIHPHYVEKENYNDIAIIELKEELNFTDLV  256

Query  225  YPICLPVEDNLRNNNFERYYPFVAGWGSLAHHGPGSDDLMEVQVPVISNTECKNSYARFA  284
             PICLP  + + +   +R     AGWG L   GP S  L EV +PV+   +C  +Y +  
Sbjct  257  NPICLPDPETVTDPLKDRIVT-AAGWGDLDFSGPRSQVLREVSIPVVPVDKCDQAYEKLN  315

Query  285  AAH----VTDTVLCAGYTQGGKDACQGDSGGPLMLPKKFTFYQIGVVSYGHKCAAAGYPG  340
                   +T+  LCAG  +GGKDACQGDSGGPLML     +  +GVVS+GHKCA  GYPG
Sbjct  316  TPSLKNGITNNFLCAGLEEGGKDACQGDSGGPLMLVNNTRWIVVGVVSFGHKCAEEGYPG  375

Query  341  VYTRVTSYLD  350
            VY+RV SYLD
Sbjct  376  VYSRVASYLD  385


>Q9VW19_DROME unnamed protein product
Length=408

 Score = 182 bits (462),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 118/337 (35%), Positives = 178/337 (53%), Gaps = 38/337 (11%)

Query  29   CTTPDNKAGKCLGIRGCKPLLEMLQTQGHAAADFLRQSVCKYENNNPIVCCPNEESREDR  88
            C+TP  ++G+C  I  C+    M + +       L   +C  E ++  +CC ++ +    
Sbjct  87   CSTPLGESGRCRHIIYCR----MPELKNDVWR--LVSQLCIIEKSSIGICCTDQSTSNRF  140

Query  89   GILV-------EYEPLRPPH---CGFSNVSHTRVVGGNPAVLGAWPWIAALGFRYPRNPA  138
               V       E   +  P    CG ++    R+ GG PA    WPW+AAL         
Sbjct  141  SPQVVTSADGDEPRIVNKPEQRGCGITSRQFPRLTGGRPAEPDEWPWMAAL-----LQEG  195

Query  139  LEPLWKCGGSLISSRHVLTAAHC--AEINELYVVRIGDLNL-VRNDDGAHPVQIEIESKI  195
            L  +W CGG LI+ RHVLTAAHC   +  E   VR+G+ N  + N+  A      I + +
Sbjct  196  LPFVW-CGGVLITDRHVLTAAHCIYKKNKEDIFVRLGEYNTHMLNETRAR--DFRIANMV  252

Query  196  IHPDYISGVTKHDIAILKLVEEVPFSEYVYPICLPVEDNLRNNNFERYYPFVAGWGSLAH  255
            +H DY      +DIAI+++     F+ Y++P+C+P      N ++      V GWG+   
Sbjct  253  LHIDYNPQNYDNDIAIVRIDRATIFNTYIWPVCMPPV----NEDWSDRNAIVTGWGTQKF  308

Query  256  HGPGSDDLMEVQVPVISNTECKNSYARFAAAHVTDTVLCAGYTQGGKDACQGDSGGPLM-  314
             GP S+ LMEV +PV   ++C++S+ +    HV DT +CAG+ +GG+D+CQGDSGGPL+ 
Sbjct  309  GGPHSNILMEVNLPVWKQSDCRSSFVQ----HVPDTAMCAGFPEGGQDSCQGDSGGPLLV  364

Query  315  -LPKKFTFYQIGVVSYGHKCAAAGYPGVYTRVTSYLD  350
             LP +  +  IG+VS+G  C   G PG+YTRV  YLD
Sbjct  365  QLPNQ-RWVTIGIVSWGVGCGQRGRPGIYTRVDRYLD  400


>PPAF1_HOLDI unnamed protein product
Length=365

 Score = 178 bits (451),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 120/360 (33%), Positives = 181/360 (50%), Gaps = 33/360 (9%)

Query  13   LIAFLHPLVHVASAQECTTPDNKAGKCLGIRGCKPLLEMLQTQGHAAADFLRQSVCKYEN  72
            L  F+  L  + +   C TP+ +  +C+ I  CK L + + T       FLR S C Y N
Sbjct  9    LWFFVLNLYSIKAQAGCRTPNGENARCVPINNCKILYDSVLTSDPEVIRFLRASQCGY-N  67

Query  73   NNPIVCCPNEESRE----DRGILVEYEPLRPPHCGFSNVSHTRVVGGNPAVLGAWPWIAA  128
              P+VCC +  S +       I      L P  CG+  V   +++ G+  V   +PW A 
Sbjct  68   GQPLVCCGSSASYQPPPTSASIRNRRPELLPNDCGYQ-VEADKILNGDDTVPEEFPWTAM  126

Query  129  LGFRYPRNPALEPLWKCGGSLISSRHVLTAAHCAE------INELYVVRIGDLNLVRNDD  182
            +G+   +N +    + CGGSLI++R+++TAAHC        +  L  VR+G+ N   + D
Sbjct  127  IGY---KNSSNFEQFACGGSLINNRYIVTAAHCVAGRVLRVVGALNKVRLGEWNTATDPD  183

Query  183  --GA-------HPVQIEIESKIIHPDYISGVTK--HDIAILKLVEEVPFSEYVYPICLPV  231
              GA        P+ + IE  I HPDY+ G     HDIA+++L  +V F+ Y+ P+CLP 
Sbjct  184  CYGAVRVCVPDKPIDLGIEETIQHPDYVDGSKDRYHDIALIRLNRQVEFTNYIRPVCLP-  242

Query  232  EDNLRNNNFERYYPFVAGWGSLAHHGPGSDDLMEVQVPVISNTECKNSYARFAAAHVTDT  291
            + N      +R    V GWG     G  S    ++ VPV+   +C  ++   A   V  +
Sbjct  243  QPNEEVQVGQRLT--VVGWGR-TETGQYSTIKQKLAVPVVHAEQCAKTFGA-AGVRVRSS  298

Query  292  VLCAGYTQGGKDACQGDSGGPLMLPK-KFTFYQIGVVSYGHKCAAAGYPGVYTRVTSYLD  350
             LCAG  +  KD+C GDSGGPL+  +    F+  G+VS+G  C   G+PG+YT+V  Y D
Sbjct  299  QLCAG-GEKAKDSCGGDSGGPLLAERANQQFFLEGLVSFGATCGTEGWPGIYTKVGKYRD  357



Lambda      K        H
   0.324    0.138    0.456 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3617638992


Query= NP_001267828.1 silk fibroin 3 precursor [Bombus terrestris]

Length=332


***** No hits found *****



Lambda      K        H
   0.324    0.138    0.456 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3617638992


Query= NP_001267830.1 silk fibroin 2 precursor [Bombus terrestris]

Length=313


***** No hits found *****



Lambda      K        H
   0.324    0.138    0.456 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3617638992


Query= NP_001267833.1 silk fibroin 1 precursor [Bombus terrestris]

Length=327


***** No hits found *****



Lambda      K        H
   0.324    0.138    0.456 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3617638992


Query= NP_001267835.1 farnesyl pyrophosphate synthase-like [Bombus
terrestris]

Length=370
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7KAK2_DROME  unnamed protein product                                 390     4e-135
Q7KN61_DROME  unnamed protein product                                 391     1e-134
FPS_DICDI  unnamed protein product                                    277     1e-90 


>Q7KAK2_DROME unnamed protein product
Length=380

 Score = 390 bits (1002),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 180/347 (52%), Positives = 250/347 (72%), Gaps = 5/347 (1%)

Query  16   VPNTSFISV-KDESRELMAVWPDIVRDLTDAGRHLDIPDVTKWLVKVLQYNVPSGGRNRA  74
            VP  + ++V KDESR+ MAV+PD+VRD+T   +  +  D  KW  +VLQYNVP G +NR 
Sbjct  32   VPIAARVTVSKDESRDFMAVFPDLVRDITTVTKAYNCSDAAKWFAQVLQYNVPRGKKNRG  91

Query  75   LTVVEAYRSLNPPDQITEENLRLTRILGWCIELLQAFFLTIDDIQDHSEIRRNQPCWYLY  134
            +  V  Y++L P   +T EN++L + LGWC+E+LQ+FF+  DD+ D+S  RR QPCW+  
Sbjct  92   ILTVLTYKNLVPTQDLTPENIKLAQYLGWCVEMLQSFFIISDDVMDNSTTRRGQPCWHKV  151

Query  135  NDIGLTAINDALMLEMCIYQLLKKHFKTKECYLDLLEQFLSVSLKTEMGQCLDLLSTNFG  194
             ++GLTAINDALM+E  +Y +LKKHF   +CY+ L+E F  ++  T  GQ LD L++N  
Sbjct  152  ENVGLTAINDALMIENAMYAILKKHFSHLDCYVALMELFHEITYITTCGQSLDQLNSN--  209

Query  195  KKPNLHLFTMDRYNSIVKYKTGYYTFVLPATVAMSFTGIKDPEMYRQAKTILLEMGHLFQ  254
                +  FTM+ Y +IV+ KT YY+F LP  +A+   G KD E +RQ+KTILLEMG+ FQ
Sbjct  210  --RCVSEFTMENYKAIVENKTAYYSFYLPFALALHLAGYKDAEAFRQSKTILLEMGNFFQ  267

Query  255  VKDDYLDCYGSIEDIGKSGTDIAEGKCSWLIVVALQRATPEQKKIFEECYGQSDVEKINR  314
            V+DD+LDC+G+ E  GK GTDI + KCSWL VVA+QRA  EQK+I  +CYG+ +  K+ R
Sbjct  268  VQDDFLDCFGNPEVTGKIGTDIQDNKCSWLAVVAMQRANVEQKQIMVDCYGKEEPAKVER  327

Query  315  VKQLYQELGVSNTYAIYEEETYNLLHTHIQQISRGLPHDFFLKLLNR  361
            VK+LY+ELG+ +TYAI+EEE+YN++ THIQQ SRG+PH  FL++LN+
Sbjct  328  VKELYKELGLPSTYAIFEEESYNMIKTHIQQTSRGVPHQTFLQILNK  374


>Q7KN61_DROME unnamed protein product
Length=419

 Score = 391 bits (1004),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 180/347 (52%), Positives = 250/347 (72%), Gaps = 5/347 (1%)

Query  16   VPNTSFISV-KDESRELMAVWPDIVRDLTDAGRHLDIPDVTKWLVKVLQYNVPSGGRNRA  74
            VP  + ++V KDESR+ MAV+PD+VRD+T   +  +  D  KW  +VLQYNVP G +NR 
Sbjct  71   VPIAARVTVSKDESRDFMAVFPDLVRDITTVTKAYNCSDAAKWFAQVLQYNVPRGKKNRG  130

Query  75   LTVVEAYRSLNPPDQITEENLRLTRILGWCIELLQAFFLTIDDIQDHSEIRRNQPCWYLY  134
            +  V  Y++L P   +T EN++L + LGWC+E+LQ+FF+  DD+ D+S  RR QPCW+  
Sbjct  131  ILTVLTYKNLVPTQDLTPENIKLAQYLGWCVEMLQSFFIISDDVMDNSTTRRGQPCWHKV  190

Query  135  NDIGLTAINDALMLEMCIYQLLKKHFKTKECYLDLLEQFLSVSLKTEMGQCLDLLSTNFG  194
             ++GLTAINDALM+E  +Y +LKKHF   +CY+ L+E F  ++  T  GQ LD L++N  
Sbjct  191  ENVGLTAINDALMIENAMYAILKKHFSHLDCYVALMELFHEITYITTCGQSLDQLNSNRC  250

Query  195  KKPNLHLFTMDRYNSIVKYKTGYYTFVLPATVAMSFTGIKDPEMYRQAKTILLEMGHLFQ  254
                +  FTM+ Y +IV+ KT YY+F LP  +A+   G KD E +RQ+KTILLEMG+ FQ
Sbjct  251  ----VSEFTMENYKAIVENKTAYYSFYLPFALALHLAGYKDAEAFRQSKTILLEMGNFFQ  306

Query  255  VKDDYLDCYGSIEDIGKSGTDIAEGKCSWLIVVALQRATPEQKKIFEECYGQSDVEKINR  314
            V+DD+LDC+G+ E  GK GTDI + KCSWL VVA+QRA  EQK+I  +CYG+ +  K+ R
Sbjct  307  VQDDFLDCFGNPEVTGKIGTDIQDNKCSWLAVVAMQRANVEQKQIMVDCYGKEEPAKVER  366

Query  315  VKQLYQELGVSNTYAIYEEETYNLLHTHIQQISRGLPHDFFLKLLNR  361
            VK+LY+ELG+ +TYAI+EEE+YN++ THIQQ SRG+PH  FL++LN+
Sbjct  367  VKELYKELGLPSTYAIFEEESYNMIKTHIQQTSRGVPHQTFLQILNK  413


>FPS_DICDI unnamed protein product
Length=382

 Score = 277 bits (708),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 144/351 (41%), Positives = 211/351 (60%), Gaps = 11/351 (3%)

Query  23   SVKDESRELMAVWPDIVRDLTDAGRHLDIPDVT-KWLVKVLQYNVPSGGRNRALTVVEAY  81
            + K+E  + + ++P +  ++      +D+P  T  W+ K++  NV  G  NR LTV+ + 
Sbjct  33   TAKEELADFVEIFPILTNEILKELPGMDMPPQTIAWVEKMINVNVSGGKMNRGLTVLHSL  92

Query  82   RSLNPPDQITEENLRLTRILGWCIELLQAFFLTIDDIQDHSEIRRNQPCWY-----LYND  136
            + L    Q++   + L  +LGWC+E LQAFFL  DDI D S  RR QPCWY     + N+
Sbjct  93   QLLVEGRQLSRSEIFLANVLGWCVEWLQAFFLVADDIMDQSITRRGQPCWYRQANPISNN  152

Query  137  --IGLTAINDALMLEMCIYQLLKKHFKTKECYLDLLEQFLSVSLKTEMGQCLDLLSTNFG  194
              IG  AIND+ +LE CIY L+KK+F+ +  Y D+L+ F   S +TE+GQ LDL  T   
Sbjct  153  GTIGSIAINDSFILESCIYILIKKYFRNEPYYADILDIFHETSYQTELGQLLDL--TTQP  210

Query  195  KKPNLHLFTMDRYNSIVKYKTGYYTFVLPATVAMSFTGIKDPEMYRQAKTILLEMGHLFQ  254
             + +  LFT++ Y  IVKYKT YY+F LP  +AM   GI     +  AK ILL MG  FQ
Sbjct  211  NRGDFSLFTLNTYRRIVKYKTAYYSFYLPVALAMLMAGITSTPAFSTAKDILLPMGEFFQ  270

Query  255  VKDDYLDCYGSIEDIGKSGTDIAEGKCSWLIVVALQRATPEQKKIFEECYGQSDVEKINR  314
            V+DD+LDCYGS   IGK G DI E KCSW+I  A+   TPEQ  + ++ YG  +   +  
Sbjct  271  VQDDFLDCYGSPAVIGKIGRDIEENKCSWMICQAILNGTPEQINLLKKHYGLDNPTDVEL  330

Query  315  VKQLYQELGVSNTYAIYEEETYNLLHTHIQQISRGLPHDFFLKLLNRTCRK  365
            VK++Y E+G+   +  YE+E+Y  L + I+ + R +P + F+KLL++  ++
Sbjct  331  VKKIYGEIGLKKIFKDYEDESYAFLISKIKSV-RIMPQEVFIKLLSKIYKR  380



Lambda      K        H
   0.324    0.138    0.456 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3617638992


Query= NP_001267838.1 defensin precursor [Bombus terrestris]

Length=96
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DEFI_DROME  unnamed protein product                                   58.5    1e-12
LUCFE_LUCSE  unnamed protein product                                  55.8    1e-11
DEFI_PHLDU  unnamed protein product                                   52.0    5e-10


>DEFI_DROME unnamed protein product
Length=92

 Score = 58.5 bits (140),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 54/93 (58%), Gaps = 11/93 (12%)

Query  2   VKVYFLVALLFVAVAAIMAA-------PVEEEYELLEQAGIEE--RADRQRRVTCDLLSI  52
           +K + LVA+ F  +A +  A       P+ E++ L+ +   +E  +  RQ+R TCDLLS 
Sbjct  1   MKFFVLVAIAFALLACVAQAQPVSDVDPIPEDHVLVHEDAHQEVLQHSRQKRATCDLLS-  59

Query  53  KGVAEHSACAANCLSMGKAGGRCEN-AVCLCRK  84
           K    H+ACA +C++ G  GG C + AVC+CR 
Sbjct  60  KWNWNHTACAGHCIAKGFKGGYCNDKAVCVCRN  92


>LUCFE_LUCSE unnamed protein product
Length=92

 Score = 55.8 bits (133),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 52/89 (58%), Gaps = 13/89 (15%)

Query  4   VYFLVALLFVAVAAIMAAPVEEEYELLEQAGIE-------ERADRQRRVTCDLLSIKGVA  56
           V F +AL FV+ +  +A P ++E   ++  G+E       E   R +R TCDLLS  GV 
Sbjct  9   VTFCLALSFVSQS--LALPADDEAHFVD--GLEALKTIEPELHGRYKRATCDLLSGTGV-  63

Query  57  EHSACAANCLSMGKAGGRCEN-AVCLCRK  84
           +HSACAA+CL  G  GG C   A+C+CR 
Sbjct  64  KHSACAAHCLLRGNRGGYCNGRAICVCRN  92


>DEFI_PHLDU unnamed protein product
Length=98

 Score = 52.0 bits (123),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 44/83 (53%), Gaps = 14/83 (17%)

Query  15  VAAIMAAPVEEEYELLEQAG------------IEERADRQRRVTCDLLSIKGVAEHSACA  62
           ++A  + PVE E E  +               + +   RQ+R TCDLLS  GV  H+ACA
Sbjct  17  ISAYPSNPVEVEAEDFDAQDPDLQTFQDTFYEVPQVHSRQKRATCDLLSAFGVG-HAACA  75

Query  63  ANCLSMGKAGGRCEN-AVCLCRK  84
           A+C+  G  GG C + AVC CR+
Sbjct  76  AHCIGHGYRGGYCNSKAVCTCRR  98



Lambda      K        H
   0.324    0.138    0.456 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3617638992


Query= NP_001267840.1 fatty acid synthase-like [Bombus terrestris]

Length=2392
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VQL7_DROME  unnamed protein product                                 2592    0.0  
B7Z001_DROME  unnamed protein product                                 2587    0.0  
Q9VQL6_DROME  unnamed protein product                                 2272    0.0  


>Q9VQL7_DROME unnamed protein product
Length=2438

 Score = 2592 bits (6718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1319/2448 (54%), Positives = 1726/2448 (71%), Gaps = 73/2448 (3%)

Query  1     MPAQFES---ANTPIVREPTMLNSNTNAY-----DVNNEIVISGFSGRFPESSDIEEFKK  52
             MPA+F        P  R    L+     Y      +N+EI I+GFSGR PESS IEEFK+
Sbjct  1     MPARFAEEVITAEPAQRAAPQLDLGGGHYVPRQQHLNDEIAITGFSGRLPESSTIEEFKQ  60

Query  53    NLFEGIDMITDDERRWPAGLFGLPKRTGKLKD--LKSFDATFFGVHAKQAHVMDPQLRLL  110
             NLF+G+DM+ DD RRW  GL+GLP R GKLKD  L++FD  FFGVH KQA  MDP LR+L
Sbjct  61    NLFDGVDMVNDDPRRWERGLYGLPDRIGKLKDSDLENFDQQFFGVHQKQAECMDPLLRML  120

Query  111   LEVVYEAIVDAGINPNDIRGSKTGVFIGVSSSESDEFWSKDPEQINGYGLTGCCRAMFPN  170
             LE+ +EAI+DAG+NP+D+RGS+TGV+IGVS+SE+++ W  D +++NGYGLTGC RAMF N
Sbjct  121   LELTHEAIIDAGLNPSDLRGSRTGVYIGVSNSETEQHWCSDADRVNGYGLTGCARAMFAN  180

Query  171   RISYTFDFNGPSYAIDTACSSSLYAMHQAIVSIRSGECDAAIVGGCNLLLKPTSSLQFHR  230
             RIS+TFDF GPSY+IDTACSSSLYA+ QA   +R G+ D A+V G  L+LKPT SLQF R
Sbjct  181   RISFTFDFKGPSYSIDTACSSSLYALEQAFSDMREGKVDNALVAGAGLILKPTMSLQFKR  240

Query  231   LGMLSPDGACKAFDTDGKGYVRSEAVSVLLLQKARDARRVYATVLHAKTNTDGNKAQGIT  290
             L MLSPDG+CKAFD  G GYVRS+   VLLLQ+   ARRVYA++L+ +TNTDG K QGIT
Sbjct  241   LNMLSPDGSCKAFDESGNGYVRSDGCVVLLLQRTSAARRVYASILNVRTNTDGFKEQGIT  300

Query  291   FPSGDMQNKLMREVYAEVGVNPADVVYVEAHGTGTKVGDPQEINSIANLFCKGRKGPLLL  350
             +P G MQN+L+RE Y E+G+NPADVVYVEAHGTGTKVGDPQE+NSI + FCK R  PLL+
Sbjct  301   YPIGKMQNRLIRETYEEIGLNPADVVYVEAHGTGTKVGDPQEVNSITDFFCKDRTTPLLI  360

Query  351   GSVKSNMGHSEPASGVCSMAKLLIAMEAGVIPGNLHFKNPNTDIPALSDGSIQVVDKNMP  410
             GSVKSNMGHSEPASGVCS+AK+LIAME GVIPGNLH+  PN D+  L DG ++VVD+N+P
Sbjct  361   GSVKSNMGHSEPASGVCSVAKILIAMEEGVIPGNLHYNKPNPDLYGLVDGRLKVVDRNLP  420

Query  411   WKGGLIAVNSFGFGGANAHILLRSNPKPK-LSPVLDNKVPKLVTVSGRTSEAVNVLLDKA  469
             W GG+I +NSFGFGGANAH++L+SNPKPK L+P   +   K+V  SGRT EAV  LL+ A
Sbjct  421   WNGGIIGLNSFGFGGANAHVILKSNPKPKALTP--KDGALKVVLASGRTFEAVEQLLESA  478

Query  470   KEYEKDDEFIALLHDIHTNNVAGHLYRGYSIMGN--VNIREVDSYVNEKRPVWFVFSGMG  527
                  DDE++ L+++IH+  +  H +RGY ++ +   + REV    ++KRP+W+++SGMG
Sbjct  479   STNADDDEYLQLINEIHSKAIPNHFFRGYGVVSSKGTHQREVIESNDDKRPIWYIYSGMG  538

Query  528   SQWPGMGKDLLSIDIFQRSLRRCAEALKPEGIDLMNLIQNGTAETFDENVLYSFVSIAAI  587
             SQW  M KDL+ I+ F ++++RCA+ LKPEG+DL++++   T ++F EN+L SF+SIAA+
Sbjct  539   SQWASMAKDLMKIEAFAKTIQRCADVLKPEGVDLIDVLTRSTDKSF-ENILNSFISIAAM  597

Query  588   QVALVDVLTYLGIQPDGIVGHSVGELGCAYADGTFTPEQTVLAAYWRGKTIKDSNLQPGG  647
             QVAL D+L+ LGI PDGIVGHSVGELGCAYADG FTPEQTVLAAYWRGK+I D+ L  G 
Sbjct  598   QVALTDLLSSLGIHPDGIVGHSVGELGCAYADGCFTPEQTVLAAYWRGKSILDTQLAKGK  657

Query  648   MAAVGLSWEEAAARCPPDVTPACNNSADSVTVSGPIESLKKLADDLQKDNIFIKLVNSSG  707
             MAAVGLSWE+A +R P D  P C+NS D+ T+SGP  S++ L   L  + +F K VNSSG
Sbjct  658   MAAVGLSWEDAHSRVPSDCFPVCHNSEDNCTISGPEASIEALVAKLNAEGVFAKAVNSSG  717

Query  708   VAFHSKYVAPVGQKLRAMLEKIITNPKQRTSRWISTSIPESAWGTPLAQLSSAAYHVNNL  767
              AFHSKY+A  G KLR  LEKII N K RT+RWISTSIPESAW TP+A+ SSAAYHVNNL
Sbjct  718   YAFHSKYIAEAGPKLRKSLEKIIPNAKNRTARWISTSIPESAWNTPVAKQSSAAYHVNNL  777

Query  768   LSPVLFYQALGHIPENAIVIEIAPHCLLQAILRRSLPSTVTNIGLHKRGHANNLNFFLEN  827
             LSPVLF++AL H+P+NAI +EIAPH LLQAIL+R+L    TN+ L KRGH NN+ FFL N
Sbjct  778   LSPVLFHEALQHVPKNAISVEIAPHGLLQAILKRALGPDATNLSLVKRGHENNVEFFLTN  837

Query  828   IGKLYLAGGQPRVSKLYPPVNYPVGRGTPMINSLVKWDHSVEWNLADYAATNASFGENVV  887
             +GKL+ AG QP+V  L  P++YPVGRGTPM+NS V WDH+ +W +A +    +S GE +V
Sbjct  838   VGKLFAAGAQPQVLTLVRPISYPVGRGTPMLNSKVGWDHTQKWLVAKFGKETSS-GETIV  896

Query  888   EVNLSKETDAYLVGHCIDERILFPATGYLVIVWKTYAKMRGTDFEKLPITFENVKFQRAT  947
             EV+LSKE DA+L GH ID RILFPATGY+ + W+T+AKM+G++F K P+  EN+ F RAT
Sbjct  897   EVDLSKEDDAFLAGHTIDGRILFPATGYMTLAWQTFAKMQGSEFHKTPVVMENLVFHRAT  956

Query  948   IMPMDGTVKFSINIFLGTGDFEICESGSVVVTGTVSVPENVDKMLLNMPAPIVKNESTVV  1007
             I+  +  VKF IN F GTG FEICESGS+ V+G +++PE++D    N   P+ +   + V
Sbjct  957   ILNKNAVVKFGINFFDGTGAFEICESGSLAVSGKITIPESID----NEELPLEEQTPSAV  1012

Query  1008  --ELNTTDVYKELRLRGYNYTGIFQGIKVVHNGGVSGRLLWND-WISFMDTMLQFSILEK  1064
               EL T DVYKELRLRGY+Y GIF+GI        +G+L W D WISFMDTMLQFSIL K
Sbjct  1013  AKELGTNDVYKELRLRGYDYGGIFRGIVRSDTVASTGKLQWVDNWISFMDTMLQFSILSK  1072

Query  1065  DCRGLYVPVRVQYVAINPIAHLEFVENYKEGE----GVPIYSYPNIGVIKSGGVEIRKMK  1120
             + R LY+P R++   INP  H E +    + E    G+P+  Y +I VIKS GVE+R +K
Sbjct  1073  NLRELYLPTRIERAVINPAKHFELLSALTKEEQVETGLPVQWYSDINVIKSAGVELRGLK  1132

Query  1121  ASLIAKKQQIR-PPKLERCLFIPYENSQPLVQDPEKAKVHALTILLLTAYENIKG-IKLK  1178
             A+L  ++   + PP LER  F+P  N+  L ++ EKA++HAL + +    EN  G +KLK
Sbjct  1133  ANLAQRRPGTQAPPTLERYQFVPNINTTDLNENSEKARLHALDVAIQVIIENSSGAVKLK  1192

Query  1179  ITEVSGDRPVDSLMLPYIKTWCSREPVINGDLQLATVLRKRYISL----KQNIKIIKCNV  1234
               E++  R  D L+   +      EPV+ GD+ + T                ++++  +V
Sbjct  1193  GVELANGRNPDVLVANRLLQIIEGEPVLTGDVAVVTSNNNEETITAALGDSGVRVVSKDV  1252

Query  1235  EKELIGQDLHIAVASNVLTDNSLNVLKNLKDSVINRGFILLEETAQTDFN-----VVDPD  1289
              KE + Q+ H     +VL+      L+N   S+   GF++LEET  T        +    
Sbjct  1253  LKEPVEQNCHFVFGIDVLSRPDTKTLENSIASIRENGFLILEETLPTYTKTGRALLTKFG  1312

Query  1290  LVCVAKQVIPGKSYILLKKKEV---RPDPIVIQLTEKNFSWVEGVKAALKNVVAQNQRPL  1346
              V V +Q +     ++L +K V       +V+  TE+NF+WV+ +KAAL     + Q   
Sbjct  1313  FVAVQEQSLGATRVLVLARKAVDLKTRKSVVVVATEQNFNWVDDLKAALATAATEEQYVY  1372

Query  1347  FVCQGEELFGMVGFMNCILNEDGGAKASYVFIQDKNMPKFNLNDKFYAKQLDKQMFANIL  1406
              VCQGEELFG VG M CI NE+GG  A  VF+QD    KF+L    Y +QL+K + +N+L
Sbjct  1373  VVCQGEELFGAVGLMTCIKNENGGKLARLVFVQDAKAEKFSLTSTLYRQQLEKDLISNVL  1432

Query  1407  RGGQWGSYKHIELDQENESSLQVEHAYINALNRGDLSSLRWIESPLSYYQLEKSPNTELC  1466
             + G WG+++H++L+ + +++LQVEHAY+NAL +GDL+SL+WIE+  +        N E C
Sbjct  1433  KNGAWGTFRHLKLETQ-QATLQVEHAYVNALVKGDLASLKWIEAAQADTAATVDKNLETC  1491

Query  1467  SVYYAPLNFRDIMLATGKLPPDALPGNLATQDCILGLEFSGRDSKGQRVMAMVPARGLAT  1526
             +VYYAP+NFRD+ML +GKL  DALPG+LA QDC+LGLEF+GRD++G+RVMAMVPA+ LAT
Sbjct  1492  TVYYAPINFRDVMLTSGKLAADALPGDLAEQDCVLGLEFAGRDTQGRRVMAMVPAKSLAT  1551

Query  1527  TVIADPGFMWKVPDKWSLEEAATVPVAYATSYYALCVRGHMKPGDSVLIHAGSGGVGQAS  1586
             T +A    MW++P+KW++EEA+TVP  Y+T YYAL VRG MK G+ +LIHAGSGGVGQA+
Sbjct  1552  TCVASKRMMWQIPEKWTMEEASTVPCVYSTVYYALVVRGQMKKGEKILIHAGSGGVGQAA  1611

Query  1587  ISIALHAGCKVFTTVGTQDKRDFLKKMFPVLTDRNIGNSRDTSFEQLILNETNGRGVDIV  1646
             IS+AL  G  VFTTVG+++KR+FL K FP L +RNIGNSRDTSFEQL+L ET GRGVD+V
Sbjct  1612  ISVALAHGLTVFTTVGSKEKREFLLKRFPKLQERNIGNSRDTSFEQLVLRETKGRGVDLV  1671

Query  1647  LNSLAEEKLQASIRCLAQGGRFLEIGKFDLSNDSPLGMSVFLKNVSFHGILLDAICEDDG  1706
             LNSL+EEKLQASIRCL   GRFLEIGKFDLSN+SPLGMSVFLKN SFHGILLD++ E + 
Sbjct  1672  LNSLSEEKLQASIRCLGLNGRFLEIGKFDLSNNSPLGMSVFLKNTSFHGILLDSVMEGEE  1731

Query  1707  PERQEVVRLVSEGIKSGAVRPLPSTVFSEQQIEQSFRYMATGKHIGKVLLKIRDEEK-QK  1765
               + +VV LV+EGIK+GAV PLP++VF++QQ+EQ+FR+MA+GKHIGKV++K+RDEE  +K
Sbjct  1732  EMQNQVVSLVAEGIKTGAVVPLPTSVFNDQQVEQAFRFMASGKHIGKVVIKVRDEEAGKK  1791

Query  1766  VVQSPQKVVSAIPRTYLNPEKSYILVGGLGGFGLELAYWMILRGAKYIILTSRSGVTTGF  1825
              +Q   ++++AIPRTY++PEKSYILVGGLGGFGLEL  W++ RGA+YI+LTSRSGV TG+
Sbjct  1792  ALQPKPRLINAIPRTYMHPEKSYILVGGLGGFGLELTNWLVTRGARYIVLTSRSGVKTGY  1851

Query  1826  QALCIRRWRNMGAHIKISTADVTTLDGAKQLIKESKALAPVGGIFNLAAVLRDGLIENLT  1885
             Q L IRRW+  G  + I T+DVTT  GAK+L++ S  LA VGGIFNLAAVLRD LIE+ T
Sbjct  1852  QGLMIRRWQERGVKVVIDTSDVTTAAGAKKLLENSNKLALVGGIFNLAAVLRDALIEDQT  1911

Query  1886  ESDFVISASPKVNGTKNLDIVSRE-CSSLDYFVVFSSVTSGRGNVGQTNYGLANSAMERL  1944
               DF   A PKV  TK LD  SR+ C+ LDYF+ FSSV+ GRGN+GQTNYGLANSAMER+
Sbjct  1912  AKDFKTVADPKVTATKYLDQFSRDICTELDYFICFSSVSCGRGNIGQTNYGLANSAMERI  1971

Query  1945  MEQRQANGLPGLAIQWGAIGDVGLILEKLGGFNDTEIGGTLPQRIQNCLDTMDIFLQQPH  2004
              EQRQ +G PG AIQWGAIGD GL+LE LG  NDT IGGTLPQR+ +CL T+D+FLQQPH
Sbjct  1972  CEQRQVSGFPGTAIQWGAIGDTGLVLENLGD-NDTVIGGTLPQRMPSCLQTIDLFLQQPH  2030

Query  2005  PILASLVTANKDNTVESANKVSVVQAIANILGIKALESVNGSTSLADLGMDSLMGTEIKQ  2064
             P++AS+V A K  + +SA  VS++  IANILG++  +++    SLADLGMDSLM  EIKQ
Sbjct  2031  PVVASMVVAEKRKSDQSAG-VSLIATIANILGLRDTKNIQDGASLADLGMDSLMSAEIKQ  2089

Query  2065  TMERNYDIVLSALEIRNLTFDKLGKLDNTS-------------GAEAGN--AGADSDDEE  2109
             T+ERN+DIVLSA EIR LTF  L  +D  +             G    N  +G  S    
Sbjct  2090  TLERNFDIVLSAQEIRQLTFGALKAMDGGADVKPAAAAPAAAAGVPEANITSGGSSRTAS  2149

Query  2110  TIQDAAGLLSFEGTEIVPVKIIVPLST---ANSAGQPLFFVPAIEGVAAPFKTVASELNR  2166
              + D   ++    T ++P + IV L T   ANS   P+FF+  IEG A+  + +A  L  
Sbjct  2150  PMGDGTQVVF--TTSLIPTEAIVQLDTKAPANSKQSPIFFISPIEGFASALEPLAKRLEV  2207

Query  2167  PAWSFQCTESCPLESVSALANFYLKKMRAIQTEGPYNIIGYSFGSCIGLEMAVQLQKAGH  2226
             PA+  Q TE+ P +S+ + A F++K++R +Q +GPY + GYSFG  +   MA  L++   
Sbjct  2208  PAYGLQYTEAVPSDSLESAAKFFIKQLRTVQPKGPYKLAGYSFGCLLTYVMAGILEETNE  2267

Query  2227  KTNLTVIDGSPDFVKLHSVELGKRATEESSEVITDGLRKCLAYFVRQFRSNITFLKLYDM  2286
               N+ ++DG+P +V  ++    +R T + +    D     LAYF     +NI +  L  +
Sbjct  2268  VANVIMLDGAPSYVNWYTSSFKQRYT-DGTNADNDNQSYGLAYFGIVL-ANIDYKALVRL  2325

Query  2287  LKNINTTEVVLNKVVELIDDK-NLDSEDLKSAALLFYKKLKAAFFYKPE-KYDGDIVLLK  2344
             L  I T E  L +  EL+ ++     E +K +A LFYKKL+ A  Y+P  K   ++ L+K
Sbjct  2326  LIVIPTWEEKLERFAELMSNEITQPVETIKKSATLFYKKLELADGYQPTLKLKTNVTLVK  2385

Query  2345  AKDSFVPLNNDYGLSKISNK-VTVIELPGNHRSILL-GKSASQIANIL  2390
               D+   L+ DY L ++  K V V  + GNHR+ L+  +S   I +IL
Sbjct  2386  PTDNSAKLDEDYRLKEVCTKPVEVHTVEGNHRTFLIEDQSLKTIQSIL  2433


>B7Z001_DROME unnamed protein product
Length=2540

 Score = 2587 bits (6705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1319/2448 (54%), Positives = 1726/2448 (71%), Gaps = 73/2448 (3%)

Query  1     MPAQFES---ANTPIVREPTMLNSNTNAY-----DVNNEIVISGFSGRFPESSDIEEFKK  52
             MPA+F        P  R    L+     Y      +N+EI I+GFSGR PESS IEEFK+
Sbjct  103   MPARFAEEVITAEPAQRAAPQLDLGGGHYVPRQQHLNDEIAITGFSGRLPESSTIEEFKQ  162

Query  53    NLFEGIDMITDDERRWPAGLFGLPKRTGKLKD--LKSFDATFFGVHAKQAHVMDPQLRLL  110
             NLF+G+DM+ DD RRW  GL+GLP R GKLKD  L++FD  FFGVH KQA  MDP LR+L
Sbjct  163   NLFDGVDMVNDDPRRWERGLYGLPDRIGKLKDSDLENFDQQFFGVHQKQAECMDPLLRML  222

Query  111   LEVVYEAIVDAGINPNDIRGSKTGVFIGVSSSESDEFWSKDPEQINGYGLTGCCRAMFPN  170
             LE+ +EAI+DAG+NP+D+RGS+TGV+IGVS+SE+++ W  D +++NGYGLTGC RAMF N
Sbjct  223   LELTHEAIIDAGLNPSDLRGSRTGVYIGVSNSETEQHWCSDADRVNGYGLTGCARAMFAN  282

Query  171   RISYTFDFNGPSYAIDTACSSSLYAMHQAIVSIRSGECDAAIVGGCNLLLKPTSSLQFHR  230
             RIS+TFDF GPSY+IDTACSSSLYA+ QA   +R G+ D A+V G  L+LKPT SLQF R
Sbjct  283   RISFTFDFKGPSYSIDTACSSSLYALEQAFSDMREGKVDNALVAGAGLILKPTMSLQFKR  342

Query  231   LGMLSPDGACKAFDTDGKGYVRSEAVSVLLLQKARDARRVYATVLHAKTNTDGNKAQGIT  290
             L MLSPDG+CKAFD  G GYVRS+   VLLLQ+   ARRVYA++L+ +TNTDG K QGIT
Sbjct  343   LNMLSPDGSCKAFDESGNGYVRSDGCVVLLLQRTSAARRVYASILNVRTNTDGFKEQGIT  402

Query  291   FPSGDMQNKLMREVYAEVGVNPADVVYVEAHGTGTKVGDPQEINSIANLFCKGRKGPLLL  350
             +P G MQN+L+RE Y E+G+NPADVVYVEAHGTGTKVGDPQE+NSI + FCK R  PLL+
Sbjct  403   YPIGKMQNRLIRETYEEIGLNPADVVYVEAHGTGTKVGDPQEVNSITDFFCKDRTTPLLI  462

Query  351   GSVKSNMGHSEPASGVCSMAKLLIAMEAGVIPGNLHFKNPNTDIPALSDGSIQVVDKNMP  410
             GSVKSNMGHSEPASGVCS+AK+LIAME GVIPGNLH+  PN D+  L DG ++VVD+N+P
Sbjct  463   GSVKSNMGHSEPASGVCSVAKILIAMEEGVIPGNLHYNKPNPDLYGLVDGRLKVVDRNLP  522

Query  411   WKGGLIAVNSFGFGGANAHILLRSNPKPK-LSPVLDNKVPKLVTVSGRTSEAVNVLLDKA  469
             W GG+I +NSFGFGGANAH++L+SNPKPK L+P   +   K+V  SGRT EAV  LL+ A
Sbjct  523   WNGGIIGLNSFGFGGANAHVILKSNPKPKALTP--KDGALKVVLASGRTFEAVEQLLESA  580

Query  470   KEYEKDDEFIALLHDIHTNNVAGHLYRGYSIMGN--VNIREVDSYVNEKRPVWFVFSGMG  527
                  DDE++ L+++IH+  +  H +RGY ++ +   + REV    ++KRP+W+++SGMG
Sbjct  581   STNADDDEYLQLINEIHSKAIPNHFFRGYGVVSSKGTHQREVIESNDDKRPIWYIYSGMG  640

Query  528   SQWPGMGKDLLSIDIFQRSLRRCAEALKPEGIDLMNLIQNGTAETFDENVLYSFVSIAAI  587
             SQW  M KDL+ I+ F ++++RCA+ LKPEG+DL++++   T ++F EN+L SF+SIAA+
Sbjct  641   SQWASMAKDLMKIEAFAKTIQRCADVLKPEGVDLIDVLTRSTDKSF-ENILNSFISIAAM  699

Query  588   QVALVDVLTYLGIQPDGIVGHSVGELGCAYADGTFTPEQTVLAAYWRGKTIKDSNLQPGG  647
             QVAL D+L+ LGI PDGIVGHSVGELGCAYADG FTPEQTVLAAYWRGK+I D+ L  G 
Sbjct  700   QVALTDLLSSLGIHPDGIVGHSVGELGCAYADGCFTPEQTVLAAYWRGKSILDTQLAKGK  759

Query  648   MAAVGLSWEEAAARCPPDVTPACNNSADSVTVSGPIESLKKLADDLQKDNIFIKLVNSSG  707
             MAAVGLSWE+A +R P D  P C+NS D+ T+SGP  S++ L   L  + +F K VNSSG
Sbjct  760   MAAVGLSWEDAHSRVPSDCFPVCHNSEDNCTISGPEASIEALVAKLNAEGVFAKAVNSSG  819

Query  708   VAFHSKYVAPVGQKLRAMLEKIITNPKQRTSRWISTSIPESAWGTPLAQLSSAAYHVNNL  767
              AFHSKY+A  G KLR  LEKII N K RT+RWISTSIPESAW TP+A+ SSAAYHVNNL
Sbjct  820   YAFHSKYIAEAGPKLRKSLEKIIPNAKNRTARWISTSIPESAWNTPVAKQSSAAYHVNNL  879

Query  768   LSPVLFYQALGHIPENAIVIEIAPHCLLQAILRRSLPSTVTNIGLHKRGHANNLNFFLEN  827
             LSPVLF++AL H+P+NAI +EIAPH LLQAIL+R+L    TN+ L KRGH NN+ FFL N
Sbjct  880   LSPVLFHEALQHVPKNAISVEIAPHGLLQAILKRALGPDATNLSLVKRGHENNVEFFLTN  939

Query  828   IGKLYLAGGQPRVSKLYPPVNYPVGRGTPMINSLVKWDHSVEWNLADYAATNASFGENVV  887
             +GKL+ AG QP+V  L  P++YPVGRGTPM+NS V WDH+ +W +A +    +S GE +V
Sbjct  940   VGKLFAAGAQPQVLTLVRPISYPVGRGTPMLNSKVGWDHTQKWLVAKFGKETSS-GETIV  998

Query  888   EVNLSKETDAYLVGHCIDERILFPATGYLVIVWKTYAKMRGTDFEKLPITFENVKFQRAT  947
             EV+LSKE DA+L GH ID RILFPATGY+ + W+T+AKM+G++F K P+  EN+ F RAT
Sbjct  999   EVDLSKEDDAFLAGHTIDGRILFPATGYMTLAWQTFAKMQGSEFHKTPVVMENLVFHRAT  1058

Query  948   IMPMDGTVKFSINIFLGTGDFEICESGSVVVTGTVSVPENVDKMLLNMPAPIVKNESTVV  1007
             I+  +  VKF IN F GTG FEICESGS+ V+G +++PE++D    N   P+ +   + V
Sbjct  1059  ILNKNAVVKFGINFFDGTGAFEICESGSLAVSGKITIPESID----NEELPLEEQTPSAV  1114

Query  1008  --ELNTTDVYKELRLRGYNYTGIFQGIKVVHNGGVSGRLLWND-WISFMDTMLQFSILEK  1064
               EL T DVYKELRLRGY+Y GIF+GI        +G+L W D WISFMDTMLQFSIL K
Sbjct  1115  AKELGTNDVYKELRLRGYDYGGIFRGIVRSDTVASTGKLQWVDNWISFMDTMLQFSILSK  1174

Query  1065  DCRGLYVPVRVQYVAINPIAHLEFVENYKEGE----GVPIYSYPNIGVIKSGGVEIRKMK  1120
             + R LY+P R++   INP  H E +    + E    G+P+  Y +I VIKS GVE+R +K
Sbjct  1175  NLRELYLPTRIERAVINPAKHFELLSALTKEEQVETGLPVQWYSDINVIKSAGVELRGLK  1234

Query  1121  ASLIAKKQQIR-PPKLERCLFIPYENSQPLVQDPEKAKVHALTILLLTAYENIKG-IKLK  1178
             A+L  ++   + PP LER  F+P  N+  L ++ EKA++HAL + +    EN  G +KLK
Sbjct  1235  ANLAQRRPGTQAPPTLERYQFVPNINTTDLNENSEKARLHALDVAIQVIIENSSGAVKLK  1294

Query  1179  ITEVSGDRPVDSLMLPYIKTWCSREPVINGDLQLATVLRKRYISL----KQNIKIIKCNV  1234
               E++  R  D L+   +      EPV+ GD+ + T                ++++  +V
Sbjct  1295  GVELANGRNPDVLVANRLLQIIEGEPVLTGDVAVVTSNNNEETITAALGDSGVRVVSKDV  1354

Query  1235  EKELIGQDLHIAVASNVLTDNSLNVLKNLKDSVINRGFILLEETAQTDFN-----VVDPD  1289
              KE + Q+ H     +VL+      L+N   S+   GF++LEET  T        +    
Sbjct  1355  LKEPVEQNCHFVFGIDVLSRPDTKTLENSIASIRENGFLILEETLPTYTKTGRALLTKFG  1414

Query  1290  LVCVAKQVIPGKSYILLKKKEV---RPDPIVIQLTEKNFSWVEGVKAALKNVVAQNQRPL  1346
              V V +Q +     ++L +K V       +V+  TE+NF+WV+ +KAAL     + Q   
Sbjct  1415  FVAVQEQSLGATRVLVLARKAVDLKTRKSVVVVATEQNFNWVDDLKAALATAATEEQYVY  1474

Query  1347  FVCQGEELFGMVGFMNCILNEDGGAKASYVFIQDKNMPKFNLNDKFYAKQLDKQMFANIL  1406
              VCQGEELFG VG M CI NE+GG  A  VF+QD    KF+L    Y +QL+K + +N+L
Sbjct  1475  VVCQGEELFGAVGLMTCIKNENGGKLARLVFVQDAKAEKFSLTSTLYRQQLEKDLISNVL  1534

Query  1407  RGGQWGSYKHIELDQENESSLQVEHAYINALNRGDLSSLRWIESPLSYYQLEKSPNTELC  1466
             + G WG+++H++L+ + +++LQVEHAY+NAL +GDL+SL+WIE+  +        N E C
Sbjct  1535  KNGAWGTFRHLKLETQ-QATLQVEHAYVNALVKGDLASLKWIEAAQADTAATVDKNLETC  1593

Query  1467  SVYYAPLNFRDIMLATGKLPPDALPGNLATQDCILGLEFSGRDSKGQRVMAMVPARGLAT  1526
             +VYYAP+NFRD+ML +GKL  DALPG+LA QDC+LGLEF+GRD++G+RVMAMVPA+ LAT
Sbjct  1594  TVYYAPINFRDVMLTSGKLAADALPGDLAEQDCVLGLEFAGRDTQGRRVMAMVPAKSLAT  1653

Query  1527  TVIADPGFMWKVPDKWSLEEAATVPVAYATSYYALCVRGHMKPGDSVLIHAGSGGVGQAS  1586
             T +A    MW++P+KW++EEA+TVP  Y+T YYAL VRG MK G+ +LIHAGSGGVGQA+
Sbjct  1654  TCVASKRMMWQIPEKWTMEEASTVPCVYSTVYYALVVRGQMKKGEKILIHAGSGGVGQAA  1713

Query  1587  ISIALHAGCKVFTTVGTQDKRDFLKKMFPVLTDRNIGNSRDTSFEQLILNETNGRGVDIV  1646
             IS+AL  G  VFTTVG+++KR+FL K FP L +RNIGNSRDTSFEQL+L ET GRGVD+V
Sbjct  1714  ISVALAHGLTVFTTVGSKEKREFLLKRFPKLQERNIGNSRDTSFEQLVLRETKGRGVDLV  1773

Query  1647  LNSLAEEKLQASIRCLAQGGRFLEIGKFDLSNDSPLGMSVFLKNVSFHGILLDAICEDDG  1706
             LNSL+EEKLQASIRCL   GRFLEIGKFDLSN+SPLGMSVFLKN SFHGILLD++ E + 
Sbjct  1774  LNSLSEEKLQASIRCLGLNGRFLEIGKFDLSNNSPLGMSVFLKNTSFHGILLDSVMEGEE  1833

Query  1707  PERQEVVRLVSEGIKSGAVRPLPSTVFSEQQIEQSFRYMATGKHIGKVLLKIRDEEK-QK  1765
               + +VV LV+EGIK+GAV PLP++VF++QQ+EQ+FR+MA+GKHIGKV++K+RDEE  +K
Sbjct  1834  EMQNQVVSLVAEGIKTGAVVPLPTSVFNDQQVEQAFRFMASGKHIGKVVIKVRDEEAGKK  1893

Query  1766  VVQSPQKVVSAIPRTYLNPEKSYILVGGLGGFGLELAYWMILRGAKYIILTSRSGVTTGF  1825
              +Q   ++++AIPRTY++PEKSYILVGGLGGFGLEL  W++ RGA+YI+LTSRSGV TG+
Sbjct  1894  ALQPKPRLINAIPRTYMHPEKSYILVGGLGGFGLELTNWLVTRGARYIVLTSRSGVKTGY  1953

Query  1826  QALCIRRWRNMGAHIKISTADVTTLDGAKQLIKESKALAPVGGIFNLAAVLRDGLIENLT  1885
             Q L IRRW+  G  + I T+DVTT  GAK+L++ S  LA VGGIFNLAAVLRD LIE+ T
Sbjct  1954  QGLMIRRWQERGVKVVIDTSDVTTAAGAKKLLENSNKLALVGGIFNLAAVLRDALIEDQT  2013

Query  1886  ESDFVISASPKVNGTKNLDIVSRE-CSSLDYFVVFSSVTSGRGNVGQTNYGLANSAMERL  1944
               DF   A PKV  TK LD  SR+ C+ LDYF+ FSSV+ GRGN+GQTNYGLANSAMER+
Sbjct  2014  AKDFKTVADPKVTATKYLDQFSRDICTELDYFICFSSVSCGRGNIGQTNYGLANSAMERI  2073

Query  1945  MEQRQANGLPGLAIQWGAIGDVGLILEKLGGFNDTEIGGTLPQRIQNCLDTMDIFLQQPH  2004
              EQRQ +G PG AIQWGAIGD GL+LE LG  NDT IGGTLPQR+ +CL T+D+FLQQPH
Sbjct  2074  CEQRQVSGFPGTAIQWGAIGDTGLVLENLGD-NDTVIGGTLPQRMPSCLQTIDLFLQQPH  2132

Query  2005  PILASLVTANKDNTVESANKVSVVQAIANILGIKALESVNGSTSLADLGMDSLMGTEIKQ  2064
             P++AS+V A K  + +SA  VS++  IANILG++  +++    SLADLGMDSLM  EIKQ
Sbjct  2133  PVVASMVVAEKRKSDQSAG-VSLIATIANILGLRDTKNIQDGASLADLGMDSLMSAEIKQ  2191

Query  2065  TMERNYDIVLSALEIRNLTFDKLGKLDNTS-------------GAEAGN--AGADSDDEE  2109
             T+ERN+DIVLSA EIR LTF  L  +D  +             G    N  +G  S    
Sbjct  2192  TLERNFDIVLSAQEIRQLTFGALKAMDGGADVKPAAAAPAAAAGVPEANITSGGSSRTAS  2251

Query  2110  TIQDAAGLLSFEGTEIVPVKIIVPLST---ANSAGQPLFFVPAIEGVAAPFKTVASELNR  2166
              + D   ++    T ++P + IV L T   ANS   P+FF+  IEG A+  + +A  L  
Sbjct  2252  PMGDGTQVVF--TTSLIPTEAIVQLDTKAPANSKQSPIFFISPIEGFASALEPLAKRLEV  2309

Query  2167  PAWSFQCTESCPLESVSALANFYLKKMRAIQTEGPYNIIGYSFGSCIGLEMAVQLQKAGH  2226
             PA+  Q TE+ P +S+ + A F++K++R +Q +GPY + GYSFG  +   MA  L++   
Sbjct  2310  PAYGLQYTEAVPSDSLESAAKFFIKQLRTVQPKGPYKLAGYSFGCLLTYVMAGILEETNE  2369

Query  2227  KTNLTVIDGSPDFVKLHSVELGKRATEESSEVITDGLRKCLAYFVRQFRSNITFLKLYDM  2286
               N+ ++DG+P +V  ++    +R T + +    D     LAYF     +NI +  L  +
Sbjct  2370  VANVIMLDGAPSYVNWYTSSFKQRYT-DGTNADNDNQSYGLAYFGIVL-ANIDYKALVRL  2427

Query  2287  LKNINTTEVVLNKVVELIDDK-NLDSEDLKSAALLFYKKLKAAFFYKPE-KYDGDIVLLK  2344
             L  I T E  L +  EL+ ++     E +K +A LFYKKL+ A  Y+P  K   ++ L+K
Sbjct  2428  LIVIPTWEEKLERFAELMSNEITQPVETIKKSATLFYKKLELADGYQPTLKLKTNVTLVK  2487

Query  2345  AKDSFVPLNNDYGLSKISNK-VTVIELPGNHRSILL-GKSASQIANIL  2390
               D+   L+ DY L ++  K V V  + GNHR+ L+  +S   I +IL
Sbjct  2488  PTDNSAKLDEDYRLKEVCTKPVEVHTVEGNHRTFLIEDQSLKTIQSIL  2535


>Q9VQL6_DROME unnamed protein product
Length=2409

 Score = 2272 bits (5887),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1175/2412 (49%), Positives = 1637/2412 (68%), Gaps = 97/2412 (4%)

Query  29    NNEIVISGFSGRFPESSDIEEFKKNLFEGIDMITDDERRWPAGLFGLPKRTGKLKD--LK  86
             + +IVISG SG+ PESS+IEEFK NL  GIDM+TD+ RRW AG++GLP+R  K+KD  L+
Sbjct  16    DADIVISGLSGKLPESSNIEEFKYNLLNGIDMVTDEPRRWEAGIYGLPERMAKMKDSDLE  75

Query  87    SFDATFFGVHAKQAHVMDPQLRLLLEVVYEAIVDAGINPNDIRGSKTGVFIGVSSSESD-  145
              FD  FF VH KQA +MDP +R+LLE+ +EAI+DAGINP  +RGS+TGV+IG+S  E++ 
Sbjct  76    KFDDKFFSVHQKQAELMDPCMRMLLELTHEAIIDAGINPVQLRGSRTGVYIGLSFVETEH  135

Query  146   EFWSKDPEQINGYGLTGCCRAMFPNRISYTFDFNGPSYAIDTACSSSLYAMHQAIVSIRS  205
             E  + +P  INGY LTGC RAMF NRISYTFDF GPS+ +DTACSSSL A++ A   +R+
Sbjct  136   EIPNMEPSSINGYCLTGCARAMFANRISYTFDFKGPSFIVDTACSSSLVALNHAFADMRA  195

Query  206   GECDAAIVGGCNLLLKPTSSLQFHRLGMLSPDGACKAFDTDGKGYVRSEAVSVLLLQKAR  265
             G CD A+V G NL+LKP  +LQF RLG++S DG+CK FD    GY R++  +V+LLQ+ +
Sbjct  196   GRCDYALVAGVNLILKPIFALQFLRLGIVSHDGSCKTFDAAANGYARADTCAVVLLQRRK  255

Query  266   DARRVYATVLHAKTNTDGNKAQGITFPSGDMQNKLMREVYAEVGVNPADVVYVEAHGTGT  325
             +A+RVYA++L+ +TNTDG K QG+TFP G MQ  L+ E Y+E+G+NP +VVYVEAHG+GT
Sbjct  256   EAKRVYASILNVRTNTDGFKEQGVTFPDGRMQQALLEETYSEIGLNPDEVVYVEAHGSGT  315

Query  326   KVGDPQEINSIANLFCK-GRKGPLLLGSVKSNMGHSEPASGVCSMAKLLIAMEAGVIPGN  384
              VGD QE N ++N FC+  R  PLL+GSVKSNMGH+EPASGV ++AK++IAME G+IP N
Sbjct  316   PVGDDQEANMLSNFFCRPSRSTPLLIGSVKSNMGHAEPASGVSALAKMIIAMEEGIIPKN  375

Query  385   LHFKNPNTDIPALSDGSIQVVDKNMPWKGGLIAVNSFGFGGANAHILLRSNPK---PKLS  441
             LH++ PN  +PAL +G ++VVD+N+PW+GG++ +NSFGFGGANAH++L+S+ K   PK  
Sbjct  376   LHYRTPNPSVPALVEGKLKVVDRNLPWQGGIVGLNSFGFGGANAHVVLKSHTKAKEPKAC  435

Query  442   PVLDN--KVPKLVTVSGRTSEAVNVLLDKAKEYEKDDEFIALLHDIHTNNVAGHLYRGYS  499
             P      +   LVT SGRT +AVN LL  A E   D E + L++DIH++ +  H +RGY+
Sbjct  436   PKAGEAEQSLSLVTCSGRTEDAVNQLLKVATEQRHDQELLTLINDIHSHPIPLHPFRGYA  495

Query  500   IMGNVNI--REVDSYVNEKRPVWFVFSGMGSQWPGMGKDLLSIDIFQRSLRRCAEALKPE  557
             ++G       EV  Y  E+RP+WFV++GMGSQW  M KDL+ +++F+ S++ CAE L   
Sbjct  496   VLGTSGCVKEEVLPYEEEERPIWFVYAGMGSQWARMAKDLMQLEVFRNSIQHCAEVLAQV  555

Query  558   GIDLMNLIQNGTAETFDENVLYSFVSIAAIQVALVDVLTYLGIQPDGIVGHSVGELGCAY  617
               DL++++   T  TFD N+LYSFVS++A+QVAL D+L  L I+PDGI+GHS GELG AY
Sbjct  556   DFDLIDVLTRSTERTFD-NMLYSFVSVSAVQVALTDLLRVLDIRPDGIIGHSAGELGAAY  614

Query  618   ADGTFTPEQTVLAAYWRGKTIKDS-NLQPGGMAAVGLSWEEAAARCPPDVTPACNNSADS  676
              DG  T EQTVLAAYWRG+++ D+ +L  G MAAVGLSWE+  ++ P D  P C+NS D+
Sbjct  615   MDGCLTAEQTVLAAYWRGRSVLDTPDLPRGKMAAVGLSWEQIGSQIPKDCYPVCHNSDDN  674

Query  677   VTVSGPIESLKKLADDLQKDNIFIKLVNSSGVAFHSKYVAPVGQKLRAMLEKIITNPKQR  736
              TVSGP  S+  + +DL    IF++ V S G AFHS Y+      LR  LE++IT PK++
Sbjct  675   CTVSGPPSSMDAMIEDLTAKGIFVREVGSGGYAFHSPYIEGAAPMLRRSLERLITEPKKK  734

Query  737   TSRWISTSIPESAWGTPLAQLSSAAYHVNNLLSPVLFYQALGHIPENAIVIEIAPHCLLQ  796
             + RW+STS+ E+ W +    L+SA Y +NNL+SPVLF+QA+  IP+NA+++EIAPH L +
Sbjct  735   SIRWLSTSVKEAEWDSEKNHLASAGYFINNLISPVLFHQAVKRIPQNALIVEIAPHGLFR  794

Query  797   AILRRSLPSTVTNIGLHKRGHANNLNFFLENIGKLYLAGGQPRVSKLYPPVNYPVGRGTP  856
             AILR SL   ++ + L +RGHANN  F L  +G+LY AGGQP++ K+ P + YPV RGTP
Sbjct  795   AILR-SLSPQISYVSLMQRGHANNFEFLLSQLGRLYAAGGQPQILKISPSIPYPVSRGTP  853

Query  857   MINSLVKWDHSVEWNLADYAATNASFGENVVEVNLSKETDAYLVGHCIDERILFPATGYL  916
             M+ SLV WDH+ +WN   +     + G+  VE++L KE + YL GH ID R+LFPATGY+
Sbjct  854   MLGSLVGWDHTQKWNYPKFKGGRQA-GQLSVELDLGKEENVYLAGHTIDGRVLFPATGYM  912

Query  917   VIVWKTYAKMRGTDFEKLPITFENVKFQRATIMPMDGTVKFSINIFLGTGDFEICESGSV  976
              + W + A+ +G D+ + P+ FE+V F RATI+ +   VK ++N F G+  FEICE  S+
Sbjct  913   TLAWMSLAQQQGLDYLRTPVLFEDVVFHRATILSVGTVVKLTLNFFPGSSSFEICEGTSL  972

Query  977   VVTGTVSVPENVDKMLLNMPA-PIVKNESTVVELNTTDVYKELRLRGYNYTGIFQGIKVV  1035
             V +G + +  NV +  L + + P +   +   +L+T D+YKELRLRGY+YTG+FQGI   
Sbjct  973   VTSGKIRLVSNVQQEQLQLSSLPGIAGSN---KLSTKDIYKELRLRGYDYTGVFQGILES  1029

Query  1036  HNGGVSGRLLWND-WISFMDTMLQFSILEKDCRGLYVPVRVQYVAINPIAHLEFVENYKE  1094
                 V+G+L W D WISFMDTMLQF IL  D R LYVP  ++   I+P+ HLE  + +++
Sbjct  1030  DISAVTGQLQWADNWISFMDTMLQFRILSNDIRELYVPTGIERALIDPLKHLELAKKHQQ  1089

Query  1095  GEGVPIYSYPNIGVIKSGGVEIRKMKASLIAKKQQIR-PPKLERCLFIPYENSQPLVQDP  1153
                + +  + NI V+K GGVEI KMK +   ++   + PP LER  F P+       ++ 
Sbjct  1090  K--LTVNWHRNISVVKCGGVEIHKMKTAQTQRRSGGQSPPSLERYRFWPHSQHLGQREEQ  1147

Query  1154  EKAKVHALTILLLTAYENIKG-IKLKITEVSGDRP-VDSLMLPYIKTWCSREPVINGDLQ  1211
             EK++  AL + +    EN  G +KLK  E++G R  +D+L    +     REP++ GD+ 
Sbjct  1148  EKSRSTALAVAIQLIIENSGGAVKLKGVELAGSRSTLDALSAVQLLELIEREPILVGDMA  1207

Query  1212  LATVLRKRYI---SLKQN-IKIIKCNVEKELIGQDLHIAVASNVLTDNSLNVLKNLKDSV  1267
             + T           LK++ I++I  +++   + Q  H   + N+L  NS+  L++  DS+
Sbjct  1208  VVTSSSNESELGEQLKEHGIRVIVKDIKAGAVEQQCHFVYSVNMLAQNSVKDLQHCLDSL  1267

Query  1268  -INRGFILLEETAQTDFNVVDPD------LVCVAKQVIPGKSYILLKKKEVR---PDPIV  1317
               + GF+LLEE A + +N++  +      LV V +Q       ++L +K  +      + 
Sbjct  1268  KSDSGFLLLEEAA-SRYNIIGKEKLNKLKLVSVLEQFFGTDRVLVLVRKLSKVQSSQALT  1326

Query  1318  IQLTEKNFSWVEGVKAALKNVVAQNQRPLFVCQGEELFGMVGFMNCILNEDGGAKASYVF  1377
             + LT K F WV  +K ++    A+ +    V QGE   G +G MNC+  E GG       
Sbjct  1327  LHLTNKQFKWVNELKNSIAKAQAEEKNLYLVAQGEPNSGALGLMNCLKREAGGHFLRLYL  1386

Query  1378  IQDKNMPKFNLNDKFYAKQLDKQMFANILRGGQWGSYKHIELDQENESSLQVEHAYINAL  1437
             I D+ +P+F+L+D FYA QL K +  N+ R G WGSY+H++++      L VE AY+N L
Sbjct  1387  ILDEGVPQFSLDDPFYAAQLAKDLVVNVYRNGSWGSYRHLKME-SRPPMLPVEQAYVNTL  1445

Query  1438  NRGDLSSLRWIESPLSYYQLEKSP---NTELCSVYYAPLNFRDIMLATGKLPPDALPGNL  1494
              +GDLSSLRWIESP S      SP     E C+VYYAPLNFRD+MLA+GKL  DALPG+L
Sbjct  1446  VKGDLSSLRWIESPRS------SPIQSQLEPCTVYYAPLNFRDVMLASGKLGVDALPGDL  1499

Query  1495  ATQDCILGLEFSGRDSKGQRVMAMVPARGLATTVIADPGFMWKVPDKWSLEEAATVPVAY  1554
             A QDC+LGLEF+GRDS G+RVMAMV A+ LAT  +A+   +W+VP KW++E+A+TVP  Y
Sbjct  1500  AYQDCVLGLEFAGRDSCGRRVMAMVTAKSLATNCLANRNLLWEVPSKWTMEQASTVPCVY  1559

Query  1555  ATSYYALCVRGHMKPGDSVLIHAGSGGVGQASISIALHAGCKVFTTVGTQDKRDFLKKMF  1614
             AT YYAL VRG MK G+ +LIHAGSGGVGQA+IS+AL  G  VFTTVG+++KR+FL K F
Sbjct  1560  ATVYYALVVRGQMKEGERILIHAGSGGVGQAAISVALAHGLTVFTTVGSKEKREFLLKRF  1619

Query  1615  PVLTDRNIGNSRDTSFEQLILNETNGRGVDIVLNSLAEEKLQASIRCLAQGGRFLEIGKF  1674
             P L  +NIGNSRDTSFEQLI++ET+G GV++VLNSL+EEKLQASIRCLA  GRFLEIGKF
Sbjct  1620  PKLKAKNIGNSRDTSFEQLIMSETHGNGVELVLNSLSEEKLQASIRCLALNGRFLEIGKF  1679

Query  1675  DLSNDSPLGMSVFLKNVSFHGILLDAICEDDGPERQEVVRLVSEGIKSGAVRPLPSTVFS  1734
             DLSN++PLGMSVFLKN SFHGILLD++ E +   +  V +LV+EGIKSGAV+PLP+TVF+
Sbjct  1680  DLSNNTPLGMSVFLKNTSFHGILLDSVMEGEEEMQLMVAKLVAEGIKSGAVQPLPTTVFA  1739

Query  1735  EQQIEQSFRYMATGKHIGKVLLKIRDEEKQKVVQSPQKVVSAIPRTYLNPEKSYILVGGL  1794
             EQ+IE++FR+MA+GKHIGKV++K+R EE+Q+      + + AIPR+Y++PEKSYILVGGL
Sbjct  1740  EQEIEKAFRFMASGKHIGKVVIKVRLEEEQQAALPRLRQIQAIPRSYMHPEKSYILVGGL  1799

Query  1795  GGFGLELAYWMILRGAKYIILTSRSGVTTGFQALCIRRWRNMGAHIKISTADVTTLDGAK  1854
             GGFGLELA W++ RGA++++L+SRSGV +G+QAL IRRW + G  ++I T DVTT  G +
Sbjct  1800  GGFGLELANWLVSRGARFLVLSSRSGVKSGYQALMIRRWHDRGVQVQIDTNDVTTAVGCQ  1859

Query  1855  QLIKESKALAPVGGIFNLAAVLRDGLIENLTESDFVISASPKVNGTKNLDIVSRE-CSSL  1913
             +L++ S  LA VGGIFNLAAVLRDGLIE+ +  +F   ++PK+  T +LD +SRE C +L
Sbjct  1860  RLLEVSNKLALVGGIFNLAAVLRDGLIEDQSPKNFEKVSAPKLLATIHLDKISREICPAL  1919

Query  1914  DYFVVFSSVTSGRGNVGQTNYGLANSAMERLMEQRQANGLPGLAIQWGAIGDVGLILEKL  1973
             +YFV FSS++ GRGN+GQTNYGLANS MER+ EQRQ  G PG AIQWGAIGD GLI+E +
Sbjct  1920  EYFVCFSSLSCGRGNMGQTNYGLANSTMERICEQRQEYGYPGTAIQWGAIGDTGLIIEHM  1979

Query  1974  GGFNDTEIGGTLPQRIQNCLDTMDIFLQQPHPILASLVTANKDNTVESANKVSVVQAIAN  2033
             G  N+T +GGTLPQR+ +CL+T+D+FLQQPHP++AS+V A K  T E AN++S++  IAN
Sbjct  1980  GN-NETVVGGTLPQRMISCLETLDLFLQQPHPVMASMVVAEKRKT-EQANRLSLIATIAN  2037

Query  2034  ILGIKALESVNGSTSLADLGMDSLMGTEIKQTMERNYDIVLSALEIRNLTFDKLGKLDNT  2093
             I+G++ ++SV+  T+L DLGMDSLM TEIKQT+ER++D+VLSA EIR LTF  L ++D  
Sbjct  2038  IMGLRDVKSVSDKTTLFDLGMDSLMSTEIKQTLERHFDLVLSAQEIRQLTFSALRQIDAQ  2097

Query  2094  SGA-----------------EAGNAGADSDDEETIQDAAGLLSFEGTEIVPVKIIVPLST  2136
                                 E          +ET +  A        E++P +++V L +
Sbjct  2098  EPPSASVSSPSASSTLSRIKEEACVEVQPQSDETRKVFA-------KEVLPQEVMVRLRS  2150

Query  2137  ---ANSAGQPLFFVPAIEGVAAPFKTVASELNRPAWSFQCTESCPLESVSALANFYLKKM  2193
                  S    +FF+  IEG     + +A+ L  PA+  QCTE  PL+S+ A A +YL+++
Sbjct  2151  KAPVASEDPAVFFLAPIEGFTIAVEALAASLTCPAYGLQCTEQVPLDSIEACAAYYLRQI  2210

Query  2194  RAIQTEGPYNIIGYSFGSCIGLEMAVQLQKAGHKTNLTVIDGSPDFVKLHSVELGKRATE  2253
             + +Q  GPY+I+GYS+G  +   +AV L++      + ++DG+P     +  E  K+   
Sbjct  2211  QKLQPLGPYHIVGYSYGCLLAHAIAVALEQRRFGVKVIMLDGAPTMASGYVQEAKKQ---  2267

Query  2254  ESSEVITDGLRK----CLAYFVRQFRSNITFLKLYDMLKNINTTEVVLNKVVELIDDKNL  2309
                   TD L +     LAYF     +++ + +L  +L  + T    L+K+ + +     
Sbjct  2268  ------TDDLNRQQSMTLAYF-GALLADVDYNQLLQLLDGVQTWPSKLDKLADTLAGYTQ  2320

Query  2310  DS-EDLKSAALLFYKKLKAAFFYKPEK-YDGDIVLLKAKDSFVPLNNDYGLSKI-SNKVT  2366
              + E +K AA +F +KL  +  YK  K    D+VL+K+ +    +  DYGL +I S ++ 
Sbjct  2321  QTREVIKKAACMFKQKLLLSESYKGAKQLHSDVVLIKSAEHNAIMAQDYGLKEICSAQID  2380

Query  2367  VIELPGNHRSIL  2378
             +  + G HR+ L
Sbjct  2381  MHVVEGTHRTFL  2392



Lambda      K        H
   0.324    0.138    0.456 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3617638992


Query= NP_001267845.1 phosphomevalonate kinase [Bombus terrestris]

Length=202
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q583U0_TRYB2  unnamed protein product                                 27.7    8.9  
Q8IGN3_DROME  unnamed protein product                                 27.7    9.5  
Q9VWZ7_DROME  unnamed protein product                                 27.3    9.8  


>Q583U0_TRYB2 unnamed protein product
Length=730

 Score = 27.7 bits (60),  Expect = 8.9, Method: Composition-based stats.
 Identities = 15/46 (33%), Positives = 21/46 (46%), Gaps = 9/46 (20%)

Query  52   IIRLSGPIKFHWAKSLDLDIDQLLGDGKYKENYRLEMAKWGENIRN  97
            ++   GP + H+ KS         GDG YK N R E   +G  + N
Sbjct  557  LLEWGGPTRSHFNKS---------GDGNYKSNARREAKLFGAALLN  593


>Q8IGN3_DROME unnamed protein product
Length=949

 Score = 27.7 bits (60),  Expect = 9.5, Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 24/55 (44%), Gaps = 3/55 (5%)

Query  62   HWAKSLD---LDIDQLLGDGKYKENYRLEMAKWGENIRNKDYGYFCRAALEMYNA  113
            +W ++ D   LD     G   Y E ++  M     N+R  D+GY+   A    NA
Sbjct  561  YWERAYDGKILDPSDKYGIESYPEGFKTTMRLTISNLRKDDFGYYHCVARNELNA  615


>Q9VWZ7_DROME unnamed protein product
Length=949

 Score = 27.3 bits (59),  Expect = 9.8, Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 24/55 (44%), Gaps = 3/55 (5%)

Query  62   HWAKSLD---LDIDQLLGDGKYKENYRLEMAKWGENIRNKDYGYFCRAALEMYNA  113
            +W ++ D   LD     G   Y E ++  M     N+R  D+GY+   A    NA
Sbjct  561  YWERAYDGKILDPSDKYGIESYPEGFKTTMRLTISNLRKDDFGYYHCVARNELNA  615



Lambda      K        H
   0.324    0.138    0.456 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3617638992


Query= NP_001267847.1 geranylgeranyl pyrophosphate synthase-like [Bombus
terrestris]

Length=308
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O61539_DROME  unnamed protein product                                 440     3e-156
Q9VS54_DROME  unnamed protein product                                 439     4e-156
O61538_DROME  unnamed protein product                                 416     6e-147


>O61539_DROME unnamed protein product
Length=338

 Score = 440 bits (1131),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 199/297 (67%), Positives = 246/297 (83%), Gaps = 0/297 (0%)

Query  12   SGDKEEDEILLLPLTYILQIPGKQIRAKLIQAFNYWLKIPQDKFHAVGDIIQLLHTSSLL  71
            S  KE+DEILL P TYI QIPGKQ R++L  AFN+WL IP +K   +GDI+Q+LH SSLL
Sbjct  15   STQKEQDEILLQPFTYIQQIPGKQFRSELALAFNHWLLIPGEKLAQIGDIVQMLHNSSLL  74

Query  72   IDDIQDNSVLRRGIPVAHNIYGVASTINASNYGLFIALEKVMALNHPEGTQVYLQQLLEL  131
            IDDI+DNS+LRRG+PVAH+IYGVASTINA+NY LF+ALEKV  L+HPE T+VY +QLLEL
Sbjct  75   IDDIEDNSILRRGVPVAHSIYGVASTINAANYALFLALEKVQQLDHPEATKVYTEQLLEL  134

Query  132  HRGQGMELYWRDNYMCPSETAYKQMIMRKTGGLFNMAVRLMQLFSDSKEDYVSLVSMLGL  191
            HRGQGME+YWRD++ CPSE+ YK M +RKTGGLF +A+RLMQLFS +KEDY  L ++LGL
Sbjct  135  HRGQGMEIYWRDSFTCPSESDYKLMTVRKTGGLFMLAIRLMQLFSSNKEDYSKLTAILGL  194

Query  192  YFQIRDDYCNLCVKEYALNKSYCEDLSEGKFSFPIIHALRTHPEDRQILNILRQRTKDNE  251
            YFQIRDDYCNL +KEY  NKS+ EDL+EGKF FP+IHA+RT  +D+Q+L+ILRQRT D E
Sbjct  195  YFQIRDDYCNLSLKEYTENKSFAEDLTEGKFGFPVIHAVRTQKQDKQVLHILRQRTHDIE  254

Query  252  VKRYCVSLLEKFGSFAYTRTVLEDMDKEVRKKIQCLGGNPLLVRVLDELMSWKHHDS  308
            VK+YC++LLEK GSF YTR VLE +D E R ++  LG NP + R+L++L+SWK  DS
Sbjct  255  VKKYCITLLEKLGSFQYTRKVLESLDAEARSEVARLGSNPYMDRLLNKLLSWKTSDS  311


>Q9VS54_DROME unnamed protein product
Length=338

 Score = 439 bits (1130),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 199/297 (67%), Positives = 246/297 (83%), Gaps = 0/297 (0%)

Query  12   SGDKEEDEILLLPLTYILQIPGKQIRAKLIQAFNYWLKIPQDKFHAVGDIIQLLHTSSLL  71
            S  KE+DEILL P TYI QIPGKQ R++L  AFN+WL IP +K   +GDI+Q+LH SSLL
Sbjct  15   STQKEQDEILLQPFTYIQQIPGKQFRSELALAFNHWLLIPGEKLAQIGDIVQMLHNSSLL  74

Query  72   IDDIQDNSVLRRGIPVAHNIYGVASTINASNYGLFIALEKVMALNHPEGTQVYLQQLLEL  131
            IDDI+DNS+LRRG+PVAH+IYGVASTINA+NY LF+ALEKV  L+HPE T+VY +QLLEL
Sbjct  75   IDDIEDNSILRRGVPVAHSIYGVASTINAANYALFLALEKVQQLDHPEATKVYTEQLLEL  134

Query  132  HRGQGMELYWRDNYMCPSETAYKQMIMRKTGGLFNMAVRLMQLFSDSKEDYVSLVSMLGL  191
            HRGQGME+YWRD++ CPSE+ YK M +RKTGGLF +A+RLMQLFS +KEDY  L ++LGL
Sbjct  135  HRGQGMEIYWRDSFTCPSESDYKLMTVRKTGGLFMLAIRLMQLFSSNKEDYSKLTAILGL  194

Query  192  YFQIRDDYCNLCVKEYALNKSYCEDLSEGKFSFPIIHALRTHPEDRQILNILRQRTKDNE  251
            YFQIRDDYCNL +KEY  NKS+ EDL+EGKF FP+IHA+RT  +D+Q+L+ILRQRT D E
Sbjct  195  YFQIRDDYCNLSLKEYTENKSFAEDLTEGKFGFPVIHAVRTQKQDKQVLHILRQRTHDIE  254

Query  252  VKRYCVSLLEKFGSFAYTRTVLEDMDKEVRKKIQCLGGNPLLVRVLDELMSWKHHDS  308
            VK+YC++LLEK GSF YTR VLE +D E R ++  LG NP + R+L++L+SWK  DS
Sbjct  255  VKKYCITLLEKLGSFQYTRKVLESLDAEARSEVARLGSNPYMDRLLNKLLSWKTSDS  311


>O61538_DROME unnamed protein product
Length=335

 Score = 416 bits (1069),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 190/297 (64%), Positives = 239/297 (80%), Gaps = 3/297 (1%)

Query  12   SGDKEEDEILLLPLTYILQIPGKQIRAKLIQAFNYWLKIPQDKFHAVGDIIQLLHTSSLL  71
            S  KE+DEILL P TYI QIPGKQ R++L  AFN+WL IP +K   +G+I+Q+LH SSLL
Sbjct  15   STQKEQDEILLQPFTYIQQIPGKQFRSELALAFNHWLLIPGEKLAQIGNIVQMLHNSSLL  74

Query  72   IDDIQDNSVLRRGIPVAHNIYGVASTINASNYGLFIALEKVMALNHPEGTQVYLQQLLEL  131
            I+D   NS+LRRG+PVAH+IYGVASTINA+NY LF+ALEKV  L+HPE  +VY +QLLEL
Sbjct  75   IED---NSILRRGVPVAHSIYGVASTINAANYALFLALEKVQQLDHPEVRKVYTEQLLEL  131

Query  132  HRGQGMELYWRDNYMCPSETAYKQMIMRKTGGLFNMAVRLMQLFSDSKEDYVSLVSMLGL  191
            HRGQGME+YWRD++ CPSE+ YK M +RKTGGLF +A+RLMQLFS +KEDY  L ++LGL
Sbjct  132  HRGQGMEIYWRDSFTCPSESDYKLMTVRKTGGLFMLAIRLMQLFSSNKEDYSKLTAILGL  191

Query  192  YFQIRDDYCNLCVKEYALNKSYCEDLSEGKFSFPIIHALRTHPEDRQILNILRQRTKDNE  251
            YFQIRDDYCNL +KE ++NKS+ EDL+EGKF FP+IHA+RT  +D+Q+L    QRT D E
Sbjct  192  YFQIRDDYCNLSLKEVSVNKSFAEDLTEGKFGFPVIHAVRTQKQDKQVLRKSSQRTHDIE  251

Query  252  VKRYCVSLLEKFGSFAYTRTVLEDMDKEVRKKIQCLGGNPLLVRVLDELMSWKHHDS  308
            VK+YC++LLEK GSF YTR VLE +D E R ++  LG NP + R+L++L+SWK  DS
Sbjct  252  VKKYCITLLEKLGSFQYTRKVLESLDAEARSEVSTLGSNPYMDRLLNKLLSWKTSDS  308



Lambda      K        H
   0.324    0.138    0.456 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3617638992


Query= NP_001267850.1 kruppel homolog 1 [Bombus terrestris]

Length=491
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

KRH1_DROME  unnamed protein product                                   361     6e-116
O96395_DROME  unnamed protein product                                 186     2e-52 
M9PF60_DROME  unnamed protein product                                 186     2e-52 


>KRH1_DROME unnamed protein product
Length=845

 Score = 361 bits (926),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 161/199 (81%), Positives = 175/199 (88%), Gaps = 2/199 (1%)

Query  78   GEDPYRCNICGKTFAVPARLTRHYRTHTGEKPYQCEYCSKSFSVKENLSVHRRIHTKERP  137
            G DPY+CN+C KTFAVPARL RHYRTHTGE+P++CE+C K FSVKENL VHRRIHTKERP
Sbjct  267  GADPYQCNVCQKTFAVPARLIRHYRTHTGERPFECEFCHKLFSVKENLQVHRRIHTKERP  326

Query  138  YKCDVCERAFEHSGKLHRHMRIHTGERPHKCTVCSKTFIQSGQLVIHMRTHTGEKPYVC-  196
            YKCDVC RAFEHSGKLHRHMRIHTGERPHKC+VC KTFIQSGQLVIHMRTHTGEKPY C 
Sbjct  327  YKCDVCGRAFEHSGKLHRHMRIHTGERPHKCSVCEKTFIQSGQLVIHMRTHTGEKPYKCP  386

Query  197  -KSCGKGFTCSKQLKVHTRTHTGEKPYTCDICGKSFGYNHVLKLHQVAHYGEKVYKCTLC  255
               CGKGFTCSKQLKVH+RTHTGEKPY CDIC + FGYNHVLKLH+V HYG K YKCT+C
Sbjct  387  EPGCGKGFTCSKQLKVHSRTHTGEKPYHCDICFRDFGYNHVLKLHRVQHYGSKCYKCTIC  446

Query  256  HETFGSKKTMELHIKTHSD  274
             ETF +KK ME HIK H++
Sbjct  447  DETFKNKKEMEAHIKGHAN  465


 Score = 140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/205 (37%), Positives = 107/205 (52%), Gaps = 6/205 (3%)

Query  19   VNPVKSLVCSPDLSVFTPACSGETLSANVEEKTYQCLLCQKVFDQKSLYQSHLRSHGKEG  78
             +P +  VC    +V  PA        +  E+ ++C  C K+F  K   Q H R H K  
Sbjct  268  ADPYQCNVCQKTFAV--PARLIRHYRTHTGERPFECEFCHKLFSVKENLQVHRRIHTK--  323

Query  79   EDPYRCNICGKTFAVPARLTRHYRTHTGEKPYQCEYCSKSFSVKENLSVHRRIHTKERPY  138
            E PY+C++CG+ F    +L RH R HTGE+P++C  C K+F     L +H R HT E+PY
Sbjct  324  ERPYKCDVCGRAFEHSGKLHRHMRIHTGERPHKCSVCEKTFIQSGQLVIHMRTHTGEKPY  383

Query  139  KC--DVCERAFEHSGKLHRHMRIHTGERPHKCTVCSKTFIQSGQLVIHMRTHTGEKPYVC  196
            KC    C + F  S +L  H R HTGE+P+ C +C + F  +  L +H   H G K Y C
Sbjct  384  KCPEPGCGKGFTCSKQLKVHSRTHTGEKPYHCDICFRDFGYNHVLKLHRVQHYGSKCYKC  443

Query  197  KSCGKGFTCSKQLKVHTRTHTGEKP  221
              C + F   K+++ H + H  E P
Sbjct  444  TICDETFKNKKEMEAHIKGHANEVP  468


 Score = 119 bits (298),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 64/205 (31%), Positives = 103/205 (50%), Gaps = 22/205 (11%)

Query  91   FAVPARLTRHYRTHTGEKP-YQCEYCSKSFSVKENLSVHRRIHTKERPYKCD--------  141
            F   A +    R  +  KP ++C+ C  +F  K   + H + H+K +    +        
Sbjct  174  FPASAAVVSQVRKPSASKPQFKCDQCGMTFGSKSAHTSHTKSHSKNQDLSLNGASGAGVA  233

Query  142  --VCERAFE-----------HSGKLHRHMRIHTGERPHKCTVCSKTFIQSGQLVIHMRTH  188
              V   A E            S  +     +  G  P++C VC KTF    +L+ H RTH
Sbjct  234  APVSTAAIELNDAGLPVGIPKSPTIKPLANVAAGADPYQCNVCQKTFAVPARLIRHYRTH  293

Query  189  TGEKPYVCKSCGKGFTCSKQLKVHTRTHTGEKPYTCDICGKSFGYNHVLKLHQVAHYGEK  248
            TGE+P+ C+ C K F+  + L+VH R HT E+PY CD+CG++F ++  L  H   H GE+
Sbjct  294  TGERPFECEFCHKLFSVKENLQVHRRIHTKERPYKCDVCGRAFEHSGKLHRHMRIHTGER  353

Query  249  VYKCTLCHETFGSKKTMELHIKTHS  273
             +KC++C +TF     + +H++TH+
Sbjct  354  PHKCSVCEKTFIQSGQLVIHMRTHT  378


>O96395_DROME unnamed protein product
Length=583

 Score = 186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/228 (38%), Positives = 136/228 (60%), Gaps = 4/228 (2%)

Query  49   EKTYQCLLCQKVFDQKSLYQSHLRSHGKEGEDPYRCNICGKTFAVPARLTRHYRTHTGEK  108
            E+ ++C LC K +      +SH+ +H  + E  ++C  C KTF     L  H + HTGE+
Sbjct  297  ERPFKCPLCPKAYTHGPTLKSHMHTH--DEEKGHKCPQCDKTFYTRGNLRAHIQRHTGER  354

Query  109  PYQCEYCSKSFSVKENLSVHRRIHTKERPYKCDVCERAFEHSGKLHRHMRIHTGERPHKC  168
            PY+C  C ++F+    L +H R+H +ERP+KC++C + F  +  L  H+R+H G+R  KC
Sbjct  355  PYKCPDCPQTFAKNSGLKLHSRLHKEERPFKCELCGKGFVQNQHLITHLRVHNGDRQFKC  414

Query  169  TVCSKTFIQSGQLVIHMRTHTGEKPYVCKSCGKGFTCSKQLKVHTRTHTGEKPYTCDICG  228
              C K+F +   ++ H RTH+G KP+ C+ CG+ F+ +  LK H R HTGEKPY CD CG
Sbjct  415  PDCDKSFFEKSNMMKHQRTHSGIKPFKCEECGQAFSHNHHLKSHLRIHTGEKPYKCDQCG  474

Query  229  KSFGYNHVLKLHQVAHY--GEKVYKCTLCHETFGSKKTMELHIKTHSD  274
            K F  N  L  H + H    ++ +KC+ C + + +++++  H KTH +
Sbjct  475  KGFSANQSLMKHTLWHVDNNDRPFKCSQCPKAYDTQQSLRGHEKTHKN  522


 Score = 175 bits (443),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 86/228 (38%), Positives = 125/228 (55%), Gaps = 2/228 (1%)

Query  49   EKTYQCLLCQKVFDQKSLYQSHLRSHGKEGEDPYRCNICGKTFAVPARLTRHYRTHTGEK  108
            +K + C  C + F   +   +H R H   GE P++C +C K +     L  H  TH  EK
Sbjct  269  QKPHLCDFCGRGFRTNAQLTTHRRRH--TGERPFKCPLCPKAYTHGPTLKSHMHTHDEEK  326

Query  109  PYQCEYCSKSFSVKENLSVHRRIHTKERPYKCDVCERAFEHSGKLHRHMRIHTGERPHKC  168
             ++C  C K+F  + NL  H + HT ERPYKC  C + F  +  L  H R+H  ERP KC
Sbjct  327  GHKCPQCDKTFYTRGNLRAHIQRHTGERPYKCPDCPQTFAKNSGLKLHSRLHKEERPFKC  386

Query  169  TVCSKTFIQSGQLVIHMRTHTGEKPYVCKSCGKGFTCSKQLKVHTRTHTGEKPYTCDICG  228
             +C K F+Q+  L+ H+R H G++ + C  C K F     +  H RTH+G KP+ C+ CG
Sbjct  387  ELCGKGFVQNQHLITHLRVHNGDRQFKCPDCDKSFFEKSNMMKHQRTHSGIKPFKCEECG  446

Query  229  KSFGYNHVLKLHQVAHYGEKVYKCTLCHETFGSKKTMELHIKTHSDSS  276
            ++F +NH LK H   H GEK YKC  C + F + +++  H   H D++
Sbjct  447  QAFSHNHHLKSHLRIHTGEKPYKCDQCGKGFSANQSLMKHTLWHVDNN  494


 Score = 161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 77/194 (40%), Positives = 108/194 (56%), Gaps = 4/194 (2%)

Query  84   CNICGKTFAVPARLTRHYRTH----TGEKPYQCEYCSKSFSVKENLSVHRRIHTKERPYK  139
            C  CG +++    L RH   H      +KP+ C++C + F     L+ HRR HT ERP+K
Sbjct  242  CTECGVSYSTQKALARHVAKHKEQGDTQKPHLCDFCGRGFRTNAQLTTHRRRHTGERPFK  301

Query  140  CDVCERAFEHSGKLHRHMRIHTGERPHKCTVCSKTFIQSGQLVIHMRTHTGEKPYVCKSC  199
            C +C +A+ H   L  HM  H  E+ HKC  C KTF   G L  H++ HTGE+PY C  C
Sbjct  302  CPLCPKAYTHGPTLKSHMHTHDEEKGHKCPQCDKTFYTRGNLRAHIQRHTGERPYKCPDC  361

Query  200  GKGFTCSKQLKVHTRTHTGEKPYTCDICGKSFGYNHVLKLHQVAHYGEKVYKCTLCHETF  259
             + F  +  LK+H+R H  E+P+ C++CGK F  N  L  H   H G++ +KC  C ++F
Sbjct  362  PQTFAKNSGLKLHSRLHKEERPFKCELCGKGFVQNQHLITHLRVHNGDRQFKCPDCDKSF  421

Query  260  GSKKTMELHIKTHS  273
              K  M  H +THS
Sbjct  422  FEKSNMMKHQRTHS  435


 Score = 119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 73/207 (35%), Positives = 106/207 (51%), Gaps = 9/207 (4%)

Query  48   EEKTYQCLLCQKVFDQKSLYQSHLRSHGKEGEDPYRCNICGKTFAVPARLTRHYRTHTGE  107
            EE+ ++C LC K F Q     +HLR H   G+  ++C  C K+F   + + +H RTH+G 
Sbjct  380  EERPFKCELCGKGFVQNQHLITHLRVHN--GDRQFKCPDCDKSFFEKSNMMKHQRTHSGI  437

Query  108  KPYQCEYCSKSFSVKENLSVHRRIHTKERPYKCDVCERAFEHSGKLHRHMRIH--TGERP  165
            KP++CE C ++FS   +L  H RIHT E+PYKCD C + F  +  L +H   H    +RP
Sbjct  438  KPFKCEECGQAFSHNHHLKSHLRIHTGEKPYKCDQCGKGFSANQSLMKHTLWHVDNNDRP  497

Query  166  HKCTVCSKTFIQSGQLVIHMRTHTG-EKP---YVCKSCGKGFTCSKQLKVHTRTHTGEKP  221
             KC+ C K +     L  H +TH   ++P   + C  C   F   K L  H  +H   +P
Sbjct  498  FKCSQCPKAYDTQQSLRGHEKTHKNPDEPKTLHQCPHCDVRFALKKTLDKHITSHKI-RP  556

Query  222  YTCDICGKSFGYNHVLKLHQVAHYGEK  248
            + C  C + F     LK H   H  +K
Sbjct  557  HPCPQCPEGFFSQKSLKKHLRLHNLKK  583


 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 68/139 (49%), Gaps = 4/139 (3%)

Query  140  CDVCERAFEHSGKLHRHMRIH----TGERPHKCTVCSKTFIQSGQLVIHMRTHTGEKPYV  195
            C  C  ++     L RH+  H      ++PH C  C + F  + QL  H R HTGE+P+ 
Sbjct  242  CTECGVSYSTQKALARHVAKHKEQGDTQKPHLCDFCGRGFRTNAQLTTHRRRHTGERPFK  301

Query  196  CKSCGKGFTCSKQLKVHTRTHTGEKPYTCDICGKSFGYNHVLKLHQVAHYGEKVYKCTLC  255
            C  C K +T    LK H  TH  EK + C  C K+F     L+ H   H GE+ YKC  C
Sbjct  302  CPLCPKAYTHGPTLKSHMHTHDEEKGHKCPQCDKTFYTRGNLRAHIQRHTGERPYKCPDC  361

Query  256  HETFGSKKTMELHIKTHSD  274
             +TF     ++LH + H +
Sbjct  362  PQTFAKNSGLKLHSRLHKE  380


 Score = 59.3 bits (142),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 56/123 (46%), Gaps = 5/123 (4%)

Query  43   LSANVEEKTYQCLLCQKVFDQKSLYQSHLRSHGKEGEDPYRCNICGKTFAVPARLTRHYR  102
            L  +  EK Y+C  C K F        H   H    + P++C+ C K +     L  H +
Sbjct  459  LRIHTGEKPYKCDQCGKGFSANQSLMKHTLWHVDNNDRPFKCSQCPKAYDTQQSLRGHEK  518

Query  103  THTG-EKP---YQCEYCSKSFSVKENLSVHRRIHTKERPYKCDVCERAFEHSGKLHRHMR  158
            TH   ++P   +QC +C   F++K+ L  H   H K RP+ C  C   F     L +H+R
Sbjct  519  THKNPDEPKTLHQCPHCDVRFALKKTLDKHITSH-KIRPHPCPQCPEGFFSQKSLKKHLR  577

Query  159  IHT  161
            +H 
Sbjct  578  LHN  580


>M9PF60_DROME unnamed protein product
Length=571

 Score = 186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/228 (38%), Positives = 136/228 (60%), Gaps = 4/228 (2%)

Query  49   EKTYQCLLCQKVFDQKSLYQSHLRSHGKEGEDPYRCNICGKTFAVPARLTRHYRTHTGEK  108
            E+ ++C LC K +      +SH+ +H  + E  ++C  C KTF     L  H + HTGE+
Sbjct  285  ERPFKCPLCPKAYTHGPTLKSHMHTH--DEEKGHKCPQCDKTFYTRGNLRAHIQRHTGER  342

Query  109  PYQCEYCSKSFSVKENLSVHRRIHTKERPYKCDVCERAFEHSGKLHRHMRIHTGERPHKC  168
            PY+C  C ++F+    L +H R+H +ERP+KC++C + F  +  L  H+R+H G+R  KC
Sbjct  343  PYKCPDCPQTFAKNSGLKLHSRLHKEERPFKCELCGKGFVQNQHLITHLRVHNGDRQFKC  402

Query  169  TVCSKTFIQSGQLVIHMRTHTGEKPYVCKSCGKGFTCSKQLKVHTRTHTGEKPYTCDICG  228
              C K+F +   ++ H RTH+G KP+ C+ CG+ F+ +  LK H R HTGEKPY CD CG
Sbjct  403  PDCDKSFFEKSNMMKHQRTHSGIKPFKCEECGQAFSHNHHLKSHLRIHTGEKPYKCDQCG  462

Query  229  KSFGYNHVLKLHQVAHY--GEKVYKCTLCHETFGSKKTMELHIKTHSD  274
            K F  N  L  H + H    ++ +KC+ C + + +++++  H KTH +
Sbjct  463  KGFSANQSLMKHTLWHVDNNDRPFKCSQCPKAYDTQQSLRGHEKTHKN  510


 Score = 175 bits (443),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 86/228 (38%), Positives = 125/228 (55%), Gaps = 2/228 (1%)

Query  49   EKTYQCLLCQKVFDQKSLYQSHLRSHGKEGEDPYRCNICGKTFAVPARLTRHYRTHTGEK  108
            +K + C  C + F   +   +H R H   GE P++C +C K +     L  H  TH  EK
Sbjct  257  QKPHLCDFCGRGFRTNAQLTTHRRRH--TGERPFKCPLCPKAYTHGPTLKSHMHTHDEEK  314

Query  109  PYQCEYCSKSFSVKENLSVHRRIHTKERPYKCDVCERAFEHSGKLHRHMRIHTGERPHKC  168
             ++C  C K+F  + NL  H + HT ERPYKC  C + F  +  L  H R+H  ERP KC
Sbjct  315  GHKCPQCDKTFYTRGNLRAHIQRHTGERPYKCPDCPQTFAKNSGLKLHSRLHKEERPFKC  374

Query  169  TVCSKTFIQSGQLVIHMRTHTGEKPYVCKSCGKGFTCSKQLKVHTRTHTGEKPYTCDICG  228
             +C K F+Q+  L+ H+R H G++ + C  C K F     +  H RTH+G KP+ C+ CG
Sbjct  375  ELCGKGFVQNQHLITHLRVHNGDRQFKCPDCDKSFFEKSNMMKHQRTHSGIKPFKCEECG  434

Query  229  KSFGYNHVLKLHQVAHYGEKVYKCTLCHETFGSKKTMELHIKTHSDSS  276
            ++F +NH LK H   H GEK YKC  C + F + +++  H   H D++
Sbjct  435  QAFSHNHHLKSHLRIHTGEKPYKCDQCGKGFSANQSLMKHTLWHVDNN  482


 Score = 160 bits (406),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 77/194 (40%), Positives = 108/194 (56%), Gaps = 4/194 (2%)

Query  84   CNICGKTFAVPARLTRHYRTH----TGEKPYQCEYCSKSFSVKENLSVHRRIHTKERPYK  139
            C  CG +++    L RH   H      +KP+ C++C + F     L+ HRR HT ERP+K
Sbjct  230  CTECGVSYSTQKALARHVAKHKEQGDTQKPHLCDFCGRGFRTNAQLTTHRRRHTGERPFK  289

Query  140  CDVCERAFEHSGKLHRHMRIHTGERPHKCTVCSKTFIQSGQLVIHMRTHTGEKPYVCKSC  199
            C +C +A+ H   L  HM  H  E+ HKC  C KTF   G L  H++ HTGE+PY C  C
Sbjct  290  CPLCPKAYTHGPTLKSHMHTHDEEKGHKCPQCDKTFYTRGNLRAHIQRHTGERPYKCPDC  349

Query  200  GKGFTCSKQLKVHTRTHTGEKPYTCDICGKSFGYNHVLKLHQVAHYGEKVYKCTLCHETF  259
             + F  +  LK+H+R H  E+P+ C++CGK F  N  L  H   H G++ +KC  C ++F
Sbjct  350  PQTFAKNSGLKLHSRLHKEERPFKCELCGKGFVQNQHLITHLRVHNGDRQFKCPDCDKSF  409

Query  260  GSKKTMELHIKTHS  273
              K  M  H +THS
Sbjct  410  FEKSNMMKHQRTHS  423


 Score = 119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 73/207 (35%), Positives = 106/207 (51%), Gaps = 9/207 (4%)

Query  48   EEKTYQCLLCQKVFDQKSLYQSHLRSHGKEGEDPYRCNICGKTFAVPARLTRHYRTHTGE  107
            EE+ ++C LC K F Q     +HLR H   G+  ++C  C K+F   + + +H RTH+G 
Sbjct  368  EERPFKCELCGKGFVQNQHLITHLRVHN--GDRQFKCPDCDKSFFEKSNMMKHQRTHSGI  425

Query  108  KPYQCEYCSKSFSVKENLSVHRRIHTKERPYKCDVCERAFEHSGKLHRHMRIH--TGERP  165
            KP++CE C ++FS   +L  H RIHT E+PYKCD C + F  +  L +H   H    +RP
Sbjct  426  KPFKCEECGQAFSHNHHLKSHLRIHTGEKPYKCDQCGKGFSANQSLMKHTLWHVDNNDRP  485

Query  166  HKCTVCSKTFIQSGQLVIHMRTHTG-EKP---YVCKSCGKGFTCSKQLKVHTRTHTGEKP  221
             KC+ C K +     L  H +TH   ++P   + C  C   F   K L  H  +H   +P
Sbjct  486  FKCSQCPKAYDTQQSLRGHEKTHKNPDEPKTLHQCPHCDVRFALKKTLDKHITSHKI-RP  544

Query  222  YTCDICGKSFGYNHVLKLHQVAHYGEK  248
            + C  C + F     LK H   H  +K
Sbjct  545  HPCPQCPEGFFSQKSLKKHLRLHNLKK  571


 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 68/139 (49%), Gaps = 4/139 (3%)

Query  140  CDVCERAFEHSGKLHRHMRIH----TGERPHKCTVCSKTFIQSGQLVIHMRTHTGEKPYV  195
            C  C  ++     L RH+  H      ++PH C  C + F  + QL  H R HTGE+P+ 
Sbjct  230  CTECGVSYSTQKALARHVAKHKEQGDTQKPHLCDFCGRGFRTNAQLTTHRRRHTGERPFK  289

Query  196  CKSCGKGFTCSKQLKVHTRTHTGEKPYTCDICGKSFGYNHVLKLHQVAHYGEKVYKCTLC  255
            C  C K +T    LK H  TH  EK + C  C K+F     L+ H   H GE+ YKC  C
Sbjct  290  CPLCPKAYTHGPTLKSHMHTHDEEKGHKCPQCDKTFYTRGNLRAHIQRHTGERPYKCPDC  349

Query  256  HETFGSKKTMELHIKTHSD  274
             +TF     ++LH + H +
Sbjct  350  PQTFAKNSGLKLHSRLHKE  368


 Score = 59.3 bits (142),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 56/123 (46%), Gaps = 5/123 (4%)

Query  43   LSANVEEKTYQCLLCQKVFDQKSLYQSHLRSHGKEGEDPYRCNICGKTFAVPARLTRHYR  102
            L  +  EK Y+C  C K F        H   H    + P++C+ C K +     L  H +
Sbjct  447  LRIHTGEKPYKCDQCGKGFSANQSLMKHTLWHVDNNDRPFKCSQCPKAYDTQQSLRGHEK  506

Query  103  THTG-EKP---YQCEYCSKSFSVKENLSVHRRIHTKERPYKCDVCERAFEHSGKLHRHMR  158
            TH   ++P   +QC +C   F++K+ L  H   H K RP+ C  C   F     L +H+R
Sbjct  507  THKNPDEPKTLHQCPHCDVRFALKKTLDKHITSH-KIRPHPCPQCPEGFFSQKSLKKHLR  565

Query  159  IHT  161
            +H 
Sbjct  566  LHN  568



Lambda      K        H
   0.324    0.138    0.456 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3617638992


Query= NP_001267853.1 feminizer [Bombus terrestris]

Length=416
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TRSF_MUSDO  unnamed protein product                                   38.9    0.007


>TRSF_MUSDO unnamed protein product
Length=367

 Score = 38.9 bits (89),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 30/105 (29%), Positives = 50/105 (48%), Gaps = 22/105 (21%)

Query  159  DIINPEDVLVKRGEGEGSKPIFEREEIKGTTVKADEIVERRTV-------------VVLN  205
            D+I  E++ +KR  GEG+KP+FER+++K  TV   E +  + +              ++ 
Sbjct  53   DLI--EEIQIKRRFGEGTKPLFERDDVKVNTVADGESISSKKIKSHKASSPSKGVNGLVK  110

Query  206  NENLESKSKVNKKYTTSSRNRSPSPRHRSSRHARYEDSKYDNRDS  250
              + +   K  KKY +S      +P  R  RH+ YE   Y   +S
Sbjct  111  QNSPDVTQKFTKKYGSSE-----NPDFR--RHSSYEKDNYHKSNS  148



Lambda      K        H
   0.324    0.138    0.456 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3617638992


Query= NP_001267855.1 isopentenyl-diphosphate Delta-isomerase 1-like
[Bombus terrestris]

Length=241
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9NGX3_DROME  unnamed protein product                                 28.5    4.8  
Q8T8Y5_DROME  unnamed protein product                                 28.5    5.1  


>Q9NGX3_DROME unnamed protein product
Length=313

 Score = 28.5 bits (62),  Expect = 4.8, Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 36/82 (44%), Gaps = 10/82 (12%)

Query  78   KGELLLQKRSPNKITFPNRYTNTCCSHPLFEI---PEETEEHEALGIRKAARRRLNFELG  134
            + E LLQ ++  K +FP     T  S  L E+   P+ET       +  A  R+L++ +G
Sbjct  37   QSERLLQAQNRRKFSFPA----TLHSASLLEVGGGPKETTRRRLSNVSDAVTRKLSYTIG  92

Query  135  IPLSQILLSDFFYLTRI---HY  153
               +QI   D     R    HY
Sbjct  93   WKAAQIPAQDIISQGRCLCGHY  114


>Q8T8Y5_DROME unnamed protein product
Length=299

 Score = 28.5 bits (62),  Expect = 5.1, Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 36/82 (44%), Gaps = 10/82 (12%)

Query  78   KGELLLQKRSPNKITFPNRYTNTCCSHPLFEI---PEETEEHEALGIRKAARRRLNFELG  134
            + E LLQ ++  K +FP     T  S  L E+   P+ET       +  A  R+L++ +G
Sbjct  23   QSERLLQAQNRRKFSFPA----TLHSASLLEVGGGPKETTRRRLSNVSDAVTRKLSYTIG  78

Query  135  IPLSQILLSDFFYLTRI---HY  153
               +QI   D     R    HY
Sbjct  79   WKAAQIPAQDIISQGRCLCGHY  100



Lambda      K        H
   0.324    0.138    0.456 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3617638992


Query= NP_001267859.1 mevalonate kinase [Bombus terrestris]

Length=380
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q65XX8_CAEEL  unnamed protein product                                 132     2e-34
Q65XY0_CAEEL  unnamed protein product                                 133     2e-34
Q65XX9_CAEEL  unnamed protein product                                 132     1e-33


>Q65XX8_CAEEL unnamed protein product
Length=484

 Score = 132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 84/294 (29%), Positives = 153/294 (52%), Gaps = 36/294 (12%)

Query  6    VSAPGKVILFGEHAVVYGKTAVAASVDLRTVLNFAELPETEQIVKICFPKVNLFINIPLQ  65
            VSAPGK+ILFGEHAVVYG+TA+A S+DLRT ++     +             +++++P  
Sbjct  14   VSAPGKIILFGEHAVVYGRTAIAGSIDLRTYVSLYTSADGR-----------IYLSLPDL  62

Query  66   QIQNFFFINKDMVHVENYEAFYNKVKE--------FVSIISYANLQ-------QRLSLEA  110
             ++  + + KD++   +  A    ++E         V I    +         Q L++ A
Sbjct  63   GVEKTWML-KDLLKAADRLAAEYPIEEDQPPSLEILVPIARKLSGSCEDQCGVQHLAILA  121

Query  111  FFYLFIYITQKEEIEVKPFQVHLNTELGIGSGLGSSSSFAVCLAACFLHWSRLQKDIYKI  170
            F+YL + +  ++  ++   +  +  +L    GLGSS ++ VC+A   L  + L      +
Sbjct  122  FWYLLLGVAHRKR-DLLAVKATVRFKLPSCVGLGSSGAYCVCIATSLLQTAGLIPPPSIV  180

Query  171  LDF--------SILDTISKYALNCEKIMHGNPSGIDNSVCTYGSIIEFKKDDYVKPISNV  222
             D           LD I K+A   E ++HG  SG+D +VCT+G +  FK    ++ + N+
Sbjct  181  ADEQGNLTWEEDHLDIIRKWATAAESLIHGRASGLDAAVCTFGGVASFKPGHRIEHLKNL  240

Query  223  HALKILLVDTRVNRSTKALVERLLELKHRYPVIIDLIMSSIDNIAKEVIKIIEK  276
              L+++LV+++V R+T  +V+ + E   ++P ++D +  SID I+ +  KI+ +
Sbjct  241  PDLRVILVNSKVERNTARMVQTVKERLKKFPEVVDAMFGSIDAISLDAAKILHR  294


 Score = 63.5 bits (153),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 45/87 (52%), Gaps = 0/87 (0%)

Query  291  YRQLMILINMNQGLLATCQVSHPSLDRICAEAQNYALAAKLTGAGGGGHAYILLLPDTQP  350
            + +L  L  +N  LL    V HP +D IC     Y +  K+TGAGGGG  +  L P+T  
Sbjct  371  FSKLNDLCRINNQLLIALGVGHPKVDLICTTLARYGIHPKMTGAGGGGSVFAFLKPNTPQ  430

Query  351  ETIASISRKLIADGFTVKLTTLGGPGV  377
              +  I  +L + GF V    LGGPGV
Sbjct  431  TLLDMIDGELRSHGFEVWQPPLGGPGV  457


>Q65XY0_CAEEL unnamed protein product
Length=514

 Score = 133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 84/294 (29%), Positives = 153/294 (52%), Gaps = 36/294 (12%)

Query  6    VSAPGKVILFGEHAVVYGKTAVAASVDLRTVLNFAELPETEQIVKICFPKVNLFINIPLQ  65
            VSAPGK+ILFGEHAVVYG+TA+A S+DLRT ++     +             +++++P  
Sbjct  44   VSAPGKIILFGEHAVVYGRTAIAGSIDLRTYVSLYTSADGR-----------IYLSLPDL  92

Query  66   QIQNFFFINKDMVHVENYEAFYNKVKE--------FVSIISYANLQ-------QRLSLEA  110
             ++  + + KD++   +  A    ++E         V I    +         Q L++ A
Sbjct  93   GVEKTWML-KDLLKAADRLAAEYPIEEDQPPSLEILVPIARKLSGSCEDQCGVQHLAILA  151

Query  111  FFYLFIYITQKEEIEVKPFQVHLNTELGIGSGLGSSSSFAVCLAACFLHWSRLQKDIYKI  170
            F+YL + +  ++  ++   +  +  +L    GLGSS ++ VC+A   L  + L      +
Sbjct  152  FWYLLLGVAHRKR-DLLAVKATVRFKLPSCVGLGSSGAYCVCIATSLLQTAGLIPPPSIV  210

Query  171  LDFSI--------LDTISKYALNCEKIMHGNPSGIDNSVCTYGSIIEFKKDDYVKPISNV  222
             D           LD I K+A   E ++HG  SG+D +VCT+G +  FK    ++ + N+
Sbjct  211  ADEQGNLTWEEDHLDIIRKWATAAESLIHGRASGLDAAVCTFGGVASFKPGHRIEHLKNL  270

Query  223  HALKILLVDTRVNRSTKALVERLLELKHRYPVIIDLIMSSIDNIAKEVIKIIEK  276
              L+++LV+++V R+T  +V+ + E   ++P ++D +  SID I+ +  KI+ +
Sbjct  271  PDLRVILVNSKVERNTARMVQTVKERLKKFPEVVDAMFGSIDAISLDAAKILHR  324


 Score = 63.2 bits (152),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 45/87 (52%), Gaps = 0/87 (0%)

Query  291  YRQLMILINMNQGLLATCQVSHPSLDRICAEAQNYALAAKLTGAGGGGHAYILLLPDTQP  350
            + +L  L  +N  LL    V HP +D IC     Y +  K+TGAGGGG  +  L P+T  
Sbjct  401  FSKLNDLCRINNQLLIALGVGHPKVDLICTTLARYGIHPKMTGAGGGGSVFAFLKPNTPQ  460

Query  351  ETIASISRKLIADGFTVKLTTLGGPGV  377
              +  I  +L + GF V    LGGPGV
Sbjct  461  TLLDMIDGELRSHGFEVWQPPLGGPGV  487


>Q65XX9_CAEEL unnamed protein product
Length=614

 Score = 132 bits (332),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 84/294 (29%), Positives = 153/294 (52%), Gaps = 36/294 (12%)

Query  6    VSAPGKVILFGEHAVVYGKTAVAASVDLRTVLNFAELPETEQIVKICFPKVNLFINIPLQ  65
            VSAPGK+ILFGEHAVVYG+TA+A S+DLRT ++     +             +++++P  
Sbjct  144  VSAPGKIILFGEHAVVYGRTAIAGSIDLRTYVSLYTSADG-----------RIYLSLPDL  192

Query  66   QIQNFFFINKDMVHVENYEAFYNKVKE--------FVSIISYANLQ-------QRLSLEA  110
             ++  + + KD++   +  A    ++E         V I    +         Q L++ A
Sbjct  193  GVEKTWML-KDLLKAADRLAAEYPIEEDQPPSLEILVPIARKLSGSCEDQCGVQHLAILA  251

Query  111  FFYLFIYITQKEEIEVKPFQVHLNTELGIGSGLGSSSSFAVCLAACFLHWSRLQKDIYKI  170
            F+YL + +  ++  ++   +  +  +L    GLGSS ++ VC+A   L  + L      +
Sbjct  252  FWYLLLGVAHRKR-DLLAVKATVRFKLPSCVGLGSSGAYCVCIATSLLQTAGLIPPPSIV  310

Query  171  LDF--------SILDTISKYALNCEKIMHGNPSGIDNSVCTYGSIIEFKKDDYVKPISNV  222
             D           LD I K+A   E ++HG  SG+D +VCT+G +  FK    ++ + N+
Sbjct  311  ADEQGNLTWEEDHLDIIRKWATAAESLIHGRASGLDAAVCTFGGVASFKPGHRIEHLKNL  370

Query  223  HALKILLVDTRVNRSTKALVERLLELKHRYPVIIDLIMSSIDNIAKEVIKIIEK  276
              L+++LV+++V R+T  +V+ + E   ++P ++D +  SID I+ +  KI+ +
Sbjct  371  PDLRVILVNSKVERNTARMVQTVKERLKKFPEVVDAMFGSIDAISLDAAKILHR  424


 Score = 63.9 bits (154),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 45/87 (52%), Gaps = 0/87 (0%)

Query  291  YRQLMILINMNQGLLATCQVSHPSLDRICAEAQNYALAAKLTGAGGGGHAYILLLPDTQP  350
            + +L  L  +N  LL    V HP +D IC     Y +  K+TGAGGGG  +  L P+T  
Sbjct  501  FSKLNDLCRINNQLLIALGVGHPKVDLICTTLARYGIHPKMTGAGGGGSVFAFLKPNTPQ  560

Query  351  ETIASISRKLIADGFTVKLTTLGGPGV  377
              +  I  +L + GF V    LGGPGV
Sbjct  561  TLLDMIDGELRSHGFEVWQPPLGGPGV  587



Lambda      K        H
   0.324    0.138    0.456 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3617638992


Query= NP_001267862.1 acetyl-CoA acetyltransferase [Bombus terrestris]

Length=394
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9W3N9_DROME  unnamed protein product                                 310     7e-103
THIL1_DICDI  unnamed protein product                                  305     8e-101
THILH_CAEEL  unnamed protein product                                  296     3e-97 


>Q9W3N9_DROME unnamed protein product
Length=410

 Score = 310 bits (795),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 169/391 (43%), Positives = 249/391 (64%), Gaps = 7/391 (2%)

Query  5    DVVIISAVRTPIGSFCGSLSSLKASDLGSIVIKESLERAHIKPVDVSEVILGQVLTAGQG  64
            +VV++SA RTPIGSF   L+ L A+ LG+  I+ ++E+A I   DV EVI+G V++AG G
Sbjct  24   EVVVVSAARTPIGSFQSQLAPLTATQLGARAIEAAIEKAGIAKTDVQEVIMGNVVSAGLG  83

Query  65   QNPARQAAMKAGLPISVPAYLINMLCGSGLKAVLNGYLSIKAGENQIVVAGGQESMSQSC  124
            Q PARQAA+ AGLP +V    +N +C SG+KAV+ G  S+  G   +VVAGG ESMS   
Sbjct  84   QAPARQAAIFAGLPTNVCCTTVNKVCSSGMKAVMLGAQSLMLGYADVVVAGGMESMSNVP  143

Query  125  HVLHLRKGVKIGDCNLMDTLLIDGLIDAFHGIHMGVTAENISKDYTVSRKEQDEYAAKSQ  184
            + L  R     G  NL D ++ DGL D ++  HMG  AEN +K   ++R++QD++A +S 
Sbjct  144  YYLK-RGATPYGGVNLTDGIVFDGLWDVYNKFHMGNCAENTAKKLEITRQQQDDFAIESY  202

Query  185  QKVEAAMTAGYFSKEIIPVTVPTGKEP--IIVDKDEYPKFGTTVESLQKLKPAFLEAKGT  242
            ++  AA     F  EI PV +   ++P  +I + +EY +     +   +L   F    GT
Sbjct  203  KRSAAAWANKVFQDEIAPVKIQQKRKPEIVISEDEEYKR--VNFDKFGQLATVFQRENGT  260

Query  243  VTAGNASGVNDGAAAVVLMSADTAMQKGLSPLAKIVAVAEAGVEPRIMGIGPVPAVELVL  302
            VTAGNAS +NDG AAVVLMSA+ A + G+ PLA+IVA  +A  +P    I P  A+  +L
Sbjct  261  VTAGNASTLNDGGAAVVLMSAEAAQKAGIKPLARIVAFQDAETDPIDFPIAPALAIPKLL  320

Query  303  QKAKWTKEEVDLYELNEAFAAQAIACVKSLGLNPNKVNINGGAIALGHPIGASGTRVLVT  362
            ++A   KE+V ++E+NEAF+   +A +K L ++P KVN++GGA+++GHPIG SG R++  
Sbjct  321  KRAGVRKEDVAMWEVNEAFSLVVLANIKKLDVDPAKVNVHGGAVSIGHPIGMSGARLVAH  380

Query  363  LLHSLERIGGNKGVAALCIGGGMGIAIAVQR  393
            L HSL++  G  G A++C GGG   +I +++
Sbjct  381  LSHSLKK--GELGCASICNGGGGASSILIEK  409


>THIL1_DICDI unnamed protein product
Length=414

 Score = 305 bits (781),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 175/391 (45%), Positives = 246/391 (63%), Gaps = 6/391 (2%)

Query  6    VVIISAVRTPIGSFCGSLSSLKASDLGSIVIKESLERAHIKPVDVSEVILGQVLTAGQGQ  65
            VVI+SAVRTPIGS  GSLS++  + L SI I+E+++RA IKP DV E I+G V++A  GQ
Sbjct  26   VVIVSAVRTPIGSIGGSLSTIPGTKLSSITIEEAVKRAGIKPSDVDEAIIGNVISANLGQ  85

Query  66   NPARQAAMKAGLPISVPAYLINMLCGSGLKAVLNGYLSIKAGENQIVVAGGQESMSQ-SC  124
             PARQ A+ AGL        IN +C SG+KA++ G  SI  G ++ VVAGG ESMSQ   
Sbjct  86   APARQCALGAGLEQKTITTTINKVCSSGMKAIVFGAQSIALGHSKTVVAGGFESMSQVPY  145

Query  125  HVLHLRKGVKIGDCNLMDTLLIDGLIDAFHGIHMGVTAENISKDYTVSRKEQDEYAAKSQ  184
            +   +R G K G+   +D L+ DGL DA++G  MGV  ++ +  Y ++R++QD++A  S 
Sbjct  146  YADKMRFGAKYGNQTFIDGLVRDGLADAYNGSAMGVCGDDCADKYKITREQQDKFAVDSY  205

Query  185  QKVEAAMTAGYFSKEII--PVTVPTGKEPIIVDKDEYPKFGTTVESLQKLKPAFLEAKGT  242
             +   A   G+F+ EI+  P+    GK   +V+ DE PK     + +  LKPAF    GT
Sbjct  206  LRALEAQKNGFFNDEIVQVPIVGRGGKVTYVVE-DEEPK-KVLFDKIPNLKPAF-TPNGT  262

Query  243  VTAGNASGVNDGAAAVVLMSADTAMQKGLSPLAKIVAVAEAGVEPRIMGIGPVPAVELVL  302
            VT  NAS +NDGA++V+LMS   A + GL PLA+I+  A+A   P      P  A+   L
Sbjct  263  VTPANASKLNDGASSVILMSESHAKELGLKPLARIIGYADAEQAPIEFPTAPALAIPKAL  322

Query  303  QKAKWTKEEVDLYELNEAFAAQAIACVKSLGLNPNKVNINGGAIALGHPIGASGTRVLVT  362
            + A     +VDL+E+NEAFA   +A  K L ++ NK+N+NGGA+ALGHPIG+SG R++VT
Sbjct  323  KNAGINMSQVDLFEINEAFAVVGLANAKILDIDHNKLNVNGGAVALGHPIGSSGCRIVVT  382

Query  363  LLHSLERIGGNKGVAALCIGGGMGIAIAVQR  393
            L H L+      GVAA+C GGG   A+ +++
Sbjct  383  LTHLLQNKNLKYGVAAICNGGGGSTALVLEK  413


>THILH_CAEEL unnamed protein product
Length=407

 Score = 296 bits (757),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 163/394 (41%), Positives = 236/394 (60%), Gaps = 7/394 (2%)

Query  1    MSNNDVVIISAVRTPIGSFCGSLSSLKASDLGSIVIKESLERAHIKPVDVSEVILGQVLT  60
            +SN    I+ A RTPIGSF  SLSS+ A +L S+ IK +LER  +KP  + EV LGQV  
Sbjct  19   LSNKHAFIVGAARTPIGSFRSSLSSVTAPELASVAIKAALERGAVKPSSIQEVFLGQVCQ  78

Query  61   AGQGQNPARQAAMKAGLPISVPAYLINMLCGSGLKAVLNGYLSIKAGENQIVVAGGQESM  120
            A  GQ PARQAA+ AGL +SV    +N +C SGLKA++     I+ G     + GG ESM
Sbjct  79   ANAGQAPARQAALGAGLDLSVAVTTVNKVCSSGLKAIILAAQQIQTGHQDFAIGGGMESM  138

Query  121  SQSCHVLHLRKGVKIGDCNLMDTLLIDGLIDAFHGIHMGVTAENISKDYTVSRKEQDEYA  180
            SQ    +  R  +  G   ++D ++ DGL DA+  +HMG   E  SK+  ++RK+QDEYA
Sbjct  139  SQVPFYVQ-RGEIPYGGFQVIDGIVKDGLTDAYDKVHMGNCGEKTSKEMGITRKDQDEYA  197

Query  181  AKSQQKVEAAMTAGYFSKEIIPVTVPTGKEPIIVDKD-EYPKFGTTVESLQKLKPAFLEA  239
              S +K   A   G    E++PV V + K   IVDKD E+ K     +    L+  F + 
Sbjct  198  INSYKKSAKAWENGNIGPEVVPVNVKSKKGVTIVDKDEEFTK--VNFDKFTSLRTVF-QK  254

Query  240  KGTVTAGNASGVNDGAAAVVLMSADTAMQKGLSPLAKIVAVAEAGVEPRIMGIGPVPAVE  299
             GT+TA NAS +NDGAAAV++ S +   ++ L PLA+I+A  +A   P    + P     
Sbjct  255  DGTITAANASTLNDGAAAVIVASQEAVSEQSLKPLARILAYGDAATHPLDFAVAPTLMFP  314

Query  300  LVLQKAKWTKEEVDLYELNEAFAAQAIACVKSLGLNPNKVNINGGAIALGHPIGASGTRV  359
             +L++A   + +V  +E+NEAF+   +A +K LG++P+ VN +GGA+++GHPIG SG R+
Sbjct  315  KILERAGVKQSDVAQWEVNEAFSCVPLAFIKKLGVDPSLVNPHGGAVSIGHPIGMSGARL  374

Query  360  LVTLLHSLERIGGNKGVAALCIGGGMGIAIAVQR  393
            +  L+H+L+   G  GVAA+C GGG    + +Q+
Sbjct  375  ITHLVHTLKS--GQIGVAAICNGGGGSSGMVIQK  406



Lambda      K        H
   0.324    0.138    0.456 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3617638992


Query= NP_001267865.1 diphosphomevalonate decarboxylase [Bombus terrestris]

Length=384
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q388P2_TRYB2  unnamed protein product                                 291     4e-96
Q388J2_TRYB2  unnamed protein product                                 290     2e-95


>Q388P2_TRYB2 unnamed protein product
Length=382

 Score = 291 bits (746),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 160/381 (42%), Positives = 232/381 (61%), Gaps = 16/381 (4%)

Query  4    VTCIASVNIAVIKYWGKRD--ETLILPVNDSISATLDTDHLHTKTTVMISPTFKEDQIWL  61
            VT  A +NIA IKYWGKR+  ETLILP NDS S TL      +KT+V +    + D + L
Sbjct  6    VTVEAPINIAFIKYWGKREGGETLILPTNDSFSITLSASPFRSKTSVELRDDIETDTLRL  65

Query  62   NGQEEDI-KNPRLQNCLTQIRKRARNSNHIDQWKVHICSENNFPTAAGLASSAAGYACLV  120
            NG E D+ K PR+Q+ L  +R        +   KV+I SENNFPTAAG+ASSA+GY  + 
Sbjct  66   NGTEVDVGKTPRVQSMLLHLRSTC--PEDLKNKKVNIVSENNFPTAAGMASSASGYCAMS  123

Query  121  AALAKLYQVEGDISSIARIGSGSACRSVMGGFVRWYMGSEPNGADSIAKQIVPASHWPEM  180
            AAL + ++   ++S +AR+GSGSACRS  GGFV W  G +P+G+D +A Q V  +HWPE+
Sbjct  124  AALIRAFKSTTNVSMLARLGSGSACRSAFGGFVIWNKGEKPDGSDCVATQFVDETHWPEI  183

Query  181  RILILVVNDAKKKVSSSVGMKRTMETSDLVQYRIKHVIPERMKRMEQAIVEKDFKIFAEH  240
            +++  V+  A+K VSS+ GM+++++TS L++ RI   +PERMK   +AI  +DF  FAE 
Sbjct  184  QVMCAVLKGAQKDVSSTKGMQQSLKTSPLMKKRISETVPERMKIASRAIKARDFATFAEI  243

Query  241  TMKDSNQLHAVCLDAYPPFVYMNDISHAIVDLVHAYNEAVNEVKVAYTFDAGPNATLYLL  300
             M +S+ L  +C    P   Y  + S+A++ LV AYN       +AYTFDAG N  L++L
Sbjct  244  AMLESDDLQEICATTEPKITYATEDSYAMIRLVKAYNAKKGRTALAYTFDAGANCFLFVL  303

Query  301  EESVPEFVGVL-DHFYPPGINLEKY----RRGLPLNEVMDSPELFNNINAKKQAPESLKY  355
            +E +PE V +L +HF  P    EK+    R  L   +V+  P+ +  +    + P   + 
Sbjct  304  KEDLPEAVAMLMEHFPTP---FEKFFFGDRELLEKVKVVSLPDEYKKLIDHPKKP--FEM  358

Query  356  IIYTKVGDGPKYLKDPKDHLL  376
            ++ + VG G KYL  P + L+
Sbjct  359  LLQSPVGCGVKYL-GPSESLI  378


>Q388J2_TRYB2 unnamed protein product
Length=382

 Score = 290 bits (742),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 159/380 (42%), Positives = 231/380 (61%), Gaps = 16/380 (4%)

Query  5    TCIASVNIAVIKYWGKRD--ETLILPVNDSISATLDTDHLHTKTTVMISPTFKEDQIWLN  62
            T  A +NIA IKYWGKR+  ETLILP NDS S TL      +KT+V +    + D + LN
Sbjct  7    TVEAPINIAFIKYWGKREGGETLILPTNDSFSITLSASPFRSKTSVELRDDIETDTLRLN  66

Query  63   GQEEDI-KNPRLQNCLTQIRKRARNSNHIDQWKVHICSENNFPTAAGLASSAAGYACLVA  121
            G E D+ K PR+Q+ L  +R        +   KV+I SENNFPTAAG+ASSA+GY  + A
Sbjct  67   GTEVDVGKTPRVQSMLLHLRSTC--PEDLKNKKVNIVSENNFPTAAGMASSASGYCAMSA  124

Query  122  ALAKLYQVEGDISSIARIGSGSACRSVMGGFVRWYMGSEPNGADSIAKQIVPASHWPEMR  181
            AL + ++   ++S +AR+GSGSACRS  GGFV W  G +P+G+D +A Q V  +HWPE++
Sbjct  125  ALIRAFKSTTNVSMLARLGSGSACRSAFGGFVIWNKGEKPDGSDCVATQFVDETHWPEIQ  184

Query  182  ILILVVNDAKKKVSSSVGMKRTMETSDLVQYRIKHVIPERMKRMEQAIVEKDFKIFAEHT  241
            ++  V+  A+K VSS+ GM+++++TS L++ RI   +PERMK   +AI  +DF  FAE  
Sbjct  185  VMCAVLKGAQKDVSSTKGMQQSLKTSPLMKKRISETVPERMKIASRAIKARDFATFAEIA  244

Query  242  MKDSNQLHAVCLDAYPPFVYMNDISHAIVDLVHAYNEAVNEVKVAYTFDAGPNATLYLLE  301
            M +S+ L  +C    P   Y  + S+A++ LV AYN       +AYTFDAG N  L++L+
Sbjct  245  MLESDDLQEICATTEPKITYATEDSYAMIRLVKAYNAKKGRTALAYTFDAGANCFLFVLK  304

Query  302  ESVPEFVGVL-DHFYPPGINLEKY----RRGLPLNEVMDSPELFNNINAKKQAPESLKYI  356
            E +PE V +L +HF  P    EK+    R  L   +V+  P+ +  +    + P   + +
Sbjct  305  EDLPEAVAMLMEHFPTP---FEKFFFGDRELLEKVKVVSLPDEYKKLIDHPKKP--FEML  359

Query  357  IYTKVGDGPKYLKDPKDHLL  376
            + + VG G KYL  P + L+
Sbjct  360  LQSPVGCGVKYL-GPSESLI  378



Lambda      K        H
   0.324    0.138    0.456 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3617638992


Query= NP_001272327.1 acyl-CoA Delta(11) desaturase-like [Bombus
terrestris]

Length=377
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q94541_DROME  unnamed protein product                                 410     1e-142
Q7K4Y0_DROME  unnamed protein product                                 410     1e-142
Q9U972_DROME  unnamed protein product                                 407     1e-141


>Q94541_DROME unnamed protein product
Length=383

 Score = 410 bits (1054),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 192/328 (59%), Positives = 242/328 (74%), Gaps = 15/328 (5%)

Query  51   KIVWRNVIAFIYLHIGAIYGVYLTFTSTKFQTNIWLVSLILFGGVGVTAGAHRLWAHRTY  110
            K+VWRN+IAF YLH+ A+YG YL  TS K+QT I    L +  G+G+TAGAHRLWAHR+Y
Sbjct  69   KLVWRNIIAFGYLHLAALYGAYLMVTSAKWQTCILAYFLYVISGLGITAGAHRLWAHRSY  128

Query  111  KAKWPMRLLLMILQTIAFQNHIYEWVRDHRVHHKFTDTNADPHNAKRGFFFSHIGWLLVR  170
            KAKWP+R++L+I  TIAFQ+  Y W RDHRVHHK+++T+ADPHNA RGFFFSH+GWLL +
Sbjct  129  KAKWPLRVILVIFNTIAFQDAAYHWARDHRVHHKYSETDADPHNATRGFFFSHVGWLLCK  188

Query  171  KHPDVLKKGATIDMSDLENDPIVVWQRRLYLLLVPTICFLFPVWVPCYFWKETLFNSWY-  229
            KHP+V  KG  +D+SDL  DPI+++Q++ Y++L+P  CF+ P  VP Y W E+  N+W+ 
Sbjct  189  KHPEVKAKGKGVDLSDLRADPILMFQKKYYMILMPIACFIIPTVVPMYAWGESFMNAWFV  248

Query  230  STLTRYALTLNGTWLVNSAAHIWGVKPYDKNIGPTENKGVAILAFGEGWHNYHHVFPWDY  289
            +T+ R+   LN TWLVNSAAH +G +PYDK I P+EN  VAILAFGEGWHNYHHVFPWDY
Sbjct  249  ATMFRWCFILNVTWLVNSAAHKFGGRPYDKFINPSENISVAILAFGEGWHNYHHVFPWDY  308

Query  290  KAAELGNYKFNFTTAFIDFCAWLGLAYDLKTVPVEAIKRRAIRTGDGTKYSKHDDSHHHM  349
            K AE G Y  NFTTAFIDF A +G AYDLKTV  + IK+R  RTGDGT  +         
Sbjct  309  KTAEFGKYSLNFTTAFIDFFAKIGWAYDLKTVSTDIIKKRVKRTGDGTHAT---------  359

Query  350  HVDMKWGWGDVDMKPEEIQEVDIINKRN  377
                 WGWGDVD   EEI++  I +K++
Sbjct  360  -----WGWGDVDQPKEEIEDAVITHKKS  382


>Q7K4Y0_DROME unnamed protein product
Length=383

 Score = 410 bits (1053),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 192/328 (59%), Positives = 242/328 (74%), Gaps = 15/328 (5%)

Query  51   KIVWRNVIAFIYLHIGAIYGVYLTFTSTKFQTNIWLVSLILFGGVGVTAGAHRLWAHRTY  110
            K+VWRN+IAF YLH+ A+YG YL  TS K+QT I    L +  G+G+TAGAHRLWAHR+Y
Sbjct  69   KLVWRNIIAFGYLHLAALYGAYLMVTSAKWQTCILAYFLYVISGLGITAGAHRLWAHRSY  128

Query  111  KAKWPMRLLLMILQTIAFQNHIYEWVRDHRVHHKFTDTNADPHNAKRGFFFSHIGWLLVR  170
            KAKWP+R++L+I  TIAFQ+  Y W RDHRVHHK+++T+ADPHNA RGFFFSH+GWLL +
Sbjct  129  KAKWPLRVILVIFNTIAFQDAAYHWARDHRVHHKYSETDADPHNATRGFFFSHVGWLLCK  188

Query  171  KHPDVLKKGATIDMSDLENDPIVVWQRRLYLLLVPTICFLFPVWVPCYFWKETLFNSWY-  229
            KHP+V  KG  +D+SDL  DPI+++Q++ Y++L+P  CF+ P  VP Y W E+  N+W+ 
Sbjct  189  KHPEVKAKGKGVDLSDLRADPILMFQKKYYMILMPIACFIIPTVVPMYAWGESFMNAWFV  248

Query  230  STLTRYALTLNGTWLVNSAAHIWGVKPYDKNIGPTENKGVAILAFGEGWHNYHHVFPWDY  289
            +T+ R+   LN TWLVNSAAH +G +PYDK I P+EN  VAILAFGEGWHNYHHVFPWDY
Sbjct  249  ATMFRWCFILNVTWLVNSAAHKFGGRPYDKFINPSENISVAILAFGEGWHNYHHVFPWDY  308

Query  290  KAAELGNYKFNFTTAFIDFCAWLGLAYDLKTVPVEAIKRRAIRTGDGTKYSKHDDSHHHM  349
            K AE G Y  NFTTAFIDF A +G AYDLKTV  + IK+R  RTGDGT  +         
Sbjct  309  KTAEFGKYSLNFTTAFIDFFAKIGWAYDLKTVSTDIIKKRVKRTGDGTHAT---------  359

Query  350  HVDMKWGWGDVDMKPEEIQEVDIINKRN  377
                 WGWGDVD   EEI++  I +K++
Sbjct  360  -----WGWGDVDQPKEEIEDAVITHKKS  382


>Q9U972_DROME unnamed protein product
Length=383

 Score = 407 bits (1047),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 190/328 (58%), Positives = 240/328 (73%), Gaps = 15/328 (5%)

Query  51   KIVWRNVIAFIYLHIGAIYGVYLTFTSTKFQTNIWLVSLILFGGVGVTAGAHRLWAHRTY  110
            K+VWRN+I F Y H+ A+YG YL  TS K+QT I    L +  G+G+TAGAHRLWAHR+Y
Sbjct  69   KLVWRNIIVFGYFHLAALYGAYLMVTSAKWQTCILAYFLYVISGLGITAGAHRLWAHRSY  128

Query  111  KAKWPMRLLLMILQTIAFQNHIYEWVRDHRVHHKFTDTNADPHNAKRGFFFSHIGWLLVR  170
            KAKWP+R++L+I  TIAFQ+  Y W RDHRVHHK+++T+ADPHNA RGFFFSH+GWLL +
Sbjct  129  KAKWPLRVILVIFNTIAFQDAAYHWARDHRVHHKYSETDADPHNATRGFFFSHVGWLLCK  188

Query  171  KHPDVLKKGATIDMSDLENDPIVVWQRRLYLLLVPTICFLFPVWVPCYFWKETLFNSWY-  229
            KHP+V  KG  +D+SDL  DPI+++Q++ Y++L+P  CF+ P  VP Y W E+  N+W+ 
Sbjct  189  KHPEVKAKGKGVDLSDLRADPILMFQKKYYMILMPIACFIIPTVVPMYAWGESFMNAWFV  248

Query  230  STLTRYALTLNGTWLVNSAAHIWGVKPYDKNIGPTENKGVAILAFGEGWHNYHHVFPWDY  289
            +T+ R+   LN TWLVNSAAH +G +PYDK I P+EN  VAILAFGEGWHNYHHVFPWDY
Sbjct  249  ATMFRWCFILNVTWLVNSAAHKFGGRPYDKFINPSENISVAILAFGEGWHNYHHVFPWDY  308

Query  290  KAAELGNYKFNFTTAFIDFCAWLGLAYDLKTVPVEAIKRRAIRTGDGTKYSKHDDSHHHM  349
            K AE G Y  NFTTAFIDF A +G AYDLKTV  + IK+R  RTGDGT  +         
Sbjct  309  KTAEFGKYSLNFTTAFIDFFAKIGWAYDLKTVSTDIIKKRVKRTGDGTHAT---------  359

Query  350  HVDMKWGWGDVDMKPEEIQEVDIINKRN  377
                 WGWGDVD   EEI++  I +K++
Sbjct  360  -----WGWGDVDQPKEEIEDAVITHKKS  382



Lambda      K        H
   0.324    0.138    0.456 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3617638992


Query= NP_001273373.1 acyl-CoA Delta(11) desaturase-like [Bombus
terrestris]

Length=322
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7K4Y0_DROME  unnamed protein product                                 202     3e-62
Q9U972_DROME  unnamed protein product                                 201     7e-62
Q94541_DROME  unnamed protein product                                 200     2e-61


>Q7K4Y0_DROME unnamed protein product
Length=383

 Score = 202 bits (515),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 103/289 (36%), Positives = 167/289 (58%), Gaps = 4/289 (1%)

Query  4    EKQPARKQEIIWAAILWYIYIHVLGIYAIWFLFTSAKWMTVIFTLFITILGCLGVTAGAH  63
            +K   R+ +++W  I+ + Y+H+  +Y  + + TSAKW T I   F+ ++  LG+TAGAH
Sbjct  61   KKAEKRRLKLVWRNIIAFGYLHLAALYGAYLMVTSAKWQTCILAYFLYVISGLGITAGAH  120

Query  64   RLWAHRTYEATGSLRLLLVLFHTIAGVGSIYDWVLYHRLHHKYYGTDKDPYNHKKGFFYS  123
            RLWAHR+Y+A   LR++LV+F+TIA   + Y W   HR+HHKY  TD DP+N  +GFF+S
Sbjct  121  RLWAHRSYKAKWPLRVILVIFNTIAFQDAAYHWARDHRVHHKYSETDADPHNATRGFFFS  180

Query  124  HYVANILSPSMDLEEIKREIDMRDIEQDGYVWFQKKFYWPLFIIFGLILPLNAPLEYWDE  183
            H    +     +++   + +D+ D+  D  + FQKK+Y  L  I   I+P   P+  W E
Sbjct  181  HVGWLLCKKHPEVKAKGKGVDLSDLRADPILMFQKKYYMILMPIACFIIPTVVPMYAWGE  240

Query  184  SMTESILITGVLRFAITVNVSWLVNSARLVWSMETQKL---PQDNISIYFLT-KSFWPMY  239
            S   +  +  + R+   +NV+WLVNSA   +          P +NIS+  L     W  Y
Sbjct  241  SFMNAWFVATMFRWCFILNVTWLVNSAAHKFGGRPYDKFINPSENISVAILAFGEGWHNY  300

Query  240  HYMVPWDWKCGEFGSYADGWATFFIKIWHELGYVTLLQTTDSEDVREML  288
            H++ PWD+K  EFG Y+  + T FI  + ++G+   L+T  ++ +++ +
Sbjct  301  HHVFPWDYKTAEFGKYSLNFTTAFIDFFAKIGWAYDLKTVSTDIIKKRV  349


>Q9U972_DROME unnamed protein product
Length=383

 Score = 201 bits (512),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 103/289 (36%), Positives = 166/289 (57%), Gaps = 4/289 (1%)

Query  4    EKQPARKQEIIWAAILWYIYIHVLGIYAIWFLFTSAKWMTVIFTLFITILGCLGVTAGAH  63
            +K   R+ +++W  I+ + Y H+  +Y  + + TSAKW T I   F+ ++  LG+TAGAH
Sbjct  61   KKAEKRRLKLVWRNIIVFGYFHLAALYGAYLMVTSAKWQTCILAYFLYVISGLGITAGAH  120

Query  64   RLWAHRTYEATGSLRLLLVLFHTIAGVGSIYDWVLYHRLHHKYYGTDKDPYNHKKGFFYS  123
            RLWAHR+Y+A   LR++LV+F+TIA   + Y W   HR+HHKY  TD DP+N  +GFF+S
Sbjct  121  RLWAHRSYKAKWPLRVILVIFNTIAFQDAAYHWARDHRVHHKYSETDADPHNATRGFFFS  180

Query  124  HYVANILSPSMDLEEIKREIDMRDIEQDGYVWFQKKFYWPLFIIFGLILPLNAPLEYWDE  183
            H    +     +++   + +D+ D+  D  + FQKK+Y  L  I   I+P   P+  W E
Sbjct  181  HVGWLLCKKHPEVKAKGKGVDLSDLRADPILMFQKKYYMILMPIACFIIPTVVPMYAWGE  240

Query  184  SMTESILITGVLRFAITVNVSWLVNSARLVWSMETQKL---PQDNISIYFLT-KSFWPMY  239
            S   +  +  + R+   +NV+WLVNSA   +          P +NIS+  L     W  Y
Sbjct  241  SFMNAWFVATMFRWCFILNVTWLVNSAAHKFGGRPYDKFINPSENISVAILAFGEGWHNY  300

Query  240  HYMVPWDWKCGEFGSYADGWATFFIKIWHELGYVTLLQTTDSEDVREML  288
            H++ PWD+K  EFG Y+  + T FI  + ++G+   L+T  ++ +++ +
Sbjct  301  HHVFPWDYKTAEFGKYSLNFTTAFIDFFAKIGWAYDLKTVSTDIIKKRV  349


>Q94541_DROME unnamed protein product
Length=383

 Score = 200 bits (509),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/289 (36%), Positives = 166/289 (57%), Gaps = 4/289 (1%)

Query  4    EKQPARKQEIIWAAILWYIYIHVLGIYAIWFLFTSAKWMTVIFTLFITILGCLGVTAGAH  63
            +K   R  +++W  I+ + Y+H+  +Y  + + TSAKW T I   F+ ++  LG+TAGAH
Sbjct  61   KKAEKRLLKLVWRNIIAFGYLHLAALYGAYLMVTSAKWQTCILAYFLYVISGLGITAGAH  120

Query  64   RLWAHRTYEATGSLRLLLVLFHTIAGVGSIYDWVLYHRLHHKYYGTDKDPYNHKKGFFYS  123
            RLWAHR+Y+A   LR++LV+F+TIA   + Y W   HR+HHKY  TD DP+N  +GFF+S
Sbjct  121  RLWAHRSYKAKWPLRVILVIFNTIAFQDAAYHWARDHRVHHKYSETDADPHNATRGFFFS  180

Query  124  HYVANILSPSMDLEEIKREIDMRDIEQDGYVWFQKKFYWPLFIIFGLILPLNAPLEYWDE  183
            H    +     +++   + +D+ D+  D  + FQKK+Y  L  I   I+P   P+  W E
Sbjct  181  HVGWLLCKKHPEVKAKGKGVDLSDLRADPILMFQKKYYMILMPIACFIIPTVVPMYAWGE  240

Query  184  SMTESILITGVLRFAITVNVSWLVNSARLVWSMETQKL---PQDNISIYFLT-KSFWPMY  239
            S   +  +  + R+   +NV+WLVNSA   +          P +NIS+  L     W  Y
Sbjct  241  SFMNAWFVATMFRWCFILNVTWLVNSAAHKFGGRPYDKFINPSENISVAILAFGEGWHNY  300

Query  240  HYMVPWDWKCGEFGSYADGWATFFIKIWHELGYVTLLQTTDSEDVREML  288
            H++ PWD+K  EFG Y+  + T FI  + ++G+   L+T  ++ +++ +
Sbjct  301  HHVFPWDYKTAEFGKYSLNFTTAFIDFFAKIGWAYDLKTVSTDIIKKRV  349



Lambda      K        H
   0.324    0.138    0.456 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3617638992


Query= NP_001274492.1 acyl-CoA Delta(11) desaturase-like [Bombus
terrestris]

Length=368
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q94541_DROME  unnamed protein product                                 374     2e-128
Q7K4Y0_DROME  unnamed protein product                                 372     8e-128
Q9U972_DROME  unnamed protein product                                 370     7e-127


>Q94541_DROME unnamed protein product
Length=383

 Score = 374 bits (959),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 176/335 (53%), Positives = 230/335 (69%), Gaps = 1/335 (0%)

Query  35   TDDYLAVDETYRSSKVEYVPRITWPDLIALIFVHVGCIYGLYLIFTEAKLLTTLWAFVVI  94
            TD  L  D T      + + ++ W ++IA  ++H+  +YG YL+ T AK  T + A+ + 
Sbjct  49   TDGGLVKDITVMKKAEKRLLKLVWRNIIAFGYLHLAALYGAYLMVTSAKWQTCILAYFLY  108

Query  95   YTSGFGITAGAHRLWSHRAYKAKWPLRFLLILLFTITGQKHVYAWALDHRVHHKYSETDA  154
              SG GITAGAHRLW+HR+YKAKWPLR +L++  TI  Q   Y WA DHRVHHKYSETDA
Sbjct  109  VISGLGITAGAHRLWAHRSYKAKWPLRVILVIFNTIAFQDAAYHWARDHRVHHKYSETDA  168

Query  155  DPHNAKRGFFFAHVGWLFTTPHPDVVAKRKAVDMSDLEADPLVMWQKRYYIPLFALLTIG  214
            DPHNA RGFFF+HVGWL    HP+V AK K VD+SDL ADP++M+QK+YY+ L  +    
Sbjct  169  DPHNATRGFFFSHVGWLLCKKHPEVKAKGKGVDLSDLRADPILMFQKKYYMILMPIACFI  228

Query  215  FPVGVPCYFWSESVWTSFWVNFNFRFCVTLNIAFFVNSVAHMWGQRPYDKYISPVENVVV  274
             P  VP Y W ES   +++V   FR+C  LN+ + VNS AH +G RPYDK+I+P EN+ V
Sbjct  229  IPTVVPMYAWGESFMNAWFVATMFRWCFILNVTWLVNSAAHKFGGRPYDKFINPSENISV  288

Query  275  SIAALGEGWHNFHHVFPWDYKTGELGNYTFNLTTGFIDAFAHIGWAYNRKYVSPAMVRRR  334
            +I A GEGWHN+HHVFPWDYKT E G Y+ N TT FID FA IGWAY+ K VS  ++++R
Sbjct  289  AILAFGEGWHNYHHVFPWDYKTAEFGKYSLNFTTAFIDFFAKIGWAYDLKTVSTDIIKKR  348

Query  335  AIRSGDGSH-VWGYGDADIPIEDLQELKQMDRKKE  368
              R+GDG+H  WG+GD D P E++++     +K E
Sbjct  349  VKRTGDGTHATWGWGDVDQPKEEIEDAVITHKKSE  383


>Q7K4Y0_DROME unnamed protein product
Length=383

 Score = 372 bits (955),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 176/335 (53%), Positives = 229/335 (68%), Gaps = 1/335 (0%)

Query  35   TDDYLAVDETYRSSKVEYVPRITWPDLIALIFVHVGCIYGLYLIFTEAKLLTTLWAFVVI  94
            TD  L  D T      +   ++ W ++IA  ++H+  +YG YL+ T AK  T + A+ + 
Sbjct  49   TDGGLVKDITVMKKAEKRRLKLVWRNIIAFGYLHLAALYGAYLMVTSAKWQTCILAYFLY  108

Query  95   YTSGFGITAGAHRLWSHRAYKAKWPLRFLLILLFTITGQKHVYAWALDHRVHHKYSETDA  154
              SG GITAGAHRLW+HR+YKAKWPLR +L++  TI  Q   Y WA DHRVHHKYSETDA
Sbjct  109  VISGLGITAGAHRLWAHRSYKAKWPLRVILVIFNTIAFQDAAYHWARDHRVHHKYSETDA  168

Query  155  DPHNAKRGFFFAHVGWLFTTPHPDVVAKRKAVDMSDLEADPLVMWQKRYYIPLFALLTIG  214
            DPHNA RGFFF+HVGWL    HP+V AK K VD+SDL ADP++M+QK+YY+ L  +    
Sbjct  169  DPHNATRGFFFSHVGWLLCKKHPEVKAKGKGVDLSDLRADPILMFQKKYYMILMPIACFI  228

Query  215  FPVGVPCYFWSESVWTSFWVNFNFRFCVTLNIAFFVNSVAHMWGQRPYDKYISPVENVVV  274
             P  VP Y W ES   +++V   FR+C  LN+ + VNS AH +G RPYDK+I+P EN+ V
Sbjct  229  IPTVVPMYAWGESFMNAWFVATMFRWCFILNVTWLVNSAAHKFGGRPYDKFINPSENISV  288

Query  275  SIAALGEGWHNFHHVFPWDYKTGELGNYTFNLTTGFIDAFAHIGWAYNRKYVSPAMVRRR  334
            +I A GEGWHN+HHVFPWDYKT E G Y+ N TT FID FA IGWAY+ K VS  ++++R
Sbjct  289  AILAFGEGWHNYHHVFPWDYKTAEFGKYSLNFTTAFIDFFAKIGWAYDLKTVSTDIIKKR  348

Query  335  AIRSGDGSH-VWGYGDADIPIEDLQELKQMDRKKE  368
              R+GDG+H  WG+GD D P E++++     +K E
Sbjct  349  VKRTGDGTHATWGWGDVDQPKEEIEDAVITHKKSE  383


>Q9U972_DROME unnamed protein product
Length=383

 Score = 370 bits (949),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 175/335 (52%), Positives = 227/335 (68%), Gaps = 1/335 (0%)

Query  35   TDDYLAVDETYRSSKVEYVPRITWPDLIALIFVHVGCIYGLYLIFTEAKLLTTLWAFVVI  94
            TD  L  D T      +   ++ W ++I   + H+  +YG YL+ T AK  T + A+ + 
Sbjct  49   TDGGLVKDITVMKKAEKRRLKLVWRNIIVFGYFHLAALYGAYLMVTSAKWQTCILAYFLY  108

Query  95   YTSGFGITAGAHRLWSHRAYKAKWPLRFLLILLFTITGQKHVYAWALDHRVHHKYSETDA  154
              SG GITAGAHRLW+HR+YKAKWPLR +L++  TI  Q   Y WA DHRVHHKYSETDA
Sbjct  109  VISGLGITAGAHRLWAHRSYKAKWPLRVILVIFNTIAFQDAAYHWARDHRVHHKYSETDA  168

Query  155  DPHNAKRGFFFAHVGWLFTTPHPDVVAKRKAVDMSDLEADPLVMWQKRYYIPLFALLTIG  214
            DPHNA RGFFF+HVGWL    HP+V AK K VD+SDL ADP++M+QK+YY+ L  +    
Sbjct  169  DPHNATRGFFFSHVGWLLCKKHPEVKAKGKGVDLSDLRADPILMFQKKYYMILMPIACFI  228

Query  215  FPVGVPCYFWSESVWTSFWVNFNFRFCVTLNIAFFVNSVAHMWGQRPYDKYISPVENVVV  274
             P  VP Y W ES   +++V   FR+C  LN+ + VNS AH +G RPYDK+I+P EN+ V
Sbjct  229  IPTVVPMYAWGESFMNAWFVATMFRWCFILNVTWLVNSAAHKFGGRPYDKFINPSENISV  288

Query  275  SIAALGEGWHNFHHVFPWDYKTGELGNYTFNLTTGFIDAFAHIGWAYNRKYVSPAMVRRR  334
            +I A GEGWHN+HHVFPWDYKT E G Y+ N TT FID FA IGWAY+ K VS  ++++R
Sbjct  289  AILAFGEGWHNYHHVFPWDYKTAEFGKYSLNFTTAFIDFFAKIGWAYDLKTVSTDIIKKR  348

Query  335  AIRSGDGSH-VWGYGDADIPIEDLQELKQMDRKKE  368
              R+GDG+H  WG+GD D P E++++     +K E
Sbjct  349  VKRTGDGTHATWGWGDVDQPKEEIEDAVITHKKSE  383



Lambda      K        H
   0.324    0.138    0.456 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3617638992


Query= NP_001274494.1 lipase member H-A-like precursor [Bombus terrestris]

Length=304
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7K3Z8_DROME  unnamed protein product                                 171     5e-51
Q9VX69_DROME  unnamed protein product                                 117     7e-30
Q8SXG0_DROME  unnamed protein product                                 117     7e-30


>Q7K3Z8_DROME unnamed protein product
Length=340

 Score = 171 bits (434),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 96/254 (38%), Positives = 149/254 (59%), Gaps = 25/254 (10%)

Query  72   RDSILYIHGFLENTEAENVRVIIRAYLDKGDVNVIVLDWGEIAFNINYVYVS-SQVVTIA  130
            ++++LY+HG+LE+ + E++ VI  AYL++ D N+IVLDWGE+A + NY++ +   +  + 
Sbjct  59   KNTVLYLHGYLEDPDVESIHVIAEAYLERKDTNLIVLDWGELA-DGNYMFDAFPNLKQLG  117

Query  131  KAVAESLKKLVDL-IDLDTLHVIGHSLGAHIAGNIGRYANI------NLSRITGLDPALP  183
              +A+ L K+ D  +D++  H++GHS+G  +AG +GR           + RI+ LDPA P
Sbjct  118  PELAKVLLKMFDHGLDIEKFHIVGHSMGGQLAGLLGREITKRTKGVRKIKRISALDPAFP  177

Query  184  LFYPSTCHVRSTDAEAVVILHTDGGFYGTATNTGTIDFYVNGGSSVQPGCP-----IIFG  238
            LFYP T H+ + DAE V ++HTD   YG  T+TGT DF+ NGG S+QPGCP     ++  
Sbjct  178  LFYPGT-HLSANDAEFVDVIHTDAWLYGAPTSTGTADFWPNGGYSLQPGCPKRNYKMLSD  236

Query  239  GEFCSHQRSTRIYAESLLNP-----KAFPAHKC----LNEIADT-EEVYFGDSTPKDIYG  288
             +  SH+RS   +AES+ +       A PA K      N+I +    V  G   P  I+G
Sbjct  237  NDLSSHRRSWWFWAESVSDRYPIGFDAVPAKKWSDFKQNKIVENCPPVVMGHHCPTTIHG  296

Query  289  TYCFNTNAKPPYGK  302
             +   TN   P+ +
Sbjct  297  DFYLQTNGHTPFAR  310


>Q9VX69_DROME unnamed protein product
Length=411

 Score = 117 bits (293),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 75/229 (33%), Positives = 121/229 (53%), Gaps = 19/229 (8%)

Query  87   AENVRVIIRAYLDKGDVNVIVLDWGEIAFNINYVYVSSQVVTIAKAVAESLKKLVDLIDL  146
            ++ + V  +AY  +GDVN + +D       + Y + +     I + +A  L KL+DL+ +
Sbjct  147  SDTIEVFSKAYNCRGDVNFVAVDAARFVDTL-YTWSAFNTEEIGENIALGLVKLLDLVPV  205

Query  147  DTLHVIGHSLGAHIAGNIGRY----ANINLSRITGLDPALPLFY--PSTCHVRSTDAEAV  200
            + +H+IGHSLGAHI G+ GR+     N  + RITGLDPA P F    +   +   DA  V
Sbjct  206  ENIHLIGHSLGAHIVGSAGRHLQHLTNQTIPRITGLDPAKPCFNEGEALSGLMRGDAHFV  265

Query  201  VILHTDGGFYGTATNTGTIDFYVNGGSSVQPGCPIIFGGEFCSHQRSTRIYAESLL--NP  258
             ++H++ G  G     G +DFY  G S +  GC  +     C+H RS   +AE++   N 
Sbjct  266  DVIHSNPGVLGKRDPVGDVDFYPGGMSPLAAGCFSV----TCAHARSWEYFAETVFPGNE  321

Query  259  KAFPAHKC--LNEIAD----TEEVYFGDSTPKDIYGTYCFNTNAKPPYG  301
            + F A +C  ++++ D     +EV  G + P++I G Y    +A  P+G
Sbjct  322  RNFMATRCNSISKLRDFRCPGDEVPMGYAVPQNIKGNYFLEVSASAPFG  370


>Q8SXG0_DROME unnamed protein product
Length=411

 Score = 117 bits (293),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 75/229 (33%), Positives = 121/229 (53%), Gaps = 19/229 (8%)

Query  87   AENVRVIIRAYLDKGDVNVIVLDWGEIAFNINYVYVSSQVVTIAKAVAESLKKLVDLIDL  146
            ++ + V  +AY  +GDVN + +D       + Y + +     I + +A  L KL+DL+ +
Sbjct  147  SDTIEVFSKAYNCRGDVNFVAVDAARFVDTL-YTWSAFNTEEIGENIALGLVKLLDLVPV  205

Query  147  DTLHVIGHSLGAHIAGNIGRY----ANINLSRITGLDPALPLFY--PSTCHVRSTDAEAV  200
            + +H+IGHSLGAHI G+ GR+     N  + RITGLDPA P F    +   +   DA  V
Sbjct  206  ENIHLIGHSLGAHIVGSAGRHLQHLTNQTIPRITGLDPAKPCFNEGEALSGLMRGDAHFV  265

Query  201  VILHTDGGFYGTATNTGTIDFYVNGGSSVQPGCPIIFGGEFCSHQRSTRIYAESLL--NP  258
             ++H++ G  G     G +DFY  G S +  GC  +     C+H RS   +AE++   N 
Sbjct  266  DVIHSNPGVLGKRDPVGDVDFYPGGMSPLAAGCFSV----TCAHARSWEYFAETVFPGNE  321

Query  259  KAFPAHKC--LNEIAD----TEEVYFGDSTPKDIYGTYCFNTNAKPPYG  301
            + F A +C  ++++ D     +EV  G + P++I G Y    +A  P+G
Sbjct  322  RNFMATRCNSISKLRDFRCPGDEVPMGYAVPQNIKGNYFLEVSASAPFG  370



Lambda      K        H
   0.324    0.138    0.456 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3617638992


Query= NP_001291369.1 allatotropin receptor precursor [Bombus terrestris]

Length=440
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

QRFPR_BRAFL  unnamed protein product                                  158     5e-44
SIFAR_DROME  unnamed protein product                                  164     7e-44
Q86RL0_DROME  unnamed protein product                                 158     4e-43


>QRFPR_BRAFL unnamed protein product
Length=380

 Score = 158 bits (399),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 102/310 (33%), Positives = 163/310 (53%), Gaps = 19/310 (6%)

Query  74   VLIASHSVVFVVGLVGNALVCIAVYRNHSMRTVTNYFIVNLAVADFLVLLLCLPFTVLWD  133
            V +  + ++F+  L+GN LV + V++N  MRT  N FI +LA +D L+ ++C+P T++ +
Sbjct  49   VTLVFYVIIFLAALLGNTLVVVVVWKNKVMRTTMNIFICSLAASDLLITIVCIPVTLMQN  108

Query  134  ITETWFLGLTLCKAVPYLQTVSVTVSILTLTFISIDRWYAICFPLRFKSTTGRAKSAII-  192
            + + W +G  +CK VP++QT++V  SILTLT I+I+R+YAI  PL+ K    + ++ II 
Sbjct  109  MLQNWIMGDFMCKLVPFIQTIAVASSILTLTGIAIERYYAIIHPLKVKYLLSKTRAGIIL  168

Query  193  -GIWAAALLFDIPDLVVLHTVPPTHIKIKTVLFTQCDIS-WSQRSQVAFTIVKLIFLYTG  250
              +W  ++    P L V H     H  +    F  C    W Q  Q ++TI  L+ L+  
Sbjct  169  ALVWVVSVGVATPMLFV-HKAEEIHDFLYEQRFVTCQEKWWGQTQQTSYTIFNLVVLFII  227

Query  251  PLIFMSVAYWQIVKVLWRSNIPGHNLPSRASQMSQIPSTGGGNPEVQLRSRRKAAKMLVT  310
            PL+ M+  Y +I   LW     G               TG       +R +R+A KMLV 
Sbjct  228  PLLTMTSLYIRIAHRLWVQQPVG--------------VTGNFAHGNSVRRKRQAVKMLVV  273

Query  311  VVITFAICYFPVHLLSVLRYTTTLP-SNKWINAISLIAHGLCYFNSAVNPLIYNFMSGKF  369
            VV+ FA+C+ P H ++V+   T L    K    +  I   + + NS  NP++Y  ++  F
Sbjct  274  VVLLFAVCWLPYHTVTVMNELTGLRLEEKSAKLLIAIVQLIAFSNSFNNPVVYAILNENF  333

Query  370  RKAFRRTFRC  379
            +K F    RC
Sbjct  334  KKNFMTMLRC  343


>SIFAR_DROME unnamed protein product
Length=758

 Score = 164 bits (414),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 115/335 (34%), Positives = 187/335 (56%), Gaps = 34/335 (10%)

Query  57   EYVDRMINYIFPKFWDWVLIAS------HSVVFVVGLVGNALVCIAVYRNHSMRTVTNYF  110
            E +D  +++ F   +   L  S      + VVF+VGL+GN+ V   V R   MRTVTNYF
Sbjct  187  EQLDGSVDFGFDPLYRHSLAMSMVYCVAYIVVFLVGLIGNSFVIAVVLRAPRMRTVTNYF  246

Query  111  IVNLAVADFLVLLLCLPFTVLWDITETWFLGLTLCKAVPYLQTVSVTVSILTLTFISIDR  170
            IVNLA+AD LV++ CLP T++ +I   W LG  +CK VPY+Q VSV  S+ +L  +S+DR
Sbjct  247  IVNLAIADILVIVFCLPATLIGNIFVPWMLGWLMCKFVPYIQGVSVAASVYSLIAVSLDR  306

Query  171  WYAICFPLRFKSTTGRAKSAIIGIWAAALLFDIPDLVVLHTVPPTHIKIKTVL--FTQ--  226
            + AI +PL+ + T  RA+  IIGIW  AL+  IP L+    VP   +    ++  ++Q  
Sbjct  307  FIAIWWPLK-QMTKRRARIMIIGIWVIALVTTIPWLLFFDLVPAEEVFSDALVSAYSQPQ  365

Query  227  --CDISW--SQRSQVAFTIVKLIFLYTGPLIFMSVAYWQI-VKVLWRSNIPGHNLPSRAS  281
              C   W       + F +  L+  Y  P+  +++ Y  I +KV  RS IPG    S+ +
Sbjct  366  FLCQEVWPPGTDGNLYFLLANLVACYLLPMSLITLCYVLIWIKVSTRS-IPGE---SKDA  421

Query  282  QMSQIPSTGGGNPEVQLRSRRKAAKMLVTVVITFAICYFPVHLL-SVLRYTTTLPSNKW-  339
            QM ++          Q +S+ K  KMLV VVI F + + P++++ + +++ + +   ++ 
Sbjct  422  QMDRM----------QQKSKVKVIKMLVAVVILFVLSWLPLYVIFARIKFGSDISQEEFE  471

Query  340  -INAISLIAHGLCYFNSAVNPLIYNFMSGKFRKAF  373
             +  +  +A  L   NS +NP++Y+ ++ K+R+ F
Sbjct  472  ILKKVMPVAQWLGSSNSCINPILYS-VNKKYRRGF  505


>Q86RL0_DROME unnamed protein product
Length=471

 Score = 158 bits (399),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 112/338 (33%), Positives = 175/338 (52%), Gaps = 43/338 (13%)

Query  81   VVFVVGLVGNALVCIAVYRNHSMRTVTNYFIVNLAVADFLVLLLCLPFTVLWDIT---ET  137
            V+ ++G+VGN +V I + +   MR  TN F+ NL++AD LVLL+C P TVL ++    ET
Sbjct  19   VIMLLGVVGNVMVPIVIVKTKDMRNSTNIFLTNLSIADLLVLLVCTP-TVLVEVNTRPET  77

Query  138  WFLGLTLCKAVPYLQTVSVTVSILTLTFISIDRWYAICFPLR--FKSTTGRAKSAIIGIW  195
            W LG  +CKAVP+++      S+LT+  IS +R+YAIC PL+  +  T GRA    +  W
Sbjct  78   WVLGHEMCKAVPFVELTVAHASVLTILAISFERYYAICEPLKAGYVCTKGRAILICVLAW  137

Query  196  AAALLFDIPDLVVLHTVPPTHIKIKT--VLFTQCDISWSQRSQVAFTIVKLIFLYTGPLI  253
              A LF  P L V       +I   +  V  TQ    W+    +AF ++ +   +  P +
Sbjct  138  GIAALFTSPILWVAEYKLAEYIDGSSVAVCLTQAISDWT----LAFFLMTISVFFVVPFV  193

Query  254  FMSVAYWQIVKVLWRSNIPGHNLPSRASQMSQIPSTGGGNPEVQLRSRRKAAKMLVTVVI  313
             + V Y  I + L         + +RA+ +   P+     PE+ L++R++   ML  VV+
Sbjct  194  TLVVLYGIIARNL---------VSNRAAMLRARPT----KPELSLKARKQVVLMLGAVVL  240

Query  314  TFAICYFPVHLLS---VLRYTTTLPSNKWINAISLI--AHGLCYFNSAVNPLIYNFMSGK  368
            +F +C  P  +L+   +L    TL     +   SL+     + Y NSA+NP++YN MS K
Sbjct  241  SFFVCLLPFRVLTLWIILSTDQTLHDLGLVRYYSLLYFCRIMLYLNSAMNPILYNLMSTK  300

Query  369  FRKAFRR-------------TFRCARENGSRIQRGYLA  393
            FR+ F+R             T    +E+ SR +RG L+
Sbjct  301  FRRGFKRLCQDAGRLLLELVTLGRRKEDSSRGRRGTLS  338



Lambda      K        H
   0.324    0.138    0.456 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3617638992


Query= NP_001295235.1 3-hydroxy-3-methylglutaryl-coenzyme A reductase
[Bombus terrestris]

Length=910
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

HMDH_DROME  unnamed protein product                                   860     0.0   
Q9Y0F3_LEIMA  unnamed protein product                                 422     1e-139
Q587C0_TRYB2  unnamed protein product                                 393     3e-128


>HMDH_DROME unnamed protein product
Length=920

 Score = 860 bits (2221),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 472/935 (50%), Positives = 618/935 (66%), Gaps = 72/935 (8%)

Query  1    MLTHLFEIHGQFCAGHPLEVIVTTFTLTACILN------METGSG---------------  39
            M+  LF  HG+FCA HP EVIV   T+TAC+L       ++  SG               
Sbjct  1    MIGRLFRAHGEFCASHPWEVIVALLTITACMLTVDKNNTLDASSGLGTATASAAAAGGSG  60

Query  40   -----------HPRNSGTLPLALHCRP--GRCNSDD-----LNAADIIVMTIIRCLAILF  81
                        P + G    +   RP  G   S D      NAAD+I+MTI+RC A+L+
Sbjct  61   SGAGSGASGTIPPSSMGGSATSSRHRPCHGWSQSCDGLEAEYNAADVILMTIVRCTAVLY  120

Query  82   TYHQFRNLQKLGSKYILGIAGLFTVFSSVVFTSSVVNFGQSDISDLKDALFFFLLIIDLS  141
             Y+QF +L +LGSKY+LGIAGLFTVFSS +FT++++ F  SDIS+LKDALFF LL+IDLS
Sbjct  121  CYYQFCSLHRLGSKYVLGIAGLFTVFSSFIFTTAIIKFLGSDISELKDALFFLLLVIDLS  180

Query  142  KAAILAQLALSSRNKEEVRANIARGMSLLGPTITLDTLVETLLISIGSLSGVKRLEILSS  201
             +  LAQLALS  N+ EV  NIARG+ LLGP I+LDT+VE LL+ +G+LSGV+RLE+L  
Sbjct  181  NSGRLAQLALSGSNQAEVTQNIARGLELLGPAISLDTIVEVLLVGVGTLSGVQRLEVLCM  240

Query  202  FACLGVIVNYIVFMTFYPACLSLILELSRETNAMKPL--SADKIFIMHPLNEEDQKPNPV  259
            FA L V+VNY+VFMTFYPACLSLI +LSR    M  +   A    ++  L EE+QK NPV
Sbjct  241  FAVLSVLVNYVVFMTFYPACLSLIFDLSRSGVDMSVVREKAKGSLLLKSLTEEEQKANPV  300

Query  260  VERVKLIMIAGLFVVHANSRWPFKSDESDSAVEGEVSSVNSHVIVNSYNKTENSSEVKNY  319
            ++RVKLIM  GL  VH  SR  F   + D+  +    +++ +V   S N+TE S E+ + 
Sbjct  301  LQRVKLIMTTGLMAVHIYSRVAFSGSDYDAVDKTLTPTLSLNV---SNNRTE-SGEIADI  356

Query  320  LMNWLSVSADNIVILILLLALAVKFIFFEDKGDIAKQLRSKEEDDTEEKVENESVKGKEN  379
            ++ WL++SAD+IVI I+L+AL VKFI F+++  +  QLR         K    +   +E+
Sbjct  357  IIKWLTMSADHIVISIVLIALVVKFICFDNRDPLPDQLRQSGPVAIAAKASQTTPIDEEH  416

Query  380  ESEDVNVLSIKLPFKQNFSGMQSISFPSKIHNWSDDKEDQTIG--EKQCDIDKRDDKNLP  437
              ++ +         +N + ++++ F           EDQ+      Q D+     + + 
Sbjct  417  VEQEKDT--------ENSAAVRTLLF---------TIEDQSSANASTQTDLLPLRHRLVG  459

Query  438  PESKVPRSLKECLEIYKSD---LGASALTDEEIIQLVK--NKHIPAYQLEKAVGDMERGV  492
            P  K PR ++ECL+I  S     G +AL+DEEI+ +V     H P +++E  + D ERGV
Sbjct  460  P-IKPPRPVQECLDILNSTEEGSGPAALSDEEIVSIVHAGGTHCPLHKIESVLDDPERGV  518

Query  493  GIRRLIIGETGKFLDTLFD-LPYKNYDYSKVLGSCCENVIGYVPVPLGIAGPLLVDGELY  551
             IRR IIG   K      D LPY+++DY KVL +CCENV+GYVP+P+G AGPLL+DGE Y
Sbjct  519  RIRRQIIGSRAKMPVGRLDVLPYEHFDYRKVLNACCENVLGYVPIPVGYAGPLLLDGETY  578

Query  552  HIPMATTEGCLVASTNRGSRALLNCGVTSRVVADGMTRGPVVRFPNIVRASEAMAWMQDP  611
            ++PMATTEG LVASTNRG +AL   GV S V   GMTR P VRFP++ RA+EA +W+++ 
Sbjct  579  YVPMATTEGALVASTNRGCKALSVRGVRSVVEDVGMTRAPCVRFPSVARAAEAKSWIEND  638

Query  612  ENFKEMKENFDLTSRFARLTKIHIRIAGRHLFIRFVATTGDAMGMNMLSKGTEKSLNTVK  671
            EN++ +K  FD TSRF RL   HI + G  L+IRFVA TGDAMGMNM+SKG E +L  ++
Sbjct  639  ENYRVVKTEFDSTSRFGRLKDCHIAMDGPQLYIRFVAITGDAMGMNMVSKGAEMALRRIQ  698

Query  672  EHFPDMEILSLSGNFCTDKKPAAVNWIQGRGKSVVCEAVVPADIVTNVLKTSVHALVDVN  731
              FPDM+I+SLSGNFC DKKPAA+NWI+GRGK VV E  + A  + +VLKT    LV+ N
Sbjct  699  LQFPDMQIISLSGNFCCDKKPAAINWIKGRGKRVVTECTISAATLRSVLKTDAKTLVECN  758

Query  732  ISKNMIGSAIAGSVGGFNAHAANIVTAIFIATGQDPAQNVGSSNCMTLMEPWGADGSDLY  791
              KNM GSA+AGS+GG NAHAAN+VTA+F+ATGQDPAQNV SSNC T ME W  +  DLY
Sbjct  759  KLKNMGGSAMAGSIGGNNAHAANMVTAVFLATGQDPAQNVTSSNCSTAMECWAENSEDLY  818

Query  792  VSCTMPSIEIGTIGGGTGLPAQGACLAMLGVQGAHTDEPGENASRLARIICATVLAGELS  851
            ++CTMPS+E+GT+GGGTGLP Q ACL MLGV+GAH   PG+NA +LA+I+CATV+AGELS
Sbjct  819  MTCTMPSLEVGTVGGGTGLPGQSACLEMLGVRGAHATRPGDNAKKLAQIVCATVMAGELS  878

Query  852  LMAALTAGHLVKSHLRHNRSSTAVTNAISIPQNTT  886
            LMAAL    LVKSH+RHNRSS AV N+ + P N T
Sbjct  879  LMAALVNSDLVKSHMRHNRSSIAV-NSANNPLNVT  912


>Q9Y0F3_LEIMA unnamed protein product
Length=434

 Score = 422 bits (1086),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 205/417 (49%), Positives = 303/417 (73%), Gaps = 11/417 (3%)

Query  460  SALTDEEIIQLVKNKHIPAYQLEKAVG-DMERGVGIRRLIIGE----TGKFLDTLFDLPY  514
            ++++D EI++ V+NK I  + LE+A+  D +R + IRR I+ +    +      L  +PY
Sbjct  18   ASMSDTEIMKQVENKKIAFHGLEQALAPDYDRAIAIRREIVKKKICPSPAATHPLERVPY  77

Query  515  KNYDYSKVLGSCCENVIGYVPVPLGIAGPLLVDGELYHIPMATTEGCLVASTNRGSRAL-  573
            KNYD+S V+G  CEN++GYVPVP+G+AGPLL+DG+   +PMATTEG LVAS +RG+RA+ 
Sbjct  78   KNYDWSSVVGQSCENILGYVPVPVGLAGPLLLDGKEVALPMATTEGALVASAHRGARAIN  137

Query  574  LNCGVTSRVVADGMTRGPVVRFPNIVRASEAMAWMQDPENFKEMKENFDLTSRFARLTKI  633
            L+ G  + V+ +GMTR PVV   +   A   + + +  E F  ++E F+ T+RF +L  I
Sbjct  138  LSGGCRTAVLKEGMTRAPVVEVNSFDEAITVIKFCE--ERFDVLREAFESTTRFGKLLSI  195

Query  634  HIRIAGRHLFIRFVATTGDAMGMNMLSKGTEKSLNTVKEHFPDMEILSLSGNFCTDKKPA  693
               +AGR + +RF A TGDAMGMNM++KG +K+L  +++H P + +L+LSGNFCTDKKP+
Sbjct  196  KCAMAGRQVHLRFSAFTGDAMGMNMITKGCDKALQVLQQHIPSVRVLTLSGNFCTDKKPS  255

Query  694  AVNWIQGRGKSVVCEAVVPADIVTNVLKTSVHALVDVNISKNMIGSAIAGSVGGFNAHAA  753
            A+NW++GRGKSVV EAV+  D+V +VLK +V ++V +N++KN+ GSA+AGS+GGFNAHAA
Sbjct  256  ALNWVEGRGKSVVAEAVIKRDVVESVLKCTVDSVVSLNVTKNLRGSALAGSIGGFNAHAA  315

Query  754  NIVTAIFIATGQDPAQNVGSSNCMTLMEPWGADGSDLYVSCTMPSIEIGTIGGGTGLPAQ  813
            NIV A++IATGQDPAQ V S+ CMT ++     G DL +S  MPSIE+G +GGGTGL +Q
Sbjct  316  NIVAALYIATGQDPAQVVESATCMTTVDK---AGEDLVISLMMPSIEVGAVGGGTGLSSQ  372

Query  814  GACLAMLGVQGAHTDEPGENASRLARIICATVLAGELSLMAALTAGHLVKSHLRHNR  870
             A L ++G  G++ ++PG ++ ++AR++   V+ GELSL++ L AGHL+ +H++ NR
Sbjct  373  RAMLELMGCAGSNKEDPGAHSRQIARVVAGAVICGELSLLSGLAAGHLLSAHMKLNR  429


>Q587C0_TRYB2 unnamed protein product
Length=434

 Score = 393 bits (1009),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 210/422 (50%), Positives = 300/422 (71%), Gaps = 14/422 (3%)

Query  458  GASALTDEEIIQLVKNKHIPAYQLEKAVG-DMERGVGIRRLIIGE-------TGKFLDTL  509
            G  A+++ E+++ V ++ +  Y LE+A+  D +R + +RR ++ +             +L
Sbjct  16   GWGAMSNAELVKAVSSRQLTFYGLEQALEPDYQRAIAVRREVVSDYVASSQSAEVKRKSL  75

Query  510  FDLPYKNYDYSKVLGSCCENVIGYVPVPLGIAGPLLVDGELYHIPMATTEGCLVASTNRG  569
              +P++NY++ +V+G  CEN++GYVP+PLG+AGP+++DG  Y IPMATTEG LVAST+RG
Sbjct  76   ERIPFENYEWDRVVGQNCENIVGYVPIPLGMAGPIIMDGCEYPIPMATTEGALVASTHRG  135

Query  570  SRALLNCG-VTSRVVADGMTRGPVVRFPNIVRASEAMAWMQDPENFKEMKENFDLTSRFA  628
            +RA+   G   + ++ +GM+R PVV   ++  A     +    ENF E+K  F+ T+RF 
Sbjct  136  ARAISQSGGCKTLILGEGMSRAPVVEVESLEEAGRLHNFC--VENFTEIKAAFESTTRFG  193

Query  629  RLTKIHIRIAGRHLFIRFVATTGDAMGMNMLSKGTEKSLNTVKEHFPDMEILSLSGNFCT  688
            +L  +   I GR  +IRF ATTGDAMGMNM++KG +K+L  +K++FP M++++LSGN+CT
Sbjct  194  KLQSLKCVIIGRKAYIRFRATTGDAMGMNMITKGVDKALELIKQNFPSMKVIALSGNYCT  253

Query  689  DKKPAAVNWIQGRGKSVVCEAVVPADIVTNVLKTSVHALVDVNISKNMIGSAIAGSVGGF  748
            DKKP+AVNWI+GRGK+VV EA+V  ++V   LK +V  LV +NI KN++GSA+AGSVGGF
Sbjct  254  DKKPSAVNWIEGRGKTVVAEALVRGELVERTLKCTVEDLVSLNIDKNLVGSAVAGSVGGF  313

Query  749  NAHAANIVTAIFIATGQDPAQNVGSSNCMTLMEPWGADGSDLYVSCTMPSIEIGTIGGGT  808
            NA AAN+V AIFIATGQDPAQ V SS C+T M      G+DL +S  MPSIE+GT+GGGT
Sbjct  314  NAQAANVVAAIFIATGQDPAQVVESSTCITTMSKV---GNDLLISVAMPSIEVGTVGGGT  370

Query  809  GLPAQGACLAMLGVQGAHTDEPGENASRLARIICATVLAGELSLMAALTAGHLVKSHLRH  868
            GLPAQ  CL M+G  G++ + PG NA  L+R++ A VL+ ELSLM+ L AGHL+ +H+R 
Sbjct  371  GLPAQSGCLDMIGCAGSNKEAPGANAQLLSRLVAAGVLSAELSLMSGLAAGHLLSAHMRL  430

Query  869  NR  870
            NR
Sbjct  431  NR  432



Lambda      K        H
   0.324    0.138    0.456 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3617638992


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jan 6, 2022  5:12 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= NP_001295236.1 hydroxymethylglutaryl-CoA synthase 1 [Bombus
terrestris]

Length=453
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q57YL2_TRYB2  unnamed protein product                                 81.3    3e-16
O77289_DROME  unnamed protein product                                 30.0    5.5  
O01737_CAEEL  unnamed protein product                                 29.6    6.5  


>Q57YL2_TRYB2 unnamed protein product
Length=499

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 76/274 (28%), Positives = 115/274 (42%), Gaps = 34/274 (12%)

Query  6    VGIKAIEIYFPAQYVEQTELEQFDGVSAGKYTIGLGQCRMGFCNDREDINSLCLTVVHRL  65
             GI  + +Y P   V   E   + G    K +  +G       ++ E+  ++  + V RL
Sbjct  9    AGISGMSVYTPPCRVALKEWCNWTGNDWKKVSNVVGDS-FRVPSNNENAYTMAASAVLRL  67

Query  66   MDRYEIKPQDIGRLEVGTETILDKSKS-------VKSILMQLFEPYDCTDIEGADTTNAC  118
            +  YE+ P  +G L  GTE+  D S         V   L +L  P      E  +  +AC
Sbjct  68   ILNYEVDPSRVGFLGFGTESSSDNSAGAVIVRGMVDKALKELGMPALSRHCEVPEFKHAC  127

Query  119  YGGTAALLNAISWVESSAWDGRLALVVAGDNAVYSSGS-ARPTGGAGAVAMLIGPNAPLI  177
             GG  AL  A  + E    D +LA+VVA D A Y+ GS    T GAG+VAML+    P +
Sbjct  128  LGGVYALKGAARYAEVDGGDDKLAIVVASDIAEYALGSTGEQTQGAGSVAMLV-QKTPRL  186

Query  178  IDRGVRSSCMKHAY---DFYKPNLK---------------SEYPIVDGKLSVQCYLNALD  219
            ++   +++     Y   DF KP  +                ++P+  G  S   YL+ + 
Sbjct  187  LELNTKAAGSASDYRGPDFRKPYRRHFIKEYGSTAENGKIPDFPVFSGPYSTLVYLDEVT  246

Query  220  TCYQTYCKKMRSKHNHNVT--LDSFNAFLFHSPY  251
               +     M S+ N       DS +A  FH PY
Sbjct  247  AAVEN----MLSRLNQEPADYYDSVSALFFHRPY  276


>O77289_DROME unnamed protein product
Length=1021

 Score = 30.0 bits (66),  Expect = 5.5, Method: Compositional matrix adjust.
 Identities = 21/95 (22%), Positives = 42/95 (44%), Gaps = 11/95 (12%)

Query  188  KHAYDFYKPNLKSEYPIVDGKLSVQCYLNALDTCYQTYCKKMRS--KHNHNVTLDSFNAF  245
            +  +D  K N KS        L + C + ++ + + +     R   K   N+  DS+   
Sbjct  236  RREFDVSKVNPKS--------LPLHCVVESVHSLHASLTIDTRQPWKRRPNIETDSYVII  287

Query  246  LFHSPYCKLVQKSFARLAFI-DFLNTSKEEVSKKH  279
               +P+ ++VQ +  RL +  +  NT++  +  KH
Sbjct  288  AAXTPWSEIVQTALQRLGYSQEVANTARGSLIIKH  322


>O01737_CAEEL unnamed protein product
Length=1866

 Score = 29.6 bits (65),  Expect = 6.5, Method: Compositional matrix adjust.
 Identities = 39/173 (23%), Positives = 69/173 (40%), Gaps = 24/173 (14%)

Query  213   CYLNALDTCYQTYCKKMRSKHNHNVTLDSFNAFLFHSPYCKLVQKSFARLAFIDFLNTSK  272
             C    +DTC Q   + +++K    + L S       S   + +++    L   +F++T+K
Sbjct  982   CIAAKVDTCVQLSREAIKAKKCVVIGLQSTG----ESATLETLEEMGGELN--EFVSTAK  1035

Query  273   EE----VSKKHPELAQFHDVKLEDTYFNRDIEKSFMNLSKPNFQQKTQPSLMIANQVGNM  328
                   + K  P  A F       +  +RDI K F +  +P  ++KT+ +L     VG  
Sbjct  1036  TVLYGLIDKHFPTDASF-------SMGDRDIFKDFDDFERPAKRRKTRETLSFLGDVGFD  1088

Query  329   YTPSVYTGLASLLISKPIKELAGSKVGVFSYGSGLCSTMYSLTITNECNEKSN  381
                 V TG+   +     K +           SG+  +  S +  N  NE +N
Sbjct  1089  TWTGVTTGMGGRVGDGVTKNITRGL-------SGIGRSSMSSSTGNTNNEDAN  1134



Lambda      K        H
   0.318    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5035546020


Query= NP_001318040.1 vitellogenin-like precursor [Bombus terrestris]

Length=1523
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VF24_DROME  unnamed protein product                                 203     2e-52
VIT6_CAEEL  unnamed protein product                                   86.7    1e-16
CLOT_PENMO  unnamed protein product                                   46.2    3e-04


>Q9VF24_DROME unnamed protein product
Length=1470

 Score = 203 bits (517),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 209/901 (23%), Positives = 391/901 (43%), Gaps = 84/901 (9%)

Query  121  PFLVIYEENGHLEGVKFAEDEPGWSKNVKKGIVSMLQLDLDQMHVQSPIKAHSFISQEVT  180
            PF +   ++G +  V F E +P WS N K+ I S+LQ  +          + +F+  E+ 
Sbjct  104  PFKIALTKDGAISHVVFKEGDPIWSMNFKRAIASVLQFQMK--------SSGAFVVDELG  155

Query  181  IHGNCEVAYNVQPMDEMQATSGKELVVTKFYDSMNCSHFK---YHEFNHVECHKCQIHER  237
            IHG C   Y V       +     + + K  +   C  +    +   ++V  + C+   +
Sbjct  156  IHGTCRTEYFV-------SNRTNYISIRKTPEVKTCKPYSEAVHTTRSNVPPNTCEFDHQ  208

Query  238  NDMSTASRRVIVIDNHDNEILIKKLIGHA----VINYFPWLAASEAHYLLTNQTLFLEKV  293
              +   +  +  +  H NE      + HA    +I+ F   +  EA ++ +   L     
Sbjct  209  KSVIIGNEAIYGMSPH-NETGYYLSMAHAKGTTLIHTFE--STGEAQFINSELLLNFLNE  265

Query  294  VPVSDIQLMGFKHLIVSPIEKVIYDEPKTPYVPEADI-DVTGHRHVVKLDELVVKMKKML  352
             P+ +             IE  +  EP    +   D  D TG R   + + L+ +   +L
Sbjct  266  TPIDN----------PIDIETSMAAEPSNLELQRLDPNDPTGGRSPQQQETLIAQAGTLL  315

Query  353  DEVAGYLKETHVDKKQIDWKHDQTINRILHVMSYMNVASLNKVFSEIEDIKDAKVEAVRN  412
            D +A  L+ T     +    +D T++ ++ ++S M+  SL K++ E++     + E +RN
Sbjct  316  DSLAEALETTEF---KFSEPYDSTLSDVIKLLSEMDFDSLTKLYREVDIGTSYRQETIRN  372

Query  413  IFLTMVSHVGTPAACLFTRNVVRTKSVPNWVAVTMLANLPMHVKVSSKELLLQMEELLNL  472
            IF  ++  +GT A+   T ++V  K     +AV +L  +P H+   S EL+ + E+ LN+
Sbjct  373  IFHEIIPRIGTKASVFLTHHLVLNKLTKPQIAVQLLIPMPFHIFELSAELVQKCEDFLNI  432

Query  473  GEFVSPSVREAGIFCFATLIHKTFKKEQTEVVDPLIERYLRHFMDHVRNEPMFHMKMVYM  532
            G    P VR+A I  FATLIH  +  +  +      E Y++ + +   ++  F  KM+Y+
Sbjct  433  GP-DRPDVRQAAILSFATLIHNVYVAKGID--KEKFEEYVQKYFNAYLSDRDFDQKMLYL  489

Query  533  MAMKNVRSKHVLKHLEPIIKGEEIVSEKPHNIRVQAIW-ILKNINVHSNYIHDILWPVLS  591
              + N++  +V  +LEPI++       +  +++ QA W  L   +  +  I+++ WP+  
Sbjct  490  QGLNNLQLGNVANYLEPIVQD----PNEHEDLKFQAAWTTLALADRRAERIYEVYWPIFE  545

Query  592  DVSLPSAVRIAAFNVLIHQVNQEPNLGRVMNIYWLMVYEKDEHLYNYYVDTVKGLANSVD  651
              +    +R+AA  +L+      P   R+++I+ ++  E D H+ NYY  TV  ++ +  
Sbjct  546  SRNASLELRVAAVTLLLI---SNPTAARLISIHRIIQSETDPHMINYYRTTVTSISETTY  602

Query  652  PCLMKIREMAKKILKFIRIRNLNQPLSSKIHV------DYVDEKYGFGESVMASLVLDNL  705
            PC   +R    ++L ++  R+L Q   S+  V      DY D K+G G  +   LV D  
Sbjct  603  PCYQHLR----RLLSYMH-RHLPQKPESRYWVTGNYIFDYRDSKFGIGAMLQVFLVGDPK  657

Query  706  TGLPYVGSVEHVETVAHKPVTTLGVHWNIDGMSKILKHINHNVLHKIVETIKNDNVKNIL  765
            + +P V   +       K    L ++    G+   +  +N        +     ++K +L
Sbjct  658  SDMPVVAFFKFDTEALGKFTGQLALYIKARGLPDTI--LNKMQSRNGSDPFTFKSIKALL  715

Query  766  NRAVKDVPAI--KDINVNVILTMNDNVVFILHSDESNSLKL-LDKLKEWNKLITEYLNVI  822
              A+   P I  KD+++  IL M    V   + ++    +L  D + E  + I    + I
Sbjct  716  --AMLQAPIINSKDLHLEFILQMEGKTVLSYYLNQRMFRQLTYDNILERMQQIIRTDSHI  773

Query  823  NWQTVLYHSHFEMHMVTDLGVPAVLASKVPSLSSLRGSVEYSENKNHLILKSKL----KY  878
            N QTV +       + T LG  + +  +   L+SLRG++  +E +N  I K  L    +Y
Sbjct  774  NMQTVRWPFMNRYTVPTVLGTSSDVLLQTTVLTSLRGNI--TEQRNSPITKHTLEIDARY  831

Query  879  QQWMHGEYVMSIYNPVVDSWHSIRKTSSVDVTLPCDIAIGYNQE-TKSFKVSLARLPVSE  937
              +         YNP ++  H I +     + +P    +  N+  +K  + S +R    +
Sbjct  832  SSY--ASVRSRSYNPFLNLDHEINREQGFLIYIPFSSELHLNESGSKCRRYSFSR---PQ  886

Query  938  FSVVGVSFHGKNYVTLTGDQHDLLKKLCSTCRHHEVITTGASLKTYESNFDSKDTGTRFS  997
                G+SF  +      G    L+ K  +      ++  G +      ++   D G R S
Sbjct  887  NLTSGLSFKSRAVTKTRG----LITKTAAAPFEEIMVPEGRNDVVQLFSYPMTDLGVRLS  942

Query  998  M  998
            M
Sbjct  943  M  943


>VIT6_CAEEL unnamed protein product
Length=1651

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 182/933 (20%), Positives = 370/933 (40%), Gaps = 164/933 (18%)

Query  32   QAPFPHGKIVTYKYHADVKAGIIDPAPFASDFNIECLLQVHHDVTNPNS-----KNTFYV  86
            ++ F  G+   Y ++  + AG+  P P           QV    T+ N+     + T + 
Sbjct  31   ESSFRAGREYRYLFNGQLSAGL--PVPSTPQGISRLQSQVTLQWTDGNTVRMQLQKTRFA  88

Query  87   TLSDMKHGLYNGPMKHYESVSHMLPIDAAKALLNPFLVIYEENGHLEGVKFAEDEPGWSK  146
            T     + +   P + +E V  M   +  + L  P    YE +G +  ++FAE++  WS+
Sbjct  89   TSQQESNSMKMLPFERFEEVERM-NREHQELLSMPVEFDYE-HGLVREIRFAENDQPWSE  146

Query  147  NVKKGIVSMLQLDL---------DQMHVQSPIKAHSFISQEVTIHGNCEVAYNVQPMDEM  197
            N+K+ +++MLQ+++         ++   Q P    SF + E T+ G CEV Y V   +E+
Sbjct  147  NIKRAVINMLQVNILKKEKYEGAEKSDNQEP--TFSFTNVERTLEGECEVLYTV---EEI  201

Query  198  QATSGKELVVTKFYDSMNCSHFKYHEFNHVE---CHKCQIHERNDMSTASRRVIVIDNHD  254
            +    +    +  +D   C+   Y   +HV+   C  CQ     D  +++     I    
Sbjct  202  KKEDEQRWAKSINFDK--CTRRPY--IHHVQTPVCKDCQQTLEQDKMSSTVLNYNITGTS  257

Query  255  NEILIKKLIGHAVINYFPWLAASEAHYLLTNQTLFLEKVVPVSDIQLMGFKHLIVSPIEK  314
            +  LI  +   +   + P    SE H L++  TL   +++   + +    K +      +
Sbjct  258  SSFLINSVELRSQHLFAP---ISEKHQLVSAFTLNTMELIYAGE-KKTEIKQVRNEKTSE  313

Query  315  VIYDEPKTPYVPEADIDVTGH----RHVVKLDELVVKM-KKMLDEVAGYLKETHVDKKQI  369
            ++Y++       E     TG     R + +  E  V+M KKM   +A       +++ + 
Sbjct  314  LVYNQESE--WAEQQWAQTGEEKYLRQLPQWTENKVEMIKKMFSLMA-----KQIEQGEA  366

Query  370  DWKHDQTINRILHVMSYMNVASLNKVFSEIEDIKDAKV-EAVRNIFLTMVSHVGTPAAC-  427
            + +   T+ RI+ V+   N   L +++  + + KD K+ E +R+I+   ++  GT     
Sbjct  367  ELEAAHTVARIVKVLRECNEEQLEQIYRHVAEHKDEKIAEQLRSIYFNTLALAGTRVTIQ  426

Query  428  LFTRNVVRTKSVPNWVAVTMLANLPMHVKVSSKELLLQMEELLNLGEFVS----------  477
             F   V   K++            P+   V+ K L+      L + E ++          
Sbjct  427  QFVDKVQSRKNI-----------APLKASVAIKTLVDMRYPSLAIAEDIARLCESDVSSS  475

Query  478  -PSVREAGIFCFATLIH-------KTF----------KKEQTEVVDPLIERYLRHFMDHV  519
             P++R++    +  +++       + F          +  +  +VD L++++        
Sbjct  476  FPALRQSCWLTYGAIVNGVCGQTPRVFVQKNGVKMCPRDAKQRIVDKLVQQF--------  527

Query  520  RNEPMFHMKMVYMMAMKNVRSKHVLKHLEPIIKGEEIVSEKPHNIRVQAIWILKNINVH-  578
             +    + K++ +  + N      +  LE II  E+  +     IR QAI   + +    
Sbjct  528  ESASTRYEKVLALKTLANAGLDLSVYPLEKIILNEQHET----TIRTQAIESFRRLRTQM  583

Query  579  SNYIHDILWPVLSDVSLPSAVRIAAFNVLIHQVNQEPNLGRVMNIYWLMVYEKDEHLYNY  638
               I  +L PV  +   P  +R++A + +I+    +P    +  I   +  E+++ +  +
Sbjct  584  PTKIQRVLMPVYLNRQQPQHIRMSALHQIIY---TQPEWSVLSQIGNQLRQERNQQVRAF  640

Query  639  YVDTVKGLANSVDPCLMKIREMAKKILKFIRIRNLNQPLSSKIHVDYVDEKY--------  690
             +  ++  AN+  PC        + +L  I       P SS+  +D  +  Y        
Sbjct  641  TLSLLRSYANNESPCEQTFSSRVQSLLNNI-------PFSSQ-EIDRFESVYGKWSTYSR  692

Query  691  ----GFGESVMASLVLDNLTGLPYVGSVEHVETVAHKPVTTLGVHWN---------IDGM  737
                GF  +  +    +++     + S+E V          L   WN            M
Sbjct  693  RHQSGFEANFASLFTTESVLPTEMMASIEGV----------LSGEWNQYFAQIGFTQKNM  742

Query  738  SKILKHINHNVLHKIVETI------------KNDNVKNILN--RAVKDVPAIKDINVNVI  783
             KI+K +  NV  K +E I              + + N+L   R  +   + +D +  V 
Sbjct  743  EKIIKKLLSNVQEKGLEQIVVRGKRASGSFQPTEFLSNLLEKLRITRRQSSEQDPHAFVY  802

Query  784  LTMNDNVVFILHSDESNSLKLLDKLKEWNKLITEYLNVINWQTVLYHSH-----FEM--H  836
            +   D     L  D  +  +++  + +  +L    +  +  Q + + +      +E    
Sbjct  803  IRHRDMDYAFLPIDADSIPEVVRSMIQGGRLEIGDIERVLAQGIHFSASNAAFLYETVRR  862

Query  837  MVTDLGVPAVLASKVPSLSSLRGSVEYS-ENKN  868
            + T +G+P    SK+P++SS+RG V +  E KN
Sbjct  863  VPTPMGLPVQFTSKMPTISSIRGQVTFELEPKN  895


>CLOT_PENMO unnamed protein product
Length=1670

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 57/252 (23%), Positives = 106/252 (42%), Gaps = 39/252 (15%)

Query  377  INRILHVMSYMNVASLNKVFSEIEDIKDAKVEAVRNIFLTMVSHVGTPAACLFTRNVVRT  436
            I R++  ++ ++   +  +++      D K    + IF+ +V H GT  A  F       
Sbjct  407  IGRLVEAVANLDYPYIQTLYTHF----DGKGTMQKYIFVQLVIHAGTEPAVNF-------  455

Query  437  KSVPNWVAVTMLANLPMHVKVSSK---ELLLQMEELLNLGEFVSPSVREAGIFCFATLIH  493
             +V N   +         + VS +    +   M  L+N  E +  S+   G+  FATL H
Sbjct  456  -AVDNLSDILFYVTFYESIGVSLRTPAPIPKIMHSLINGEEGLHHSL---GLMNFATLAH  511

Query  494  KTFKKEQTE------------VVDP--LIERYLRHFMDHVRNEPM-FHMKMVYMMAMKNV  538
                 E  +              DP  +I  ++ + +  + N+      +++Y+ A+ N+
Sbjct  512  DACLSEDRKHFYFDYSCGPKTTCDPELIITNFIPYLVRELGNQGKDVWQRLIYLQALSNL  571

Query  539  RSKHVLKHLEPIIKGEEIVSEKPHNIRVQAIWILKNINVHS---NYIHDILWPVLSDVSL  595
             +   +  L+PII G   V+E    +R  AIW L   N+H    + I++IL P++ +   
Sbjct  572  GTPQTINVLKPIILG---VTETNIFMRTNAIWSLSAYNMHKTALSQIYEILMPIIENKGE  628

Query  596  PSAVRIAAFNVL  607
               +R  AF  L
Sbjct  629  QFEIRNIAFLTL  640


 Score = 33.5 bits (75),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 60/306 (20%), Positives = 114/306 (37%), Gaps = 82/306 (27%)

Query  1242  KTRECIEEALRHSTLRKYTVNMTIRKVPLY----------------LTSIVNMAQDILRA  1285
             + +E IE+   +ST   Y   + I   PLY                L +I     DI++A
Sbjct  1256  RVKEAIEKGCDYST---YAPGIDIITSPLYDHSHITATWTPDFPDNLKNITYYVDDIIKA  1312

Query  1286  TYFSHMKY--TWNH------------VDPGNAKIVLEFPHSTSLLNIAAATPMYSYELVH  1331
             +    +++  T  H            ++ G   +  E P++ S++N          EL  
Sbjct  1313  SLSKKIEFDHTSAHHASRVEIDATKCIETGLWTVRTEKPYAVSIIN----------ELEL  1362

Query  1332  LPFGDPLWSPWMDNAQFSFLMLHNYVKGGLKF-CTIRPRVLVTLDNGIIPYIVRDKWTLL  1390
               + +P+++P    A  +  +L+    G     CTI    + T D  +  Y   + W  +
Sbjct  1363  PAWANPIFTP----APLATTLLYGLTVGRTPVSCTIDETKVRTADGKVFAYEPSECWNAM  1418

Query  1391  SGDH-IDQMYSIFVKSVQDNVLALKVYIGEHELEIMPVDGGMTVT-------IDNEVIDK  1442
             + D   DQ  ++ V++            G+ E+ I+    G+ +        ++ E    
Sbjct  1419  TLDTTFDQRGAMLVRNT-----------GQWEVRIIWQKEGLVIDMSPTNFLVNGEPAKG  1467

Query  1443  TNIEKGVMIPKNSDSYVIRLTKGYEIMTIESQLLPFQIYYLPDSVTIFMGTSLQGQITGM  1502
             T+    V+   + DS+ I    G  +              + D V + +G   +G  TG+
Sbjct  1468  TDNRYTVL--HHDDSHTIVFESGTSVK-------------VSDKVEVLLGLDHRGHTTGI  1512

Query  1503  CGHMDS  1508
             CG+ D 
Sbjct  1513  CGNFDG  1518


 Score = 32.3 bits (72),  Expect = 4.6, Method: Compositional matrix adjust.
 Identities = 43/154 (28%), Positives = 65/154 (42%), Gaps = 24/154 (16%)

Query  15   MDTLIALLAILATAFAIQAPFPHGKIVTYKYHADVKAGI--IDPAPFASDFNIECLLQVH  72
            M  LI LL  L    A+Q     G    Y+Y A V +GI  I+    A+    +  +Q+ 
Sbjct  1    MKALILLL--LGACQALQP----GLEYQYRYSARVASGIPSINRQFAAAGIQADVTVQMA  54

Query  73   HDVTNPNSKNTFYVTLSDMKHGLYNGPMKHYESVSHMLPI------DAAKALLNPFLVIY  126
             D +         V  S+++ G  N  +     +   LPI      D    L  PF VI 
Sbjct  55   ADYS-------VVVQFSNIEVGDLNKVLDC--DLRAPLPIEYHPLEDYVDLLEKPFRVIM  105

Query  127  EENGHLEGVKFAEDEPGWSKNVKKGIVSMLQLDL  160
             E+ H+       +EP W  NV+KG V++ ++ L
Sbjct  106  NES-HVPSYMEGPEEPIWISNVRKGFVNIFRVPL  138



Lambda      K        H
   0.318    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5035546020


Query= XP_003392860.1 ubiquitin-like-conjugating enzyme ATG3 [Bombus
terrestris]

Length=323
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VVS6_DROME  unnamed protein product                                 421     1e-148
C0H519_PLAF7  unnamed protein product                                 192     3e-59 
Q9N369_CAEEL  unnamed protein product                                 163     5e-48 


>Q9VVS6_DROME unnamed protein product
Length=330

 Score = 421 bits (1082),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 213/331 (64%), Positives = 255/331 (77%), Gaps = 12/331 (4%)

Query  1    MQSVINSVKGTALGVAEYLTPVLKESKFRETGVLTPEEFVAAGDHLVHHCPTWQWATGDE  60
            MQSV+N+VKGTAL VAEYLTPVLKESKFRETGVLTPEEFVAAGDHLVHHCPTWQWA GDE
Sbjct  1    MQSVLNTVKGTALNVAEYLTPVLKESKFRETGVLTPEEFVAAGDHLVHHCPTWQWAAGDE  60

Query  61   DRVKSYLPKTKQFLLTRNVPCTRRCKQIEYSKEQECIIEEDDPEGGWVDTHHY-DSSLGG  119
             + K YLPK KQFL+TRNVPC RRCKQ+EY  E E ++EE+  +GGWV+TH   D     
Sbjct  61   TKTKPYLPKDKQFLITRNVPCYRRCKQMEYVGE-ETLVEEESGDGGWVETHQLNDDGTTQ  119

Query  120  IEERVTEMTLDETQLSQSIGTEENNGDNNEDDDDDDDDGDAADMEAFEVSGMLDEQDKYA  179
            +E+++ E+T++ET+        + +        +D+DD +A DM+ FE SGML+  D   
Sbjct  120  LEDKICELTMEETKEEMHTPDSDKSAPGAGGQAEDEDDDEAIDMDDFEESGMLELVDPAV  179

Query  180  AKITKKPANEKWES----------FSEGEIIHTRTYDLYITYDKYYQTPRLWLSGYDENR  229
            A  T+KP  E   S           S   ++HTRTYDL+I+YDKYYQTPRLW+ GYDE R
Sbjct  180  ATTTRKPEPEAKASPVAAASGDAEASGDSVLHTRTYDLHISYDKYYQTPRLWVVGYDEQR  239

Query  230  KPLTVEEMYEDVSQDHAKKTVTMEVHPHIPGPLMASVHPCRHAEVMKKIIETVMEGGREL  289
            KPLTVE+MYEDVSQDHAKKTVTME HPH+PGP MASVHPCRHA++MKKII+TV EGG +L
Sbjct  240  KPLTVEQMYEDVSQDHAKKTVTMESHPHLPGPNMASVHPCRHADIMKKIIQTVEEGGGQL  299

Query  290  GVHMYLIIFLKFVQSVIPTIEYDYTQNFMLN  320
            GVH+YLIIFLKFVQ+VIPTIEYD+TQNF ++
Sbjct  300  GVHLYLIIFLKFVQTVIPTIEYDFTQNFNMS  330


>C0H519_PLAF7 unnamed protein product
Length=313

 Score = 192 bits (489),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 116/313 (37%), Positives = 171/313 (55%), Gaps = 19/313 (6%)

Query  3    SVINSVKGTALGVAEYLTPVLKESKFRETGVLTPEEFVAAGDHLVHHCPTWQWATGDEDR  62
            +V + +  T   +  Y   V   S F + G LTP EFV +GD LV+   TW+W   D+DR
Sbjct  6    NVKHKIGDTCRKLYSYFKTVNNTSTFIQNGTLTPSEFVDSGDFLVYKFKTWEWQEADKDR  65

Query  63   VKSYLPKTKQFLLTRNVPCTRRCKQIEYSKEQECIIEEDDPEGGWVDTHHYDSSLGGIEE  122
            V  YLP+ KQFL+T+NVPC +R K +        I++ D     W+        L   EE
Sbjct  66   VVPYLPENKQFLITKNVPCKQRIKDLNNIVHDLKIVDND-----WL--------LPSYEE  112

Query  123  RVTEMTLDETQLSQSIGTEENNGDNNEDDDDDDDDGDAADMEAFEV-SGMLDEQDKYAAK  181
                  + E   +      + N  N E++++DD+  +A D+  F + + ++ E D   A 
Sbjct  113  DNNPTDIYEYLPNSEYTINDKNIYNYEEEEEDDNCDEAIDINNFYMENNLIKEHD--PAS  170

Query  182  ITKKPANEKWESFSEGEIIHTRTYDLYITYDKYYQTPRLWLSGYDENRKPLTVEEMYEDV  241
            I       K  +     ++  RTYD+ ITYDKYYQTPR+WL GY+EN  PL  EE++ED+
Sbjct  171  INSTSCYSK--NMLHDNLMKIRTYDVSITYDKYYQTPRIWLFGYNENGDPLKSEEIFEDI  228

Query  242  SQDHAKKTVTMEVHPHIPGPLMASVHPCRHAEVMKKIIETVMEGGRELGVHMYLIIFLKF  301
              D++ KTVT + HP   G + AS+HPC+HAE +  ++   +   +E    +YL+  LKF
Sbjct  229  LSDYSYKTVTYDPHP-CTGVMTASIHPCKHAEAILNVVNNWISEEKEPRHDLYLLFLLKF  287

Query  302  VQSVIPTIEYDYT  314
            +  VIPTIEYD+T
Sbjct  288  ISGVIPTIEYDFT  300


>Q9N369_CAEEL unnamed protein product
Length=305

 Score = 163 bits (413),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 94/120 (78%), Gaps = 7/120 (6%)

Query  1    MQSVINSVKGTALGVAEYLTPVLKESKFRETGVLTPEEFVAAGDHLVHHCPTWQWA-TGD  59
            MQ+++N++K  AL + E  TPVL+ESKFRETGVLTPEE+VAAGDHLVHHCPTW+WA   D
Sbjct  1    MQNLVNNLKSAALQIGETFTPVLRESKFRETGVLTPEEYVAAGDHLVHHCPTWKWAGASD  60

Query  60   EDRVKSYLPKTKQFLLTRNVPCTRRCKQIEYSKEQECIIEEDD------PEGGWVDTHHY  113
              +++++LP  KQFL+TRNVPC +RCKQ+EY ++ E II E+D       E GWVDTHHY
Sbjct  61   PSKIRTFLPIDKQFLITRNVPCHKRCKQMEYDEKLEKIINEEDGEYQTSDETGWVDTHHY  120



Lambda      K        H
   0.318    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5035546020


Query= XP_003392861.1 anaphase-promoting complex subunit 7 [Bombus
terrestris]

Length=571
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9W3Y6_DROME  unnamed protein product                                 232     2e-68
Q8T020_DROME  unnamed protein product                                 231     3e-68
Q8IRQ6_DROME  unnamed protein product                                 215     7e-63


>Q9W3Y6_DROME unnamed protein product
Length=615

 Score = 232 bits (592),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 154/545 (28%), Positives = 277/545 (51%), Gaps = 15/545 (3%)

Query  4    LYDQIKLLYEQSLYSNVISLANLVLSLSEHNSDLLPIHGKFHIYVYYADAHFYLGKYKRA  63
            L+   K LY+  LY  VI  A+L+ ++ +++  +  +  ++ + +Y  +A++    Y+ A
Sbjct  15   LFANAKKLYDHKLYECVIPAADLLRTVLKNDRYVATLDVEYQVLLYLLNANYKERNYRAA  74

Query  64   EALYKKSLQFRKCLLKSKGAT-KPLEGQKDLPTDVDIKFQIHLCLIKLKNPQEALQVLQS  122
               + + +  R+ +++ K A    +E       D + + +   C  ++ N   A++ L  
Sbjct  75   LRHFDEIIHKRRLMMRHKNAVLVAIESSYPEFGDAEQRRRAAECYRQIGNTDMAIETLLQ  134

Query  123  IPGKQRTPKVNMALAKMFHEQGM-----ERSAITTYKEVLRECPLALEAAEGLLSLGVKG  177
            +P   R+P++N+ LA++ H         +  A+  YKEV+RECP+AL+  E LL LGV G
Sbjct  135  VPPTLRSPRINLMLARLQHHGSRHGTTKKSEAVLAYKEVIRECPMALQVIEALLELGVNG  194

Query  178  IEVNSLIVGCASSLSNLDWLNTWIKAHAHIHNREYTHAVTTLRSLDNVSLLRDNFNLLTT  237
             E+NSL++  A+   + DWL+ WIKA A + N +++ A  T   L + + LR N +L+  
Sbjct  195  NEINSLVMHAATVPDHFDWLSKWIKALAQMFNFKHSDASQTFLMLHDNTTLRCNEHLMMA  254

Query  238  MGECYYYAGDDKNALLCLRRARIIEPDIMKGVDVYAAVLYKTHSVKE----LERLIPIIT  293
            +G+C YY GD   A           PD ++ + + A +  +    ++    ++ L   ++
Sbjct  255  LGKCLYYNGDYFQAEDIFSSTLCANPDNVEAIGLMAVLCGQEGGCEQDSADMDYLFAKVS  314

Query  294  ASNECSGEVYVAMAYSLYATRKLGRANTFTAQALNLNPNDIEATILRGNILIEQKKYQDA  353
            +  + +   + A A  LY   K  R   F  + L+  P + EA ILRG +LI  +++  A
Sbjct  315  SEVKYTASHWFAHAQLLYDEGKFERGLNFVEKCLDSEPRNHEALILRGRLLIALERHTQA  374

Query  354  LFFFRHAVQLKPYRYEPHKGLVDCLVGMHRLREAINIASGSCKQLGHTTRVLTLYASV--  411
            +  FR A  + PYR+E ++GL    +   R +EA  + + + +   ++ R  T++     
Sbjct  375  VCAFRTAQMVAPYRFEIYRGLFHSYLAQKRFKEANALCNWTIRLFQNSPRSFTMFGRTLF  434

Query  412  LMKDPVSVGKAKNLLEKALLQDEVYLPAVYLLAEIYEQEMNLEAAIALLERQVEIQTACK  471
            L  DP     A+   EK+L  + +Y PAV L+A+I + E   +A I LLE+ V I     
Sbjct  435  LFPDPRMRRTARKFAEKSLKINHIYTPAVNLIADICQVEGPTKAIIKLLEKHVIIFPKVN  494

Query  472  LHQMLGDLWARVHNEEKALDHYAIALNLDPNNRRALEGMHRL---DNSSNKLDTAYYMTV  528
            L   LGD+  +     KA+++Y  AL  DP ++R L G+  L   D+ S  LD +  + +
Sbjct  495  LLNHLGDIMRKQKEPVKAMEYYYKALRQDPKSKRTLRGLRLLAKSDDESPVLDESDDIGM  554

Query  529  GEEQT  533
              +Q+
Sbjct  555  DNQQS  559


>Q8T020_DROME unnamed protein product
Length=595

 Score = 231 bits (590),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 154/545 (28%), Positives = 277/545 (51%), Gaps = 15/545 (3%)

Query  4    LYDQIKLLYEQSLYSNVISLANLVLSLSEHNSDLLPIHGKFHIYVYYADAHFYLGKYKRA  63
            L+   K LY+  LY  VI  A+L+ ++ +++  +  +  ++ + +Y  +A++    Y+ A
Sbjct  15   LFANAKKLYDHKLYECVIPAADLLRTVLKNDRYVATLDVEYQVLLYLLNANYKERNYRAA  74

Query  64   EALYKKSLQFRKCLLKSKGAT-KPLEGQKDLPTDVDIKFQIHLCLIKLKNPQEALQVLQS  122
               + + +  R+ +++ K A    +E       D + + +   C  ++ N   A++ L  
Sbjct  75   LRHFDEIIHKRRLMMRHKNAVLVAIESSYPEFGDAEQRRRAAECYRQIGNTDMAIETLLQ  134

Query  123  IPGKQRTPKVNMALAKMFHEQGM-----ERSAITTYKEVLRECPLALEAAEGLLSLGVKG  177
            +P   R+P++N+ LA++ H         +  A+  YKEV+RECP+AL+  E LL LGV G
Sbjct  135  VPPTLRSPRINLMLARLQHHGSRHGTTKKSEAVLAYKEVIRECPMALQVIEALLELGVNG  194

Query  178  IEVNSLIVGCASSLSNLDWLNTWIKAHAHIHNREYTHAVTTLRSLDNVSLLRDNFNLLTT  237
             E+NSL++  A+   + DWL+ WIKA A + N +++ A  T   L + + LR N +L+  
Sbjct  195  NEINSLVMHAATVPDHFDWLSKWIKALAQMFNFKHSDASQTFLMLHDNTTLRCNEHLMMA  254

Query  238  MGECYYYAGDDKNALLCLRRARIIEPDIMKGVDVYAAVLYKTHSVKE----LERLIPIIT  293
            +G+C YY GD   A           PD ++ + + A +  +    ++    ++ L   ++
Sbjct  255  LGKCLYYNGDYFQAEDIFSSTLCANPDNVEAIGLMAVLCGQEGGCEQDSADMDYLFAKVS  314

Query  294  ASNECSGEVYVAMAYSLYATRKLGRANTFTAQALNLNPNDIEATILRGNILIEQKKYQDA  353
            +  + +   + A A  LY   K  R   F  + L+  P + EA ILRG +LI  +++  A
Sbjct  315  SEVKYTASHWFAHAQLLYDEGKFERGLNFVEKCLDSEPRNHEALILRGRLLIALERHTQA  374

Query  354  LFFFRHAVQLKPYRYEPHKGLVDCLVGMHRLREAINIASGSCKQLGHTTRVLTLYASV--  411
            +  FR A  + PYR+E ++GL    +   R +EA  + + + +   ++ R  T++     
Sbjct  375  VCAFRTAQMVAPYRFEIYRGLFHSYLAQKRFKEANALCNWTIRLFQNSPRSFTMFGRTLF  434

Query  412  LMKDPVSVGKAKNLLEKALLQDEVYLPAVYLLAEIYEQEMNLEAAIALLERQVEIQTACK  471
            L  DP     A+   EK+L  + +Y PAV L+A+I + E   +A I LLE+ V I     
Sbjct  435  LFPDPRMRRTARKFAEKSLKINHIYTPAVNLIADICQVEGPTKAIIKLLEKHVIIFPKVN  494

Query  472  LHQMLGDLWARVHNEEKALDHYAIALNLDPNNRRALEGMHRL---DNSSNKLDTAYYMTV  528
            L   LGD+  +     KA+++Y  AL  DP ++R L G+  L   D+ S  LD +  + +
Sbjct  495  LLNHLGDIMRKQKEPVKAMEYYYKALRQDPKSKRTLRGLRLLAKSDDESPVLDESDDIGM  554

Query  529  GEEQT  533
              +Q+
Sbjct  555  DNQQS  559


>Q8IRQ6_DROME unnamed protein product
Length=528

 Score = 215 bits (548),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 135/442 (31%), Positives = 228/442 (52%), Gaps = 14/442 (3%)

Query  106  CLIKLKNPQEALQVLQSIPGKQRTPKVNMALAKMFHEQGM-----ERSAITTYKEVLREC  160
            C  ++ N   A++ L  +P   R+P++N+ LA++ H         +  A+  YKEV+REC
Sbjct  31   CYRQIGNTDMAIETLLQVPPTLRSPRINLMLARLQHHGSRHGTTKKSEAVLAYKEVIREC  90

Query  161  PLALEAAEGLLSLGVKGIEVNSLIVGCASSLSNLDWLNTWIKAHAHIHNREYTHAVTTLR  220
            P+AL+  E LL LGV G E+NSL++  A+   + DWL+ WIKA A + N +++ A  T  
Sbjct  91   PMALQVIEALLELGVNGNEINSLVMHAATVPDHFDWLSKWIKALAQMFNFKHSDASQTFL  150

Query  221  SLDNVSLLRDNFNLLTTMGECYYYAGDDKNALLCLRRARIIEPDIMKGVDVYAAVLYKTH  280
             L + + LR N +L+  +G+C YY GD   A           PD ++ + + A +  +  
Sbjct  151  MLHDNTTLRCNEHLMMALGKCLYYNGDYFQAEDIFSSTLCANPDNVEAIGLMAVLCGQEG  210

Query  281  SVKE----LERLIPIITASNECSGEVYVAMAYSLYATRKLGRANTFTAQALNLNPNDIEA  336
              ++    ++ L   +++  + +   + A A  LY   K  R   F  + L+  P + EA
Sbjct  211  GCEQDSADMDYLFAKVSSEVKYTASHWFAHAQLLYDEGKFERGLNFVEKCLDSEPRNHEA  270

Query  337  TILRGNILIEQKKYQDALFFFRHAVQLKPYRYEPHKGLVDCLVGMHRLREAINIASGSCK  396
             ILRG +LI  +++  A+  FR A  + PYR+E ++GL    +   R +EA  + + + +
Sbjct  271  LILRGRLLIALERHTQAVCAFRTAQMVAPYRFEIYRGLFHSYLAQKRFKEANALCNWTIR  330

Query  397  QLGHTTRVLTLYASV--LMKDPVSVGKAKNLLEKALLQDEVYLPAVYLLAEIYEQEMNLE  454
               ++ R  T++     L  DP     A+   EK+L  + +Y PAV L+A+I + E   +
Sbjct  331  LFQNSPRSFTMFGRTLFLFPDPRMRRTARKFAEKSLKINHIYTPAVNLIADICQVEGPTK  390

Query  455  AAIALLERQVEIQTACKLHQMLGDLWARVHNEEKALDHYAIALNLDPNNRRALEGMHRL-  513
            A I LLE+ V I     L   LGD+  +     KA+++Y  AL  DP ++R L G+  L 
Sbjct  391  AIIKLLEKHVIIFPKVNLLNHLGDIMRKQKEPVKAMEYYYKALRQDPKSKRTLRGLRLLA  450

Query  514  --DNSSNKLDTAYYMTVGEEQT  533
              D+ S  LD +  + +  +Q+
Sbjct  451  KSDDESPVLDESDDIGMDNQQS  472



Lambda      K        H
   0.318    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5035546020


Query= XP_003392862.1 protein FAM122A [Bombus terrestris]

Length=347


***** No hits found *****



Lambda      K        H
   0.318    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5035546020


Query= XP_003392863.1 selT-like protein [Bombus terrestris]

Length=186
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SELT_DROME  unnamed protein product                                   171     3e-54
Q38C92_TRYB2  unnamed protein product                                 28.9    3.1  


>SELT_DROME unnamed protein product
Length=198

 Score = 171 bits (433),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 112/174 (64%), Gaps = 5/174 (3%)

Query  7    LILCFCVILCALDNKADDNQVSLTKLSTKTGPTLKFFYCYSCGYRKVFEEYVNILQQKYP  66
            L+LC C    AL     + ++ +TK      PT+ F YCYSCGYRK FE+YV +L +KYP
Sbjct  12   LVLCLCAGY-ALVFAEGEKEIPVTKFGQNIAPTMTFLYCYSCGYRKAFEDYVGLLGEKYP  70

Query  67   ELQIDGENYMPSHNKMFIAKLLSFAKILLIILIVSGLD----LGQPPTSLWQWCLDNRFY  122
            ++Q++G NY P     +++K++   KI++I+ +VS +     LG    S W     N+ Y
Sbjct  71   QIQVNGGNYDPPGLNYYLSKMIFALKIIIIVSVVSAVSPFTFLGLNTPSWWSHMQANKIY  130

Query  123  SCIMIFFIFNAIEGHFISSGAFEIHFNDVPVWSKLETGRIPQPLELFQIIDNHL  176
            +C+MIFF+ N +E   ISSGAFEI  NDVPVWSKL+TGR P P  LFQIIDNHL
Sbjct  131  ACMMIFFLGNMLEAQLISSGAFEITLNDVPVWSKLQTGRFPSPEVLFQIIDNHL  184


>Q38C92_TRYB2 unnamed protein product
Length=1220

 Score = 28.9 bits (63),  Expect = 3.1, Method: Composition-based stats.
 Identities = 12/24 (50%), Positives = 15/24 (63%), Gaps = 0/24 (0%)

Query  153  VWSKLETGRIPQPLELFQIIDNHL  176
            VWSKLE G IP  +E+ +  D  L
Sbjct  487  VWSKLEDGEIPDEVEIQEAFDQPL  510



Lambda      K        H
   0.318    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5035546020


Query= XP_003392864.1 LOW QUALITY PROTEIN: ankyrin repeat domain-containing
protein 13C [Bombus terrestris]

Length=434
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7K4M9_DROME  unnamed protein product                                 179     6e-50
A8DYI9_DROME  unnamed protein product                                 179     6e-50
Q8IGB6_DROME  unnamed protein product                                 170     9e-47


>Q7K4M9_DROME unnamed protein product
Length=637

 Score = 179 bits (454),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 136/471 (29%), Positives = 222/471 (47%), Gaps = 77/471 (16%)

Query  11   KYPLHKCIFQGDIKALSSLIRIYNIAEKDTQGNTPLHLAVMLGRKESIQLLLAHGAPVKV  70
            +YPLH  I+  +++ L + I   +  + D +G TPL LAV L     ++ LLA       
Sbjct  10   EYPLHWHIWHNELEQLQAAIDQNDKEKIDPRGRTPLMLAVRLANLPCVKCLLAAKCNATY  69

Query  71   KNLAGWSPLAEAISYGDRQTISSLVRKLNQQAREQMEERRPNLLATLRQMGDFYMELKWD  130
            +   GWS + EA+  GD   +++++   + Q   Q     P LL  L    DFY+E+KW+
Sbjct  70   E-YEGWSIVQEAVCTGDVDILTAIIEVRDLQRHVQRVTHVPKLLQHLLDAPDFYIEMKWE  128

Query  131  FQSWVPLVSRVLPSDVCKIHKRGASIRMDTTLX-------ERGDISFIFNGDKKPSKSLA  183
            F SWVPL+SR+ PSD  K++KRGA++R+DTTL        +RG+ S+IF G    +K  A
Sbjct  129  FTSWVPLMSRLCPSDTYKVYKRGANVRIDTTLLGFDNNTWQRGNRSYIFKG----AKETA  184

Query  184  VLDNLAKRYQTVRYEETELEIQDEVDI---------LMSSDIMAAQMSTKGITLSKAQTG  234
             +  +      V  EE   +I D V I          +++ ++   +    I+  + + G
Sbjct  185  TMIEIDHDTNEVMVEEMSSDIGDIVAIPPALGTVRARLNAPVITNNIEMDKISFERNKCG  244

Query  235  -WIFREDKREMVGPFHAECYQIDGMVLESKKRREHLSEEDLQKNKA--------------  279
             W +R +K EM+  ++ + Y    +   +K R +HLSEE ++   A              
Sbjct  245  IWGWRSEKSEMINGYNCKVYGASNVEFVTKTRMDHLSEEQIKNKTARTPLHSLLGIADED  304

Query  280  -------------------IMESLTKGSSQGFAN-------EKPQVRRASLNPPPESNIT  313
                               + E+   G   G  N              AS    P+S++T
Sbjct  305  YVSPADAAAALKDRTPSPRLEEASNAGVENGGRNSPAPGNQSNGSSAGASGTSTPKSSVT  364

Query  314  WEEYIMAPPGQSPLLGR------NLVYKESSKSFKATVAMSPDFPLTV-DMLLNVLEVIA  366
             EEY      +  L GR      NL  K   + F+A + ++ + P+ + + +L +L++++
Sbjct  365  PEEYFTQ---EFDLHGRDVGGPKNLSTK--VQRFRANLWLAEEHPIRLQEQVLPILDLMS  419

Query  367  PFK--HFSKLREFVLMKLPPGFPVKIDIPILPTVTAKITFQE-FAFRNDID  414
                 H SKLR+F+ M+LP GFPVK++IP+   + A ITF   FA    +D
Sbjct  420  TMASPHVSKLRDFITMQLPAGFPVKVEIPLFHVLNACITFGNVFALTTPVD  470


>A8DYI9_DROME unnamed protein product
Length=630

 Score = 179 bits (454),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 133/469 (28%), Positives = 221/469 (47%), Gaps = 73/469 (16%)

Query  11   KYPLHKCIFQGDIKALSSLIRIYNIAEKDTQGNTPLHLAVMLGRKESIQLLLAHGAPVKV  70
            +YPLH  I+  +++ L + I   +  + D +G TPL LAV L     ++ LLA       
Sbjct  10   EYPLHWHIWHNELEQLQAAIDQNDKEKIDPRGRTPLMLAVRLANLPCVKCLLAAKCNATY  69

Query  71   KNLAGWSPLAEAISYGDRQTISSLVRKLNQQAREQMEERRPNLLATLRQMGDFYMELKWD  130
            +   GWS + EA+  GD   +++++   + Q   Q     P LL  L    DFY+E+KW+
Sbjct  70   E-YEGWSIVQEAVCTGDVDILTAIIEVRDLQRHVQRVTHVPKLLQHLLDAPDFYIEMKWE  128

Query  131  FQSWVPLVSRVLPSDVCKIHKRGASIRMDTTLX-------ERGDISFIFNGDKKPSKSLA  183
            F SWVPL+SR+ PSD  K++KRGA++R+DTTL        +RG+ S+IF G    +K  A
Sbjct  129  FTSWVPLMSRLCPSDTYKVYKRGANVRIDTTLLGFDNNTWQRGNRSYIFKG----AKETA  184

Query  184  VLDNLAKRYQTVRYEETELEIQDEVDI---------LMSSDIMAAQMSTKGITLSKAQTG  234
             +  +      V  EE   +I D V I          +++ ++   +    I+  + + G
Sbjct  185  TMIEIDHDTNEVMVEEMSSDIGDIVAIPPALGTVRARLNAPVITNNIEMDKISFERNKCG  244

Query  235  -WIFREDKREMVGPFHAECYQIDGMVLESKKRREHLSEEDLQKNKA--------------  279
             W +R +K EM+  ++ + Y    +   +K R +HLSEE ++   A              
Sbjct  245  IWGWRSEKSEMINGYNCKVYGASNVEFVTKTRMDHLSEEQIKNKTARTPLHSLLGIADED  304

Query  280  -------------------IMESLTKGSSQGFAN-------EKPQVRRASLNPPPESNIT  313
                               + E+   G   G  N              AS    P+S++T
Sbjct  305  YVSPADAAAALKDRTPSPRLEEASNAGVENGGRNSPAPGNQSNGSSAGASGTSTPKSSVT  364

Query  314  WEEYIMAPPGQSPLLGRNLV----YKESSKSFKATVAMSPDFPLTV-DMLLNVLEVIAPF  368
             EEY      +  L GR++          + F+A + ++ + P+ + + +L +L++++  
Sbjct  365  PEEYFTQ---EFDLHGRDVGGPKNLSTKVQRFRANLWLAEEHPIRLQEQVLPILDLMSTM  421

Query  369  K--HFSKLREFVLMKLPPGFPVKIDIPILPTVTAKITFQE-FAFRNDID  414
               H SKLR+F+ M+LP GFPVK++IP+   + A ITF   FA    +D
Sbjct  422  ASPHVSKLRDFITMQLPAGFPVKVEIPLFHVLNACITFGNVFALTTPVD  470


>Q8IGB6_DROME unnamed protein product
Length=618

 Score = 170 bits (431),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 133/457 (29%), Positives = 214/457 (47%), Gaps = 78/457 (17%)

Query  26   LSSLIRIYNIAEK-DTQGNTPLHLAVMLGRKESIQLLLAHGAPVKVKNLAGWSPLAEAIS  84
            L+  + + N  EK D +G TPL LAV L     ++ LLA       +   GWS + EA+ 
Sbjct  5    LTDSVTLQNDKEKIDPRGRTPLMLAVRLANLPCVKCLLAAKCNATYE-YEGWSIVQEAVC  63

Query  85   YGDRQTISSLVRKLNQQAREQMEERRPNLLATLRQMGDFYMELKWDFQSWVPLVSRVLPS  144
             GD   +++++   + Q   Q     P LL  L    DFY+E+KW+F SWVPL+SR+ PS
Sbjct  64   TGDVDILTAIIEVRDLQRHVQRVTHVPKLLQHLLDAPDFYIEMKWEFTSWVPLMSRLCPS  123

Query  145  DVCKIHKRGASIRMDTTLX-------ERGDISFIFNGDKKPSKSLAVLDNLAKRYQTVRY  197
            D  K++KRGA++R+DTTL        +RG+ S+IF G    +K  A +  +      V  
Sbjct  124  DTYKVYKRGANVRIDTTLLGFDNNTWQRGNRSYIFKG----AKETATMIEIDHDTNEVMV  179

Query  198  EETELEIQDEVDI---------LMSSDIMAAQMSTKGITLSKAQTG-WIFREDKREMVGP  247
            EE   +I D V I          +++ ++   +    I+  + + G W +R +K EM+  
Sbjct  180  EEMSSDIGDIVAIPPALGTVRARLNAPVITNNIEMDKISFERNKCGIWGWRSEKSEMING  239

Query  248  FHAECYQIDGMVLESKKRREHLSEEDLQKNKA----------------------------  279
            ++ + Y    +   +K R +HLSEE ++   A                            
Sbjct  240  YNCKVYGASNVEFVTKTRMDHLSEEQIKNKTARTPLHSLLGIADEDYVSPADAAAALKDR  299

Query  280  -----IMESLTKGSSQGFAN-------EKPQVRRASLNPPPESNITWEEYIMAPPGQSPL  327
                 + E+   G   G  N              AS    P+S++T EEY      +  L
Sbjct  300  TPSPRLEEASNAGVENGGRNSPAPGNQSNGSSAGASGTSTPKSSVTPEEYFTQ---EFDL  356

Query  328  LGR------NLVYKESSKSFKATVAMSPDFPLTV-DMLLNVLEVIAPFK--HFSKLREFV  378
             GR      NL  K   + F+A + ++ + P+ + + +L +L++++     H SKLR+F+
Sbjct  357  HGRDVGGPKNLSTK--VQRFRANLWLAEEHPIRLQEQVLPILDLMSTMASPHVSKLRDFI  414

Query  379  LMKLPPGFPVKIDIPILPTVTAKITFQE-FAFRNDID  414
             M+LP GFPVK++IP+   + A ITF   FA    +D
Sbjct  415  TMQLPAGFPVKVEIPLFHVLNACITFGNVFALTTPVD  451



Lambda      K        H
   0.318    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5035546020


Query= XP_003392865.1 BTB/POZ domain-containing protein 9 isoform X1
[Bombus terrestris]

Length=615
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

BTBD9_DROME  unnamed protein product                                  624     0.0  
A0A0B4KGU2_DROME  unnamed protein product                             98.2    4e-21
Q9VEL0_DROME  unnamed protein product                                 97.4    7e-21


>BTBD9_DROME unnamed protein product
Length=722

 Score = 624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/540 (55%), Positives = 396/540 (73%), Gaps = 4/540 (1%)

Query  23   NTLSEDIGALYLSDDYSDVTLIVGGQRFNSHKIILAARSQYFRALLFGGLKESTQHEIEL  82
            +  S D+  L +++ Y+DV  IV  +R  +H++ILAARS+YFRALL+GG+ E+TQ +I L
Sbjct  30   DRFSADMARLCMNEQYADVEFIVEEERIPAHRVILAARSEYFRALLYGGMAETTQRQIPL  89

Query  83   KDANLTGFKGLLEYIYTGRMSLTDRREEVVLDILGLAHLYGFSELEASISDYLREILNIK  142
             +  L  FK LL YIY+G + L+   E+  +D+LG+A+ YGF +LE +IS+YLR+ L + 
Sbjct  90   -EVPLEAFKVLLRYIYSGTLLLSTLDEDSTIDVLGMANQYGFQDLEMAISNYLRQYLALD  148

Query  143  NVCLIFGTALLYRLEFLTKVCHEYMDEHACEVIQHESFLQLSADALNELVSRDSFYAPEI  202
            NVC+I   A LY LE LT+VC  +MD +A +++ H SF  LS ++L E++ RD F+APE+
Sbjct  149  NVCMILDAARLYNLEELTEVCLMFMDRNAGDLLLHNSFNTLSKESLEEVLRRDCFFAPEV  208

Query  203  DIFLAVRAWVNANPDADGKTVLDKVRLNLVSITDLLNVVRPTGLISPEAILDAIAARTQT  262
             IFLAV  W   N + D K+V+  VRL L+++  LL VVRP+G++ P+ ILDAI  R+ +
Sbjct  209  QIFLAVWKWSRFNSNVDFKSVVSYVRLPLMNLEHLLQVVRPSGILDPDKILDAIDERSTS  268

Query  263  RDSDLNYRGRLLIDVNVAQPTYGAQVLQGEMRSYLLDGYTNNYDMERGYTRHTITESREH  322
            +   L YR  L  + NVA  T+ ++ +QGE R  LLDG    YDME GYTRH IT+S++ 
Sbjct  269  KA--LPYRAALWPEENVAAETFLSRCIQGECRDALLDGDVTTYDMENGYTRHCITDSKDA  326

Query  323  GILVKLGTQCIINHIKMLLWDKDMRSYSYYLEVSMDQKNWVRVIDYTEYFCRSWQYLYFE  382
            GI+V+LGT C+INHI+MLLWD+D R+YSYY+EVS DQ++W RV+DY++Y CRSWQYLYFE
Sbjct  327  GIVVELGTFCMINHIRMLLWDRDSRAYSYYVEVSGDQQHWDRVVDYSDYHCRSWQYLYFE  386

Query  383  PRIVLYIRIVGTNNTVNKVFHLVSFEAYYTNHTEKLYNGFVIPTRNVATMDQSATVTEGV  442
             R V +IR+VGT NTVN+VFH+V  EA +T    +L N FV P  NVAT++ SA VT+GV
Sbjct  387  ARPVRFIRLVGTQNTVNRVFHVVGLEAMHTAKVPRLVNHFVAPKTNVATVEMSAIVTDGV  446

Query  443  CRSRNALLNGDTSNYDWDSGYTCHQVGSGSILIQLGQPYIIDSMRLLLWDCDDRSYSYYI  502
             R+RNAL+NGD   YDWDSGYTCHQ+GSG I+++LGQPY + SMRLLLWDCDDR+YS+YI
Sbjct  447  SRTRNALINGDYVRYDWDSGYTCHQLGSGEIVVRLGQPYYLGSMRLLLWDCDDRTYSFYI  506

Query  503  EVSGNSWSWVLVGDKTREACRSWQTIHFEPARPVVFIRIVGTHNTANEVFHCVHFECPAQ  562
            E+S N   W +V D+  +  RSWQ  HF P RPVV+IRIVGT NTANE+FHCVH ECP Q
Sbjct  507  EISTNRKEWQMVVDRRNDRTRSWQNFHFTP-RPVVYIRIVGTRNTANEIFHCVHLECPTQ  565


>A0A0B4KGU2_DROME unnamed protein product
Length=735

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 75/268 (28%), Positives = 118/268 (44%), Gaps = 23/268 (9%)

Query  24   TLSEDIGALYLSDDYSDVTLIVGG-------QRFNSHKIILAARSQYFRALLFGGLKEST  76
            T+ E   A++ ++  SDV  IVGG       Q   +HK ILA  S  F A+ +GGL E+ 
Sbjct  197  TVLERNAAMFNNELMSDVKFIVGGEFDIDPIQTIPAHKYILATGSSVFYAMFYGGLAENK  256

Query  77   QHEIELKDANLTGFKGLLEYIYTGRMSLTDRREEVVLDILGLAHLYGFSELEASISDYLR  136
            Q EI++ D   T F  LL Y+Y   + L     E +L  L  A  Y    L  +  +YL 
Sbjct  257  Q-EIKVPDVEPTAFLTLLRYLYCDEIKL---EPEHILATLYAAKKYIVPHLARACVNYLE  312

Query  137  EILNIKNVCLIFGTALLYRLEFLTKVCHEYMDEHACEVIQHESFLQLSADALNELVSRDS  196
              L  KN CL+   + L+    L + C E +D  A   ++ E F+ +       ++SR++
Sbjct  313  VKLTAKNACLLLSQSRLFEEPELMQRCWEVIDAQAEMAVKSEDFVDIDLKTFESILSRET  372

Query  197  FYAPEIDIFLAVRAW---------VNANPDADGK---TVLDKVRLNLVSITDLLNVVRPT  244
                EI +F A   W         ++  P    +     L  +R+  +S+ +  N V  T
Sbjct  373  LNCKEIHLFEAALNWAMNACEKMSIDDTPQNKRRLLGQALHLIRIPTMSLEEFANGVAQT  432

Query  245  GLISPEAILDAIAARTQTRDSDLNYRGR  272
            G++S +  +D     T      L +  R
Sbjct  433  GILSSQETIDMFLHFTAKMKPSLGFPTR  460


>Q9VEL0_DROME unnamed protein product
Length=677

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 75/268 (28%), Positives = 118/268 (44%), Gaps = 23/268 (9%)

Query  24   TLSEDIGALYLSDDYSDVTLIVGG-------QRFNSHKIILAARSQYFRALLFGGLKEST  76
            T+ E   A++ ++  SDV  IVGG       Q   +HK ILA  S  F A+ +GGL E+ 
Sbjct  197  TVLERNAAMFNNELMSDVKFIVGGEFDIDPIQTIPAHKYILATGSSVFYAMFYGGLAENK  256

Query  77   QHEIELKDANLTGFKGLLEYIYTGRMSLTDRREEVVLDILGLAHLYGFSELEASISDYLR  136
            Q EI++ D   T F  LL Y+Y   + L     E +L  L  A  Y    L  +  +YL 
Sbjct  257  Q-EIKVPDVEPTAFLTLLRYLYCDEIKL---EPEHILATLYAAKKYIVPHLARACVNYLE  312

Query  137  EILNIKNVCLIFGTALLYRLEFLTKVCHEYMDEHACEVIQHESFLQLSADALNELVSRDS  196
              L  KN CL+   + L+    L + C E +D  A   ++ E F+ +       ++SR++
Sbjct  313  VKLTAKNACLLLSQSRLFEEPELMQRCWEVIDAQAEMAVKSEDFVDIDLKTFESILSRET  372

Query  197  FYAPEIDIFLAVRAW---------VNANPDADGK---TVLDKVRLNLVSITDLLNVVRPT  244
                EI +F A   W         ++  P    +     L  +R+  +S+ +  N V  T
Sbjct  373  LNCKEIHLFEAALNWAMNACEKMSIDDTPQNKRRLLGQALHLIRIPTMSLEEFANGVAQT  432

Query  245  GLISPEAILDAIAARTQTRDSDLNYRGR  272
            G++S +  +D     T      L +  R
Sbjct  433  GILSSQETIDMFLHFTAKMKPSLGFPTR  460



Lambda      K        H
   0.318    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5035546020


Query= XP_003392868.1 ejaculatory bulb-specific protein 3 [Bombus
terrestris]

Length=125
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9W0X2_DROME  unnamed protein product                                 123     2e-37
PEB3_DROME  unnamed protein product                                   121     2e-36
Q9VBX5_DROME  unnamed protein product                                 27.7    2.8  


>Q9W0X2_DROME unnamed protein product
Length=121

 Score = 123 bits (308),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 80/120 (67%), Gaps = 3/120 (3%)

Query  1    MKIYLLLFTLVAVVCVTA---EDYTTKYDNVDVDRILQNGRILTNYIKCMLDEGPCTNEG  57
            MK  L L   V V    A   + YT KYD+V+VD +L N R+L NY+KC++D+GPCT EG
Sbjct  1    MKASLALVFCVCVGLAAAAPEKTYTNKYDSVNVDEVLGNNRVLGNYLKCLMDKGPCTAEG  60

Query  58   RELKKILPDALSTGCSKCNEKQKHTANKVVNYLRTKRPKDWERLSAKYDSSGEYKKRYEN  117
            RELK++LPDAL + CSKC E Q+  + KV+NYLR  +  +W+ L  KYD  G Y+ ++E 
Sbjct  61   RELKRLLPDALHSDCSKCTEVQRKNSQKVINYLRANKAGEWKLLLNKYDPQGIYRAKHEG  120


>PEB3_DROME unnamed protein product
Length=126

 Score = 121 bits (303),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 71/95 (75%), Gaps = 0/95 (0%)

Query  21   YTTKYDNVDVDRILQNGRILTNYIKCMLDEGPCTNEGRELKKILPDALSTGCSKCNEKQK  80
            YTTKYDN+DVD IL++ R+  NY KC++D G CT EGRELKK LPDAL T CSKC+EKQ+
Sbjct  21   YTTKYDNIDVDEILKSDRLFGNYFKCLVDNGKCTPEGRELKKSLPDALKTECSKCSEKQR  80

Query  81   HTANKVVNYLRTKRPKDWERLSAKYDSSGEYKKRY  115
               +KV+ Y+   +P++W++L AKYD    Y KRY
Sbjct  81   QNTDKVIRYIIENKPEEWKQLQAKYDPDEIYIKRY  115


>Q9VBX5_DROME unnamed protein product
Length=917

 Score = 27.7 bits (60),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 25/79 (32%), Positives = 37/79 (47%), Gaps = 7/79 (9%)

Query  26   DNVDVDRILQNGRILTNYIKCMLDEGP----CTNEGRELKKILPDALSTGCSKCNEKQKH  81
            DN + DRI Q  R L    +    + P    C  EGR L+KI+   +S G      + + 
Sbjct  682  DNNEADRIWQYERALETDSEIPFVKKPTVEKCEVEGRRLRKIMLKKISNGSELTPFQARQ  741

Query  82   TANKVV-NYLR--TKRPKD  97
            T +  + + LR  T+ PKD
Sbjct  742  TFSMYLESVLRRLTEDPKD  760



Lambda      K        H
   0.318    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5035546020


Query= XP_003392871.1 exosome complex component RRP42 isoform X1 [Bombus
terrestris]

Length=291
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q29QQ9_DROME  unnamed protein product                                 291     2e-98
Q8T4A9_DROME  unnamed protein product                                 93.2    3e-21
Q583T6_TRYB2  unnamed protein product                                 55.8    1e-08


>Q29QQ9_DROME unnamed protein product
Length=296

 Score = 291 bits (745),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 153/296 (52%), Positives = 209/296 (71%), Gaps = 5/296 (2%)

Query  1    MAETVLSSGEKTFILHGIDADFRNDGRRRCEYRSMEIETKLMPQTHGSARLRIGNTDILV  60
            MA   LS  EKT+ILHG++ DFR DGR R +YR M++ET L+    GSARLR+ NTDILV
Sbjct  1    MAYVALSEAEKTYILHGVEDDFRCDGRSRRDYRPMDLETGLVSNASGSARLRLANTDILV  60

Query  61   GIKIELDVPHADRSNEGKLEFFVDCSATATPAFEGKGGDDLATEISNILTAAYQTPNAFD  120
            G+K E+DVP+      GKLEFFVDCSA ATP FEG+GG DLA E+   L  AY++P AF+
Sbjct  61   GVKTEIDVPNPLTPEFGKLEFFVDCSANATPEFEGRGGSDLAQELILSLQNAYESPLAFN  120

Query  121  LRTLCILPHKKCWKIYVDILILQCGGNLFDAVGIAVKAALNSTEIPKITTATLDGGEPDI  180
             RTLC++P ++CWK+Y+DILIL+CGGNL DAV +A KAAL +T++P++T   LD G  D+
Sbjct  121  YRTLCLIPGQQCWKLYIDILILECGGNLHDAVSLAAKAALFNTKLPRVTATMLDAGITDL  180

Query  181  ELSDDAYDCIQLDTSNYPIIVTLCKIGDNYIVDPTSEEEVCSASSIVMSVLP-NGK--VS  237
             +SD+ YDC ++     P++VT+CKIGD  +VDP++EEEVCS  S+V+SV   NG+  +S
Sbjct  181  IISDNPYDCTRIGIETVPLLVTVCKIGDYVLVDPSAEEEVCSTVSMVVSVSMRNGQAFLS  240

Query  238  SVIKLGYGSIQPNTFIKMLQIGKNIGLQLNESLMKALK-EESQLGQQR-QILGFLR  291
                 G G++  +T    L++G  IG  L+  L K L  E+ ++G +R QI+GFL+
Sbjct  241  GTHLTGGGAMHRDTMRNCLELGLAIGEHLDRLLTKMLNLEQQRVGLKRPQIVGFLK  296


>Q8T4A9_DROME unnamed protein product
Length=412

 Score = 93.2 bits (230),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 73/261 (28%), Positives = 117/261 (45%), Gaps = 12/261 (5%)

Query  7    SSGEKTFILHGIDADFRNDGRRRCEYRSMEIETKLMPQTHGSARLRIGNTDILVGIKIEL  66
            S  E++F+   +  + R DGRR  E R +E+      +  GS  + +G+T +L  +  E+
Sbjct  13   SKPERSFVQLAVKQNQRLDGRRSNESRDVEL---TFGKDWGSVAVSMGDTKVLAQVTCEM  69

Query  67   DVPHADRSNEGKLEFFVDCSATATPAFEGKGGDDLATEISNILTAAYQTPNAFDLRTLCI  126
              P   R NEGK+   V     A         D  + +++++L   +++  + DL +LC+
Sbjct  70   GPPALSRPNEGKIHLNVYLGGVAFLDEAHTTHDQRSLKLNSLLERTFRSSRSIDLESLCV  129

Query  127  LPHKKCWKIYVDILILQCGGNLFDAVGIAVKAALNSTEIPKITTATLDGGEPDIELSDDA  186
               K  W I V++ +L   GNL+DA  IA  AAL     P +       GE  I      
Sbjct  130  AVEKHVWCIRVNVNVLNHDGNLYDASTIATLAALMHFRRPDV---WYKDGELRI-FKKKE  185

Query  187  YDCIQLDTSNYPIIVTLC--KIGDNYIVDPTSEEEVCSASSIVMSVLPNGKVSSVIKLGY  244
             + I L   +YP+ VT C  K     I+DPT  EE  + S IV+S         +  L  
Sbjct  186  REFIPLLFHHYPVSVTYCVYKSSVQPILDPTLLEENAADSVIVLSF---NSFQELCSLTA  242

Query  245  GSIQPNTFIKMLQIGKNIGLQ  265
            G   P     ++Q  +N  ++
Sbjct  243  GGTAPTNARIIMQCARNAAVR  263


>Q583T6_TRYB2 unnamed protein product
Length=363

 Score = 55.8 bits (133),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 71/171 (42%), Gaps = 8/171 (5%)

Query  1    MAETVLSSGEKTFILHGIDADFRNDGRRRCEYRSMEIETKLMPQTHGSARLRIGNTDILV  60
            +A   L+  E  F      A  R D R   + R + +E  L+  +     +R G + +  
Sbjct  10   IASPALTQREVEFTKSAWLAGLRPDQRTAQQMREVSVEFPLL--SRDVVVVRCGGSVVTA  67

Query  61   GIKIELDVPHADRSNEGKLEFFVDCSATA--TPAFEGKGGDDLATEISNILTAAYQTPNA  118
             I   L  P   R   G L F V    T   +PA +G    +L   +  ++    +T   
Sbjct  68   AIATALVEPTPQRPKHGLLHFSVRRLHTERDSPAADGSTQKNLVAFLERLV----RTGGV  123

Query  119  FDLRTLCILPHKKCWKIYVDILILQCGGNLFDAVGIAVKAALNSTEIPKIT  169
             D   LC+LP +K W + VD+ I+   GN  DA   AV A L     P++T
Sbjct  124  IDTAGLCVLPGQKVWSLTVDVTIMNDEGNCNDAAVWAVIALLMHHRRPELT  174


 Score = 33.1 bits (74),  Expect = 0.22, Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 26/38 (68%), Gaps = 0/38 (0%)

Query  211  IVDPTSEEEVCSASSIVMSVLPNGKVSSVIKLGYGSIQ  248
            +VDPT+ E + +ASSIV+++   G+V +V+K    SI 
Sbjct  261  VVDPTTAESLAAASSIVVAINAEGQVCTVVKAEGCSIH  298



Lambda      K        H
   0.318    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5035546020


Query= XP_003392873.1 GTP-binding protein Rheb homolog [Bombus terrestris]

Length=182
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RHEB_DROME  unnamed protein product                                   296     6e-104
RHEB_DICDI  unnamed protein product                                   192     5e-63 
RASC_DICDI  unnamed protein product                                   140     2e-42 


>RHEB_DROME unnamed protein product
Length=182

 Score = 296 bits (758),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 141/182 (77%), Positives = 159/182 (87%), Gaps = 0/182 (0%)

Query  1    MPPKQRKIAIMGYRSVGKSSLSIQFVEGQFVDSYDPTIENTFTKSTRVNSQDYEVKLVDT  60
            MP K+R IA+MGYRSVGKSSL IQFVEGQFVDSYDPTIENTFTK  RV SQDY VKL+DT
Sbjct  1    MPTKERHIAMMGYRSVGKSSLCIQFVEGQFVDSYDPTIENTFTKIERVKSQDYIVKLIDT  60

Query  61   AGQDEYSIFPTQYSMDIHGYVLVYSITSAKSFEVVQIIYDKLLDITGKVHVPIVLVGNKT  120
            AGQDEYSIFP QYSMD HGYVLVYSITS KSFEVV+IIY+KLLD+ GK +VP+VLVGNK 
Sbjct  61   AGQDEYSIFPVQYSMDYHGYVLVYSITSQKSFEVVKIIYEKLLDVMGKKYVPVVLVGNKI  120

Query  121  DLYVDRMITTEQGKRLADSWHAAFLETSAKQNESVADIFHTLLIEIEKADGNVQEKSNCI  180
            DL+ +R ++TE+GK+LA+SW AAFLETSAKQNESV DIFH LLI IE  +GN QEKS C+
Sbjct  121  DLHQERTVSTEEGKKLAESWRAAFLETSAKQNESVGDIFHQLLILIENENGNPQEKSGCL  180

Query  181  IS  182
            +S
Sbjct  181  VS  182


>RHEB_DICDI unnamed protein product
Length=185

 Score = 192 bits (489),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 126/182 (69%), Gaps = 2/182 (1%)

Query  2    PPKQRKIAIMGYRSVGKSSLSIQFVEGQFVDSYDPTIENTFTKSTRVNSQDYEVKLVDTA  61
            P K RKI +MG R+VGKS++++QFVE    DSY PTIENT+ K  R   Q+Y V+++DTA
Sbjct  3    PQKHRKICVMGSRAVGKSTITMQFVESHCPDSYHPTIENTYQKIIRHQGQEYSVEIIDTA  62

Query  62   GQDEYSIFPTQYSMDIHGYVLVYSITSAKSFEVVQIIYDKLLDITGKVHVPIVLVGNKTD  121
            GQDEYSI   QYS+ IHGY+LVYS+TS  S EV++++ DK+L   G   +P VLVGNK+D
Sbjct  63   GQDEYSILQKQYSIGIHGYILVYSVTSVSSLEVIKVLNDKILSSLGAEKIPRVLVGNKSD  122

Query  122  LYVDRMITTEQGKRLADSWHAAFLETSAKQNESVADIFHTLLIEIEKADGNVQ--EKSNC  179
            L  +R I+ +QG +LA+ W  AF+E S K NE+V ++F  +L E+ K     +  +K  C
Sbjct  123  LDNERNISRDQGIQLANEWECAFVECSGKNNENVEEVFKQILNEVNKGSTGPEPPQKEGC  182

Query  180  II  181
            I+
Sbjct  183  IL  184


>RASC_DICDI unnamed protein product
Length=189

 Score = 140 bits (353),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 111/183 (61%), Gaps = 8/183 (4%)

Query  7    KIAIMGYRSVGKSSLSIQFVEGQFVDSYDPTIENTFTKSTRVNSQDYEVKLVDTAGQDEY  66
            K+ I+G   VGKS+L+IQ  + QF+  YDPTIEN++ K   ++ + Y + ++DTAGQ+EY
Sbjct  6    KLVIVGDGGVGKSALTIQLTQNQFIAEYDPTIENSYRKQVNIDEEVYMLDILDTAGQEEY  65

Query  67   SIFPTQYSMDIHGYVLVYSITSAKSFEVVQIIYDKLLDITGKVHVPIVLVGNKTDLY-VD  125
            S    QY     G+++VYSI S  SFE V    +++L +      PIV++GNK DL   D
Sbjct  66   SAMRDQYIRSGRGFLIVYSIISRASFEAVTTFREQILRVKDLSTYPIVIIGNKADLPDKD  125

Query  126  RMITTEQGKRLADSWHAAFLETSAKQNESVADIFHTLLIEIEKADGNVQ-------EKSN  178
            R +   +GK LA S+ A FLETSAK   +V + F TL+ EI++ + N Q       +K  
Sbjct  126  RKVPPMEGKELAKSFGAPFLETSAKSRVNVEEAFFTLVREIKRWNQNPQNEEMLPPKKRG  185

Query  179  CII  181
            CII
Sbjct  186  CII  188



Lambda      K        H
   0.318    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5035546020


Query= XP_003392875.1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex
subunit 12 [Bombus terrestris]

Length=142
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

NDUAC_CAEEL  unnamed protein product                                  117     2e-34
G5ECX2_CAEEL  unnamed protein product                                 28.5    2.4  
C1716_DROME  unnamed protein product                                  27.3    5.9  


>NDUAC_CAEEL unnamed protein product
Length=146

 Score = 117 bits (293),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 87/139 (63%), Gaps = 2/139 (1%)

Query  3    NIAKFVGLDRACNYWRTIKANGGILNSLFTLYRVDELKAGTLVGVDKYGNKYYENNSNFV  62
            ++  ++G+D+   + + +K  GG+   L   Y +D  + GTLVG D +GN+YYENN+ FV
Sbjct  2    SLKAWLGIDKIQKFGQMVKEIGGVKAVLKKRYLMDATRVGTLVGSDNFGNRYYENNAYFV  61

Query  63   GSNRWVIYSEEVNMDYDGSQVPAEWFGWLHYKTDLIPTKDPNRPKYSWMADHKPNLSG-T  121
              NRWV + ++V +DYD +QVP EW  WLH+ TD  P+  P  P   W+ +HK N S   
Sbjct  62   PRNRWVEFPDKVWLDYDATQVPPEWHSWLHHITDDAPSVKPP-PTQDWVLEHKENTSIYA  120

Query  122  SEAYIPYTTTKPKIIPWKP  140
             + Y+PY+TT+ KI  W+P
Sbjct  121  DKKYVPYSTTRTKIQGWQP  139


>G5ECX2_CAEEL unnamed protein product
Length=1187

 Score = 28.5 bits (62),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 38/87 (44%), Gaps = 11/87 (13%)

Query  65   NRWVIYSEEVNMDYDGSQVPAEWFGWLHYKTDLIPTKDPNR--------PKYSWM-ADHK  115
            N W + +EEVN++ +  +V      W++Y   ++      R        PK  W+    +
Sbjct  655  NEWEVINEEVNVNKETFEVDITLTPWVNYTFRVVAVNSHGRSDMKIDGQPKEDWLTCQTR  714

Query  116  PNLSGTSEAYIPYTTTKPK--IIPWKP  140
            P+   T+   +    T+P   +I WKP
Sbjct  715  PSFPYTNPTGVKGEGTEPDNLVISWKP  741


>C1716_DROME unnamed protein product
Length=2313

 Score = 27.3 bits (59),  Expect = 5.9, Method: Composition-based stats.
 Identities = 14/45 (31%), Positives = 20/45 (44%), Gaps = 8/45 (18%)

Query  97    LIPTKDPNRPKYSWMADHKPNLSGTSEAYIPYTTTKPKIIPWKPP  141
             L P  DP  P ++W          TS+  I Y   + +I  W+PP
Sbjct  1958  LPPGVDPLPPAWNWQV--------TSDGDIYYYNLRERISQWEPP  1994



Lambda      K        H
   0.318    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5035546020


Query= XP_003392876.1 uncharacterized protein LOC100644354 [Bombus
terrestris]

Length=160
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PPK1_DICDI  unnamed protein product                                   28.5    3.2  
M9PDI0_DROME  unnamed protein product                                 28.1    3.7  
Q9VZL2_DROME  unnamed protein product                                 28.1    3.9  


>PPK1_DICDI unnamed protein product
Length=1053

 Score = 28.5 bits (62),  Expect = 3.2, Method: Composition-based stats.
 Identities = 24/85 (28%), Positives = 35/85 (41%), Gaps = 15/85 (18%)

Query  19   VRERERLIGMTEE-------ERAWRAR--YLKS-QILAPEEPLTTKEYYRHYYNPLRRLY  68
            + ER R I +T +       +RA + R  Y+ + + L PEE      Y     N  R L 
Sbjct  402  ILERVRFIAITSQNLDMYFCKRALKLRLGYISTRKTLKPEE-----HYINMVLNTTRNLI  456

Query  69   RIPLNALERVLTPLMGNKNAIITRY  93
                N    +L P + N N  I +Y
Sbjct  457  NEIYNIYMNILAPELSNNNVFIIKY  481


>M9PDI0_DROME unnamed protein product
Length=282

 Score = 28.1 bits (61),  Expect = 3.7, Method: Compositional matrix adjust.
 Identities = 20/63 (32%), Positives = 29/63 (46%), Gaps = 9/63 (14%)

Query  73   NALERVLTPLMGNKNAIITRYVIAKCLMGLVILYGARYYYKYNTGNWTRQSGWMVRPTRE  132
            N   RVL+   G +N + TR +  KC  G     G RY      G W++  G  +  TRE
Sbjct  174  NMRSRVLSLRKGEQNCLPTRTIQKKCKKG---ARGCRYEK----GEWSQCVGGQI--TRE  224

Query  133  ARI  135
             ++
Sbjct  225  DKL  227


>Q9VZL2_DROME unnamed protein product
Length=777

 Score = 28.1 bits (61),  Expect = 3.9, Method: Composition-based stats.
 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 1/40 (3%)

Query  41   KSQILAPEEPLTTKEYYRHYYNPLR-RLYRIPLNALERVL  79
            K Q +  + PLTT  Y+  Y N LR R Y   L+AL R L
Sbjct  280  KVQEIIHDLPLTTTPYFLGYMNQLRVRDYYNALSALHRAL  319



Lambda      K        H
   0.318    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5035546020


Query= XP_003392877.1 uncharacterized protein LOC100644354 [Bombus
terrestris]

Length=160
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PPK1_DICDI  unnamed protein product                                   28.5    3.2  
M9PDI0_DROME  unnamed protein product                                 28.1    3.7  
Q9VZL2_DROME  unnamed protein product                                 28.1    3.9  


>PPK1_DICDI unnamed protein product
Length=1053

 Score = 28.5 bits (62),  Expect = 3.2, Method: Composition-based stats.
 Identities = 24/85 (28%), Positives = 35/85 (41%), Gaps = 15/85 (18%)

Query  19   VRERERLIGMTEE-------ERAWRAR--YLKS-QILAPEEPLTTKEYYRHYYNPLRRLY  68
            + ER R I +T +       +RA + R  Y+ + + L PEE      Y     N  R L 
Sbjct  402  ILERVRFIAITSQNLDMYFCKRALKLRLGYISTRKTLKPEE-----HYINMVLNTTRNLI  456

Query  69   RIPLNALERVLTPLMGNKNAIITRY  93
                N    +L P + N N  I +Y
Sbjct  457  NEIYNIYMNILAPELSNNNVFIIKY  481


>M9PDI0_DROME unnamed protein product
Length=282

 Score = 28.1 bits (61),  Expect = 3.7, Method: Compositional matrix adjust.
 Identities = 20/63 (32%), Positives = 29/63 (46%), Gaps = 9/63 (14%)

Query  73   NALERVLTPLMGNKNAIITRYVIAKCLMGLVILYGARYYYKYNTGNWTRQSGWMVRPTRE  132
            N   RVL+   G +N + TR +  KC  G     G RY      G W++  G  +  TRE
Sbjct  174  NMRSRVLSLRKGEQNCLPTRTIQKKCKKG---ARGCRYEK----GEWSQCVGGQI--TRE  224

Query  133  ARI  135
             ++
Sbjct  225  DKL  227


>Q9VZL2_DROME unnamed protein product
Length=777

 Score = 28.1 bits (61),  Expect = 3.9, Method: Composition-based stats.
 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 1/40 (3%)

Query  41   KSQILAPEEPLTTKEYYRHYYNPLR-RLYRIPLNALERVL  79
            K Q +  + PLTT  Y+  Y N LR R Y   L+AL R L
Sbjct  280  KVQEIIHDLPLTTTPYFLGYMNQLRVRDYYNALSALHRAL  319



Lambda      K        H
   0.318    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5035546020


Query= XP_003392881.1 uncharacterized protein LOC100644871 [Bombus
terrestris]

Length=93
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9TZN2_CAEEL  unnamed protein product                                 28.9    0.43 
Q9Y1A7_DROME  unnamed protein product                                 27.3    2.2  
Q38BP4_TRYB2  unnamed protein product                                 25.4    9.5  


>Q9TZN2_CAEEL unnamed protein product
Length=245

 Score = 28.9 bits (63),  Expect = 0.43, Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 26/55 (47%), Gaps = 1/55 (2%)

Query  17   VRSYHVPNEVRPPSMDEVIVPQGSWQQSYFKAQQKHNLQLAAGIIILGATIAYGR  71
            VR YHV  E     +DE IVP G  Q   FK+Q + +     G I   A I Y +
Sbjct  155  VRDYHVRREELWGIIDEAIVP-GDCQIYSFKSQFEDDPFTEDGCIWALAFIFYNK  208


>Q9Y1A7_DROME unnamed protein product
Length=499

 Score = 27.3 bits (59),  Expect = 2.2, Method: Composition-based stats.
 Identities = 11/18 (61%), Positives = 14/18 (78%), Gaps = 1/18 (6%)

Query  72   VSGLLWLNFRPPKPEDRP  89
            VSGLLW+ ++ PK E RP
Sbjct  403  VSGLLWMRYKQPKTE-RP  419


>Q38BP4_TRYB2 unnamed protein product
Length=1056

 Score = 25.4 bits (54),  Expect = 9.5, Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 27/53 (51%), Gaps = 4/53 (8%)

Query  1    MLRHILQPIVRNTRNGV-RSYHVPNEVRPPSMDEVIVPQGSWQQSYFKAQQKH  52
            +L H+ +P+V +  +G+  S+ V  E RP    EV    G    S F+  +KH
Sbjct  54   VLSHMFEPVVTSVEHGIAESHEVTGESRPTG--EVCADSGDGCPS-FEEHRKH  103



Lambda      K        H
   0.318    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5035546020


Query= XP_003392882.1 exocyst complex component 1 [Bombus terrestris]

Length=859
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

EXOC1_DROME  unnamed protein product                                  798     0.0   
EXOC1_CAEEL  unnamed protein product                                  415     9e-132
Q9VXU2_DROME  unnamed protein product                                 33.1    1.2   


>EXOC1_DROME unnamed protein product
Length=889

 Score = 798 bits (2060),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/890 (48%), Positives = 598/890 (67%), Gaps = 38/890 (4%)

Query  1    MAAIRHTLQREVFTPSDEKLLSVCYVSKAYRKKKMSFLCLTTTTDSPSSLLLYQVKKNDK  60
            MA I+HTLQ+E+F  S E+LLSV  V K   KK   +LC+ TT      + L  +K++++
Sbjct  7    MANIKHTLQKELFLASGERLLSVVTVVKKKDKKP-CYLCVVTTAPPVPVVTLCLIKQSEQ  65

Query  61   --NVFKKKQSWPLSDIQIVDGVKN--DSMDIELHIDKVYKWSVTTAQERRTFIS--NLYT  114
                +K+K+SW L +I+ VDG     ++ + +L ++K+YKW      ER+ F++  N   
Sbjct  66   REGEYKRKRSWQLDEIKWVDGRNEQFETHEFDLQLEKLYKWYALNPHERQNFLAVLNRQI  125

Query  115  YSCNLAQRPQFKNIPKELLID--PSSLKESDSITFTPELLTSPI----SSDYQPITEKEA  168
                  QR +F+N+P   L +  P  +    ++  T  +         + ++  +T+KEA
Sbjct  126  QKSVRGQRAEFRNVPAAWLSEKSPEKVALGRAVQKTQHMDDEEDEEEEAQEFTALTDKEA  185

Query  169  ADLKQLMEDCEYAVSNAELFMETLSKDLSILDGENVQSVLASEACVTQLMNSIEAAITEA  228
             +L +L  +C++A+ +AE F+E LS++L  LDG N+QSVLASE  V ++M  I+ AI+EA
Sbjct  186  NELGKLFSECDFAIKDAEQFIEQLSRELHDLDGANMQSVLASEQKVLKMMEHIDNAISEA  245

Query  229  SIVESRLAAYDEALGRIREVMARVGQKNQAIHTANNNARLLLDQLNTVISQLDISPTHQR  288
               E+RL +Y++ LG ++E M ++G KN  I  ANNN   L+ +LN VISQLD+  + Q+
Sbjct  246  DKFENRLDSYEDILGHVKETMEKIGGKNAMIEIANNNNIKLMKELNKVISQLDLPHSQQQ  305

Query  289  VLSEAELP---GEKEELSQAGAALLKATTAPLPPGLDKLSAVTEQKRRLDKLRVKFSVIV  345
             L E +L    G K  ++ A   L +A  + + P L +L AV +Q++R +K + KFS  V
Sbjct  306  ALDEPDLKTANGRKAAIA-AAQCLQQAMNSDIDPALLRLEAVQDQRKRFEKWKQKFSATV  364

Query  346  ARHLNNLFIHLGNDVGDMSTSMTDLILPTHQAVHHELEPYTELMQLLRALDNKAFVQLTK  405
            +R +NNLFIHLGN++GDM  + T+L LP H  VH EL PYTELM   +A+D K +  L +
Sbjct  365  SRFMNNLFIHLGNEIGDMQVTSTELTLPNHSNVHRELTPYTELMHWTKAMDRKTYDGLMR  424

Query  406  VYTDTMSKLYKRDLKRFFEEAK----NKLICKRLQANTSKSSGQKVEDLLNPAPICLLSG  461
            VYT ++SK+Y RD++ FF  AK     KL   R   + S SS +     + P     ++ 
Sbjct  425  VYTASLSKIYDRDVRNFFNLAKIQVTEKLRNSREDLDMSTSSRKSAVSTI-PYGTLGINR  483

Query  462  ETWAP---VGEGNLLDSVLDCLLSQMQPVCLAEQAFCISFLQLDSVLSPSKSS-----EM  513
            + W P     +    D++L+ +L++++P+ L EQ FCI+F Q+D V+SP+  +     EM
Sbjct  484  DQWGPGVETADRMRFDALLEKVLAELEPIALQEQLFCINFFQMD-VISPTTKNTQTTLEM  542

Query  514  EE----TDNVSNGAASPGSVTSTASKKLERQVNEEVRATMAAIFPSLETELNNFIAFLDK  569
            E+    T ++ +GA SP S      K+++RQ+NE+VR  M  +F  LE EL +FI   ++
Sbjct  543  EKAVDMTQSIISGAVSP-SGDGVPQKRIDRQINEDVRKLMMGLFGCLEPELVSFIQSFER  601

Query  570  IDSFWCMYVLVRLSQHVMSAQDTGSFLSMTFASALIQVKRAFDKFMQTQLQSILCDTKVN  629
            +DSF+ +YV VRL+QHVMSAQDT SFLSMTFASAL+QVKR+FD+FMQ QL SI  + K++
Sbjct  602  VDSFYSLYVFVRLTQHVMSAQDTHSFLSMTFASALVQVKRSFDRFMQNQLLSIR-EAKLH  660

Query  630  RRNKCGILPYVENFGPFARTAEKIFKNSDRKVDLEKWYTKLVSTMFEAIVIHSREHHKTP  689
            +R+K  ILPYVENF  FA+TAE IF+ SDR+ D+EKWY +LV+ +FE I +HS+EH KTP
Sbjct  661  KRSK-AILPYVENFENFAQTAEGIFRKSDRRTDMEKWYLQLVNAIFEGIQLHSQEHPKTP  719

Query  690  QEVIKMENFHHLYDLLSQLKIPIFDHERKEAKQKYQDALRAYVTQYFGRPLEKLNLFFEG  749
             +V++MEN+HH+Y LL+QLK+P  D  +KEAK+ Y DAL+AYVTQYFGRPLEKLN FFEG
Sbjct  720  VQVVRMENYHHMYALLAQLKVPGLDALKKEAKKCYNDALKAYVTQYFGRPLEKLNQFFEG  779

Query  750  VQAKVGAGVKESEVSYQMAFSKQELRRVVKEYPAREVKKGLENLYRKVEKHLCEEENLLQ  809
            VQ KV  GVKE+E+SYQMAFSKQELR+V+ +YPAREVKKGLENLY+KVEKHL EEENLLQ
Sbjct  780  VQLKVAQGVKETEISYQMAFSKQELRKVIAQYPAREVKKGLENLYKKVEKHLSEEENLLQ  839

Query  810  VVWREMQGEFIAQYIYIEELIQRCYPDSMVTLEFTIQDILEFFSEIARSH  859
            VVW  MQ EFIAQY Y+EE IQ+CY  +M+ LEF IQDIL FFS+IARSH
Sbjct  840  VVWHAMQEEFIAQYNYLEERIQKCYAGAMINLEFNIQDILAFFSDIARSH  889


>EXOC1_CAEEL unnamed protein product
Length=848

 Score = 415 bits (1066),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 282/880 (32%), Positives = 466/880 (53%), Gaps = 53/880 (6%)

Query  1    MAAIRHTLQREVFTPSDEKLLSVCYVSK--AYRKKKMSFLCLTTTTDSPSSLLLYQVKKN  58
            M+AIR  +QR++F   DE++ ++  VSK    +KK  + LCL  T + P ++ LY VK  
Sbjct  1    MSAIRKIIQRQLFQKDDERIQAIVNVSKLDGKKKKNQTLLCLAVTIEHPIAVRLYFVKGE  60

Query  59   DKNVFKKKQSWPLSDIQIVDGVKNDSMDIELHI---DKVYKWSVTTAQERRTFISNLYTY  115
              + FKKK  + L +++ +DG+       E HI   D  Y     +A+E+  FI  LY  
Sbjct  61   KDDTFKKKDRFNLREVREIDGINPKKASPEFHITIGDHQYVILAGSAEEKDEFIRELYKL  120

Query  116  SCNL--AQRPQFKN--IPK---ELLIDPSSLKESDSITFTPELLTSPISSDYQPITEKEA  168
            SC     Q P F N  +P+   E  I P  L E D            + SDYQPI+ KE 
Sbjct  121  SCQYLPVQMPDFCNFSLPQLESETSIIPIELPEHDM----------AMQSDYQPISNKED  170

Query  169  ADLKQLMEDCEYAVSNAELFMETLSKDLSILDGENVQSVLASEACVTQLMNSIEAAITEA  228
            AD ++L+      +  A +F E L++ L  LDG N+ S++ SE  V QL++SI+AA+T  
Sbjct  171  ADFRKLIARANLTIGEAHIFAEMLTEQLQSLDGANINSMMDSENSVNQLLSSIDAALTGV  230

Query  229  SIVESRLAAYDEALGRIREVMARVGQKNQAIHTANNNARLLLDQLNTVISQLD-ISPTHQ  287
              VE  L   D+ L  +R  +  + +K+        N + L +++ + ++ L  ++ +H 
Sbjct  231  ESVEKELDRCDDILAFVRNSIELIEEKDSLSVVERKNKQRLNEEIVSFVNSLQAVTDSHI  290

Query  288  RVLSEAEL--PGEKEELSQAGAALLKATTAPLPPGLDKLSAVTEQKRRLDKLRVKFSVIV  345
              L +A    P   +  + A  A+ +     +   + ++ A  ++   L  + V F   +
Sbjct  291  ETLKQANFSNPESVQRCTDAARAVAQFWHGRISKPMLQMKAYQDRNDELTAVDV-FVDRL  349

Query  346  ARHLNNLFIHLGNDVGDMSTSMTDLILPTHQAVHHELEPYTELMQLLRALDNKAFVQLTK  405
              HL+ LF +L ND+  +     +L +P        L P ++L+  L+    KA   + +
Sbjct  350  MSHLSALFSNL-NDLS-LDHEWHELCIPKQSQRFRALSPLSDLINWLKTNRPKACNLVLQ  407

Query  406  VYTDTMSKLYKRDLKRFFEEAKNKLICKRLQANTSKSSGQKVEDLLNPAPICLLSGE---  462
             Y D+ + LYKR    FFE     LI K  +AN+S+   +  E     A I L S     
Sbjct  408  KYIDSTNLLYKRLFDNFFE----TLINKVPKANSSEKKSKANE----SANISLRSDNQSF  459

Query  463  -TWAPVGEGNLLDSVLDCLLSQMQPVCLAEQAFCISFLQLDSVLSPSKSSEMEETDNVSN  521
             + +   +  +L  +++ +L+++  V  AEQ F + F  ++S L       + + D  S 
Sbjct  460  LSTSSEIDTEVLPQLIETVLAELSAVIDAEQKFVVRFFHINSEL-------LAQFDTTST  512

Query  522  GAASPGSVTSTASKKLERQVNEEVRATMAAIFPSLETELNNFIAFLDKIDSFWCMYVLVR  581
            G+      +S   + +E+ +NE+VR  M  +F SL   L++F   + + +    + + V 
Sbjct  513  GSGD---SSSLGGRSMEKHMNEQVRHVMGNLFDSLNIHLDSFCRAVCRHNPSNVLLLFVI  569

Query  582  LSQHVMSAQDTGSFLSMTFASALIQVKRAFDKFMQTQLQSILCDTKVNRRNKCGILPYVE  641
            +S+ V+  QD  S+ S+TF S ++ +KR FD F+Q +  S   + ++ ++ + GILP + 
Sbjct  570  MSKKVLLPQDPSSYFSITFGSLVVLIKRQFDAFIQMEC-SQYSEVRIAKKTRIGILPSIF  628

Query  642  NFGPFARTAEKIFKNSDRKVDLEKWYTKLVSTMFEAI-VIHSREHHKTPQEVIKMENFHH  700
             F  F R AE IF+N++R+ DLEK Y  L   + + I    + ++ K+P  V+K EN+H 
Sbjct  629  RFANFVRRAEIIFENAERRTDLEKAYFNLCRAVCDGIQKAAANQYSKSPSSVVKFENYHE  688

Query  701  LYDLLSQLKIPIFDHERKEAKQKYQDALRAYVTQYFGRPLEKLNLFFEGVQAKVGA-GVK  759
            LY  LS+LKI   D +RK+AK   ++ + AYV ++ GRPL+++  FF+ V   +   G++
Sbjct  689  LYLTLSELKISCLDQQRKDAKALKEEHIDAYVKEFMGRPLKEIQTFFDNVNNFIETRGIR  748

Query  760  ESEVSYQMAFSKQELRRVVKEYPAREVKKGLENLYRKVEKHLCEEENLLQVVWREMQGEF  819
              E+SYQ  FS+ EL++V+ ++P +EVKKGLE LY+K+EK+L    +LLQVVWR+MQ +F
Sbjct  749  PDEISYQQQFSRIELKKVISQHPGKEVKKGLEQLYKKIEKNLVANSSLLQVVWRDMQEQF  808

Query  820  IAQYIYIEELIQRCYPDSMVTLEFTIQDILEFFSEIARSH  859
            + Q     +LI  CYP S + LE +   +L+FFSEIA+ H
Sbjct  809  VKQIAEYNKLILTCYPGSKIELEVSTDTVLQFFSEIAQQH  848


>Q9VXU2_DROME unnamed protein product
Length=1398

 Score = 33.1 bits (74),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 36/67 (54%), Gaps = 3/67 (4%)

Query  273  LNTVISQLDISPTH--QRVLSEAELPGEKE-ELSQAGAALLKATTAPLPPGLDKLSAVTE  329
            LN+ +SQL    T+  Q VL+E   PG+ E E  QAG A ++         L+ L+   E
Sbjct  4    LNSSLSQLKGQLTNLAQEVLAETAGPGDLEYEGHQAGGASVQDAEQQAKTALELLAETQE  63

Query  330  QKRRLDK  336
            QK +LDK
Sbjct  64   QKEQLDK  70



Lambda      K        H
   0.318    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5035546020


Query= XP_003392883.1 microfibrillar-associated protein 1 [Bombus
terrestris]

Length=459
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MFAP1_DROME  unnamed protein product                                  395     5e-134
MFAP1_CAEEL  unnamed protein product                                  270     9e-86 


>MFAP1_DROME unnamed protein product
Length=478

 Score = 395 bits (1014),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 208/320 (65%), Positives = 268/320 (84%), Gaps = 3/320 (1%)

Query  137  ERTRERIKLESSDSSEDEELSDSEIERRREALKQRVLSKKENEEELIHGEEDERSGDTSE  196
            +R   +I L +S+S  D ELSD+E+E RR  L+ R+L +++ EEE++  E++++S  +  
Sbjct  159  QRGTNKITL-ASESDTDAELSDTELENRRTKLRSRML-QQQREEEVLQKEDEKQSESSES  216

Query  197  ESSEYEEYTDSEEETGPRLKPVFVRKKDRITVMEKEKEAMKQKQAEIEAKKLAEERKRQT  256
            ESSEYEE T+SEE+  PRLKP+FVRK+DR T+ EKE+EA KQKQ E EAK+ A+ER+R T
Sbjct  217  ESSEYEEETESEEDNEPRLKPLFVRKRDRATIQEKEREAQKQKQLEAEAKRAAKERRRAT  276

Query  257  LRMVEEAIRKEAQVGKTTSEHEGKLEDVCTDDENDEVEYEAWKLRELKRIKRDREEREQL  316
            LRMVEE+++K+ +  K  + +E  +EDVCTDDENDEVEYEAWKLRELKR+KRDREER+ +
Sbjct  277  LRMVEESVKKDLEKTKPET-NEACIEDVCTDDENDEVEYEAWKLRELKRMKRDREERDNV  335

Query  317  EKERLEVERIRNMTEEERRQEVRLNPKVITNKAAKGKYKFLQKYYHRGAFYLDKEDNIFK  376
            E+E+L+++R+RNMTEEERRQE+R NPKV+TNKA KGKYKFLQKYYHRGAFYLD+E+++ K
Sbjct  336  EREKLDIDRMRNMTEEERRQELRQNPKVVTNKATKGKYKFLQKYYHRGAFYLDEENDVLK  395

Query  377  RDFSGATLEDHFDKTILPKVMQVKNFGRSGRTKYTHLVDQDTTQFDSPWISETAQNLKFH  436
            RDF+ ATLEDHFDKTILPKVMQVKNFGR GRTKYTHLVDQDTT+FDSPW +E++ N+KFH
Sbjct  396  RDFAQATLEDHFDKTILPKVMQVKNFGRCGRTKYTHLVDQDTTKFDSPWYAESSSNIKFH  455

Query  437  NNQAAGMKQVFERPSLKKRK  456
            N  A GM+Q F++P+  KRK
Sbjct  456  NEHAGGMRQQFDKPTGSKRK  475


>MFAP1_CAEEL unnamed protein product
Length=466

 Score = 270 bits (691),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 139/245 (57%), Positives = 183/245 (75%), Gaps = 0/245 (0%)

Query  213  PRLKPVFVRKKDRITVMEKEKEAMKQKQAEIEAKKLAEERKRQTLRMVEEAIRKEAQVGK  272
            PRLKP+F RKKDRIT+ E EKE  K+   +IE +K AEERKR++ ++VE+ +++E    K
Sbjct  222  PRLKPIFTRKKDRITLQEAEKEKEKEILKKIEDEKRAEERKRESAKLVEKVLQEEEAAEK  281

Query  273  TTSEHEGKLEDVCTDDENDEVEYEAWKLRELKRIKRDREEREQLEKERLEVERIRNMTEE  332
              +E    L  V TDDE + + YEAWKLRE+KR+KR+R+ERE+  +E+ E+++I  M+EE
Sbjct  282  RKTEDRVDLSSVLTDDETENMAYEAWKLREMKRLKRNRDEREEAAREKAELDKIHAMSEE  341

Query  333  ERRQEVRLNPKVITNKAAKGKYKFLQKYYHRGAFYLDKEDNIFKRDFSGATLEDHFDKTI  392
            ER + +RLNPKVITNK  KGKYKFLQKY+HRGAF+LD+ED + KR+F+ AT +D FDKTI
Sbjct  342  ERLKYLRLNPKVITNKQDKGKYKFLQKYFHRGAFFLDEEDEVLKRNFAEATNDDQFDKTI  401

Query  393  LPKVMQVKNFGRSGRTKYTHLVDQDTTQFDSPWISETAQNLKFHNNQAAGMKQVFERPSL  452
            LPKVMQVKNFG++ RTKYTHL ++DTT     W S    N +F   +A G + VFERP+ 
Sbjct  402  LPKVMQVKNFGKASRTKYTHLTEEDTTDHQGVWASTNQLNSQFSTKRAGGSRPVFERPAT  461

Query  453  KKRKN  457
            KKRKN
Sbjct  462  KKRKN  466



Lambda      K        H
   0.318    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5035546020


Query= XP_003392884.1 LOW QUALITY PROTEIN: FAS-associated factor 1 [Bombus
terrestris]

Length=647
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A0A0B4LFH2_DROME  unnamed protein product                             447     6e-149
Q7JUP3_DROME  unnamed protein product                                 447     6e-149
UBXN3_CAEEL  unnamed protein product                                  125     7e-30 


>A0A0B4LFH2_DROME unnamed protein product
Length=690

 Score = 447 bits (1150),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 264/702 (38%), Positives = 404/702 (58%), Gaps = 67/702 (10%)

Query  1    MAGIRDEILANFQACTGIDDVGDAIKYLEESNWDLLAAVNQAMLHGTQQLPSEVSPDIEM  60
            M+  +DE L +FQ+ TGIDDVG+A  +LE ++W+L+ A+++ + H    L    SP   +
Sbjct  1    MSENKDEALTSFQSITGIDDVGEAFSHLEAADWNLVEALSRVIPHEDAPL---TSPHPIL  57

Query  61   IEEIERMPQAHSLSSQTNCDPKSNSKVEVTENSK------------------PGTSK---  99
            + E    P  +++ S     P    ++  T N+                   P   +   
Sbjct  58   VPE---PPARNAVESTNGFRPPGFDEMPGTSNASGFFAAALQNQNQNLNLNQPHIQQRFP  114

Query  100  ----------PKSCEK--ERTLTFHINHLNNE-YKINLSEFSSLKDLKQLIWVQTNVPPC  146
                      P S +   +  +TF+I H N + Y++ L   ++++ LK+ I+ +T+VP C
Sbjct  115  TQLTSSINLDPASSQNNNQNVITFNI-HFNQQLYQLRLPSEATVEQLKRKIFAETSVPVC  173

Query  147  QQRLYGWKKEPKSDYRSLQS----LDLPKENTLYMSPATEDVDLTTDIVSLSNRMTQTYT  202
            +Q + GW     SD + L +    LDL  EN L +   TED  + T+   ++ R+ + +T
Sbjct  174  RQAIRGWPPSKASDAQQLGTRLCNLDLSPENELILVDLTEDGFMDTEQDEVTQRVDKDFT  233

Query  203  LNIKNEINKETYNLKFPGTNTILDVKSGIYSLTAVPVRNQQWKGWPSLVKNDNVMLAQSG  262
            + I+ E +     L  PG  T+ +VK  ++ + ++PVR+Q+W GWP+   ND   LAQSG
Sbjct  234  IFIQFE-SDPPLTLSLPGRMTVQEVKMNVFDIKSIPVRHQEWTGWPNGCDNDTT-LAQSG  291

Query  263  ISYPEHDLSVNEI----PIKKERKEVIDLVESDSSIDEDDIEDD--------VFVDNVRS  310
            I    H  +V       P    +    D+V  DS    D+ ED         +F D+  +
Sbjct  292  IGL-SHRFAVRSTERSAPTNSNQHNAFDVVTVDSESSTDEFEDATDFNNAEYIFTDSPPA  350

Query  311  TKTQR-LMPENVTDETIGTMHFAEEFEKRYGPAHPEFFTGTFKDAVKESCLKPAKERKLL  369
                R L+P +  DE  G+  F E ++ RYG   PEFF G+ ++A + +CL+ AKERKLL
Sbjct  351  QPPNRHLIPNDTDDEISGSTQFVENYKARYGEPCPEFFVGSLENAKQLACLRSAKERKLL  410

Query  370  AVYLHHDNSVLANVFCTQLLSCEAVLQVLSANFIVWGWDITFESNKQKFLSSVKQTLGSF  429
            A+YLHH  S+L+NVFC QL+  E+++Q     F+++GWD+T+ESNK  FLSS+   + S 
Sbjct  411  AIYLHHGKSILSNVFCDQLMKHESIIQTFKEKFVLYGWDMTYESNKDMFLSSLTACISSN  470

Query  430  ATLAMENIDVDTLPALVIIMRARSI---TEMFTVIHANVGVNELLTNLIHVVEVFQEQRR  486
            A+L   NI +D LPA++++ ++R +    E+ +VIH N+G+++LLT LI   E+F+EQ +
Sbjct  471  ASLTARNIKLDKLPAIMLVGKSRQLGSNCEVLSVIHGNIGLDDLLTRLIETCEMFEEQLQ  530

Query  487  TDIGVEEERQARERVKQEQDRAYQESLAADRAKEEAKQMQEELEKQRKEQAENERLAEEA  546
             +I  E+ER AR++VK EQD AYQE+L AD AK+ AK+ +E  +   +++ E+ER  E+A
Sbjct  531  VEIRQEDERAARDQVKAEQDMAYQETLQADMAKDAAKRQKEAAQLAERKRMESERAEEDA  590

Query  547  RKEAHRQAVESSLPPEP-QQSTGDGVLKVRVRLPAGKFLERRFQSDTPLQTLLNFLIVEG  605
            R+E+ R   + SLP EP +Q TG    K+RVR P G FLERRF  +  LQ LLNF+   G
Sbjct  591  RRESIRLVAQQSLPQEPSEQETGTS--KIRVRKPTGDFLERRFFINNNLQDLLNFVTANG  648

Query  606  YPTEEYKVLCSWPRRDLTSMDSKLTLMDLKFCPQETVILEER  647
            +  EEYK++ SWPRRDLT+++S  TL  LK  PQETVILEER
Sbjct  649  FLIEEYKLISSWPRRDLTAIESSQTLESLKLYPQETVILEER  690


>Q7JUP3_DROME unnamed protein product
Length=695

 Score = 447 bits (1151),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 265/704 (38%), Positives = 405/704 (58%), Gaps = 66/704 (9%)

Query  1    MAGIRDEILANFQACTGIDDVGDAIKYLEESNWDLLAAVNQAMLHGTQQLPSE---VSPD  57
            M+  +DE L +FQ+ TGIDDVG+A  +LE ++W+L+ A+++ + H    L S    + P+
Sbjct  1    MSENKDEALTSFQSITGIDDVGEAFSHLEAADWNLVEALSRVIPHEDAPLTSPHPILVPE  60

Query  58   IEMIEEIE-----RMPQAHSLSSQTNCD-------------------------PKSNSKV  87
                  +E     R P    +   +N                           P S    
Sbjct  61   PPARNAVESTNGFRPPGFDEMPGTSNASGFFAAALQNQNQNLNLNQPHIQQRFPTSQLLA  120

Query  88   EVTE--NSKPGTSKPKSCEKERTLTFHINHLNNE-YKINLSEFSSLKDLKQLIWVQTNVP  144
            ++T   N  P +S+  +   +  +TF+I H N + Y++ L   ++++ LK+ I+ +T+VP
Sbjct  121  QLTSSINLDPASSQNNN---QNVITFNI-HFNQQLYQLRLPSEATVEQLKRKIFAETSVP  176

Query  145  PCQQRLYGWKKEPKSDYRSLQS----LDLPKENTLYMSPATEDVDLTTDIVSLSNRMTQT  200
             C+Q + GW     SD + L +    LDL  EN L +   TED  + T+   ++ R+ + 
Sbjct  177  VCRQAIRGWPPSKASDAQQLGTRLCNLDLSPENELILVDLTEDGFMDTEQDEVTQRVDKD  236

Query  201  YTLNIKNEINKETYNLKFPGTNTILDVKSGIYSLTAVPVRNQQWKGWPSLVKNDNVMLAQ  260
            +T+ I+ E +     L  PG  T+ +VK  ++ + ++PVR+Q+W GWP+   ND   LAQ
Sbjct  237  FTIFIQFE-SDPPLTLSLPGRMTVQEVKMNVFDIKSIPVRHQEWTGWPNGCDNDTT-LAQ  294

Query  261  SGISYPEHDLSVNEI----PIKKERKEVIDLVESDSSIDEDDIEDD--------VFVDNV  308
            SGI    H  +V       P    +    D+V  DS    D+ ED         +F D+ 
Sbjct  295  SGIGL-SHRFAVRSTERSAPTNSNQHNAFDVVTVDSESSTDEFEDATDFNNAEYIFTDSP  353

Query  309  RSTKTQR-LMPENVTDETIGTMHFAEEFEKRYGPAHPEFFTGTFKDAVKESCLKPAKERK  367
             +    R L+P +  DE  G+  F E ++ RYG   PEFF G+ ++A + +CL+ AKERK
Sbjct  354  PAQPPNRHLIPNDTDDEISGSTQFVENYKARYGEPCPEFFVGSLENAKQLACLRSAKERK  413

Query  368  LLAVYLHHDNSVLANVFCTQLLSCEAVLQVLSANFIVWGWDITFESNKQKFLSSVKQTLG  427
            LLA+YLHH  S+L+NVFC QL+  E+++Q     F+++GWD+T+ESNK  FLSS+   + 
Sbjct  414  LLAIYLHHGKSILSNVFCDQLMKHESIIQTFKEKFVLYGWDMTYESNKDMFLSSLTACIS  473

Query  428  SFATLAMENIDVDTLPALVIIMRARSI---TEMFTVIHANVGVNELLTNLIHVVEVFQEQ  484
            S A+L   NI +D LPA++++ ++R +    E+ +VIH N+G+++LLT LI   E+F+EQ
Sbjct  474  SNASLTARNIKLDKLPAIMLVGKSRQLGSNCEVLSVIHGNIGLDDLLTRLIETCEMFEEQ  533

Query  485  RRTDIGVEEERQARERVKQEQDRAYQESLAADRAKEEAKQMQEELEKQRKEQAENERLAE  544
             + +I  E+ER AR++VK EQD AYQE+L AD AK+ AK+ +E  +   +++ E+ER  E
Sbjct  534  LQVEIRQEDERAARDQVKAEQDMAYQETLQADMAKDAAKRQKEAAQLAERKRMESERAEE  593

Query  545  EARKEAHRQAVESSLPPEP-QQSTGDGVLKVRVRLPAGKFLERRFQSDTPLQTLLNFLIV  603
            +AR+E+ R   + SLP EP +Q TG    K+RVR P G FLERRF  +  LQ LLNF+  
Sbjct  594  DARRESIRLVAQQSLPQEPSEQETGTS--KIRVRKPTGDFLERRFFINNNLQDLLNFVTA  651

Query  604  EGYPTEEYKVLCSWPRRDLTSMDSKLTLMDLKFCPQETVILEER  647
             G+  EEYK++ SWPRRDLT+++S  TL  LK  PQETVILEER
Sbjct  652  NGFLIEEYKLISSWPRRDLTAIESSQTLESLKLYPQETVILEER  695


>UBXN3_CAEEL unnamed protein product
Length=613

 Score = 125 bits (313),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 114/400 (29%), Positives = 198/400 (50%), Gaps = 34/400 (9%)

Query  275  IPIKKERKEV--IDLVESDSSI-----DEDDIEDDVFVDNVRSTKTQR------LMPENV  321
            IPI   R +V  +D  E D S+     D+DD   +V    V +  +        ++P+  
Sbjct  219  IPINPRRVDVFNVDSDEDDDSMAIAYEDDDDGVHEVHHSEVVARGSGPPNGRIPMIPDGF  278

Query  322  TDETIGTMHFAEEFEKRYGPA------HPEFFTGTFKDAVKESCLKPAKE-RKLLAVYLH  374
            +  +    +F   F  R+          P F+T     AVKE+   P  E R+ L  Y++
Sbjct  279  SSVSDALRNFVAIFSDRFCSTPQTQAFMPPFYTEPLPAAVKEAFDHPNSEHRRPLLFYIN  338

Query  375  HDNSVLANVFCTQLLSCEAVLQVLSANFIVWGWDITFESNKQKFLSSVKQT-LGSFAT--  431
            HD S+ AN+F +Q+L  E V  ++   ++++ WDIT +SN   FL  ++   +G   T  
Sbjct  339  HDRSIAANIFASQVLCSETVSTLIRHQYVLFPWDITSDSNLMLFLEYLQAANMGDVRTII  398

Query  432  --LAMENIDVDTLPALVIIMRARSITEMFTVIHANVGVNELLTNLIHVVEVFQEQRRTDI  489
              LAM  I+  + P + I+++ R+   +          ++++  L+  V  + + R  + 
Sbjct  399  QRLAMSKIE--SFPLMAIVVKERNSYRLVDYCRGTDTSDQVMEKLLSGVSEYSDIRMNEQ  456

Query  490  GVEEERQARERVKQEQDRAYQESLAADRAKEEAKQMQEELEKQRKEQAENERLAEEARKE  549
                ER+ RE ++ +Q+  Y+ SLAAD+A+ EAKQ + E ++  +E+   E   E  R  
Sbjct  457  SERREREEREAIRNQQEAEYKASLAADKARMEAKQQEIEEQRLEEERKLREEEEECVR--  514

Query  550  AHRQAVESSLPPEPQQSTGDG-VLKVRVRLPAGKFLERRFQSDTPLQTLLNFLIVEGYPT  608
              RQ V S++P EP  S     ++ V+ RLP G    RRF+    +QTL+N+L  +GY  
Sbjct  515  --RQTVASTVPEEPPASAPLAEIINVKFRLPEGGQDMRRFRRLESIQTLINYLSSKGYSP  572

Query  609  EEYKVLCS-WPRRDLT-SMDSKLTLMDLKFCPQETVILEE  646
            +++K   S +P++++T   D      D K+  +E + +EE
Sbjct  573  DKFKYFNSDFPKKEITRHFDLSHNFADTKWPAREQIFVEE  612



Lambda      K        H
   0.318    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5035546020


Query= XP_003392885.1 importin-7 [Bombus terrestris]

Length=1057
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VSD6_DROME  unnamed protein product                                 1356    0.0  
Q86NK4_DROME  unnamed protein product                                 1353    0.0  
Q7KIF8_DROME  unnamed protein product                                 1351    0.0  


>Q9VSD6_DROME unnamed protein product
Length=1049

 Score = 1356 bits (3509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 665/1060 (63%), Positives = 836/1060 (79%), Gaps = 19/1060 (2%)

Query  1     MDVRKVTELLRATIDP--EQQKQAEEQLNQIHKIIGFAPTLLQVLM-TAEEMSVRQAGVI  57
             M+ +K+TELLRATIDP  EQ+K AE+QL QIHKIIGF PT+LQ++M T  E  VRQAG +
Sbjct  1     MEAQKLTELLRATIDPNPEQRKAAEDQLAQIHKIIGFVPTILQIVMQTTVEQPVRQAGAV  60

Query  58    YLKNLIATNWADREDENGS-VKFTIHEQDRAMIRDAIVDALVHAPELIRVQLGVCVSNII  116
             YLKNLI ++W+D E + G  + F+IHEQDRAMIR AIVDA+VHAPELIRVQL VCV++II
Sbjct  61    YLKNLINSSWSDHEAKPGEPIPFSIHEQDRAMIRGAIVDAIVHAPELIRVQLSVCVNHII  120

Query  117   KHDFPGRWTQIVDKITIYLQNSDASCWPGVLLALHQLVKNFEYKKAEERGPLNEAMNLLF  176
             K DFPGRW Q+VD I+IYLQN D + W G L+ ++QLVK +EYK+ EER PLNEAMNLL 
Sbjct  121   KSDFPGRWPQVVDSISIYLQNQDVNGWNGALVTMYQLVKTYEYKRHEERTPLNEAMNLLL  180

Query  177   PMIYQLILRLLPDPSEQSVLLQKQILKIFFTLTQYTLPLDLISKEVFSQWMDVVRQVADR  236
             PMIYQL++RLL + SEQSVLLQKQILKI++ LTQYTLPLDLI+KE+FSQWM++ RQVADR
Sbjct  181   PMIYQLMVRLLAEQSEQSVLLQKQILKIYYALTQYTLPLDLITKEIFSQWMEICRQVADR  240

Query  237   PVPPETNNPDLDDDERAELPWWKCKKWALHILRRMFERYGSPGNVTHE-YKEFSGWYLRT  295
              VP   ++  LDDDER E P+WK KKWALHI+ RMFERYGSP NV  E Y++F+ WYL T
Sbjct  241   AVP---DSSHLDDDERTEFPYWKTKKWALHIMVRMFERYGSPSNVVSEKYQKFAEWYLPT  297

Query  296   FSGGILEVLLKILDQYRRKIYVSPRVIQQSINYINQGVSHAYSWKFLKPHMFEIIRDVLF  355
             FS G+LEVLLKILDQYR ++YVSPRV+   +NY+   VSHAY+WK +KPHM  +I+DV+F
Sbjct  298   FSQGVLEVLLKILDQYRNRVYVSPRVLTDVLNYLKNAVSHAYTWKLIKPHMVAVIQDVIF  357

Query  356   PILSYSAADEELWNNNPYEYIRVKFDIFEDFVSPVTAAQTLLYSACKKRKDMLQETIQFC  415
             PI+S++ +D+ELW ++PYEYIR+KFDIFED+ +PV AAQ+LL+S CKKRK +L + +   
Sbjct  358   PIMSFTDSDQELWESDPYEYIRLKFDIFEDYATPVPAAQSLLHSMCKKRKGILPKAMATI  417

Query  416   VEVLTSPNADPRQKDGALHMIGSLADVLLKKKVYKEQMDKMLLQYVLPEFSSPHGHMRAR  475
             ++++TSPNAD +QKDGALHMIG+LADVLLKK  Y++Q++ ML  YV PEF +P GHMRAR
Sbjct  418   MQIITSPNADNKQKDGALHMIGTLADVLLKKASYRDQVESMLTTYVFPEFQNPAGHMRAR  477

Query  476   ACWVLHYFSEIKFKQEQILVEAVRLTTNVLLTDQDLPVKVEAAIALQMLLSAQEKAKKYV  535
             ACWVLHYF +++ K  Q+L E +RLTTN LLTD++LPVKVEAAI LQM +S+Q++A +YV
Sbjct  478   ACWVLHYFCDVQIKNPQVLAEIMRLTTNALLTDKELPVKVEAAIGLQMFISSQDEAPQYV  537

Query  536   KPLIKPITLELLAIVRETENDDLTTVIQKIVYIYPDQLMPIAVEICQHLAATFSQVLETD  595
             +  IK IT ELL I+RETEN+DLT V+QKIV  + +QL+P+A EICQHLA TFSQVLE++
Sbjct  538   EAQIKEITKELLTIIRETENEDLTNVMQKIVCTFTEQLLPVATEICQHLATTFSQVLESE  597

Query  596   EGSDEKAITAMGLLNTIESLLSVMENQPEIIARLQPTVLQVVAHIFGESVMEFYEESLSL  655
             EGSDEKAITAM LLNTIE+LLSVME  P+++  L P V+ VV HIF  ++ +FYEE+ SL
Sbjct  598   EGSDEKAITAMSLLNTIETLLSVMEEHPDVLLNLHPIVINVVGHIFQHNITDFYEETFSL  657

Query  656   VYDLTIKTISGDMWKVLEMIYQLFQKDGFEYFTDMMPALHNYITVDTPAFLSNENHILAM  715
             VYDLT K IS +MW++LE+IYQ+F+KDG +YF D+MPALHNY+TVDTPAFLSN N +LA+
Sbjct  658   VYDLTAKAISPEMWQMLELIYQVFKKDGIDYFIDIMPALHNYVTVDTPAFLSNPNRLLAI  717

Query  716   FNMCKAVLTGDAGEDPECHAAKLLEVIILQCKDHIDQCIPSFVQLVLERLMREVKTSELR  775
              +MCK +LT   GEDPECHAAKL+EVIILQCK  ID  I  FV+L L RL REV++SELR
Sbjct  718   LDMCKTMLTSSPGEDPECHAAKLMEVIILQCKGQIDSVIHMFVELALSRLTREVQSSELR  777

Query  776   TMCLQVVIAALYYNPALCLETMDRLQGNFRQSTEPIASHFIKQWIHDTDCFLGLHDRKLC  835
             TMCLQVVIAALYYNP L L  +D++    +Q+ + I++HFIKQW+HDTDCFLG+HDRKLC
Sbjct  778   TMCLQVVIAALYYNPQLLLSILDKMS---QQNNDSISAHFIKQWLHDTDCFLGIHDRKLC  834

Query  836   VLGLCTLISMGPAKPPAVNECAQQIIPSLILLFDGLKRAYAAKASDAGDEENEEDDSDID  895
             VLGLCTLIS+G AKP  ++E A +I+P+LILLFDGLKRAY ++A +  ++E EED  D +
Sbjct  835   VLGLCTLISLGEAKPQVLSEVAGKIVPALILLFDGLKRAYESRAQEEEEDEEEEDGDDCE  894

Query  896   EEILSSDEDEIDDASQEYLEKLQEKVTRSSTQHGFNVSASIQDGHGDHRSDDDGDDSEYD  955
             E  LSSDED++D+ + +YL+KL E       + GF V A I+D   D     D ++S  D
Sbjct  895   EA-LSSDEDDMDEMAPDYLDKLAEFAKTKGNESGFEVKAEIKDDDADSDG--DAEESVGD  951

Query  956   ANEETPLEYYATPLDSDDMNQ---DEYIVFKEVMQNIERTDTVWYRALTGHLTAEQQKAL  1012
              N ET LE + TP+D D+ N+   DEY  FKEV+  +   D  WY  LT +LT EQ KAL
Sbjct  952   LN-ETGLESFTTPID-DEENESAIDEYWTFKEVITALSAQDQAWYALLTSNLTPEQAKAL  1009

Query  1013  QEIILLADQRKAALESKRIEQSGGYAFHSQTVPTSFNFGG  1052
             QE+++ ADQRKAA ESK IE+ GG+AF    VPTSF FG 
Sbjct  1010  QEVVVTADQRKAAKESKLIEKQGGFAFPQTAVPTSFKFGS  1049


>Q86NK4_DROME unnamed protein product
Length=1049

 Score = 1353 bits (3501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 664/1060 (63%), Positives = 835/1060 (79%), Gaps = 19/1060 (2%)

Query  1     MDVRKVTELLRATIDP--EQQKQAEEQLNQIHKIIGFAPTLLQVLM-TAEEMSVRQAGVI  57
             M+ +K+TELLRATIDP  EQ+K AE+QL QIHKIIGF PT+LQ++M T  E  VRQAG +
Sbjct  1     MEAQKLTELLRATIDPNPEQRKAAEDQLAQIHKIIGFVPTILQIVMQTTVEQPVRQAGAV  60

Query  58    YLKNLIATNWADREDENGS-VKFTIHEQDRAMIRDAIVDALVHAPELIRVQLGVCVSNII  116
             YLKNLI ++W+D E + G  + F+IHEQDRAMIR AIVDA+VHAPELIRVQL VCV++II
Sbjct  61    YLKNLINSSWSDHEAKPGEPIPFSIHEQDRAMIRGAIVDAIVHAPELIRVQLSVCVNHII  120

Query  117   KHDFPGRWTQIVDKITIYLQNSDASCWPGVLLALHQLVKNFEYKKAEERGPLNEAMNLLF  176
             K DFPGRW Q+VD I+IYLQN D + W G L+ ++QLVK +EYK+ EER PLNEAMNLL 
Sbjct  121   KSDFPGRWPQVVDSISIYLQNQDVNGWNGALVTMYQLVKTYEYKRHEERTPLNEAMNLLL  180

Query  177   PMIYQLILRLLPDPSEQSVLLQKQILKIFFTLTQYTLPLDLISKEVFSQWMDVVRQVADR  236
             PMIYQL++RLL + SEQSVLLQKQILKI++ LTQYTLPLDLI+KE+FSQWM++ RQVADR
Sbjct  181   PMIYQLMVRLLAEQSEQSVLLQKQILKIYYALTQYTLPLDLITKEIFSQWMEICRQVADR  240

Query  237   PVPPETNNPDLDDDERAELPWWKCKKWALHILRRMFERYGSPGNVTHE-YKEFSGWYLRT  295
              VP   ++  LDDDER E P+WK KKWALHI+ RMFERYGSP NV  E Y++F+ WYL T
Sbjct  241   AVP---DSSHLDDDERTEFPYWKTKKWALHIMVRMFERYGSPSNVVSEKYQKFAEWYLPT  297

Query  296   FSGGILEVLLKILDQYRRKIYVSPRVIQQSINYINQGVSHAYSWKFLKPHMFEIIRDVLF  355
             FS G+LEVLLKILDQYR ++YVSPRV+   +NY+   VSHAY+WK +KPHM  +I+DV+F
Sbjct  298   FSQGVLEVLLKILDQYRNRVYVSPRVLTDVLNYLKNAVSHAYTWKLIKPHMVAVIQDVIF  357

Query  356   PILSYSAADEELWNNNPYEYIRVKFDIFEDFVSPVTAAQTLLYSACKKRKDMLQETIQFC  415
             PI+S++ +D+ELW ++PYEYIR+KFDIFED+ +PV AAQ+LL+S CKKRK +L + +   
Sbjct  358   PIMSFTDSDQELWESDPYEYIRLKFDIFEDYATPVPAAQSLLHSMCKKRKGILPKAMATI  417

Query  416   VEVLTSPNADPRQKDGALHMIGSLADVLLKKKVYKEQMDKMLLQYVLPEFSSPHGHMRAR  475
             ++++TSPNAD +QKDGALHMIG+LADVLLKK  Y++Q++ ML  YV PEF +P GHMRAR
Sbjct  418   MQIITSPNADNKQKDGALHMIGTLADVLLKKASYRDQVESMLTTYVFPEFQNPAGHMRAR  477

Query  476   ACWVLHYFSEIKFKQEQILVEAVRLTTNVLLTDQDLPVKVEAAIALQMLLSAQEKAKKYV  535
             ACWVLHYF +++ K  Q+L E +RLTTN LLTD++LPVKVEAAI LQM +S+Q++A +YV
Sbjct  478   ACWVLHYFCDVQIKNPQVLAEIMRLTTNALLTDKELPVKVEAAIGLQMFISSQDEAPQYV  537

Query  536   KPLIKPITLELLAIVRETENDDLTTVIQKIVYIYPDQLMPIAVEICQHLAATFSQVLETD  595
             +  IK IT ELL I+RETEN+DLT V+QKIV  + +QL+P+A EICQHLA TFSQVLE++
Sbjct  538   EAQIKEITKELLTIIRETENEDLTNVMQKIVCTFTEQLLPVATEICQHLATTFSQVLESE  597

Query  596   EGSDEKAITAMGLLNTIESLLSVMENQPEIIARLQPTVLQVVAHIFGESVMEFYEESLSL  655
             EGSDEKAITAM LLNTIE+LLSVME  P+++  L P V+ VV HIF  ++ + YEE+ SL
Sbjct  598   EGSDEKAITAMSLLNTIETLLSVMEEHPDVLLNLHPIVINVVGHIFQHNITDLYEETFSL  657

Query  656   VYDLTIKTISGDMWKVLEMIYQLFQKDGFEYFTDMMPALHNYITVDTPAFLSNENHILAM  715
             VYDLT K IS +MW++LE+IYQ+F+KDG +YF D+MPALHNY+TVDTPAFLSN N +LA+
Sbjct  658   VYDLTAKAISPEMWQMLELIYQVFKKDGIDYFIDIMPALHNYVTVDTPAFLSNPNRLLAI  717

Query  716   FNMCKAVLTGDAGEDPECHAAKLLEVIILQCKDHIDQCIPSFVQLVLERLMREVKTSELR  775
              +MCK +LT   GEDPECHAAKL+EVIILQCK  ID  I  FV+L L RL REV++SELR
Sbjct  718   LDMCKTMLTSSPGEDPECHAAKLMEVIILQCKGQIDSVIHMFVELALSRLTREVQSSELR  777

Query  776   TMCLQVVIAALYYNPALCLETMDRLQGNFRQSTEPIASHFIKQWIHDTDCFLGLHDRKLC  835
             TMCLQVVIAALYYNP L L  +D++    +Q+ + I++HFIKQW+HDTDCFLG+HDRKLC
Sbjct  778   TMCLQVVIAALYYNPQLLLSILDKMS---QQNNDSISAHFIKQWLHDTDCFLGIHDRKLC  834

Query  836   VLGLCTLISMGPAKPPAVNECAQQIIPSLILLFDGLKRAYAAKASDAGDEENEEDDSDID  895
             VLGLCTLIS+G AKP  ++E A +I+P+LILLFDGLKRAY ++A +  ++E EED  D +
Sbjct  835   VLGLCTLISLGEAKPQVLSEVAGKIVPALILLFDGLKRAYESRAQEEEEDEEEEDGDDCE  894

Query  896   EEILSSDEDEIDDASQEYLEKLQEKVTRSSTQHGFNVSASIQDGHGDHRSDDDGDDSEYD  955
             E  LSSDED++D+ + +YL+KL E       + GF V A I+D   D     D ++S  D
Sbjct  895   EA-LSSDEDDMDEMAPDYLDKLAEFAKTKGNESGFEVKAEIKDDDADSDG--DAEESVGD  951

Query  956   ANEETPLEYYATPLDSDDMNQ---DEYIVFKEVMQNIERTDTVWYRALTGHLTAEQQKAL  1012
              N ET LE + TP+D D+ N+   DEY  FKEV+  +   D  WY  LT +LT EQ KAL
Sbjct  952   LN-ETGLESFTTPID-DEENESAIDEYWTFKEVITALSAQDQAWYALLTSNLTPEQAKAL  1009

Query  1013  QEIILLADQRKAALESKRIEQSGGYAFHSQTVPTSFNFGG  1052
             QE+++ ADQRKAA ESK IE+ GG+AF    VPTSF FG 
Sbjct  1010  QEVVVTADQRKAAKESKLIEKQGGFAFPQTAVPTSFKFGS  1049


>Q7KIF8_DROME unnamed protein product
Length=1049

 Score = 1351 bits (3496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 664/1060 (63%), Positives = 835/1060 (79%), Gaps = 19/1060 (2%)

Query  1     MDVRKVTELLRATIDP--EQQKQAEEQLNQIHKIIGFAPTLLQVLM-TAEEMSVRQAGVI  57
             M+ +K+TELLRATIDP  EQ+K AE+QL QIHKIIGF PT+LQ++M T  E  VRQAG +
Sbjct  1     MEAQKLTELLRATIDPNPEQRKAAEDQLAQIHKIIGFVPTILQIVMQTTVEQPVRQAGAV  60

Query  58    YLKNLIATNWADREDENGS-VKFTIHEQDRAMIRDAIVDALVHAPELIRVQLGVCVSNII  116
             YLKNLI ++W+D E + G  + F+IHEQDRAMIR AIVDA+VHAPELIRVQL VCV++II
Sbjct  61    YLKNLINSSWSDHEAKPGEPIPFSIHEQDRAMIRGAIVDAIVHAPELIRVQLSVCVNHII  120

Query  117   KHDFPGRWTQIVDKITIYLQNSDASCWPGVLLALHQLVKNFEYKKAEERGPLNEAMNLLF  176
             K DFPGRW Q+VD I+IYLQN D + W G L+ ++QLVK +EYK+ EER PLNEAMNLL 
Sbjct  121   KSDFPGRWPQVVDSISIYLQNQDVNGWNGALVTMYQLVKTYEYKRHEERTPLNEAMNLLL  180

Query  177   PMIYQLILRLLPDPSEQSVLLQKQILKIFFTLTQYTLPLDLISKEVFSQWMDVVRQVADR  236
             PMIYQL++RLL + SEQSVLLQKQILKI++ LTQYTLPLDLI+KE+FSQWM++ RQVADR
Sbjct  181   PMIYQLMVRLLAEQSEQSVLLQKQILKIYYALTQYTLPLDLITKEIFSQWMEICRQVADR  240

Query  237   PVPPETNNPDLDDDERAELPWWKCKKWALHILRRMFERYGSPGNVTHE-YKEFSGWYLRT  295
              VP   ++  LDDDER E P+WK KKWALHI+ RMFERYGSP NV  E Y++F+ WYL T
Sbjct  241   AVP---DSSHLDDDERTEFPYWKTKKWALHIMVRMFERYGSPSNVVSEKYQKFAEWYLPT  297

Query  296   FSGGILEVLLKILDQYRRKIYVSPRVIQQSINYINQGVSHAYSWKFLKPHMFEIIRDVLF  355
             FS G+LEVLLKILDQYR ++YVSPRV+   +NY+   VSHAY+WK +KPHM  +I+DV+F
Sbjct  298   FSQGVLEVLLKILDQYRNRVYVSPRVLTDVLNYLKNAVSHAYTWKLIKPHMVAVIQDVIF  357

Query  356   PILSYSAADEELWNNNPYEYIRVKFDIFEDFVSPVTAAQTLLYSACKKRKDMLQETIQFC  415
             PI+S++ +D+ELW ++PYEYIR+KFDIFED+ +PV AAQ+LL+S CKKRK +L + +   
Sbjct  358   PIMSFTDSDQELWESDPYEYIRLKFDIFEDYATPVPAAQSLLHSMCKKRKGILPKAMATI  417

Query  416   VEVLTSPNADPRQKDGALHMIGSLADVLLKKKVYKEQMDKMLLQYVLPEFSSPHGHMRAR  475
             ++++TSPNAD +QKDGALHMIG+LADVLLKK  Y++Q++ ML  YV PEF +P GHMRAR
Sbjct  418   MQIITSPNADNKQKDGALHMIGTLADVLLKKASYRDQVESMLTTYVFPEFQNPAGHMRAR  477

Query  476   ACWVLHYFSEIKFKQEQILVEAVRLTTNVLLTDQDLPVKVEAAIALQMLLSAQEKAKKYV  535
             ACWVLHYF +++ K  Q+L E +RLTTN LLTD++LPVKVEAAI LQM +S+Q++A +YV
Sbjct  478   ACWVLHYFCDVQIKNPQVLAEIMRLTTNALLTDKELPVKVEAAIGLQMFISSQDEAPQYV  537

Query  536   KPLIKPITLELLAIVRETENDDLTTVIQKIVYIYPDQLMPIAVEICQHLAATFSQVLETD  595
             +  IK IT ELL I+RETEN+DLT V+QKIV  + +QL+P+A EICQHLA TFSQVLE++
Sbjct  538   EAQIKEITKELLTIIRETENEDLTNVMQKIVCTFTEQLLPVATEICQHLATTFSQVLESE  597

Query  596   EGSDEKAITAMGLLNTIESLLSVMENQPEIIARLQPTVLQVVAHIFGESVMEFYEESLSL  655
             EGSDEKAITAM LLNTIE+LLSVME  P+++  L P V+ VV HIF  ++ +FYEE+ SL
Sbjct  598   EGSDEKAITAMSLLNTIETLLSVMEEHPDVLLNLHPIVINVVGHIFQHNITDFYEETFSL  657

Query  656   VYDLTIKTISGDMWKVLEMIYQLFQKDGFEYFTDMMPALHNYITVDTPAFLSNENHILAM  715
             VYDLT K IS +MW++LE+IYQ+F+KDG +YF D+MPALHNY+TVDTPAFLSN N +LA+
Sbjct  658   VYDLTAKAISPEMWQMLELIYQVFKKDGIDYFIDIMPALHNYVTVDTPAFLSNPNRLLAI  717

Query  716   FNMCKAVLTGDAGEDPECHAAKLLEVIILQCKDHIDQCIPSFVQLVLERLMREVKTSELR  775
              +MCK +LT   GEDPECHAAKL+EVIILQCK  ID  I  FV+L L RL REV++SELR
Sbjct  718   LDMCKTMLTSSPGEDPECHAAKLMEVIILQCKGQIDSVIHMFVELALSRLTREVQSSELR  777

Query  776   TMCLQVVIAALYYNPALCLETMDRLQGNFRQSTEPIASHFIKQWIHDTDCFLGLHDRKLC  835
             TMCLQVVIAALYYNP L L  +D++    +Q+ + I++HFIKQW+HDTDCFLG+HD KLC
Sbjct  778   TMCLQVVIAALYYNPQLLLSILDKMS---QQNNDSISAHFIKQWLHDTDCFLGIHDCKLC  834

Query  836   VLGLCTLISMGPAKPPAVNECAQQIIPSLILLFDGLKRAYAAKASDAGDEENEEDDSDID  895
             VLGLCTLIS+G AKP  ++E A +I+P+LILLFDGLKRAY ++A +  ++E EED  D +
Sbjct  835   VLGLCTLISLGEAKPQVLSEVAGKIVPALILLFDGLKRAYESRAQEEEEDEEEEDGDDCE  894

Query  896   EEILSSDEDEIDDASQEYLEKLQEKVTRSSTQHGFNVSASIQDGHGDHRSDDDGDDSEYD  955
             E  LSSDED++D+ + +YL+KL E       + GF V A I+D   D     D ++S  D
Sbjct  895   EA-LSSDEDDMDEMAPDYLDKLAEFAKTKGNESGFEVKAEIKDDDADSDG--DAEESVGD  951

Query  956   ANEETPLEYYATPLDSDDMNQ---DEYIVFKEVMQNIERTDTVWYRALTGHLTAEQQKAL  1012
              N ET LE + TP+D D+ N+   DEY  FKEV+  +   D  WY  LT +LT EQ KAL
Sbjct  952   LN-ETGLESFTTPID-DEENESAIDEYWTFKEVITALSAQDQAWYALLTSNLTPEQAKAL  1009

Query  1013  QEIILLADQRKAALESKRIEQSGGYAFHSQTVPTSFNFGG  1052
             QE+++ ADQRKAA ESK IE+ GG+AF    VPTSF FG 
Sbjct  1010  QEVVVTADQRKAAKESKLIEKQGGFAFPQTAVPTSFKFGS  1049



Lambda      K        H
   0.318    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5035546020


Query= XP_003392886.1 NEDD8-conjugating enzyme Ubc12 isoform X1 [Bombus
terrestris]

Length=181
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

UBC12_DROME  unnamed protein product                                  304     4e-107
Q8I607_PLAF7  unnamed protein product                                 101     1e-27 
UBC2_CAEEL  unnamed protein product                                   99.8    6e-27 


>UBC12_DROME unnamed protein product
Length=181

 Score = 304 bits (779),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 157/180 (87%), Gaps = 1/180 (1%)

Query  1    MIKLFSLKQAKKDGESPKAGTQKKASAAQLRITKDINELNLPKTCGTEFPDPDDLLSFKL  60
            MIKLF+LKQ KKDGE  K   QKKASAAQLRI KDINELNLP TC T+FPDP+DLL+FKL
Sbjct  1    MIKLFTLKQQKKDGEQ-KGSQQKKASAAQLRIQKDINELNLPNTCATDFPDPNDLLNFKL  59

Query  61   IICPDEGFYRGGRFVFSFKVGPNYPHEPPKVKCETQVYHPNIDLDGNVCLNILREDWKPV  120
            II PDEGFYR GRFVF+F+VG NYPHEPPKVKC TQVYHPNIDLDGNVCLNILREDW PV
Sbjct  60   IISPDEGFYRDGRFVFNFRVGSNYPHEPPKVKCATQVYHPNIDLDGNVCLNILREDWNPV  119

Query  121  LTINSIVYGLQYLFLEPNPEDPLNKDAAEVLQNNRRAFEQNVAKAMRGGYVGAFYFERCL  180
            L INSIVYGLQ+LFLEPNPEDPLNK+AA+VLQ NRR FE NV KAMRGG VG  YFE CL
Sbjct  120  LNINSIVYGLQFLFLEPNPEDPLNKEAADVLQTNRRQFENNVKKAMRGGCVGETYFECCL  179


>Q8I607_PLAF7 unnamed protein product
Length=147

 Score = 101 bits (252),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 83/143 (58%), Gaps = 3/143 (2%)

Query  31   RITKDINELNL-PKTCGTEFPDPDDLLSFK-LIICPDEGFYRGGRFVFSFKVGPNYPHEP  88
            RITK++ +LN  P T  +  P  DDL  ++  I+ P +  Y  G +  + K  P+YP +P
Sbjct  5    RITKELQDLNKDPPTNCSAGPIGDDLFFWQATIMGPGDSPYENGVYFLNIKFPPDYPFKP  64

Query  89   PKVKCETQVYHPNIDLDGNVCLNILREDWKPVLTINSIVYGLQYLFLEPNPEDPLNKDAA  148
            PK+   T++YHPNI+  G +CL+IL++ W P LTI+ ++  +  L  +PN +DPL  + A
Sbjct  65   PKIIFTTKIYHPNINTAGAICLDILKDQWSPALTISKVLLSISSLLTDPNADDPLVPEIA  124

Query  149  EVLQNNRRAFEQNVAKAMRGGYV  171
             V + +R  + Q  AKA    Y 
Sbjct  125  HVYKTDRTKYHQ-TAKAWTQKYA  146


>UBC2_CAEEL unnamed protein product
Length=147

 Score = 99.8 bits (247),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 79/133 (59%), Gaps = 4/133 (3%)

Query  31   RITKDINEL--NLPKTCGTEFPDPDDLLSFK-LIICPDEGFYRGGRFVFSFKVGPNYPHE  87
            RI K++ +L  + P  C    P  DDL  ++  I+ P E  Y+GG F  +     +YP +
Sbjct  5    RIQKELQDLGRDPPAQCSAG-PVGDDLFHWQATIMGPPESPYQGGVFFLTIHFPTDYPFK  63

Query  88   PPKVKCETQVYHPNIDLDGNVCLNILREDWKPVLTINSIVYGLQYLFLEPNPEDPLNKDA  147
            PPKV   T++YHPNI+ +G++CL+ILR  W P LTI+ ++  +  L  +PNP+DPL  + 
Sbjct  64   PPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEI  123

Query  148  AEVLQNNRRAFEQ  160
            A + + +R  + Q
Sbjct  124  ARIYKTDRERYNQ  136



Lambda      K        H
   0.318    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5035546020


Query= XP_003392887.2 NEDD8-conjugating enzyme Ubc12 isoform X2 [Bombus
terrestris]

Length=150
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

UBC12_DROME  unnamed protein product                                  255     3e-88
UBC12_CAEEL  unnamed protein product                                  97.8    2e-26
UBC2_CAEEL  unnamed protein product                                   95.1    1e-25


>UBC12_DROME unnamed protein product
Length=181

 Score = 255 bits (651),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 129/145 (89%), Gaps = 0/145 (0%)

Query  5    INELNLPKTCGTEFPDPDDLLSFKLIICPDEGFYRGGRFVFSFKVGPNYPHEPPKVKCET  64
            INELNLP TC T+FPDP+DLL+FKLII PDEGFYR GRFVF+F+VG NYPHEPPKVKC T
Sbjct  35   INELNLPNTCATDFPDPNDLLNFKLIISPDEGFYRDGRFVFNFRVGSNYPHEPPKVKCAT  94

Query  65   QVYHPNIDLDGNVCLNILREDWKPVLTINSIVYGLQYLFLEPNPEDPLNKDAAEVLQNNR  124
            QVYHPNIDLDGNVCLNILREDW PVL INSIVYGLQ+LFLEPNPEDPLNK+AA+VLQ NR
Sbjct  95   QVYHPNIDLDGNVCLNILREDWNPVLNINSIVYGLQFLFLEPNPEDPLNKEAADVLQTNR  154

Query  125  RAFEQNVAKAMRGGYVGAFYFERCL  149
            R FE NV KAMRGG VG  YFE CL
Sbjct  155  RQFENNVKKAMRGGCVGETYFECCL  179


>UBC12_CAEEL unnamed protein product
Length=180

 Score = 97.8 bits (242),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 72/127 (57%), Gaps = 7/127 (6%)

Query  12   KTCGTEFPDPDDLLSFKLIICPDEGFYRGGRFVFSFKVGPNYPHEPPKVKCETQVYHPNI  71
            K    E P    L   +L + P EG YRGG+F F   V P Y + PP VKC T+V+HPNI
Sbjct  46   KLWHLEVPSTSCLHELELTVTPQEGIYRGGKFRFKITVPPEYNNVPPVVKCLTKVWHPNI  105

Query  72   DLDGNVCLNILRED------WKPVLTINSIVYGLQYLFLE-PNPEDPLNKDAAEVLQNNR  124
            + DG++CL+ILR++      W+P   +  +V+GL  LF +  +  D LN  AA++   NR
Sbjct  106  NEDGSICLSILRQNSLDQYGWRPTRNLTDVVHGLVSLFNDLMDFNDALNIQAAQMWSQNR  165

Query  125  RAFEQNV  131
             +F   V
Sbjct  166  ESFNHRV  172


>UBC2_CAEEL unnamed protein product
Length=147

 Score = 95.1 bits (235),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 71/120 (59%), Gaps = 2/120 (2%)

Query  11   PKTCGTEFPDPDDLLSFK-LIICPDEGFYRGGRFVFSFKVGPNYPHEPPKVKCETQVYHP  69
            P  C    P  DDL  ++  I+ P E  Y+GG F  +     +YP +PPKV   T++YHP
Sbjct  18   PAQCSAG-PVGDDLFHWQATIMGPPESPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHP  76

Query  70   NIDLDGNVCLNILREDWKPVLTINSIVYGLQYLFLEPNPEDPLNKDAAEVLQNNRRAFEQ  129
            NI+ +G++CL+ILR  W P LTI+ ++  +  L  +PNP+DPL  + A + + +R  + Q
Sbjct  77   NINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRERYNQ  136



Lambda      K        H
   0.318    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5035546020


Query= XP_003392888.1 F-box only protein 28 [Bombus terrestris]

Length=365
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VT01_DROME  unnamed protein product                                 189     3e-57
Q95RF4_DROME  unnamed protein product                                 152     1e-43
Q7K2J4_DROME  unnamed protein product                                 139     2e-36


>Q9VT01_DROME unnamed protein product
Length=314

 Score = 189 bits (479),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 123/159 (77%), Gaps = 0/159 (0%)

Query  2    LQLINLPDIVLETILSNLSYDDISRYRIVCKQFDRICKKLLNRGFNLMEKYHAQCLRAVK  61
            + L++LP  +++ IL  L YD++++ R VC  F+ + +++LN+GFN +   HA+  + +K
Sbjct  1    MNLLDLPQTLIQDILELLPYDEVAKKREVCTLFNYLGQQILNKGFNKIIMAHAKNFKRIK  60

Query  62   SQLPRRESERRSHPLARHCDILTAIETRISMLSMTFIKYVDLNLCCFIPGKVIDEIFRVL  121
            S LPRRESERR+H L+RH DILT+IETRISML+MT+ K++DLN+CCFIPG+V+DEI  +L
Sbjct  61   SMLPRRESERRNHILSRHSDILTSIETRISMLTMTYSKFIDLNICCFIPGRVLDEINSIL  120

Query  122  RLIRDSKTPPRAHEILQELRDISSMAMEHFDEKILPDLK  160
            R++  S    R HE+LQELRDISSMA+EHFDEKI  + K
Sbjct  121  RILSTSTKQLRPHEVLQELRDISSMAIEHFDEKIAVNFK  159


>Q95RF4_DROME unnamed protein product
Length=265

 Score = 152 bits (384),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 89/108 (82%), Gaps = 0/108 (0%)

Query  53   HAQCLRAVKSQLPRRESERRSHPLARHCDILTAIETRISMLSMTFIKYVDLNLCCFIPGK  112
            HA+  + +KS LPRRESERR+H L+RH DILT+IETRISML+MT+ K++DLN+CCFIPG+
Sbjct  3    HAKNFKRIKSMLPRRESERRNHILSRHSDILTSIETRISMLTMTYSKFIDLNICCFIPGR  62

Query  113  VIDEIFRVLRLIRDSKTPPRAHEILQELRDISSMAMEHFDEKILPDLK  160
            V+DEI  +LR++  S    R HE+LQELRDISSMA+EHFDEKI  + K
Sbjct  63   VLDEINSILRILSTSTKQLRPHEVLQELRDISSMAIEHFDEKIAVNFK  110


>Q7K2J4_DROME unnamed protein product
Length=603

 Score = 139 bits (351),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 100/299 (33%), Positives = 154/299 (52%), Gaps = 20/299 (7%)

Query  4    LINLPDIVLETILSNLSYDDISRYRIVCKQFDRICKKLLNRGFNLMEKYHAQCLRAVKSQ  63
            L +LP+ ++E ILS + Y  +S  R+V  + + IC  +LN  F    K      +A+K+ 
Sbjct  122  LYDLPNELIEKILSYVDYKKVSNLRLVSHRMNDICMAMLNTAFTKQIKTTLSRFQAIKAS  181

Query  64   LPRRESERRSHPLARHCDILTAIETRISMLSMTFIKYVDLNLCCFIPGKVIDEIFRVLRL  123
            +PRRES RR+HPLA  CDI+     R+S+L M+  K+++   CCF PG ++DE+  +L  
Sbjct  182  MPRRESHRRNHPLACECDIIETCYMRLSLLQMSMGKHIERGHCCFFPGAILDEVQAILNY  241

Query  124  IRDSKTPPRAHEILQELRDISSMAMEHFDEKI---LPDLKHSICTSVVSNVGSYELPS--  178
            I  +    R + +  EL D+S+MAME+F ++I   LP L +        N   Y LP+  
Sbjct  242  ISITPRLQRPYRVTDELFDLSTMAMEYFKDRIEATLPGLAY-------FNKDFYTLPTTT  294

Query  179  --GSLMISHHTTSSNSVTLPHNFNSEKLNQTFKKIYSRTK--KNKLSVLSIKGQIGKMKL  234
               +L IS     S S + P N     L +  +KI    K   N+LSVL  + ++   K 
Sbjct  295  KRPTLAISSDLEDSASNSPPQNHMV--LRKGIRKIKQGMKMYNNQLSVL--RTELRTCKR  350

Query  235  RMKRQGFQMRLQSLKLQEQAKKIHDQDTQLAEMRKHLEEWEQKMVDLTAELSRAREETQ  293
            +   Q  Q+  QS  + EQ K+  +   +L E  K  EE  +K   L  EL++ + E Q
Sbjct  351  KAAEQSKQLAEQSNLISEQQKQTLEYANRLDENDKKNEEMSRKFSTLLQELNKCKTELQ  409



Lambda      K        H
   0.318    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5035546020


Query= XP_003392889.1 cilia- and flagella-associated protein 91 isoform X2
[Bombus terrestris]

Length=640
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q386N1_TRYB2  unnamed protein product                                 63.5    3e-10


>Q386N1_TRYB2 unnamed protein product
Length=709

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 79/279 (28%), Positives = 129/279 (46%), Gaps = 28/279 (10%)

Query  313  ATRWTKEKLSQLHSDLKASRSNTKTIEAPLLLKRKYKLPALPSTPYRKSTEDITNKRLHQ  372
            ATR   E L  +H+ +  S +  +TI   L L R    P  P TP  +   D+ N+ + +
Sbjct  417  ATRVV-EALEYVHAKIHKSDTPAETIRV-LELYRATPRPQRPDTPTLELEGDV-NEAVEE  473

Query  373  LSILIQKIIKGRAIQCMMFEGRNRCRELIEELQSSYGLEEHSKKQHQEEKAHTLELQHLQ  432
               L+Q++++GRA+Q   F+G+ RCR LIEELQ++      S  ++ E    + E +  +
Sbjct  474  SCTLLQRLLRGRAVQNDFFDGKERCRGLIEELQAA------SNAKYAE---RSAEEKQAE  524

Query  433  SEKSMQEDSLYEILNSLEGMTISGMLDFLSKELIRLEDERRIHAFALLAERERATREAAE  492
            +E+ M+E     I N  +G  I   LD+L  E+ R +D   + A   L     A R   E
Sbjct  525  AEEKMREAIADSIGNEAQGDIICDTLDYLFHEMTRQQD---LLALEALRHEAEAVRAERE  581

Query  493  AGRRQLEYNRRREFDE---MFRQTMKVNQESVESYLEDIIKEGIEWISDEATKAYISELC  549
            A   +L    R   D+    +   ++  ++ VE Y  D+     E  + E     I   C
Sbjct  582  AREAELRAQERILHDKEAVQYAAYVRAIEDIVECYSHDLYATVAEECAMEEA---IEAEC  638

Query  550  DKIDSISKAAQNNATKLSEEEMVANMIY----NFVLPEV  584
             +++ +     N    LS+ E+  N++     NFVLP V
Sbjct  639  QRLEQLPPPTSN---ILSDPEVAENLVCDVLDNFVLPAV  674


 Score = 59.7 bits (143),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 42/69 (61%), Gaps = 2/69 (3%)

Query  68   NIGTQTDYRDSDSQTAPWDPPYKIKSGH--YPEALSIAHLSWNHGLEIGIHDLEIINRMR  125
            +   QT +R++++QT P+ P Y I  G    P+ L +  L WN GL  G  ++E+I R+R
Sbjct  132  DAAMQTVFRENEAQTLPYTPNYYIPEGGDPNPQVLGLMELHWNEGLPAGKEEVELIQRLR  191

Query  126  RKRAWEAVL  134
            R+RA EA L
Sbjct  192  RRRAVEASL  200



Lambda      K        H
   0.318    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5035546020


Query= XP_003392892.1 serine/threonine-protein kinase 32A [Bombus
terrestris]

Length=462
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PK2_DICDI  unnamed protein product                                    187     1e-53
KRAC_DICDI  unnamed protein product                                   182     4e-52
KS6A1_CAEEL  unnamed protein product                                  180     2e-49


>PK2_DICDI unnamed protein product
Length=479

 Score = 187 bits (474),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 120/343 (35%), Positives = 180/343 (52%), Gaps = 28/343 (8%)

Query  2    GANQSTRNEPTPGEEVNF---------DHFQILRAIGKGSFGKVCIVQKRDRTGNMYAMK  52
            G+     +E    EEV F         D F++L  IGKGSFGKV  V+K+     ++AMK
Sbjct  124  GSGNGNDDEDEGPEEVIFSKNKQSATKDDFELLNVIGKGSFGKVMQVKKKGED-KIFAMK  182

Query  53   YVHKGECAMRGALKNVAREVEILSQLEHPCLVNLWFSFQDEEDLFMVSDLLLGGDLRYHI  112
             + K     R  + +   E  IL  + HP +VNL ++FQ ++ L+MV D + GG+L +H+
Sbjct  183  VLRKDAIIARKQVNHTKSEKTILQCISHPFIVNLHYAFQTKDKLYMVLDFVNGGELFFHL  242

Query  113  QQEVVFSEQSIVLFVAEIALALDYLQSHKIVHRDIKPDNILLDEEGHAHVTDFNIATVLE  172
            ++E  FSE  + ++ AEI  ALD+L    IV+RD+KP+NILLD EGH  +TDF ++  +E
Sbjct  243  KREGRFSEPRVKIYAAEIVSALDHLHKQDIVYRDLKPENILLDSEGHICITDFGLSKKIE  302

Query  173  DGELATSMSGTKPYIAPEIYMCSCEEYGVLGYGFAVDWWSLGILAWETLAGERPYPLCST  232
              +   +  GT  Y+APE+           G+G AVDWWSLG L +E L G  P+   + 
Sbjct  303  TTDGTFTFCGTPEYLAPEVLNGH-------GHGCAVDWWSLGTLLYEMLTGLPPFYSQNV  355

Query  233  TTHREALQILQKERPTPVDWSSAICELMNRLLVVAPGARVSTL--KELKQVNAMRELDFD  290
            +T  +  +IL  E   P   S     L+  LL      R+ T    E+KQ    + +D++
Sbjct  356  STMYQ--KILNGELKIPTYISPEAKSLLEGLLTREVDKRLGTKGGGEVKQHPWFKNIDWE  413

Query  291  KVLNKQIKPSFTPP----KDHLNCDPTFELE---EMIIETKPL  326
            K+  K+++  F P      D    DP F  E   + ++ET  L
Sbjct  414  KLDRKEVEVHFKPKVKSGTDISQIDPVFTQERPMDSLVETSAL  456


>KRAC_DICDI unnamed protein product
Length=444

 Score = 182 bits (461),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 107/311 (34%), Positives = 167/311 (54%), Gaps = 16/311 (5%)

Query  10   EPTPGEEVNFDHFQILRAIGKGSFGKVCIVQKRDRTGNMYAMKYVHKGECAMRGALKNVA  69
            +P   E+V    F++L  +GKGSFGKV  V+K+D TG +YAMK + K        +++  
Sbjct  108  QPKKSEKVGVADFELLNLVGKGSFGKVIQVRKKD-TGEVYAMKVLSKKHIVEHNEVEHTL  166

Query  70   REVEILSQLEHPCLVNLWFSFQDEEDLFMVSDLLLGGDLRYHIQQEVVFSEQSIVLFVAE  129
             E  IL ++ HP LVNL +SFQ E+ L+ + D + GG+L YH+Q++  F+E  +  + AE
Sbjct  167  SERNILQKINHPFLVNLNYSFQTEDKLYFILDYVNGGELFYHLQKDKKFTEDRVRYYGAE  226

Query  130  IALALDYLQSHKIVHRDIKPDNILLDEEGHAHVTDFNIAT--VLEDGELATSMSGTKPYI  187
            I LAL++L    +++RD+KP+N+LL  EGH  +TDF +    +L   +   +  GT  Y+
Sbjct  227  IVLALEHLHLSGVIYRDLKPENLLLTNEGHICMTDFGLCKEGLLTPTDKTGTFCGTPEYL  286

Query  188  APEIYMCSCEEYGVLGYGFAVDWWSLGILAWETLAGERPYPLCSTTTHREALQILQKERP  247
            APE+   +       GYG  VDWWS G L +E L G  P+   +        +I+ ++  
Sbjct  287  APEVLQGN-------GYGKQVDWWSFGSLLYEMLTGLPPF--YNQDVQEMYRKIMMEKLS  337

Query  248  TPVDWSSAICELMNRLLVVAPGARVSTLKELKQVNAMRELDFDKVLNKQIKPSFTP----  303
             P   S     L+ +LL   P  R++    +K+    R +D++++  K I P F P    
Sbjct  338  FPHFISPDARSLLEQLLERDPEKRLADPNLIKRHPFFRSIDWEQLFQKNIPPPFIPNVKG  397

Query  304  PKDHLNCDPTF  314
              D    DP F
Sbjct  398  SADTSQIDPVF  408


>KS6A1_CAEEL unnamed protein product
Length=784

 Score = 180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 112/311 (36%), Positives = 174/311 (56%), Gaps = 17/311 (5%)

Query  14   GEEVNFDHFQILRAIGKGSFGKVCIVQK-RDR-TGNMYAMKYVHKGECAMRGALKNVARE  71
            GE+ +   F++L+ +G+GSFGKV +V+K R R +G++YAMK + K    +R   +    E
Sbjct  96   GEKADPRQFELLKVLGQGSFGKVFLVRKVRGRDSGHVYAMKVLKKATLKVRDR-QRTKLE  154

Query  72   VEILSQLEHPCLVNLWFSFQDEEDLFMVSDLLLGGDLRYHIQQEVVFSEQSIVLFVAEIA  131
              IL+ + HP +V L ++FQ E  L+++ D L GGDL   + +EV+F+E  +  ++AE+ 
Sbjct  155  RNILAHISHPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEDDVKFYLAELT  214

Query  132  LALDYLQSHKIVHRDIKPDNILLDEEGHAHVTDFNIATVLEDGELAT-SMSGTKPYIAPE  190
            LAL++L S  IV+RD+KP+NILLD +GH  VTDF ++    D E  T S  GT  Y+APE
Sbjct  215  LALEHLHSLGIVYRDLKPENILLDADGHIKVTDFGLSKEAIDSEKKTYSFCGTVEYMAPE  274

Query  191  IYMCSCEEYGVLGYGFAVDWWSLGILAWETLAGERPYPLCSTTTHREALQILQKERPTP-  249
            +           G+  A D+WSLG+L +E L G  P+       +    QIL+ +   P 
Sbjct  275  V-------INRRGHSMAADFWSLGVLMFEMLTGHLPFQ--GRDRNDTMTQILKAKLSMPH  325

Query  250  ---VDWSSAICELMNRLLVVAPGARVSTLKELKQVNAMRELDFDKVLNKQIKPSFTPPKD  306
                +  S +  L  R      GA    ++E+K+     ++DF K+LNK+I P F P   
Sbjct  326  FLTQEAQSLLRALFKRNSQNRLGAGPDGVEEIKRHAFFAKIDFVKLLNKEIDPPFKPALS  385

Query  307  HLNCDPTFELE  317
             ++    F+ E
Sbjct  386  TVDSTSYFDPE  396


 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 82/290 (28%), Positives = 135/290 (47%), Gaps = 31/290 (11%)

Query  5    QSTRNEPTPGEEVNFDHFQILRAIGKGSFGKVCIVQKRDRTGNMYAMKYVHKGECAMRGA  64
            +S R+ PT       D ++IL  IG G+   V   Q +  T   YA+K V K       A
Sbjct  437  KSVRSVPTAKTNPFTDDYEILEKIGNGAHSVVHKCQMK-ATRRKYAVKIVKK-------A  488

Query  65   LKNVAREVEIL-SQLEHPCLVNLWFSFQDEEDLFMVSDLLLGGDLRYH-IQQEVVFSEQS  122
            + +   EV+IL     H  +V L+  ++DE  ++M+ +L  GG+L    + ++ + SE+ 
Sbjct  489  VFDATEEVDILLRHSHHQFVVKLFDVYEDETAIYMIEELCEGGELLDKLVNKKSLGSEKE  548

Query  123  IVLFVAEIALALDYLQSHKIVHRDIKPDNILL----DEEGHAHVTDFNIA--TVLEDGEL  176
            +   +A +  A+ YL S ++ HRD+   NIL      +     + DF  A  +  E+G L
Sbjct  549  VAAIMANLLNAVQYLHSQQVAHRDLTAANILFALKDGDPSSLRIVDFGFAKQSRAENGML  608

Query  177  ATSMSGTKPYIAPEIYMCSCEEYGVLGYGFAVDWWSLGILAWETLAGERPYPLCSTTTHR  236
             T    T  ++APE+           GY  + D WSLG+L    L G  P+ +    T  
Sbjct  609  MTPCY-TAQFVAPEVLRKQ-------GYDRSCDVWSLGVLLHTMLTGCTPFAMGPNDTPD  660

Query  237  EALQILQKERPT---PVDW---SSAICELMNRLLVVAPGARVSTLKELKQ  280
            + LQ +   + +   PV W   S    +L+ ++L V P  RV+  + L+ 
Sbjct  661  QILQRVGDGKISMTHPV-WDTISDEAKDLVRKMLDVDPNRRVTAKQALQH  709



Lambda      K        H
   0.318    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5035546020


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jan 6, 2022  5:12 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_003392893.1 isocitrate dehydrogenase [NAD] subunit beta,
mitochondrial [Bombus terrestris]

Length=374
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VD58_DROME  unnamed protein product                                 534     0.0   
IDHB_DICDI  unnamed protein product                                   332     3e-112
IDH3A_DROME  unnamed protein product                                  292     1e-96 


>Q9VD58_DROME unnamed protein product
Length=370

 Score = 534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/372 (72%), Positives = 310/372 (83%), Gaps = 8/372 (2%)

Query  1    MALLARNICKVFSQTAQKGAVRCLHVGTVHRQESAVEQEG--KVKCTLIPGDGVGPELVV  58
            M++LAR + + F Q A   A R LH  +  R   A +  G  +  CTLIPGDGVGPELV 
Sbjct  1    MSMLARTVGRTFMQAA---AARSLHTTSTLR---ATDNYGANRTTCTLIPGDGVGPELVY  54

Query  59   SVQSVFKAANVPVEFEPYFLSEVNPTLSAPLEQVSNSIARNRVCLKGILATPDHSMTGEL  118
            S+Q VFKAA+VPV+FE YFLSE+NP LSA LE V  SI +N+VC+KG+LATPD+S  G+L
Sbjct  55   SLQEVFKAASVPVDFECYFLSEINPVLSAKLEDVVASIQKNKVCIKGVLATPDYSNVGDL  114

Query  119  QTLNMKLRKSLDLYSNVVHVKSLPGVTCRHKNVDCIIIREQTEGEYSALEHESVKGVVEC  178
            QTLNMKLR  LDLY+NVVHV+SLPGV  RH N+D +IIREQTEGEYSALEHESV G+VEC
Sbjct  115  QTLNMKLRNDLDLYANVVHVRSLPGVKTRHTNIDTVIIREQTEGEYSALEHESVPGIVEC  174

Query  179  LKIVTAVKSQRIAKFAFDYAVKHNRKKVTCVHKANIMKLGDGLFLKSCQEIAKMYPRITF  238
            LKI+TA KS RIAKFAFDYA K+ RKKVT VHKANIMKLGDGLFL+SC+E++++YPRI F
Sbjct  175  LKIITAKKSMRIAKFAFDYATKNQRKKVTAVHKANIMKLGDGLFLRSCEEVSRLYPRIQF  234

Query  239  ETMIVDNCTMQMVSNPHQFDVMVLPNLYGNILDNVASGLVGGAGVVAGASYSPECVVFEP  298
            E MIVDN TMQMVSNP+QFDVMV PNLYG I+DN+ASGLVGGAGVVAGASYS E VVFEP
Sbjct  235  EKMIVDNTTMQMVSNPNQFDVMVTPNLYGAIVDNLASGLVGGAGVVAGASYSSESVVFEP  294

Query  299  GARHTYSEAVGKNVANPTAMLLCAVKLLRHVNLKRYSEQIKDALNRVLNDGKVLTKDLGG  358
            GARHT++EAVGKNVANPTAMLLC VKLLRH+NL  Y E I++A+N+VLNDGKV TKDLGG
Sbjct  295  GARHTFAEAVGKNVANPTAMLLCGVKLLRHINLPTYGEIIQNAINKVLNDGKVRTKDLGG  354

Query  359  QSSTTDFTTAVI  370
            QS+T DFT A+I
Sbjct  355  QSTTQDFTRAII  366


>IDHB_DICDI unnamed protein product
Length=360

 Score = 332 bits (850),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 165/336 (49%), Positives = 230/336 (68%), Gaps = 10/336 (3%)

Query  41   KVKCTLIPGDGVGPELVVSVQSVFKAANVPVEFEPYFLSEVNPTLSAPLEQVSNSIARNR  100
            K   T+IPGDG+GPE+  SV  VF+AA VP+E+E + +S   P      +++  SI RN+
Sbjct  29   KKTVTVIPGDGIGPEITSSVMGVFQAAKVPIEWEIFDISGGQPIS----QELIASITRNK  84

Query  101  VCLKGILATPDHSMTGELQTLNMKLRKSLDLYSNVVHVKSLPGVTCRHKNV--DCIIIRE  158
            V LKG L T   S +   Q+ NM+LRK+LDLY++VV  K +PG+T RH +V  D ++IRE
Sbjct  85   VALKGPLYTEILSGS---QSRNMELRKALDLYAHVVPCKQIPGITARHDDVLVDFVVIRE  141

Query  159  QTEGEYSALEHESVKGVVECLKIVTAVKSQRIAKFAFDYAVKHNRKKVTCVHKANIMKLG  218
             T+GEYS LE     GVV+ LKI+T   S+RIA++AF+YA  + RKKVT VHKANI K  
Sbjct  142  NTQGEYSGLEQVLTPGVVQSLKIITKEASERIARYAFEYAKANGRKKVTAVHKANIQKQT  201

Query  219  DGLFLKSCQEIAKMYPRITFETMIVDNCTMQMVSNPHQFDVMVLPNLYGNILDNVASGLV  278
            DGLFL +C +IAK YP I FE  I+DNC MQ+V +P Q+DVMV PNLYGNI+ N+ + LV
Sbjct  202  DGLFLATCTQIAKEYPEIKFENTIIDNCCMQLVKSPEQYDVMVTPNLYGNIVSNIGAALV  261

Query  279  GGAGVVAGASYSPECVVFEPGARHTYSEAVGKNVANPTAMLLCAVKLLRHVNLKRYSEQI  338
            GG G+  GA+     ++FE GA H  ++  GK+ ANPT +LL +V +L+H+ L  ++ ++
Sbjct  262  GGPGLAGGANVGEGSIIFEMGAHHVAADIAGKDKANPTGLLLASVMMLKHLGLNEHATKV  321

Query  339  KDALNRVLNDGKVLTKDLGGQSSTTDFTTAVINCLR  374
            ++A+  V+ +G  LT D+GG+SST  FT AVI+ + 
Sbjct  322  ENAVKAVIKEG-TLTSDIGGKSSTKQFTGAVIDYIE  356


>IDH3A_DROME unnamed protein product
Length=377

 Score = 292 bits (748),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 147/332 (44%), Positives = 219/332 (66%), Gaps = 6/332 (2%)

Query  40   GKVKCTLIPGDGVGPELVVSVQSVFKAANVPVEFEPYFLSEV-NPTLSAPLEQVS-NSIA  97
            G  K TLIPGDG+GPE+  +VQ +F AANVP+E+E   ++ V  P     + Q + +S+ 
Sbjct  46   GTKKVTLIPGDGIGPEISAAVQKIFTAANVPIEWEAVDVTPVRGPDGKFGIPQAAIDSVN  105

Query  98   RNRVCLKGILATPDHSMTGELQTLNMKLRKSLDLYSNVVHVKSLPGVTCRHKNVDCIIIR  157
             N++ LKG L TP   +    ++LN+ LRK  +LY+NV   +SL G    + +VD + IR
Sbjct  106  TNKIGLKGPLMTP---VGKGHRSLNLALRKEFNLYANVRPCRSLEGYKTLYDDVDVVTIR  162

Query  158  EQTEGEYSALEHESVKGVVECLKIVTAVKSQRIAKFAFDYAVKHNRKKVTCVHKANIMKL  217
            E TEGEYS +EHE V GVV+ +K++T   S+R+A++AF YA  +NRKKVT VHKANIM++
Sbjct  163  ENTEGEYSGIEHEIVDGVVQSIKLITEEASKRVAEYAFQYAKNNNRKKVTVVHKANIMRM  222

Query  218  GDGLFLKSCQEIAKMYPRITFETMIVDNCTMQMVSNPHQFDVMVLPNLYGNILDNVASGL  277
             DGLFL+  +++A+ +P I FE   +D   + MV NP ++DV+V+PNLYG+IL ++ +GL
Sbjct  223  SDGLFLRCVRDMAQKFPEIQFEEKYLDTVCLNMVQNPGKYDVLVMPNLYGDILSDMCAGL  282

Query  278  VGGAGVVAGASYSPECVVFEPGARHTYSEAVGKNVANPTAMLLCAVKLLRHVNLKRYSEQ  337
            VGG G+    +      +FE     T  +  GK++ANPTA+LL AV +LRH+ L  Y+++
Sbjct  283  VGGLGLTPSGNMGLNGALFE-SVHGTAPDIAGKDLANPTALLLSAVMMLRHMELNTYADK  341

Query  338  IKDALNRVLNDGKVLTKDLGGQSSTTDFTTAV  369
            I+ A    + +GK LT DLGG++  ++FT  +
Sbjct  342  IERAAFETIKEGKYLTGDLGGRAKCSEFTNEI  373



Lambda      K        H
   0.319    0.133    0.387 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3931755120


Query= XP_003392894.1 methenyltetrahydrofolate synthase domain-containing
protein [Bombus terrestris]

Length=457
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VN21_DROME  unnamed protein product                                 251     2e-77
Q8IGE9_DROME  unnamed protein product                                 250     3e-77
Q384C0_TRYB2  unnamed protein product                                 29.6    6.5  


>Q9VN21_DROME unnamed protein product
Length=545

 Score = 251 bits (640),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 150/432 (35%), Positives = 254/432 (59%), Gaps = 21/432 (5%)

Query  7    PPEVTKHSFRQKVWDYLMKNDLVNFPLTVYDRIPNFKGAAEAAQRLADLEIFKEAKIIKI  66
            P E TK S R + W  + +  +      +++RIP+F GA +AA   A+ E FK+A+ IK+
Sbjct  29   PIEPTKRSLRVQTWKKIQEGKVGIGFNNIFNRIPSFVGADKAAALFANEEEFKKAQHIKV  88

Query  67   NPDKPQEPVRFLALEANKEILVPIPRLRTGLFLHVTPIAGSSKSELRTLSKIHGLTEAGK  126
            N D+     + LAL A+K + +P  R  + L L V  +A +++ + +   ++  + +   
Sbjct  89   NIDRVLHEFKELALLADKSVYLPSTRESSALCLKVDVLADATEEQKKEALRVQDIQKFRS  148

Query  127  PLGVDSKIKIDLVILGSVCVSHDGYRLGKGKGFADLEFAMMMRMGAVTQDTIVITTVHDC  186
             +G+DS +K+D+V++GSV VS +GYR+G+G GFADL+  +++ +GA+T  TI++T VHD 
Sbjct  149  EIGLDSGLKLDIVVIGSVVVSREGYRIGRGNGFADLDIGLLIELGAITPKTIIVTIVHDM  208

Query  187  QVFDSLPPEIFKEYDVPVDIIVTPTQTIIVNPKLKKPSCIMWHMLSERRIKSMPVLQQLK  246
            QV DSLPP +F++YD PVDII TPT+ I V  +L  P+ + W +LSERR+K +PVLQQLK
Sbjct  209  QVVDSLPPNLFQKYDTPVDIIATPTEIIRVPKRLSFPNGVYWELLSERRLKILPVLQQLK  268

Query  247  EMDEKEGKIVTLKEEDSDIEIQKSYRSHYIKNKRRSKTKKAASSGKDVNEERGEQVKPRS  306
            E +EK GK ++LKEED+D+E    ++++  +     +  +  + G+  ++   EQ +  +
Sbjct  269  EREEKAGKSISLKEEDTDVE---QHQNNRRRRGPVRRRIQRGNPGRTTSQTDNEQPQGET  325

Query  307  SKKRAFNK-----------IKSGDDNVFSDVAEAKVERNDKNMQQRRKNLRLKSKSQ-VE  354
            ++KR   +            KS  D       EA  + +D+ + +   + R   K++  +
Sbjct  326  AQKRTPRRKGRFVNRRRRTTKSEGDQ---SGVEAGAKTDDRKLPEAGTDERRSKKNKNSD  382

Query  355  FSLKLSNISSGARIRDLKNALSERGIKPNEITWLGYRGICYLHFNKLRKNNSLSEQPIQV  414
            F +KL+N+S   R++DLK+ L +R   P  I+W G+ G C+LHF   +   S  +    +
Sbjct  383  FCIKLTNLSRDIRVKDLKSELRKRECTPMSISWKGHFGKCFLHFGNRKGVPSTQD---DM  439

Query  415  DSIMANLQQLCI  426
            D ++ +L  L +
Sbjct  440  DKVLKSLNDLSL  451


>Q8IGE9_DROME unnamed protein product
Length=534

 Score = 250 bits (639),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 150/432 (35%), Positives = 254/432 (59%), Gaps = 21/432 (5%)

Query  7    PPEVTKHSFRQKVWDYLMKNDLVNFPLTVYDRIPNFKGAAEAAQRLADLEIFKEAKIIKI  66
            P E TK S R + W  + +  +      +++RIP+F GA +AA   A+ E FK+A+ IK+
Sbjct  18   PIEPTKRSLRVQTWKKIQEGKVGIGFNNIFNRIPSFVGADKAAALFANEEEFKKAQHIKV  77

Query  67   NPDKPQEPVRFLALEANKEILVPIPRLRTGLFLHVTPIAGSSKSELRTLSKIHGLTEAGK  126
            N D+     + LAL A+K + +P  R  + L L V  +A +++ + +   ++  + +   
Sbjct  78   NIDRVLHEFKELALLADKSVYLPSTRESSALCLKVDVLADATEEQKKEALRVQDIQKFRS  137

Query  127  PLGVDSKIKIDLVILGSVCVSHDGYRLGKGKGFADLEFAMMMRMGAVTQDTIVITTVHDC  186
             +G+DS +K+D+V++GSV VS +GYR+G+G GFADL+  +++ +GA+T  TI++T VHD 
Sbjct  138  EIGLDSGLKLDIVVIGSVVVSREGYRIGRGNGFADLDIGLLIELGAITPKTIIVTIVHDM  197

Query  187  QVFDSLPPEIFKEYDVPVDIIVTPTQTIIVNPKLKKPSCIMWHMLSERRIKSMPVLQQLK  246
            QV DSLPP +F++YD PVDII TPT+ I V  +L  P+ + W +LSERR+K +PVLQQLK
Sbjct  198  QVVDSLPPNLFQKYDTPVDIIATPTEIIRVPKRLSFPNGVYWELLSERRLKILPVLQQLK  257

Query  247  EMDEKEGKIVTLKEEDSDIEIQKSYRSHYIKNKRRSKTKKAASSGKDVNEERGEQVKPRS  306
            E +EK GK ++LKEED+D+E    ++++  +     +  +  + G+  ++   EQ +  +
Sbjct  258  EREEKAGKSISLKEEDTDVE---QHQNNRRRRGPVRRRIQRGNPGRTTSQTDNEQPQGET  314

Query  307  SKKRAFNK-----------IKSGDDNVFSDVAEAKVERNDKNMQQRRKNLRLKSKSQ-VE  354
            ++KR   +            KS  D       EA  + +D+ + +   + R   K++  +
Sbjct  315  AQKRTPRRKGRFVNRRRRTTKSEGDQ---SGVEAGAKTDDRKLPEAGTDERRSKKNKNSD  371

Query  355  FSLKLSNISSGARIRDLKNALSERGIKPNEITWLGYRGICYLHFNKLRKNNSLSEQPIQV  414
            F +KL+N+S   R++DLK+ L +R   P  I+W G+ G C+LHF   +   S  +    +
Sbjct  372  FCIKLTNLSRDIRVKDLKSELRKRECTPMSISWKGHFGKCFLHFGNRKGVPSTQD---DM  428

Query  415  DSIMANLQQLCI  426
            D ++ +L  L +
Sbjct  429  DKVLKSLNDLSL  440


>Q384C0_TRYB2 unnamed protein product
Length=1216

 Score = 29.6 bits (65),  Expect = 6.5, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 39/78 (50%), Gaps = 8/78 (10%)

Query  287  AASSGKDVNEERGEQVKPRSSKKRAFNKIK--SGDDNVFSDV------AEAKVERNDKNM  338
            A   GK + EE+   ++ R +KK+AFN++    G +N +S         EAK ER D  +
Sbjct  741  AIVGGKPLTEEQERLLQKRMAKKKAFNELYDMGGKNNTYSHYHEMTREVEAKKERLDTAL  800

Query  339  QQRRKNLRLKSKSQVEFS  356
            Q+   ++  K K    FS
Sbjct  801  QEVGHDITNKIKLVGHFS  818



Lambda      K        H
   0.319    0.133    0.387 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3931755120


Query= XP_003392897.3 protein Star [Bombus terrestris]

Length=340
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

STAR_DROME  unnamed protein product                                   121     3e-30


>STAR_DROME unnamed protein product
Length=597

 Score = 121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 82/278 (29%), Positives = 136/278 (49%), Gaps = 48/278 (17%)

Query  62   VASCL-AFLAAFSTAMSLLLVWSEAAALRRQAFDANMTRDYVLNSVSMDNPELVAYIREV  120
            +A CL +F A F+T    L+V+ +   +R Q F  NM+RDY LN V+ D+P L+ ++R++
Sbjct  283  IALCLLSFAAVFAT----LIVYMDTTEIRHQQFRLNMSRDYELNGVAQDDPALIDFLRQI  338

Query  121  QL-KPTTQQDPSNATQTTE-------------------------------ERYVAGLTEG  148
             + K   +  P  A   +                                  YVA L  G
Sbjct  339  HMGKYLGKASPKVAAAASVGVGPPPNSPRLAAAGSTFGSGNSSGSGADQLAHYVADLVGG  398

Query  149  KREGVYVEYISR-IGAISSTGWLERNLSWRGVLILTDPRSFFEAHR-GTRNPKTRVLHAC  206
            K  G  ++ +S  +  + +  WL   L+W GVL+  +PR +F   +   +  + +V+HAC
Sbjct  399  KMNGAVIQSLSGPLAHLITAPWLSEQLNWMGVLVEPEPRWYFTLRKQNAQRARMQVVHAC  458

Query  207  LSTDKDTKEITYHQESEVQVTKLGEGPNSLVSSDEGFPTTRLKCFPLYSVLLAYSATTLD  266
            +S +   KEIT H E +V++       NSL   +  +  +R+KCFPLY+++LA   T  D
Sbjct  459  VSPNTYPKEITIHNE-DVRI-------NSLHDEETSWFNSRVKCFPLYTIMLACERTEYD  510

Query  267  YLSLDSPDAQDSQVLDTIPWETTRISVVSIRWSPHHSE  304
             LSL      + ++L T+P++  +I V+SI     H +
Sbjct  511  LLSLGV-QGHELEILQTLPFDKVKIDVISIHLLEDHED  547



Lambda      K        H
   0.319    0.133    0.387 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3931755120


Query= XP_003392898.1 facilitated trehalose transporter Tret1 [Bombus
terrestris]

Length=477
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8IQH6_DROME  unnamed protein product                                 356     1e-118
Q9VU17_DROME  unnamed protein product                                 356     1e-117
TRE12_DROME  unnamed protein product                                  312     2e-101


>Q8IQH6_DROME unnamed protein product
Length=471

 Score = 356 bits (913),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 186/469 (40%), Positives = 288/469 (61%), Gaps = 3/469 (1%)

Query  9    DAAVRQESRKLWQYLASISACILVVGVGTALAWTSPVLPQLYAADSW--LVITKEQGSWI  66
              +    S+K  QY+A+++A       GT L WTSP   ++          + K+Q SW+
Sbjct  3    HTSTSNNSQKWPQYVAALAAAGGAFAAGTVLGWTSPAETEIVDRGEGYDFPVDKDQFSWV  62

Query  67   SSLLALGAIAGALGSGSMADKMGRKKSLLLLSVPFLLSWGIILVATEVKLLYIARFLVGI  126
             S + LGA    +  G + + +GRK ++L L +PF+L W +++ A  V +LY +RF++GI
Sbjct  63   GSAMTLGAACVCIPIGFLINMIGRKWTMLFLVLPFILGWTMLIWAVNVSMLYASRFILGI  122

Query  127  GVGAGCVLGPTYISEISEVSTRGTLGALFQLFLTVGIFVAFILGSVLNYTMLALVCALIV  186
              GA CV  P Y  EI++   RGTLG+ FQL +T+GI   + +G+ +    L+++C ++ 
Sbjct  123  AGGAFCVTAPMYTGEIAQKEIRGTLGSFFQLMITIGILFVYAVGAGVKIFWLSIICGILP  182

Query  187  VFFLTTFYWMPESPVWLVNQNRKQEAMSAMSVLRGEDYDPKQELNEMQKEAEASAGKKPS  246
            + F   F++MPESP +LV+++R + A+ ++  LRG++YD + EL E+++    +   K +
Sbjct  183  LIFGAIFFFMPESPTYLVSKDRSENAIKSIQWLRGKEYDYEPELAELRETDRETKANKVN  242

Query  247  LSDMAKDPVNKKAMIASFGMMFFQQASGVNAVIFYTVMIFEASGSSMAPELASILVALVQ  306
            +      PV +KA+  S G+MFFQQ  G+NAVIFY   IF  + + +  E A+IL+ ++Q
Sbjct  243  VWAALNRPVTRKALAISMGLMFFQQVCGINAVIFYASRIFLEANTGIEAEWATILIGIMQ  302

Query  307  LVMSGVAALIVDRAGRKPLLMISTSIMSVSLIALG-YYFQQKDDGNDVSSLGWLPLASLI  365
            +V + V+ L+VD+ GR+ LL+ S   M++S  A+G Y+F QK D   V SLGWLP+ASL 
Sbjct  303  VVATFVSTLVVDKLGRRILLLASGISMAISTTAIGVYFFLQKQDAAQVVSLGWLPVASLC  362

Query  366  VFMVAFSIGLGPVPWMLMGELFAAETKAVASSVAVMLNWLLVFIVTKTFPMMNKELGTDM  425
            +F++ FSIG GPVPW++MGELFA + K  A S+A   NWLL F+VTKTF  +N  LG   
Sbjct  363  LFIIMFSIGYGPVPWLMMGELFATDIKGFAGSLAGTSNWLLAFVVTKTFVNLNDGLGIGG  422

Query  426  TFWIFAVVMACATAFTHVLVPETKGKTYQQIHDELQGGPTVDKSVQQMK  474
            TFW+FA +      F +  VPETKGK+  +I  EL G  +  +++   K
Sbjct  423  TFWLFAGLTVVGVIFVYFAVPETKGKSLNEIQQELAGNRSTPQAIPAEK  471


>Q9VU17_DROME unnamed protein product
Length=539

 Score = 356 bits (913),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 187/473 (40%), Positives = 290/473 (61%), Gaps = 3/473 (1%)

Query  5    GMINDAAVRQESRKLWQYLASISACILVVGVGTALAWTSPVLPQLYAADSW--LVITKEQ  62
            G +   +    S+K  QY+A+++A       GT L WTSP   ++          + K+Q
Sbjct  67   GNMVHTSTSNNSQKWPQYVAALAAAGGAFAAGTVLGWTSPAETEIVDRGEGYDFPVDKDQ  126

Query  63   GSWISSLLALGAIAGALGSGSMADKMGRKKSLLLLSVPFLLSWGIILVATEVKLLYIARF  122
             SW+ S + LGA    +  G + + +GRK ++L L +PF+L W +++ A  V +LY +RF
Sbjct  127  FSWVGSAMTLGAACVCIPIGFLINMIGRKWTMLFLVLPFILGWTMLIWAVNVSMLYASRF  186

Query  123  LVGIGVGAGCVLGPTYISEISEVSTRGTLGALFQLFLTVGIFVAFILGSVLNYTMLALVC  182
            ++GI  GA CV  P Y  EI++   RGTLG+ FQL +T+GI   + +G+ +    L+++C
Sbjct  187  ILGIAGGAFCVTAPMYTGEIAQKEIRGTLGSFFQLMITIGILFVYAVGAGVKIFWLSIIC  246

Query  183  ALIVVFFLTTFYWMPESPVWLVNQNRKQEAMSAMSVLRGEDYDPKQELNEMQKEAEASAG  242
             ++ + F   F++MPESP +LV+++R + A+ ++  LRG++YD + EL E+++    +  
Sbjct  247  GILPLIFGAIFFFMPESPTYLVSKDRSENAIKSIQWLRGKEYDYEPELAELRETDRETKA  306

Query  243  KKPSLSDMAKDPVNKKAMIASFGMMFFQQASGVNAVIFYTVMIFEASGSSMAPELASILV  302
             K ++      PV +KA+  S G+MFFQQ  G+NAVIFY   IF  + + +  E A+IL+
Sbjct  307  NKVNVWAALNRPVTRKALAISMGLMFFQQVCGINAVIFYASRIFLEANTGIEAEWATILI  366

Query  303  ALVQLVMSGVAALIVDRAGRKPLLMISTSIMSVSLIALG-YYFQQKDDGNDVSSLGWLPL  361
             ++Q+V + V+ L+VD+ GR+ LL+ S   M++S  A+G Y+F QK D   V SLGWLP+
Sbjct  367  GIMQVVATFVSTLVVDKLGRRILLLASGISMAISTTAIGVYFFLQKQDAAQVVSLGWLPV  426

Query  362  ASLIVFMVAFSIGLGPVPWMLMGELFAAETKAVASSVAVMLNWLLVFIVTKTFPMMNKEL  421
            ASL +F++ FSIG GPVPW++MGELFA + K  A S+A   NWLL F+VTKTF  +N  L
Sbjct  427  ASLCLFIIMFSIGYGPVPWLMMGELFATDIKGFAGSLAGTSNWLLAFVVTKTFVNLNDGL  486

Query  422  GTDMTFWIFAVVMACATAFTHVLVPETKGKTYQQIHDELQGGPTVDKSVQQMK  474
            G   TFW+FA +      F +  VPETKGK+  +I  EL G  +  +++   K
Sbjct  487  GIGGTFWLFAGLTVVGVIFVYFAVPETKGKSLNEIQQELAGNRSTPQAIPAEK  539


>TRE12_DROME unnamed protein product
Length=488

 Score = 312 bits (800),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 166/442 (38%), Positives = 261/442 (59%), Gaps = 8/442 (2%)

Query  25   SISACILVVGVGTALAWTSPVLPQLYAAD-SWLVITKEQGSWISSLLALGAIAGALGSGS  83
            S+S C LVVG  +A  +TSP L  +     +   +TK+ GSW+  ++ L A+AG +  G 
Sbjct  34   SVSLCSLVVGFVSA--YTSPALVSMTDRTITSFEVTKDAGSWVGGIMPLAALAGGITGGP  91

Query  84   MADKMGRKKSLLLLSVPFLLSWGIILVATEVKLLYIARFLVGIGVGAGCVLGPTYISEIS  143
            + + +GR+ ++L  +VPF++S  +I  A  V ++   RFL G  VG   +  P Y+ E  
Sbjct  92   LIEYLGRRSTILATAVPFIVSSLLIACAVNVIMILCGRFLTGFCVGIASLSLPVYLGETL  151

Query  144  EVSTRGTLGALFQLFLTVGIFVAFILGSVLNYTMLALVCALIVVFFLTTFYWMPESPVWL  203
            +   RGTLG L      +GI V ++ GS +N++MLA + A + V FL     +PE+P W 
Sbjct  152  QPEVRGTLGLLPTALGNIGILVCYVAGSFMNWSMLAFLGAALPVPFLILMIIIPETPRWF  211

Query  204  VNQNRKQEAMSAMSVLRGEDYDPKQELNEM---QKEAEASAGKKPSLSDMAKDPVNKKAM  260
            VN+ +++ A  A+  LRG++ D + EL E+   Q +A+  A +   L    ++  N K +
Sbjct  212  VNRGQEERARKALKWLRGKEADVEPELKELMQSQADADRQATQNTCLELFKRN--NLKPL  269

Query  261  IASFGMMFFQQASGVNAVIFYTVMIFEASGSSMAPELASILVALVQLVMSGVAALIVDRA  320
              S G+MFFQQ SG+NAVIFYTV IF+ +GS++   L++I+V +V    + +  +++DR 
Sbjct  270  SISLGLMFFQQFSGINAVIFYTVQIFKDAGSTIDSNLSTIIVGVVNFFATFMGIILIDRL  329

Query  321  GRKPLLMISTSIMSVSLIALGYYFQQKDDGNDVSSLGWLPLASLIVFMVAFSIGLGPVPW  380
            GRK LL +S   M V+L  LG +F  K  G DVS LGWLPL   +++++ FS+G GP+PW
Sbjct  330  GRKILLYVSDIAMIVTLSILGGFFYCKAHGPDVSHLGWLPLTCFVIYILGFSLGFGPIPW  389

Query  381  MLMGELFAAETKAVASSVAVMLNWLLVFIVTKTFPMMNKELGTDMTFWIFAVVMACATAF  440
            ++MGE+  A+ +  A+SV    NW   F+VTKTF  +   +G    FW+F  +      F
Sbjct  390  LMMGEILPAKIRGPAASVVTAFNWFCTFVVTKTFQDLTVAMGAHGAFWLFGAICIVGLFF  449

Query  441  THVLVPETKGKTYQQIHDELQG  462
              + VPET+GK+ ++I  ++ G
Sbjct  450  VIIFVPETRGKSLEEIERKMMG  471



Lambda      K        H
   0.319    0.133    0.387 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3931755120


Query= XP_003392902.2 lateral signaling target protein 2 homolog [Bombus
terrestris]

Length=499
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7KS77_DROME  unnamed protein product                                 204     1e-59
Q9VDA1_DROME  unnamed protein product                                 202     6e-59
Q9VDA2_DROME  unnamed protein product                                 188     7e-55


>Q7KS77_DROME unnamed protein product
Length=479

 Score = 204 bits (518),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 124/164 (76%), Gaps = 15/164 (9%)

Query  336  KTSQQHGSQSGHHGK---RTTGQG-----SPLDALFQMTSKTFDAGEHSQEQANHLNLFN  387
            K + Q GS+     K   + TG G     +PLDALFQMT+K FD    SQ+++ HL++F+
Sbjct  290  KLTTQEGSEEAQKKKSEEQPTGSGKSNGDTPLDALFQMTTKDFD---ESQDKS-HLDIFS  345

Query  388  NRQQPKKKRKSRTAFTNQQIFELEKRFLYQKYLSPADRDEIATQLGLSNAQVITWFQNRR  447
            NR QPKKKRKSRTAFTN QIFELEKRFLYQKYLSPADRDEIA  LGLSNAQVITWFQNRR
Sbjct  346  NRPQPKKKRKSRTAFTNHQIFELEKRFLYQKYLSPADRDEIAASLGLSNAQVITWFQNRR  405

Query  448  AKLKRDMEELKKDVQTVNPLLVAQHHKTFLENVQDLGILKKRPL  491
            AK KRD+EELKKD  +V    V   HK+FLENV DL ILKK+P+
Sbjct  406  AKQKRDIEELKKDFDSVK---VFSAHKSFLENVNDLSILKKKPM  446


 Score = 35.4 bits (80),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 32/68 (47%), Gaps = 22/68 (32%)

Query  157  SAAG-AADDYFKPLKRLKMVQMQHSDEEDDRD-----------RDTNE------RGVKSF  198
            SA G   +DYF PLKRL+M     S   + RD             TN+       GVKSF
Sbjct  79   SAVGNLPEDYFHPLKRLRM----SSSSSEPRDHTPSPPSAVPEPQTNQTTKSAIEGVKSF  134

Query  199  SILDILSH  206
            SI DIL H
Sbjct  135  SIADILGH  142


>Q9VDA1_DROME unnamed protein product
Length=479

 Score = 202 bits (513),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 107/164 (65%), Positives = 124/164 (76%), Gaps = 15/164 (9%)

Query  336  KTSQQHGSQSGHHGK---RTTGQG-----SPLDALFQMTSKTFDAGEHSQEQANHLNLFN  387
            K + Q GS+     K   + TG G     +PLDALFQMT+K FD    SQ+++ HL++F+
Sbjct  290  KLTTQEGSEEAQKKKSEEQPTGSGKSNGDTPLDALFQMTTKDFD---ESQDKS-HLDIFS  345

Query  388  NRQQPKKKRKSRTAFTNQQIFELEKRFLYQKYLSPADRDEIATQLGLSNAQVITWFQNRR  447
            +R QPKKKRKSRTAFTN QIFELEKRFLYQKYLSPADRDEIA  LGLSNAQVITWFQNRR
Sbjct  346  DRPQPKKKRKSRTAFTNHQIFELEKRFLYQKYLSPADRDEIAASLGLSNAQVITWFQNRR  405

Query  448  AKLKRDMEELKKDVQTVNPLLVAQHHKTFLENVQDLGILKKRPL  491
            AK KRD+EELKKD  +V    V   HK+FLENV DL ILKK+P+
Sbjct  406  AKQKRDIEELKKDFDSVK---VFSAHKSFLENVNDLSILKKKPM  446


 Score = 36.2 bits (82),  Expect = 0.053, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 30/64 (47%), Gaps = 14/64 (22%)

Query  157  SAAG-AADDYFKPLKRLKMVQMQHSDEE-------------DDRDRDTNERGVKSFSILD  202
            SA G  A+DYF PLKRL+M        E              ++   +   GVKSFSI D
Sbjct  79   SAVGNLAEDYFHPLKRLRMSSSSSEPREHTASPPSAVPEPQTNQTTKSAIEGVKSFSIAD  138

Query  203  ILSH  206
            IL H
Sbjct  139  ILGH  142


>Q9VDA2_DROME unnamed protein product
Length=372

 Score = 188 bits (477),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 109/143 (76%), Gaps = 8/143 (6%)

Query  349  GKRTTGQGSPLDALFQMTSKTFDAGEHSQEQANHLNLFNNRQQPKKKRKSRTAFTNQQIF  408
            G   +   +PLDALFQ+++K FD     Q+ A  LN+F  R  PKKKRKSRTAFTNQQIF
Sbjct  209  GASKSSGDTPLDALFQLSTKNFD---EEQDPAT-LNIFATRSNPKKKRKSRTAFTNQQIF  264

Query  409  ELEKRFLYQKYLSPADRDEIATQLGLSNAQVITWFQNRRAKLKRDMEELKKDVQTVNPLL  468
            ELEKRFLYQKYLSPADRDEIA  LGLSNAQVITWFQNRRAKLKRDMEELKKDVQ      
Sbjct  265  ELEKRFLYQKYLSPADRDEIAGGLGLSNAQVITWFQNRRAKLKRDMEELKKDVQCEK---  321

Query  469  VAQHHKTFLENVQDLGILKKRPL  491
                +++FL+NV DL ILK RP+
Sbjct  322  -MSANQSFLKNVNDLTILKTRPV  343



Lambda      K        H
   0.319    0.133    0.387 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3931755120


Query= XP_003392903.1 transcription factor LBX1 [Bombus terrestris]

Length=340
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

BAGP_DROME  unnamed protein product                                   127     3e-33
A8Y527_DROME  unnamed protein product                                 90.5    2e-20
Q7PL95_DROME  unnamed protein product                                 91.7    3e-20


>BAGP_DROME unnamed protein product
Length=382

 Score = 127 bits (318),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 76/88 (86%), Gaps = 3/88 (3%)

Query  179  SRKKRSRAAFSHAQVYELERRFAAQKYLSGPERADLARGLKLTETQVKIWFQNRRYKTKR  238
            SRKKRSRAAFSHAQV+ELERRFA Q+YLSGPER+++A+ L+LTETQVKIWFQNRRYKTKR
Sbjct  173  SRKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKR  232

Query  239  RQ-QQELGALVNSGNARRVAVRVLVHPD  265
            +Q QQ   AL+  G ++RV V+VLV  D
Sbjct  233  KQIQQHEAALL--GASKRVPVQVLVRED  258


>A8Y527_DROME unnamed protein product
Length=307

 Score = 90.5 bits (223),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 60/91 (66%), Gaps = 6/91 (7%)

Query  177  LQSRKKRSRAAFSHAQVYELERRFAAQKYLSGPERADLARGLKLTETQVKIWFQNRRYKT  236
            L  R+KR R  F+ AQVYELERRF  Q+YLS PER  LA  + LT TQVKIWFQN RYK 
Sbjct  89   LAQRRKR-RVLFTQAQVYELERRFKQQRYLSAPEREHLASLIHLTPTQVKIWFQNHRYKC  147

Query  237  KRRQQQELGALVNSGN-----ARRVAVRVLV  262
            KR+ +++  A  N  N      RRVAV VLV
Sbjct  148  KRQAKEKAMAEQNQHNQPASSPRRVAVPVLV  178


>Q7PL95_DROME unnamed protein product
Length=468

 Score = 91.7 bits (226),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 60/91 (66%), Gaps = 6/91 (7%)

Query  177  LQSRKKRSRAAFSHAQVYELERRFAAQKYLSGPERADLARGLKLTETQVKIWFQNRRYKT  236
            L  R+KR R  F+ AQVYELERRF  Q+YLS PER  LA  + LT TQVKIWFQN RYK 
Sbjct  250  LAQRRKR-RVLFTQAQVYELERRFKQQRYLSAPEREHLASLIHLTPTQVKIWFQNHRYKC  308

Query  237  KRRQQQELGALVNSGNA-----RRVAVRVLV  262
            KR+ +++  A  N  N      RRVAV VLV
Sbjct  309  KRQAKEKAMAEQNQHNQPASSPRRVAVPVLV  339



Lambda      K        H
   0.319    0.133    0.387 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3931755120


Query= XP_003392904.1 homeobox protein Nkx-2.5-like [Bombus terrestris]

Length=384
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A8Y527_DROME  unnamed protein product                                 115     2e-29
Q7PL95_DROME  unnamed protein product                                 116     2e-28
Q9NCG1_DROME  unnamed protein product                                 113     5e-28


>A8Y527_DROME unnamed protein product
Length=307

 Score = 115 bits (289),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 70/94 (74%), Gaps = 5/94 (5%)

Query  119  KRKPRVLFSQNQVYELEQRFKQQRYLSAPERELLAQTLKLTSTQVKIWFQNRRYKNKRAR  178
            +RK RVLF+Q QVYELE+RFKQQRYLSAPERE LA  + LT TQVKIWFQN RYK KR  
Sbjct  92   RRKRRVLFTQAQVYELERRFKQQRYLSAPEREHLASLIHLTPTQVKIWFQNHRYKCKRQA  151

Query  179  LEDAEKLQAQNAKNQ---SLKKIHVPVLIRDGKP  209
             E A  +  QN  NQ   S +++ VPVL++DGKP
Sbjct  152  KEKA--MAEQNQHNQPASSPRRVAVPVLVKDGKP  183


>Q7PL95_DROME unnamed protein product
Length=468

 Score = 116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 70/94 (74%), Gaps = 5/94 (5%)

Query  119  KRKPRVLFSQNQVYELEQRFKQQRYLSAPERELLAQTLKLTSTQVKIWFQNRRYKNKRAR  178
            +RK RVLF+Q QVYELE+RFKQQRYLSAPERE LA  + LT TQVKIWFQN RYK KR  
Sbjct  253  RRKRRVLFTQAQVYELERRFKQQRYLSAPEREHLASLIHLTPTQVKIWFQNHRYKCKRQA  312

Query  179  LEDAEKLQAQNAKNQ---SLKKIHVPVLIRDGKP  209
             E A  +  QN  NQ   S +++ VPVL++DGKP
Sbjct  313  KEKA--MAEQNQHNQPASSPRRVAVPVLVKDGKP  344


>Q9NCG1_DROME unnamed protein product
Length=380

 Score = 113 bits (283),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 69/94 (73%), Gaps = 5/94 (5%)

Query  119  KRKPRVLFSQNQVYELEQRFKQQRYLSAPERELLAQTLKLTSTQVKIWFQNRRYKNKRAR  178
            +RK RVLF+Q QVYELE+RFKQQRYLSAPERE LA  + LT TQVKIWFQN RYK KR  
Sbjct  165  RRKRRVLFTQAQVYELERRFKQQRYLSAPEREHLASLIHLTPTQVKIWFQNHRYKCKRQA  224

Query  179  LEDAEKLQAQNAKNQ---SLKKIHVPVLIRDGKP  209
               A  +  QN  NQ   S +++ VPVL++DGKP
Sbjct  225  KRKA--MAEQNQHNQPASSPRRVAVPVLVKDGKP  256



Lambda      K        H
   0.319    0.133    0.387 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3931755120


Query= XP_003392905.2 homeobox protein MSX-1 [Bombus terrestris]

Length=417
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

HMSH_DROME  unnamed protein product                                   166     5e-46
VAB15_CAEEL  unnamed protein product                                  137     8e-38
Q9VSC2_DROME  unnamed protein product                                 84.3    2e-17


>HMSH_DROME unnamed protein product
Length=515

 Score = 166 bits (420),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 95/186 (51%), Positives = 112/186 (60%), Gaps = 31/186 (17%)

Query  220  PVRPTPAYIGGFSSLGSISGIPTGLHPAV-WGGGHQGAAAAAAAAAAAAATASFFPSHFS  278
            P+RPTP     FS+L + +   TG+   V W G  Q            A           
Sbjct  356  PIRPTP-----FSALAAAAVAWTGMGGGVPWPGTRQMPPFGPPGMFPGAGFG--------  402

Query  279  HHAPLNENGEPAKIKCNLRKHKPNRKPRTPFTTQQLLALEKKFTERQYLSVAERAEFSSS  338
                  +  EP +IKCNLRKHKPNRKPRTPFTTQQLL+LEKKF E+QYLS+AERAEFSSS
Sbjct  403  -----GDANEPPRIKCNLRKHKPNRKPRTPFTTQQLLSLEKKFREKQYLSIAERAEFSSS  457

Query  339  LHLTETQVKIWFQNRRAKAKRMQEAEIEKLRMCAVRQQHTTLYGSHPGLLAPASLYPVGM  398
            L LTETQVKIWFQNRRAKAKR+QEAEIEK++M A+            G  AP + + +  
Sbjct  458  LRLTETQVKIWFQNRRAKAKRLQEAEIEKIKMAAL------------GRGAPGAQWAMAG  505

Query  399  LSHPGL  404
              HP L
Sbjct  506  YFHPSL  511


>VAB15_CAEEL unnamed protein product
Length=225

 Score = 137 bits (344),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 100/166 (60%), Gaps = 15/166 (9%)

Query  218  PTPVRP-TPAYIGGFSSLGSISGIPTGLHPAVWGGGHQGAAAAAAAAAAAAATASFFPSH  276
            PTP+ P TP  I G   +    G    L P +      G      ++ ++  + +  P  
Sbjct  34   PTPITPKTPMLIPGLHPMTPYFG--AQLDPVMIYFAQTGNRLPIVSSDSSPESCASSPLS  91

Query  277  FSHHAPL-------NENGEPAKI-----KCNLRKHKPNRKPRTPFTTQQLLALEKKFTER  324
              H           +   + AKI     KC LRKHK NRKPRTPF+TQQL++LE+KF  +
Sbjct  92   MQHSLQWLSSQREDSPTSDDAKIQIGLSKCMLRKHKNNRKPRTPFSTQQLISLERKFQSK  151

Query  325  QYLSVAERAEFSSSLHLTETQVKIWFQNRRAKAKRMQEAEIEKLRM  370
            QYLS+AERAEFS+SL LTETQVKIWFQNRRAK+KR+QEAE+EK++ 
Sbjct  152  QYLSIAERAEFSASLQLTETQVKIWFQNRRAKSKRLQEAEVEKVKF  197


>Q9VSC2_DROME unnamed protein product
Length=525

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 50/65 (77%), Gaps = 0/65 (0%)

Query  302  NRKPRTPFTTQQLLALEKKFTERQYLSVAERAEFSSSLHLTETQVKIWFQNRRAKAKRMQ  361
             R+PRT FT+QQLL LEK+F + +YLS  +R E +S L L+ETQVKIWFQNRR K KR +
Sbjct  439  TRRPRTAFTSQQLLELEKQFKQNKYLSRPKRFEVASGLMLSETQVKIWFQNRRMKWKRSK  498

Query  362  EAEIE  366
            +A+ E
Sbjct  499  KAQQE  503



Lambda      K        H
   0.319    0.133    0.387 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3931755120


Query= XP_003392919.1 uncharacterized protein LOC100650023 isoform X3
[Bombus terrestris]

Length=844
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SCHI1_DROME  unnamed protein product                                  131     2e-31


>SCHI1_DROME unnamed protein product
Length=616

 Score = 131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 87/280 (31%), Positives = 150/280 (54%), Gaps = 38/280 (14%)

Query  536  FDVYNIETAMPKIDLDAIESHLRAAREEERRRRNDREEIRRRLAMGPDAEDLRAERGRKP  595
            FD Y I   M   D++ +++H +  ++ E++RR +R+EIR+RLA+G D + L  +  ++ 
Sbjct  346  FDAYKIANDM---DVETLQNHYKKVKQIEKKRRFNRDEIRKRLAIG-DKDSLNNDIKKEE  401

Query  596  SLQSRLQSGMNLQICFMNETPSDTESPCSENDASPGSTPSLLNSKQQ----QKQQMPVRP  651
             L                 T SD ES  S+++  P  +  +L  + +    ++ +     
Sbjct  402  FL-----------------TGSDNESYSSDSETCPKLSSGVLRKQSEFCETKRNKEFEND  444

Query  652  QVLSLPPLRLDSGLN---SAPIDEAD--------FFARQARLQTEARMALAQAKEMAHMQ  700
            ++     +  D  +N     PI   D        FFA Q++LQ E R+ALAQ+KE+A  Q
Sbjct  445  KIFQKNQINQDKSMNHMNGNPIGTTDYPSDENLFFFANQSKLQIEVRIALAQSKEIA--Q  502

Query  701  MEVERQRLKQSPITEMVRSSLEKVGVQLGEDRRRLSRVLLTELNVAQLQVVANDLHARIA  760
            M+V+ ++   +PI +++RS L  VG+++  + R +SR LLT + V  LQ++ N+L   I 
Sbjct  503  MKVKARKHGVTPIVDVIRSMLCDVGIKMNSNHRWISRQLLTGIQVPTLQLLVNNLQEYIE  562

Query  761  ALNEALVEGLLRRDDLHMEQDSMLVDVEDLTRYLGAKQES  800
             LN  L+E L  RDDL+ +QD +L D+E +  +   +Q+S
Sbjct  563  NLNVTLLESLKERDDLNSDQDDILHDLEKINNFFVFQQQS  602


 Score = 37.0 bits (84),  Expect = 0.074, Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 11/46 (24%)

Query  152  RGIVNPNYPGFQHLAPSLLSD-----------TDLTEDEHESCPDY  186
            +GI NPNYPGFQ  A +L  D           +DLT+ + E  P +
Sbjct  7    KGITNPNYPGFQKFAHTLSDDYIEYSDMECNESDLTDSDREDDPTF  52



Lambda      K        H
   0.319    0.133    0.387 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3931755120


Query= XP_003392920.1 rho-associated protein kinase 2 [Bombus terrestris]

Length=1342
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

X2JE40_DROME  unnamed protein product                                 1521    0.0  
Q9U779_DROME  unnamed protein product                                 1520    0.0  
Q9VXE3_DROME  unnamed protein product                                 1519    0.0  


>X2JE40_DROME unnamed protein product
Length=1374

 Score = 1521 bits (3937),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 793/1363 (58%), Positives = 995/1363 (73%), Gaps = 40/1363 (3%)

Query  6     DEDRRRRLRVLEERVKDPRSITNIDCLLDTVQALVADCDHPSVKRMKNIEAYMNRYDSVA  65
             D +RRRR   LE  ++DP SI N+DCLLDTV ALV+DCDH S++R+KNIE Y  +Y  +A
Sbjct  15    DVERRRRANTLEREMRDPTSICNVDCLLDTVSALVSDCDHESLRRLKNIEQYAAKYKPLA  74

Query  66    QDICKMRMRTDDFTLIKVIGRGSFGEVQLVRHKSTQKVYAMKLLSKFEMIKRSDSAFFWE  125
               I ++RM  +DF  IK+IG G+FGEVQLVRHKS+ +VYAMK LSKFEM+KR DSAFFWE
Sbjct  75    MQINQLRMNVEDFHFIKLIGAGAFGEVQLVRHKSSSQVYAMKRLSKFEMMKRPDSAFFWE  134

Query  126   ERDIMAHANSQWIVQLHFAFQDQKYLYMVMDYMPGGDLVNLMSNYDVPEKWAKFYCAEVV  185
             ER IMAHANS+WIVQLHFAFQD KYLYMVMD+MPGGD+V+LM +YD+PEKWA FY  EVV
Sbjct  135   ERHIMAHANSEWIVQLHFAFQDAKYLYMVMDFMPGGDIVSLMGDYDIPEKWAIFYTMEVV  194

Query  186   LALDAIHLMGFVHRDVKPDNMLLDKYGHLKLADFGTCMRMDVDGLVRSDTAVGTPDYISP  245
             LALD IH MGFVHRDVKPDNMLLD YGHLKLADFGTCMRM  +G V S  AVGTPDYISP
Sbjct  195   LALDTIHNMGFVHRDVKPDNMLLDSYGHLKLADFGTCMRMGANGQVVSSNAVGTPDYISP  254

Query  246   EVLQSQGGEGVYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMDHRNSLHFPQEV  305
             EVLQSQG +  YGRECDWWSVG+FLYEML G+TPFYADSLVGTY KIMDH+NSL FP EV
Sbjct  255   EVLQSQGVDNEYGRECDWWSVGIFLYEMLFGETPFYADSLVGTYGKIMDHKNSLSFPPEV  314

Query  306   DISHSAKNLICGFLTDRTKRLGRNGVEEIKNHPFFKNDQWTFENLRECVPPVVPELSGDD  365
             +IS  AK LI  FLTDRT+RLGR G+E+IK HPFF+ND W+F+N+RE VPPVVPELS DD
Sbjct  315   EISEQAKALIRAFLTDRTQRLGRYGIEDIKAHPFFRNDTWSFDNIRESVPPVVPELSSDD  374

Query  366   DTSNFEDVDKEDGPEESFPIPKAFSGNHLPFIGFTYSEDYQLMASSGKESVDGLENHINN  425
             DT NFED+++++ PEE FP+PK F GNHLPFIGFTY+ DYQL++S   ++     N  N+
Sbjct  375   DTRNFEDIERDEKPEEVFPVPKGFDGNHLPFIGFTYTGDYQLLSSDTVDAESKEANVANS  434

Query  426   GT---------------SDDIKISQLENLLDKEKRQVESLESRQKALTTRLEAMTRRETE  470
             G                S+  ++ +LE LL++E+ + E+LE +   L  ++E +T+RE E
Sbjct  435   GAASNNHGHGHNHRHRPSNSNELKRLEALLERERGRSEALEQQDAGLRQQIELITKREAE  494

Query  471   LREEIGRADKELTLLRHNYKEAQRRVEHETESRRKAESLIVELKKKYDEEQTKRARDASN  530
             L+      +K+L L +HNYK A ++VE E E R+K E+L+VE ++  + EQ  RARD + 
Sbjct  495   LQRIASEYEKDLALRQHNYKVAMQKVEQEIELRKKTEALLVETQRNLENEQKTRARDLN-  553

Query  531   SQQTSERVTSLEKQIKEMQSKLERETEMVTRLRKQATEITVARQAAEQMANELQVERAKL  590
                 +++V SLEKQ+ EM+   + ETE   +L+K   E+    ++ E+   ++      L
Sbjct  554   ---INDKVVSLEKQLLEMEQSYKTETENTQKLKKHNAELDFTVKSQEEKVRDMVDMIDTL  610

Query  591   QAQRDNLQQEVATLQGQLSKERSSRSQASSLTAELESRLSALHVELEHSREKEEKAIMDN  650
             Q  ++ L QE A LQ  + +E++ RSQ   +  E E+++  L  ++E +  +E+KA  DN
Sbjct  611   QKHKEELGQENAELQALVVQEKNLRSQLKEMHKEAENKMQTLINDIERTMCREQKAQEDN  670

Query  651   RQLTEKISALEKEAASLTLELKAAQARYNQEVVAHQETERSRILSKEEANLEVVKALQAK  710
             R L EKIS LEK  A L  ELKAAQ RY QEV AHQETE+SR++S+EEANL+ VKALQ+K
Sbjct  671   RALLEKISDLEKAHAGLDFELKAAQGRYQQEVKAHQETEKSRLVSREEANLQEVKALQSK  730

Query  711   LNEEKSGRQRAELLAQEKERQTSMLSVDYRQIQQRLQKLEGEHRQEVEKVKVLQGQVEQE  770
             LNEEKS R +A+  +QEKERQ SMLSVDYRQIQ RLQKLEGE RQE EKV  LQ Q++QE
Sbjct  731   LNEEKSARIKADQHSQEKERQLSMLSVDYRQIQLRLQKLEGECRQESEKVAALQSQLDQE  790

Query  771   QQKRNILQTDLAQQSSEAGRLRAREQQLAGEVAQLREAKRQIEDELHHLKTQRNVDQLQT  830
               KRN L ++L+  SSE   LR+RE QL  E++  REAKR+ E++L  LK+  +      
Sbjct  791   HSKRNALLSELSLHSSEVAHLRSRENQLQKELSTQREAKRRFEEDLTQLKSTHHEALANN  850

Query  831   KELQEQLEAEAYFSTLYKTQTQELREELDEKIRLQQELEEERSSLVHQLQLSLARGDSEA  890
             +ELQ QLEAE  FS LYKTQ  E REE  E++   ++LEEER SL HQ+Q+++AR DSEA
Sbjct  851   RELQAQLEAEQCFSRLYKTQANENREESAERLSKIEDLEEERVSLKHQVQVAVARADSEA  910

Query  891   LARSIAEETVADLEKERTMKELEFKDGVAKHHQELNAKEQIINRLKDSEGELKKNVDQYL  950
             LARSIAEETVADLEKE+T+KELE KD V KH  E+NAKE  +  LK++E EL K + Q  
Sbjct  911   LARSIAEETVADLEKEKTIKELELKDFVMKHRNEINAKEAALATLKEAENELHKKLGQKA  970

Query  951   KEKEDLNKRFKELQDQLSKAQSN-GEEIEKLSSKLKTEQLLKQQAVNKLAEIMNRKDLSS  1009
              E EDL ++ K+ Q++L+  +S+  EEI KL  K K E LLKQ AVNKLAE+MNR+D S 
Sbjct  971   AEYEDLVQQHKKQQEELALMRSSKDEEITKLLDKCKNEVLLKQVAVNKLAEVMNRRD-SD  1029

Query  1010  SGKSKNKA-SAADLRKKEKDCRRLQQELTQEREKYGQLTAKWQKDLQDLQAQLVEENQAK  1068
               K KNKA S A+LRKKEK+ RRLQQEL+QER+K+ QL  K     QDLQ    EE Q K
Sbjct  1030  LPKQKNKARSTAELRKKEKEMRRLQQELSQERDKFNQLLLKH----QDLQQLCAEEQQLK  1085

Query  1069  LRLQMELDSKDSEIETLQMKIASLNSETASVSSVENDGED----SVLSEHGTMRLEGWLN  1124
              ++ ME+D K +EIE LQ K+    +ETAS+SS +ND ED    S+LS       EGWL+
Sbjct  1086  QKMVMEIDCKATEIENLQSKL----NETASLSSADNDPEDSQHSSLLSLTQDSVFEGWLS  1141

Query  1125  VPNKQNIKR-HGWKKQYVVVSSKKIIFYNSENDKLN-ADPVLILDLNKVFHVRSVTQGDV  1182
             VPNKQN +R HGWK+QYV+VSS+KIIFYNS+ DK N  D VLILDL+KV+HVRSVTQGDV
Sbjct  1142  VPNKQNRRRGHGWKRQYVIVSSRKIIFYNSDIDKHNTTDAVLILDLSKVYHVRSVTQGDV  1201

Query  1183  IRADAKDIPRIFQLLYAGEGEARRPGDEGNTLPGVELPQLT-DKPGTQSLKGHEFVSISY  1241
             IRADAK+IPRIFQLLYAGEG + RP ++      V       ++PGT   KGHEFV I+Y
Sbjct  1202  IRADAKEIPRIFQLLYAGEGASHRPDEQSQLDVSVLHGNCNEERPGTIVHKGHEFVHITY  1261

Query  1242  HMPTTCEVCSKQLWHMFRPPPALECRRCRIKVHKEHLDKKEDAIAPCKLHYDPNSARELL  1301
             HMPT CEVC K LWHMF+PP A EC+RCR K+HKEH+D K D +APCKL++DP SAR++L
Sbjct  1262  HMPTACEVCPKPLWHMFKPPAAYECKRCRNKIHKEHVD-KHDPLAPCKLNHDPRSARDML  1320

Query  1302  ILAGSPDEQKYWVARLSRRVQKCGYKANSHVDGT--GQRVSPR  1342
             +LA +P++Q  WVARL +R+QK GYKA S+ + +  G ++SPR
Sbjct  1321  LLAATPEDQSLWVARLLKRIQKSGYKAASYNNNSTDGSKISPR  1363


>Q9U779_DROME unnamed protein product
Length=1390

 Score = 1520 bits (3935),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 796/1363 (58%), Positives = 996/1363 (73%), Gaps = 42/1363 (3%)

Query  6     DEDRRRRLRVLEERVKDPRSITNIDCLLDTVQALVADCDHPSVKRMKNIEAYMNRYDSVA  65
             D +RRRR   LE  ++DP SI N+DCLLDTV ALV+DCDH S++R+KNIE Y  +Y  +A
Sbjct  15    DVERRRRANTLEREMRDPTSICNVDCLLDTVSALVSDCDHESLRRLKNIEQYAAKYKPLA  74

Query  66    QDICKMRMRTDDFTLIKVIGRGSFGEVQLVRHKSTQKVYAMKLLSKFEMIKRSDSAFFWE  125
               I ++RM  +DF  IK+IG G+FGEVQLVRHKS+ +VYAMK LSKFEM+KR DSAFFWE
Sbjct  75    MQINQLRMNVEDFHFIKLIGAGAFGEVQLVRHKSSSQVYAMKRLSKFEMMKRPDSAFFWE  134

Query  126   ERDIMAHANSQWIVQLHFAFQDQKYLYMVMDYMPGGDLVNLMSNYDVPEKWAKFYCAEVV  185
             ER IMAHANS+WIVQLHFAFQD KYLYMVMD+MPGGD+V+LM +YD+PEKWA FY  EVV
Sbjct  135   ERHIMAHANSEWIVQLHFAFQDAKYLYMVMDFMPGGDIVSLMGDYDIPEKWAIFYTMEVV  194

Query  186   LALDAIHLMGFVHRDVKPDNMLLDKYGHLKLADFGTCMRMDVDGLVRSDTAVGTPDYISP  245
             LALD IH MGFVHRDVKPDNMLLD YGHLKLADFGTCMRM  +G V S  AVGTPDYISP
Sbjct  195   LALDTIHNMGFVHRDVKPDNMLLDSYGHLKLADFGTCMRMGANGQVVSSNAVGTPDYISP  254

Query  246   EVLQSQGGEGVYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMDHRNSLHFPQEV  305
             EVLQSQG +  YGRECDWWSVG+FLYEML G+TPFYADSLVGTY KIMDH+NSL FP EV
Sbjct  255   EVLQSQGVDNEYGRECDWWSVGIFLYEMLFGETPFYADSLVGTYGKIMDHKNSLSFPPEV  314

Query  306   DISHSAKNLICGFLTDRTKRLGRNGVEEIKNHPFFKNDQWTFENLRECVPPVVPELSGDD  365
             +IS  AK LI  FLTDRT+RLGR G+E+IK HPFF+ND W+F+N+RE VPPVVPELS DD
Sbjct  315   EISEQAKALIRAFLTDRTQRLGRYGIEDIKAHPFFRNDTWSFDNIRESVPPVVPELSSDD  374

Query  366   DTSNFEDVDKEDGPEESFPIPKAFSGNHLPFIGFTYSEDYQLMASSGKESVDGLENHINN  425
             DT NFED+++++ PEE FP+PK F GNHLPFIGFTY+ DYQL++S   ++     N  N+
Sbjct  375   DTRNFEDIERDEKPEEVFPVPKGFDGNHLPFIGFTYTGDYQLLSSDTVDAESKEANVANS  434

Query  426   GT---------------SDDIKISQLENLLDKEKRQVESLESRQKALTTRLEAMTRRETE  470
             G                S+  ++ +LE LL++E+ + E+LE +   L  ++E +T+RE E
Sbjct  435   GAASNNHGHGHNHRHRPSNSNELKRLEALLERERGRSEALEQQDAGLRQQIELITKREAE  494

Query  471   LREEIGRADKELTLLRHNYKEAQRRVEHETESRRKAESLIVELKKKYDEEQTKRARDASN  530
             L+      +K+L L +HNYK A ++VE E E R+K E+L+VE ++  + EQ  RARD + 
Sbjct  495   LQRIASEYEKDLALRQHNYKVAMQKVEQEIELRKKTEALLVETQRNLENEQKTRARDLN-  553

Query  531   SQQTSERVTSLEKQIKEMQSKLERETEMVTRLRKQATEITVARQAAEQMANELQVERAKL  590
                 +++V SLEKQ+ EM+   + ETE   +L+K   E+    ++ E+   ++      L
Sbjct  554   ---INDKVVSLEKQLLEMEQSYKTETENTQKLKKHNAELDFTVKSQEEKVRDMVDMIDTL  610

Query  591   QAQRDNLQQEVATLQGQLSKERSSRSQASSLTAELESRLSALHVELEHSREKEEKAIMDN  650
             Q  ++ L QE A LQ  + +E++ RSQ   +  E E+++  L  ++E +  +E+KA  DN
Sbjct  611   QKHKEELGQENAELQALVVQEKNLRSQLKEMHKEAENKMQTLINDIERTMCREQKAQEDN  670

Query  651   RQLTEKISALEKEAASLTLELKAAQARYNQEVVAHQETERSRILSKEEANLEVVKALQAK  710
             R L EKIS LEK  A L  ELKAAQ RY QEV AHQETE+SR++S+EEANL+ VKALQ+K
Sbjct  671   RALLEKISDLEKAHAGLDFELKAAQGRYQQEVKAHQETEKSRLVSREEANLQEVKALQSK  730

Query  711   LNEEKSGRQRAELLAQEKERQTSMLSVDYRQIQQRLQKLEGEHRQEVEKVKVLQGQVEQE  770
             LNEEKS R +A+  +QEKERQ SMLSVDYRQIQ RLQKLEGE RQE EKV  LQ Q++QE
Sbjct  731   LNEEKSARIKADQHSQEKERQLSMLSVDYRQIQLRLQKLEGECRQESEKVAALQSQLDQE  790

Query  771   QQKRNILQTDLAQQSSEAGRLRAREQQLAGEVAQLREAKRQIEDELHHLKTQRNVDQLQT  830
               KRN L ++L+  SSE   LR+RE QL  E++  REAKR+ E++L  LK+  +      
Sbjct  791   HSKRNALLSELSLHSSEVAHLRSRENQLQKELSTQREAKRRFEEDLTQLKSTHHEALANN  850

Query  831   KELQEQLEAEAYFSTLYKTQTQELREELDEKIRLQQELEEERSSLVHQLQLSLARGDSEA  890
             +ELQ QLEAE  FS LYKTQ  E REE  E++   ++LEEER SL HQ+Q+++AR DSEA
Sbjct  851   RELQAQLEAEQCFSRLYKTQANENREESAERLSKIEDLEEERVSLKHQVQVAVARADSEA  910

Query  891   LARSIAEETVADLEKERTMKELEFKDGVAKHHQELNAKEQIINRLKDSEGELKKNVDQYL  950
             LARSIAEETVADLEKE+T+KELE KD V KH  E+NAKE  +  LK++E EL K + Q  
Sbjct  911   LARSIAEETVADLEKEKTIKELELKDFVMKHRNEINAKEAALATLKEAENELHKKLGQKA  970

Query  951   KEKEDLNKRFKELQDQLSKAQSN-GEEIEKLSSKLKTEQLLKQQAVNKLAEIMNRKDLSS  1009
              E EDL ++ K+ Q++L+  +S+  EEI KL  K K E LLKQ AVNKLAE+MNR+D S 
Sbjct  971   AEYEDLVQQHKKQQEELALMRSSKDEEITKLLDKCKNEVLLKQVAVNKLAEVMNRRD-SD  1029

Query  1010  SGKSKNKA-SAADLRKKEKDCRRLQQELTQEREKYGQLTAKWQKDLQDLQAQLVEENQAK  1068
               K KNKA S A+LRKKEK+ RRLQQEL+QER+K+ QL  K     QDLQ    EE Q K
Sbjct  1030  LPKQKNKARSTAELRKKEKEMRRLQQELSQERDKFNQLLLKH----QDLQQLCAEEQQLK  1085

Query  1069  LRLQMELDSKDSEIETLQMKIASLNSETASVSSVENDGED----SVLSEHGTMRLEGWLN  1124
              ++ ME+D K +EIE LQ K+    +ETAS+SS +ND ED    S+LS       EGWL+
Sbjct  1086  QKMVMEIDCKATEIENLQSKL----NETASLSSADNDPEDSQHSSLLSLTQDSVFEGWLS  1141

Query  1125  VPNKQNIKR-HGWKKQYVVVSSKKIIFYNSENDKLN-ADPVLILDLNKVFHVRSVTQGDV  1182
             VPNKQN +R HGWK+QYV+VSS+KIIFYNS+ DK N  D VLILDL+KV+HVRSVTQGDV
Sbjct  1142  VPNKQNRRRGHGWKRQYVIVSSRKIIFYNSDIDKHNTTDAVLILDLSKVYHVRSVTQGDV  1201

Query  1183  IRADAKDIPRIFQLLYAGEGEARRPGDEGNTLPGVELPQLTD--KPGTQSLKGHEFVSIS  1240
             IRADAK+IPRIFQLLYAGEG + RP DE N L    L    +  +PGT   KGHEFV I+
Sbjct  1202  IRADAKEIPRIFQLLYAGEGASHRP-DEQNQLDVSVLHGNCNEERPGTIVHKGHEFVHIT  1260

Query  1241  YHMPTTCEVCSKQLWHMFRPPPALECRRCRIKVHKEHLDKKEDAIAPCKLHYDPNSAREL  1300
             YHMPT CEVC K LWHMF+PP A EC+RCR K+HKEH+D K D +APCKL++DP SAR++
Sbjct  1261  YHMPTACEVCPKPLWHMFKPPAAYECKRCRNKIHKEHVD-KHDPLAPCKLNHDPRSARDM  1319

Query  1301  LILAGSPDEQKYWVARLSRRVQKCGYKANSHVDGT--GQRVSP  1341
             L+LA +P++Q  WVARL +R+QK GYKA S+ + +  G ++SP
Sbjct  1320  LLLAATPEDQSLWVARLLKRIQKSGYKAASYNNNSTDGSKISP  1362


>Q9VXE3_DROME unnamed protein product
Length=1390

 Score = 1519 bits (3933),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 792/1362 (58%), Positives = 994/1362 (73%), Gaps = 40/1362 (3%)

Query  6     DEDRRRRLRVLEERVKDPRSITNIDCLLDTVQALVADCDHPSVKRMKNIEAYMNRYDSVA  65
             D +RRRR   LE  ++DP SI N+DCLLDTV ALV+DCDH S++R+KNIE Y  +Y  +A
Sbjct  15    DVERRRRANTLEREMRDPTSICNVDCLLDTVSALVSDCDHESLRRLKNIEQYAAKYKPLA  74

Query  66    QDICKMRMRTDDFTLIKVIGRGSFGEVQLVRHKSTQKVYAMKLLSKFEMIKRSDSAFFWE  125
               I ++RM  +DF  IK+IG G+FGEVQLVRHKS+ +VYAMK LSKFEM+KR DSAFFWE
Sbjct  75    MQINQLRMNVEDFHFIKLIGAGAFGEVQLVRHKSSSQVYAMKRLSKFEMMKRPDSAFFWE  134

Query  126   ERDIMAHANSQWIVQLHFAFQDQKYLYMVMDYMPGGDLVNLMSNYDVPEKWAKFYCAEVV  185
             ER IMAHANS+WIVQLHFAFQD KYLYMVMD+MPGGD+V+LM +YD+PEKWA FY  EVV
Sbjct  135   ERHIMAHANSEWIVQLHFAFQDAKYLYMVMDFMPGGDIVSLMGDYDIPEKWAIFYTMEVV  194

Query  186   LALDAIHLMGFVHRDVKPDNMLLDKYGHLKLADFGTCMRMDVDGLVRSDTAVGTPDYISP  245
             LALD IH MGFVHRDVKPDNMLLD YGHLKLADFGTCMRM  +G V S  AVGTPDYISP
Sbjct  195   LALDTIHNMGFVHRDVKPDNMLLDSYGHLKLADFGTCMRMGANGQVVSSNAVGTPDYISP  254

Query  246   EVLQSQGGEGVYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMDHRNSLHFPQEV  305
             EVLQSQG +  YGRECDWWSVG+FLYEML G+TPFYADSLVGTY KIMDH+NSL FP EV
Sbjct  255   EVLQSQGVDNEYGRECDWWSVGIFLYEMLFGETPFYADSLVGTYGKIMDHKNSLSFPPEV  314

Query  306   DISHSAKNLICGFLTDRTKRLGRNGVEEIKNHPFFKNDQWTFENLRECVPPVVPELSGDD  365
             +IS  AK LI  FLTDRT+RLGR G+E+IK HPFF+ND W+F+N+RE VPPVVPELS DD
Sbjct  315   EISEQAKALIRAFLTDRTQRLGRYGIEDIKAHPFFRNDTWSFDNIRESVPPVVPELSSDD  374

Query  366   DTSNFEDVDKEDGPEESFPIPKAFSGNHLPFIGFTYSEDYQLMASSGKESVDGLENHINN  425
             DT NFED+++++ PEE FP+PK F GNHLPFIGFTY+ DYQL++S   ++     N  N+
Sbjct  375   DTRNFEDIERDEKPEEVFPVPKGFDGNHLPFIGFTYTGDYQLLSSDTVDAESKEANVANS  434

Query  426   GT---------------SDDIKISQLENLLDKEKRQVESLESRQKALTTRLEAMTRRETE  470
             G                S+  ++ +LE LL++E+ + E+LE +   L  ++E +T+RE E
Sbjct  435   GAASNNHGHGHNHRHRPSNSNELKRLEALLERERGRSEALEQQDAGLRQQIELITKREAE  494

Query  471   LREEIGRADKELTLLRHNYKEAQRRVEHETESRRKAESLIVELKKKYDEEQTKRARDASN  530
             L+      +K+L L +HNYK A ++VE E E R+K E+L+VE ++  + EQ  RARD + 
Sbjct  495   LQRIASEYEKDLALRQHNYKVAMQKVEQEIELRKKTEALLVETQRNLENEQKTRARDLN-  553

Query  531   SQQTSERVTSLEKQIKEMQSKLERETEMVTRLRKQATEITVARQAAEQMANELQVERAKL  590
                 +++V SLEKQ+ EM+   + ETE   +L+K   E+    ++ E+   ++      L
Sbjct  554   ---INDKVVSLEKQLLEMEQSYKTETENTQKLKKHNAELDFTVKSQEEKVRDMVDMIDTL  610

Query  591   QAQRDNLQQEVATLQGQLSKERSSRSQASSLTAELESRLSALHVELEHSREKEEKAIMDN  650
             Q  ++ L QE A LQ  + +E++ RSQ   +  E E+++  L  ++E +  +E+KA  DN
Sbjct  611   QKHKEELGQENAELQALVVQEKNLRSQLKEMHKEAENKMQTLINDIERTMCREQKAQEDN  670

Query  651   RQLTEKISALEKEAASLTLELKAAQARYNQEVVAHQETERSRILSKEEANLEVVKALQAK  710
             R L EKIS LEK  A L  ELKAAQ RY QEV AHQETE+SR++S+EEANL+ VKALQ+K
Sbjct  671   RALLEKISDLEKAHAGLDFELKAAQGRYQQEVKAHQETEKSRLVSREEANLQEVKALQSK  730

Query  711   LNEEKSGRQRAELLAQEKERQTSMLSVDYRQIQQRLQKLEGEHRQEVEKVKVLQGQVEQE  770
             LNEEKS R +A+  +QEKERQ SMLSVDYRQIQ RLQKLEGE RQE EKV  LQ Q++QE
Sbjct  731   LNEEKSARIKADQHSQEKERQLSMLSVDYRQIQLRLQKLEGECRQESEKVAALQSQLDQE  790

Query  771   QQKRNILQTDLAQQSSEAGRLRAREQQLAGEVAQLREAKRQIEDELHHLKTQRNVDQLQT  830
               KRN L ++L+  SSE   LR+RE QL  E++  REAKR+ E++L  LK+  +      
Sbjct  791   HSKRNALLSELSLHSSEVAHLRSRENQLQKELSTQREAKRRFEEDLTQLKSTHHEALANN  850

Query  831   KELQEQLEAEAYFSTLYKTQTQELREELDEKIRLQQELEEERSSLVHQLQLSLARGDSEA  890
             +ELQ QLEAE  FS LYKTQ  E REE  E++   ++LEEER SL HQ+Q+++AR DSEA
Sbjct  851   RELQAQLEAEQCFSRLYKTQANENREESAERLSKIEDLEEERVSLKHQVQVAVARADSEA  910

Query  891   LARSIAEETVADLEKERTMKELEFKDGVAKHHQELNAKEQIINRLKDSEGELKKNVDQYL  950
             LARSIAEETVADLEKE+T+KELE KD V KH  E+NAKE  +  LK++E EL K + Q  
Sbjct  911   LARSIAEETVADLEKEKTIKELELKDFVMKHRNEINAKEAALATLKEAENELHKKLGQKA  970

Query  951   KEKEDLNKRFKELQDQLSKAQSN-GEEIEKLSSKLKTEQLLKQQAVNKLAEIMNRKDLSS  1009
              E EDL ++ K+ Q++L+  +S+  EEI KL  K K E LLKQ AVNKLAE+MNR+D S 
Sbjct  971   AEYEDLVQQHKKQQEELALMRSSKDEEITKLLDKCKNEVLLKQVAVNKLAEVMNRRD-SD  1029

Query  1010  SGKSKNKA-SAADLRKKEKDCRRLQQELTQEREKYGQLTAKWQKDLQDLQAQLVEENQAK  1068
               K KNKA S A+LRKKEK+ RRLQQEL+QER+K+ QL  K     QDLQ    EE Q K
Sbjct  1030  LPKQKNKARSTAELRKKEKEMRRLQQELSQERDKFNQLLLKH----QDLQQLCAEEQQLK  1085

Query  1069  LRLQMELDSKDSEIETLQMKIASLNSETASVSSVENDGED----SVLSEHGTMRLEGWLN  1124
              ++ ME+D K +EIE LQ K+    +ETAS+SS +ND ED    S+LS       EGWL+
Sbjct  1086  QKMVMEIDCKATEIENLQSKL----NETASLSSADNDPEDSQHSSLLSLTQDSVFEGWLS  1141

Query  1125  VPNKQNIKR-HGWKKQYVVVSSKKIIFYNSENDKLN-ADPVLILDLNKVFHVRSVTQGDV  1182
             VPNKQN +R HGWK+QYV+VSS+KIIFYNS+ DK N  D VLILDL+KV+HVRSVTQGDV
Sbjct  1142  VPNKQNRRRGHGWKRQYVIVSSRKIIFYNSDIDKHNTTDAVLILDLSKVYHVRSVTQGDV  1201

Query  1183  IRADAKDIPRIFQLLYAGEGEARRPGDEGNTLPGVELPQLT-DKPGTQSLKGHEFVSISY  1241
             IRADAK+IPRIFQLLYAGEG + RP ++      V       ++PGT   KGHEFV I+Y
Sbjct  1202  IRADAKEIPRIFQLLYAGEGASHRPDEQSQLDVSVLHGNCNEERPGTIVHKGHEFVHITY  1261

Query  1242  HMPTTCEVCSKQLWHMFRPPPALECRRCRIKVHKEHLDKKEDAIAPCKLHYDPNSARELL  1301
             HMPT CEVC K LWHMF+PP A EC+RCR K+HKEH+D K D +APCKL++DP SAR++L
Sbjct  1262  HMPTACEVCPKPLWHMFKPPAAYECKRCRNKIHKEHVD-KHDPLAPCKLNHDPRSARDML  1320

Query  1302  ILAGSPDEQKYWVARLSRRVQKCGYKANSHVDGT--GQRVSP  1341
             +LA +P++Q  WVARL +R+QK GYKA S+ + +  G ++SP
Sbjct  1321  LLAATPEDQSLWVARLLKRIQKSGYKAASYNNNSTDGSKISP  1362



Lambda      K        H
   0.319    0.133    0.387 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3931755120


Query= XP_003392925.1 WD repeat-containing protein 7 isoform X10 [Bombus
terrestris]

Length=1505
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9W543_DROME  unnamed protein product                                 1899    0.0  
Q2XXU2_DROME  unnamed protein product                                 1866    0.0  
O46092_DROME  unnamed protein product                                 1805    0.0  


>Q9W543_DROME unnamed protein product
Length=1525

 Score = 1899 bits (4918),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 954/1557 (61%), Positives = 1160/1557 (75%), Gaps = 89/1557 (6%)

Query  4     GTSLVVPIVLWGRIAPTHCVSCIYLSRDQKTLVTGCYDGQICLWQVDPETLKMSPRCLLV  63
              T+LVVP+VLWG  APTHC+S ++LS DQ TLVTGCYDGQICLWQV+P TLKMSPRCLLV
Sbjct  3     STNLVVPVVLWGPTAPTHCISSVFLSDDQFTLVTGCYDGQICLWQVEPTTLKMSPRCLLV  62

Query  64    GHTAPIMCLSRASVIMEQNYIVSSSESGEMCTWDLVDGKCREAVKLTSVHTQMLPYVSAG  123
             GH+AP++CL RAS++ E N++VSSSE+GEMCTWDL DGKC EAVKL  VHTQ+  Y +A 
Sbjct  63    GHSAPVLCLVRASLLPENNFLVSSSENGEMCTWDLTDGKCMEAVKLPQVHTQIQSYHTAN  122

Query  124   GEDVRLFCSGYYPEVLVMDPFSLEVLFTLSSRVNPDWISALHVLRPAKRKGRFYVHTNDV  183
              EDVRLFC GYY E++VMDPFSLEV++ LSS+V PDWISA+HVLRP +RK       +DV
Sbjct  123   SEDVRLFCIGYYAEIMVMDPFSLEVIYVLSSKVKPDWISAIHVLRPMRRK-------DDV  175

Query  184   VLALTTTGTVKVWTLLGHENRNSEPLYEHESKQIRCLNALAMTCCPYNQRTVLIVCSKHW  243
             VLA+TTTGTVKVWTL G+EN+++EP+YE+ESK+IRCLNA+ M CC  NQRTVL+VC+K+W
Sbjct  176   VLAITTTGTVKVWTLTGNENKHAEPIYENESKEIRCLNAITMNCCAQNQRTVLLVCTKYW  235

Query  244   QIYDAGDFSLLCSITAPCGERWMAGDFLSADRVILWSDEGCGYLYKLPANSVADNKNFHT  303
             QIYDAGDF++LCS+ AP  ERW  GDF+++DRV+LW+DEG GYLYKLPAN + DNK FH+
Sbjct  236   QIYDAGDFTVLCSVIAPARERWQGGDFITSDRVMLWTDEGKGYLYKLPANCIPDNKEFHS  295

Query  304   AGVEYDQPYLYCTLTQPGVKPLSCPPAMRLVTVQKQSKTLKYLLRGDSGGVV-LWTVPEV  362
               V  D PYLY  L   G K LSCPPAM+L+   + +     LLRGDS G + +W VPEV
Sbjct  296   KSVVRDAPYLYYVLQHAGDKVLSCPPAMKLL---QGAGGQHNLLRGDSEGYISVWNVPEV  352

Query  363   TTQQLAQICQNDRSTPLSLPPAVKTSITTAWEEMKPSPVGILDQLDSGDGHGIKLTASIY  422
                 ++ I Q  +  P  L P V TS+  AW  M P PVGILDQL       +KLT+SIY
Sbjct  353   PLDNIS-ILQAKQMPPRPLKPHVCTSLVEAWSIMDPPPVGILDQLSRITESPVKLTSSIY  411

Query  423   LPQQSRLVVGREDGSIIIVPATQTVMLQLLHGNHQQYDDWPPHQVLLGHSGRVNCLLYPH  482
             LPQQSRLV+GREDGSI+IVPATQTVM+QLL G  Q + DWP HQ+L GH GRVNCLL P 
Sbjct  412   LPQQSRLVIGREDGSIVIVPATQTVMMQLLVGIKQNFSDWPSHQILYGHRGRVNCLLCPS  471

Query  483   GAAPRYDRTHLVSGSVDFAVCLWDLYAGTLIHRFCVHAGEITQLMVPPDNCSPRIQKCVC  542
                 RY+++HL+SG +DFAVCLWDLY+G+L+HRFCVHAGEITQL+VPP++CSPRI KC+C
Sbjct  472   MIHSRYEKSHLLSGGIDFAVCLWDLYSGSLLHRFCVHAGEITQLLVPPESCSPRILKCIC  531

Query  543   SVASDHSVTLLSLAERKCVVLASRHLFPVVTIKWRPLDDFMIVGCSDGAVYVWQMETGHL  602
             SVASDHSVTL+SL ERKCV LASRHLFPVVTIKWRPLDDF+IVGCSDG+VYVWQMETGHL
Sbjct  532   SVASDHSVTLVSLQERKCVTLASRHLFPVVTIKWRPLDDFLIVGCSDGSVYVWQMETGHL  591

Query  603   DRVLHGIIAEEVLYACDENT------IAASGGSATGGELGLANPAVHFFRGLRHRNLSAI  656
             DRVLHG++AEEVL ACDE               A+  E+G+ANPAVHFFRGL+ RN++AI
Sbjct  592   DRVLHGMLAEEVLSACDEQAEDGGSGGGGGSNGASASEMGMANPAVHFFRGLKSRNMNAI  651

Query  657   RHATQRGLHQLQQLHGGQGVDHGNQIKTKGTPLMIQGFRSNPKDPESHILFFDIEALIVQ  716
             RHATQRG+ QLQQL G    +    +K +  PL+IQG R+NPKD ESHILFFDIE LI +
Sbjct  652   RHATQRGITQLQQLQGHNQGNFDFLMKHRSNPLVIQGLRTNPKDAESHILFFDIEGLIFE  711

Query  717   LLNDEYGAMSPGSLEAQGLISASEYQKVAALTQSASPDAHKKIADFFGRVKDKAGDVERI  776
             L ++EY  M+P +LE+ G+     + +     +S   DA KKI DFF +VK+KA DVE+I
Sbjct  712   LHSEEYAQMTPATLESLGV-----HLQNPKDGKSMHLDASKKIGDFFNKVKNKAVDVEKI  766

Query  777   LKEKDRHGILAKMKEGAENVHTKIQAKVESV--GLKPSTLDGKGDNWNNNEIAKNNLKRN  834
             LK+KD+HG++ K KE  E V  K+QAKVES+   ++P            +E  ++   + 
Sbjct  767   LKDKDKHGLVQKFKEKTEIVEKKVQAKVESLQKAVEP------------HEEQQDLKSKI  814

Query  835   GAFSEPNATMEVAQLILSLLHAWGIDPDLDRVCEGKLGLLRPMVPVSFGVLSKGGYMSLL  894
              +  E    MEVAQL+LSLLH+WG+DP LD++CE +LGLLRP+VP+S+GVLSK GYMSLL
Sbjct  815   ASKMEVTHVMEVAQLLLSLLHSWGLDPHLDKMCETRLGLLRPIVPISYGVLSKAGYMSLL  874

Query  895   LPTWQ--MQLEP-IGEPTTQLEQRLPAELVRQERLTRAFTARAHWELSTTLTSNHLLAVV  951
             LPTWQ    + P I  P++  ++ LP EL R E LT  FT+R HWELSTTLT+NH+LA+V
Sbjct  875   LPTWQNNYAIPPGIQLPSSSKKRPLPEELQRLEHLTAVFTSRLHWELSTTLTTNHILALV  934

Query  952   ALANTLMSMNNATFVPEQERNRKMHRPGNRSTVNWNKAEEENEEIYTAQQAQIKQGWSLL  1011
             A++NTL+SM+ A+F+P+ E+++K+ R   R+    +  EEE EE+     +QIK  WSLL
Sbjct  935   AMSNTLLSMSAASFLPDSEKHKKLQRLAQRTDSTLSN-EEEREELMAHHISQIKHAWSLL  993

Query  1012  ATLHCVLLPDKIVSQGGVKTFKRPQVEMMARRWQHQCLEIREAAQALLLAELGRMGPKGR  1071
             AT HC LLPDKI +    K FKRPQVEMM +RWQH C+EIREAAQ +LL EL RMG KGR
Sbjct  994   ATHHCFLLPDKIEALEP-KKFKRPQVEMMVKRWQHHCIEIREAAQQILLGELTRMGKKGR  1052

Query  1072  KTLVDSWSQYLPMYSTQEPIAPQSQN---------------------------QSPPAPG  1104
             K LV+SW+QYLP+Y+  EPI    Q                                A  
Sbjct  1053  KQLVESWAQYLPLYTHTEPIVGAQQQLALISQPASGGAGSGSGGNGGVGVGVSGGGGAGS  1112

Query  1105  SPIPSSESHTEEEDEEEELAEAEINVARKPSSVAELKRKQTTAVVLLGVIGAEFGQDVTT  1164
                P       +  ++E+  E E  + RKPSS++ELKRKQTTAV+LLGVIGAEFGQD++ 
Sbjct  1113  GSGPGGSVPGGDAHQDEDYEEEEEEIIRKPSSLSELKRKQTTAVILLGVIGAEFGQDISQ  1172

Query  1165  TNQKRDNE----------------QRRKSSIVEGFGIGNNNLARHTSMALTHLLHAPHSP  1208
              +                      +RRKSS+VEGFGI NN LAR TSMAL HLL+AP SP
Sbjct  1173  ESPNHRGSISMATGANLTSGVAGGERRKSSVVEGFGIANN-LARLTSMALAHLLYAPPSP  1231

Query  1209  KLPLHTALRRAAIDLIGRGFTVWEPYLDVSKVLLGLLEMCCDADKLVPNMTYGLPLTPQA  1268
             KLP +T LRRAAIDL+GRGFTVWEPYLDVSKVLLGLLE+ C+  K VPN+ Y LPLTPQA
Sbjct  1232  KLPQYTPLRRAAIDLLGRGFTVWEPYLDVSKVLLGLLEISCEG-KAVPNLNYKLPLTPQA  1290

Query  1269  DTCRTARHALTLIATARPAAFITTMAREVARYNTLQQNAQTLNVNMGASVLVRAKPEILR  1328
             D CRTARHAL LIATARPAAFITTMAREVARYNT+QQNAQ++N  +  SVL +AK EIL+
Sbjct  1291  DACRTARHALRLIATARPAAFITTMAREVARYNTMQQNAQSINTPLTQSVLHKAKGEILQ  1350

Query  1329  IVEQLIDKMQSEMSDLLVEVMDIILHCLDPGHLKTKPLNDVFPAVCRFNQVSHCPATRRI  1388
              VE LIDKMQSE++ LLVEVMDI LHC+D   LK + L ++ PA+C+FNQ+SHC  TRRI
Sbjct  1351  CVEMLIDKMQSEIAGLLVEVMDIALHCVDGNELKNRGLAELCPAICKFNQISHCAQTRRI  1410

Query  1389  AVGSRNGQLALYELRGNVKCQTVPAHVASVTALAFSPEGKFLVSYSCTENKLCFWQQTSS  1448
             AVG+ +G LA+YELR N KCQ +PAH   +T+LAFSP+GK+LVSYSC EN+L FW QTS+
Sbjct  1411  AVGANSGNLAIYELRQN-KCQMIPAHTHPITSLAFSPDGKYLVSYSCAENRLSFW-QTST  1468

Query  1449  GMFGLGNSQTRCVKSYSTAPINDVARLNPMRLARLIWINNRTVTLMLADGSETRFNV  1505
             GMFGLG SQTRC K YSTAPI DV+RLNPMRLA+L+WINNRTVTLMLADGSETRFNV
Sbjct  1469  GMFGLGQSQTRCTKGYSTAPIPDVSRLNPMRLAKLVWINNRTVTLMLADGSETRFNV  1525


>Q2XXU2_DROME unnamed protein product
Length=1505

 Score = 1866 bits (4834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 938/1539 (61%), Positives = 1143/1539 (74%), Gaps = 89/1539 (6%)

Query  11    IVLWGRIAPTHCVSCIYLSRDQKTLVTGCYDGQICLWQVDPETLKMSPRCLLVGHTAPIM  70
             +VLWG  APTHC+S ++LS DQ TLVTGCYDGQICLWQV+P TLKMSPRCLLVGH+AP++
Sbjct  1     VVLWGPTAPTHCISSVFLSDDQFTLVTGCYDGQICLWQVEPTTLKMSPRCLLVGHSAPVL  60

Query  71    CLSRASVIMEQNYIVSSSESGEMCTWDLVDGKCREAVKLTSVHTQMLPYVSAGGEDVRLF  130
             CL RAS++ E N++VSSSE+GEMCTWDL DGKC EAVKL  VHTQ+  Y +A  EDVRLF
Sbjct  61    CLVRASLLPENNFLVSSSENGEMCTWDLTDGKCMEAVKLPQVHTQIQSYHTANSEDVRLF  120

Query  131   CSGYYPEVLVMDPFSLEVLFTLSSRVNPDWISALHVLRPAKRKGRFYVHTNDVVLALTTT  190
             C GYY E++VMDPFSLEV++ LSS+V PDWISA+HVLRP +RK       +DVVLA+TTT
Sbjct  121   CIGYYAEIMVMDPFSLEVIYVLSSKVKPDWISAIHVLRPMRRK-------DDVVLAITTT  173

Query  191   GTVKVWTLLGHENRNSEPLYEHESKQIRCLNALAMTCCPYNQRTVLIVCSKHWQIYDAGD  250
             GTVKVWTL G+EN+++EP+YE+ESK+IRCLNA+ M CC  NQRTVL+VC+K+WQIYDAGD
Sbjct  174   GTVKVWTLTGNENKHAEPIYENESKEIRCLNAITMNCCAQNQRTVLLVCTKYWQIYDAGD  233

Query  251   FSLLCSITAPCGERWMAGDFLSADRVILWSDEGCGYLYKLPANSVADNKNFHTAGVEYDQ  310
             F++LCS+ AP  ERW  GDF+++DRV+LW+DEG GYLYKLPAN + DNK FH+  V  D 
Sbjct  234   FTVLCSVIAPARERWQGGDFITSDRVMLWTDEGKGYLYKLPANCIPDNKEFHSKSVVRDA  293

Query  311   PYLYCTLTQPGVKPLSCPPAMRLVTVQKQSKTLKYLLRGDSGGVV-LWTVPEVTTQQLAQ  369
             PYLY  L   G K LSCPPAM+L+   + +     LLRGDS G + +W VPEV    ++ 
Sbjct  294   PYLYYVLQHAGDKVLSCPPAMKLL---QGAGGQHNLLRGDSEGYISVWNVPEVPLDNIS-  349

Query  370   ICQNDRSTPLSLPPAVKTSITTAWEEMKPSPVGILDQLDSGDGHGIKLTASIYLPQQSRL  429
             I Q  +  P  L P V TS+  AW  M P PVGILDQL       +KLT+SIYLPQQSRL
Sbjct  350   ILQAKQMPPRPLKPHVCTSLVEAWSIMDPPPVGILDQLSRITESPVKLTSSIYLPQQSRL  409

Query  430   VVGREDGSIIIVPATQTVMLQLLHGNHQQYDDWPPHQVLLGHSGRVNCLLYPHGAAPRYD  489
             V+GREDGSI+IVPATQTVM+QLL G  Q + DWP HQ+L GH GRVNCLL P     RY+
Sbjct  410   VIGREDGSIVIVPATQTVMMQLLVGIKQNFSDWPSHQILYGHRGRVNCLLCPSMIHSRYE  469

Query  490   RTHLVSGSVDFAVCLWDLYAGTLIHRFCVHAGEITQLMVPPDNCSPRIQKCVCSVASDHS  549
             ++HL+SG +DFAVCLWDLY+G+L+HRFCVHAGEITQL+VPP++CSPRI KC+CSVASDHS
Sbjct  470   KSHLLSGGIDFAVCLWDLYSGSLLHRFCVHAGEITQLLVPPESCSPRILKCICSVASDHS  529

Query  550   VTLLSLAERKCVVLASRHLFPVVTIKWRPLDDFMIVGCSDGAVYVWQMETGHLDRVLHGI  609
             VTL+SL ERKCV LASRHLFPVVTIKWRPLDDF+IVGCSDG+VYVWQMETGHLDRVLHG+
Sbjct  530   VTLVSLQERKCVTLASRHLFPVVTIKWRPLDDFLIVGCSDGSVYVWQMETGHLDRVLHGM  589

Query  610   IAEEVLYACDENT------IAASGGSATGGELGLANPAVHFFRGLRHRNLSAIRHATQRG  663
             +AEEVL ACDE               A+  E+G+ANPAVHFFRGL+ RN++AIRHATQRG
Sbjct  590   LAEEVLSACDEQAEDGGSGGGGGSNGASASEMGMANPAVHFFRGLKSRNMNAIRHATQRG  649

Query  664   LHQLQQLHGGQGVDHGNQIKTKGTPLMIQGFRSNPKDPESHILFFDIEALIVQLLNDEYG  723
             + QLQQL G    +    +K +  PL+IQG R+NPKD ESHILFFDIE LI +L ++EY 
Sbjct  650   ITQLQQLQGHNQGNFDFLMKHRSNPLVIQGLRTNPKDAESHILFFDIEGLIFELHSEEYA  709

Query  724   AMSPGSLEAQGLISASEYQKVAALTQSASPDAHKKIADFFGRVKDKAGDVERILKEKDRH  783
              M+P +LE+ G+     + +     +S   DA KKI DFF +VK+KA DVE+ILK+KD+H
Sbjct  710   QMTPATLESLGV-----HLQNPKDGKSMHLDASKKIGDFFNKVKNKAVDVEKILKDKDKH  764

Query  784   GILAKMKEGAENVHTKIQAKVESV--GLKPSTLDGKGDNWNNNEIAKNNLKRNGAFSEPN  841
             G++ K KE  E V  K+QAKVES+   ++P            +E  ++   +  +  E  
Sbjct  765   GLVQKFKEKTEIVEKKVQAKVESLQKAVEP------------HEEQQDLKSKIASKMEVT  812

Query  842   ATMEVAQLILSLLHAWGIDPDLDRVCEGKLGLLRPMVPVSFGVLSKGGYMSLLLPTWQ--  899
               MEVAQL+LSLLH+WG+DP LD++CE +LGLLRP+VP+S+GVLSK GYMSLLLPTWQ  
Sbjct  813   HVMEVAQLLLSLLHSWGLDPHLDKMCETRLGLLRPIVPISYGVLSKAGYMSLLLPTWQNN  872

Query  900   MQLEP-IGEPTTQLEQRLPAELVRQERLTRAFTARAHWELSTTLTSNHLLAVVALANTLM  958
               + P I  P++  ++ LP EL R E LT  FT+R HWELSTTLT+NH+LA+VA++NTL+
Sbjct  873   YAIPPGIQLPSSSKKRPLPEELQRLEHLTAVFTSRLHWELSTTLTTNHILALVAMSNTLL  932

Query  959   SMNNATFVPEQERNRKMHRPGNRSTVNWNKAEEENEEIYTAQQAQIKQGWSLLATLHCVL  1018
             SM+ A+F+P+ E+++K+ R   R+    +  EEE EE+     +QIK  WSLLAT HC L
Sbjct  933   SMSAASFLPDSEKHKKLQRLAQRTDSTLSN-EEEREELMAHHISQIKHAWSLLATHHCFL  991

Query  1019  LPDKIVSQGGVKTFKRPQVEMMARRWQHQCLEIREAAQALLLAELGRMGPKGRKTLVDSW  1078
             LPDKI +    K FKRPQVEMM +RWQH C+EIREAAQ +LL EL RMG KGRK LV+SW
Sbjct  992   LPDKIEALEP-KKFKRPQVEMMVKRWQHHCIEIREAAQQILLGELTRMGKKGRKQLVESW  1050

Query  1079  SQYLPMYSTQEPIAPQSQN---------------------------QSPPAPGSPIPSSE  1111
             +QYLP+Y+  EPI    Q                                A     P   
Sbjct  1051  AQYLPLYTHTEPIVGAQQQLALISQPASGGAGSGSGGNGGVGVGVSGGGGAGSGSGPGGS  1110

Query  1112  SHTEEEDEEEELAEAEINVARKPSSVAELKRKQTTAVVLLGVIGAEFGQDVTTTNQKRDN  1171
                 +  ++E+  E E  + RKPSS++ELKRKQTTAV+LLGVIGAEFGQD++  +     
Sbjct  1111  VPGGDAHQDEDYEEEEEEIIRKPSSLSELKRKQTTAVILLGVIGAEFGQDISQESPNHRG  1170

Query  1172  E----------------QRRKSSIVEGFGIGNNNLARHTSMALTHLLHAPHSPKLPLHTA  1215
                              +RRKSS+VEGFGI NN LAR TSMAL HLL+AP SPKLP +T 
Sbjct  1171  SISMATGANLTSGVAGGERRKSSVVEGFGIANN-LARLTSMALAHLLYAPPSPKLPQYTP  1229

Query  1216  LRRAAIDLIGRGFTVWEPYLDVSKVLLGLLEMCCDADKLVPNMTYGLPLTPQADTCRTAR  1275
             LRRAAIDL+GRGFTVWEPYLDVSKVLLGLLE+ C+  K VPN+ Y LPLTPQAD CRTAR
Sbjct  1230  LRRAAIDLLGRGFTVWEPYLDVSKVLLGLLEISCEG-KAVPNLNYKLPLTPQADACRTAR  1288

Query  1276  HALTLIATARPAAFITTMAREVARYNTLQQNAQTLNVNMGASVLVRAKPEILRIVEQLID  1335
             HAL LIATARPAAFITTMAREVARYNT+QQNAQ++N  +  SVL +AK EIL+ VE LID
Sbjct  1289  HALRLIATARPAAFITTMAREVARYNTMQQNAQSINTPLTQSVLHKAKGEILQCVEMLID  1348

Query  1336  KMQSEMSDLLVEVMDIILHCLDPGHLKTKPLNDVFPAVCRFNQVSHCPATRRIAVGSRNG  1395
             KMQSE++ LLVEVMDI LHC+D   LK + L ++ PA+C+FNQ+SHC  TRRIAVG+ +G
Sbjct  1349  KMQSEIAGLLVEVMDIALHCVDGNELKNRGLAELCPAICKFNQISHCAQTRRIAVGANSG  1408

Query  1396  QLALYELRGNVKCQTVPAHVASVTALAFSPEGKFLVSYSCTENKLCFWQQTSSGMFGLGN  1455
              LA+YELR N KCQ +PAH   +T+LAFSP+GK+LVSYSC EN+L FW QTS+GMFGLG 
Sbjct  1409  NLAIYELRQN-KCQMIPAHTHPITSLAFSPDGKYLVSYSCAENRLSFW-QTSTGMFGLGQ  1466

Query  1456  SQTRCVKSYSTAPINDVARLNPMRLARLIWINNRTVTLM  1494
             SQTRC K YSTAPI DV+RLNPMRLA+L+WINNRTVTLM
Sbjct  1467  SQTRCTKGYSTAPIPDVSRLNPMRLAKLVWINNRTVTLM  1505


>O46092_DROME unnamed protein product
Length=1471

 Score = 1805 bits (4675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 914/1505 (61%), Positives = 1117/1505 (74%), Gaps = 89/1505 (6%)

Query  56    MSPRCLLVGHTAPIMCLSRASVIMEQNYIVSSSESGEMCTWDLVDGKCREAVKLTSVHTQ  115
             MSPRCLLVGH+AP++CL RAS++ E N++VSSSE+GEMCTWDL DGKC EAVKL  VHTQ
Sbjct  1     MSPRCLLVGHSAPVLCLVRASLLPENNFLVSSSENGEMCTWDLTDGKCMEAVKLPQVHTQ  60

Query  116   MLPYVSAGGEDVRLFCSGYYPEVLVMDPFSLEVLFTLSSRVNPDWISALHVLRPAKRKGR  175
             +  Y +A  EDVRLFC GYY E++VMDPFSLEV++ LSS+V PDWISA+HVLRP +RK  
Sbjct  61    IQSYHTANSEDVRLFCIGYYAEIMVMDPFSLEVIYVLSSKVKPDWISAIHVLRPMRRK--  118

Query  176   FYVHTNDVVLALTTTGTVKVWTLLGHENRNSEPLYEHESKQIRCLNALAMTCCPYNQRTV  235
                  +DVVLA+TTTGTVKVWTL G+EN+++EP+YE+ESK+IRCLNA+ M CC  NQRTV
Sbjct  119   -----DDVVLAITTTGTVKVWTLTGNENKHAEPIYENESKEIRCLNAITMNCCAQNQRTV  173

Query  236   LIVCSKHWQIYDAGDFSLLCSITAPCGERWMAGDFLSADRVILWSDEGCGYLYKLPANSV  295
             L+VC+K+WQIYDAGDF++LCS+ AP  ERW  GDF+++DRV+LW+DEG GYLYKLPAN +
Sbjct  174   LLVCTKYWQIYDAGDFTVLCSVIAPARERWQGGDFITSDRVMLWTDEGKGYLYKLPANCI  233

Query  296   ADNKNFHTAGVEYDQPYLYCTLTQPGVKPLSCPPAMRLVTVQKQSKTLKYLLRGDSGGVV  355
              DNK FH+  V  D PYLY  L   G K LSCPPAM+L+   + +     LLRGDS G +
Sbjct  234   PDNKEFHSKSVVRDAPYLYYVLQHAGDKVLSCPPAMKLL---QGAGGQHNLLRGDSEGYI  290

Query  356   -LWTVPEVTTQQLAQICQNDRSTPLSLPPAVKTSITTAWEEMKPSPVGILDQLDSGDGHG  414
              +W VPEV    ++ I Q  +  P  L P V TS+  AW  M P PVGILDQL       
Sbjct  291   SVWNVPEVPLDNIS-ILQAKQMPPRPLKPHVCTSLVEAWSIMDPPPVGILDQLSRITESP  349

Query  415   IKLTASIYLPQQSRLVVGREDGSIIIVPATQTVMLQLLHGNHQQYDDWPPHQVLLGHSGR  474
             +KLT+SIYLPQQSRLV+GREDGSI+IVPATQTVM+QLL G  Q + DWP HQ+L GH GR
Sbjct  350   VKLTSSIYLPQQSRLVIGREDGSIVIVPATQTVMMQLLVGIKQNFSDWPSHQILYGHRGR  409

Query  475   VNCLLYPHGAAPRYDRTHLVSGSVDFAVCLWDLYAGTLIHRFCVHAGEITQLMVPPDNCS  534
             VNCLL P     RY+++HL+SG +DFAVCLWDLY+G+L+HRFCVHAGEITQL+VPP++CS
Sbjct  410   VNCLLCPSMIHSRYEKSHLLSGGIDFAVCLWDLYSGSLLHRFCVHAGEITQLLVPPESCS  469

Query  535   PRIQKCVCSVASDHSVTLLSLAERKCVVLASRHLFPVVTIKWRPLDDFMIVGCSDGAVYV  594
             PRI KC+CSVASDHSVTL+SL ERKCV LASRHLFPVVTIKW PLDDF+IVGCSDG+VYV
Sbjct  470   PRILKCICSVASDHSVTLVSLQERKCVTLASRHLFPVVTIKWAPLDDFLIVGCSDGSVYV  529

Query  595   WQMETGHLDRVLHGIIAEEVLYACDENT------IAASGGSATGGELGLANPAVHFFRGL  648
             WQMETGHLDRVLHG++AEEVL ACDE               A+  E+G+ANPAVHFFRGL
Sbjct  530   WQMETGHLDRVLHGMLAEEVLSACDEQAEDGGSGGGGGSNGASASEMGMANPAVHFFRGL  589

Query  649   RHRNLSAIRHATQRGLHQLQQLHGGQGVDHGNQIKTKGTPLMIQGFRSNPKDPESHILFF  708
             + RN++AIRHATQRG+ QLQQL G    +    +K +  PL+IQG R+NPKD ESHILFF
Sbjct  590   KSRNMNAIRHATQRGITQLQQLQGHNQGNFDFLMKHRSNPLVIQGLRTNPKDAESHILFF  649

Query  709   DIEALIVQLLNDEYGAMSPGSLEAQGLISASEYQKVAALTQSASPDAHKKIADFFGRVKD  768
             DIE LI +L ++EY  M+P +LE+ G+     + +     +S   DA KKI DFF +VK+
Sbjct  650   DIEGLIFELHSEEYAQMTPATLESLGV-----HLQNPKDGKSMHLDASKKIGDFFNKVKN  704

Query  769   KAGDVERILKEKDRHGILAKMKEGAENVHTKIQAKVESV--GLKPSTLDGKGDNWNNNEI  826
             KA DVE+ILK+KD+HG++ K KE  E V  K+QAKVES+   ++P            +E 
Sbjct  705   KAVDVEKILKDKDKHGLVQKFKEKTEIVEKKVQAKVESLQKAVEP------------HEE  752

Query  827   AKNNLKRNGAFSEPNATMEVAQLILSLLHAWGIDPDLDRVCEGKLGLLRPMVPVSFGVLS  886
              ++   +  +  E    MEVAQL+LSLLH+WG+DP LD++CE +LGLLRP+VP+S+GVLS
Sbjct  753   QQDLKSKIASKMEVTHVMEVAQLLLSLLHSWGLDPHLDKMCETRLGLLRPIVPISYGVLS  812

Query  887   KGGYMSLLLPTWQ--MQLEP-IGEPTTQLEQRLPAELVRQERLTRAFTARAHWELSTTLT  943
             K GYMSLLLPTWQ    + P I  P++  ++ LP EL R E LT  FT+R HWELSTTLT
Sbjct  813   KAGYMSLLLPTWQNNYAIPPGIQLPSSSKKRPLPEELQRLEHLTAVFTSRLHWELSTTLT  872

Query  944   SNHLLAVVALANTLMSMNNATFVPEQERNRKMHRPGNRSTVNWNKAEEENEEIYTAQQAQ  1003
             +NH+LA+VA++NTL+SM+ A+F+P+ E+++K+ R   R+    +  EEE EE+     +Q
Sbjct  873   TNHILALVAMSNTLLSMSAASFLPDSEKHKKLQRLAQRTDSTLSN-EEEREELMAHHISQ  931

Query  1004  IKQGWSLLATLHCVLLPDKIVSQGGVKTFKRPQVEMMARRWQHQCLEIREAAQALLLAEL  1063
             IK  WSLLAT HC LLPDKI +    K FKRPQVEMM +RWQH C+EIREAAQ +LL EL
Sbjct  932   IKHAWSLLATHHCFLLPDKIEALEP-KKFKRPQVEMMVKRWQHHCIEIREAAQQILLGEL  990

Query  1064  GRMGPKGRKTLVDSWSQYLPMYS-------TQEPIAPQSQNQSPPAPGSPIPSSESHTE-  1115
              RMG KGRK LV+SW+QYLP+Y+        Q+ +A  SQ  S  A      +       
Sbjct  991   TRMGKKGRKQLVESWAQYLPLYTHTEPIVGAQQQLALISQPASGGAGSGSGGNGGVGVGV  1050

Query  1116  -------------------EEDEEEELAEAEINVARKPSSVAELKRKQTTAVVLLGVIGA  1156
                                +  ++E+  E E  + RKPSS++ELKRKQTTAV+LLGVIGA
Sbjct  1051  SGGGGAGSGSGPGGSVPGGDAHQDEDYEEEEEEIIRKPSSLSELKRKQTTAVILLGVIGA  1110

Query  1157  EFGQDVTTTNQKRDNE----------------QRRKSSIVEGFGIGNNNLARHTSMALTH  1200
             EFGQD++  +                      +RRKSS+VEGFGI NN LAR TSMAL H
Sbjct  1111  EFGQDISQESPNHRGSISMATGANLTSGVAGGERRKSSVVEGFGIANN-LARLTSMALAH  1169

Query  1201  LLHAPHSPKLPLHTALRRAAIDLIGRGFTVWEPYLDVSKVLLGLLEMCCDADKLVPNMTY  1260
             LL+AP SPKLP +T LRRAAIDL+GRGFTVWEPYLDVSKVLLGLLE+ C+  K VPN+ Y
Sbjct  1170  LLYAPPSPKLPQYTPLRRAAIDLLGRGFTVWEPYLDVSKVLLGLLEISCEG-KAVPNLNY  1228

Query  1261  GLPLTPQADTCRTARHALTLIATARPAAFITTMAREVARYNTLQQNAQTLNVNMGASVLV  1320
              LPLTPQAD CRTARHAL LIATARPAAFITTMAREVARYNT+QQNAQ++N  +  SVL 
Sbjct  1229  KLPLTPQADACRTARHALRLIATARPAAFITTMAREVARYNTMQQNAQSINTPLTQSVLH  1288

Query  1321  RAKPEILRIVEQLIDKMQSEMSDLLVEVMDIILHCLDPGHLKTKPLNDVFPAVCRFNQVS  1380
             +AK EIL+ VE LIDKMQSE++ LLVEVMDI LHC+D   LK + L ++ PA+C+FNQ+S
Sbjct  1289  KAKGEILQCVEMLIDKMQSEIAGLLVEVMDIALHCVDGNELKNRGLAELCPAICKFNQIS  1348

Query  1381  HCPATRRIAVGSRNGQLALYELRGNVKCQTVPAHVASVTALAFSPEGKFLVSYSCTENKL  1440
             HC  TRRIAVG+ +G LA+YELR N KCQ +PAH   +T+LAFSP+GK+LVSYSC EN+L
Sbjct  1349  HCAQTRRIAVGANSGNLAIYELRQN-KCQMIPAHTHPITSLAFSPDGKYLVSYSCAENRL  1407

Query  1441  CFWQQTSSGMFGLGNSQTRCVKSYSTAPINDVARLNPMRLARLIWINNRTVTLMLADGSE  1500
              FW QTS+GMFGLG SQTRC K YSTAPI DV+RLNPMRLA+L+WINNRTVTLMLADGSE
Sbjct  1408  SFW-QTSTGMFGLGQSQTRCTKGYSTAPIPDVSRLNPMRLAKLVWINNRTVTLMLADGSE  1466

Query  1501  TRFNV  1505
             TRFNV
Sbjct  1467  TRFNV  1471



Lambda      K        H
   0.319    0.133    0.387 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3931755120


Query= XP_003392928.1 growth hormone-inducible transmembrane protein
[Bombus terrestris]

Length=339
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

BI1_DROME  unnamed protein product                                    42.0    4e-04
ACH8_CAEEL  unnamed protein product                                   33.5    0.25 
ABCGO_DICDI  unnamed protein product                                  29.6    4.9  


>BI1_DROME unnamed protein product
Length=245

 Score = 42.0 bits (97),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 54/247 (22%), Positives = 102/247 (41%), Gaps = 46/247 (19%)

Query  107  WPQYVKDRIKTTYMYLGASIVSSTVAAAVCLRSPTMMNLVMRQGWVAMLVTLASVWGSGI  166
            +  YV++ +   YM LG++  ++ + A + +R        +  G +A + TL  V G   
Sbjct  23   YEPYVREHLSKVYMVLGSTAAATAMGAMLQMRD------FLDLGVLAAVATLVLVLGLHF  76

Query  167  LLQT---------IPYKEGFGAKQIAWLIHTGTVGAFLAPLYLLGGPLVLRAAWYTAGVV  217
                         + Y  GF + Q        T+G  L  +  +   ++L A   T    
Sbjct  77   YKDDGKNYYTRLGMLYAFGFCSGQ--------TLGPLLGYICSINPAIILSALTGTFVTF  128

Query  218  GGLSVVAVCAPNEKFLNMGGPL-----AVGLGFVFASSVGSMFLPPTTALGSGLYSISLY  272
              LS+ A+ A   K+L +GG L      + L  +F     S F+  T           LY
Sbjct  129  ISLSLSALLAEQGKYLYLGGMLVSVINTMALLSLFNMVFKSYFVQVT----------QLY  178

Query  273  GGLVLFSMLLLYDTQRIIKQAETYPIHEYLARPYDPINNAISVYMDAVNIFVRILTMLAS  332
             G+ + +  ++YDTQ I+++              D + +A+ ++ D +++F R+L +L  
Sbjct  179  VGVFVMAAFIVYDTQNIVEKCRN--------GNRDVVQHALDLFFDVLSMFRRLLIILTQ  230

Query  333  GGSKRQK  339
               ++Q 
Sbjct  231  KEERKQN  237


>ACH8_CAEEL unnamed protein product
Length=474

 Score = 33.5 bits (75),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 32/65 (49%), Gaps = 1/65 (2%)

Query  275  LVLFSMLLLYDTQRIIKQAETYPIHEYLARPYDPINNAISVYMDAVNIFVR-ILTMLASG  333
            +  F+++LL   +R+    E Y + + L   YDP+   ++ +   VN+ +R IL  L   
Sbjct  5    IAFFTLILLVSIERVYSSDEEYRLLKDLREGYDPVERPVADHRKPVNVKLRLILQQLVDV  64

Query  334  GSKRQ  338
              + Q
Sbjct  65   DERNQ  69


>ABCGO_DICDI unnamed protein product
Length=1159

 Score = 29.6 bits (65),  Expect = 4.9, Method: Composition-based stats.
 Identities = 17/61 (28%), Positives = 31/61 (51%), Gaps = 17/61 (28%)

Query  82    IGIGSLCYYGLGLSPSMGAIDYAKLWPQYVKDRIKTTYMYLGASIVSSTVAAAVCLRSPT  141
             I +GS+CYY +GL P +    Y                 +L + +++STVA+++C+   T
Sbjct  997   IILGSICYYMIGLRPGILHFIY-----------------FLISLVLTSTVASSMCMAIST  1039

Query  142   M  142
             +
Sbjct  1040  I  1040



Lambda      K        H
   0.319    0.133    0.387 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3931755120


Query= XP_003392930.1 neuroligin-1 [Bombus terrestris]

Length=1031
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9NGK5_DROME  unnamed protein product                                 546     2e-175
Q6NR70_DROME  unnamed protein product                                 543     4e-174
B9VMQ5_APIME  unnamed protein product                                 498     4e-162


>Q9NGK5_DROME unnamed protein product
Length=1248

 Score = 546 bits (1407),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 271/526 (52%), Positives = 358/526 (68%), Gaps = 39/526 (7%)

Query  164  TRTVRTRYGTLRGVEDRSSTSVETYYGVPYATPPIGALRYMPPVTPTPWRGIKLADTMPP  223
            + TV+T+YG LRG+  RSS  VE + G+PYA+PP+G+LR+MPP+TP+ W+ ++ AD   P
Sbjct  182  SNTVKTKYGLLRGIVVRSSPLVEAFLGIPYASPPVGSLRFMPPITPSTWKTVRSADRFSP  241

Query  224  ACPQKPPEPDS------SLPRSKRAYLERLAPLLANQSEDCLYLNLYVPKSPH-------  270
             CPQ  P P +       +PR++ A L RL PLL NQSEDCLYLN+YVP           
Sbjct  242  VCPQNIPIPPNGPEALLEVPRARLAQLRRLLPLLKNQSEDCLYLNIYVPYETRRQRRNTD  301

Query  271  ---GSTPDLLPALLLIHGDSYSWGAGNSFDGTALAAYGRLIVVSINFRLGVLGFLKTGPK  327
               G     L  ++ IHG+SY W +GN +DG+ LAA+G +IVV+INFRLG+ GFLKTG K
Sbjct  302  DTTGEPKTKLSTVVFIHGESYDWNSGNPYDGSELAAHGNVIVVTINFRLGIFGFLKTGGK  361

Query  328  GSAQGNYGLMDLVAGLHWLHENLGAFGGDPDRLTLFGHGTGAALANFLAVSPMARELVER  387
             SAQGN+GLMDLVAGLHWL ENL AFGGDP  +TL G+GTGA LAN L VSP+A +L++R
Sbjct  362  ESAQGNFGLMDLVAGLHWLKENLPAFGGDPQSITLLGYGTGAVLANILVVSPVASDLIQR  421

Query  388  VVLLGGSALSPWAIQRDPLTAKRHVANQTDCSGDVEADDIAPCLRLRSLEELLAVQWDTP  447
             VL+ GSALSPWAIQ++PL  KR VA QT C GD+  DD+APCLR +S+ ELLAV+ D P
Sbjct  422  TVLVSGSALSPWAIQKNPLFVKRRVAEQTGCHGDMLYDDLAPCLRTKSVAELLAVKVDHP  481

Query  448  RFTSGFAPFVDGAVM---PAPINQNFQPTASSSGLMPLIPGPGTEFANFGDRDLLLGLTS  504
            RF  GFAPFVDG V+     P+     P  S+     ++   G E+ANF  RDL+  LTS
Sbjct  482  RFLVGFAPFVDGTVISPGANPLGSTTLPLGSA-----IVSTSGIEYANFPKRDLIFCLTS  536

Query  505  EEAWINLTDDDLQNGLNETRRDRILRTYVRNTYRYHLHEIYSTLRNEYTDWERGEQSPSA  564
             E++++L+  DL+ G NETRRDRILRT+VRN + YHL+EI++ L+NEYTDWE+  ++P +
Sbjct  537  VESYLDLSAQDLEFGFNETRRDRILRTFVRNNFHYHLNEIFAVLKNEYTDWEKAIRNPLS  596

Query  565  ICEGLLSLLGDGQVAAPLLRLALLHSASGGRGYFLHFQLG----DRP----SQRGEEVPY  616
              +  L  L DG  A+PL++L  +HS  GGR YFLHF+      + P    S RGE+VP+
Sbjct  597  SRDATLQFLSDGHTASPLIKLGYMHSLRGGRAYFLHFKHKTIEEEYPQRSGSVRGEDVPF  656

Query  617  LLGIPLLRGEVVSVLFAQVNYTLADENLSKLLVHYLANFVRRGDPN  662
             LG+P+      S LF   NYT  +  + +L++ YL+NF + G+PN
Sbjct  657  WLGLPM------SPLFPH-NYTTQERQIGRLMLRYLSNFAKTGNPN  695


 Score = 152 bits (384),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 96/241 (40%), Positives = 121/241 (50%), Gaps = 53/241 (22%)

Query  679   PFWDSYDSINQLYLEAGRSTEMRSHYRGHKMSLWLNLLPQLHRPGYEI---SMRHHHLVD  735
             PFWD+YD +NQLY+E G    ++SHYRGHK+S+WLNL+PQLHR  + I   SMRHH   D
Sbjct  785   PFWDAYDVVNQLYVELGNKANIQSHYRGHKLSMWLNLIPQLHR-HFNINDQSMRHHQFQD  843

Query  736   ---SPSLYEGAVRQQTEALP-------------LPAPPLPVPSPTEPSS-----------  768
                +  LYEG VR Q +  P                PP P  +P+  ++           
Sbjct  844   DMNNRDLYEGVVRPQLQTKPAEDDNIIIMQRSRTTTPPPPSKNPSTNATQALNPLGTGTP  903

Query  769   ------ISSAISTTECTPNATVATTVATTSRTFQHPKLGPAPNNI------LRKLASTYY  816
                   I  A+S +E T   +         R      L  A   I      LR+L    +
Sbjct  904   TTTECGIDGAMSVSELTTTQSPKDNRTGIVRVETQKDLATASTGIIGNLELLRRLGGKQF  963

Query  817   QSYTTALTVTIAIGVFLLILNILIFAGIYHQRDKNASNAAGGLSSGFGDKKKEELLEAGC  876
             QSYTTAL  T+A+G FLLILN+LIFAGIYHQR+K A +A          K KEEL E   
Sbjct  964   QSYTTALIATVAVGCFLLILNVLIFAGIYHQREKRARDA----------KTKEELQEGDN  1013

Query  877   S  877
             S
Sbjct  1014  S  1014


>Q6NR70_DROME unnamed protein product
Length=1248

 Score = 543 bits (1398),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 270/526 (51%), Positives = 357/526 (68%), Gaps = 39/526 (7%)

Query  164  TRTVRTRYGTLRGVEDRSSTSVETYYGVPYATPPIGALRYMPPVTPTPWRGIKLADTMPP  223
            + TV+T+YG LRG+  RSS  VE + G+PYA+PP+G+LR+MPP+TP+ W+ ++ AD   P
Sbjct  182  SNTVKTKYGLLRGIVVRSSPLVEAFLGIPYASPPVGSLRFMPPITPSTWKTVRSADRFSP  241

Query  224  ACPQKPPEPDS------SLPRSKRAYLERLAPLLANQSEDCLYLNLYVPKSPH-------  270
             CPQ  P P +       +PR++ A L RL PLL NQSEDCL LN+YVP           
Sbjct  242  VCPQNIPIPPNGPEALLEVPRARLAQLRRLLPLLKNQSEDCLCLNIYVPYETRRQRRNTD  301

Query  271  ---GSTPDLLPALLLIHGDSYSWGAGNSFDGTALAAYGRLIVVSINFRLGVLGFLKTGPK  327
               G     L  ++ IHG+SY W +GN +DG+ LAA+G +IVV+INFRLG+ GFLKTG K
Sbjct  302  DTTGEPKTKLSTVVFIHGESYDWNSGNPYDGSELAAHGNVIVVTINFRLGIFGFLKTGGK  361

Query  328  GSAQGNYGLMDLVAGLHWLHENLGAFGGDPDRLTLFGHGTGAALANFLAVSPMARELVER  387
             SAQGN+GLMDLVAGLHWL ENL AFGGDP  +TL G+GTGA LAN L VSP+A +L++R
Sbjct  362  ESAQGNFGLMDLVAGLHWLKENLPAFGGDPQSITLLGYGTGAVLANILVVSPVASDLIQR  421

Query  388  VVLLGGSALSPWAIQRDPLTAKRHVANQTDCSGDVEADDIAPCLRLRSLEELLAVQWDTP  447
             VL+ GSALSPWAIQ++PL  KR VA QT C GD+  DD+APCLR +S+ ELLAV+ D P
Sbjct  422  TVLVSGSALSPWAIQKNPLFVKRRVAEQTGCHGDMLYDDLAPCLRTKSVAELLAVKVDHP  481

Query  448  RFTSGFAPFVDGAVM---PAPINQNFQPTASSSGLMPLIPGPGTEFANFGDRDLLLGLTS  504
            RF  GFAPFVDG V+     P+     P  S+     ++   G E+ANF  RDL+  LTS
Sbjct  482  RFLVGFAPFVDGTVISPGANPLGSTTLPLGSA-----IVSTSGIEYANFPKRDLIFCLTS  536

Query  505  EEAWINLTDDDLQNGLNETRRDRILRTYVRNTYRYHLHEIYSTLRNEYTDWERGEQSPSA  564
             E++++L+  DL+ G NETRRDRILRT+VRN + YHL+EI++ L+NEYTDWE+  ++P +
Sbjct  537  VESYLDLSAQDLEFGFNETRRDRILRTFVRNNFHYHLNEIFAVLKNEYTDWEKAIRNPLS  596

Query  565  ICEGLLSLLGDGQVAAPLLRLALLHSASGGRGYFLHFQLG----DRP----SQRGEEVPY  616
              +  L  L DG  A+PL++L  +HS  GGR YFLHF+      + P    S RGE+VP+
Sbjct  597  SRDATLQFLSDGHTASPLIKLGYMHSLRGGRAYFLHFKHKTIEEEYPQRSGSVRGEDVPF  656

Query  617  LLGIPLLRGEVVSVLFAQVNYTLADENLSKLLVHYLANFVRRGDPN  662
             LG+P+      S LF   NYT  +  + +L++ YL+NF + G+PN
Sbjct  657  WLGLPM------SPLFPH-NYTTQERQIGRLMLRYLSNFAKTGNPN  695


 Score = 152 bits (384),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 96/241 (40%), Positives = 121/241 (50%), Gaps = 53/241 (22%)

Query  679   PFWDSYDSINQLYLEAGRSTEMRSHYRGHKMSLWLNLLPQLHRPGYEI---SMRHHHLVD  735
             PFWD+YD +NQLY+E G    ++SHYRGHK+S+WLNL+PQLHR  + I   SMRHH   D
Sbjct  785   PFWDAYDVVNQLYVELGNKANIQSHYRGHKLSMWLNLIPQLHR-HFNINDQSMRHHQFQD  843

Query  736   ---SPSLYEGAVRQQTEALP-------------LPAPPLPVPSPTEPSS-----------  768
                +  LYEG VR Q +  P                PP P  +P+  ++           
Sbjct  844   DMNNRDLYEGVVRPQLQTKPAEDDNIIIMQRSRTTTPPPPSKNPSTNATQALNPLGTGTP  903

Query  769   ------ISSAISTTECTPNATVATTVATTSRTFQHPKLGPAPNNI------LRKLASTYY  816
                   I  A+S +E T   +         R      L  A   I      LR+L    +
Sbjct  904   TTTECGIDGAMSVSELTTTQSPKDNRTGIVRVETQKDLATASTGIIGNLELLRRLGGKQF  963

Query  817   QSYTTALTVTIAIGVFLLILNILIFAGIYHQRDKNASNAAGGLSSGFGDKKKEELLEAGC  876
             QSYTTAL  T+A+G FLLILN+LIFAGIYHQR+K A +A          K KEEL E   
Sbjct  964   QSYTTALIATVAVGCFLLILNVLIFAGIYHQREKRARDA----------KTKEELQEGDN  1013

Query  877   S  877
             S
Sbjct  1014  S  1014


>B9VMQ5_APIME unnamed protein product
Length=807

 Score = 498 bits (1282),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 292/721 (40%), Positives = 395/721 (55%), Gaps = 64/721 (9%)

Query  158  GSQKYSTRTVRTRYGTLRGVE---DRSSTSVETYYGVPYATPPIGALRYMPPVTPTPWRG  214
             S + S+R VRT+YG L GV    DR    VE + GVPYA+PPIG+LR+MPPV+   W G
Sbjct  16   ASAELSSRIVRTKYGDLSGVIVTLDRHLEGVEVFRGVPYASPPIGSLRFMPPVSSALWHG  75

Query  215  IKLADTMPPACPQKPPEPDSSLPRSKRAYLERLAPLLANQSEDCLYLNLYVP--KSPHGS  272
            +K+AD   P CPQ+ PE    +P+ +  YL RL P L NQSEDCLYLN+Y P        
Sbjct  76   VKVADKFGPVCPQRLPELSDKMPKGRVEYLRRLLPYLRNQSEDCLYLNVYAPVQAGARDG  135

Query  273  TPDLLPALLLIHGDSYSWGAGNSFDGTALAAYGRLIVVSINFRLGVLGFLKTGPKGSAQ-  331
                 P ++ +HG+SY W +GN +DG+ LA+YG ++VV+IN+RLG+LGFL        + 
Sbjct  136  GGRRYPVIVFVHGESYEWSSGNPYDGSVLASYGGVVVVTINYRLGILGFLNANTDSHLRS  195

Query  332  -GNYGLMDLVAGLHWLHENLGAFGGDPDRLTLFGHGTGAALANFLAVSPMARE--LVERV  388
              NYGLMD +A LHW+ EN+G FGGDP  +TL GHGTGAA  NFL  S    +  L  R 
Sbjct  196  PANYGLMDQIAALHWVQENIGNFGGDPRNVTLIGHGTGAACVNFLMTSHAVPDGLLFHRS  255

Query  389  VLLGGSALSPWAIQRDPLTAKRHVANQTDCS-GDVEADDIAPCLRLRSLEELLAVQWDTP  447
            VL+ GSALSPWA+ R        VA   +CS    ++  +  CLR   L  L++V     
Sbjct  256  VLMSGSALSPWALVRGAANYALQVAKHLNCSWAASDSQALLRCLREVPLNALVSVPVKGL  315

Query  448  RFTSGFAPFVDGAVMP--APINQNFQPTASSSGLMPLIPGPGTEFANFGDRDLLLGLTSE  505
             F   F P VDG V+    P +Q+F     +   +  I       A     DL++G+   
Sbjct  316  EFAPAFGPSVDGVVIDPGDPEDQDFTLQVDTINTLNNILLRKDVVAKLSRYDLMIGVVRS  375

Query  506  EAWINLTDDDLQNGLNETRRDRILRTYVRNTYRYHLHEIYSTLRNEYTDWERGEQSPSAI  565
            EA+  LT DD Q G+   RR +ILR +VRNTY YH  EI +T+ NEYTDWER  Q P  I
Sbjct  376  EAYFALTADDAQYGIEADRRTKILREFVRNTYTYHQAEILATIINEYTDWERPVQHPVNI  435

Query  566  CEGLLSLLGDGQVAAPLLRLALLHSASGGRGYFLHF----QLGDRPSQ----RGEEVPYL  617
             +  L  LGD    AP  R A LHS S    Y   F    + GD P +     GE++PY 
Sbjct  436  KDETLEALGDANTVAPATRTADLHSQSRRNSYLYVFDYQSKFGDYPQKPGCIHGEDLPYF  495

Query  618  LGIPLLRGEVVSVLFAQVNYTLADENLSKLLVHYLANFVRRGDPNGVSPLTSGSDGLPTS  677
             G PL+ G    +     NYT A+  LS+ ++ YL NF R G+PN  +P     D  P  
Sbjct  496  FGAPLVGG----LSHWPKNYTRAEMALSESVILYLTNFARTGNPNEGTP-----DVGPMR  546

Query  678  PPF-------WDSYDSINQLYLEAGRSTEMRSHYRGHKMSLWLNLLPQLHRPGYEISMRH  730
            P         W +Y+++++ YL     +++++HYR H++S WLNL+P LH+PG +   R 
Sbjct  547  PERTKLKNIDWIAYETVHKKYLSIELKSKLKNHYRAHRLSFWLNLVPDLHKPGSDDVPRS  606

Query  731  HHLVDSPSLYEGAVRQQTEALPLPAPPLPVPSPTEPSSISSAISTTECTPNATVATTVAT  790
            HHL+D            TE +P   P      PT     ++ ++  E   N    +T A 
Sbjct  607  HHLLD------------TEQVP---PRFIQRVPTTTRMTTAEVTLAERAHN---FSTAAP  648

Query  791  TSRTFQHPKLGPAPNNILRKLASTYYQSYTTALTVTIAIGVFLLILNILIFAGIYHQRDK  850
            +  TF+   + P             + +Y+TAL+VTIAIG  LLILN+LIFAG+Y+QRDK
Sbjct  649  SELTFEDSTVQPEGG----------FAAYSTALSVTIAIGCSLLILNVLIFAGVYYQRDK  698

Query  851  N  851
            +
Sbjct  699  S  699



Lambda      K        H
   0.319    0.133    0.387 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3931755120


Query= XP_003392931.1 putative ATP-dependent RNA helicase DHX33 [Bombus
terrestris]

Length=693
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MOG5_CAEEL  unnamed protein product                                   544     1e-179
DHX8_DROME  unnamed protein product                                   536     2e-176
DHX16_CAEEL  unnamed protein product                                  521     5e-173


>MOG5_CAEEL unnamed protein product
Length=1200

 Score = 544 bits (1401),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 279/630 (44%), Positives = 409/630 (65%), Gaps = 12/630 (2%)

Query  58    NISLQQQRKSLPVYKLRKRLLEEIRRNSTLIVIGETGSGKTTQIPQLLLSSGIAGTIGCI  117
             N+S+ +QR+SLP++ L+K L+E +  N  L+V+GETGSGKTTQ+ Q  + +G+ G  G I
Sbjct  530   NLSMVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGL-GRRGKI  588

Query  118   GITQPRRVAAVSVARRVAQEQGVEPGKLVGYCVRFEDVTSSQTRIKYLTDGMMVREAMTD  177
             G TQPRRVAA+SVA+RVA+E G + G  VGY +RFED TS  T IKY+TDGM++RE + D
Sbjct  589   GCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLID  648

Query  178   EILSDYSVVILDEAHERSVQTDVLLGVARRAQNLRKLKNLPPLKLLVMSATMDVDKFSKY  237
               LS YS+++LDEAHER++ TDVL G+ + A   R     P LKL++ SAT+D  KFS+Y
Sbjct  649   PDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKR-----PELKLIITSATLDSVKFSEY  703

Query  238   F-QAPAVYLEGRQHPVKIYHAVKSQEDYAFSALVTAFQIHRDNPANEDILVFLTGQEEIE  296
             F +AP   + GR  PV+I +  + + DY  +A +T  QIH   P   D+LVFLTGQEEI+
Sbjct  704   FLEAPIFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPG-DVLVFLTGQEEID  762

Query  297   AAATSARQVAKQLDGQGYPSLKVFPLYSALPTHQQLEAFKPSSPGMRKLILSTNVAETSV  356
              +     +  K + G   P L + P+Y ALP+  Q   F P+  G RK++++TN+AETS+
Sbjct  763   TSCEVLYERMKSM-GPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSL  821

Query  357   TIGGIRHVIDTGVVKARTHHPTTGLDVLRVEKVSKAQAWQRTGRAGREAAGKCYRNYTKE  416
             TI GI +V+D G VK + ++P +G+D L V  +S+A A QR+GRAGR   GKCYR YT+ 
Sbjct  822   TIDGIFYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTER  881

Query  417   EF-ERMKEMPVPEIQRCSLAGVALQLLAIGVD-ITTFDFMDKPPKEAVDVAVTCLEKLGA  474
              F + M   PVPEIQR +LA   LQL A+G++ +  FDFMD PP +++  A+  L  L A
Sbjct  882   AFRDEMLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSA  941

Query  475   VKGSPPQLTTLGRTMSLFPLDPRFTKVILASAEHQCLEEALTVVALLSGESVFTDPPAKR  534
             + G    LT LGR M+ FPL+P  +K+++ S +  C EE LT+VA+L+ +++F  P  K+
Sbjct  942   LDGDG-LLTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQ  1000

Query  535   QQAYVARSRFASPEGDHVTLLNVFRAYANTKQKKVWCHENFLHHRNLEYATEVRQQLATL  594
               A   +++F  PEGDH+TLL V+ ++ N    + WC ENF+  R+++ A ++R+QL  +
Sbjct  1001  DHADQKKAKFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGI  1060

Query  595   AERANLEKASCGTNTEQLRKALLEGLYDNLAELQRDQTYITVSSKQPVAIHPSSTLHASK  654
              +R  L   SCG +  +++KA+  G + N A+    + Y T++  Q V IHPSS     +
Sbjct  1061  MDRHKLLMVSCGRDVSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQQ  1120

Query  655   PPLILFTEVVATGRCYLRGLSVIDCSWLTE  684
             P  +++ E+V T + Y+R ++ ID  WL E
Sbjct  1121  PEWVVYHELVMTTKEYMREVTAIDPKWLVE  1150


>DHX8_DROME unnamed protein product
Length=1242

 Score = 536 bits (1382),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 286/632 (45%), Positives = 405/632 (64%), Gaps = 12/632 (2%)

Query  56    KGNISLQQQRKSLPVYKLRKRLLEEIRRNSTLIVIGETGSGKTTQIPQLLLSSGIAGTIG  115
             K +++L +QR+SLP+YKLR  L++ +  N  LIVIGETGSGKTTQI Q L   G     G
Sbjct  574   KTDLTLVEQRQSLPIYKLRDDLIKAVTDNQILIVIGETGSGKTTQITQYLGECGFTAR-G  632

Query  116   CIGITQPRRVAAVSVARRVAQEQGVEPGKLVGYCVRFEDVTSSQTRIKYLTDGMMVREAM  175
              IG TQPRRVAA+SVA+RVA+E G   G+ VGY +RFED TS +T IKY+TDGM++RE +
Sbjct  633   KIGCTQPRRVAAMSVAKRVAEEYGCRLGQEVGYTIRFEDCTSPETIIKYMTDGMLLRECL  692

Query  176   TDEILSDYSVVILDEAHERSVQTDVLLGVARRAQNLRKLKNLPPLKLLVMSATMDVDKFS  235
              +  L  YSV++LDEAHER++ TDVL G+ + A   R     P LKL+V SAT+D  KFS
Sbjct  693   MEAELKSYSVIMLDEAHERTIHTDVLFGLLKTAVQKR-----PELKLIVTSATLDAVKFS  747

Query  236   KYF-QAPAVYLEGRQHPVKIYHAVKSQEDYAFSALVTAFQIHRDNPANEDILVFLTGQEE  294
             +YF +AP   + GR  PV++ +  + + DY  ++L+T  QIH   P   DIL+FLTGQEE
Sbjct  748   QYFFKAPIFTIPGRTFPVEVLYTKEPETDYLDASLITVMQIHLREPPG-DILLFLTGQEE  806

Query  295   IEAAATSARQVAKQLDGQGYPSLKVFPLYSALPTHQQLEAFKPSSPGMRKLILSTNVAET  354
             I+ A     +  K L G   P L + P+YSALP+  Q   F P+  G RK++++TN+AET
Sbjct  807   IDTACEILYERMKSL-GPDVPELIILPVYSALPSEMQTRIFDPAPAGSRKVVIATNIAET  865

Query  355   SVTIGGIRHVIDTGVVKARTHHPTTGLDVLRVEKVSKAQAWQRTGRAGREAAGKCYRNYT  414
             S+TI GI +V+D G VK + ++  TG+D L V  +S+A A QR GRAGR   GK YR YT
Sbjct  866   SLTIDGIFYVVDPGFVKQKVYNSKTGMDSLVVTPISQAAAKQRAGRAGRTGPGKTYRLYT  925

Query  415   KEEF-ERMKEMPVPEIQRCSLAGVALQLLAIGV-DITTFDFMDKPPKEAVDVAVTCLEKL  472
             +  + + M   PVPEIQR +LA   LQL  +G+ D+  FDFMD PP E++ +A+  L  L
Sbjct  926   ERAYRDEMLPTPVPEIQRTNLATTVLQLKTMGINDLLHFDFMDAPPVESLVMALEQLHSL  985

Query  473   GAVKGSPPQLTTLGRTMSLFPLDPRFTKVILASAEHQCLEEALTVVALLSGESVFTDPPA  532
              A+      LT LGR M+ FPL+P  +K+++ S   QC +E LT+V++LS ++VF  P  
Sbjct  986   SALDDEG-LLTRLGRRMAEFPLEPNLSKMLIMSVALQCSDEILTIVSMLSVQNVFYRPKD  1044

Query  533   KRQQAYVARSRFASPEGDHVTLLNVFRAYANTKQKKVWCHENFLHHRNLEYATEVRQQLA  592
             K+  A   +++F   EGDH+TLL V+ ++ N K    WC+ENF+  R L+ + +VR+QL 
Sbjct  1045  KQALADQKKAKFNQAEGDHLTLLAVYNSWKNNKFSNAWCYENFVQIRTLKRSQDVRKQLL  1104

Query  593   TLAERANLEKASCGTNTEQLRKALLEGLYDNLAELQRDQTYITVSSKQPVAIHPSSTLHA  652
              + +R  L+  S G N+ +++KA+  G + N A+    + Y T+   Q V IHPSS L  
Sbjct  1105  GIMDRHKLDVVSAGKNSVRIQKAICSGFFRNAAKKDPQEGYRTLVDSQVVYIHPSSALFN  1164

Query  653   SKPPLILFTEVVATGRCYLRGLSVIDCSWLTE  684
              +P  +++ E+V T + Y+R ++ ID  WL E
Sbjct  1165  RQPEWVIYHELVQTTKEYMREVTTIDPKWLVE  1196


>DHX16_CAEEL unnamed protein product
Length=1008

 Score = 521 bits (1342),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 280/644 (43%), Positives = 403/644 (63%), Gaps = 13/644 (2%)

Query  45   NQQNVQAENVDKGNISLQQQRKSLPVYKLRKRLLEEIRRNSTLIVIGETGSGKTTQIPQL  104
            N++ V+ E  +K  +S+++ RKSLPVY  R   +E ++ +  LI+ GETGSGKTTQ+PQ 
Sbjct  342  NEEVVETE-AEKKKMSIEETRKSLPVYAFRDAFIEAVKEHQVLIIEGETGSGKTTQLPQY  400

Query  105  LLSSGIAGTIGCIGITQPRRVAAVSVARRVAQEQGVEPGKLVGYCVRFEDVTSSQTRIKY  164
            L  +G       IG TQPRRVAA+SVA RVA E G + G  VGY +RFED TS +T +KY
Sbjct  401  LYEAGFCEGGKRIGCTQPRRVAAMSVAARVADEVGCKLGTQVGYSIRFEDCTSEKTVLKY  460

Query  165  LTDGMMVREAMTDEILSDYSVVILDEAHERSVQTDVLLGVARRAQNLRKLKNLPPLKLLV  224
            +TDGM++RE + +  L+ YSV+++DEAHER++ TD+L G+ +     RK      LKLL+
Sbjct  461  MTDGMLLREFLNEPDLASYSVMMIDEAHERTLHTDILFGLVKDIARFRK-----DLKLLI  515

Query  225  MSATMDVDKFSKYF-QAPAVYLEGRQHPVKIYHAVKSQEDYAFSALVTAFQIHRDNPANE  283
             SAT+D +KFS +F  AP   + GR+ PV IY+    + DY  +A+VT  QIH   P   
Sbjct  516  SSATLDAEKFSSFFDDAPIFRIPGRRFPVDIYYTQAPEADYVDAAIVTIMQIHLTQPLPG  575

Query  284  DILVFLTGQEEIEAAATSARQVAKQLDGQGYPSLKVFPLYSALPTHQQLEAFKPSSPGMR  343
            DILVFLTGQEEIE    +  + +K L G     L   P+Y+ LP+  Q + F+P+    R
Sbjct  576  DILVFLTGQEEIETVQEALMERSKAL-GSKIKELIPLPVYANLPSDLQAKIFEPTPKDAR  634

Query  344  KLILSTNVAETSVTIGGIRHVIDTGVVKARTHHPTTGLDVLRVEKVSKAQAWQRTGRAGR  403
            K++L+TN+AETSVTI GI +VID G  K  +    +G++ L V  +SKA A QR GRAGR
Sbjct  635  KVVLATNIAETSVTIDGINYVIDPGFSKQNSFDARSGVEHLHVVTISKAAANQRAGRAGR  694

Query  404  EAAGKCYRNYTKEEFE-RMKEMPVPEIQRCSLAGVALQLLAIGV-DITTFDFMDKPPKEA  461
               GKC+R YT   ++  ++E P+PEIQR +L  V L L ++G+ D+  FDF+D PP+E 
Sbjct  695  TGPGKCFRLYTAWAYKHELEEQPIPEIQRTNLGNVVLMLKSLGIHDLVHFDFLDPPPQET  754

Query  462  VDVAVTCLEKLGAVKGSPPQLTTLGRTMSLFPLDPRFTKVILASAEHQCLEEALTVVALL  521
            + +A+  L  LGA+     +LT LGR M+ FP DP  +K+I+AS +++C EE +T+ A+L
Sbjct  755  LVIALEQLYALGALNHR-GELTKLGRRMAEFPCDPCMSKMIIASEKYECSEEIVTIAAML  813

Query  522  S-GESVFTDPPAKRQQAYVARSRFASPEGDHVTLLNVFRAYANTKQKKVWCHENFLHHRN  580
            S   +VF  P A+   A  AR  F SP GDH+TL+NV+  +  +   + WC EN++ HR 
Sbjct  814  SCNAAVFYRPKAQVIHADSARKGFWSPAGDHITLMNVYNKWQESSFSQRWCVENYVQHRT  873

Query  581  LEYATEVRQQLATLAERANLEKASCGTNTEQLRKALLEGLYDNLAELQRDQTYITVSSKQ  640
            ++ A +VR QL  L ER  +E  S  T+T ++RKA+  G + N+++L     Y TV  K 
Sbjct  874  MKRARDVRDQLVGLLERVEIETKS-STDTIKIRKAITAGYFYNVSKLDNTGHYKTVKHKH  932

Query  641  PVAIHPSSTLHASKPPLILFTEVVATGRCYLRGLSVIDCSWLTE  684
                HP+S L    P  +++ E+V T + ++R +S I+  WL E
Sbjct  933  TTHPHPNSCLFEETPRWVVYFELVFTSKEFMREMSEIESGWLLE  976



Lambda      K        H
   0.319    0.133    0.387 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3931755120


Query= XP_003392932.1 major facilitator superfamily domain-containing
protein 1 [Bombus terrestris]

Length=513
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TH2A_TRYBB  unnamed protein product                                   30.8    3.0  
Q86NN1_DROME  unnamed protein product                                 30.8    3.8  
Q9VWC0_DROME  unnamed protein product                                 30.8    3.8  


>TH2A_TRYBB unnamed protein product
Length=529

 Score = 30.8 bits (68),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 13/45 (29%), Positives = 25/45 (56%), Gaps = 0/45 (0%)

Query  97   SVFGIRLGTIIYMGLTLIGQIIFATGAMVNEFWVMMVGRFVFGVG  141
            ++FG++   II   ++++   +       NEFWV+  GR + G+G
Sbjct  145  TMFGLKKSFIIVGVMSVVASALNHISVATNEFWVLCAGRVLMGIG  189


>Q86NN1_DROME unnamed protein product
Length=2201

 Score = 30.8 bits (68),  Expect = 3.8, Method: Composition-based stats.
 Identities = 25/85 (29%), Positives = 41/85 (48%), Gaps = 15/85 (18%)

Query  424  TVVAIWVSDVTTTGGYLNMTPG-QREKYEEIR-RTPESLEREKLLAPESTSDLSTDDLLQ  481
            +VV +  +DVT TG Y+N + G  +E Y +++ R   S+  E++L P S           
Sbjct  658  SVVIVQDTDVTITGVYVNASNGAAQEAYCKMQYRVQSSVTEERVLRPGSVE--------P  709

Query  482  PQSDISIRNRYLSRIGGMVPPNVKT  506
            P+S        LS +  M+PP   +
Sbjct  710  PKSYTP-----LSALSSMLPPGASS  729


>Q9VWC0_DROME unnamed protein product
Length=2529

 Score = 30.8 bits (68),  Expect = 3.8, Method: Composition-based stats.
 Identities = 25/85 (29%), Positives = 41/85 (48%), Gaps = 15/85 (18%)

Query  424   TVVAIWVSDVTTTGGYLNMTPG-QREKYEEIR-RTPESLEREKLLAPESTSDLSTDDLLQ  481
             +VV +  +DVT TG Y+N + G  +E Y +++ R   S+  E++L P S           
Sbjct  986   SVVIVQDTDVTITGVYVNASNGAAQEAYCKMQYRVQSSVTEERVLRPGSVE--------P  1037

Query  482   PQSDISIRNRYLSRIGGMVPPNVKT  506
             P+S        LS +  M+PP   +
Sbjct  1038  PKSYTP-----LSALSSMLPPGASS  1057



Lambda      K        H
   0.319    0.133    0.387 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3931755120


Query= XP_003392933.1 chromatin complexes subunit BAP18 isoform X2 [Bombus
terrestris]

Length=160
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

H8ESF4_CAEEL  unnamed protein product                                 35.8    0.011
H8ESF3_CAEEL  unnamed protein product                                 35.4    0.012
G5EF87_CAEEL  unnamed protein product                                 35.4    0.013


>H8ESF4_CAEEL unnamed protein product
Length=685

 Score = 35.8 bits (81),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 26/40 (65%), Gaps = 1/40 (3%)

Query  31   TTDSPAGK-WTDEEIEMLRHSVKTFSEDLNKISEHIKGRT  69
            T  +P G+ WT++E  +L  +++ F +D NK+ +H+  RT
Sbjct  144  TKGAPPGRDWTEQETCLLLEALEMFKDDWNKVCDHVGTRT  183


>H8ESF3_CAEEL unnamed protein product
Length=792

 Score = 35.4 bits (80),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 26/40 (65%), Gaps = 1/40 (3%)

Query  31   TTDSPAGK-WTDEEIEMLRHSVKTFSEDLNKISEHIKGRT  69
            T  +P G+ WT++E  +L  +++ F +D NK+ +H+  RT
Sbjct  248  TKGAPPGRDWTEQETCLLLEALEMFKDDWNKVCDHVGTRT  287


>G5EF87_CAEEL unnamed protein product
Length=789

 Score = 35.4 bits (80),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 26/40 (65%), Gaps = 1/40 (3%)

Query  31   TTDSPAGK-WTDEEIEMLRHSVKTFSEDLNKISEHIKGRT  69
            T  +P G+ WT++E  +L  +++ F +D NK+ +H+  RT
Sbjct  248  TKGAPPGRDWTEQETCLLLEALEMFKDDWNKVCDHVGTRT  287



Lambda      K        H
   0.319    0.133    0.387 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3931755120


Query= XP_003392935.1 tribbles homolog 2 [Bombus terrestris]

Length=347
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TRIB_DROME  unnamed protein product                                   193     2e-57
Q38B72_TRYB2  unnamed protein product                                 125     1e-31
O18645_DROME  unnamed protein product                                 121     3e-30


>TRIB_DROME unnamed protein product
Length=484

 Score = 193 bits (491),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 102/260 (39%), Positives = 150/260 (58%), Gaps = 28/260 (11%)

Query  84   RCVDVHTGQQLVAKALTVGDKGCEALLQAHLRLE------------GTGAASGVAGVVEA  131
            RCVD+ TG+Q + +   + ++    + +A+ +L+            G      V  ++  
Sbjct  141  RCVDIFTGEQFLCR---IVNEPLHKVQRAYFQLQQHDEELRRSTIYGHPLIRPVHDIIPL  197

Query  132  PGGRRYLLL-------------EGHHGDLHAYVRARRRLREPEARRLFRQAARAVATCHE  178
               R Y+L+              G + +LH Y+R  +RL E EAR +F Q  + V  CH 
Sbjct  198  TKDRTYILIAPVPQERDSTGGVTGVYENLHTYIRHAKRLCETEARAIFHQICQTVQVCHR  257

Query  179  YGVVLRDLKLRKFVFADEARTRLRLESLEDAVIVEGDDDKLTDRRGCPAYVAPEVLRSGR  238
             G++LRDLKL++F F DEART+L+ ESLE ++I++G+DD L+D+ GCP Y APE+L   +
Sbjct  258  NGIILRDLKLKRFYFIDEARTKLQYESLEGSMILDGEDDTLSDKIGCPLYTAPELLCPQQ  317

Query  239  AYSGKAADIWSLGVLLYTMLVGRYPFNDAEHASLFAKISRGQFAVPEGLSPRARCLIRSL  298
             Y GK AD+WSLGV+LYTMLVG+YPF +  + +L   I  G   +P  LS   R L+ SL
Sbjct  318  TYKGKPADMWSLGVILYTMLVGQYPFYEKANCNLITVIRHGNVQIPLTLSKSVRWLLLSL  377

Query  299  LRKEPSERPYAEDVPRHPWL  318
            LRK+ +ER  A  +   PWL
Sbjct  378  LRKDYTERMTASHIFLTPWL  397


>Q38B72_TRYB2 unnamed protein product
Length=729

 Score = 125 bits (315),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 95/174 (55%), Gaps = 3/174 (2%)

Query  145  GDLHAYVRARRRLREPEARRLFRQAARAVATCHEYGVVLRDLKLRKFVFADEARTRLRLE  204
            G+L  Y+  R  L E   R +F+Q A  VA CH Y V+ RDLK    +      T +++ 
Sbjct  91   GELFDYICQRGPLAEDVVRHIFQQIAAGVAYCHRYRVIHRDLKPENILLEKNTNT-VKIA  149

Query  205  SLEDAVIVEGDDDKLTDRRGCPAYVAPEVLRSGRAYSGKAADIWSLGVLLYTMLVGRYPF  264
                +     D   L    G P Y +P+V+ SG  Y+G   D+WS GV+LYTMLVG  PF
Sbjct  150  DFGLSSYTH-DGRFLETSCGTPNYASPQVV-SGEMYAGPDTDVWSCGVILYTMLVGALPF  207

Query  265  NDAEHASLFAKISRGQFAVPEGLSPRARCLIRSLLRKEPSERPYAEDVPRHPWL  318
             D   A+LF KI R ++ VPE +SP+A  L+R +L   P ER   E V +HPW+
Sbjct  208  EDTNVAALFQKIKRAEYLVPESVSPQAHDLLRRMLVVNPLERATMEQVIQHPWV  261


>O18645_DROME unnamed protein product
Length=582

 Score = 121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 67/203 (33%), Positives = 105/203 (52%), Gaps = 6/203 (3%)

Query  128  VVEAPGGRRYLLLEGHHGDLHAYVRARRRLREPEARRLFRQAARAVATCHEYGVVLRDLK  187
            V+  P     ++     G+L  Y+    +L+E +ARR F+Q    V  CH + +V RDLK
Sbjct  94   VISTPSDIFMIMEYVSGGELFDYIVKHGKLQEHQARRFFQQIISGVDYCHRHMIVHRDLK  153

Query  188  LRKFVFADEARTRLRLESLEDAVIVEGDDDKLTDRRGCPAYVAPEVLRSGRAYSGKAADI  247
                +       ++    L + ++   D + L    G P Y APEV+ SG+ Y+G   DI
Sbjct  154  PENLLLDHNMHVKIADFGLSNMML---DGEFLRTSCGSPNYAAPEVI-SGKLYAGPEVDI  209

Query  248  WSLGVLLYTMLVGRYPFNDAEHASLFAKISRGQFAVPEGLSPRARCLIRSLLRKEPSERP  307
            WS GV+LY +L G  PF+D    +LF KI  G F +PE L+ +   L+  +L+ +P +R 
Sbjct  210  WSCGVILYALLCGTLPFDDEHVPTLFRKIKSGIFPIPEYLNKQVVNLVCQMLQVDPLKRA  269

Query  308  YAEDVPRHPWLAK--PLRVCPTS  328
              E++ +H W  K  P  + P+S
Sbjct  270  NIEEIKKHEWFQKDLPAYLFPSS  292



Lambda      K        H
   0.319    0.133    0.387 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3931755120


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jan 6, 2022  5:12 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_003392936.1 sterol regulatory element-binding protein 1 [Bombus
terrestris]

Length=1021
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q24146_DROME  unnamed protein product                                 441     3e-137
Q9VW37_DROME  unnamed protein product                                 440     5e-137
Q9XX00_CAEEL  unnamed protein product                                 132     5e-31 


>Q24146_DROME unnamed protein product
Length=1113

 Score = 441 bits (1134),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 318/864 (37%), Positives = 453/864 (52%), Gaps = 105/864 (12%)

Query  239   KVQINRLSTNTHIGVPRVKEVKRSAHNAIERRYRTSINDKIIELKNIIVGVDAKLNKSAI  298
             KV INR+        P+VKEVKRSAHNAIERRYRTSINDKI ELKN++VG  AKLNKSA+
Sbjct  270   KVPINRVQ-------PKVKEVKRSAHNAIERRYRTSINDKINELKNLVVGEQAKLNKSAV  322

Query  299   LRKTIDYIRFLQNSNARLKAENMSLK---LAAQRQNLRDLLVCGE---------------  340
             LRK+ID IR LQ  N  LKAE   L+   +A     ++DLL  G                
Sbjct  323   LRKSIDKIRDLQRQNHDLKAELQRLQRELMARDGSKVKDLLQLGTRPGRASKKRRESSQT  382

Query  341   ------LTPPRSDSSESSLSPAPAPLS-PQSP----SSIKDDPDLLQNVDSTSVLTN-QG  388
                   LTPPRSD S+ SLSP  + +S P SP    ++         N +   V ++ +G
Sbjct  383   FTTDAGLTPPRSDESDPSLSPMHSDISLPPSPYGGSTASCSSGSSSSNEEPLVVPSSMRG  442

Query  389   MRDHTRLTICGFMLLFLAFNPLGFLINNVGRFNSDYINTKLDG-RTILNYQDQSDLEN--  445
             M  H+RL +C FM   LA NP    +   G ++S+     + G R IL+Y    D+E   
Sbjct  443   MATHSRLGLCMFMFAILAVNPFKTFLQR-GHYDSNDDLGDMSGQRRILSY----DVEGEG  497

Query  446   -PVW-SNVFLWLTNAILLIGGLCRLLLYGDPILPSDSKIFLELHRWRRQAEFNISKNEYS  503
               VW  + ++WL N  L++G L +LL+YGDP L + +  + + HR R  A+F  S+ + S
Sbjct  498   FAVWQQSSWIWLLNFTLMLGCLVKLLVYGDPQLDAQTDAYCQ-HRQR--ADFYFSQGQSS  554

Query  504   QACRDLHQCLQYLGRPYPSSRAEIWLATMWQIIRQLLHKLWIGKWI-LYTHKWFSEKTTR  562
             QA      CL   G   P+SR E +L T WQ +R L H+LW+G+ +   +   FS   +R
Sbjct  555   QAYAGYLNCLHMFGLSLPASRLECYLQTTWQFLRFLFHRLWLGRVLSRRSGGLFSNAASR  614

Query  563   QQAEISAMEMAIIYQHMLCLHLSEGSKSGTL---YLALSAVNYAEATGETIPKSLLAEIY  619
             +QA  SA E+A+++  +  L L+     G +    +AL A N AE     +       I+
Sbjct  615   KQALASARELALLFNRLNQLQLTGNGSRGDMNGIMMALFASNMAEVAHNLLTPRETICIH  674

Query  620   INVALCFKHS----LFPFIHKYYLGKARTLLSSCAVPPK---LKWIMSDEGTKFLAFQKW  672
             +  AL  K S    L  F  +YY+ +AR          +   L+W  +  G ++ A   +
Sbjct  675   VMTALRMKRSAPKWLQQFFARYYMSRARQECGRTRATEQTQELRWAFTAYGYRYCATHVF  734

Query  673   QY-----GEQPDNEFTSQTSKADPLSYASRAYRDYLIGHCLRILTG------------TV  715
              Y     GEQ D  FT   +  DP ++  + YR++L+   ++ L G              
Sbjct  735   TYDLSDSGEQ-DGFFTRLRNPCDPAAHVIKQYREHLLFKSIQCLVGAGHKSGGLPTSSVS  793

Query  716   GDAHLSSILEYGQTIMASAGIDAGFLCTDKVTVTHCEDEIG---LWWGAVIYVAACWRLK  772
             G+A      ++  TI+++       L   K T+   EDE     +WW  V+  A  W L 
Sbjct  794   GEAEQLQQQQHSGTIVSNVLKYTSLL---KDTLWADEDERDTNVVWWADVLETAVHWLLG  850

Query  773   EDD--SQAWSIVESKFPYEKCYQLCNNNNSISPLPYIVLNAL--------QAAKATTKSV  822
             ED    Q +  ++ + P +   Q C  N+ +    + VL A          A   + K +
Sbjct  851   EDTLAEQLYGRIK-QMPTQ--LQQCGENDHLPKALHAVLRAKMILLKNNGNALDKSLKQL  907

Query  823   SMRFIDQAGILLEQCLVYYNCKQQSSQNVLLTQLWICDWLLEMRTTLWQ----ELDNDLE  878
                  D++ + L++CL   N    +    LL QL  CDWLLE RT LW+     +++D  
Sbjct  908   VNILCDESSVELQECLT-VNRITDAKGIKLLFQLLTCDWLLETRTALWELEHMNMEDDGF  966

Query  879   KLTTNISLGGFQRDLACLRQLCQHIPSTLARVFVYEATTRIMAGATPVKTQILLDRSLHH  938
                    L  FQ DL  LR + ++IP+  +R+++YEA  R+MAGA+P  TQ LLDRSL  
Sbjct  967   YQVPGEVLEKFQTDLNSLRNIVENIPNAQSRIYLYEAVCRLMAGASPCPTQQLLDRSLRS  1026

Query  939   RNSRSSIICG-KDRSQDQYT-GEREHAVALCLACRHLPPLLLASPGERAGMLAEAAKTLE  996
             RN+ SSI CG KDR Q  +  GERE A A+ +AC++LPP LL+SPGERAGMLAEAAKTLE
Sbjct  1027  RNAHSSIFCGSKDRRQQNFVGGERERASAMYVACKYLPPALLSSPGERAGMLAEAAKTLE  1086

Query  997   RVGDRKRLQECYKLMRQLGPAISA  1020
             +VGD+++L+ECY+LM+ LG  I +
Sbjct  1087  KVGDKRKLKECYQLMKSLGNGIGS  1110


>Q9VW37_DROME unnamed protein product
Length=1113

 Score = 440 bits (1132),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 318/864 (37%), Positives = 454/864 (53%), Gaps = 105/864 (12%)

Query  239   KVQINRLSTNTHIGVPRVKEVKRSAHNAIERRYRTSINDKIIELKNIIVGVDAKLNKSAI  298
             KV INR+        P+VKEVKRSAHNAIERRYRTSINDKI ELKN++VG  AKLNKSA+
Sbjct  270   KVPINRVQ-------PKVKEVKRSAHNAIERRYRTSINDKINELKNLVVGEQAKLNKSAV  322

Query  299   LRKTIDYIRFLQNSNARLKAENMSLK---LAAQRQNLRDLLVCGE---------------  340
             LRK+ID IR LQ  N  LKAE   L+   +A     ++DLL  G                
Sbjct  323   LRKSIDKIRDLQRQNHDLKAELQRLQRELMARDGSKVKDLLQLGTRPGRASKKRRESSQT  382

Query  341   ------LTPPRSDSSESSLSPAPAPLS-PQSP----SSIKDDPDLLQNVDSTSVLTN-QG  388
                   LTPPRSD S+ SLSP  + +S P SP    ++         N +   V ++ +G
Sbjct  383   FTTDAGLTPPRSDESDPSLSPMHSDISLPPSPYGGSTASCSSGSSSSNEEPLVVPSSMRG  442

Query  389   MRDHTRLTICGFMLLFLAFNPLGFLINNVGRFNSDYINTKLDG-RTILNYQDQSDLEN--  445
             M  H+RL +C FM   LA NP    +   G ++S+     + G R IL+Y    D+E   
Sbjct  443   MATHSRLGLCMFMFAILAVNPFKTFLQR-GHYDSNDDLGDMSGQRRILSY----DVEGEG  497

Query  446   -PVW-SNVFLWLTNAILLIGGLCRLLLYGDPILPSDSKIFLELHRWRRQAEFNISKNEYS  503
               VW  + ++WL N  L++G L +LL+YGDP L + +  + + HR R  A+F  S+ + S
Sbjct  498   FAVWQQSSWIWLLNFTLMLGCLVKLLVYGDPQLDAQTDAYCQ-HRQR--ADFYFSQGQSS  554

Query  504   QACRDLHQCLQYLGRPYPSSRAEIWLATMWQIIRQLLHKLWIGKWI-LYTHKWFSEKTTR  562
             QA      CL   G   P+SR E +L T WQ +R L H+LW+G+ +   +   FS   +R
Sbjct  555   QAYAGYLNCLHMFGLSLPASRLECYLQTTWQFLRFLFHRLWLGRVLSRRSGGLFSNAASR  614

Query  563   QQAEISAMEMAIIYQHMLCLHLSEGSKSGTL---YLALSAVNYAEATGETIPKSLLAEIY  619
             +QA  SA E+A+++  +  L L+     G +    +AL A N AE     +       I+
Sbjct  615   KQALASARELALLFNRLNQLQLTGNGSRGDMNGIMMALFASNMAEVAHNLLTPRETICIH  674

Query  620   INVALCFKHS----LFPFIHKYYLGKART---LLSSCAVPPKLKWIMSDEGTKFLAFQKW  672
             +  AL  K S    L     +YY+ +AR    L  +     +L+W  +  G ++ A   +
Sbjct  675   VMTALRMKRSAPKWLQQLFARYYMSRARQECGLTRATEQTQELRWAFTAYGYRYCATHVF  734

Query  673   QY-----GEQPDNEFTSQTSKADPLSYASRAYRDYLIGHCLRILTG------------TV  715
              Y     GEQ D  FT   +  DP ++  + YR++L+   ++ L G              
Sbjct  735   TYDLSDSGEQ-DGFFTRLRNPCDPAAHVIKQYREHLLFKAIQCLVGAGHKSGGLPTSSVS  793

Query  716   GDAHLSSILEYGQTIMASAGIDAGFLCTDKVTVTHCEDEIG---LWWGAVIYVAACWRLK  772
             G+A      ++  TI+++       L   K T+   EDE     +WW  V+  A  W L 
Sbjct  794   GEAEQLQQQQHSGTIVSNVLKYTSLL---KDTLWADEDERDTNVVWWADVLETAVHWLLG  850

Query  773   EDD--SQAWSIVESKFPYEKCYQLCNNNNSISPLPYIVLNAL--------QAAKATTKSV  822
             ED    Q +  ++ + P +   Q C  N+ +    + VL A          A   + K +
Sbjct  851   EDTLAEQLYGRIK-QMPTQ--LQQCGENDHLPKALHAVLRAKMILLKNNGNALDKSLKQL  907

Query  823   SMRFIDQAGILLEQCLVYYNCKQQSSQNVLLTQLWICDWLLEMRTTLWQ----ELDNDLE  878
                  D++ + L++CL   N    +    LL QL  CDWLLE RT LW+     +++D  
Sbjct  908   VNILCDESSVELQECLT-VNRITDAKGIKLLFQLLTCDWLLETRTALWELEHMNMEDDGF  966

Query  879   KLTTNISLGGFQRDLACLRQLCQHIPSTLARVFVYEATTRIMAGATPVKTQILLDRSLHH  938
                    L  FQ DL  LR + ++IP+  +R+++YEA  R+MAGA+P  TQ LLDRSL  
Sbjct  967   YQVPGEVLEKFQTDLNSLRNIVENIPNAQSRIYLYEAVCRLMAGASPCPTQQLLDRSLRS  1026

Query  939   RNSRSSIICG-KDRSQDQYT-GEREHAVALCLACRHLPPLLLASPGERAGMLAEAAKTLE  996
             RN+ SSI CG KDR Q  +  GERE A A+ +AC++LPP LL+SPGERAGMLAEAAKTLE
Sbjct  1027  RNAHSSIFCGSKDRRQQNFVGGERERASAMYVACKYLPPALLSSPGERAGMLAEAAKTLE  1086

Query  997   RVGDRKRLQECYKLMRQLGPAISA  1020
             +VGD+++L+ECY+LM+ LG  I +
Sbjct  1087  KVGDKRKLKECYQLMKSLGNGIGS  1110


>Q9XX00_CAEEL unnamed protein product
Length=1113

 Score = 132 bits (332),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 115/431 (27%), Positives = 198/431 (46%), Gaps = 62/431 (14%)

Query  245  LSTNTHIGVPRVKEVKRSAHNAIERRYRTSINDKIIELKNIIVGVDAKLNKSAILRKTID  304
            +S  T I V R K  +R+AHN IE++YR SIND+I +LK ++ G +AKL+KSA LR+ I+
Sbjct  341  MSQGTTIIVRRPKTERRTAHNLIEKKYRCSINDRIQQLKVLLCGDEAKLSKSATLRRAIE  400

Query  305  YIRFLQNSNARLKAENMSLKLAAQRQNLRDLLVCGELTPPRSDSSESSLSPAPAPLSPQS  364
            +I  +++ N  LK     ++   Q   L                      P P P+    
Sbjct  401  HIEEVEHENQVLKHHVEQMRKTLQNNRL----------------------PYPEPIQYTE  438

Query  365  PSS--------IKDDPDLLQNVDSTSVLTNQGMRD-HTRLTICGFMLLFLAFNPLGFLIN  415
             S+             +  ++  ST+     G RD  +++T+   +L  L FNP+G L  
Sbjct  439  YSARSPVESSPSPPRNERKRSRMSTTTPMKNGTRDGSSKVTLFAMLLAVLIFNPIGLLAG  498

Query  416  NV---GRFNSDYINTKLDGRTILNYQDQSDLENPVWSN-----VFLWLTNAILLIGGLCR  467
            +           I +  +   +++  D +      W        ++W+ N +++I  + +
Sbjct  499  SAIFSKAAAEAPIASPFEHGRVIDDPDGTSTRTLFWEGSIINMSYVWVFNILMIIYVVVK  558

Query  468  LLLYGDPILPSDSKIFLELHRWRRQAEFNISKNEYSQACRDLHQCLQYLGRPYPSSRAEI  527
            LL++GDP+    S  +      R +A   ++      A R   +CL  L R  PS   + 
Sbjct  559  LLIHGDPVQDFMSVSWQTFVTTREKARAELNSGNLKDAQRKFCECLATLDRSLPSPGVDS  618

Query  528  WLATMWQIIRQLLHKLWIGKWILYTHKWFSEKTTRQQAEI--SAMEMAIIYQHMLCLHLS  585
              +  W+ +R LL+ LWIG++I    +     TT+  + +  S  + A++Y  +  LHL 
Sbjct  619  VFSVGWECVRHLLNWLWIGRYIARRRR----STTKPVSVVCRSHAQTAVLYHEIHQLHLM  674

Query  586  ----------EGSKSGTLYLALSAVNYAEATG---ETIPKSLLAEIYINVA----LCFKH  628
                      E S    L+++L AVN AEA G   + +P++++A+IYI+ +    L   +
Sbjct  675  GITGNFEDTYEPSALTGLFMSLCAVNLAEAAGASNDGLPRAVMAQIYISASIQCRLALPN  734

Query  629  SLFPFIHKYYL  639
             L PF   Y+L
Sbjct  735  LLAPFFSGYFL  745



Lambda      K        H
   0.319    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 13016428792


Query= XP_003392938.1 uncharacterized protein LOC100642190 isoform X1
[Bombus terrestris]

Length=467
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VE96_DROME  unnamed protein product                                 125     8e-31
YKA7_CAEEL  unnamed protein product                                   90.5    3e-19
Q7K4D1_DROME  unnamed protein product                                 86.3    1e-17


>Q9VE96_DROME unnamed protein product
Length=600

 Score = 125 bits (315),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 115/380 (30%), Positives = 170/380 (45%), Gaps = 69/380 (18%)

Query  122  LIDF-SPPGSPTFTTRSSSDGVSIDSFGSDGNSNPSAFTSSGNTSQTESAFEDDFDFFVI  180
            LI F SPP SPTFT +S+SD     S  S  + +  +  ++G+ SQ ES FEDD+     
Sbjct  249  LISFDSPPSSPTFTQKSNSD---CVSVDSFSSDSNFSSPNNGSVSQPESGFEDDYH----  301

Query  181  SNKKASQN--DPWK-MNSI----TDPFGPLEITNRNTLQSVKHVGDASFFAFNTNNHTNN  233
             ++ ++Q+  DPW+ ++S+     D FG   +     +QS                 ++N
Sbjct  302  RSRPSTQSPLDPWEAVDSVGLGGVDSFGSAPVRQTYQVQS---------------RGSDN  346

Query  234  QASFNQTSLKSTQS--MPTIIRAKPPKPPAPKVLQTKIQQKINNIEIDSRCSNKIVPSAK  291
                 ++ L  TQS  MPTII+        PK+ Q     K              +PS  
Sbjct  347  PLCNGKSLLPPTQSLTMPTIIK--------PKISQKPKAPKPPPFIGGHLPPGYSIPSGY  398

Query  292  SMT-----LDLSNSWQNDSKDNPSPPMPTIPPPAPPLEYLAEINNDLPVSNEE--PYGIA  344
            + +       +            S  +  +      ++ LA  N       EE  PY +A
Sbjct  399  AGSETPPSPPMPKGPPPPPPPASSGGISLLDVINGKVDALALSNGCQGYMEEEVVPYAVA  458

Query  345  LYDFPLIHADDLPFKQGDIIYLIRKINEDWMEGRV-GNQQGIFPINFIDIKIPLPGVPDN  403
            LYDF  I   DL F++G+ IYL+     +W+ GR     +GIFPIN++DIK+PL      
Sbjct  459  LYDFDGIEPGDLSFREGEKIYLLDHPTPEWLRGRTRSGCEGIFPINYVDIKVPLGATGGA  518

Query  404  ---------------------IVTAIYPFKGETPEDLVFDEGEKITVLSRISQDWLYGEC  442
                                     +Y F GE   DL   E E +TVL RI++DWLYGE 
Sbjct  519  AAAPTASAAAPSPSPSQQQLPTALCLYHFPGEVEGDLALQENELVTVLYRINEDWLYGEV  578

Query  443  KDRKGQFPVNYVNRIPCNLP  462
              R+GQFP N+++++P NLP
Sbjct  579  AGRQGQFPANFLDQVPANLP  598


>YKA7_CAEEL unnamed protein product
Length=493

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 71/133 (53%), Gaps = 17/133 (13%)

Query  340  PYGIALYDFPLIHADDLPFKQGDIIYLIRKINEDWMEGRVGNQQ--GIFPINFIDIKIPL  397
            PYGIA +D+    +D++  + GD + + +K++ +W  G   NQ+  GI P +++DIKIPL
Sbjct  194  PYGIAKFDYAPTQSDEMGLRIGDTVLISKKVDAEWFYGENQNQRTFGIVPSSYLDIKIPL  253

Query  398  ----------PGVPDN-----IVTAIYPFKGETPEDLVFDEGEKITVLSRISQDWLYGEC  442
                      P  P         TAIY +      DL F  G +I V +R++++WL GEC
Sbjct  254  KEAFTALPPRPAAPSGSSSGTYATAIYDYNSNEAGDLNFAVGSQIMVTARVNEEWLEGEC  313

Query  443  KDRKGQFPVNYVN  455
              R G FP  +V+
Sbjct  314  FGRSGIFPSQFVD  326


 Score = 75.9 bits (185),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 61/141 (43%), Gaps = 21/141 (15%)

Query  336  SNEEPYGIALYDFPLIHADDLPFKQGDIIYLIRKINEDWMEGRVGNQQGIFPINFIDI--  393
            S+   Y  A+YD+    A DL F  G  I +  ++NE+W+EG    + GIFP  F+D   
Sbjct  270  SSSGTYATAIYDYNSNEAGDLNFAVGSQIMVTARVNEEWLEGECFGRSGIFPSQFVDCPN  329

Query  394  --KIPLP-----------------GVPDNIVTAIYPFKGETPEDLVFDEGEKITVLSRIS  434
              ++P+                    P   VT  Y +      DL   EG+ IT L  I 
Sbjct  330  LYQVPMKQSAPSSAPSYSHPITNNSGPKQTVTVSYDYDSGVASDLRLFEGDVITALEDID  389

Query  435  QDWLYGECKDRKGQFPVNYVN  455
              WL  EC+ ++G  P  ++ 
Sbjct  390  AQWLLAECRGQQGMVPKTFLG  410


>Q7K4D1_DROME unnamed protein product
Length=838

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 67/118 (57%), Gaps = 6/118 (5%)

Query  340  PYGIALYDFPLIHADDLPFKQGDIIYLIRKINEDWMEGRVGNQQGIFPINFIDIKIPLPG  399
            P+  AL+DF    A DL FK+GD+I +  +I+ +W  G+   Q+G FPIN++ + +PLP 
Sbjct  138  PHAYALFDFASGEATDLKFKKGDLILIKHRIDNNWFVGQANGQEGTFPINYVKVSVPLP-  196

Query  400  VPDNIVTAIYPFK-GETPED--LVFDEGEKITVLSRISQDWLYGECKDRKGQFPVNYV  454
            +P  I  A+Y FK G   E+  L F +   I V+ R+  +W  G      G FP+ +V
Sbjct  197  MPQCI--AMYDFKMGPNDEEGCLEFKKSTVIQVMRRVDHNWAEGRIGQTIGIFPIAFV  252


 Score = 57.0 bits (136),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 48/75 (64%), Gaps = 8/75 (11%)

Query  322  PLEYLAEINNDLPVSNEEPYGIALYDFPLIHADD---LPFKQGDIIYLIRKINEDWMEGR  378
            P+ Y+ +++  LP+    P  IA+YDF +   D+   L FK+  +I ++R+++ +W EGR
Sbjct  185  PINYV-KVSVPLPM----PQCIAMYDFKMGPNDEEGCLEFKKSTVIQVMRRVDHNWAEGR  239

Query  379  VGNQQGIFPINFIDI  393
            +G   GIFPI F+++
Sbjct  240  IGQTIGIFPIAFVEL  254


 Score = 33.9 bits (76),  Expect = 0.34, Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 23/40 (58%), Gaps = 2/40 (5%)

Query  355  DLPFKQGDIIYLIRKINEDWMEGRVG--NQQGIFPINFID  392
            +L    GDIIY+ RK    W +G     ++ G+FP +F++
Sbjct  796  ELELHLGDIIYVQRKQKNGWYKGTHARTHKTGLFPASFVE  835


 Score = 30.8 bits (68),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 14/54 (26%), Positives = 30/54 (56%), Gaps = 2/54 (4%)

Query  340  PYG-IALYDFPLIHADDLPFKQGDIIYLIRKINEDWMEGR-VGNQQGIFPINFI  391
            P+G +AL+ +     D+L  K+G +  +  +  + W +G+   +  G+FP N++
Sbjct  422  PWGYLALFPYKPRQTDELELKKGCVYIVTERCVDGWFKGKNWLDITGVFPGNYL  475



Lambda      K        H
   0.319    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 13016428792


Query= XP_003392942.1 proteasome subunit alpha type-1 [Bombus terrestris]

Length=277
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PSA1_DROME  unnamed protein product                                   335     3e-116
PSA1_DICDI  unnamed protein product                                   311     2e-107
Q9VK14_DROME  unnamed protein product                                 306     7e-105


>PSA1_DROME unnamed protein product
Length=279

 Score = 335 bits (859),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 166/278 (60%), Positives = 215/278 (77%), Gaps = 5/278 (2%)

Query  1    MFRNQYDSDVTVWSPQGRLHQVEYAMEAVKLGSATVGLKNKSHAVLIALKRASSELSAHQ  60
            MFRNQYDSDVTVWSPQGRLHQVEYAMEAVKLG+ATVGLKNK +AVL+AL + +SELS  Q
Sbjct  1    MFRNQYDSDVTVWSPQGRLHQVEYAMEAVKLGTATVGLKNKDYAVLVALCKPTSELSDTQ  60

Query  61   KKIFPIDKHMGISISGLTADARMLSRYMRTECLNYKYSHDDLLPVSRLLASLGNKLQTCT  120
            +KI PID H+GISI+GLTADAR+LSRY+R+ECLNYK+S+D   PVSRL+ +LGNK+QT T
Sbjct  61   RKIIPIDDHLGISIAGLTADARVLSRYLRSECLNYKHSYDTTYPVSRLITNLGNKMQTTT  120

Query  121  QRYDRRPYGVGLLIAGYDDQGPHIYQTCPSSNYFDCKAMAIGARSQSARTYLEKHLNELL  180
            QRYDRRPYGVGLL+AGYD++GPHIYQ  PS+ +F+CKA +IG+RSQSARTYLEK+LN+ L
Sbjct  121  QRYDRRPYGVGLLVAGYDERGPHIYQVTPSATFFNCKANSIGSRSQSARTYLEKNLNKFL  180

Query  181  SCDLDELIKHGLRALRDTLPNE---VDLSVKNVSIAVVGKGTDFKIYDEDAISVYLSQIE  237
                DE+I+HG+RA+  TLP +    D    ++++A+VGK   F I      + +++  +
Sbjct  181  DSSKDEIIRHGIRAILGTLPTDEQGKDAGQYDITVAIVGKDQPFTILSNKDSAKHVAIAK  240

Query  238  DDKRSKPTEPDVEQDSKPPQPPPSDEGPQDPQVTVAMD  275
            ++    P   D +    PP+ P +  GP+DP+V VA +
Sbjct  241  ENDNDTPRNDDDDDRPSPPEEPAA--GPRDPEVLVATE  276


>PSA1_DICDI unnamed protein product
Length=248

 Score = 311 bits (797),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 145/241 (60%), Positives = 186/241 (77%), Gaps = 1/241 (0%)

Query  1    MFRNQYDSDVTVWSPQGRLHQVEYAMEAVKLGSATVGLKNKSHAVLIALKRASSELSAHQ  60
            M+RNQYDSD+T +SP GR+HQ+EYAMEAVK G A V LK+K  AVL++LKR+SSEL ++Q
Sbjct  1    MYRNQYDSDITTFSPSGRIHQIEYAMEAVKQGGAAVALKSKQFAVLVSLKRSSSELGSYQ  60

Query  61   KKIFPIDKHMGISISGLTADARMLSRYMRTECLNYKYSHDDLLPVSRLLASLGNKLQTCT  120
            KKIF +D H+GI+ISGLTADARML  YMR EC NY Y ++  + V RL+  + +K Q  T
Sbjct  61   KKIFVVDDHVGIAISGLTADARMLCNYMRNECSNYNYVYESQMRVERLVTKVADKHQVHT  120

Query  121  QRYDRRPYGVGLLIAGYDDQGPHIYQTCPSSNYFDCKAMAIGARSQSARTYLEKHLNELL  180
            QRY RRPYGVGLL+AGYD  G HIYQTCPS N++D K+++IG+RSQSA+TYLEKH     
Sbjct  121  QRYGRRPYGVGLLVAGYDQLGAHIYQTCPSGNFYDYKSISIGSRSQSAKTYLEKHFESFE  180

Query  181  SCDLDELIKHGLRALRDTLPNEVD-LSVKNVSIAVVGKGTDFKIYDEDAISVYLSQIEDD  239
             C L++LI HGLRALR+T+PN  D L+ KNVSI +VG+G  FKI +E     YL+ +E++
Sbjct  181  ECTLEQLITHGLRALRETIPNTDDTLNSKNVSIGIVGEGQPFKIIEEADAQPYLNLLENE  240

Query  240  K  240
            +
Sbjct  241  E  241


>Q9VK14_DROME unnamed protein product
Length=289

 Score = 306 bits (785),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 149/271 (55%), Positives = 198/271 (73%), Gaps = 11/271 (4%)

Query  1    MFRNQYDSDVTVWSPQGRLHQVEYAMEAVKLGSATVGLKNKSHAVLIALKRASSELSAHQ  60
            MFRNQYD+D T WSPQGRL QVEYAMEAVK G+ATVGLK   +AVL AL R S + +  Q
Sbjct  1    MFRNQYDNDTTTWSPQGRLFQVEYAMEAVKQGAATVGLKGTDYAVLAALCRTSKDTNTLQ  60

Query  61   KKIFPIDKHMGISISGLTADARMLSRYMRTECLNYKYSHDDLLPVSRLLASLGNKLQTCT  120
            +KI P+D H+G+SI+GLTADAR++ +YMRTEC+ Y++S++   PV RL+++LGNKLQT T
Sbjct  61   RKIMPVDDHVGMSIAGLTADARVVCQYMRTECMAYRHSYNAEFPVRRLVSNLGNKLQTTT  120

Query  121  QRYDRRPYGVGLLIAGYDDQGPHIYQTCPSSNYFDCKAMAIGARSQSARTYLEKHLNELL  180
            QRYDRRPYGVGLL+AGYD+QGPHIYQ  P++N  +CKAMAIG+RSQSARTYLE+++    
Sbjct  121  QRYDRRPYGVGLLVAGYDEQGPHIYQVMPTANVLNCKAMAIGSRSQSARTYLERNMESFE  180

Query  181  SCDLDELIKHGLRALRDTLPNEVDLSVKNVSIAVVGKGTDFKIYDEDAISVYLSQIEDDK  240
             CD+DELI H ++A+R +L ++ D+    +++A+VGK   FK++ E     Y+      K
Sbjct  181  DCDMDELICHAIQAIRGSLGSD-DVENLTINVAIVGKDVPFKMFTEAENQKYV------K  233

Query  241  RSKPTEPDVEQDSKPPQPPPSDEGPQDPQVT  271
              K  +P +E D      P S+EG  D  +T
Sbjct  234  LVKAMDPPLEAD----HDPLSEEGMSDDDMT  260



Lambda      K        H
   0.319    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 13016428792


Query= XP_003392943.1 ER membrane protein complex subunit 8/9 homolog
[Bombus terrestris]

Length=207
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

EMC89_DROME  unnamed protein product                                  166     7e-52
Q93568_CAEEL  unnamed protein product                                 72.4    1e-15
Q580G6_TRYB2  unnamed protein product                                 50.1    2e-07


>EMC89_DROME unnamed protein product
Length=203

 Score = 166 bits (420),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 98/215 (46%), Positives = 129/215 (60%), Gaps = 21/215 (10%)

Query  1    MADISFSSRAYCKIILHAAKYPHCAINGLLLGKQNSKSDSKSVELHIEDVIPLFHICLHV  60
            M D   S RAY K+I HAAKYPH A+NGLLL ++ SK      ++ I D IPLFH CL+V
Sbjct  1    MCDYKVSERAYAKLIFHAAKYPHQAVNGLLLAEKTSKGS----QVEIVDAIPLFHQCLYV  56

Query  61   SPMAEIALTMVDQYAIGKGLVLAGYYLANENINDLSTDK-PAHKIADKIAENCGNTLLVV  119
            +PMAE+AL ++D +A  +GLV+AGYY A EN  D   DK PA KIADKI EN  N   VV
Sbjct  57   TPMAEVALMLIDAHAEREGLVIAGYYAAPENFYDNQVDKTPAAKIADKIQENFKNACFVV  116

Query  120  VDNKEITLAMSSNPLRV--------SQFVDGKWKLKDVTDILYDKGVTHTDVLYSLLKAE  171
            VDNK +TL      ++V        +++   K+ L   +D L  +GV+       LLK  
Sbjct  117  VDNKLMTLQHDRAAIQVFNCPGDSGARWSKAKFTLSQASDTL--EGVS------LLLKRG  168

Query  172  EYRNLVDFDNHLDDISLDWQNCKLNKTIEEFMEKY  206
              R+LVDFDNHLD+   +W N  LN+ + +  + Y
Sbjct  169  AMRDLVDFDNHLDNPDKNWTNDFLNQPLNDLQKLY  203


>Q93568_CAEEL unnamed protein product
Length=196

 Score = 72.4 bits (176),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/196 (30%), Positives = 94/196 (48%), Gaps = 16/196 (8%)

Query  11   YCKIILHAAKYPHCAINGLLLGKQNSKSDSKSVELHIEDVIPLFHICLHVSPMAEIALTM  70
            Y  IILH  KYP   + GLL+G  N K D    ++ +   +PL H    ++P  E+A  +
Sbjct  12   YSTIILHCLKYPAKGVFGLLIG--NKKGD----KVTVTSCVPLCHESTPLAPPLELATAL  65

Query  71   VDQYAIGK-GLVLAGYYLANENINDLSTDKPAHKIADKIAE-NCGNTLLVVVDNKEITLA  128
            V     GK G  L G Y +N   +D S +  A ++AD+I+       +LV V N+ +   
Sbjct  66   VH----GKFGASLVGVYFSNATPSDTSLNVYATRLADRISSVTSSAAILVQVMNERLVSD  121

Query  129  MSSNPLRVSQFVDGKWKLKDVTDILYDKGVTHTDVLYSLLKAEEYRNLVDFDNHLDDISL  188
               + L   +     WK    T  ++ +G      L ++++ + YR L DF+NHLD+   
Sbjct  122  CEQDRLVAYEKDGDSWK---ETKTIF-QGSNFLRGLQAVIQKKLYRELSDFENHLDNPEF  177

Query  189  DWQNCKLNKTIEEFME  204
            D+ N  L+  + +  E
Sbjct  178  DFYNTNLSNKLVQVAE  193


>Q580G6_TRYB2 unnamed protein product
Length=272

 Score = 50.1 bits (118),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/161 (24%), Positives = 66/161 (41%), Gaps = 15/161 (9%)

Query  45   LHIEDVIPLFHICLHVSP--MAEIALTMVDQYAIGKGLVLAGYYLANENINDLSTD----  98
            + + D +PLFH  +   P  M  +A   V  YA  KGLVL GYY+ANE   D +      
Sbjct  105  IFVADAVPLFHTIIMTDPHPMMTVAYAQVSSYARTKGLVLLGYYIANERTGDTAVCSLTE  164

Query  99   ---KPAHKIADKIAENCGNTLLVVVDNKEITLAMSSNPLRVSQFVD------GKWKLKDV  149
               +  H     + E     ++       + +  +      S F D      G+W    +
Sbjct  165  NVLRMLHSRKSGVHEPLLWRIVSTPSGDSVDVRGAYYNSGSSSFTDAPSLTFGRWNSDTL  224

Query  150  TDILYDKGVTHTDVLYSLLKAEEYRNLVDFDNHLDDISLDW  190
            +    +      +   + + A +   LVDF++HL+ + L++
Sbjct  225  SCETTEPKAAAVEAFENSMDALKQFQLVDFEDHLESVQLNY  265



Lambda      K        H
   0.319    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 13016428792


Query= XP_003392944.1 cysteine-rich hydrophobic domain-containing protein 2
[Bombus terrestris]

Length=165
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q581Q1_TRYB2  unnamed protein product                                 28.1    3.6  
Q9VHM3_DROME  unnamed protein product                                 27.3    6.6  


>Q581Q1_TRYB2 unnamed protein product
Length=429

 Score = 28.1 bits (61),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 22/82 (27%), Positives = 33/82 (40%), Gaps = 24/82 (29%)

Query  69   MRINSVLKKTLPVNVKWLFCGCVCCCCTLGCSL------WPVICLSKRTQHSLNKLL---  119
            +RI+SV +++           C  C  T G         W V CL ++T   L K+    
Sbjct  208  VRIDSVFQQSE---------ACDVCAVTKGHGFTGVVKRWGVACLPRKTHRGLRKVACIG  258

Query  120  EWENSRLYHTL------GLHWR  135
             W  SR+ +T+      G H R
Sbjct  259  AWHPSRVMYTVARAGQHGYHHR  280


>Q9VHM3_DROME unnamed protein product
Length=418

 Score = 27.3 bits (59),  Expect = 6.6, Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 7/57 (12%)

Query  2    ADFDAIYEEEEENEQNLE-----EQYVKMVPDPIVIRGAGNMTVFGLSNRFDSEFPN  53
            AD+D+I  E+EE +Q LE     E  V  V D  V      + V  L N  D E+ +
Sbjct  167  ADYDSIMAEDEEQQQTLELDEDTELIVGDVNDAYVYDSDDEVAV--LDNVLDDEYEH  221



Lambda      K        H
   0.319    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 13016428792


Query= XP_003392945.1 60S ribosomal protein L21 [Bombus terrestris]

Length=159
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9V9M7_DROME  unnamed protein product                                 256     6e-89
RL21_DICDI  unnamed protein product                                   146     1e-45
Q8ILK3_PLAF7  unnamed protein product                                 131     2e-39


>Q9V9M7_DROME unnamed protein product
Length=159

 Score = 256 bits (654),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 139/159 (87%), Gaps = 0/159 (0%)

Query  1    MTNSKGYRRGTRDLFSRKFRKHGTIPLSTYMKVYKVGDIVDIKGNGAVQKGMPYKVYHGK  60
            MTNSKGYRRGTRD+FSR FRKHG IPLSTYM+V+K+GDIVDIKG+GAVQKG+PYK YHGK
Sbjct  1    MTNSKGYRRGTRDMFSRPFRKHGVIPLSTYMRVFKIGDIVDIKGHGAVQKGLPYKAYHGK  60

Query  61   TGRVFNVTPHALGVIVNKRVRGRIIAKRINVRIEHLTHSKCREDFLQRVKENEKLKELAK  120
            TGR+FNVT HA+GVIVNKRVRG+I+AKR+NVRIEH+ HSKCREDFL+RVKENE+L + AK
Sbjct  61   TGRIFNVTQHAVGVIVNKRVRGKILAKRVNVRIEHIHHSKCREDFLRRVKENERLLKEAK  120

Query  121  EKNIKVKLKRQPAEPRPGHIVSGRENPILLAPIPYEFIA  159
            EK   V LKRQP +P+  H V   E PI LAPIPYEFIA
Sbjct  121  EKGQWVSLKRQPEQPKKAHFVKKLEEPIALAPIPYEFIA  159


>RL21_DICDI unnamed protein product
Length=160

 Score = 146 bits (369),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 106/159 (67%), Gaps = 1/159 (1%)

Query  1    MTNSKGYRRGTRDLFSRKFRKHGTIPLSTYMKVYKVGDIVDIKGNGAVQKGMPYKVYHGK  60
            M +S G R  TR LFSR FR HG +  +T+++ +++GD VDIK  G V KGMP+K YHG+
Sbjct  1    MPHSFGLRARTRYLFSRGFRNHGLLQTTTFLRTFRLGDYVDIKATGNVHKGMPHKFYHGR  60

Query  61   TGRVFNVTPHALGVIVNKRVRGRIIAKRINVRIEHLTHSKCREDFLQRVKENEKLKELAK  120
            TGRV+NVTP A+GVI+NKRV  RIIAK+I+VR EH+  S      L+R++EN+K    AK
Sbjct  61   TGRVWNVTPRAVGVIINKRVGPRIIAKKIHVRTEHVKPSNSMAAHLKRIQENKKAVVEAK  120

Query  121  EKNIKVKLKRQPAEPRPGHIVSGRENPIL-LAPIPYEFI  158
            +    V ++R PA P+ G  V+ R    + + P+ YE +
Sbjct  121  KAGKWVDVRRNPAAPKDGFFVNPRNTEFVEVKPVKYELL  159


>Q8ILK3_PLAF7 unnamed protein product
Length=161

 Score = 131 bits (329),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 100/153 (65%), Gaps = 1/153 (1%)

Query  4    SKGYRRGTRDLFSRKFRKHGTIPLSTYMKVYKVGDIVDIKGNGAVQKGMPYKVYHGKTGR  63
            S+G R GTR  FS+KFRKHG    + Y++    GD VDI  +   QKGMP+  YHGKTG+
Sbjct  5    SRGKRSGTRYKFSKKFRKHGECTANKYLEKLNYGDYVDIVCDSTQQKGMPFNYYHGKTGK  64

Query  64   VFNVTPHALGVIVNKRVRGRIIAKRINVRIEHLTHSKCREDFLQRVKENEKLKELAKEKN  123
            +F++T   +GV+VNKRV+ RI  K++ VRIEH+  S+C EDFL R  +N +L + AK KN
Sbjct  65   IFHITKRGVGVLVNKRVKHRIEQKKVCVRIEHVRKSRCNEDFLLRKIKNAELIKEAKLKN  124

Query  124  IKVKLKRQPAEPRPGHIVSGRENPIL-LAPIPY  155
              + +KR+   P+P  ++    + I+ + P+P+
Sbjct  125  EHINIKRKTEGPKPAAMIKVPPSKIITIEPLPF  157



Lambda      K        H
   0.319    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 13016428792


Query= XP_003392947.1 nucleotide exchange factor SIL1 [Bombus terrestris]

Length=457
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SIL1_DROME  unnamed protein product                                   174     2e-49
FORG_DICDI  unnamed protein product                                   31.6    1.9  
H2KZY3_CAEEL  unnamed protein product                                 30.8    2.7  


>SIL1_DROME unnamed protein product
Length=429

 Score = 174 bits (441),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 122/421 (29%), Positives = 207/421 (49%), Gaps = 52/421 (12%)

Query  5    SNTIILTCLLLLPVVLGDLEKNETTFVPTREWQTVKRGTSIPAGLHVRHNFETGVTEAKL  64
             + +IL CL +      D + N+  FV T EWQT+  G +IP GLHVR N +TG+ EAKL
Sbjct  11   GSVLILGCLQVAAATETDNKTND--FVATDEWQTIAEGQAIPRGLHVRINLQTGLKEAKL  68

Query  65   MDGNDLEEEDSNKNLNSTNTNTNSVILHPENAILEEKDHVPAEKSDLFNYSIEELKDRLK  124
            +D     E +   +L S   + N+   H +N  L              +Y          
Sbjct  69   LD-----ESERGTSLQSQPDDQNARESHDDNEPLA------------LDYK---------  102

Query  125  KMKQEGEDFPEIDIEHSKKIRQKFRDYEALKKEFKAFEINITVSDSDLLSSYIKKFQTYK  184
                     P+I  E  ++++++ + Y  L+K +K F+ N   +D +L+   I +F+ + 
Sbjct  103  ---------PDIIEESIRRVKEQKKSYAELRKAYKEFQKNFR-TDGELIVQLIDQFRNF-  151

Query  185  NRVTMGILTTAETERILDILYNLEYLLHHIDNAKAFADMEGMNKIISP-CLNGTNNEIKI  243
            +R  +     +E    LD L NLEYLLH IDNA  F D  G++ ++ P  +N T+  +++
Sbjct  152  SRTPL----ESEMRSKLDCLENLEYLLHQIDNALMFIDNGGLDDVLLPIVVNDTSTSLRV  207

Query  244  EALRLLGAAVQSNPKVQLKALENDFVQKLLHILSTSSKTDLKSRCLFALGALIRQFPIGQ  303
             A+R+LG+   +NPK Q+K  E +F   L  IL++S      S  L A GAL+R+FP+ Q
Sbjct  208  SAMRVLGSLASNNPKAQIKVFEKNFGSHLAQILTSSGNVGEISAALHAFGALLRKFPLAQ  267

Query  304  KVWVDHGGIEIFGQIL--VDGQLQVQMKVMKLINDLIVERQHIEHIT-DVAQQELRVKAY  360
            +  +   G +   ++L   D +L+ + KV+ LI+DL++E++ +  ++ D  +    +  Y
Sbjct  268  QRVLSTSGTQALIKVLQSPDVELRSKAKVVTLISDLVLEKRSVLDVSKDDPEASSTMAQY  327

Query  361  SAADIERKLLKYSYCDHLSNLMITSFKIDLSDLLRTNYEFLKTISDSMITAAPICIDKWR  420
               D E  L    YC  +  ++   F      LL    E ++  + ++ T   +C   W 
Sbjct  328  VLLDFESWLKTPGYCAAVDTVLTKEFL-----LLLEQPEVVEQFATALETTEDMCTSTWS  382

Query  421  K  421
            +
Sbjct  383  Q  383


>FORG_DICDI unnamed protein product
Length=1074

 Score = 31.6 bits (70),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 31/58 (53%), Gaps = 1/58 (2%)

Query  182  TYKNRVTMGILTTAETERILDILYNLEYLLHHIDNAKAFADMEGMNKIISPCLNGTNN  239
            TY++   +  L  +ET    DI+++L+Y L   + A++F +  GM  I+    NG  N
Sbjct  116  TYRSSKWVKALNDSETNE-KDIMFHLKYKLQENEFAESFIEQNGMEGILRMVTNGKGN  172


>H2KZY3_CAEEL unnamed protein product
Length=510

 Score = 30.8 bits (68),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 5/68 (7%)

Query  50   HVRHNFETGVTEAKLMDGNDLEEEDSNKN---LNSTNTNTNSVILHPENAILEEKDHVPA  106
            H+R        E+K  +   L E D NK    +N+  T+T SVILH EN I  +  H+  
Sbjct  92   HIRITLALPFDESKWAELETLTETDLNKTPIFINNIRTSTVSVILHLENLI--KSFHLNV  149

Query  107  EKSDLFNY  114
            + +++F +
Sbjct  150  KSAEIFPF  157



Lambda      K        H
   0.319    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 13016428792


Query= XP_003392950.1 shootin-1 isoform X2 [Bombus terrestris]

Length=605
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MYSP_CAEEL  unnamed protein product                                   33.5    0.54 


>MYSP_CAEEL unnamed protein product
Length=872

 Score = 33.5 bits (75),  Expect = 0.54, Method: Compositional matrix adjust.
 Identities = 70/265 (26%), Positives = 112/265 (42%), Gaps = 71/265 (27%)

Query  116  KLNRSNSLESKWKSKY--------EESEKRRKLLLQKSEAASKEHADLEKKYQQLQRQNS  167
            KLN +N+  ++WKSK+        EE E  RK +LQK     ++   + +K  QL++  S
Sbjct  287  KLNLANTEITQWKSKFDAEVALHHEEVEDLRKKMLQKQAEYEEQIEIMLQKISQLEKAKS  346

Query  168  TLQSQVQ------EKEQ---------RLQKLRTVSE--------------------AVCK  192
             LQS+V+      EK Q         R Q  R V E                    AV  
Sbjct  347  RLQSEVEVLIVDLEKAQNTIALLERAREQLERQVGELKVRIDEITVELEAAQRELRAVNA  406

Query  193  EYEQLKHQYETETGAMHKAMQQASQWYRQNRELKRRSQIITQKFLQSNPE-GSLDLEIAD  251
            E +++KH YE       KA++Q     R+N++L        +    +N +   LDLE A 
Sbjct  407  ELQKMKHLYE-------KAVEQKEALARENKKLHDELHEAKEALADANRKLHELDLENA-  458

Query  252  EVDSNFEDLDQLRETVKELSKEIARLQTELHSARLQEFEAQEQVTHLTTQLDEERT-LRR  310
                              L+ EI  LQT L  A  Q  +A+ +      +L   R  + R
Sbjct  459  -----------------RLAGEIRELQTALKEADAQRRDAENRAQRALAELQALRIEMER  501

Query  311  KCEEKVNEMKVQKENME-RVTKMVA  334
            + +EK  EM+  ++N++  + +++A
Sbjct  502  RLQEKEEEMEALRKNLQFEIDRLIA  526



Lambda      K        H
   0.319    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 13016428792


Query= XP_003392951.1 protein BCCIP homolog isoform X1 [Bombus terrestris]

Length=301
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TOP2_DROME  unnamed protein product                                   32.7    0.48 
Q387U1_TRYB2  unnamed protein product                                 32.0    0.73 
Q5U117_DROME  unnamed protein product                                 29.3    4.2  


>TOP2_DROME unnamed protein product
Length=1447

 Score = 32.7 bits (73),  Expect = 0.48, Method: Compositional matrix adjust.
 Identities = 16/46 (35%), Positives = 24/46 (52%), Gaps = 0/46 (0%)

Query  155  EDDTEVLGLLINERFVNIPAQISVPLLENLMSDIKKANNKKMSFNF  200
            +D + + GLLIN    N P  + +P LE  ++ I KA  K    +F
Sbjct  524  QDGSHIKGLLINFIHTNWPELLRLPFLEEFITPIVKATKKNEELSF  569


>Q387U1_TRYB2 unnamed protein product
Length=3460

 Score = 32.0 bits (71),  Expect = 0.73, Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 42/90 (47%), Gaps = 2/90 (2%)

Query  114   TVINLSSKQSYPCIQQLRELLTQMTKEHAADTINAMIRKLLEDDTEVLGLLINERFVNIP  173
             T + L+++ S  C   +R ++ Q  ++  +DT   ++    +  T+VLG          P
Sbjct  2326  TALTLAARLS--CNPAVRHIVIQGCQQAGSDTTTVVLSSPSKSSTKVLGWGTLSGGDRSP  2383

Query  174   AQISVPLLENLMSDIKKANNKKMSFNFSYY  203
             A++S P  E L ++++  N      N  YY
Sbjct  2384  ARMSSPCNEGLQNELRIFNCWMSLCNCLYY  2413


>Q5U117_DROME unnamed protein product
Length=639

 Score = 29.3 bits (64),  Expect = 4.2, Method: Compositional matrix adjust.
 Identities = 19/58 (33%), Positives = 28/58 (48%), Gaps = 3/58 (5%)

Query  75   GLADLIIRENYVGSVVKQSADLEGSDDEDTDVNDVFGITT---VINLSSKQSYPCIQQ  129
            GL  L +  +Y G     SA L  S+ + TD+N   G+ T   V++L  +   P  QQ
Sbjct  126  GLYGLNVSTDYEGKGYGWSASLMASEPDSTDINVTLGLQTHRVVVDLLKEVGTPLQQQ  183



Lambda      K        H
   0.319    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 13016428792


Query= XP_003392952.1 protein Skeletor, isoforms B/C [Bombus terrestris]

Length=692
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VH23_DROME  unnamed protein product                                 447     2e-148
SKEL1_DROME  unnamed protein product                                  314     4e-96 
SKEL2_DROME  unnamed protein product                                  316     6e-93 


>Q9VH23_DROME unnamed protein product
Length=689

 Score = 447 bits (1151),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 261/673 (39%), Positives = 380/673 (56%), Gaps = 37/673 (5%)

Query  6    LRLISGLLLFAYTASHFSHANNGPNYYGKLIGSLKNYAHGIKGDVYAVDDTTIFIKGFCY  65
            L +I  + L    AS  +   +GP Y GK +G L +Y H + GDVYAV++ T  I GF Y
Sbjct  17   LLVILTIFLLCPAASAQNEEEDGP-YRGKYLGKLNSYHHQVSGDVYAVNEYTFLIVGFNY  75

Query  66   DGTGPDAYFWVGNSSTPTPQGYIVPYPEIKEGSDPVVLKLYNYTDIILKLPNGKRIRDIK  125
            DG G D +FW G S+ P PQG+IVP     E     +L  Y+  D  L LP+ K+I +IK
Sbjct  76   DGNGADTFFWSGASNRPGPQGFIVP----DEYGKTNILDRYHNKDFTLTLPDRKKITEIK  131

Query  126  WLSVWCRRFTVNFGDVFIPANLKAPKARVLPEFSRLAHGLRSGNITILDCKTIYIPNLHY  185
            WL+V+      NFGDV+IP     P +++   FS+ +H + S ++ ILD KTI I +  Y
Sbjct  132  WLAVYDLSSQNNFGDVYIPEEFDPPMSQLGGTFSKRSHNVSSSSVEILDSKTIRIKDFTY  191

Query  186  DGAGPDAYFWVGNGSEPNTFGIKVPSERQSLAPLSGYQGADIEIVLPANLTVHDIDWLSV  245
            DG G   +FW G G +P++ G K+P ER  L P+  Y    IE+ LP + T+ DIDW+SV
Sbjct  192  DGRGKRTFFWTGVGPQPSSRGSKLPDERGYLDPIRQYNKETIELELPGDKTIFDIDWISV  251

Query  246  WCVQFKHNFGHVMIPKDLDVPPALGQTKIATSSTPPPPDKETPPLSKLELTNCKEIMEGR  305
            + V    N+GHV+    L+VPP+L               K TP   +  L NC+++ +  
Sbjct  252  YDVADNENYGHVLFNDKLNVPPSLV--------------KVTP--FEFSLPNCRQLHKD-  294

Query  306  VQVQWEMIGDDIQIRVSGRINEDQYVAFGLSGREGKPEMIGGDVVVVAYDNRTGKFIAVD  365
            +QV WE+ G  I  ++SG++  + Y++FG+SG +   +MIG DVVV   D+  G    VD
Sbjct  295  MQVSWEVFGPQITFQLSGQVGGNDYMSFGISGSDVSSQMIGSDVVVAYIDDIRG--YTVD  352

Query  366  YYLSDYAQC----DGKKGVCPDERVGGKNDAVLVHGERKNGVTTVTYMRPMSTNEPVKDR  421
            Y ++  A C       KGVC D+ VGG +   L    RK+G+ T+++ R + +++     
Sbjct  353  YNITSLAPCVQVLGQNKGVCRDDVVGGLDSFQLNTYSRKDGINTISFRRTLKSSDDGDKE  412

Query  422  MIPNTETSVIAAIGPLNMRGEANAHHSFDRTNEDIRIDF-TSRNVHECTNSLYNLPDMSD  480
            +  +    VI A GPL+   E   H  + ++  DI IDF T+  V++C  +     + ++
Sbjct  413  IFLDRSNYVIWAFGPLDSNNEPAFHTYYPKS--DIVIDFNTTEPVNDCF-AFTKRAETTN  469

Query  481  IEPWPAAVITNET--TFSARIGPAGGKRGYTRITGQPAWGIAWYINDLLIPEITVERGQT  538
               W    IT+ T  TF+A +GP+GG RGY  +T   + G+AWYIN  +IPE+ ++RG T
Sbjct  470  PPVWERTRITDATVRTFNAYLGPSGGLRGYQGLTNHVSSGLAWYINGYMIPELYLKRGLT  529

Query  539  YTFIVEGGNDPANPARYHPFYITDSPEGGFGQKTETEQRAQRVFAGVKYDTDGYPYPTAA  598
            YTF V GGN+P +P  YHP  ITD P+GG+ + ++ +Q   RV AGV++   G P PTAA
Sbjct  530  YTFKVRGGNNPHSPEHYHPLVITDDPQGGYDRLSDAKQSEIRVLAGVEFTRRGRPKPTAA  589

Query  599  GRYCEWVH-KTVDMSAD--METFENFFETLRLECDKGEPAKLVWTVAEDTPDLVYYQCYT  655
            G  C   + +  D   D    TF+ F  +L  EC +GEPA L  T     PD VYY  +T
Sbjct  590  GPLCLSRYPQNSDRRLDDNFPTFKKFNRSLITECVEGEPALLEITPNITWPDTVYYNSFT  649

Query  656  HNNLGWKINVVNS  668
            H N+GWKI++V+S
Sbjct  650  HGNMGWKIHIVDS  662


>SKEL1_DROME unnamed protein product
Length=784

 Score = 314 bits (804),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 167/423 (39%), Positives = 239/423 (57%), Gaps = 21/423 (5%)

Query  31   YYGKLIGSLKNYAHGIKGDVYAVDDTTIFIKGFCYDGTGPDAYFWVGNSSTPTPQGYIVP  90
            YYG  IG+L    HG+ GDVYAVD  TIFIK F YDG  P AYF+VGN++ P+ +G    
Sbjct  32   YYGTKIGALTRLHHGVSGDVYAVDSRTIFIKKFNYDGEAPAAYFYVGNTARPSNEGAARL  91

Query  91   YPEIKEGSDPVVLKLYNYTDIILKLPNGKRIRDIKWLSVWCRRFTVNFGDVFIPANLKAP  150
              E   G    + + Y   D+ L LP GK +RDIKW SVWC  F VNFGDV IP NL  P
Sbjct  92   RDE--RGGTASLTRRYRNKDVTLSLPEGKTLRDIKWFSVWCDEFAVNFGDVSIPPNLDFP  149

Query  151  KARVLPEFSRLAHGLRSGNITILDCKTIYIPNLHYDGAGPDAYFWVGNGSEPNTFGIKVP  210
            + + +    R  HG+ S NI I+D +T+ +PN  YDG  PDA FWVG G  P + G+++P
Sbjct  150  RPQKISAL-RGVHGVSSDNIVIVDAQTLLVPNFSYDGEAPDAKFWVGRGQRPTSDGLRIP  208

Query  211  SERQSLAPLSGYQGADIEIVLPANLTVHDIDWLSVWCVQFKHNFGHVMIPKDLDVPPALG  270
             E     PL  Y+   I + LP +LT+ DI    VWC  F  +FGHV +P+ L+VPP+L 
Sbjct  209  DENGKENPLRRYERKTIVLTLPEDLTIFDIGHFGVWCEAFTVDFGHVRLPEGLNVPPSLK  268

Query  271  QTKIATSSTPPPPDKETPPLSKLELTNCKEIMEGRV-QVQWEMIGDDIQIRVSGRINEDQ  329
               I+             P SKL   NC+ + +    +V+W + G+ I +++  ++  + 
Sbjct  269  MLGIS-------------PQSKL---NCEVLYDDLAFEVRWAVAGESIVVQLVAKLEPNH  312

Query  330  YVAFGLSGREGKPEMIGGDVVVVAYDNRTGKFIAVDYYLSDYAQCDGKKGVCPDERVGGK  389
            Y++FG+S  +   +MIG D VV   D +TG   A DY+L   AQC G +G CPD ++  K
Sbjct  313  YMSFGISPNKNISQMIGADAVVAWVDPQTGNGFATDYFLEGKAQCSGGRGACPDTKISEK  372

Query  390  NDAV-LVHGERKNGVTTVTYMRPMSTNEPVKDRMIPNTETSVIAAIGPLNMRGEANAHHS  448
             +++ L++    NG + VTY R ++  + +   +      SV+ AIGPLN   E + H  
Sbjct  373  TNSIRLLNAAMVNGYSIVTYQRSLAATDRLDLPISITGAESVVWAIGPLNDYQEVSFHTF  432

Query  449  FDR  451
            +++
Sbjct  433  YNK  435


 Score = 197 bits (502),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 125/201 (62%), Gaps = 8/201 (4%)

Query  469  TNSLYNLPDMSDIEPWPAAVITNETTFSARIGPAGGKRGYTRITGQPAWGIAWYINDLLI  528
            +N  +++P +   EP        +  F A++GP GGK GY  ITG   WGI+WYIN LLI
Sbjct  531  SNGAWDIPAIQCHEP-------EDGVFYAQMGPTGGKHGYPAITGHVGWGISWYINGLLI  583

Query  529  PEITVERGQTYTFIVEGGNDPANPARYHPFYITDSPEGGFGQKTETEQRAQRVFAGVKYD  588
            PEI V RG+TYTF+VEGGN+P  PA+YHPFYI+D P GG+  K E E++A R++AGV   
Sbjct  584  PEIHVVRGKTYTFVVEGGNNPDIPAKYHPFYISDDPVGGYEHKREEEKKAVRIYAGVHRS  643

Query  589  TDGYPYPTAAGRYCEWVHKTVDMSA-DMETFENFFETLRLECDKGEPAKLVWTVAEDTPD  647
              G   PT  GR C W        A D ++F  +  TL L+CD GEP  + W    +TPD
Sbjct  644  RSGQVTPTGVGRLCNWTPDVEGPPADDYQSFGAYQRTLTLKCDAGEPGVITWKPDRNTPD  703

Query  648  LVYYQCYTHNNLGWKINVVNS  668
             VYY C+TH  LGWKI+V +S
Sbjct  704  TVYYHCFTHRYLGWKIHVHDS  724


>SKEL2_DROME unnamed protein product
Length=1503

 Score = 316 bits (809),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 167/423 (39%), Positives = 239/423 (57%), Gaps = 21/423 (5%)

Query  31   YYGKLIGSLKNYAHGIKGDVYAVDDTTIFIKGFCYDGTGPDAYFWVGNSSTPTPQGYIVP  90
            YYG  IG+L    HG+ GDVYAVD  TIFIK F YDG  P AYF+VGN++ P+ +G    
Sbjct  32   YYGTKIGALTRLHHGVSGDVYAVDSRTIFIKKFNYDGEAPAAYFYVGNTARPSNEGAARL  91

Query  91   YPEIKEGSDPVVLKLYNYTDIILKLPNGKRIRDIKWLSVWCRRFTVNFGDVFIPANLKAP  150
              E   G    + + Y   D+ L LP GK +RDIKW SVWC  F VNFGDV IP NL  P
Sbjct  92   RDE--RGGTASLTRRYRNKDVTLSLPEGKTLRDIKWFSVWCDEFAVNFGDVSIPPNLDFP  149

Query  151  KARVLPEFSRLAHGLRSGNITILDCKTIYIPNLHYDGAGPDAYFWVGNGSEPNTFGIKVP  210
            + + +    R  HG+ S NI I+D +T+ +PN  YDG  PDA FWVG G  P + G+++P
Sbjct  150  RPQKISAL-RGVHGVSSDNIVIVDAQTLLVPNFSYDGEAPDAKFWVGRGQRPTSDGLRIP  208

Query  211  SERQSLAPLSGYQGADIEIVLPANLTVHDIDWLSVWCVQFKHNFGHVMIPKDLDVPPALG  270
             E     PL  Y+   I + LP +LT+ DI    VWC  F  +FGHV +P+ L+VPP+L 
Sbjct  209  DENGKENPLRRYERKTIVLTLPEDLTIFDIGHFGVWCEAFTVDFGHVRLPEGLNVPPSLK  268

Query  271  QTKIATSSTPPPPDKETPPLSKLELTNCKEIMEGRV-QVQWEMIGDDIQIRVSGRINEDQ  329
               I+             P SKL   NC+ + +    +V+W + G+ I +++  ++  + 
Sbjct  269  MLGIS-------------PQSKL---NCEVLYDDLAFEVRWAVAGESIVVQLVAKLEPNH  312

Query  330  YVAFGLSGREGKPEMIGGDVVVVAYDNRTGKFIAVDYYLSDYAQCDGKKGVCPDERVGGK  389
            Y++FG+S  +   +MIG D VV   D +TG   A DY+L   AQC G +G CPD ++  K
Sbjct  313  YMSFGISPNKNISQMIGADAVVAWVDPQTGNGFATDYFLEGKAQCSGGRGACPDTKISEK  372

Query  390  NDAV-LVHGERKNGVTTVTYMRPMSTNEPVKDRMIPNTETSVIAAIGPLNMRGEANAHHS  448
             +++ L++    NG + VTY R ++  + +   +      SV+ AIGPLN   E + H  
Sbjct  373  TNSIRLLNAAMVNGYSIVTYQRSLAATDRLDLPISITGAESVVWAIGPLNDYQEVSFHTF  432

Query  449  FDR  451
            +++
Sbjct  433  YNK  435


 Score = 198 bits (504),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 125/201 (62%), Gaps = 8/201 (4%)

Query  469  TNSLYNLPDMSDIEPWPAAVITNETTFSARIGPAGGKRGYTRITGQPAWGIAWYINDLLI  528
            +N  +++P +   EP        +  F A++GP GGK GY  ITG   WGI+WYIN LLI
Sbjct  531  SNGAWDIPAIQCHEP-------EDGVFYAQMGPTGGKHGYPAITGHVGWGISWYINGLLI  583

Query  529  PEITVERGQTYTFIVEGGNDPANPARYHPFYITDSPEGGFGQKTETEQRAQRVFAGVKYD  588
            PEI V RG+TYTF+VEGGN+P  PA+YHPFYI+D P GG+  K E E++A R++AGV   
Sbjct  584  PEIHVVRGKTYTFVVEGGNNPDIPAKYHPFYISDDPVGGYEHKREEEKKAVRIYAGVHRS  643

Query  589  TDGYPYPTAAGRYCEWVHKTVDMSA-DMETFENFFETLRLECDKGEPAKLVWTVAEDTPD  647
              G   PT  GR C W        A D ++F  +  TL L+CD GEP  + W    +TPD
Sbjct  644  RSGQVTPTGVGRLCNWTPDVEGPPADDYQSFGAYQRTLTLKCDAGEPGVITWKPDRNTPD  703

Query  648  LVYYQCYTHNNLGWKINVVNS  668
             VYY C+TH  LGWKI+V +S
Sbjct  704  TVYYHCFTHRYLGWKIHVHDS  724



Lambda      K        H
   0.319    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 13016428792


Query= XP_003392954.1 nuclear pore complex protein Nup107 isoform X1
[Bombus terrestris]

Length=910
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A1YK58_DROME  unnamed protein product                                 517     2e-170
A1YK63_DROME  unnamed protein product                                 517     2e-170
A1YK61_DROME  unnamed protein product                                 516     4e-170


>A1YK58_DROME unnamed protein product
Length=845

 Score = 517 bits (1331),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 307/861 (36%), Positives = 471/861 (55%), Gaps = 66/861 (8%)

Query  83   LLDIDTSLTLAPHEVRDIMAASEKS--EFTLREMMEDSSATGMILKAREPWRDVMSKLFY  140
            LL    + ++AP  +   +   EKS  E   R +MED   TG  L   +   DV+   F+
Sbjct  14   LLRTTLNSSMAPQNLSHSLLILEKSNAEQNERSLMED---TGDDLDRGKSRMDVLFPQFF  70

Query  141  DFLHSLQANFSEAQVFNTIADFIQNCTDT-----LDIMRGMQSKVETTEISEDEISLENE  195
            D L + Q N  EA  F  I    Q C        L+I  GM  +    E       L  E
Sbjct  71   DVLQA-QGNGQEA--FEVIQSLTQVCRGVVEQLELEIDHGMGGEQGARERESMLTWLRQE  127

Query  196  RNTWRLIYCLYQNRI----------NSLNFPTPVENNIYISEKVVIDNLFKTESYIREYQ  245
             NTWRL++ L+ +RI             + PT     +  SEK VI  L+   + +REYQ
Sbjct  128  INTWRLLHALFYDRILLQTDRQADDEMQDGPT-----LGGSEKEVIQQLYALNATLREYQ  182

Query  246  LIIDWLEKNALDQADKYPITEHFTDKTVAWENTVRQLLMYKDKEQIPFRSSRPLVSSLDP  305
            L++DWLE        + P+  H  D+ +AWENT+ QL   ++ +   F     +V+ LDP
Sbjct  183  LVVDWLEACYDRGEQQNPLHAH--DRMMAWENTLFQL---ENLQGAAFGKGHKIVTRLDP  237

Query  306  DAPIREGKPLHDLDREDDARMEKRMFIEVRCGRLQKAQALAQYCGQPWRAACLLGWIPHH  365
            DAP+RE +PLH LD ED+ R+ + +F  +R GR+     L ++ GQ WRAA L GW  H 
Sbjct  238  DAPVREKRPLHALDEEDNLRLSRAIFELIRAGRVYDGLKLCKHFGQTWRAAILEGWRLHE  297

Query  366  DPNYQNPLS--DSKLPIEGNPNRSLWKLCAWELSQERRVGQFYRT---IYASLCGNVQQM  420
            DPN++  +S    KLPIEGNP R +WK CAW L+  +   ++ R    +++   G+++ +
Sbjct  298  DPNFEQNVSVLHEKLPIEGNPRRDIWKRCAWMLADSKNYDEYSRATAGVFSGHLGSLKTL  357

Query  421  LQVASSWQDALWAYMKTLLDIKVEREVRDLVAKSFTDMPDDYWKNEISLKDVFKELHASK  480
            L   S+W D LWA++K  +DI+VE E+R    K++  MPDDYW   ++++ +F+EL+ +K
Sbjct  358  LH--SNWHDLLWAHLKVQIDIRVESEIRGCCLKNYQPMPDDYWNGRMTMEQIFEELNVAK  415

Query  481  NPDIRAQSNKPDHLIQKYLILDQIPKLMEEIEDMICSKSC--DPHFLRFLAHLIYFFRQI  538
            +  +R  +     +IQ++LILD   +L++ +   +   +    PH LRF+AH++ F RQI
Sbjct  416  DASVRDFAQSQLGIIQRHLILDTCGELIQHMVRWVEKDTSQQSPHQLRFMAHIVLFLRQI  475

Query  539  GKNAKDKIGDKVLLAYVRVLIEMDDPILIAFYTAMLPQELQITNYASYLETIKDYEQRKK  598
            G+  +++  +K++ AYV  LI   +P LIA+YTA L   LQ+  Y+ +LE ++    R+ 
Sbjct  476  GRVEQERQAEKIVAAYVEALIARGEPQLIAYYTASLSNPLQVQLYSRFLEQVEQKRPREL  535

Query  599  CLAAAEDANLNVEAITKLVVESIRSKNIDVDPTD--LKGTMTDADVDKINALDWLIFYQS  656
             + AA  A L+VE IT++ V++IR  +  +        G ++  D  KI+AL+WLI    
Sbjct  536  AVDAALQAGLDVEQITRVTVQNIRLAHQPLGEFGEPQSGEISAIDQRKISALEWLIHLPE  595

Query  657  QREEALSQTNALIRYFLTNEKIDAARKAFNKIPVDSIEAIMAEYPTLEGTLTNLTMTNNL  716
            QR E L Q NA+IR +L + K++  R+ F  +P D ++ +++ Y ++          +N+
Sbjct  596  QRGELLWQANAMIRTYLASSKVECMRQTFRMVPADIVQQLVSLYGSV----------DNI  645

Query  717  SKRASSTIREYLCYKTYLDAQEGFAEW--FSHFHHGKPTPLEELPAYATFTEKVAYEHKK  774
              R    ++EYLCYK YL   + F EW         KP       +   FTE++A E K+
Sbjct  646  PPREECCLKEYLCYKAYLSGVDSFVEWNRLQQNRPKKPQTSHAASSQDNFTERMASERKE  705

Query  775  SQYNVEMERWKSTMQHHTKAVKQLLFNVLLFPDGGWLVDSNNNNDESCTPEEAT------  828
              +  E+ RW+  ++   K   +LL+NVL+FPD GWLVD          PE A       
Sbjct  706  QAHRSEVVRWEHKVKEQAKQTIELLYNVLMFPDKGWLVDPFIAK----LPENAVQLNWDH  761

Query  829  REHQMEKLRELCIPKVTLLLHSVMTEMNEHAECIQLADILASEQYQLYKVFQKGRLREVF  888
            R  QMEKLR +CIP++ L L+ VM +  + A C++LAD ++SE  QLYKV+ K +L E+ 
Sbjct  762  RLLQMEKLRSICIPEIALFLNEVMFKSGDFAGCVRLADEISSENRQLYKVYTKHKLAELL  821

Query  889  KKICESSLVLMDQKKDPWGYP  909
             KI ++SL L++ K DPWGYP
Sbjct  822  AKIADASLELLNSKLDPWGYP  842


>A1YK63_DROME unnamed protein product
Length=845

 Score = 517 bits (1331),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 306/861 (36%), Positives = 471/861 (55%), Gaps = 66/861 (8%)

Query  83   LLDIDTSLTLAPHEVRDIMAASEKS--EFTLREMMEDSSATGMILKAREPWRDVMSKLFY  140
            LL    + ++AP  +   +   EKS  E   R +MED   TG  L   +   DV+   F+
Sbjct  14   LLRTTLNSSMAPQNLSHSLLILEKSNAEQNERSLMED---TGDDLDRGKSRMDVLFPQFF  70

Query  141  DFLHSLQANFSEAQVFNTIADFIQNCTDT-----LDIMRGMQSKVETTEISEDEISLENE  195
            D L + Q N  EA  F  I    Q C        L+I  GM  +    +       L  E
Sbjct  71   DVLQA-QGNGQEA--FEVIQSLTQVCRGVVEQLELEIDHGMGGEQGARQRESMLTWLRQE  127

Query  196  RNTWRLIYCLYQNRI----------NSLNFPTPVENNIYISEKVVIDNLFKTESYIREYQ  245
             NTWRL++ L+ +RI             + PT     +  SEK VI  L+   + +REYQ
Sbjct  128  INTWRLLHALFYDRILLQTDRQADDEMQDGPT-----LGGSEKEVIQQLYALNATLREYQ  182

Query  246  LIIDWLEKNALDQADKYPITEHFTDKTVAWENTVRQLLMYKDKEQIPFRSSRPLVSSLDP  305
            L++DWLE        + P+  H  D+ +AWENT+ QL   ++ +   F     +V+ LDP
Sbjct  183  LVVDWLEACYDRGEQQNPLHAH--DRMMAWENTLFQL---ENLQGAAFGKGHKIVTRLDP  237

Query  306  DAPIREGKPLHDLDREDDARMEKRMFIEVRCGRLQKAQALAQYCGQPWRAACLLGWIPHH  365
            DAP+RE +PLH LD ED+ R+ + +F  +R GR+     L ++ GQ WRAA L GW  H 
Sbjct  238  DAPVREKRPLHALDEEDNLRLSRAIFELIRAGRVDDGLKLCKHFGQTWRAAILEGWRLHE  297

Query  366  DPNYQNPLS--DSKLPIEGNPNRSLWKLCAWELSQERRVGQFYRT---IYASLCGNVQQM  420
            DPN++  +S    KLPIEGNP R +WK CAW L+  +   ++ R    +++   G+++ +
Sbjct  298  DPNFEQNVSVLHEKLPIEGNPRRDIWKRCAWMLADSKNYDEYSRATAGVFSGHLGSLKTL  357

Query  421  LQVASSWQDALWAYMKTLLDIKVEREVRDLVAKSFTDMPDDYWKNEISLKDVFKELHASK  480
            L   S+W D LWA++K  +DI+VE E+R    K++  MPDDYW   ++++ +F+EL+ +K
Sbjct  358  LH--SNWHDVLWAHLKVQIDIRVESEIRGCCLKNYQPMPDDYWNGRMTMEQIFEELNVAK  415

Query  481  NPDIRAQSNKPDHLIQKYLILDQIPKLMEEIEDMICSKSC--DPHFLRFLAHLIYFFRQI  538
            +  +R  +     +IQ++LILD   +L++ +   +   +    PH LRF+AH++ F RQI
Sbjct  416  DASVRDFAQSQLGIIQRHLILDTCGELIQHMVRWVEKDTSQQSPHQLRFMAHIVLFLRQI  475

Query  539  GKNAKDKIGDKVLLAYVRVLIEMDDPILIAFYTAMLPQELQITNYASYLETIKDYEQRKK  598
            G+  +++  +K++ AYV  LI   +P LIA+YTA L   LQ+  Y+ +LE ++    R+ 
Sbjct  476  GRVEQERQAEKIVAAYVEALIARGEPQLIAYYTASLSNPLQVQLYSRFLEQVEQKRPREL  535

Query  599  CLAAAEDANLNVEAITKLVVESIRSKNIDVDPTD--LKGTMTDADVDKINALDWLIFYQS  656
             + AA  A L+VE IT++ V++IR  +  +        G ++  D  KI+AL+WLI    
Sbjct  536  AVDAALQAGLDVEQITRVTVQNIRLAHQPLGEFGEPQSGEISAIDQRKISALEWLIHLPE  595

Query  657  QREEALSQTNALIRYFLTNEKIDAARKAFNKIPVDSIEAIMAEYPTLEGTLTNLTMTNNL  716
            QR E L Q NA+IR +L + K++  R+ F  +P D ++ +++ Y ++          +N+
Sbjct  596  QRGELLWQANAMIRTYLASSKVECMRQTFRMVPADIVQQLVSLYGSV----------DNI  645

Query  717  SKRASSTIREYLCYKTYLDAQEGFAEW--FSHFHHGKPTPLEELPAYATFTEKVAYEHKK  774
              R    ++EYLCYK YL   + F EW         KP       +   FTE++A E K+
Sbjct  646  PPREECCLKEYLCYKAYLSGVDSFVEWNRLQQNRPKKPQTSHAASSQDNFTERMASERKE  705

Query  775  SQYNVEMERWKSTMQHHTKAVKQLLFNVLLFPDGGWLVDSNNNNDESCTPEEAT------  828
              +  E+ RW+  ++   K   +LL+NVL+FPD GWLVD          PE A       
Sbjct  706  QAHRSEVVRWEHKVKEQAKQTIELLYNVLMFPDKGWLVDPFIAK----LPENAVQLNWDH  761

Query  829  REHQMEKLRELCIPKVTLLLHSVMTEMNEHAECIQLADILASEQYQLYKVFQKGRLREVF  888
            R  QMEKLR +CIP++ L L+ VM +  + A C++LAD ++SE  QLYKV+ K +L E+ 
Sbjct  762  RLLQMEKLRSICIPEIALFLNEVMFKSGDFAGCVRLADEISSENRQLYKVYTKHKLAELL  821

Query  889  KKICESSLVLMDQKKDPWGYP  909
             KI ++SL L++ K DPWGYP
Sbjct  822  AKIADASLELLNSKLDPWGYP  842


>A1YK61_DROME unnamed protein product
Length=845

 Score = 516 bits (1329),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 306/861 (36%), Positives = 471/861 (55%), Gaps = 66/861 (8%)

Query  83   LLDIDTSLTLAPHEVRDIMAASEKS--EFTLREMMEDSSATGMILKAREPWRDVMSKLFY  140
            LL    + ++AP  +   +   EKS  E   R +MED   TG  L   +   DV+   F+
Sbjct  14   LLRTTLNSSMAPQNLSHSLLILEKSNAEQNERSLMED---TGDDLDRGKSRMDVLFPQFF  70

Query  141  DFLHSLQANFSEAQVFNTIADFIQNCTDT-----LDIMRGMQSKVETTEISEDEISLENE  195
            D L + Q N  EA  F  I    Q C        L+I  GM  +    +       L  E
Sbjct  71   DVLQA-QGNGQEA--FEVIQSLTQVCRGVVEQLELEIDHGMGGEQGARQRESMLTWLRQE  127

Query  196  RNTWRLIYCLYQNRI----------NSLNFPTPVENNIYISEKVVIDNLFKTESYIREYQ  245
             NTWRL++ L+ +RI             + PT     +  SEK VI  L+   + +REYQ
Sbjct  128  INTWRLLHALFYDRILLQTDRQADDEMQDGPT-----LGGSEKEVIQQLYALNATLREYQ  182

Query  246  LIIDWLEKNALDQADKYPITEHFTDKTVAWENTVRQLLMYKDKEQIPFRSSRPLVSSLDP  305
            L++DWLE        + P+  H  D+ +AWENT+ QL   ++ +   F     +V+ LDP
Sbjct  183  LVVDWLEACYDRGEQQNPLHAH--DRMMAWENTLFQL---ENLQGAAFGKGHKIVTRLDP  237

Query  306  DAPIREGKPLHDLDREDDARMEKRMFIEVRCGRLQKAQALAQYCGQPWRAACLLGWIPHH  365
            DAP+RE +PLH LD ED+ R+ + +F  +R GR+     L ++ GQ WRAA L GW  H 
Sbjct  238  DAPVREKRPLHALDEEDNLRLSRAIFELIRAGRVDDGLKLCKHFGQTWRAAILEGWRLHE  297

Query  366  DPNYQNPLS--DSKLPIEGNPNRSLWKLCAWELSQERRVGQFYRT---IYASLCGNVQQM  420
            DPN++  +S    KLPIEGNP R +WK CAW L+  +   ++ R    +++   G+++ +
Sbjct  298  DPNFEQNVSVLHEKLPIEGNPRRDIWKRCAWMLADSKNYDEYSRATAGVFSGHLGSLKTL  357

Query  421  LQVASSWQDALWAYMKTLLDIKVEREVRDLVAKSFTDMPDDYWKNEISLKDVFKELHASK  480
            L   S+W D LWA++K  +DI+VE E+R    K++  MPDDYW   ++++ +F+EL+ +K
Sbjct  358  LH--SNWHDLLWAHLKVQIDIRVESEIRGCCLKNYQPMPDDYWNGRMTMEQIFEELNVAK  415

Query  481  NPDIRAQSNKPDHLIQKYLILDQIPKLMEEIEDMICSKSC--DPHFLRFLAHLIYFFRQI  538
            +  +R  +     +IQ++LILD   +L++ +   +   +    PH LRF+AH++ F RQI
Sbjct  416  DASVRDFAQSQLGIIQRHLILDTCGELIQHMVRWVEKDTSQQSPHQLRFMAHIVLFLRQI  475

Query  539  GKNAKDKIGDKVLLAYVRVLIEMDDPILIAFYTAMLPQELQITNYASYLETIKDYEQRKK  598
            G+  +++  +K++ AYV  LI   +P LIA+YTA L   LQ+  Y+ +LE ++    R+ 
Sbjct  476  GRVEQERQAEKIVAAYVEALIARGEPQLIAYYTASLSNPLQVQLYSRFLEQVEQKRPREL  535

Query  599  CLAAAEDANLNVEAITKLVVESIRSKNIDVDPTD--LKGTMTDADVDKINALDWLIFYQS  656
             + AA  A L+VE IT++ V++IR  +  +        G ++  D  KI+AL+WLI    
Sbjct  536  AVDAALQAGLDVEQITRVTVQNIRLAHQPLGEFGEPQSGEISAIDQRKISALEWLIHLPE  595

Query  657  QREEALSQTNALIRYFLTNEKIDAARKAFNKIPVDSIEAIMAEYPTLEGTLTNLTMTNNL  716
            QR E L Q NA+IR +L + K++  R+ F  +P D ++ +++ Y ++          +N+
Sbjct  596  QRGELLWQANAMIRTYLASSKVECMRQTFRMVPADIVQQLVSLYGSV----------DNI  645

Query  717  SKRASSTIREYLCYKTYLDAQEGFAEW--FSHFHHGKPTPLEELPAYATFTEKVAYEHKK  774
              R    ++EYLCYK YL   + F EW         KP       +   FTE++A E K+
Sbjct  646  PPREECCLKEYLCYKAYLSGVDSFVEWNRLQQNRPKKPQTSHAASSQDNFTERMASERKE  705

Query  775  SQYNVEMERWKSTMQHHTKAVKQLLFNVLLFPDGGWLVDSNNNNDESCTPEEAT------  828
              +  E+ RW+  ++   K   +LL+NVL+FPD GWLVD          PE A       
Sbjct  706  QAHRSEVVRWEHKVKEQAKQTIELLYNVLMFPDKGWLVDPFIAK----LPENAVQLNWDH  761

Query  829  REHQMEKLRELCIPKVTLLLHSVMTEMNEHAECIQLADILASEQYQLYKVFQKGRLREVF  888
            R  QMEKLR +CIP++ L L+ VM +  + A C++LAD ++SE  QLYKV+ K +L E+ 
Sbjct  762  RLLQMEKLRSICIPEIALFLNEVMFKSGDFAGCVRLADEISSENRQLYKVYTKHKLAELL  821

Query  889  KKICESSLVLMDQKKDPWGYP  909
             KI ++SL L++ K DPWGYP
Sbjct  822  AKIADASLELLNSKLDPWGYP  842



Lambda      K        H
   0.319    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 13016428792


Query= XP_003392955.1 mitochondrial-processing peptidase subunit beta
[Bombus terrestris]

Length=477
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VFF0_DROME  unnamed protein product                                 716     0.0   
Q23295_CAEEL  unnamed protein product                                 433     3e-149
MPPB_DICDI  unnamed protein product                                   409     2e-139


>Q9VFF0_DROME unnamed protein product
Length=470

 Score = 716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/477 (71%), Positives = 397/477 (83%), Gaps = 7/477 (1%)

Query  1    MATRLLKVSSALRAYSNKTSLVKVPKQWQSTSASLKEILVNQPPTHVTTLDCGMRIATED  60
            MA R+L V+  +R++     ++K  K    ++A+L++ L+N P T VT LD G+R+A+ED
Sbjct  1    MALRVLGVTQNMRSFMRGVDMIKRYK----SAATLQKTLLNIPATQVTKLDNGLRVASED  56

Query  61   SGAPTATVGLWIDAGSRFETDEINGVAHFMEHMAFKGTTKRSQTDLELEIENMGAHLNAY  120
            SGA TATVGLWIDAGSR E ++ NGVAHF+EHMAFKGT KRSQTDLELE+EN+GAHLNAY
Sbjct  57   SGASTATVGLWIDAGSRSENEKNNGVAHFLEHMAFKGTAKRSQTDLELEVENLGAHLNAY  116

Query  121  TSREQTVFYAKCLAEDVPKAVEILSDIIQNSKLGESEIERERSVILREMQEVETNLQEVV  180
            TSREQTVFYAKCL++DVPKAVEIL+DIIQNSKLGE+EI RERSVILREMQEVE+NLQEVV
Sbjct  117  TSREQTVFYAKCLSKDVPKAVEILADIIQNSKLGEAEIARERSVILREMQEVESNLQEVV  176

Query  181  FDHLHASAYQGTPLGRTILGPTKNIKSITRNDLVNYVKQYYGPPRFILAGAGGVNHNQLV  240
            FDHLHA+AYQGTPLG+TILGPTKNI+SI + DL +Y++ +Y   R +LA AGGV H+ LV
Sbjct  177  FDHLHATAYQGTPLGQTILGPTKNIQSIGKADLTDYIQTHYKASRIVLAAAGGVKHDDLV  236

Query  241  DLAQKHFGQMKGPFYDEIPPLLEPCRYTGSEIRVRDDSIPLAHVAIAVEGAGWTDPDNIP  300
             LA    G ++      +P  + PCR+TGSE+RVRDDS+PLAHVAIAVEG GWTD DNIP
Sbjct  237  KLACSSLGGLEASV---LPAEVTPCRFTGSEVRVRDDSLPLAHVAIAVEGCGWTDQDNIP  293

Query  301  LMVANTLMGAWDRSQGGGVNNISFLAEASATDGLCHSYQSFNTCYQDTGLWGVYFVSDPM  360
            LMVANTL+GAWDRSQGGG NN S LA ASA D LCHS+QSFNTCY+DTGLWG+YFV DP+
Sbjct  294  LMVANTLVGAWDRSQGGGANNASNLARASAEDNLCHSFQSFNTCYKDTGLWGIYFVCDPL  353

Query  361  EIEWFVHNVQREWMRLCTSVTEKEVERAKNILKTNMLLQLDGTTAICEDIGRQMLCYNRR  420
            + E  + NVQ EWMRLCT VTE EVERAKN+LKTNMLLQLDGTT ICEDIGRQ+LCYNRR
Sbjct  354  QCEDMLFNVQTEWMRLCTMVTEAEVERAKNLLKTNMLLQLDGTTPICEDIGRQILCYNRR  413

Query  421  IPLHELEARINSITASNIHDIGMKYIYDQCPVIAAVGPVENLQDYNVIRSGMYRLRV  477
            IPLHELE RI++++  N+ D+ MKYIYD+CP +AAVGPVENL DYN IRS MY LRV
Sbjct  414  IPLHELEQRIDAVSVGNVRDVAMKYIYDRCPAVAAVGPVENLPDYNRIRSSMYWLRV  470


>Q23295_CAEEL unnamed protein product
Length=458

 Score = 433 bits (1114),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 211/418 (50%), Positives = 286/418 (68%), Gaps = 3/418 (1%)

Query  43   PPTHVTTLDCGMRIATEDSGAPTATVGLWIDAGSRFETDEINGVAHFMEHMAFKGTTKRS  102
            P T VTTL  G R+ATE++G  TAT+G++IDAGSR+E ++ NG AHF+EHMAFKGT +R+
Sbjct  28   PETIVTTLPNGFRVATENTGGSTATIGVFIDAGSRYENEKNNGTAHFLEHMAFKGTPRRT  87

Query  103  QTDLELEIENMGAHLNAYTSREQTVFYAKCLAEDVPKAVEILSDIIQNSKLGESEIERER  162
            +  LELE+EN+GAHLNAYTSRE T +YAKC  E + ++V+ILSDI+ NS L   +IE ER
Sbjct  88   RMGLELEVENIGAHLNAYTSRESTTYYAKCFTEKLDQSVDILSDILLNSSLATKDIEAER  147

Query  163  SVILREMQEVETNLQEVVFDHLHASAYQGTPLGRTILGPTKNIKSITRNDLVNYVKQYYG  222
             VI+REM+EV  N QEVVFD LHA  ++G PL  TILGP + I++I +NDL  Y+  +Y 
Sbjct  148  GVIIREMEEVAQNFQEVVFDILHADVFKGNPLSYTILGPIELIQTINKNDLQGYINTHYR  207

Query  223  PPRFILAGAGGVNHNQLVDLAQKHFGQMKGPFYDEIPPLLEPCRYTGSEIRVRDDSIPLA  282
              R +LA AGGVNH+ +V +A+K+FG++K   + +      P  Y+  E+R     +P+ 
Sbjct  208  SGRMVLAAAGGVNHDAIVKMAEKYFGELK---HGDSSTEFVPATYSPCEVRGDIPDLPML  264

Query  283  HVAIAVEGAGWTDPDNIPLMVANTLMGAWDRSQGGGVNNISFLAEASATDGLCHSYQSFN  342
            + A+ VEG  WT  DN+ LMVANTLMG +DR +G GVN  + LAE  + D     +QSFN
Sbjct  265  YGAMVVEGVSWTHEDNLALMVANTLMGEYDRMRGFGVNAPTRLAEKLSQDAGIEVFQSFN  324

Query  343  TCYQDTGLWGVYFVSDPMEIEWFVHNVQREWMRLCTSVTEKEVERAKNILKTNMLLQLDG  402
            TCY++TGL G YFV+ P  I+  + +V ++W+ L  ++ E  V+RAK  L TN+LL LDG
Sbjct  325  TCYKETGLVGTYFVAAPESIDNLIDSVLQQWVWLANNIDEAAVDRAKRSLHTNLLLMLDG  384

Query  403  TTAICEDIGRQMLCYNRRIPLHELEARINSITASNIHDIGMKYIYDQCPVIAAVGPVE  460
            +T +CEDIGRQ+LCY RRIP  EL ARI SIT   + D+  +   +     A VG  +
Sbjct  385  STPVCEDIGRQLLCYGRRIPTPELHARIESITVQQLRDVCRRVFLEGQVSAAVVGKTQ  442


>MPPB_DICDI unnamed protein product
Length=469

 Score = 409 bits (1050),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 201/437 (46%), Positives = 275/437 (63%), Gaps = 2/437 (0%)

Query  43   PPTHVTTLDCGMRIATEDSGAPTATVGLWIDAGSRFETDEINGVAHFMEHMAFKGTTKR-  101
            P T +TTL  G+R+ATE +    A+VG+W+D+GS +ETD+ NGVAHF+EHM FKGT KR 
Sbjct  33   PETKITTLSNGIRVATEQTYGEVASVGVWVDSGSVYETDKNNGVAHFLEHMIFKGTAKRP  92

Query  102  SQTDLELEIENMGAHLNAYTSREQTVFYAKCLAEDVPKAVEILSDIIQNSKLGESEIERE  161
            +   +E EIENMG  LNA+TSRE + +Y K L ++VP AV+ILSDI+QNSK   S IE+E
Sbjct  93   TPQSIETEIENMGGSLNAFTSREHSAYYMKVLKDNVPNAVDILSDILQNSKFETSLIEQE  152

Query  162  RSVILREMQEVETNLQEVVFDHLHASAYQGTPLGRTILGPTKNIKSITRNDLVNYVKQYY  221
            R  IL E   +++   EVVFD LHA+A+QG+ LGRTILGP +NIKSITR  +  ++ + Y
Sbjct  153  RDTILSENDYIQSKEDEVVFDQLHAAAFQGSALGRTILGPVENIKSITREQIQEFINENY  212

Query  222  GPPRFILAGAGGVNHNQLVDLAQKHFGQMK-GPFYDEIPPLLEPCRYTGSEIRVRDDSIP  280
               R +++ AG VNH QLV+  ++ F  +K      ++        + GSE+RVRDD  P
Sbjct  213  TGDRLVISAAGAVNHEQLVEQVKEKFANVKMSQVSKDVKRAAITNDFIGSELRVRDDEQP  272

Query  281  LAHVAIAVEGAGWTDPDNIPLMVANTLMGAWDRSQGGGVNNISFLAEASATDGLCHSYQS  340
            L H A+AV    WTDPD   L +  T++G W+R    G N  S L E  AT+ L  SY +
Sbjct  273  LIHFAVAVRALPWTDPDYFVLELIQTMIGNWNRGIAAGKNIASNLGEIVATEDLAESYST  332

Query  341  FNTCYQDTGLWGVYFVSDPMEIEWFVHNVQREWMRLCTSVTEKEVERAKNILKTNMLLQL  400
            F TCYQDTGL+G Y V  P  ++  V  + +EW R+ TS  + EVER K  L    L+Q 
Sbjct  333  FFTCYQDTGLFGNYGVCQPERVDDLVAEMLKEWQRIATSCNKNEVERNKQKLLATTLMQY  392

Query  401  DGTTAICEDIGRQMLCYNRRIPLHELEARINSITASNIHDIGMKYIYDQCPVIAAVGPVE  460
            DGT+ +CE IGRQ+L   RR+   E+  RIN IT +++  +    + D  P + A+GP+ 
Sbjct  393  DGTSKVCEGIGRQILTLGRRLSPFEVYTRINEITVADVQRVASTLLRDVSPAVTAIGPIA  452

Query  461  NLQDYNVIRSGMYRLRV  477
            N  DYN ++   Y  R+
Sbjct  453  NYPDYNFVKGWTYWNRL  469



Lambda      K        H
   0.319    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 13016428792


Query= XP_003392957.1 LETM1 and EF-hand domain-containing protein
anon-60Da, mitochondrial [Bombus terrestris]

Length=774
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

LETM1_DROME  unnamed protein product                                  514     5e-169
C9ZLK0_TRYB9  unnamed protein product                                 52.4    7e-07 


>LETM1_DROME unnamed protein product
Length=1013

 Score = 514 bits (1323),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 284/600 (47%), Positives = 419/600 (70%), Gaps = 42/600 (7%)

Query  111  IVQSSSKSVEKVEKLTVWQKVKGEIIHYYHGFRLLGLDMKISAKLIWRILKGKELSRREH  170
            + +++ KSV K +K  +  ++  E++HYYHGFRLL +D+ I +KL+WR+L GK L+RRE+
Sbjct  166  LAKTADKSVAKPKK-PLRTRIWDELVHYYHGFRLLFIDVAICSKLLWRVLNGKTLTRREN  224

Query  171  RLLIKTTGDVFRLIPFSVFIIVPFMEFLLPIVIKFFPGLLPSTFQTATEKEDKLKQALKM  230
            + L +TT D+FRLIPFSVFIIVPFME LLP+ IKFFPG+LPSTFQT+T++++KL+Q+L +
Sbjct  225  KQLQRTTSDLFRLIPFSVFIIVPFMELLLPLFIKFFPGMLPSTFQTSTDRQEKLRQSLSV  284

Query  231  KIEVAKFLQKTLDDMAVQSPGYKSKRAKEFAEFFYKVRSSGAVASNDEIMQFSKLFEDEI  290
            ++EVAKFLQ+TLD M VQ   + S+ AK+F  FF K+R+     SNDEI++F+K F+DEI
Sbjct  285  RLEVAKFLQQTLDQMPVQHKEHSSEEAKQFEAFFTKIRNPTEPVSNDEIIKFAKRFDDEI  344

Query  291  TLDSLTRPQLVALCRVLDVQTLGTSNFLRFLLRMRLRSLTADDKLIEKEGIDSLTRTELQ  350
            TLDSL+R QL ALCRVL++ T+GT+  LRF LR++LRSL  DD++I +EG+DSL   ELQ
Sbjct  345  TLDSLSREQLAALCRVLELNTIGTTTLLRFQLRLKLRSLATDDRVIAREGVDSLDLLELQ  404

Query  351  QACRARGMRAYGLPDSKLKEQLSQWLDLSLNKKVPPSLLLLSRALMVPETIPMSDKLKAT  410
            QAC+ARGMRAYGL + +L+ QL +W+DLSLN++VPP+LLLLSR +++ +    +DKLK T
Sbjct  405  QACKARGMRAYGLTEERLRFQLKEWIDLSLNEQVPPTLLLLSRTMLISDDSITTDKLKET  464

Query  411  ISALPDTVVARTQGAIGEKEGKMDHKTNIEIIKMEERKIEEER--------------QEK  456
            I  LPD V A T+ AIGE EGK+D+KT IEIIK EERKI EER              +E+
Sbjct  465  IRVLPDAVGAHTRHAIGESEGKVDNKTKIEIIKEEERKIREEREEEREETIAKRSAIKEE  524

Query  457  EPQTTTVA--------FQNHK-------TDE-ITNSDVKVIEQALDSLGKDKKMSVEKEE  500
             P     A          +HK       TD+ I+++DV+++ +AL +L  DK++ VEKE 
Sbjct  525  IPAPYVFAEKLSGSQDLLDHKEQSSVSETDKGISSTDVQLLSEALKTLSSDKQLVVEKET  584

Query  501  LKELKEEMAEYQEDIKELYEIKAAAKGQEDIENIKVSKGATRLFKKVNKMINKMDAVLTQ  560
            +KELKEE+A+Y+ED++EL E++   K     E ++ S+ A  L+ +VNKMI+++D VL  
Sbjct  585  IKELKEELADYKEDVEELREVRQVVK-----EPVRESRAAKLLYNRVNKMISQLDNVLND  639

Query  561  LES-EKQMKELQKNTVGEEEVTVSQTAEELVKIDELISVIKKIQNVPDQHRLQRIAEILA  619
            LE+ + Q+K+ + +       TV    +++V IDEL++ I++++   D+ R + + ++L 
Sbjct  640  LEARQHQIKQAESSDYAASSPTVE--PQQMVHIDELVATIRRMKEASDEERFKVVGDLLV  697

Query  620  KIDDDRDGSIKIEDVLKVVELIGKEDIKLSKKQVDELLELIDKEEILEEKGQTEKVVQKD  679
            K+D D+DG I + ++ K V+ I +E   + KKQ++E  EL+ K   L  + + E++V  D
Sbjct  698  KLDADKDGVISVNEITKAVQSIDREATNIDKKQLEEFTELLSK---LASRRRHEEIVHID  754


 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 67/96 (70%), Gaps = 0/96 (0%)

Query  587  EELVKIDELISVIKKIQNVPDQHRLQRIAEILAKIDDDRDGSIKIEDVLKVVELIGKEDI  646
            EE+V ID+L++ IK ++   D+ RL+ I  +L K D D+DG + + D+ KV+E IG+++I
Sbjct  748  EEIVHIDDLMNNIKVLKETSDEARLKHIEAVLEKFDADKDGVVTVNDIRKVLESIGRDNI  807

Query  647  KLSKKQVDELLELIDKEEILEEKGQTEKVVQKDASE  682
            KLS K ++EL+ L+DKE++L+ + + EK + K   E
Sbjct  808  KLSDKAIEELISLLDKEQVLQAEQKIEKAIAKSMKE  843


>C9ZLK0_TRYB9 unnamed protein product
Length=377

 Score = 52.4 bits (124),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 58/220 (26%), Positives = 90/220 (41%), Gaps = 25/220 (11%)

Query  205  FFPGLLPSTFQTATEKEDKLKQALKMKIEVAKFLQKTLDDMAVQSPGYKSKRAKEFAEFF  264
             FP L+PSTF++  +  +K    L   +   + L + L   A  S    +K  +E   F 
Sbjct  1    MFPDLIPSTFESENQGRNKAFTTLMGTVRARRRLAEYLSSTAFVS---FTKEQQEVVRF-  56

Query  265  YKVRSSGAVASNDEIMQFSKLFEDEITLDSLTRPQ--LVALCRVLDVQTLGTSNFLR---  319
                + G   + ++I   +  F  E   +    P    VAL R + V       FL    
Sbjct  57   ---SAMGEAVTANQIRLIAPHFGREGPFNVYQIPNGIAVALARTVGVYKAYHGLFLTKMA  113

Query  320  -FLLRMRLRSLTA---DDKLIEKEGIDSLTRTELQQACRARGMRAYGLPDSKLKEQLSQW  375
             ++ R  LR       DD+++  EG+D LT  EL +A   RGMR +      L+ QL  W
Sbjct  114  PYMRRKILRQYHKTREDDRMLRLEGLDDLTDEELIKANLVRGMR-WTEDAETLRIQLEWW  172

Query  376  LDLSLNKKVPPSLLLLSRALMVPETIPMSDKLKATISALP  415
            + L  +  VP + L   +        P    LK ++  LP
Sbjct  173  ISLGRDPDVPYNTLFWVK--------PTRYSLKESMKRLP  204



Lambda      K        H
   0.319    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 13016428792


Query= XP_003392959.1 hrp65 protein isoform X1 [Bombus terrestris]

Length=508
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

HRP65_CHITE  unnamed protein product                                  419     5e-142
NONA_DROME  unnamed protein product                                   385     1e-126
B3GWA1_CAEEL  unnamed protein product                                 229     2e-68 


>HRP65_CHITE unnamed protein product
Length=535

 Score = 419 bits (1077),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 196/338 (58%), Positives = 276/338 (82%), Gaps = 1/338 (0%)

Query  67   IMERIMSISGPTHDLPPQETIEKKFSGRNRLYIGNLTNDVTEEEIQQMFQQYGETSELFL  126
            +  ++ +++GPTHDLP     E KFSGRNRLYIGNLT+DVTEEE++++F  YGE SE F+
Sbjct  85   VNSKLKNLAGPTHDLPELVCEEIKFSGRNRLYIGNLTSDVTEEELKELFSPYGEISEAFI  144

Query  127  NKEKNFSFVKMDYRVNAEKAKHELDRKMVKGRALKVRFAPLDSTIKVKNLTPWISNELLE  186
            N EKNF+F+K+DYR NAE+AK +LD +M K + +++RFAP  +TI+VKNLTP++SNELL 
Sbjct  145  NAEKNFAFLKIDYRANAERAKKDLDGRMRKNKPIRIRFAPNATTIRVKNLTPFVSNELLF  204

Query  187  KAFSVFGEIERAIVIVDKKGKSSGEGIIEFCKKNSAQLALRKCTEGCYRLTASPLPVIVE  246
            K+F VFG++ERA++IVD +GK++GEGI+EF +K+ A  AL+ C+E CY LT+S  P +VE
Sbjct  205  KSFEVFGQVERAVIIVDDRGKTTGEGIVEFARKSGAMSALKYCSEKCYFLTSSLRPCVVE  264

Query  247  LFEQQDDIDGYPDKSLPR-TTEFFKAREIGPRFAEVGSFEYEYGTRWKQLYELRKQKIEA  305
             F+  D+ DG+P+KSL R + +++KAR+ GPRFAE+GSFE+E+GT+WKQ+Y++ KQK +A
Sbjct  265  TFDHIDETDGFPEKSLMRKSNDYYKARQNGPRFAEMGSFEHEFGTKWKQMYDMYKQKHDA  324

Query  306  IEREMAIEEEKLEAQMEFERCEFETKRLREELRMREADRERQKREWEMKERQAEEQRTRE  365
            ++REM +EEEKLEAQME+ + E ET+ LRE+LR RE DR+RQK+EWE +ERQA+E R R+
Sbjct  325  LKREMQLEEEKLEAQMEYAKFEHETESLREQLRKREQDRDRQKKEWEDRERQADESRIRD  384

Query  366  EELRRRQQEEMAMAIRRQEEELHRRQQENNLFLQGQAM  403
            E+  RRQQ++M M ++RQ+EE+ RRQQEN+LF+Q Q +
Sbjct  385  EQQMRRQQDDMQMRMQRQDEEMRRRQQENSLFMQAQQL  422


>NONA_DROME unnamed protein product
Length=700

 Score = 385 bits (989),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 193/339 (57%), Positives = 251/339 (74%), Gaps = 3/339 (1%)

Query  67   IMERIMSISGPTHDLPPQET-IEKKFSGRNRLYIGNLTNDVTEEEIQQMFQQYGETSELF  125
            I +R+ SISGPT +L P E   E KFSGRNRLY+GNLTND+T++E+++MF+ YGE SE+F
Sbjct  273  ITQRLRSISGPTFELEPVEVPTETKFSGRNRLYVGNLTNDITDDELREMFKPYGEISEIF  332

Query  126  LNKEKNFSFVKMDYRVNAEKAKHELDRKMVKGRALKVRFAPLDSTIKVKNLTPWISNELL  185
             N +KNF+F+K+DY  NAEKAK  LD  M KGR L+VRFAP  + ++V NLTP++SNELL
Sbjct  333  SNLDKNFTFLKVDYHPNAEKAKRALDGSMRKGRQLRVRFAPNATILRVSNLTPFVSNELL  392

Query  186  EKAFSVFGEIERAIVIVDKKGKSSGEGIIEFCKKNSAQLALRKCTEGCYRLTASPLPVIV  245
             K+F +FG IERA + VD +GK  GEGI+EF KK+SA   LR C E C+ LTAS  P +V
Sbjct  393  YKSFEIFGPIERASITVDDRGKHMGEGIVEFAKKSSASACLRMCNEKCFFLTASLRPCLV  452

Query  246  ELFEQQDDIDGYPDKSL-PRTTEFFKAREIGPRFAEVGSFEYEYGTRWKQLYELRKQKIE  304
            +  E  DD DG P+K+   +  +F + R IGPRFA+  SFE+EYG+RWKQL+ L K K +
Sbjct  453  DPMEVNDDTDGLPEKAFNKKMPDFNQERSIGPRFADPNSFEHEYGSRWKQLHNLFKTKQD  512

Query  305  AIEREMAIEEEKLEAQMEFERCEFETKRLREELRMREADRERQKREWEMKERQAEEQRTR  364
            A++RE+ +EE+KLEAQME+ R E ET+ LR+ELR RE D ER+K EWEM+E+QAEE R R
Sbjct  513  ALKRELKMEEDKLEAQMEYARYEQETELLRQELRKREVDNERKKLEWEMREKQAEEMRKR  572

Query  365  EEELRRRQQEEMAMAIRRQEEELHRRQQENNLFLQGQAM  403
            EEE  RR Q EM   + RQEE++ RRQQE  LF++ Q +
Sbjct  573  EEETMRRHQTEMQSHMNRQEEDMLRRQQE-TLFMKAQQL  610


>B3GWA1_CAEEL unnamed protein product
Length=562

 Score = 229 bits (585),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/262 (42%), Positives = 178/262 (68%), Gaps = 1/262 (0%)

Query  85   ETIEKKFSGRNRLYIGNLTNDVTEEEIQQMFQQYGETSELFLNKEKNFSFVKMDYRVNAE  144
            E  +KKF+GR RL++GNL N+V E E++++F  +G+ +E +L+  K F+F+++D R +AE
Sbjct  106  EVPKKKFTGRCRLFVGNLPNEVKETELKELFSPHGDIAECYLSG-KGFAFLRLDTRAHAE  164

Query  145  KAKHELDRKMVKGRALKVRFAPLDSTIKVKNLTPWISNELLEKAFSVFGEIERAIVIVDK  204
             AK  +D +++ GR ++VRFA   + I+VK L+P +SNE+L  AFS FG++ERA+ IVD+
Sbjct  165  SAKEAIDGRIIHGRQVRVRFAVHGAAIRVKELSPTVSNEMLYHAFSHFGDVERAVHIVDE  224

Query  205  KGKSSGEGIIEFCKKNSAQLALRKCTEGCYRLTASPLPVIVELFEQQDDIDGYPDKSLPR  264
            KG+ +GEGI+EF +K +   A+    +  + LTASP P+I E+ E +D+ DG  ++ +PR
Sbjct  225  KGRPTGEGIVEFERKPNCNEAMAAIRDKVFLLTASPKPLICEVLEPRDEDDGLAERMIPR  284

Query  265  TTEFFKAREIGPRFAEVGSFEYEYGTRWKQLYELRKQKIEAIEREMAIEEEKLEAQMEFE  324
            T    K RE+GPRF    SFEY YG +WK+LY + +++   ++ E+     +LE+ ME  
Sbjct  285  TPGLSKERELGPRFPTPNSFEYVYGMKWKELYVVEQKRRAQLDEELRESRRRLESDMELA  344

Query  325  RCEFETKRLREELRMREADRER  346
              +++ + LRE+L+ R+ + ER
Sbjct  345  YQDYQAQMLREDLQRRQQELER  366



Lambda      K        H
   0.319    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 13016428792


Query= XP_003392960.1 putative tyramine receptor 2 isoform X2 [Bombus
terrestris]

Length=402
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SER2_CAEEL  unnamed protein product                                   323     6e-107
G5EF04_CAEEL  unnamed protein product                                 318     7e-106
H2FLI4_CAEEL  unnamed protein product                                 318     1e-105


>SER2_CAEEL unnamed protein product
Length=455

 Score = 323 bits (827),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 174/398 (44%), Positives = 251/398 (63%), Gaps = 36/398 (9%)

Query  29   SNLPVWEAAAASLTLGFLVLATVLGNALVILSVFTYRPLRIVQNFFIVSLAVADLAVAIL  88
            S +P  E    ++T   ++  TV+GN LV+++VF+YRPL+ VQN+F+VSLA +DLAVAI 
Sbjct  50   SIIPTVELVLGTITYLVIIAMTVVGNTLVVVAVFSYRPLKKVQNYFLVSLAASDLAVAIF  109

Query  89   VMPFNVA-YLLLGKWIFGIHLCKLWLTCDVLCCTASILNLCAIALDRYWAITDPINYAQK  147
            VMP +V  +L  GKW+ G+ +C+ + T D+L CT+SILNLCAIALDRYWAI +PINYAQK
Sbjct  110  VMPLHVVTFLAGGKWLLGVTVCQFFTTADILLCTSSILNLCAIALDRYWAIHNPINYAQK  169

Query  148  RTLKRVLATIAGVWILSGAISSPPLIGWNDWPEELEPGTPCQLTRRQGYVIYSSLGSFFI  207
            RT K V   I  VWILS  IS PP+IGWN+W E +   + C L+  + +V++S+ GSFF+
Sbjct  170  RTTKFVCIVIVIVWILSMLISVPPIIGWNNWQENMMEDS-CGLSTEKAFVVFSAAGSFFL  228

Query  208  PLLLMSLVYLEIFLATRRRLRERARQSRINAVQSTRHREVDDAEESVSSETNHNERSTPR  267
            PLL+M +VY++IF++ R+R+R    +S +  +Q+    E DD    +S      +R++  
Sbjct  229  PLLVMVVVYVKIFISARQRIRTNRGRSALMRIQNA---EGDDDYRKMSI-----KRASVE  280

Query  268  SHAKPSLIDDEPTEVTIGGGGTVTTSSSRRTTGGRAPATTTTVYQ---------------  312
            S    S + ++   V   G  TVTT ++  T GG  P   TT +                
Sbjct  281  SARTSSRVGEKTPLVIADGQTTVTTLAAHSTDGGSLPKDETTKHMKYHNNGSCKVKVKDV  340

Query  313  -----------FIEERQRISLSKERRAARTLGVIMGVFVVCWLPFFLMYVIVPFCPACCP  361
                        + +R++IS++KE+RAA+T+ VI+ VF  CWLPFF+ YVI PFC  C  
Sbjct  341  KEDEGNPNPTAVLRKREKISVAKEKRAAKTIAVIIFVFSFCWLPFFVAYVIRPFCETCKL  400

Query  362  SDRMVYFITWLGYVNSALNPLIYTIFNLDYRRAFRKLL  399
              ++    TWLGY+NS+LNP +Y I NL++RRAF+K+L
Sbjct  401  HAKVEQAFTWLGYINSSLNPFLYGILNLEFRRAFKKIL  438


>G5EF04_CAEEL unnamed protein product
Length=421

 Score = 318 bits (816),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 175/402 (44%), Positives = 255/402 (63%), Gaps = 19/402 (5%)

Query  3    SSGESSGTMTE-DYEVTGCGPSEEETGSNLPVWEAAAASLTLGFLVLATVLGNALVILSV  61
            SS  S+ T+   D  +T   P      S +P  E    ++T   ++  TV+GN LV+++V
Sbjct  17   SSAVSTTTLPPLDIPMTSMKPP-----SIIPTVELVLGTITYLVIIAMTVVGNTLVVVAV  71

Query  62   FTYRPLRIVQNFFIVSLAVADLAVAILVMPFNVA-YLLLGKWIFGIHLCKLWLTCDVLCC  120
            F+YRPL+ VQN+F+VSLA +DLAVAI VMP +V  +L  GKW+ G+ +C+ + T D+L C
Sbjct  72   FSYRPLKKVQNYFLVSLAASDLAVAIFVMPLHVVTFLAGGKWLLGVTVCQFFTTADILLC  131

Query  121  TASILNLCAIALDRYWAITDPINYAQKRTLKRVLATIAGVWILSGAISSPPLIGWNDWPE  180
            T+SILNLCAIALDRYWAI +PINYAQKRT K V   I  VWILS  IS PP+IGWN+W E
Sbjct  132  TSSILNLCAIALDRYWAIHNPINYAQKRTTKFVCIVIVIVWILSMLISVPPIIGWNNWQE  191

Query  181  ELEPGTPCQLTRRQGYVIYSSLGSFFIPLLLMSLVYLEIFLATRRRLRERARQSRINAVQ  240
             +   + C L+  + +V++S+ GSFF+PLL+M +VY++IF++ R+R+R    +S +  +Q
Sbjct  192  NMMEDS-CGLSTEKAFVVFSAAGSFFLPLLVMVVVYVKIFISARQRIRTNRGRSALMRIQ  250

Query  241  STRHREVDDAEESVSSETNHNERSTPRSHAKPSLIDDEPT---EVTIGGGGTVTTSSSRR  297
            +    + D  + S+   +  + R++ R+    SL  DE T   +    G   V     + 
Sbjct  251  NAEGDD-DYRKMSIKRASVESARTSSRTDGG-SLPKDETTKHMKYHNNGSCKVKVKDVKE  308

Query  298  TTGGRAPATTTTVYQFIEERQRISLSKERRAARTLGVIMGVFVVCWLPFFLMYVIVPFCP  357
              G   P         + +R++IS++KE+RAA+T+ VI+ VF  CWLPFF+ YVI PFC 
Sbjct  309  DEGNPNPTAV------LRKREKISVAKEKRAAKTIAVIIFVFSFCWLPFFVAYVIRPFCE  362

Query  358  ACCPSDRMVYFITWLGYVNSALNPLIYTIFNLDYRRAFRKLL  399
             C    ++    TWLGY+NS+LNP +Y I NL++RRAF+K+L
Sbjct  363  TCKLHAKVEQAFTWLGYINSSLNPFLYGILNLEFRRAFKKIL  404


>H2FLI4_CAEEL unnamed protein product
Length=420

 Score = 318 bits (814),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 176/399 (44%), Positives = 255/399 (64%), Gaps = 25/399 (6%)

Query  3    SSGESSGTMTE-DYEVTGCGPSEEETGSNLPVWEAAAASLTLGFLVLATVLGNALVILSV  61
            SS  S+ T+   D  +T   P      S +P  E    ++T   ++  TV+GN LV+++V
Sbjct  28   SSAVSTTTLPPLDIPMTSMKPP-----SIIPTVELVLGTITYLVIIAMTVVGNTLVVVAV  82

Query  62   FTYRPLRIVQNFFIVSLAVADLAVAILVMPFNVA-YLLLGKWIFGIHLCKLWLTCDVLCC  120
            F+YRPL+ VQN+F+VSLA +DLAVAI VMP +V  +L  GKW+ G+ +C+ + T D+L C
Sbjct  83   FSYRPLKKVQNYFLVSLAASDLAVAIFVMPLHVVTFLAGGKWLLGVTVCQFFTTADILLC  142

Query  121  TASILNLCAIALDRYWAITDPINYAQKRTLKRVLATIAGVWILSGAISSPPLIGWNDWPE  180
            T+SILNLCAIALDRYWAI +PINYAQKRT K V   I  VWILS  IS PP+IGWN+W E
Sbjct  143  TSSILNLCAIALDRYWAIHNPINYAQKRTTKFVCIVIVIVWILSMLISVPPIIGWNNWQE  202

Query  181  ELEPGTPCQLTRRQGYVIYSSLGSFFIPLLLMSLVYLEIFLATRRRLRERARQSRINAVQ  240
             +   + C L+  + +V++S+ GSFF+PLL+M +VY++IF++ R+R+R    +S +  +Q
Sbjct  203  NMMEDS-CGLSTEKAFVVFSAAGSFFLPLLVMVVVYVKIFISARQRIRTNRGRSALMRIQ  261

Query  241  STRHREVDDAEESVSSETNHNERSTPRSHAKPSLIDDEPTEVTIGGGGTVTTSSSRRTTG  300
            +    E DD    +S      +R++  S    S + ++   V   G  TVTT ++     
Sbjct  262  NA---EGDDDYRKMSI-----KRASVESARTSSRVGEKTPLVIADGQTTVTTLAAHSNPN  313

Query  301  GRAPATTTTVYQFIEERQRISLSKERRAARTLGVIMGVFVVCWLPFFLMYVIVPFCPACC  360
              A          + +R++IS++KE+RAA+T+ VI+ VF  CWLPFF+ YVI PFC  C 
Sbjct  314  PTA---------VLRKREKISVAKEKRAAKTIAVIIFVFSFCWLPFFVAYVIRPFCETCK  364

Query  361  PSDRMVYFITWLGYVNSALNPLIYTIFNLDYRRAFRKLL  399
               ++    TWLGY+NS+LNP +Y I NL++RRAF+K+L
Sbjct  365  LHAKVEQAFTWLGYINSSLNPFLYGILNLEFRRAFKKIL  403



Lambda      K        H
   0.319    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 13016428792


Query= XP_003392961.1 delta-1-pyrroline-5-carboxylate synthase isoform X2
[Bombus terrestris]

Length=775
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ALH13_CAEEL  unnamed protein product                                  822     0.0  
Q8IR55_DROME  unnamed protein product                                 32.0    2.7  
Q9NCW7_DROME  unnamed protein product                                 32.0    2.8  


>ALH13_CAEEL unnamed protein product
Length=802

 Score = 822 bits (2124),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/738 (56%), Positives = 544/738 (74%), Gaps = 21/738 (3%)

Query  39   RKPTMFNERSQLTYTRRLVVKLGSAVITREDEHGLALGRLASIVEQVAECQNGGRECIMV  98
            +K  + N R+ L   +R+VVKLGSAVITREDE GLALGRLASIVEQV+E Q  GR+ ++V
Sbjct  67   QKHPLINTRNDLKKAQRVVVKLGSAVITREDECGLALGRLASIVEQVSELQQSGRQMLIV  126

Query  99   TSGAVAFGKQKLAQELLMSLSMRETLSPGGHMRKRSGTPLEPRAAAAVGQSGLMSLYDAM  158
            +SGAVAFG+QKL QEL+MS+SMR+TL      R  SG   + RA AA G  GLMSLY+ +
Sbjct  127  SSGAVAFGRQKLRQELVMSMSMRQTL------RGPSGMTADKRACAASGMPGLMSLYEQL  180

Query  159  FAQYGVKLAQVLVTKPDFYNEETRKNLFSTLSELLSLNIVPIINTNDAVSPPPHVDEEVA  218
            F QYG+ +AQVL+TKPD  +++ RKNL +T+  LLSLNI+PI+N NDAV+P P ++    
Sbjct  181  FQQYGITVAQVLLTKPDIDDDQRRKNLQATIESLLSLNIIPIVNANDAVAPDPKLN----  236

Query  219  GSGGRRGISIKDNDSLAAMLAAEIQADLLILMSDVDGIYNLPPWHDGAKMLHTFSMDLRD  278
                   + I DNDSLAA L+AEI+A+LLI++S+V+G+Y  PP  +G+++L+T+      
Sbjct  237  -------MHISDNDSLAARLSAEIEAELLIILSNVNGVYTGPPDLEGSRLLYTYVPSENS  289

Query  279  TIQFGQKSKVGTGGMDAKVNAALWALDRGVSVVICNGTQEKAIKNILSGRKIGTFFTQTT  338
             + FG  SK GTGGM++KV A + AL+ GV+ VI NG  + AI + ++G+KIGT F  T 
Sbjct  290  GVTFGANSKFGTGGMESKVTACVNALNNGVTTVITNGLAQDAITDAVAGKKIGTMFCNTK  349

Query  339  -ETFAPVEVVAEEARAGSRILQALQPEERASCINTLADLLESRQREILSANAKDLEAAEK  397
                 P+E VAE+ R   R L AL  +ER + +  LA LL  +++ I+ AN  DL  A+ 
Sbjct  350  GYEGPPIEEVAEKCRDAGRQLAALSNKERGAMVRHLAALLVDKEKYIIEANQTDLANAKS  409

Query  398  SGLAKALLSRLSLTPAKLKSLSCGLRQIANDSLTNVGRVLRRTRLAEGLELKQITVPIGV  457
            +GL   LL+RL +TP K++ L  GL  IA+ + T VGRVL++ +++EGL L+Q+TVPIG 
Sbjct  410  AGLDPQLLNRLKMTPEKIQDLHAGLNTIADSAETLVGRVLKKVKISEGLFLEQVTVPIGS  469

Query  458  LLVIFESRPDSLPQVAALAMSSANGLLLKGGKEAANSNRYLMELVKEALSTVG--AANAI  515
            L+VIFESRPD LPQVA+LAM+S N LLLKGGKEA  SN+ L  LV+EAL T G    +A+
Sbjct  470  LMVIFESRPDCLPQVASLAMASGNALLLKGGKEAEESNKALHALVQEALGTHGFEMRDAV  529

Query  516  SLISTREDVGDLLSMGKHIDLVIPRGSSDLVRSIQEQSKHIPVLGHAEGICHVYVDKDAD  575
            +L+ +REDV DLL +   IDL+IPRGSSDLVRS+QE+SK IPVLGHAEG+CHVY+DKD D
Sbjct  530  TLVRSREDVADLLQLKDLIDLIIPRGSSDLVRSMQEKSKGIPVLGHAEGVCHVYIDKDCD  589

Query  576  LMKAMKIIRDSKCDYPAACNAMETLLIHESHMKSSFFTDVCNMLQKEGVKVNSGPRLREQ  635
              KA++I+RDSKCDYP+ACNA ET+LIH+    + FF  +C+M + EGVK+++GP+L   
Sbjct  590  EQKAIQIVRDSKCDYPSACNAAETILIHKDLATAPFFDSLCSMFKAEGVKLHAGPKLAAL  649

Query  636  LTFGPPAAKSMKTEYGALECAIEVVTDVDDAINHIHKYGSGHTDVIVTENSQSATHFGRE  695
            L F PP A+SM  EYG+LEC +EVV +V++A+ HI +YGSGHT+ I+TEN+ +A HF + 
Sbjct  650  LKFAPPPAESMSFEYGSLECTLEVVDNVEEAVAHIIRYGSGHTESIITENTNTAEHFLKH  709

Query  696  VDSACVFHNASTRFSDGYRFGLGAEVGISTARIHARGPVGVDGLLTTKWVLHGDGHAAAD  755
            VDSAC FHNASTRF+DGYRFGLGAEVGIST RIHARGPVGV+GLLTTKW+L G+GH   D
Sbjct  710  VDSACAFHNASTRFADGYRFGLGAEVGISTGRIHARGPVGVEGLLTTKWLLRGEGHLVED  769

Query  756  FAEGGDKVWLHQSLPINE  773
            F + G   +LH++L  +E
Sbjct  770  F-KNGKYSYLHENLNPSE  786


>Q8IR55_DROME unnamed protein product
Length=2567

 Score = 32.0 bits (71),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 2/37 (5%)

Query  585  DSKCDYPAACNAMETLLIHESHMK--SSFFTDVCNML  619
            D + D P  C  + TLL+H S +K  S FF ++CN L
Sbjct  83   DKEVDLPLDCLYVYTLLLHYSCVKKPSLFFHNICNKL  119


>Q9NCW7_DROME unnamed protein product
Length=2501

 Score = 32.0 bits (71),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 2/37 (5%)

Query  585  DSKCDYPAACNAMETLLIHESHMK--SSFFTDVCNML  619
            D + D P  C  + TLL+H S +K  S FF ++CN L
Sbjct  83   DKEVDLPLDCLYVYTLLLHYSCVKKPSLFFHNICNKL  119



Lambda      K        H
   0.319    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 13016428792


Query= XP_003392963.1 U4/U6 small nuclear ribonucleoprotein Prp4 [Bombus
terrestris]

Length=525
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VVI0_DROME  unnamed protein product                                 652     0.0  
Q57W14_TRYB2  unnamed protein product                                 141     7e-37
WDS_DROME  unnamed protein product                                    133     2e-34


>Q9VVI0_DROME unnamed protein product
Length=553

 Score = 652 bits (1681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/563 (59%), Positives = 411/563 (73%), Gaps = 49/563 (9%)

Query  1    MSDDEDLVYVKKQKTVHYGSLEEAERARLVAVA---------------------------  33
            MSDD+D+ Y+K+Q+T+HYGSLEE+ER R  A A                           
Sbjct  1    MSDDDDIQYIKRQRTLHYGSLEESERKRQNAAASGAAATTTSGTTASSGAGTTTTGTGGQ  60

Query  34   -----------ESSEEEKNITNLGDNANATATLGNIHISNEYMELEDEMSKDRQALLEEF  82
                       ES+++  N    G      ATL N  I ++Y +LE EM +D+ ALLEEF
Sbjct  61   LEDIDSDEDYEESTKKTSNAKQAGAPPPTAATLAN-KIDDDYFDLEMEMERDKVALLEEF  119

Query  83   ERRKKARQINVSTDDSEVKKNLRQLDEPICLFGEGPADRRTRLRELLANLGEDAI-KKKH  141
            ER+K+ARQINVSTDD+E+K NLRQL+EPIC FGEGPA+RR RL+ELLA LGE+AI K+++
Sbjct  120  ERKKRARQINVSTDDTEIKSNLRQLNEPICYFGEGPAERRRRLKELLAGLGENAINKRQY  179

Query  142  EEEEKPSHPIERDTETTWYHEGPDSLQIARSWIATYSLPRAKARLGKARQDLELPTATRT  201
            E+EE+     E+D + TWYHEGPDSL+IAR W+A YSLPRAK RL +AR+ LE+P+A R 
Sbjct  180  EDEERKQQQREQD-QATWYHEGPDSLRIARLWLADYSLPRAKDRLVRAREALEVPSAARA  238

Query  202  ARRQELLKKLQALTIYCSQIGDTRPISFCQFSPNSKLLATASWSGLCKIWSVPDCTLLRT  261
             R  E+ KKLQ+L   CSQ+GDTRP+S   FS +S LL T+SWSGLCK+WSVPDC L +T
Sbjct  239  GRMVEMQKKLQSLAPLCSQVGDTRPVSSAAFSEDSSLLLTSSWSGLCKLWSVPDCELKQT  298

Query  262  LKGHTCNVGCIVFHPKATITEEVVGEKSGQTCVLASCASDGTVKLWSGGSGEEPLAEVEG  321
            L+GH   VG +   P     EE V         +AS   DG VKLW G + EE +A++ G
Sbjct  299  LRGHASYVGGVALRPGVKADEENV-------VAMASGGHDGAVKLW-GFNNEESIADITG  350

Query  322  HEPHRVSRLAFHPSGRFLGTCCYDASWRLWDLEQQAEVLHQEGHARAVHCISFQGDGSVS  381
            H PHRVS++AFHPSGRFL T CYD+SWRLWDLEQ+ EVLHQEGHA+ VHC+S+  DGSV 
Sbjct  351  HMPHRVSKVAFHPSGRFLATACYDSSWRLWDLEQKTEVLHQEGHAKPVHCLSYHSDGSVL  410

Query  382  ATGGHDSFGRVWDLRTGRCIMFMEGHLKSIFGIDFSPNGFHIATASEDNTSKIWDLRKRS  441
             TGG D+FGRVWDLRTGRCIMF+EGHL ++FG+DFSPNGFHIAT S+DNT KIWDLR+R 
Sbjct  411  VTGGLDAFGRVWDLRTGRCIMFLEGHLGAVFGVDFSPNGFHIATGSQDNTCKIWDLRRRQ  470

Query  442  CVYTIPAHTNLLSDVKYQRIEGQYLVTASYDNTAKIWSNKTWQPLKTLPGHDGKVMSVDI  501
             VYTIPAHTNL+SDVKYQ+  G +LVT SYD+T KIWSNKTWQPLKTL GHD KV+SVDI
Sbjct  471  PVYTIPAHTNLISDVKYQQECGSFLVTCSYDSTTKIWSNKTWQPLKTLQGHDNKVISVDI  530

Query  502  SPDHKFIGTSSYDRTFKLWAPEN  524
            +P+ ++I T+S+DRTFKLW+P++
Sbjct  531  APNSQYIATTSFDRTFKLWSPDS  553


>Q57W14_TRYB2 unnamed protein product
Length=419

 Score = 141 bits (356),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 86/288 (30%), Positives = 145/288 (50%), Gaps = 17/288 (6%)

Query  233  SPNSKLLATASWSGLCKIWSVPDCTLLRTLKGHTCNVGCIVFHPKATITEEVVGEKSGQT  292
            +P    +AT S+   CKIW         TL GH   + C+ F+P++T             
Sbjct  147  NPYGNRVATGSFDKTCKIWDARTAQCYCTLAGHMAEIVCMSFNPQST-------------  193

Query  293  CVLASCASDGTVKLWSGGSGEEPLAEVEGHEPHRVSRLAFHPSGRFLGTCCYDASWRLWD  352
              L+S + D T K+W+  +G+E L  + GH    VS L F+ +G  + T  +D + +LWD
Sbjct  194  -HLSSGSMDYTAKVWNVETGQE-LYTLLGHTAEIVS-LNFNTNGDLILTGSFDTTAKLWD  250

Query  353  LEQQAEVLHQEGHARAVHCISFQGDGSVSATGGHDSFGRVWDLRTGRCIMFMEGHLKSIF  412
            +     V     H   +    F   G++  TG  D   ++WD+ +G+C+  + GH   I 
Sbjct  251  VRTGKCVHTLSSHRAEISSTQFNFAGNLCVTGCIDRTSKLWDVGSGQCVSTLRGHTDEIL  310

Query  413  GIDFSPNGFHIATASEDNTSKIWDLRKRSCVYTIPAHTNLLSDVKYQRIEGQYLVTASYD  472
             + FS +G  I TAS D T++++D    +CV ++  H   +S V++   +G  +++A+ D
Sbjct  311  DVAFSTSGSQIVTASADATARVYDTATFNCVASLVGHEGEISKVQFNP-QGTKIISAAND  369

Query  473  NTAKIWSNKTWQPLKTLPGHDGKVMSVDISPDHKFIGTSSYDRTFKLW  520
             T ++WS +T Q L+TL GH+ ++ S   + +   I T S D T  +W
Sbjct  370  KTCRVWSVETGQNLQTLTGHNDEIFSCAFNYEGDTILTGSKDNTCGIW  417


 Score = 133 bits (335),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 80/298 (27%), Positives = 145/298 (49%), Gaps = 16/298 (5%)

Query  226  PISFCQFSPNSKLLATASWSGLCKIWSVPDCTLLRTLKGHTCNVGCIVFHPKATITEEVV  285
            P++ C F+       T S+   CK+W       + +L+GH   V  + F+          
Sbjct  97   PLTNCAFNKGGDSFITGSYDRTCKVWDTATGNEIVSLEGHRNVVYSVSFNNP-------Y  149

Query  286  GEKSGQTCVLASCASDGTVKLWSGGSGEEPLAEVEGHEPHRVSRLAFHPSGRFLGTCCYD  345
            G +      +A+ + D T K+W   + +     + GH    V  ++F+P    L +   D
Sbjct  150  GNR------VATGSFDKTCKIWDARTAQ-CYCTLAGHMAEIVC-MSFNPQSTHLSSGSMD  201

Query  346  ASWRLWDLEQQAEVLHQEGHARAVHCISFQGDGSVSATGGHDSFGRVWDLRTGRCIMFME  405
             + ++W++E   E+    GH   +  ++F  +G +  TG  D+  ++WD+RTG+C+  + 
Sbjct  202  YTAKVWNVETGQELYTLLGHTAEIVSLNFNTNGDLILTGSFDTTAKLWDVRTGKCVHTLS  261

Query  406  GHLKSIFGIDFSPNGFHIATASEDNTSKIWDLRKRSCVYTIPAHTNLLSDVKYQRIEGQY  465
             H   I    F+  G    T   D TSK+WD+    CV T+  HT+ + DV +    G  
Sbjct  262  SHRAEISSTQFNFAGNLCVTGCIDRTSKLWDVGSGQCVSTLRGHTDEILDVAFST-SGSQ  320

Query  466  LVTASYDNTAKIWSNKTWQPLKTLPGHDGKVMSVDISPDHKFIGTSSYDRTFKLWAPE  523
            +VTAS D TA+++   T+  + +L GH+G++  V  +P    I +++ D+T ++W+ E
Sbjct  321  IVTASADATARVYDTATFNCVASLVGHEGEISKVQFNPQGTKIISAANDKTCRVWSVE  378


 Score = 102 bits (253),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 72/264 (27%), Positives = 114/264 (43%), Gaps = 21/264 (8%)

Query  217  YCSQIGDTRPISFCQFSPNSKLLATASWSGLCKIWSVPDCTLLRTLKGHTCNVGCIVFHP  276
            YC+  G    I    F+P S  L++ S     K+W+V     L TL GHT  +  + F+ 
Sbjct  173  YCTLAGHMAEIVCMSFNPQSTHLSSGSMDYTAKVWNVETGQELYTLLGHTAEIVSLNFNT  232

Query  277  KATITEEVVGEKSGQTCVLASCASDGTVKLWSGGSGEEPLAEVEGHEPHR--VSRLAFHP  334
               +              + + + D T KLW   +G+     V     HR  +S   F+ 
Sbjct  233  NGDL--------------ILTGSFDTTAKLWDVRTGKC----VHTLSSHRAEISSTQFNF  274

Query  335  SGRFLGTCCYDASWRLWDLEQQAEVLHQEGHARAVHCISFQGDGSVSATGGHDSFGRVWD  394
            +G    T C D + +LWD+     V    GH   +  ++F   GS   T   D+  RV+D
Sbjct  275  AGNLCVTGCIDRTSKLWDVGSGQCVSTLRGHTDEILDVAFSTSGSQIVTASADATARVYD  334

Query  395  LRTGRCIMFMEGHLKSIFGIDFSPNGFHIATASEDNTSKIWDLRKRSCVYTIPAHTNLLS  454
              T  C+  + GH   I  + F+P G  I +A+ D T ++W +     + T+  H + + 
Sbjct  335  TATFNCVASLVGHEGEISKVQFNPQGTKIISAANDKTCRVWSVETGQNLQTLTGHNDEIF  394

Query  455  DVKYQRIEGQYLVTASYDNTAKIW  478
               +   EG  ++T S DNT  IW
Sbjct  395  SCAFNY-EGDTILTGSKDNTCGIW  417


 Score = 69.3 bits (168),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 57/120 (48%), Gaps = 0/120 (0%)

Query  404  MEGHLKSIFGIDFSPNGFHIATASEDNTSKIWDLRKRSCVYTIPAHTNLLSDVKYQRIEG  463
            +  H+  +    F+  G    T S D T K+WD    + + ++  H N++  V +    G
Sbjct  91   LRAHMLPLTNCAFNKGGDSFITGSYDRTCKVWDTATGNEIVSLEGHRNVVYSVSFNNPYG  150

Query  464  QYLVTASYDNTAKIWSNKTWQPLKTLPGHDGKVMSVDISPDHKFIGTSSYDRTFKLWAPE  523
              + T S+D T KIW  +T Q   TL GH  +++ +  +P    + + S D T K+W  E
Sbjct  151  NRVATGSFDKTCKIWDARTAQCYCTLAGHMAEIVCMSFNPQSTHLSSGSMDYTAKVWNVE  210


>WDS_DROME unnamed protein product
Length=361

 Score = 133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 86/311 (28%), Positives = 149/311 (48%), Gaps = 21/311 (7%)

Query  215  TIYCSQIGDTRPISFCQFSPNSKLLATASWSGLCKIWSVPDCTLLRTLKGHTCNVGCIVF  274
            T+  +  G T+ +S  +FSPN + LA++S   L KIW   D    +T+ GH   +  + +
Sbjct  63   TLKFTLAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAW  122

Query  275  HPKATITEEVVGEKSGQTCVLASCASDGTVKLWSGGSGEEPLAEVEGHEPHRVSRLAFHP  334
                          S  + +L S + D T+K+W   +G+  L  ++GH  + V    F+P
Sbjct  123  --------------SSDSRLLVSGSDDKTLKVWELSTGKS-LKTLKGHS-NYVFCCNFNP  166

Query  335  SGRFLGTCCYDASWRLWDLEQQAEVLHQEGHARAVHCISFQGDGSVSATGGHDSFGRVWD  394
                + +  +D S R+WD+     +     H+  V  + F  DGS+  +  +D   R+WD
Sbjct  167  QSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWD  226

Query  395  LRTGRCI-MFMEGHLKSIFGIDFSPNGFHIATASEDNTSKIWDLRKRSCVYTIPAHTN--  451
              +G+C+   ++     +  + FSPNG +I  A+ DNT K+WD  K  C+ T   H N  
Sbjct  227  TASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEK  286

Query  452  LLSDVKYQRIEGQYLVTASYDNTAKIWSNKTWQPLKTLPGHDGKVMSVDISPDHKFIGTS  511
                  +    G+++V+ S DN   IW+ ++ + ++ L GH   V+     P    I ++
Sbjct  287  YCIFANFSVTGGKWIVSGSEDNMVYIWNLQSKEVVQKLQGHTDTVLCTACHPTENIIASA  346

Query  512  SY--DRTFKLW  520
            +   D+T KLW
Sbjct  347  ALENDKTIKLW  357



Lambda      K        H
   0.319    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 13016428792


Query= XP_003392964.1 histone H4 [Bombus terrestris]

Length=103
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

H4_DROME  unnamed protein product                                     199     3e-68
H4_PENVA  unnamed protein product                                     192     2e-65
H4_DICDI  unnamed protein product                                     141     4e-45


>H4_DROME unnamed protein product
Length=103

 Score = 199 bits (507),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 103/103 (100%), Positives = 103/103 (100%), Gaps = 0/103 (0%)

Query  1    MTGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK  60
            MTGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
Sbjct  1    MTGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK  60

Query  61   VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG  103
            VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct  61   VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG  103


>H4_PENVA unnamed protein product
Length=103

 Score = 192 bits (489),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/103 (97%), Positives = 100/103 (97%), Gaps = 0/103 (0%)

Query  1    MTGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK  60
            MTGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
Sbjct  1    MTGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK  60

Query  61   VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG  103
            VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKR   TLYGFGG
Sbjct  61   VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRXXXTLYGFGG  103


>H4_DICDI unnamed protein product
Length=108

 Score = 141 bits (355),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 76/88 (86%), Gaps = 0/88 (0%)

Query  16   AKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTE  75
            AKRH+K  +++I GITKPAIRRLARRGGVKRIS  IYEETR VL+ FL NVIRD+V YTE
Sbjct  21   AKRHKKTQKEHINGITKPAIRRLARRGGVKRISFPIYEETRNVLRTFLTNVIRDSVAYTE  80

Query  76   HAKRKTVTAMDVVYALKRQGRTLYGFGG  103
            HA R+TVTAMDVVYALKRQGRTLYGF  
Sbjct  81   HAGRRTVTAMDVVYALKRQGRTLYGFNS  108



Lambda      K        H
   0.319    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 13016428792


Query= XP_003392965.1 histone H3 [Bombus terrestris]

Length=136
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

H3_DROME  unnamed protein product                                     274     8e-97
H33B_DROME  unnamed protein product                                   267     4e-94
H33A_DROME  unnamed protein product                                   267     4e-94


>H3_DROME unnamed protein product
Length=136

 Score = 274 bits (701),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 136/136 (100%), Positives = 136/136 (100%), Gaps = 0/136 (0%)

Query  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  120
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  121  MPKDIQLARRIRGERA  136
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136


>H33B_DROME unnamed protein product
Length=136

 Score = 267 bits (683),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 135/136 (99%), Gaps = 0/136 (0%)

Query  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60
            MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPGTVALREIRRYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  120
            LLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  121  MPKDIQLARRIRGERA  136
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136


>H33A_DROME unnamed protein product
Length=136

 Score = 267 bits (683),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 135/136 (99%), Gaps = 0/136 (0%)

Query  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60
            MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPGTVALREIRRYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  120
            LLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  121  MPKDIQLARRIRGERA  136
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



Lambda      K        H
   0.319    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 13016428792


Query= XP_003392968.1 histone H2A [Bombus terrestris]

Length=124
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

H2A_DROME  unnamed protein product                                    243     1e-84
H2A_PENVA  unnamed protein product                                    238     8e-83
C6KT18_PLAF7  unnamed protein product                                 184     2e-61


>H2A_DROME unnamed protein product
Length=124

 Score = 243 bits (619),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 123/124 (99%), Positives = 123/124 (99%), Gaps = 0/124 (0%)

Query  1    MSGRGKGGKAKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAA  60
            MSGRGKGGK KGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAA
Sbjct  1    MSGRGKGGKVKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAA  60

Query  61   EVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKT  120
            EVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKT
Sbjct  61   EVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKT  120

Query  121  EKKA  124
            EKKA
Sbjct  121  EKKA  124


>H2A_PENVA unnamed protein product
Length=123

 Score = 238 bits (607),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 119/123 (97%), Positives = 122/123 (99%), Gaps = 0/123 (0%)

Query  1    MSGRGKGGKAKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAA  60
            MSGRGKGGK KGK+KSRS+RAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAA
Sbjct  1    MSGRGKGGKVKGKSKSRSSRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAA  60

Query  61   EVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKT  120
            EVLELAGNAARDNKKTRI+PRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKT
Sbjct  61   EVLELAGNAARDNKKTRIVPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKT  120

Query  121  EKK  123
            EKK
Sbjct  121  EKK  123


>C6KT18_PLAF7 unnamed protein product
Length=132

 Score = 184 bits (467),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 105/125 (84%), Gaps = 1/125 (1%)

Query  1    MSGRGKGGKAKG-KAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLA  59
            MS +GK G+ K  K  S S +AGLQFPVGRI R L+KG YA+RVGAGAPVYLAAV+EYL 
Sbjct  1    MSAKGKTGRKKASKGTSNSAKAGLQFPVGRIGRYLKKGKYAKRVGAGAPVYLAAVLEYLC  60

Query  60   AEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKK  119
            AE+LELAGNAARDNKK+RI PRH+QLA+RNDEELNK L+GVT A GGVLPNI  VLLPKK
Sbjct  61   AEILELAGNAARDNKKSRITPRHIQLAVRNDEELNKFLAGVTFASGGVLPNIHNVLLPKK  120

Query  120  TEKKA  124
            ++ KA
Sbjct  121  SQLKA  125



Lambda      K        H
   0.319    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 13016428792


Query= XP_003392969.1 histone H3 [Bombus terrestris]

Length=136
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

H3_DROME  unnamed protein product                                     274     8e-97
H33B_DROME  unnamed protein product                                   267     4e-94
H33A_DROME  unnamed protein product                                   267     4e-94


>H3_DROME unnamed protein product
Length=136

 Score = 274 bits (701),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 136/136 (100%), Positives = 136/136 (100%), Gaps = 0/136 (0%)

Query  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  120
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  121  MPKDIQLARRIRGERA  136
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136


>H33B_DROME unnamed protein product
Length=136

 Score = 267 bits (683),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 135/136 (99%), Gaps = 0/136 (0%)

Query  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60
            MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPGTVALREIRRYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  120
            LLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  121  MPKDIQLARRIRGERA  136
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136


>H33A_DROME unnamed protein product
Length=136

 Score = 267 bits (683),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 135/136 (99%), Gaps = 0/136 (0%)

Query  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60
            MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPGTVALREIRRYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  120
            LLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  121  MPKDIQLARRIRGERA  136
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136



Lambda      K        H
   0.319    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 13016428792


Query= XP_003392970.1 histone H4 [Bombus terrestris]

Length=103
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

H4_DROME  unnamed protein product                                     199     3e-68
H4_PENVA  unnamed protein product                                     192     2e-65
H4_DICDI  unnamed protein product                                     141     4e-45


>H4_DROME unnamed protein product
Length=103

 Score = 199 bits (507),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 103/103 (100%), Positives = 103/103 (100%), Gaps = 0/103 (0%)

Query  1    MTGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK  60
            MTGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
Sbjct  1    MTGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK  60

Query  61   VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG  103
            VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct  61   VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG  103


>H4_PENVA unnamed protein product
Length=103

 Score = 192 bits (489),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/103 (97%), Positives = 100/103 (97%), Gaps = 0/103 (0%)

Query  1    MTGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK  60
            MTGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
Sbjct  1    MTGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK  60

Query  61   VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG  103
            VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKR   TLYGFGG
Sbjct  61   VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRXXXTLYGFGG  103


>H4_DICDI unnamed protein product
Length=108

 Score = 141 bits (355),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 76/88 (86%), Gaps = 0/88 (0%)

Query  16   AKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTE  75
            AKRH+K  +++I GITKPAIRRLARRGGVKRIS  IYEETR VL+ FL NVIRD+V YTE
Sbjct  21   AKRHKKTQKEHINGITKPAIRRLARRGGVKRISFPIYEETRNVLRTFLTNVIRDSVAYTE  80

Query  76   HAKRKTVTAMDVVYALKRQGRTLYGFGG  103
            HA R+TVTAMDVVYALKRQGRTLYGF  
Sbjct  81   HAGRRTVTAMDVVYALKRQGRTLYGFNS  108



Lambda      K        H
   0.319    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 13016428792


Query= XP_003392977.1 iron-sulfur cluster co-chaperone protein HscB,
mitochondrial [Bombus terrestris]

Length=251
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A8JNT7_DROME  unnamed protein product                                 118     3e-32
Q38BB1_TRYB2  unnamed protein product                                 43.9    6e-05
Q584G5_TRYB2  unnamed protein product                                 43.1    1e-04


>A8JNT7_DROME unnamed protein product
Length=240

 Score = 118 bits (295),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/210 (30%), Positives = 117/210 (56%), Gaps = 9/210 (4%)

Query  43   LTNVSQYSSNSLSKCWNCN--FVYKSDLFCSKCKVLQEPPENLTYFDIIGVPKSYDVKVT  100
            L  + ++S  S   CWNC      K ++ CS C  LQ+    + YF ++  P  + ++  
Sbjct  32   LPEIRKFSVESSPACWNCQKKSELKQNMICSDCGHLQDVNSGINYFKLLSFPIQFSLESQ  91

Query  101  EIQKKYKELQKLLHPDKFGTKSEKEKQFSETLSSLVNNAYSTLIHPLKRGLYMLKLNDIT  160
            ++ + +++LQ ++HPDK+  K+ +E+  S   SSL+N AY TL  P+ RG Y+L+L    
Sbjct  92   KLTRSFRQLQTIVHPDKYSNKTSREQTNSSDWSSLINKAYKTLSTPIDRGQYLLQLEGEQ  151

Query  161  ISEETDNVNAEFLIEIMEKNEEIEDVGD--DIEKIK-KLVQENETMLNNLTKEIADAFRQ  217
            + ++   +N EFL+ +ME+NEE+ED  D   +E +  +L++E E M     +++   F  
Sbjct  152  MPQDNSALNKEFLMAMMERNEEVEDAEDTQTLENLNIQLIKELEEM----ARKLNALFDS  207

Query  218  ENIKKAEFLLIRMKYYDSINTKLRKLKHDL  247
            +++   +  L+ MKY  SI   +++ +  L
Sbjct  208  KDLSGVKETLVEMKYLLSIQNSIKQKQQSL  237


>Q38BB1_TRYB2 unnamed protein product
Length=499

 Score = 43.9 bits (102),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 47/87 (54%), Gaps = 2/87 (2%)

Query  85   YFDIIGVPKSYDVKVTEIQKKYKELQKLLHPDKFGTKSEKEKQFSETLSSLVNNAYSTLI  144
            Y+ I+G+P+  +   + I++ YK+     HPDK+   +E+EK  +E +   V  A+S L 
Sbjct  370  YYKILGLPQG-ESDDSSIKRAYKKGCLQWHPDKWAHATEEEKAHAEKMFKEVGEAFSILS  428

Query  145  HPLKRGLY-MLKLNDITISEETDNVNA  170
             P K+ LY   +L+D +    T +  A
Sbjct  429  DPQKKRLYDSGQLDDASSPGGTSDFPA  455


>Q584G5_TRYB2 unnamed protein product
Length=705

 Score = 43.1 bits (100),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 42/72 (58%), Gaps = 2/72 (3%)

Query  85   YFDIIGVPKSYDVKVTEIQKKYKELQKLLHPDKFGTKSEKEKQFSETLSSLVNNAYSTLI  144
            Y+ ++GV  S +    EI+ +Y+EL    HPDK  +  E+E+  +E    ++  A++TLI
Sbjct  599  YYYVLGV--SRNATEREIKARYRELSLRWHPDKCMSLPEEERVVAERKFKIIVEAHTTLI  656

Query  145  HPLKRGLYMLKL  156
              +KR  Y LK+
Sbjct  657  DAVKRRDYDLKM  668



Lambda      K        H
   0.319    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 13016428792


Query= XP_003392978.1 adenylate kinase isoenzyme 6 [Bombus terrestris]

Length=178
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

KAD6_DROME  unnamed protein product                                   179     4e-58
Q584W4_TRYB2  unnamed protein product                                 104     2e-28
KAD6_PLAF7  unnamed protein product                                   77.4    5e-18


>KAD6_DROME unnamed protein product
Length=175

 Score = 179 bits (455),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 109/164 (66%), Gaps = 0/164 (0%)

Query  9    PNILITGTPGVGKSLLSRTLCQKTGLTSINVSDFAIEKGCVEFYDAVYECPILDEEKLLD  68
            PNILITGTPG GKS L   +  +     ++ S  A EK  VE YD  Y+CPILDEEKL+D
Sbjct  10   PNILITGTPGAGKSYLCERIASELKFEWLDCSKIAKEKNFVEEYDEEYDCPILDEEKLMD  69

Query  69   EMEDLICKGGVVVDYHGCDFFPKEWFDIVFVLRTDNTILYDRLTDRGYTGKKLEDNIQCE  128
             +E L+ KGG VV+YHGCDFFP+ WF  VFV+   NT LYDRL +R Y  KKL  NIQCE
Sbjct  70   HLEPLMAKGGNVVEYHGCDFFPERWFQAVFVVTCPNTTLYDRLKERNYNEKKLASNIQCE  129

Query  129  IFQIILEQARTTFEEEIVYELTSDNRNQLRSNVNSIFQWIQQWK  172
            IF  ILE+AR +++ +IV+EL  + +     ++ ++  W + WK
Sbjct  130  IFGTILEEARDSYKSDIVFELKGETKADAHISIKTVKNWYRMWK  173


>Q584W4_TRYB2 unnamed protein product
Length=177

 Score = 104 bits (259),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 93/160 (58%), Gaps = 5/160 (3%)

Query  10   NILITGTPGVGK-SLLSRTLCQKTGLTSINVSDFAIEKGCVEFYDAVYECPILDEE---K  65
            NILITGTPG GK SL    + +  G + I+V     E      YD  ++  ++DE+   +
Sbjct  8    NILITGTPGTGKTSLAELLVEELEGFSRIDVGKVVKENEFYTEYDKEFDTHVIDEDDEGR  67

Query  66   LLDEMEDLICKGG-VVVDYHGCDFFPKEWFDIVFVLRTDNTILYDRLTDRGYTGKKLEDN  124
            LLD ME ++ +GG  VVDYH  + FPK WF +V VLRT   +L++RL DR Y   K  +N
Sbjct  68   LLDFMEPIMVQGGNHVVDYHSSELFPKRWFHLVVVLRTSTEVLFERLMDRKYGELKRNEN  127

Query  125  IQCEIFQIILEQARTTFEEEIVYELTSDNRNQLRSNVNSI  164
            ++ EI  I  E+AR  ++E+I+    ++   ++ + V+ I
Sbjct  128  MEAEIHGICEEEARGAYDEDIIIVRDNNTLEEMAATVSLI  167


>KAD6_PLAF7 unnamed protein product
Length=186

 Score = 77.4 bits (189),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 56/183 (31%), Positives = 94/183 (51%), Gaps = 17/183 (9%)

Query  6    RSFPNILITGTPGVGKS-------------LLSRTLCQKTGLTSINVSDFAIEKGCVEFY  52
            R  PNI+ITG PG GKS             LL R   +   +T +N+S+   ++   + +
Sbjct  3    RKVPNIIITGVPGSGKSTLCEELKEIINKELLKRNDMEGFEMTHLNLSNIIKDERLYKEF  62

Query  53   DAVYECPILDEEKL--LDEMEDLICKGGVVVDYHGCDFFPK-EWFDIVFVLRTDNTILYD  109
            D   +  I  EE L    + +  + KGG ++D+H  +F    +  D +F+L      LY+
Sbjct  63   DDELDASIYSEELLNEYLKKKYKLEKGGYIIDFHDINFVKDVDIIDKIFLLTIQTNFLYE  122

Query  110  RLTDRGYTGKKLEDNIQCEIFQIILEQARTTFEE-EIVYELTSDNRNQLRSNVNSIFQWI  168
            RL  R YT +K+++NI+CEIFQ+I E     F    I+ E+ +++  Q  +N++ I  W+
Sbjct  123  RLEKRNYTKEKIKNNIECEIFQVIKEDILDHFPNTNILQEIENNDLQQYDNNLSIIKNWV  182

Query  169  QQW  171
              +
Sbjct  183  LSY  185



Lambda      K        H
   0.319    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 13016428792


Query= XP_003392979.1 maternal B9.15 protein [Bombus terrestris]

Length=265
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VXJ9_DROME  unnamed protein product                                 82.8    1e-17
BTG_DICDI  unnamed protein product                                    58.9    9e-10
Q4V5V6_DROME  unnamed protein product                                 32.3    0.16 


>Q9VXJ9_DROME unnamed protein product
Length=564

 Score = 82.8 bits (203),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 68/117 (58%), Gaps = 7/117 (6%)

Query  1    MRNEITAAVLFLVQLIEKNEKFSPDQLECFKRRLVELLTERFKNHWFPDKPFKGQGYRCI  60
            M  EI  A+ F++  +    K    ++  F   L + L ++F++HW+P+KPFKG  YRC+
Sbjct  1    MHIEIQVALNFVISYLYN--KLPRRRVNIFGEELEKALRDKFQDHWYPEKPFKGSAYRCL  58

Query  61   RVNGHNRRDATLESAANAAGVKYEDL--SLPVELTLWVDPNEVCCRFGESKGSYCTL  115
            +    +  D+ LE AA  +GV   D+  +LP EL++W+DP EV  R GE KG+   L
Sbjct  59   KTG--DPIDSVLERAARESGVPIGDILENLPNELSVWIDPGEVSFRIGE-KGAVKIL  112


>BTG_DICDI unnamed protein product
Length=423

 Score = 58.9 bits (141),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 33/104 (32%), Positives = 51/104 (49%), Gaps = 3/104 (3%)

Query  5    ITAAVLFLVQLIEKNEKFSPDQLECFKRRLVELLTERFKNHWFPDKPFKGQGYRCIRVNG  64
            + AA  +   L + N     + ++ F++ L+  L +R K HW+PD P +GQGYR I    
Sbjct  114  VVAACWWAESLGKLNMNIPKENIKRFRKELIFALRDRIKGHWYPDYPERGQGYRAIIC--  171

Query  65   HNRRDATLESAANAAGVKYEDLSLPVE-LTLWVDPNEVCCRFGE  107
                D  L  AA  + +  E   L  +  T+W+DP  V  R G+
Sbjct  172  EETTDRLLMDAAKKSDIVGEFRQLVKQNTTMWIDPGNVTYRHGK  215


>Q4V5V6_DROME unnamed protein product
Length=150

 Score = 32.3 bits (72),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 2/44 (5%)

Query  101  VCCRFGESKGSYCTLASFDD--KENTVPIFQGNEGLEKENKQSE  142
            VCC  G S GS+C+L        E    +FQ +EG  ++ +  E
Sbjct  17   VCCLMGSSSGSFCSLERMKKFAMEACEHLFQADEGARRDRRSIE  60



Lambda      K        H
   0.319    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 13016428792


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jan 6, 2022  5:12 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_003392980.1 heterogeneous nuclear ribonucleoprotein L isoform X1
[Bombus terrestris]

Length=479
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A0A0B4K8A1_DROME  unnamed protein product                             489     2e-170
A0A0B4K7W3_DROME  unnamed protein product                             484     9e-169
A0A0B4K852_DROME  unnamed protein product                             483     5e-168


>A0A0B4K8A1_DROME unnamed protein product
Length=515

 Score = 489 bits (1260),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 253/445 (57%), Positives = 312/445 (70%), Gaps = 41/445 (9%)

Query  30   DELRRKREDNNKPNHVLLFTIINPVYPITVEVLHAISAPSGQVQRIVIFKKNGVQAMVEF  89
            D+LRRKR +  +PNH+LLFTIINP YPITV+VLH I  P GQV RIVIFKKNGVQAMVEF
Sbjct  62   DDLRRKRPETTRPNHILLFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEF  121

Query  90   DTVESATRAKETLHGADIYSGCCTLKIDFAKPTKLNVYKNDAE-SWDYTTPTLGSSAHKN  148
            D +++ATRA+E L+GADIY+GCCTLKID+AKP KLNVYKN+ + SWDYT  T        
Sbjct  122  DNLDAATRARENLNGADIYAGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLST--GEILPI  179

Query  149  DATGNGRPAPLLAEPRYGAAPQPYGST-------------------PQVTFPPGAG---H  186
               GNGR +PLL EP YG  PQPY  +                   P   FPP      H
Sbjct  180  KEIGNGR-SPLLQEPLYGTRPQPYSKSLFSIPENVVMLESQPPLLGPGAAFPPFGAPEYH  238

Query  187  DRYEENFNGPATYPEPYVERYGIKSDFSGREPIHPTPPRPGYVPTLGQTPPSSTQGSVMM  246
                EN+ G A +P       G+  + +G  P    P        +  TP    QG+VMM
Sbjct  239  TTTPENWKGAAIHPT------GLMKEPAGVVPGRNAP--------VAFTPQGQAQGAVMM  284

Query  247  VYGLQPDKVNTDKLFNLFCLYGNVTKVKFLKTKEGCAMIQMGDNIAVERCLQNLNNVTIG  306
            VYGL  D  NTDKLFNL CLYGNV ++KFLKTKEG AM+QMGD +AVERC+Q+LNN+ +G
Sbjct  285  VYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMGDAVAVERCVQHLNNIPVG  344

Query  307  TDGRLQLGFSKQAFLSDVTNPYILPDKTASFKDFTGSKNNRFLNPAMANKNRIQPPSKIV  366
            T G++Q+ FSKQ FLS+V NP++LPD + SFK++TGSKNNRFL+PA A+KNRIQPPSKI+
Sbjct  345  TGGKIQIAFSKQNFLSEVINPFLLPDHSPSFKEYTGSKNNRFLSPAQASKNRIQPPSKIL  404

Query  367  HFFNTPPDLTEETVHRVFVERGIEAPTTVKLFPLKSERSSSGLIEFSSVGIAVAAIMECN  426
            HFFNTPP LTE+ +  +F  + + A T+V+LFPLK+ERSSSGLIEFS++  AV AIM+CN
Sbjct  405  HFFNTPPGLTEDQLIGIFNIKDVPA-TSVRLFPLKTERSSSGLIEFSNISQAVLAIMKCN  463

Query  427  HTALENSNGKFPYIMKLCFSSSRTI  451
            H  +E    KFP+IMKLCFSSS+++
Sbjct  464  HLPIEGKGTKFPFIMKLCFSSSKSM  488


>A0A0B4K7W3_DROME unnamed protein product
Length=492

 Score = 484 bits (1247),  Expect = 9e-169, Method: Compositional matrix adjust.
 Identities = 249/426 (58%), Positives = 309/426 (73%), Gaps = 31/426 (7%)

Query  30   DELRRKREDNNKPNHVLLFTIINPVYPITVEVLHAISAPSGQVQRIVIFKKNGVQAMVEF  89
            D+LRRKR +  +PNH+LLFTIINP YPITV+VLH I  P GQV RIVIFKKNGVQAMVEF
Sbjct  67   DDLRRKRPETTRPNHILLFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEF  126

Query  90   DTVESATRAKETLHGADIYSGCCTLKIDFAKPTKLNVYKNDAE-SWDYTTPTLGSSAHKN  148
            D +++ATRA+E L+GADIY+GCCTLKID+AKP KLNVYKN+ + SWDYT  T+       
Sbjct  127  DNLDAATRARENLNGADIYAGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLSTV-------  179

Query  149  DATGNGRPAPLLAEPRYGAAPQPYGSTPQVTFPPGAG---HDRYEENFNGPATYPEPYVE  205
               GNGR +PLL EP Y    +P    P   FPP      H    EN+ G A +P     
Sbjct  180  KEIGNGR-SPLLQEPLY----EPPLLGPGAAFPPFGAPEYHTTTPENWKGAAIHPT----  230

Query  206  RYGIKSDFSGREPIHPTPPRPGYVPTLGQTPPSSTQGSVMMVYGLQPDKVNTDKLFNLFC  265
              G+  + +G  P    P        +  TP    QG+VMMVYGL  D  NTDKLFNL C
Sbjct  231  --GLMKEPAGVVPGRNAP--------VAFTPQGQAQGAVMMVYGLDHDTSNTDKLFNLVC  280

Query  266  LYGNVTKVKFLKTKEGCAMIQMGDNIAVERCLQNLNNVTIGTDGRLQLGFSKQAFLSDVT  325
            LYGNV ++KFLKTKEG AM+QMGD +AVERC+Q+LNN+ +GT G++Q+ FSKQ FLS+V 
Sbjct  281  LYGNVARIKFLKTKEGTAMVQMGDAVAVERCVQHLNNIPVGTGGKIQIAFSKQNFLSEVI  340

Query  326  NPYILPDKTASFKDFTGSKNNRFLNPAMANKNRIQPPSKIVHFFNTPPDLTEETVHRVFV  385
            NP++LPD + SFK++TGSKNNRFL+PA A+KNRIQPPSKI+HFFNTPP LTE+ +  +F 
Sbjct  341  NPFLLPDHSPSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIFN  400

Query  386  ERGIEAPTTVKLFPLKSERSSSGLIEFSSVGIAVAAIMECNHTALENSNGKFPYIMKLCF  445
             + + A T+V+LFPLK+ERSSSGLIEFS++  AV AIM+CNH  +E    KFP+IMKLCF
Sbjct  401  IKDVPA-TSVRLFPLKTERSSSGLIEFSNISQAVLAIMKCNHLPIEGKGTKFPFIMKLCF  459

Query  446  SSSRTI  451
            SSS+++
Sbjct  460  SSSKSM  465


>A0A0B4K852_DROME unnamed protein product
Length=497

 Score = 483 bits (1243),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 249/426 (58%), Positives = 308/426 (72%), Gaps = 26/426 (6%)

Query  30   DELRRKREDNNKPNHVLLFTIINPVYPITVEVLHAISAPSGQVQRIVIFKKNGVQAMVEF  89
            D+LRRKR +  +PNH+LLFTIINP YPITV+VLH I  P GQV RIVIFKKNGVQAMVEF
Sbjct  67   DDLRRKRPETTRPNHILLFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEF  126

Query  90   DTVESATRAKETLHGADIYSGCCTLKIDFAKPTKLNVYKNDAE-SWDYTTPTLGSSAHKN  148
            D +++ATRA+E L+GADIY+GCCTLKID+AKP KLNVYKN+ + SWDYT  T        
Sbjct  127  DNLDAATRARENLNGADIYAGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLST--GEILPI  184

Query  149  DATGNGRPAPLLAEPRYGAAPQPYGSTPQVTFPPGAG---HDRYEENFNGPATYPEPYVE  205
               GNGR +PLL EP Y    +P    P   FPP      H    EN+ G A +P     
Sbjct  185  KEIGNGR-SPLLQEPLY----EPPLLGPGAAFPPFGAPEYHTTTPENWKGAAIHPT----  235

Query  206  RYGIKSDFSGREPIHPTPPRPGYVPTLGQTPPSSTQGSVMMVYGLQPDKVNTDKLFNLFC  265
              G+  + +G  P    P        +  TP    QG+VMMVYGL  D  NTDKLFNL C
Sbjct  236  --GLMKEPAGVVPGRNAP--------VAFTPQGQAQGAVMMVYGLDHDTSNTDKLFNLVC  285

Query  266  LYGNVTKVKFLKTKEGCAMIQMGDNIAVERCLQNLNNVTIGTDGRLQLGFSKQAFLSDVT  325
            LYGNV ++KFLKTKEG AM+QMGD +AVERC+Q+LNN+ +GT G++Q+ FSKQ FLS+V 
Sbjct  286  LYGNVARIKFLKTKEGTAMVQMGDAVAVERCVQHLNNIPVGTGGKIQIAFSKQNFLSEVI  345

Query  326  NPYILPDKTASFKDFTGSKNNRFLNPAMANKNRIQPPSKIVHFFNTPPDLTEETVHRVFV  385
            NP++LPD + SFK++TGSKNNRFL+PA A+KNRIQPPSKI+HFFNTPP LTE+ +  +F 
Sbjct  346  NPFLLPDHSPSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIFN  405

Query  386  ERGIEAPTTVKLFPLKSERSSSGLIEFSSVGIAVAAIMECNHTALENSNGKFPYIMKLCF  445
             + + A T+V+LFPLK+ERSSSGLIEFS++  AV AIM+CNH  +E    KFP+IMKLCF
Sbjct  406  IKDVPA-TSVRLFPLKTERSSSGLIEFSNISQAVLAIMKCNHLPIEGKGTKFPFIMKLCF  464

Query  446  SSSRTI  451
            SSS+++
Sbjct  465  SSSKSM  470



Lambda      K        H
   0.315    0.133    0.398 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5412849180


Query= XP_003392981.2 LOW QUALITY PROTEIN: protein RRNAD1 [Bombus
terrestris]

Length=493
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q93574_CAEEL  unnamed protein product                                 112     1e-26
Q8I4K4_CAEEL  unnamed protein product                                 105     2e-24
ADH2_ENTHI  unnamed protein product                                   35.0    0.16 


>Q93574_CAEEL unnamed protein product
Length=478

 Score = 112 bits (280),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 125/506 (25%), Positives = 214/506 (42%), Gaps = 77/506 (15%)

Query  27   VLDVYGWLLNSYIVDFFQDELWDKLPGSWRF-----ALQDTPP--REFGKWLSGDISCTR  79
            V+  Y  +LNS  +++F    WD L   WR      +L+D           +S D  C  
Sbjct  9    VVSKYRRILNSRSIEYFASSSWDLLEDEWREYLNLESLEDVIVFVNSSDNLVSAD--CAS  66

Query  80   VWPLTLLALRQVANILQVNRDHEDPKSTLTCEFNKVITNNNNKICKISRNDTFDKLYSQD  139
            + P +L  L+    + + NR   +  S L  ++     +          N +F  + S  
Sbjct  67   I-PHSLRDLKANLKLFEYNRKCVENPSDLWRQWTGTTRD--------GLNASFRTISSA-  116

Query  140  QKFNNLFSKHIKKKKRYEIHEIAEVCAGCAY-----EASCKCIIDIGSGMGHLARILAFQ  194
               N L  K IK KK++EI  I E+ +               ++DIG+G+GHL+R+++  
Sbjct  117  ---NGLVRKRIKAKKQHEIDRIVELISQIQIFQKDSADPIDSLVDIGAGIGHLSRMISIH  173

Query  195  YGLNVTCIEQDCILLQQARKWDQELL---TSIRKHIPNFHQKCPQHFTAKLESSSLVESE  251
              ++V  +E +      A   D++LL     I   I NF+ K     +  +  ++ V  +
Sbjct  174  NNISVMAVEGNQQFTLAANSLDEKLLLDSAKIGSRIENFNVK-----STPIRYTNFVTED  228

Query  252  LVNRLKELFQNEFDLSETETEFGLIGLHPCGDLAPILLKFYSSRSEAKFICIVGCCY---  308
            L  ++ +   N            L+GLH CGD +  +LK +    ++K + + GCCY   
Sbjct  229  LALKIDDFAVNSA---------ILVGLHCCGDFSSTILKVFQKSEKSKALVLFGCCYHKE  279

Query  309  ------MKLTIQSETRELKG---------YPLSQYLLARKNHLLTYTALEVACHAIEKYC  353
                  ++       RE+           +PLS+     +N  + Y   E ACH  E   
Sbjct  280  FQCFHFLRPENNENEREISENTSFGKSTVFPLSKKW---ENVEIDYLLREAACHNNENLE  336

Query  354  DKLKNGNYEDLIVHTYRAALETILVKXNE--KLRHSQFRNVK-VSKGMTFEQYCNVATAN  410
            ++      +  +    R+ LE  + K +E  + R+    +VK +    TFE+Y   A AN
Sbjct  337  ERFLKQKID--LSRYARSYLEKWIWKVSELPEDRNIGMCSVKCIENQTTFEEYIRKAMAN  394

Query  411  -----FDAYLQPQESDINNLEINNLLNRWEQVIIFGSLRMMLAPLVETIVLYDRFLFLSE  465
                  D  LQ       +  +++L  R  Q   F  LR M AP +E+ ++ DR   L E
Sbjct  395  RGNHLLDKVLQIIPQSELSAHVSSL--RSSQFDSFEVLRCMFAPAIESAIIDDRVELLRE  452

Query  466  KSLTPTLKPVFDSRLSPRNLVLMSRK  491
              +   + P+F+  +SPRNL +++ K
Sbjct  453  NGINSRVVPLFEPSISPRNLAIIAYK  478


>Q8I4K4_CAEEL unnamed protein product
Length=440

 Score = 105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 99/383 (26%), Positives = 169/383 (44%), Gaps = 55/383 (14%)

Query  143  NNLFSKHIKKKKRYEIHEIAEVCAGCAY-----EASCKCIIDIGSGMGHLARILAFQYGL  197
            N L  K IK KK++EI  I E+ +               ++DIG+G+GHL+R+++    +
Sbjct  79   NGLVRKRIKAKKQHEIDRIVELISQIQIFQKDSADPIDSLVDIGAGIGHLSRMISIHNNI  138

Query  198  NVTCIEQDCILLQQARKWDQELL---TSIRKHIPNFHQKCPQHFTAKLESSSLVESELVN  254
            +V  +E +      A   D++LL     I   I NF+ K     +  +  ++ V  +L  
Sbjct  139  SVMAVEGNQQFTLAANSLDEKLLLDSAKIGSRIENFNVK-----STPIRYTNFVTEDLAL  193

Query  255  RLKELFQNEFDLSETETEFGLIGLHPCGDLAPILLKFYSSRSEAKFICIVGCCY------  308
            ++ +   N            L+GLH CGD +  +LK +    ++K + + GCCY      
Sbjct  194  KIDDFAVNSA---------ILVGLHCCGDFSSTILKVFQKSEKSKALVLFGCCYHKEFQC  244

Query  309  ---MKLTIQSETRELKG---------YPLSQYLLARKNHLLTYTALEVACHAIEKYCDKL  356
               ++       RE+           +PLS+     +N  + Y   E ACH  E   ++ 
Sbjct  245  FHFLRPENNENEREISENTSFGKSTVFPLSKKW---ENVEIDYLLREAACHNNENLEERF  301

Query  357  KNGNYEDLIVHTYRAALETILVKXNE--KLRHSQFRNVK-VSKGMTFEQYCNVATAN---  410
                 +  +    R+ LE  + K +E  + R+    +VK +    TFE+Y   A AN   
Sbjct  302  LKQKID--LSRYARSYLEKWIWKVSELPEDRNIGMCSVKCIENQTTFEEYIRKAMANRGN  359

Query  411  --FDAYLQPQESDINNLEINNLLNRWEQVIIFGSLRMMLAPLVETIVLYDRFLFLSEKSL  468
               D  LQ       +  +++L  R  Q   F  LR M AP +E+ ++ DR   L E  +
Sbjct  360  HLLDKVLQIIPQSELSAHVSSL--RSSQFDSFEVLRCMFAPAIESAIIDDRVELLRENGI  417

Query  469  TPTLKPVFDSRLSPRNLVLMSRK  491
               + P+F+  +SPRNL +++ K
Sbjct  418  NSRVVPLFEPSISPRNLAIIAYK  440


>ADH2_ENTHI unnamed protein product
Length=870

 Score = 35.0 bits (79),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 47/137 (34%), Gaps = 19/137 (14%)

Query  283  DLAPILLKFYSSRSEAKFICI-----VGCCYMKLTIQSETRELKGYPLSQYLL-------  330
            DL     KF +   +A+ ICI      G       + S+    K YPL+ Y L       
Sbjct  585  DLRKRAFKFPTMGKKARLICIPTTSGTGSEVTPFAVISDHETGKKYPLADYSLTPSVAIV  644

Query  331  ------ARKNHLLTYTALEVACHAIEKYCDKLKNGNYEDLIVHTYRAALETILVKXNEKL  384
                  +     +  T L+V  HA E Y   + N   + L     +   E +L   N  L
Sbjct  645  DPMFTMSLPKRAIADTGLDVLVHATEAYVSVMANEYTDGLAREAVKLVFENLLKSYNGDL  704

Query  385  R-HSQFRNVKVSKGMTF  400
                +  N     GM F
Sbjct  705  EAREKMHNAATIAGMAF  721



Lambda      K        H
   0.315    0.133    0.398 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5412849180


Query= XP_003392983.2 LOW QUALITY PROTEIN: smad nuclear-interacting protein
1 [Bombus terrestris]

Length=194
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8IEN7_PLAF7  unnamed protein product                                 139     2e-38
Q580T9_TRYB2  unnamed protein product                                 73.2    1e-15
Q9V7W9_DROME  unnamed protein product                                 68.9    9e-14


>Q8IEN7_PLAF7 unnamed protein product
Length=561

 Score = 139 bits (349),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 101/152 (66%), Gaps = 12/152 (8%)

Query  37   PNFELSGKLTEDTNTVNGVVIKYSEPADARKPKRRWRLYPFKEEKA---LPTLYIHRQSA  93
             NF  SG L ++    NG+ +KY+E  DA KP ++WRLY FK+         L+IH +S 
Sbjct  414  QNFNPSGLLAQEKIYKNGIEMKYTESIDAEKPDKKWRLYMFKDSNNNEPQKILHIHDKSY  473

Query  94   YLMGRDRKVADIPLDHPSCSKQHAVLQYRLVSFQKEDGGEGRRIRPYLIDLESANGTFVN  153
            YL+G+++   DI L++ S SKQHAV+Q     F+K +     +I P+L+DL S NGT++N
Sbjct  474  YLIGKEQLAVDIQLNNISISKQHAVIQ-----FKKHES----KILPFLLDLNSTNGTYIN  524

Query  154  NVKLEPRRYHELLERDVIRFGYSSREYVLLHE  185
            N K++P +Y+EL E D+IRFG S+RE+VLLH+
Sbjct  525  NEKIQPNKYYELRETDIIRFGSSNREFVLLHD  556


>Q580T9_TRYB2 unnamed protein product
Length=274

 Score = 73.2 bits (178),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/153 (31%), Positives = 70/153 (46%), Gaps = 41/153 (27%)

Query  72   WRLYPFKEEKALPTLY-IHRQSAYLMGRDRKVADIPLDHPSCSKQHAVLQYRLV------  124
            +RL   KE + + T   I R++  LMG+DR + DIPLDHPSCS QHA L+   V      
Sbjct  120  YRLRVLKEGETVATFNDISRRAVTLMGKDRGINDIPLDHPSCSAQHAALEVNFVHRNSEP  179

Query  125  --------------------------------SFQKEDGGEGRR--IRPYLIDLESANGT  150
                                               +E GG+     +   ++DL S NGT
Sbjct  180  FQQRLHTLMQEEYRNINWSSPDEVGKLCAHALQLMREFGGDEDMWLMELQVVDLGSTNGT  239

Query  151  FVNNVKLEPRRYHELLERDVIRFGYSSREYVLL  183
             +N   L P     ++E DV+ FGYS+R+Y+++
Sbjct  240  NLNGELLRPLERATVIEGDVLTFGYSTRKYLIV  272


>Q9V7W9_DROME unnamed protein product
Length=383

 Score = 68.9 bits (167),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 61/125 (49%), Gaps = 13/125 (10%)

Query  59   YSEPADARKPKRRWRLYPFKEEKALPTLYIHRQSAYLMGRDRKVADIPLDHPSCSKQHAV  118
            Y  P+ A KP     L   K++K +  L +  +  YL GR+ ++ D  +DH SCS+ H+ 
Sbjct  5    YDIPSWAGKPPTGLHLDVLKDDKLVQKLMVDEKRCYLFGRNSQMNDFCIDHASCSRVHSA  64

Query  119  LQYRLVSFQKEDGGEGRRIR-PYLIDLESANGTFVNNVKLEPRRYHELLERDVIRFGYSS  177
              Y             + +   YL+DL S +GTF+  ++LE  +  +L       FG S+
Sbjct  65   FVYH------------KHLNIAYLVDLGSTHGTFIGTLRLEAHKPTQLQINSTFHFGAST  112

Query  178  REYVL  182
            R Y+L
Sbjct  113  RNYIL  117



Lambda      K        H
   0.315    0.133    0.398 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5412849180


Query= XP_003392984.1 proto-oncogene tyrosine-protein kinase ROS isoform X3
[Bombus terrestris]

Length=2586
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

7LESS_DROME  unnamed protein product                                  741     0.0  
Q8SWV4_DROME  unnamed protein product                                 295     1e-81
Q7KJ08_DROME  unnamed protein product                                 295     7e-80


>7LESS_DROME unnamed protein product
Length=2554

 Score = 741 bits (1912),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 667/2392 (28%), Positives = 1090/2392 (46%), Gaps = 264/2392 (11%)

Query  39    ECASKC-PDLDLNQNRTDDSSSEVGCGIRCKIDQCTKGCGAWQRALDT--SCQAVCNGTQ  95
             +C  +C  + DL  +       +   G +C   +CTKGC  W RAL    SCQ  C   Q
Sbjct  219   DCVQRCIVEEDLFLDEFGIQCEKADNGEKCYKTRCTKGCAQWYRALKELESCQEACLSLQ  278

Query  96    ELLPPKELYCVLGCHDALNRYFQQLKAEIG---------IPSAPALVADSLTATSLRLEW  146
                 P ++ C+  C  A   Y+   +  I          +  AP   AD   +T L + W
Sbjct  279   --FYPYDMPCIGACEMAQRDYWHLQRLAISHLVERTQPQLERAPR--ADG-QSTPLTIRW  333

Query  147   KGIDIERRGGGISYLVQWRY-----EEL--------------AETWQYCRNQSWGEDDQI  187
                  E       + +Q+++     EEL              +  W    +    E    
Sbjct  334   AMHFPEHYLASRPFNIQYQFVDHHGEELDLEQEDQDASGETGSSAWFNLADYDCDEYYVC  393

Query  188   -LVENLQPYTKYRFRVALLLKSSQHNPEPIVSAPSVVIRTLAAGLPTSAPVIVRAVAVDS  246
              ++E L PYT+YRFR  L     ++  E + S  +   +T   G P SAPVI   + +D 
Sbjct  394   EILEALIPYTQYRFRFELPF--GENRDEVLYSPATPAYQTPPEGAPISAPVIEHLMGLDD  451

Query  247   CRASVSWEPGPFPNGPLLSYVLRLQGADHSQLKD--IPASENTDHYMFQNLEPNKNYSIS  304
                +V W PG F NGP+  Y LRL  ++ +   +  +PA   +  Y+F  L+   NY+++
Sbjct  452   SHLAVHWHPGRFTNGPIEGYRLRLSSSEGNATSEQLVPAGRGS--YIFSQLQAGTNYTLA  509

Query  305   VTMRNGVGEGPPAVTCIMTTP---EPAVKDTQQPILILGGQHVVMKQDADMLDDPSVVYE  361
             ++M N  GEGP A   + T     E   KD  + +L++G +  VM Q  +   + S++Y+
Sbjct  510   LSMINKQGEGPVAKGFVQTHSARNEKPAKDLTESVLLVG-RRAVMWQSLEPAGENSMIYQ  568

Query  362   NTSTIRGVAIHVASARLFISDSLGYVYRTSITKRTKPTVILSPSQ-----------ANFK  410
             +   +  +A      +L++ +  G +     + + +   ++SP+Q             + 
Sbjct  569   SQEELADIAWSKREQQLWLLNVHGELR----SLKFESGQMVSPAQQLKLDLGNISSGRWV  624

Query  411   PLSLSVDWLNLHLYILGEV-KHATTVWQIARCNLDGRGLTVAVAGFLTRPTHIEVDPYNG  469
             P  LS DWL+  LY   E  +   + +QI   +L G         F      +EVD  NG
Sbjct  625   PRRLSFDWLHHRLYFAMESPERNQSSFQIISTDLLGESAQKVGESFDLPVEQLEVDALNG  684

Query  470   YLFWVTRGGLYRLDLADISNGVKHEVQPYLILEDANLGAFTVDHTNF--RLLVPHHIQNT  527
             ++FW     L+R DL        H    + +L     G F V   +F   L++P   +  
Sbjct  685   WIFWRNEESLWRQDL--------HGRMIHRLLRIRQPGWFLVQPQHFIIHLMLPQ--EGK  734

Query  528   VISVSLDG--REVINL----RANTQQPKFKNVVSLAM-ANGLFYWTNGEEVLIEGYHSGQ  580
              + +S DG  +  + L          P   +  S A+    L    +G+ +L+E    GQ
Sbjct  735   FLEISYDGGFKHPLPLPPPSNGAGNGPASSHWQSFALLGRSLLLPDSGQLILVE--QQGQ  792

Query  581   NRYFHNAYPDRSNGSFVSVNVLMDASQPVPVPVNPPTGVQAVLGVERAKVSWQAPHLLGG  640
                   ++P ++     +V +L+  SQP+      P  ++A+LG + AK+SW+ P     
Sbjct  793   AASPSASWPLKNLPDCWAVILLVPESQPLTSAGGKPHSLKALLGAQAAKISWKEPERNPY  852

Query  641   QGKGAWQNWSYELEIKDESTGETIHQKDIAGSSHTVHNLREKSEYSIKAAAYTSAGR-GP  699
             Q   A ++WSYELE+ D ++      ++I G    +  L+  + Y ++  A    G  G 
Sbjct  853   QSADAARSWSYELEVLDVASQSAFSIRNIRGPIFGLQRLQPDNLYQLRVRAINVDGEPGE  912

Query  700   WSTEFRGRTLRDGSHASILWSANEG-LLRSDVTGENIDTLIYKAGLKETEVDYHIVDVSW  758
             W+     RT   G H  + W++ +G ++ ++  GE ++  + +  L+       +V+ S 
Sbjct  913   WTEPLAARTWPLGPH-RLRWASRQGSVIHTNELGEGLE--VQQEQLERLPGPMTMVNES-  968

Query  759   YKDILYIVGNNSALYRYNITSHQ---KTKMNIHSVGSVAVDWISKKLYWANPKQQIITRA  815
                + Y V  +  L+  N+   Q        +  VGSV  DW   ++YW +  +  + R 
Sbjct  969   ---VGYYVTGDGLLHCINLVHSQWGCPISEPLQHVGSVTYDWRGGRVYWTDLARNCVVRM  1025

Query  816   NLNGSHQEPMSILAIVKELMIDSLEAYLYWSTGHAVEVARLNGQDRRYYHSDEIFNGKQV  875
             +     +E + +      L +D  + +LY++T   +        +   Y+      G  +
Sbjct  1026  DPWSGSRELLPVFE-ANFLALDPRQGHLYYATSSQLSRHGSTPDEAVTYYRVNGLEGS-I  1083

Query  876   MGLTLDTENRYVYWIVRSYESGSI-VYRAPTS---------ERISMSHKIVPEKVSALQY  925
                 LDT+   ++W+V+   SG++ +YRAP +         ++I    + VP+ +  L+ 
Sbjct  1084  ASFVLDTQQDQLFWLVKG--SGALRLYRAPLTAGGDSLQMIQQIKGVFQAVPDSLQLLR-  1140

Query  926   PNMQGPLCYFSEHLLWLQ-DDRNAVIGDLSGQNTAIINGISLSGLHMVAVMDPALHQYPK  984
                  PL      LLWL+   R A +  L+    A ++ + L      +         P+
Sbjct  1141  -----PLGA----LLWLERSGRRARLVRLA----APLDVMELPTPDQASPASALQLLDPQ  1187

Query  985   NLTSETVAVLPNAVNYSSIRVE-GTWRNFNISWDPVENINYGTVFYEV--KFADYINTNS  1041
              L      V+P  V   S+R++ G W +F++ W P  +    +V Y +  +F   + T  
Sbjct  1188  PLPPRDEGVIPMTVLPDSVRLDDGHWDDFHVRWQPSTSGGNHSVSYRLLLEFGQRLQT--  1245

Query  1042  NPEITTETSMPYNNSEQILPYSVLE--VTVKAFTYWETAHHTRKILRSPQSVPSQPTNPR  1099
                   + S P+    Q LP + L+  +++   T W +   TR  L +P   PSQP   R
Sbjct  1246  -----LDLSTPFARLTQ-LPQAQLQLKISITPRTAWRSGDTTRVQLTTPPVAPSQPRRLR  1299

Query  1100  AFIEFRKEPLSENVDIFAIFRWDQPEFTNGL---ITGYTVQCWFKENNVEMQICDQSLIP  1156
              F+E     L E  ++ A+ RWD PE           Y + CW     V  ++ ++  + 
Sbjct  1300  VFVERLATALQE-ANVSAVLRWDAPEQGQEAPMQALEYHISCW-----VGSELHEELRLN  1353

Query  1157  STLLEHTVQDLLPNTTYYFQVRAHTEIGAGPYTDVISVSTIYENP----IPQLLVATMDA  1212
              + LE  V+ L P+ TY+FQV A             +   ++  P    +P++L A  + 
Sbjct  1354  QSALEARVEHLQPDQTYHFQVEARVAATG--AAAGAASHALHVAPEVQAVPRVLYANAEF  1411

Query  1213  VRISDLDQEMNYTVTRHIAVEVTYLAA---ESKIYWINEMQELVTSDLDGTNATKILTLN  1269
             +   DLD   N     H A  V +L     E ++ W+NE  EL+T  + G+   K+  + 
Sbjct  1412  IGELDLDTR-NRRRLVHTASPVEHLVGIEGEQRLLWVNEHVELLT-HVPGSAPAKLARMR  1469

Query  1270  NSAFSITVDWVARHLYWSE-SSYRENGGCIMKLDLTMWQAGILKYENIVTT--SRRIVNL  1326
                 ++ VDW+ R +YW+E  +       I +LDL  ++  IL+ E + +T   R + +L
Sbjct  1470  AEVLALAVDWIQRIVYWAELDATAPQAAIIYRLDLCNFEGKILQGERVWSTPRGRLLKDL  1529

Query  1327  DILPSTGSLYWIEQTK---KDGGVIMRSNLSGSD-----IQPFFDHIDDCSCPYRPSVIP  1378
               LP   SL W+E  +   ++G +  R+   GS+     +QP    I   +    P    
Sbjct  1530  VALPQAQSLIWLEYEQGSPRNGSLRGRNLTDGSELEWATVQPL---IRLHAGSLEPGSET  1586

Query  1379  VMTIDST------DYQKPVMYWISLEGHLNSADIDGCKCNLIVSAGFNKGLPARSLTVDK  1432
             +  +D+       D  + +    +L   LN    D     L   +G+          V  
Sbjct  1587  LNLVDNQGKLCVYDVARQLCTASALRAQLNLLGEDSIAGQLAQDSGY-------LYAVKN  1639

Query  1433  MNIYWSNIPEDQIYFVNKKYPDDQEIKHFYLPSVRSIKALGKSLQTYPITNCLI-PRQDS  1491
              +I        Q+ +  +  P++          VR ++A   + Q YP  NCL+ P    
Sbjct  1640  WSIRAYGRRRQQLEYTVELEPEE----------VRLLQA--HNYQAYPPKNCLLLPSSGG  1687

Query  1492  YNVEEARKTASSITVRLPEPVPQFGCEGYSLPTTLYTIYVSQCLENDPNMCEDSDRTK--  1549
               ++          + LP       C    +P   Y + ++  L   P   E     +  
Sbjct  1688  SLLKATDCEEQRCLLNLPMITASEDCP-LPIPGVRYQLNLT--LARGPGSEEHDHGVEPL  1744

Query  1550  ---LQTYEKEYEIKDLKPFTKYRLKLALSNYYADSESMSLEFDSGVVLRTEAGAPTAPEN  1606
                L    +   + DL PFT+YR+   LS++Y    ++     + + L T +  P+ P N
Sbjct  1745  GQWLLGAGESLNLTDLLPFTRYRVSGILSSFYQKKLALPTLVLAPLELLTASATPSPPRN  1804

Query  1607  VTVEALTPTLAIVYWMPPKILNAAAVRYEVHWRLVRLINGARQKGEQFIKGTERTTDGRF  1666
              +V  L+P    V W+PP+ L + +V Y +HW+  + ++G   +  +  +  ER  +   
Sbjct  1805  FSVRVLSPRELEVSWLPPEQLRSESVYYTLHWQ--QELDGENVQDRREWEAHERRLETAG  1862

Query  1667  FTMLEPWLPDQEYLVFVRAYPAHVNDVYSESSGQV-VKMYPEPNNLTLTGVSVNSLNVSW  1725
                L    P   Y ++V+A   H     S SS ++ V+ + E   L L  +   SL+++W
Sbjct  1863  THRLTGIKPGSGYSLWVQA---HATPTKSNSSERLHVRSFAELPELQLLELGPYSLSLTW  1919

Query  1726  VPTVDLMVKYTLEYKDVAVENWQEANDFTMENDKVTYFIRKLQPRTLYKFHLLLRYPNYK  1785
               T D +    LE +  A     E     +  +     +  LQPRT Y+  LLL Y    
Sbjct  1920  AGTPDPLGSLQLECRSSA-----EQLRRNVAGNHTKMVVEPLQPRTRYQCRLLLGYAATP  1974

Query  1786  KDFVWPTDGRFTFQTLGDVPSAPGMPTVTKLRNSVYQLNWEPAQAHGSQITLYRVEGMKI  1845
                ++       ++TLGD PS PG P +  +   V+++ W  A+ +G+ I LY +E ++ 
Sbjct  1975  GAPLYHGTAE-VYETLGDAPSQPGKPQLEHIAEEVFRVTWTAARGNGAPIALYNLEALQA  2033

Query  1846  NK------INEQIDSTGNAS--------------WKLYYNGTDNYWIITGDMNDKYR-FR  1884
                        + +S G+                W  + N T+   I+    + +   FR
Sbjct  2034  RSDIRRRRRRRRRNSGGSLEQLPWAEEPVVVEDQWLDFCNTTELSCIVKSLHSSRLLLFR  2093

Query  1885  IQARN-AYGFGSWSRSSPIIDLTEATGGILAAQQHLGLVLGLSVPVITIMLVCFCFFLCP  1943
             ++AR+  +G+G +S  S  +         ++ ++   LVL +  P   +        L  
Sbjct  2094  VRARSLEHGWGPYSEESERV-----AEPFVSPEKRGSLVLAIIAPAAIVSSCVLALVLVR  2148

Query  1944  VYRQRKDDKKAVL----PPLVSDVELATLREIPRGNFVQSNALYASTLQNDPDDSTLPKI  1999
               ++R+   K +L    P + S+  L+TL+   +   V++ A   ST  +D D + LP+I
Sbjct  2149  KVQKRRLRAKKLLQQSRPSIWSN--LSTLQTQQQLMAVRNRAF--STTLSDADIALLPQI  2204

Query  2000  RREQITLAKFLGSGAFGEVFQGNAKDLERPGITPVAIKTLRKGASAQEKTEFLQEARLMS  2059
                Q+ L +FLGSGAFGEV++G  K  +      VAIK+LRKGAS  E  E LQEA+LMS
Sbjct  2205  NWSQLKLLRFLGSGAFGEVYEGQLKTEDSEEPQRVAIKSLRKGAS--EFAELLQEAQLMS  2262

Query  2060  HFRHKHVLRLLGVCLDTDPPLLVLELMEAGDLLSYLRASRSLQPSDPH---ALRLQDLLA  2116
             +F+H++++ L+G+C DT+   L++E MEAGDLLSYLRA+R+    +P     L L +LLA
Sbjct  2263  NFKHENIVCLVGICFDTESISLIMEHMEAGDLLSYLRAARATSTQEPQPTAGLSLSELLA  2322

Query  2117  MCEDVARGCRYLEELHFVHRDLACRNCLVS----ARDRENRVVKIGDFGLARDIYKNDYY  2172
             MC DVA GC YLE++HFVHRDLACRNCLV+    + DR  R VKIGDFGLARDIYK+DYY
Sbjct  2323  MCIDVANGCSYLEDMHFVHRDLACRNCLVTESTGSTDR-RRTVKIGDFGLARDIYKSDYY  2381

Query  2173  RKEGEGLLPVRWMAPESLVDGVFTSQSDVWAFGVLMWEITSLGQQPYPARTNIEVLHHVR  2232
             RKEGEGLLPVRWM+PESLVDG+FT+QSDVWAFGVL WEI +LGQQPY AR N EVL HV+
Sbjct  2382  RKEGEGLLPVRWMSPESLVDGLFTTQSDVWAFGVLCWEILTLGQQPYAARNNFEVLAHVK  2441

Query  2233  AGGRLPKSLNCPPALHQLMLRCWSVAD-ARPSFKVCLENIVSLRSTIEDAQL  2283
              GGRL +   C   L+ L+L CW      RPSF+ C   + ++ + +   Q+
Sbjct  2442  EGGRLQQPPMCTEKLYSLLLLCWRTDPWERPSFRRCYNTLHAISTDLRRTQM  2493


>Q8SWV4_DROME unnamed protein product
Length=1158

 Score = 295 bits (756),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 152/400 (38%), Positives = 244/400 (61%), Gaps = 9/400 (2%)

Query  1879  DKYRFRIQARNAYGFGSWSRSSPIIDLTEATGGILAAQQHLGLVLGLSVPVITIMLVCFC  1938
             D++R +++     G+     +    ++ E  G   ++ Q+L  +L +S+ V+ I +    
Sbjct  524   DEFRSKVRCICPDGWSLKRDNHTACEIREEAGK--SSFQYLVSILMISLAVLFICIAALI  581

Query  1939  FFLCPVYRQRKDDKKAVLPPLVSDVELATLRE-IPRGNFVQSNALYA--STLQNDPDDST  1995
             F L   Y+++K  KK     +  D++L  LR  I   N    N  Y     L    D ++
Sbjct  582   FMLYNRYQRKKQSKKRHKMLVEQDLQLTRLRNNIDDSNLNNFNPNYGCDGILNGHIDVNS  641

Query  1996  LPKIRREQITLAKFLGSGAFGEVFQGNAKDLERPGI-TPVAIKTLRKGASAQEKTEFLQE  2054
             LP++ R+ + L   LG GAFGEV+    +  +   +   VA+KTLR+    +++ +FL+E
Sbjct  642   LPQVARDSLQLVNALGKGAFGEVYMALYRHRDGDAVEMGVAVKTLREDPKREKEEDFLKE  701

Query  2055  ARLMSHFRHKHVLRLLGVCLDTDPPLLVLELMEAGDLLSYLRASRSLQPSDPHALRLQDL  2114
             A +M+ F H +++ L+GVC D  P  +VLEL+  GDL  +LR +R+  P  P  L ++DL
Sbjct  702   AAIMAKFNHPNMVHLIGVCFDRQPYYIVLELLAGGDLQKFLRENRN-TPERPSLLTMKDL  760

Query  2115  LAMCEDVARGCRYLEELHFVHRDLACRNCLVSARDRENRVVKIGDFGLARDIYKNDYYRK  2174
             L    DVA+GCRY+E   F+HRD+A RNCL+S++    RVVKI DFG++RDIY++DYYRK
Sbjct  761   LFCALDVAKGCRYMESKRFIHRDIAARNCLLSSKG-PGRVVKIADFGMSRDIYRSDYYRK  819

Query  2175  EGEGLLPVRWMAPESLVDGVFTSQSDVWAFGVLMWEITSLGQQPYPARTNIEVLHHVRAG  2234
              G+ +LP++WM PE+ +DG+FTS++DVW+FG+L+WE+ SLG+ PYP + N +V+  V  G
Sbjct  820   GGKAMLPIKWMPPEAFLDGIFTSKTDVWSFGILLWEVFSLGRSPYPGQHNTQVMELVVRG  879

Query  2235  GRLPKSLNCPPALHQLMLRCWS-VADARPSFKVCLENIVS  2273
             GRL     CP +++++M  CW+   + RP+F   LE++ +
Sbjct  880   GRLGSPTECPVSIYKVMADCWNPTPEDRPTFITLLEHLTA  919


>Q7KJ08_DROME unnamed protein product
Length=1701

 Score = 295 bits (754),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 152/400 (38%), Positives = 244/400 (61%), Gaps = 9/400 (2%)

Query  1879  DKYRFRIQARNAYGFGSWSRSSPIIDLTEATGGILAAQQHLGLVLGLSVPVITIMLVCFC  1938
             D++R +++     G+     +    ++ E  G   ++ Q+L  +L +S+ V+ I +    
Sbjct  1067  DEFRSKVRCICPDGWSLKRDNHTACEIREEAGK--SSFQYLVSILMISLAVLFICIAALI  1124

Query  1939  FFLCPVYRQRKDDKKAVLPPLVSDVELATLRE-IPRGNFVQSNALYA--STLQNDPDDST  1995
             F L   Y+++K  KK     +  D++L  LR  I   N    N  Y     L    D ++
Sbjct  1125  FMLYNRYQRKKQSKKRHKMLVEQDLQLTRLRNNIDDSNLNNFNPNYGCDGILNGHIDVNS  1184

Query  1996  LPKIRREQITLAKFLGSGAFGEVFQGNAKDLERPGI-TPVAIKTLRKGASAQEKTEFLQE  2054
             LP++ R+ + L   LG GAFGEV+    +  +   +   VA+KTLR+    +++ +FL+E
Sbjct  1185  LPQVARDSLQLVNALGKGAFGEVYMALYRHRDGDAVEMGVAVKTLREDPKREKEEDFLKE  1244

Query  2055  ARLMSHFRHKHVLRLLGVCLDTDPPLLVLELMEAGDLLSYLRASRSLQPSDPHALRLQDL  2114
             A +M+ F H +++ L+GVC D  P  +VLEL+  GDL  +LR +R+  P  P  L ++DL
Sbjct  1245  AAIMAKFNHPNMVHLIGVCFDRQPYYIVLELLAGGDLQKFLRENRNT-PERPSLLTMKDL  1303

Query  2115  LAMCEDVARGCRYLEELHFVHRDLACRNCLVSARDRENRVVKIGDFGLARDIYKNDYYRK  2174
             L    DVA+GCRY+E   F+HRD+A RNCL+S++    RVVKI DFG++RDIY++DYYRK
Sbjct  1304  LFCALDVAKGCRYMESKRFIHRDIAARNCLLSSKG-PGRVVKIADFGMSRDIYRSDYYRK  1362

Query  2175  EGEGLLPVRWMAPESLVDGVFTSQSDVWAFGVLMWEITSLGQQPYPARTNIEVLHHVRAG  2234
              G+ +LP++WM PE+ +DG+FTS++DVW+FG+L+WE+ SLG+ PYP + N +V+  V  G
Sbjct  1363  GGKAMLPIKWMPPEAFLDGIFTSKTDVWSFGILLWEVFSLGRSPYPGQHNTQVMELVVRG  1422

Query  2235  GRLPKSLNCPPALHQLMLRCWS-VADARPSFKVCLENIVS  2273
             GRL     CP +++++M  CW+   + RP+F   LE++ +
Sbjct  1423  GRLGSPTECPVSIYKVMADCWNPTPEDRPTFITLLEHLTA  1462



Lambda      K        H
   0.315    0.133    0.398 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5412849180


Query= XP_003392985.1 prefoldin subunit 3 [Bombus terrestris]

Length=190
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PFD3_DROME  unnamed protein product                                   226     5e-76
PFD3_CAEEL  unnamed protein product                                   136     9e-41
ACT2_TRYBB  unnamed protein product                                   31.2    0.48 


>PFD3_DROME unnamed protein product
Length=194

 Score = 226 bits (576),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 140/174 (80%), Gaps = 3/174 (2%)

Query  12   LDKEKKSYAGIPEAEFVDDVDAFMARPENESADKVLQMLDESHGKYKFMEYNLFNKRRRL  71
            L + +K++AGIPEA F++++D FM++PENE+ +KVLQ LDE HGKY+FM  NL  +RR+L
Sbjct  13   LPENQKTFAGIPEAVFLEEIDTFMSQPENENCEKVLQRLDEQHGKYRFMACNLEARRRKL  72

Query  72   KAQIPDLERSLEMIKKLQQEKNKSKELETQFLLSEQVYAKAVIPPTDKVCLWLGANVMLE  131
            K+QIPDLERSLEM+  L++E    +E ETQFLLS+QV+ K ++PPT  V LWLGA+VMLE
Sbjct  73   KSQIPDLERSLEMVNVLRKE---DEERETQFLLSDQVFIKTLVPPTKTVYLWLGASVMLE  129

Query  132  YTLDDAQEMLTKNIEAAKRNLGYVEHDLDFVRDQFTTTEVNMARIYNWEVKRRQ  185
            Y LD+A+ +L +NI +A  NL  VEHD DF+RDQ TTTEVNMAR+YNW VK+RQ
Sbjct  130  YPLDEAEALLNQNITSAVGNLKSVEHDQDFLRDQITTTEVNMARVYNWGVKKRQ  183


>PFD3_CAEEL unnamed protein product
Length=185

 Score = 136 bits (343),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 66/170 (39%), Positives = 116/170 (68%), Gaps = 1/170 (1%)

Query  18   SYAGIPEAEFVDDVDAFMARPENESADKVLQMLDESHGKYKFMEYNLFNKRRRLKAQIPD  77
            S  GIP++E ++DV++++ + E  S ++   +L E +GKYK++E ++  ++ R+  +IP+
Sbjct  9    SARGIPKSELIEDVESWLTK-EKLSIEEAEVVLREKYGKYKYVESSMLAQKVRMSEKIPE  67

Query  78   LERSLEMIKKLQQEKNKSKELETQFLLSEQVYAKAVIPPTDKVCLWLGANVMLEYTLDDA  137
             E SL +I  L  ++   +  ET FLLS+ VY KA +   +KV +WLGANVM+EY L++A
Sbjct  68   FENSLSIIDTLIAKRAADESFETTFLLSDDVYTKATVQKPEKVSIWLGANVMVEYDLENA  127

Query  138  QEMLTKNIEAAKRNLGYVEHDLDFVRDQFTTTEVNMARIYNWEVKRRQAA  187
            +++L KN  + ++ +  + ++L +++DQ TTTEVNM+ I N+ V +R+AA
Sbjct  128  RKLLDKNRGSVQKVVDELTNELSYIKDQITTTEVNMSHIVNFGVNKRRAA  177


>ACT2_TRYBB unnamed protein product
Length=376

 Score = 31.2 bits (69),  Expect = 0.48, Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 37/89 (42%), Gaps = 11/89 (12%)

Query  50   LDESHGKYKFMEYNLFNK-----RRRLKAQIPDLERSLEMIKKLQQEKNKSKELETQFLL  104
            LDE+ G ++ M +   NK     RR L   I  L     M K L +   K    E   L 
Sbjct  269  LDEAPGFHE-MTFQSINKCDIDVRRDLYGNI-VLSGGTTMFKNLPERLGK----EISNLA  322

Query  105  SEQVYAKAVIPPTDKVCLWLGANVMLEYT  133
               +  K V PP  K  +W+G +++   T
Sbjct  323  PSSIKPKVVAPPERKYSVWIGGSILSSLT  351



Lambda      K        H
   0.315    0.133    0.398 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5412849180


Query= XP_003392987.1 C-Myc-binding protein isoform X1 [Bombus terrestris]

Length=93
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q38E79_TRYB2  unnamed protein product                                 75.9    1e-19
Q9VF23_DROME  unnamed protein product                                 73.9    7e-17
Q38BT6_TRYB2  unnamed protein product                                 29.6    0.32 


>Q38E79_TRYB2 unnamed protein product
Length=84

 Score = 75.9 bits (185),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 59/81 (73%), Gaps = 2/81 (2%)

Query  3   NFKPPDSKREEFRKYLERAGVMDALTKVLVSLYEEPEKPDDALEYIRQNLGGITEVDIEV  62
           +++  ++K+EEFRKYLE   V+D LT+VLV+LYEEPEKPDD +++I++ LGG +  D E 
Sbjct  2   SYQSSEAKKEEFRKYLEGKQVIDTLTRVLVNLYEEPEKPDDPVDFIKKVLGGASTADYE-  60

Query  63  QTLKKELEEAKAKITELKAKL  83
             L++E    KA++  LK +L
Sbjct  61  -ALQQENACLKAEVAALKKRL  80


>Q9VF23_DROME unnamed protein product
Length=457

 Score = 73.9 bits (180),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 55/76 (72%), Gaps = 0/76 (0%)

Query  8   DSKREEFRKYLERAGVMDALTKVLVSLYEEPEKPDDALEYIRQNLGGITEVDIEVQTLKK  67
           +SKR ++RKYLERAGV+DAL+K L+ LYEE  KP+DA+ ++R+ +      D +   +K 
Sbjct  5   ESKRVQYRKYLERAGVIDALSKALIKLYEEQNKPEDAIRFVRKFMCESCPDDAQYDVMKN  64

Query  68  ELEEAKAKITELKAKL  83
           +LEEAK  I++L+ +L
Sbjct  65  DLEEAKTHISKLEQEL  80


>Q38BT6_TRYB2 unnamed protein product
Length=698

 Score = 29.6 bits (65),  Expect = 0.32, Method: Composition-based stats.
 Identities = 16/43 (37%), Positives = 27/43 (63%), Gaps = 1/43 (2%)

Query  9    SKREEFRKYLERAGVMDALTKVLVSLYEEPEKPDDALEYIRQN  51
            SK ++F K  ER   + ALTKVLV  + +PE  ++   Y++++
Sbjct  630  SKHKQFCKLYERRRALVALTKVLVKKW-DPELEEELQHYVQES  671



Lambda      K        H
   0.315    0.133    0.398 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5412849180


Query= XP_003392988.1 transmembrane protein 267 isoform X1 [Bombus
terrestris]

Length=206


***** No hits found *****



Lambda      K        H
   0.315    0.133    0.398 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5412849180


Query= XP_003392989.1 uncharacterized protein LOC100648386 [Bombus
terrestris]

Length=103
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q582Y4_TRYB2  unnamed protein product                                 32.3    0.037
Q388N2_TRYB2  unnamed protein product                                 31.2    0.12 
Q54D12_DICDI  unnamed protein product                                 27.3    2.6  


>Q582Y4_TRYB2 unnamed protein product
Length=313

 Score = 32.3 bits (72),  Expect = 0.037, Method: Composition-based stats.
 Identities = 22/71 (31%), Positives = 31/71 (44%), Gaps = 7/71 (10%)

Query  4    DDLLLYLAIAAGIVGGALLLLFVLVFVLFVKVNRLSKDGFNHPNRQ--NMIADYCYTNPT  61
            D LLLY+AI     G A   LF+L+ V       L+   +   N+Q    ++D C     
Sbjct  87   DSLLLYIAITHSYEGAAFQFLFILLLVA-----SLTPFAWRFANKQCAEEVSDRCPAGIN  141

Query  62   IVPGELLSRRG  72
             +P  L  R G
Sbjct  142  PLPQHLFRREG  152


>Q388N2_TRYB2 unnamed protein product
Length=472

 Score = 31.2 bits (69),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 14/57 (25%), Positives = 29/57 (51%), Gaps = 6/57 (11%)

Query  36   NRLSKDGFNHPNR------QNMIADYCYTNPTIVPGELLSRRGFSMYSGSENIDDDY  86
            ++++ D   HPNR        +I +  +++P  +PG   S+RG S  S   ++ + +
Sbjct  334  DKVTLDDLQHPNRFRDIPESGLICESLWSDPQPMPGRAPSKRGVSCLSFGPDVTETF  390


>Q54D12_DICDI unnamed protein product
Length=455

 Score = 27.3 bits (59),  Expect = 2.6, Method: Composition-based stats.
 Identities = 11/18 (61%), Positives = 13/18 (72%), Gaps = 0/18 (0%)

Query  48   RQNMIADYCYTNPTIVPG  65
            R+ MI D  YT PT+VPG
Sbjct  254  REQMIPDVEYTLPTLVPG  271



Lambda      K        H
   0.315    0.133    0.398 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5412849180


Query= XP_003392991.1 uncharacterized protein LOC100648618 [Bombus
terrestris]

Length=805
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SAX3_CAEEL  unnamed protein product                                   51.2    3e-06
DSCL_DROME  unnamed protein product                                   39.7    0.014
G5EDG4_CAEEL  unnamed protein product                                 39.3    0.015


>SAX3_CAEEL unnamed protein product
Length=1273

 Score = 51.2 bits (121),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 80/345 (23%), Positives = 136/345 (39%), Gaps = 43/345 (12%)

Query  164  KHEQTGYWSCAARTSTNDPFTSTEPAKLSIVNEHQNPLIVFAKLDNVVEVPAGSSAQIMC  223
            K    G + C A     +  ++    KL+++ E       F      V+   G  A + C
Sbjct  101  KDSDAGAYYCVASNEHGEVKSNEGSLKLAMLRED------FRVRPRTVQALGGEMAVLEC  154

Query  224  QMKASVRECQWSWRQLNQSQPWNLEVKRFPAFGNDSTDCSIKFKNVLPEQEGYWTC----  279
                   E   SWR+ ++     L ++  P +   S D ++    V     G + C    
Sbjct  155  SPPRGFPEPVVSWRKDDKE----LRIQDMPRYTLHS-DGNLIIDPVDRSDSGTYQCVANN  209

Query  280  --GGRIDPNSSFTQSNPIRFLISEV-EFVQLSRGIQVAPGESVLLRCLVNKPVVQCEWSW  336
              G R+        SNP R  + E  +F Q  + + V  G +VL  C V     Q + +W
Sbjct  210  MVGERV--------SNPARLSVFEKPKFEQEPKDMTVDVGAAVLFDCRVTGDP-QPQITW  260

Query  337  RASNSSQAPLLVKKFNPNKDADHDCSVRFKNVLYEEEGLWTCGVRLSPHGILHEAPPATV  396
            +  N    P+ V +    KD   +  +R + V   +EG + C  R +P G L     A+ 
Sbjct  261  KRKNE---PMPVTRAYIAKD---NRGLRIERVQPSDEGEYVCYAR-NPAGTLE----ASA  309

Query  397  SLLPTAKVNFVEMPSDTSVPIGTEATLKCVTSSRVEKCTWTWKSLHGNEPEIVAQEYPSN  456
             L   A  +F   P+D SVP G  AT +C    +     + W S  G +  +      ++
Sbjct  310  HLRVQAPPSFQTKPADQSVPAGGTATFECTLVGQPSPA-YFW-SKEGQQDLLFPSYVSAD  367

Query  457  G--DLGRDCSLTLPRVYAEKQGQWACQVSISSLNTMLTSPFVKLT  499
            G   +    +LT+  V    +G + C   ++S  + L+   +K+T
Sbjct  368  GRTKVSPTGTLTIEEVRQVDEGAYVC-AGMNSAGSSLSKAALKVT  411


 Score = 42.0 bits (97),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 58/268 (22%), Positives = 98/268 (37%), Gaps = 34/268 (13%)

Query  267  KNVLPEQEGYWTCGGRIDPNSSFTQSNPIRFLISEVEFVQLSRGIQVAPGESVLLRCLVN  326
            KN      G + C    +     +    ++  +   +F    R +Q   GE  +L C   
Sbjct  98   KNGKDSDAGAYYCVASNEHGEVKSNEGSLKLAMLREDFRVRPRTVQALGGEMAVLECSPP  157

Query  327  KPVVQCEWSWRASNSSQAPLLVKKFNPNKDADHDCSVRFKNVLYEEEGLWTC------GV  380
            +   +   SWR  +     L ++   P      D ++    V   + G + C      G 
Sbjct  158  RGFPEPVVSWRKDDKE---LRIQDM-PRYTLHSDGNLIIDPVDRSDSGTYQCVANNMVGE  213

Query  381  RLSPHGILHEAPPATVSLLPTAKVNFVEMPSDTSVPIGTEATLKC-VTSSRVEKCTWTWK  439
            R+S         PA +S+    K  F + P D +V +G      C VT     + TW  K
Sbjct  214  RVS--------NPARLSVFEKPK--FEQEPKDMTVDVGAAVLFDCRVTGDPQPQITWKRK  263

Query  440  SLHGNEPEIVAQEYPSNGDLGRDCSLTLPRVYAEKQGQWACQVSISSLNTMLTSPFVKLT  499
                NEP  V + Y +  + G    L + RV    +G++ C  + +   T+  S  +++ 
Sbjct  264  ----NEPMPVTRAYIAKDNRG----LRIERVQPSDEGEYVC-YARNPAGTLEASAHLRV-  313

Query  500  VFEQDEVKFSELSQDIQISAGGSVFLHC  527
               Q    F     D  + AGG+    C
Sbjct  314  ---QAPPSFQTKPADQSVPAGGTATFEC  338


>DSCL_DROME unnamed protein product
Length=2074

 Score = 39.7 bits (91),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 89/405 (22%), Positives = 162/405 (40%), Gaps = 60/405 (15%)

Query  293  NPIRFLISEVEFVQLSRGIQVAPGESVLLRCLVNKPVVQCEWSWRASNSSQA-PLL----  347
            N  R +IS    V+ +  +QV+  E  +L C V +     E+SW   N +   P+L    
Sbjct  230  NSHRGIISP-SVVEHTAHVQVSQDEGAVLLC-VAQGCPSPEYSWFTHNGAGPLPVLSGPR  287

Query  348  VKKFNPNKDADHDCSVRFKNVLYEEEGLWTCGVRLSPHGILHEAPPATVSLLPTAKVNFV  407
            V+   P         +  + V  E+ G++ C       G +     A + L     +   
Sbjct  288  VRLLGP--------ILAIEAVTGEDSGVYKCTA-----GNVGGEASAELRLTVATPIQVE  334

Query  408  EMPSDTSVPIGTEATLKCVTSSR-----VEKCTWTWKSLHGNEPEIVAQEYPSNGDLGRD  462
              P+  SV +G  A  +C+ +S      ++   W +K           ++ PS+G +  +
Sbjct  335  ISPNVLSVHMGGTAEFRCLVTSNGSPVGMQNILW-YKD---------GRQLPSSGRV--E  382

Query  463  CSLTLPRVYAEKQGQWACQVSISSLNTMLTSPFVKLTVFEQDEVKFSELSQDIQISAGGS  522
             +L +PRV  E +G + C V     +T   +  ++L       + +S + Q +Q   G +
Sbjct  383  DTLVVPRVSRENRGMYQCVVRRPEGDTFQATAELQLG-DAPPVLLYSFIEQTLQ--PGPA  439

Query  523  VFLHC-VTSSAVEQCRWSLT--PVNSNTTVVVKQFPAAGSEARDCSVRLTHALAEQEGLW  579
            V L C    +   Q  W+L   P+ SN   ++ Q+     +     V ++H + E  G +
Sbjct  440  VSLKCSAAGNPTPQISWTLDGFPLPSNGRFMIGQYITVHGDV-ISHVNISHVMVEDGGEY  498

Query  580  TCGARVR-GKQNYTDAPPAKLSLLEPEPVTV--ALWAVPHQMTTLSCKVETVLSKVQCHW  636
             C A  R G+  +     A+L++     + +   + AV  +   L C V     + + HW
Sbjct  499  ACIAENRAGRVQHA----ARLNIYGLPYIRLIPKVTAVSGETLNLKCPVAGYPIE-EIHW  553

Query  637  IHAPKTHIFQNISETKRHNVQMDYHTGVCTLEFKPDHSDLGNWMC  681
                +      + +  R  VQ D   G  T+     +SD G + C
Sbjct  554  ERGGR-----ELPDDIRQRVQPD---GSLTISPVQKNSDSGVYTC  590


>G5EDG4_CAEEL unnamed protein product
Length=5213

 Score = 39.3 bits (90),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 46/221 (21%), Positives = 85/221 (38%), Gaps = 27/221 (12%)

Query  466  TLPRVYAEKQGQWACQVSISSLNTMLTSPFVKLTVFEQDEVKFSELSQDIQISAGGSVFL  525
            T+P +  +  G++ C+V  ++ N  + +   ++   E     F    +++ +  G + FL
Sbjct  485  TIPELSLKDAGEYECRVISNNGNYSVKT---RVETRESPPEIFG--VRNVSVPLGEAAFL  539

Query  526  HCVTSSAVE-QCRWSLTPVNSNTTVVVKQFPAAGSEARDCSVRLTHALAEQEGLWTCGAR  584
            HC T SA E + RW      +     V   P       + ++++ H      G++ C AR
Sbjct  540  HCSTRSAGEVEIRW------TRYGATVFNGPNTERNPTNGTLKIHHVTRADAGVYECMAR  593

Query  585  VRGKQNYTDAPPAKLSLLEPEPVTVALWAVPHQM---TTLSCKVETVLSKVQCHWIHAPK  641
              G  +       +L ++EP  V V    V   M     LSC+      K + HW    +
Sbjct  594  NAGGMS---TRKMRLDIMEPPSVKVTPQDVYFNMREGVNLSCEAMGD-PKPEVHWYFKGR  649

Query  642  THIFQNISETKRHNVQMDYHTGVCTLEFKPDHSDLGNWMCK  682
             H+  +       + +  Y            H D G + C+
Sbjct  650  -HLLNDYKYQVGQDSKFLYIRDAT-------HHDEGTYECR  682


 Score = 35.0 bits (79),  Expect = 0.34, Method: Compositional matrix adjust.
 Identities = 30/131 (23%), Positives = 55/131 (42%), Gaps = 19/131 (15%)

Query  200   PLIVFAKLDNVVEVPAGSSAQIMCQMKASVRECQWSWRQLNQSQPWNLEVKRFPAFGNDS  259
             P  +F    +  E+ A ++ +I C+ +  +   + SW      +P    +   P      
Sbjct  3034  PPKIFGDSFSTTEIVADTTLEIPCRTEG-IPPPEISW--FLDGKP----ILEMPGVTYKQ  3086

Query  260   TDCSIKFKNVLPEQEGYWTC-----GGRIDPNSSFTQSNPIRFLISEVEFVQLSRGIQVA  314
              D S++  N+ P QEG +TC      GR + ++    S P R +++       S  ++V 
Sbjct  3087  GDLSLRIDNIKPNQEGRYTCVAENKAGRAEQDTYVEISEPPRVVMA-------SEVMRVV  3139

Query  315   PGESVLLRCLV  325
              G    +RC V
Sbjct  3140  EGRQTTIRCEV  3150



Lambda      K        H
   0.315    0.133    0.398 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5412849180


Query= XP_003392992.1 LOW QUALITY PROTEIN: CWF19-like protein 1 [Bombus
terrestris]

Length=527
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q57X52_TRYB2  unnamed protein product                                 31.6    1.9  
Q38AF8_TRYB2  unnamed protein product                                 30.4    3.9  
CADE_DROME  unnamed protein product                                   29.6    8.1  


>Q57X52_TRYB2 unnamed protein product
Length=926

 Score = 31.6 bits (70),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 32/63 (51%), Gaps = 7/63 (11%)

Query  22   KFLFNKIDAINKKSGPFDFLLCVGNFFGEDNTELED-YKSGMKSIPVPTYIIGANEEVDL  80
            K L ++IDA   + G  D L   G   GE N   ED Y+  M+S    T +  A EE+ L
Sbjct  428  KDLTSEIDA---RRGVIDKL--TGQL-GEANARNEDLYRKVMQSSEFSTQLRSATEEMQL  481

Query  81   NNY  83
            NN+
Sbjct  482  NNF  484


>Q38AF8_TRYB2 unnamed protein product
Length=457

 Score = 30.4 bits (67),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 24/87 (28%), Positives = 41/87 (47%), Gaps = 12/87 (14%)

Query  408  CQLQVVPIHKNQAAALKEAFEEMAQCNNFKISELPPHTDLQQIAQPGVLYFYAELPDRQK  467
            C+++V+P     AAA  +AFEE  +   F   +L   +  Q I   G L  ++  P+ Q 
Sbjct  331  CKVKVIP----DAAARMDAFEEKVRAAGFDARQLMCGSRGQGIYTIGCLLNHSCEPNLQV  386

Query  468  LYHRIKKDFPLHFGREVLASDRILDLD  494
            LY  +        G E L+ + + D++
Sbjct  387  LYTAV--------GDETLSIEALRDIE  405


>CADE_DROME unnamed protein product
Length=1507

 Score = 29.6 bits (65),  Expect = 8.1, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 27/57 (47%), Gaps = 5/57 (9%)

Query  403   FKTSHCQLQVVPIHKNQAAALKEAFEEMAQCNNFKIS-ELPPHTDLQQIAQPGVLYF  458
             F   HC+L  V  + +  A     +E +A CNN KIS E+ P  D   I   G L F
Sbjct  1118  FTGPHCELVSVAFYGSGYAF----YEPIAACNNTKISLEITPQIDQGLIMYLGPLNF  1170



Lambda      K        H
   0.315    0.133    0.398 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5412849180


Query= XP_003392993.1 probable methylthioribulose-1-phosphate dehydratase
[Bombus terrestris]

Length=233
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9PF12_DROME  unnamed protein product                                 32.7    0.24 
Q9GQQ6_DROME  unnamed protein product                                 32.7    0.25 
Q9VX41_DROME  unnamed protein product                                 32.7    0.25 


>M9PF12_DROME unnamed protein product
Length=1162

 Score = 32.7 bits (73),  Expect = 0.24, Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 47/123 (38%), Gaps = 20/123 (16%)

Query  73    ELPPVEKRLKKSQCTPLFMCAYIRRNAGAVIHTHSKFAVMVTLHWPGKEFRVTHLEMIK-  131
             E PP E  L K   TP  +C           H              G+ F+V ++E +K 
Sbjct  895   ESPPKEP-LSKHNRTPKMIC-----------HVFESDEAQFIAQSIGQAFQVAYMEFLKA  942

Query  132   -GIRNQKLGKAYRYDEELVVPIIENTPFEEDLKDELEKAII---AYPETCAVLVRRHGVY  187
              GI N+ L K   Y E L    I     E   K EL+K ++   A  E   V++   G  
Sbjct  943   NGIENESLAKEMDYQEVLNSQEIFGDELEIFAKKELQKEVVVPKAKGEILGVVIVESG--  1000

Query  188   VWG  190
              WG
Sbjct  1001  -WG  1002


>Q9GQQ6_DROME unnamed protein product
Length=1168

 Score = 32.7 bits (73),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 47/123 (38%), Gaps = 20/123 (16%)

Query  73    ELPPVEKRLKKSQCTPLFMCAYIRRNAGAVIHTHSKFAVMVTLHWPGKEFRVTHLEMIK-  131
             E PP E  L K   TP  +C           H              G+ F+V ++E +K 
Sbjct  901   ESPPKEP-LSKHNRTPKMIC-----------HVFESDEAQFIAQSIGQAFQVAYMEFLKA  948

Query  132   -GIRNQKLGKAYRYDEELVVPIIENTPFEEDLKDELEKAII---AYPETCAVLVRRHGVY  187
              GI N+ L K   Y E L    I     E   K EL+K ++   A  E   V++   G  
Sbjct  949   NGIENESLAKEMDYQEVLNSQEIFGDELEIFAKKELQKEVVVPKAKGEILGVVIVESG--  1006

Query  188   VWG  190
              WG
Sbjct  1007  -WG  1008


>Q9VX41_DROME unnamed protein product
Length=1167

 Score = 32.7 bits (73),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 47/123 (38%), Gaps = 20/123 (16%)

Query  73    ELPPVEKRLKKSQCTPLFMCAYIRRNAGAVIHTHSKFAVMVTLHWPGKEFRVTHLEMIK-  131
             E PP E  L K   TP  +C           H              G+ F+V ++E +K 
Sbjct  900   ESPPKEP-LSKHNRTPKMIC-----------HVFESDEAQFIAQSIGQAFQVAYMEFLKA  947

Query  132   -GIRNQKLGKAYRYDEELVVPIIENTPFEEDLKDELEKAII---AYPETCAVLVRRHGVY  187
              GI N+ L K   Y E L    I     E   K EL+K ++   A  E   V++   G  
Sbjct  948   NGIENESLAKEMDYQEVLNSQEIFGDELEIFAKKELQKEVVVPKAKGEILGVVIVESG--  1005

Query  188   VWG  190
              WG
Sbjct  1006  -WG  1007



Lambda      K        H
   0.315    0.133    0.398 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5412849180


Query= XP_003392994.1 COMM domain-containing protein 10 [Bombus terrestris]

Length=197
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q387A7_TRYB2  unnamed protein product                                 32.0    0.37 
Q7KK96_DROME  unnamed protein product                                 27.7    9.2  
Q8T0F9_DROME  unnamed protein product                                 27.3    9.6  


>Q387A7_TRYB2 unnamed protein product
Length=1008

 Score = 32.0 bits (71),  Expect = 0.37, Method: Composition-based stats.
 Identities = 17/52 (33%), Positives = 24/52 (46%), Gaps = 0/52 (0%)

Query  1     MASWITVTPRLERGLKIANQVDNSKFRLLINRICQTLQSAIDTKIFSEEEEE  52
             M SW  V PRL+R L+      +S F   + R+     S     + +EEE E
Sbjct  950   MGSWAYVRPRLQRLLRHLGMAGSSDFLPYVGRVTAASPSTGYATVHAEEEAE  1001


>Q7KK96_DROME unnamed protein product
Length=1179

 Score = 27.7 bits (60),  Expect = 9.2, Method: Compositional matrix adjust.
 Identities = 18/49 (37%), Positives = 29/49 (59%), Gaps = 3/49 (6%)

Query  149  KKDARPMSLLQLNLTGEEESKLTVEFDKKELIDLYHNLEKIQSQLDAFK  197
            KK  +    LQL +T   E + ++E  KK+  ++  NLEK +++LDA K
Sbjct  811  KKREQEFETLQLEIT---ELQKSIETAKKQHQEMIDNLEKFKAELDALK  856


>Q8T0F9_DROME unnamed protein product
Length=985

 Score = 27.3 bits (59),  Expect = 9.6, Method: Compositional matrix adjust.
 Identities = 18/49 (37%), Positives = 29/49 (59%), Gaps = 3/49 (6%)

Query  149  KKDARPMSLLQLNLTGEEESKLTVEFDKKELIDLYHNLEKIQSQLDAFK  197
            KK  +    LQL +T   E + ++E  KK+  ++  NLEK +++LDA K
Sbjct  617  KKREQEFETLQLEIT---ELQKSIETAKKQHQEMIDNLEKFKAELDALK  662



Lambda      K        H
   0.315    0.133    0.398 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5412849180


Query= XP_003392995.1 ankyrin repeat domain-containing protein 16 [Bombus
terrestris]

Length=272
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

G5ECZ1_CAEEL  unnamed protein product                                 112     1e-27
Q8MQG0_CAEEL  unnamed protein product                                 112     1e-27
Q17490_CAEEL  unnamed protein product                                 111     3e-27


>G5ECZ1_CAEEL unnamed protein product
Length=1867

 Score = 112 bits (279),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 75/232 (32%), Positives = 123/232 (53%), Gaps = 9/232 (4%)

Query  40   TTSGDTALHLATREGHLNIVRYLCENFKKPDFRVNVASRDMKRPLHEAAQFARSDILKYL  99
            T  G T LHLA++ G+L +VR L E        V++  ++   PLH AA +    +   L
Sbjct  554  TKKGFTPLHLASKYGNLEVVRLLLERGTP----VDIEGKNQVTPLHVAAHYNNDKVAMLL  609

Query  100  IGKGADVDALKRADWTPLMLACTKTGSDAYKCIVALLEAKANPLLRNKDGWTSLHLVCRS  159
            +  GA   A  +  +TPL +A  K   +  +    LL+ KA+P  +++ G+T LHL  + 
Sbjct  610  LENGASAKAAAKNGYTPLHIAAKK---NQMEIASTLLQFKADPNAKSRAGFTPLHLSAQE  666

Query  160  GDENAFDLLVNKFVERIDDRSNNGRSVMHIAAFHGHEGLVNRLMALNTKLLNARDSSGST  219
            G +    LL+    + +  ++NNG + MH+ A   H   V +++  N   +N++ ++G T
Sbjct  667  GHKEISGLLIENGSD-VGAKANNGLTAMHLCAQEDHVP-VAQILYNNGAEINSKTNAGYT  724

Query  220  PLHEAVKGGHLSVAKRLIDLGADVEAKDNASQTILHIAAVIGNTEAIKAILK  271
            PLH A   G L++ K L++ GADV  K  AS T LH AA  G+   ++ +L+
Sbjct  725  PLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLE  776


 Score = 104 bits (260),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 75/225 (33%), Positives = 115/225 (51%), Gaps = 9/225 (4%)

Query  40   TTSGDTALHLATREGHLNIVRYLCENFKKPDFRVNVASRDMKRPLHEAAQFARSDILKYL  99
            T  G+T LHLA R    ++VR L  N  K    V+  +R+++ PLH A++   +DI+  L
Sbjct  455  TVRGETPLHLAARANQTDVVRVLIRNGAK----VDAQARELQTPLHIASRLGNTDIVILL  510

Query  100  IGKGADVDALKRADWTPLMLACTKTGSDAYKCIVALLEAKANPLLRNKDGWTSLHLVCRS  159
            +  GA+ +A  R +++PL +A  K G +    I  LL+  A+  L  K G+T LHL  + 
Sbjct  511  LQAGANSNATTRDNYSPLHIAA-KEGQEEVAGI--LLDHNADKTLLTKKGFTPLHLASKY  567

Query  160  GDENAFDLLVNKFVERIDDRSNNGRSVMHIAAFHGHEGLVNRLMALNTKLLNARDSSGST  219
            G+     LL+ +    +D    N  + +H+AA H +   V  L+  N     A   +G T
Sbjct  568  GNLEVVRLLLERGTP-VDIEGKNQVTPLHVAA-HYNNDKVAMLLLENGASAKAAAKNGYT  625

Query  220  PLHEAVKGGHLSVAKRLIDLGADVEAKDNASQTILHIAAVIGNTE  264
            PLH A K   + +A  L+   AD  AK  A  T LH++A  G+ E
Sbjct  626  PLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKE  670


 Score = 85.9 bits (211),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 72/231 (31%), Positives = 111/231 (48%), Gaps = 17/231 (7%)

Query  45   TALHLATREGHLNIVRYLCENFKKPDFRVNVASRDMKRPLHEAAQFARSDILKYLIGKGA  104
            T LH A R GH  +V  L          ++  +++   PLH AAQ    D  + L+   A
Sbjct  295  TPLHCAARSGHDQVVDLLVVQGAP----ISAKTKNGLAPLHMAAQGDHVDAARTLLYHRA  350

Query  105  DVDALKRADWTPLMLA--CTKTGSDAYKCIVALLEAKANPLLRNKDGWTSLHLVCRSGDE  162
             VD +     TPL +A  C        +    LL+  A+P  R  +G+T LH+ C+    
Sbjct  351  PVDDVTVDYLTPLHVAAHCGHV-----RVAKLLLDRSADPNSRALNGFTPLHIACKKNRI  405

Query  163  NAFDLLVNKFVERIDDRSNNGRSVMHIAAFHGHEGLVNRLM--ALNTKLLNARDSSGSTP  220
               +LL+ K+   I+  + +G + +H+AAF G   +V  L+    N  +   R   G TP
Sbjct  406  KVVELLL-KYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVR---GETP  461

Query  221  LHEAVKGGHLSVAKRLIDLGADVEAKDNASQTILHIAAVIGNTEAIKAILK  271
            LH A +     V + LI  GA V+A+    QT LHIA+ +GNT+ +  +L+
Sbjct  462  LHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQ  512


 Score = 85.5 bits (210),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 79/267 (30%), Positives = 125/267 (47%), Gaps = 19/267 (7%)

Query  7    SRNFLHACQNGDLSRV-ETLVSKHDIQDWTHFRHTTSGDTALHLATREGHLNIVRYLCEN  65
            S +FL A + GDL +V E L +  DI          +G  +LHLA++EGH  +VR L   
Sbjct  34   SASFLRAARAGDLEKVLELLRAGTDINT-----SNANGLNSLHLASKEGHSEVVRELI--  86

Query  66   FKKPDFRVNVASRDMKRPLHEAAQFARSDILKYLIGKGADVDALKRADWTPLMLACTKTG  125
              K   +V+ A+R     LH A+   +S I+  L+  GA+V+      +TPL +A  +  
Sbjct  87   --KRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENH  144

Query  126  SDAYKCIVALLEAKANPLLRNKDGWTSLHLVCRSGDENAFDLLVNKFVERIDDRSNNGRS  185
             +  K    LL+  AN  L  +DG+T L +  + G +    +L+       D +      
Sbjct  145  EEVVKY---LLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLEN-----DSKGKVRLP  196

Query  186  VMHIAAFHGHEGLVNRLMALNTKLLNARDSSGSTPLHEAVKGGHLSVAKRLIDLGADVEA  245
             +HIAA    +     L+  N    +    SG TPLH A   GH +V + L++ GA+V  
Sbjct  197  ALHIAA-KKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNY  255

Query  246  KDNASQTILHIAAVIGNTEAIKAILKK  272
            +   + + LH+A   G T     +L +
Sbjct  256  QARHNISPLHVATKWGRTNMANLLLSR  282


 Score = 82.8 bits (203),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 72/236 (31%), Positives = 121/236 (51%), Gaps = 15/236 (6%)

Query  40   TTSGDTALHLATREGHLNIVRYLCENFKKPDFRVNVASRDMKRPLHEAAQFARSDILKYL  99
            + SG T LH+A   GH N+ + L E        VN  +R    PLH A ++ R+++   L
Sbjct  224  SKSGFTPLHIAAHYGHENVGQLLLEK----GANVNYQARHNISPLHVATKWGRTNMANLL  279

Query  100  IGKGADVDALKRADWTPLMLACTKTGSDAYKCIVALLEAKANPL-LRNKDGWTSLHLVCR  158
            + +GA +D+  +   TPL  A  ++G D    +V LL  +  P+  + K+G   LH+  +
Sbjct  280  LSRGAIIDSRTKDLLTPLHCAA-RSGHDQ---VVDLLVVQGAPISAKTKNGLAPLHMAAQ  335

Query  159  SGD--ENAFDLLVNKFVERIDDRSNNGRSVMHIAAFHGHEGLVNRLMALNTKLLNARDSS  216
             GD  + A  LL ++    +DD + +  + +H+AA  GH   V +L+   +   N+R  +
Sbjct  336  -GDHVDAARTLLYHR--APVDDVTVDYLTPLHVAAHCGHV-RVAKLLLDRSADPNSRALN  391

Query  217  GSTPLHEAVKGGHLSVAKRLIDLGADVEAKDNASQTILHIAAVIGNTEAIKAILKK  272
            G TPLH A K   + V + L+   A +EA   +  T LH+AA +G    +  +L++
Sbjct  392  GFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQ  447


 Score = 77.4 bits (189),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 63/228 (28%), Positives = 108/228 (47%), Gaps = 9/228 (4%)

Query  45   TALHLATREGHLNIVRYLCENFKKPDFRVNVASRDMKRPLHEAAQFARSDILKYLIGKGA  104
            T LH+A   GH+ + + L +    P+ R    + +   PLH A +  R  +++ L+   A
Sbjct  361  TPLHVAAHCGHVRVAKLLLDRSADPNSR----ALNGFTPLHIACKKNRIKVVELLLKYRA  416

Query  105  DVDALKRADWTPLMLACTKTGSDAYKCIVALLEAKANPLLRNKDGWTSLHLVCRSGDENA  164
             ++A   +  TPL +A       A   ++ LL+  ANP +    G T LHL  R+   + 
Sbjct  417  AIEATTESGLTPLHVAAFM---GAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDV  473

Query  165  FDLLVNKFVERIDDRSNNGRSVMHIAAFHGHEGLVNRLMALNTKLLNARDSSGSTPLHEA  224
              +L+     ++D ++   ++ +HIA+  G+  +V  L+       NA      +PLH A
Sbjct  474  VRVLIRNGA-KVDAQARELQTPLHIASRLGNTDIVILLLQAGANS-NATTRDNYSPLHIA  531

Query  225  VKGGHLSVAKRLIDLGADVEAKDNASQTILHIAAVIGNTEAIKAILKK  272
             K G   VA  L+D  AD         T LH+A+  GN E ++ +L++
Sbjct  532  AKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLER  579


 Score = 36.6 bits (83),  Expect = 0.025, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 31/59 (53%), Gaps = 6/59 (10%)

Query  13   ACQNGDLSRVETLVSK-HDIQDWTHFRHTTSGDTALHLATREGHLNIVRYLCENFKKPD  70
            AC  G L+ V+ LV    D+ + T   +T      LH A ++GH N VRYL EN   P+
Sbjct  729  ACHFGQLNMVKFLVENGADVGEKTRASYT-----PLHQAAQQGHNNCVRYLLENGASPN  782


>Q8MQG0_CAEEL unnamed protein product
Length=1841

 Score = 112 bits (279),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 75/232 (32%), Positives = 123/232 (53%), Gaps = 9/232 (4%)

Query  40   TTSGDTALHLATREGHLNIVRYLCENFKKPDFRVNVASRDMKRPLHEAAQFARSDILKYL  99
            T  G T LHLA++ G+L +VR L E        V++  ++   PLH AA +    +   L
Sbjct  554  TKKGFTPLHLASKYGNLEVVRLLLERGTP----VDIEGKNQVTPLHVAAHYNNDKVAMLL  609

Query  100  IGKGADVDALKRADWTPLMLACTKTGSDAYKCIVALLEAKANPLLRNKDGWTSLHLVCRS  159
            +  GA   A  +  +TPL +A  K   +  +    LL+ KA+P  +++ G+T LHL  + 
Sbjct  610  LENGASAKAAAKNGYTPLHIAAKK---NQMEIASTLLQFKADPNAKSRAGFTPLHLSAQE  666

Query  160  GDENAFDLLVNKFVERIDDRSNNGRSVMHIAAFHGHEGLVNRLMALNTKLLNARDSSGST  219
            G +    LL+    + +  ++NNG + MH+ A   H   V +++  N   +N++ ++G T
Sbjct  667  GHKEISGLLIENGSD-VGAKANNGLTAMHLCAQEDHVP-VAQILYNNGAEINSKTNAGYT  724

Query  220  PLHEAVKGGHLSVAKRLIDLGADVEAKDNASQTILHIAAVIGNTEAIKAILK  271
            PLH A   G L++ K L++ GADV  K  AS T LH AA  G+   ++ +L+
Sbjct  725  PLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLE  776


 Score = 104 bits (260),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 74/225 (33%), Positives = 116/225 (52%), Gaps = 9/225 (4%)

Query  40   TTSGDTALHLATREGHLNIVRYLCENFKKPDFRVNVASRDMKRPLHEAAQFARSDILKYL  99
            T  G+T LHLA R    ++VR L  N  K    V+  +R+++ PLH A++   +DI+  L
Sbjct  455  TVRGETPLHLAARANQTDVVRVLIRNGAK----VDAQARELQTPLHIASRLGNTDIVILL  510

Query  100  IGKGADVDALKRADWTPLMLACTKTGSDAYKCIVALLEAKANPLLRNKDGWTSLHLVCRS  159
            +  GA+ +A  R +++PL +A  K G +    I  LL+  A+  L  K G+T LHL  + 
Sbjct  511  LQAGANSNATTRDNYSPLHIAA-KEGQEEVAGI--LLDHNADKTLLTKKGFTPLHLASKY  567

Query  160  GDENAFDLLVNKFVERIDDRSNNGRSVMHIAAFHGHEGLVNRLMALNTKLLNARDSSGST  219
            G+     LL+ +    +D    N  + +H+AA + ++  V  L+  N     A   +G T
Sbjct  568  GNLEVVRLLLERGTP-VDIEGKNQVTPLHVAAHYNNDK-VAMLLLENGASAKAAAKNGYT  625

Query  220  PLHEAVKGGHLSVAKRLIDLGADVEAKDNASQTILHIAAVIGNTE  264
            PLH A K   + +A  L+   AD  AK  A  T LH++A  G+ E
Sbjct  626  PLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKE  670


 Score = 85.9 bits (211),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 72/231 (31%), Positives = 111/231 (48%), Gaps = 17/231 (7%)

Query  45   TALHLATREGHLNIVRYLCENFKKPDFRVNVASRDMKRPLHEAAQFARSDILKYLIGKGA  104
            T LH A R GH  +V  L          ++  +++   PLH AAQ    D  + L+   A
Sbjct  295  TPLHCAARSGHDQVVDLLVVQGAP----ISAKTKNGLAPLHMAAQGDHVDAARTLLYHRA  350

Query  105  DVDALKRADWTPLMLA--CTKTGSDAYKCIVALLEAKANPLLRNKDGWTSLHLVCRSGDE  162
             VD +     TPL +A  C        +    LL+  A+P  R  +G+T LH+ C+    
Sbjct  351  PVDDVTVDYLTPLHVAAHCGHV-----RVAKLLLDRSADPNSRALNGFTPLHIACKKNRI  405

Query  163  NAFDLLVNKFVERIDDRSNNGRSVMHIAAFHGHEGLVNRLM--ALNTKLLNARDSSGSTP  220
               +LL+ K+   I+  + +G + +H+AAF G   +V  L+    N  +   R   G TP
Sbjct  406  KVVELLL-KYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVR---GETP  461

Query  221  LHEAVKGGHLSVAKRLIDLGADVEAKDNASQTILHIAAVIGNTEAIKAILK  271
            LH A +     V + LI  GA V+A+    QT LHIA+ +GNT+ +  +L+
Sbjct  462  LHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQ  512


 Score = 85.9 bits (211),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 79/267 (30%), Positives = 125/267 (47%), Gaps = 19/267 (7%)

Query  7    SRNFLHACQNGDLSRV-ETLVSKHDIQDWTHFRHTTSGDTALHLATREGHLNIVRYLCEN  65
            S +FL A + GDL +V E L +  DI          +G  +LHLA++EGH  +VR L   
Sbjct  34   SASFLRAARAGDLEKVLELLRAGTDINT-----SNANGLNSLHLASKEGHSEVVRELI--  86

Query  66   FKKPDFRVNVASRDMKRPLHEAAQFARSDILKYLIGKGADVDALKRADWTPLMLACTKTG  125
              K   +V+ A+R     LH A+   +S I+  L+  GA+V+      +TPL +A  +  
Sbjct  87   --KRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENH  144

Query  126  SDAYKCIVALLEAKANPLLRNKDGWTSLHLVCRSGDENAFDLLVNKFVERIDDRSNNGRS  185
             +  K    LL+  AN  L  +DG+T L +  + G +    +L+       D +      
Sbjct  145  EEVVKY---LLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLEN-----DSKGKVRLP  196

Query  186  VMHIAAFHGHEGLVNRLMALNTKLLNARDSSGSTPLHEAVKGGHLSVAKRLIDLGADVEA  245
             +HIAA    +     L+  N    +    SG TPLH A   GH +V + L++ GA+V  
Sbjct  197  ALHIAA-KKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNY  255

Query  246  KDNASQTILHIAAVIGNTEAIKAILKK  272
            +   + + LH+A   G T     +L +
Sbjct  256  QARHNISPLHVATKWGRTNMANLLLSR  282


 Score = 83.2 bits (204),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 72/236 (31%), Positives = 121/236 (51%), Gaps = 15/236 (6%)

Query  40   TTSGDTALHLATREGHLNIVRYLCENFKKPDFRVNVASRDMKRPLHEAAQFARSDILKYL  99
            + SG T LH+A   GH N+ + L E        VN  +R    PLH A ++ R+++   L
Sbjct  224  SKSGFTPLHIAAHYGHENVGQLLLEK----GANVNYQARHNISPLHVATKWGRTNMANLL  279

Query  100  IGKGADVDALKRADWTPLMLACTKTGSDAYKCIVALLEAKANPL-LRNKDGWTSLHLVCR  158
            + +GA +D+  +   TPL  A  ++G D    +V LL  +  P+  + K+G   LH+  +
Sbjct  280  LSRGAIIDSRTKDLLTPLHCAA-RSGHDQ---VVDLLVVQGAPISAKTKNGLAPLHMAAQ  335

Query  159  SGD--ENAFDLLVNKFVERIDDRSNNGRSVMHIAAFHGHEGLVNRLMALNTKLLNARDSS  216
             GD  + A  LL ++    +DD + +  + +H+AA  GH   V +L+   +   N+R  +
Sbjct  336  -GDHVDAARTLLYHR--APVDDVTVDYLTPLHVAAHCGHV-RVAKLLLDRSADPNSRALN  391

Query  217  GSTPLHEAVKGGHLSVAKRLIDLGADVEAKDNASQTILHIAAVIGNTEAIKAILKK  272
            G TPLH A K   + V + L+   A +EA   +  T LH+AA +G    +  +L++
Sbjct  392  GFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQ  447


 Score = 77.4 bits (189),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 63/228 (28%), Positives = 108/228 (47%), Gaps = 9/228 (4%)

Query  45   TALHLATREGHLNIVRYLCENFKKPDFRVNVASRDMKRPLHEAAQFARSDILKYLIGKGA  104
            T LH+A   GH+ + + L +    P+ R    + +   PLH A +  R  +++ L+   A
Sbjct  361  TPLHVAAHCGHVRVAKLLLDRSADPNSR----ALNGFTPLHIACKKNRIKVVELLLKYRA  416

Query  105  DVDALKRADWTPLMLACTKTGSDAYKCIVALLEAKANPLLRNKDGWTSLHLVCRSGDENA  164
             ++A   +  TPL +A       A   ++ LL+  ANP +    G T LHL  R+   + 
Sbjct  417  AIEATTESGLTPLHVAAFM---GAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDV  473

Query  165  FDLLVNKFVERIDDRSNNGRSVMHIAAFHGHEGLVNRLMALNTKLLNARDSSGSTPLHEA  224
              +L+     ++D ++   ++ +HIA+  G+  +V  L+       NA      +PLH A
Sbjct  474  VRVLIRNGA-KVDAQARELQTPLHIASRLGNTDIVILLLQAGANS-NATTRDNYSPLHIA  531

Query  225  VKGGHLSVAKRLIDLGADVEAKDNASQTILHIAAVIGNTEAIKAILKK  272
             K G   VA  L+D  AD         T LH+A+  GN E ++ +L++
Sbjct  532  AKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLER  579


 Score = 36.6 bits (83),  Expect = 0.023, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 31/59 (53%), Gaps = 6/59 (10%)

Query  13   ACQNGDLSRVETLVSK-HDIQDWTHFRHTTSGDTALHLATREGHLNIVRYLCENFKKPD  70
            AC  G L+ V+ LV    D+ + T   +T      LH A ++GH N VRYL EN   P+
Sbjct  729  ACHFGQLNMVKFLVENGADVGEKTRASYT-----PLHQAAQQGHNNCVRYLLENGASPN  782


>Q17490_CAEEL unnamed protein product
Length=6994

 Score = 111 bits (277),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 75/232 (32%), Positives = 123/232 (53%), Gaps = 9/232 (4%)

Query  40   TTSGDTALHLATREGHLNIVRYLCENFKKPDFRVNVASRDMKRPLHEAAQFARSDILKYL  99
            T  G T LHLA++ G+L +VR L E        V++  ++   PLH AA +    +   L
Sbjct  554  TKKGFTPLHLASKYGNLEVVRLLLERGTP----VDIEGKNQVTPLHVAAHYNNDKVAMLL  609

Query  100  IGKGADVDALKRADWTPLMLACTKTGSDAYKCIVALLEAKANPLLRNKDGWTSLHLVCRS  159
            +  GA   A  +  +TPL +A  K   +  +    LL+ KA+P  +++ G+T LHL  + 
Sbjct  610  LENGASAKAAAKNGYTPLHIAAKK---NQMEIASTLLQFKADPNAKSRAGFTPLHLSAQE  666

Query  160  GDENAFDLLVNKFVERIDDRSNNGRSVMHIAAFHGHEGLVNRLMALNTKLLNARDSSGST  219
            G +    LL+    + +  ++NNG + MH+ A   H   V +++  N   +N++ ++G T
Sbjct  667  GHKEISGLLIENGSD-VGAKANNGLTAMHLCAQEDHVP-VAQILYNNGAEINSKTNAGYT  724

Query  220  PLHEAVKGGHLSVAKRLIDLGADVEAKDNASQTILHIAAVIGNTEAIKAILK  271
            PLH A   G L++ K L++ GADV  K  AS T LH AA  G+   ++ +L+
Sbjct  725  PLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLE  776


 Score = 105 bits (263),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 75/225 (33%), Positives = 115/225 (51%), Gaps = 9/225 (4%)

Query  40   TTSGDTALHLATREGHLNIVRYLCENFKKPDFRVNVASRDMKRPLHEAAQFARSDILKYL  99
            T  G+T LHLA R    ++VR L  N  K    V+  +R+++ PLH A++   +DI+  L
Sbjct  455  TVRGETPLHLAARANQTDVVRVLIRNGAK----VDAQARELQTPLHIASRLGNTDIVILL  510

Query  100  IGKGADVDALKRADWTPLMLACTKTGSDAYKCIVALLEAKANPLLRNKDGWTSLHLVCRS  159
            +  GA+ +A  R +++PL +A  K G +    I  LL+  A+  L  K G+T LHL  + 
Sbjct  511  LQAGANSNATTRDNYSPLHIA-AKEGQEEVAGI--LLDHNADKTLLTKKGFTPLHLASKY  567

Query  160  GDENAFDLLVNKFVERIDDRSNNGRSVMHIAAFHGHEGLVNRLMALNTKLLNARDSSGST  219
            G+     LL+ +    +D    N  + +H+AA H +   V  L+  N     A   +G T
Sbjct  568  GNLEVVRLLLERGTP-VDIEGKNQVTPLHVAA-HYNNDKVAMLLLENGASAKAAAKNGYT  625

Query  220  PLHEAVKGGHLSVAKRLIDLGADVEAKDNASQTILHIAAVIGNTE  264
            PLH A K   + +A  L+   AD  AK  A  T LH++A  G+ E
Sbjct  626  PLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKE  670


 Score = 90.5 bits (223),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 79/267 (30%), Positives = 125/267 (47%), Gaps = 19/267 (7%)

Query  7    SRNFLHACQNGDLSRV-ETLVSKHDIQDWTHFRHTTSGDTALHLATREGHLNIVRYLCEN  65
            S +FL A + GDL +V E L +  DI          +G  +LHLA++EGH  +VR L   
Sbjct  34   SASFLRAARAGDLEKVLELLRAGTDINT-----SNANGLNSLHLASKEGHSEVVRELI--  86

Query  66   FKKPDFRVNVASRDMKRPLHEAAQFARSDILKYLIGKGADVDALKRADWTPLMLACTKTG  125
              K   +V+ A+R     LH A+   +S I+  L+  GA+V+      +TPL +A  +  
Sbjct  87   --KRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENH  144

Query  126  SDAYKCIVALLEAKANPLLRNKDGWTSLHLVCRSGDENAFDLLVNKFVERIDDRSNNGRS  185
             +  K    LL+  AN  L  +DG+T L +  + G +    +L+       D +      
Sbjct  145  EEVVK---YLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLEN-----DSKGKVRLP  196

Query  186  VMHIAAFHGHEGLVNRLMALNTKLLNARDSSGSTPLHEAVKGGHLSVAKRLIDLGADVEA  245
             +HIAA    +     L+  N    +    SG TPLH A   GH +V + L++ GA+V  
Sbjct  197  ALHIAA-KKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNY  255

Query  246  KDNASQTILHIAAVIGNTEAIKAILKK  272
            +   + + LH+A   G T     +L +
Sbjct  256  QARHNISPLHVATKWGRTNMANLLLSR  282


 Score = 87.4 bits (215),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 74/266 (28%), Positives = 119/266 (45%), Gaps = 43/266 (16%)

Query  38   RHTTSGDTALHLATREGHLNIVRYLCENFKKPDFRVNVASRDMKRPLHEAAQFARSDILK  97
            RH  S    LH+AT+ G  N+   L       D R    ++D+  PLH AA+     ++ 
Sbjct  258  RHNIS---PLHVATKWGRTNMANLLLSRGAIIDSR----TKDLLTPLHCAARSGHDQVVD  310

Query  98   YLIGKGADVDALKRADWTPLMLACTKTGSDAYKCIV------------------------  133
             L+ +GA + A  +    PL +A      DA + ++                        
Sbjct  311  LLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCG  370

Query  134  ------ALLEAKANPLLRNKDGWTSLHLVCRSGDENAFDLLVNKFVERIDDRSNNGRSVM  187
                   LL+  A+P  R  +G+T LH+ C+       +LL+ K+   I+  + +G + +
Sbjct  371  HVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLL-KYRAAIEATTESGLTPL  429

Query  188  HIAAFHGHEGLVNRLM--ALNTKLLNARDSSGSTPLHEAVKGGHLSVAKRLIDLGADVEA  245
            H+AAF G   +V  L+    N  +   R   G TPLH A +     V + LI  GA V+A
Sbjct  430  HVAAFMGAINIVIYLLQQGANPDVETVR---GETPLHLAARANQTDVVRVLIRNGAKVDA  486

Query  246  KDNASQTILHIAAVIGNTEAIKAILK  271
            +    QT LHIA+ +GNT+ +  +L+
Sbjct  487  QARELQTPLHIASRLGNTDIVILLLQ  512


 Score = 85.9 bits (211),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 72/236 (31%), Positives = 121/236 (51%), Gaps = 15/236 (6%)

Query  40   TTSGDTALHLATREGHLNIVRYLCENFKKPDFRVNVASRDMKRPLHEAAQFARSDILKYL  99
            + SG T LH+A   GH N+ + L E        VN  +R    PLH A ++ R+++   L
Sbjct  224  SKSGFTPLHIAAHYGHENVGQLLLEK----GANVNYQARHNISPLHVATKWGRTNMANLL  279

Query  100  IGKGADVDALKRADWTPLMLACTKTGSDAYKCIVALLEAKANPL-LRNKDGWTSLHLVCR  158
            + +GA +D+  +   TPL  A  ++G D    +V LL  +  P+  + K+G   LH+  +
Sbjct  280  LSRGAIIDSRTKDLLTPLHCA-ARSGHDQ---VVDLLVVQGAPISAKTKNGLAPLHMAAQ  335

Query  159  SGD--ENAFDLLVNKFVERIDDRSNNGRSVMHIAAFHGHEGLVNRLMALNTKLLNARDSS  216
             GD  + A  LL ++    +DD + +  + +H+AA  GH   V +L+   +   N+R  +
Sbjct  336  -GDHVDAARTLLYHR--APVDDVTVDYLTPLHVAAHCGHV-RVAKLLLDRSADPNSRALN  391

Query  217  GSTPLHEAVKGGHLSVAKRLIDLGADVEAKDNASQTILHIAAVIGNTEAIKAILKK  272
            G TPLH A K   + V + L+   A +EA   +  T LH+AA +G    +  +L++
Sbjct  392  GFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQ  447


 Score = 79.3 bits (194),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 63/228 (28%), Positives = 108/228 (47%), Gaps = 9/228 (4%)

Query  45   TALHLATREGHLNIVRYLCENFKKPDFRVNVASRDMKRPLHEAAQFARSDILKYLIGKGA  104
            T LH+A   GH+ + + L +    P+ R    + +   PLH A +  R  +++ L+   A
Sbjct  361  TPLHVAAHCGHVRVAKLLLDRSADPNSR----ALNGFTPLHIACKKNRIKVVELLLKYRA  416

Query  105  DVDALKRADWTPLMLACTKTGSDAYKCIVALLEAKANPLLRNKDGWTSLHLVCRSGDENA  164
             ++A   +  TPL +A       A   ++ LL+  ANP +    G T LHL  R+   + 
Sbjct  417  AIEATTESGLTPLHVAAFM---GAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDV  473

Query  165  FDLLVNKFVERIDDRSNNGRSVMHIAAFHGHEGLVNRLMALNTKLLNARDSSGSTPLHEA  224
              +L+     ++D ++   ++ +HIA+  G+  +V  L+       NA      +PLH A
Sbjct  474  VRVLIRNGA-KVDAQARELQTPLHIASRLGNTDIVILLLQAGANS-NATTRDNYSPLHIA  531

Query  225  VKGGHLSVAKRLIDLGADVEAKDNASQTILHIAAVIGNTEAIKAILKK  272
             K G   VA  L+D  AD         T LH+A+  GN E ++ +L++
Sbjct  532  AKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLER  579


 Score = 35.4 bits (80),  Expect = 0.048, Method: Composition-based stats.
 Identities = 25/62 (40%), Positives = 33/62 (53%), Gaps = 7/62 (11%)

Query  11   LH-ACQNGDLSRVETLVSK-HDIQDWTHFRHTTSGDTALHLATREGHLNIVRYLCENFKK  68
            LH AC  G L+ V+ LV    D+ +      T +  T LH A ++GH N VRYL EN   
Sbjct  726  LHVACHFGQLNMVKFLVENGADVGE-----KTRASYTPLHQAAQQGHNNCVRYLLENGAS  780

Query  69   PD  70
            P+
Sbjct  781  PN  782


 Score = 30.4 bits (67),  Expect = 1.9, Method: Composition-based stats.
 Identities = 14/58 (24%), Positives = 28/58 (48%), Gaps = 0/58 (0%)

Query  215  SSGSTPLHEAVKGGHLSVAKRLIDLGADVEAKDNASQTILHIAAVIGNTEAIKAILKK  272
            + GS     A + G L     L+  G D+   +      LH+A+  G++E ++ ++K+
Sbjct  31   AEGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKR  88



Lambda      K        H
   0.315    0.133    0.398 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5412849180


Query= XP_003392998.1 uncharacterized protein LOC100649485 isoform X2
[Bombus terrestris]

Length=697
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9W2G5_DROME  unnamed protein product                                 66.6    5e-11
RAD50_DROME  unnamed protein product                                  34.3    0.43 
Q9XZ61_DROME  unnamed protein product                                 32.7    0.97 


>Q9W2G5_DROME unnamed protein product
Length=842

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 87/402 (22%), Positives = 163/402 (41%), Gaps = 45/402 (11%)

Query  144  DIAKIIDKDPDPCFEGVYNWYYTGGSIDYIQLYNKNILLFPFMGELVSVPLNNIEDF---  200
            ++A+ I +  +  F   Y++YYTGG+++ I     + L     G  +   L+   D+   
Sbjct  154  EMAEHIAQQENSFFRDSYDYYYTGGNLNTIPFDGNDQLAMHVSGNKLR-DLHFSRDYGEA  212

Query  201  -LWKPLFKKAAKCELNGTLYEL--KHNINVDACMFLGRYKRHCNFYTLSENDDKCNLTEI  257
              W+PL     + E +  ++EL   HN+N  + MFL R  +  + Y L   D++ + ++ 
Sbjct  213  EFWQPLHSATIE-ESSSEVFELLPLHNLN-RSQMFLARLLKEVSLYELKCKDEQDSDSDY  270

Query  258  HT------QTSKIPYIGADLSPINANQYCLVNVERCVTLWDIVKMKPI-NCNTIMQATVL  310
                     +   P+  A  S  NAN   L + +R +   DI   + I   +  +   + 
Sbjct  271  ELIRHCMFSSQVAPFTSAAQSLANANTLALASQDRSLRFVDISTQQDIAKLDVCLLKGLK  330

Query  311  DDSWSSIKFQSTDPNILLFVDRCCLHYLDVRVPFDQPALTMCPKF----YLEKCEHLSID  366
              S +  + +  + +    + +  L  +DVR       L + P F    + + CE  S  
Sbjct  331  KTSSTWAQLKQAEESTFHCLTQPVLFTVDVRC-----NLPLNPCFASGVHSKACERFSCL  385

Query  367  VASRNNFCRYIGTYHSMLMCDSRSPQQCVQQK--------WTHQFKSPPLTSSVIARDDK  418
                N    Y+ + H+    D R    C+ +K        WTHQ   PP         D 
Sbjct  386  AKGVNPNLLYVASNHNFHCLDIR----CLGKKLTDRAVVTWTHQMTYPPCFIDTSVHQDS  441

Query  419  EFVVLSSQIAGETTVI-VNTWTDSEISQSYN--FPYTPPHIKETLNESQIQGMC-LNPYL  474
            E++ L   +  +  +  +       + + ++   P+ P  ++E L ++++ G   +   +
Sbjct  442  EYIALGGLLPKDLRICELQGAQAKSVDEMFSPAIPFAPVTLEEALIDARLGGFVDVYADI  501

Query  475  RDRFELSNTGSFLI----KNDTQNIFLFLQNSIGDIYYQCLT  512
             +R     TG   I     +D     L   NS+GD+Y Q LT
Sbjct  502  AERVTTCITGMRFIGLEGASDQAFTQLLTSNSLGDVYCQRLT  543


 Score = 33.9 bits (76),  Expect = 0.51, Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 36/73 (49%), Gaps = 13/73 (18%)

Query  584  WKQSLEKLNTYMDILAPELLAVW-------------EICEEVPLPLTAAPHQKVLNWLES  630
            W++S  KL+ Y D+++  LL VW             E+ +E        P Q++ NWLE 
Sbjct  684  WQKSAYKLSHYTDMMSTRLLDVWDMEEYDTTRDVTREMFDERIKGKELEPEQRMANWLEQ  743

Query  631  ADTKPSILSQEEI  643
              ++  + +++E+
Sbjct  744  LPSQTVVPTEDEV  756


>RAD50_DROME unnamed protein product
Length=1318

 Score = 34.3 bits (77),  Expect = 0.43, Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 47/93 (51%), Gaps = 12/93 (13%)

Query  531  LNAWQNAVSIETDAIAPLTMSSKSNMHFPFKSFTNKKLRLKRKHESVDCFEPSWKQSLEK  590
            L + QNAV  + DA+  L    K N      S  ++++ L+   +S+    P  K+ LEK
Sbjct  853  LESAQNAVQQQMDALNRL--REKKN------SLKDRQIHLREGLQSL----PQLKERLEK  900

Query  591  LNTYMDILAPELLAVWEICEEVPLPLTAAPHQK  623
            LN+++  +A E+  +    + + L L AA  +K
Sbjct  901  LNSFLTTVASEISELKAKIQPLKLNLRAAIEEK  933


>Q9XZ61_DROME unnamed protein product
Length=324

 Score = 32.7 bits (73),  Expect = 0.97, Method: Compositional matrix adjust.
 Identities = 23/73 (32%), Positives = 36/73 (49%), Gaps = 11/73 (15%)

Query  41   LHSTFSAADSDLENVIEQYQEYPYHCDLPKPLLPPAKVPRNMLNEEDPALELVTLKNYVN  100
            +H    A  SD + + EQ  E          LL PA  P  M  EED   E+ +L+ Y+ 
Sbjct  215  IHFNLMALISDRQRIYEQQIE---------KLLNPA--PNAMDTEEDRQAEISSLRTYIE  263

Query  101  SDIERMKRYYLKH  113
             +I++ KRY +++
Sbjct  264  YEIQKKKRYKVEN  276



Lambda      K        H
   0.315    0.133    0.398 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5412849180


Query= XP_003392999.1 mitochondrial import inner membrane translocase
subunit TIM50-C [Bombus terrestris]

Length=387
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TI50C_DROME  unnamed protein product                                  350     2e-118
CTDS_DICDI  unnamed protein product                                   90.9    2e-20 
SCPL1_CAEEL  unnamed protein product                                  81.6    1e-16 


>TI50C_DROME unnamed protein product
Length=428

 Score = 350 bits (899),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 166/279 (59%), Positives = 202/279 (72%), Gaps = 2/279 (1%)

Query  101  LKYSFAFLGVFTTVGLSYVIYNLTRTKYDEHGNVIEDEFSNLPFYERIYKMLKREFNYYT  160
            +K  FA  G        + +Y   + + D +G  IEDEF++ P  ++  + + +  +YY 
Sbjct  145  MKLGFAIFGGSAVAAGFWAVYEFGKPEVDPNGQPIEDEFTHKPLVQQYLQRMWKSIHYYQ  204

Query  161  KMVQEPSRNKLLPDPLKYPYIQPPYTLVLELTDVLVHPDWTYETGWRFKKRPGVDQFLEA  220
            +M+QEPSR KLLPDPLK PY+QP YTLVLE+ DVLVHPDWTY+TGWRFKKRPGVD FL  
Sbjct  205  RMIQEPSRAKLLPDPLKPPYVQPRYTLVLEMKDVLVHPDWTYQTGWRFKKRPGVDHFLAE  264

Query  221  IAPPQFEIVVYTAEQGMTVFPILDILDPNGYIMYRLVRDTTRFVDGHHVKDLNALNRDLS  280
             A   FEIVV+TAEQGMTVFPILD LDPNGYIMYRLVRD T FVDGHHVK+L+ LNRDL 
Sbjct  265  CAK-DFEIVVFTAEQGMTVFPILDALDPNGYIMYRLVRDATHFVDGHHVKNLDNLNRDLK  323

Query  281  KVIVVDWNPKSTKFHPENTLQLLQWTGNDDDTTLYDLAAFLKVILATNVEDVREVLTYYR  340
            KVIVVDW+  +TK HP+NT  L +W GNDDD  L DL AFLK+I   NV+DVREVL YYR
Sbjct  324  KVIVVDWDANATKMHPDNTFGLARWHGNDDDGQLLDLIAFLKIIAQNNVDDVREVLHYYR  383

Query  341  QFENPLKVFRENQRKFLMQMEAEENKAQQESSKVLTSKW  379
            QF++P+  FRENQRK   QM  E  + +Q  +K +  +W
Sbjct  384  QFDDPINQFRENQRKLAEQM-LEAERIEQSKTKPMVKQW  421


>CTDS_DICDI unnamed protein product
Length=306

 Score = 90.9 bits (224),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 72/135 (53%), Gaps = 16/135 (12%)

Query  186  TLVLELTDVLVH--------PDWTYETGWR-------FKKRPGVDQFLEAIAPPQFEIVV  230
            TLVL+L + LVH        PD+                KRP VD FL AIA  +FEIVV
Sbjct  138  TLVLDLDETLVHSSFKPVHNPDFIVPVEIEGTIHQVYVVKRPFVDDFLRAIAE-KFEIVV  196

Query  231  YTAEQGMTVFPILDILDPNGYIMYRLVRDTTRFVDGHHVKDLNALNRDLSKVIVVDWNPK  290
            +TA       P+LD LD    I YRL R++     G++VKDL+ L RDL   I+VD +P 
Sbjct  197  FTASLAKYADPVLDFLDTGRVIHYRLFRESCHNHKGNYVKDLSRLGRDLKSTIIVDNSPS  256

Query  291  STKFHPENTLQLLQW  305
            S  FHPEN + +  W
Sbjct  257  SYLFHPENAIPIDSW  271


>SCPL1_CAEEL unnamed protein product
Length=491

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/175 (31%), Positives = 85/175 (49%), Gaps = 21/175 (12%)

Query  186  TLVLELTDVLVH--------PDWTYET---GWRFK----KRPGVDQFLEAIAPPQFEIVV  230
             LV++L + LVH        PD+       G   +    KRP VD+FL  +    FE ++
Sbjct  313  CLVIDLDETLVHSSFKPVKNPDFVIPVEIDGVEHQVYVLKRPYVDEFLAKVGE-HFECIL  371

Query  231  YTAEQGMTVFPILDILDPNGYIMYRLVRDTTRFVDGHHVKDLNALNRDLSKVIVVDWNPK  290
            +TA       P+ D+LD       RL R+   F  G++VKDL+ L R+L++ +++D +P 
Sbjct  372  FTASLAKYADPVADLLDKKRVFRGRLFREACVFHKGNYVKDLSRLGRNLNQTLIIDNSPA  431

Query  291  STKFHPENTLQLLQWTGNDDDTTLYDLAAFLKVILATNVEDVREVLTYYRQFENP  345
            S  FHPEN + +  W  +  DT L D+   L+     ++     +   YR  E P
Sbjct  432  SYAFHPENAVPVTTWFDDPSDTELLDILPSLE-----HLNGFSSIYDLYRPEEGP  481



Lambda      K        H
   0.315    0.133    0.398 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5412849180


Query= XP_003393000.1 monoacylglycerol lipase ABHD12 isoform X1 [Bombus
terrestris]

Length=359
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q38DS6_TRYB2  unnamed protein product                                 79.0    4e-16
Q4GYA0_TRYB2  unnamed protein product                                 60.5    7e-10
AHO3_CAEEL  unnamed protein product                                   43.1    2e-04


>Q38DS6_TRYB2 unnamed protein product
Length=370

 Score = 79.0 bits (193),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 58/189 (31%), Positives = 96/189 (51%), Gaps = 11/189 (6%)

Query  127  QPIFLYMHGNSGNRASNHRLELYKLFQT-LDYHVICFDYRGYGDSEEAELSEIGVVSDSK  185
            Q   LY HGN+GN    HR+ +  +  T     V+  DYRGYG S+    ++ GV+ D++
Sbjct  139  QCSILYFHGNAGN--VGHRIPIAAMLSTKCRCAVLMVDYRGYGQSDSVSPTQEGVMLDAQ  196

Query  186  YVLEWLLKIVNGTAP-VFVWGHSLGTGVSVHVLALLATEKVQPAGLFLESPFNNIADELS  244
              L++LL   +  A  +FV G SLG  V++H+ A     K   AG+ +E+ F +I D  S
Sbjct  197  ACLDYLLCHPHIPADRIFVMGTSLGGAVAIHLAAEPHNAK-HIAGVIVENTFTSIGDMAS  255

Query  245  EHPLSQIFKHLPWFHWVIVEPF------YDNYLRFESDKHIEKIQCPIMILHAEDDNIVP  298
            E     +    P F ++++  F         ++++ S   ++KI  P++ L    DN+VP
Sbjct  256  EMVRHALNGAQPCFSFLLLSLFEYYVKPLCLHIKWRSIDAVQKICAPMLFLSGLKDNVVP  315

Query  299  FALGEKLFK  307
                +KL+ 
Sbjct  316  PLQMKKLYS  324


>Q4GYA0_TRYB2 unnamed protein product
Length=670

 Score = 60.5 bits (145),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 54/203 (27%), Positives = 99/203 (49%), Gaps = 44/203 (22%)

Query  121  MLKNAKQPIFLYMHGNSGNRASNHRLELYKLFQTLDY-------HVICFDYRGYG----D  169
            +L  A + I +Y H N+        +++  +F+T+ Y        V+  +Y GYG    +
Sbjct  53   LLDTAAKFIIIYAHTNA--------VDVAMVFETMSYVSKRTSTSVLLVEYTGYGIAYGE  104

Query  170  SEEAELSEIGVVSDSKYVLEWLLKIVNGTAPVFVWGHSLGTGVSVHVLALLATEKVQPAG  229
            + E  ++E  V+S   Y +  +    +    V + G S+GTG S  V ALL  E+  PA 
Sbjct  105  TTERSMNE-DVLSAYYYAVRHMRVPADR---VVLMGCSIGTGPSAQVCALLQGEEEVPAL  160

Query  230  LFLESPFNNI---ADELSEHPLSQIFKHL--PWFHWVIVEPFYDNYLRFESDKHIEKIQC  284
            L L+SPF ++   A++++ + +  I  +L   WF  + V               + +++C
Sbjct  161  LVLQSPFTSLKECANDMTPN-VGSIVGYLGYDWFRTIDV---------------VAQVRC  204

Query  285  PIMILHAEDDNIVPFALGEKLFK  307
            PI+I H + D++VPF   ++L +
Sbjct  205  PIIIHHGQCDDVVPFEHAQQLKR  227


>AHO3_CAEEL unnamed protein product
Length=332

 Score = 43.1 bits (100),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 79/182 (43%), Gaps = 31/182 (17%)

Query  130  FLYMHGNSGNRASNHRLELYKLFQTLDYHVICFDYRGYGDSEEAELSEIGVVSDSKYVLE  189
             L+ HGN+ +        LY L   L+ +V  +DY GYG S   + SE  + +D     E
Sbjct  115  LLFSHGNAVDLGQMTSF-LYGLGFHLNCNVFSYDYSGYGCST-GKPSEKNLYADITAAFE  172

Query  190  WLLKIVNGTAP--VFVWGHSLGTGVSVHVLALLATEKVQPAGLFLESPFNNIADELSEHP  247
             LLK   G     + ++G S+GT  SV    L + E +  A L L SP            
Sbjct  173  -LLKSEFGVPKEKIILYGQSIGTVPSVD---LASREDL--AALVLHSPL-----------  215

Query  248  LSQIFKHLPWFH--WVIVEPFYDNYLRFESDKHIEKIQCPIMILHAEDDNIVPFALGEKL  305
            +S +    P     W            F S + + +++CP +++H  DD ++ F+ G  +
Sbjct  216  MSGMRVAFPGTTTTWCCDA--------FPSIEKVPRVKCPTLVIHGTDDEVIDFSHGVSI  267

Query  306  FK  307
            ++
Sbjct  268  YE  269



Lambda      K        H
   0.315    0.133    0.398 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5412849180


Query= XP_003393002.1 very long-chain-fatty-acid--CoA ligase bubblegum
[Bombus terrestris]

Length=684
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

BGM_DROME  unnamed protein product                                    632     0.0   
BGML_DROME  unnamed protein product                                   499     7e-169
FCSA_DICDI  unnamed protein product                                   202     8e-56 


>BGM_DROME unnamed protein product
Length=666

 Score = 632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/660 (49%), Positives = 451/660 (68%), Gaps = 21/660 (3%)

Query  39   GPDQILPADSFTTTKIDGHVRIQLNNEDF---KPISVPGLLSNTVRKYPNHIALAATPDE  95
            GP+++  AD++ TT     V+I++  +     +PISVPGLL  TV  Y ++ AL     +
Sbjct  12   GPNRLRQADAYRTTNRQDAVKIRMAKDGIGAEEPISVPGLLKRTVNNYGDYPALRTKNGK  71

Query  96   TGHRKTYTFIEYENQIKTVAKAFLKLGLERFHGVCILGFNSPEWLFSNLGAIYAGGIAVG  155
             G+  T T+ +YE ++  VAKAF+KLGLE  H V +L FN  EW +S +GAI+A GI  G
Sbjct  72   NGYH-TVTYKQYEQKVHQVAKAFIKLGLEEHHSVGVLAFNCAEWFYSAMGAIHARGIIAG  130

Query  156  IYATNTPDACQHCLQISQANIVVVEDSKQLEKILQIRHNLPHLKAIIQ----YTGTPNEK  211
            IY TN+ DA QH L+ S A IVVV+D+KQ++KI  IR  LP LKA IQ    Y+    ++
Sbjct  131  IYTTNSADAVQHVLESSHAQIVVVDDAKQMDKIHAIRDKLPKLKAAIQIQEPYSPYLKKE  190

Query  212  D-VLSWNDLIKIGEAESDDKLNEILKRIATNECCTLVFTSGTVGYPKAVMLSHDNLIYNV  270
            D    W+++  +  ++ +D+    L+ +A NECC LV+TSGTVG PK VMLSHDN+ ++V
Sbjct  191  DGYYRWSEIESMNVSDVEDQYMTRLENVAINECCCLVYTSGTVGMPKGVMLSHDNITFDV  250

Query  271  R----SMNRVFKFKTACEHIISYLPLSHVAAQAIDIYYSIYIVATLHFADRNALKGSLIN  326
            R    +M+RV       E I+SYLPLSHVAAQ +DIY   ++   + FAD++ALKG+L+ 
Sbjct  251  RGIVKAMDRVV---VGAESIVSYLPLSHVAAQTVDIYTCAFVAGCIWFADKDALKGTLVK  307

Query  327  TLLEVRPTIFVGVPRVWEKIYSKLQS-EVNTGFIKTCIVSWATSQGY-HYNVNKMNGNDH  384
            +L + RPT F+GVPRV+EK   ++ +   ++G +K  + SWA      HY V++  G   
Sbjct  308  SLQDARPTRFMGVPRVYEKFQERMVAVASSSGSLKKMLASWAKGITLKHYMVSQ--GKSS  365

Query  385  KHWGYIFAKWLIFNKIKTALGLDRCHRCITAAAPLSIQIKEYFLSLDIPILEAYGMSECS  444
              + Y  AK LI +K+K ALG DR     +AAAP+S + K+YFLSLD+ I++A+GMSE +
Sbjct  366  GGFRYKIAKSLIMSKVKQALGFDRVLTLASAAAPMSPETKKYFLSLDLKIVDAFGMSETA  425

Query  445  GGHILTAPDQFKLGSIGRTVPGLKTKLDNPDSNGEGEVCMYGRHIFMGYLNEPEKTGEAL  504
            G H +  PD   L +IG+T+PG ++K  N D+NG GE+C+ GRH+FMGY++  EKT E+L
Sbjct  426  GCHTICLPDSVGLNTIGKTLPGCESKFINKDANGHGELCIRGRHVFMGYIDNKEKTEESL  485

Query  505  DGERWLHSGDVGKIDSNGFLHITGRIKEIIITAGGENIPPVHIEELVLAELPALSNALLI  564
            D + WLHSGD+G +D  G++ +TGR KEIIITAGGENIPPVHIE  +  EL A+SNA L+
Sbjct  486  DDDCWLHSGDLGFVDDKGYVSLTGRSKEIIITAGGENIPPVHIENTIKKELDAISNAFLV  545

Query  565  GDKRKYLTILVTLKTTVNTETSEPTDDFTEETLKWLQSIGSTSKTISDVLKTHD-PLVYE  623
            G++RKYLT+L+TLKT V+ ++ EP D+ + E+  W++S+G   KT+SD+L     P V++
Sbjct  546  GEQRKYLTVLITLKTEVDKDSGEPLDELSHESSVWVKSLGVEHKTVSDILAAGPCPKVWK  605

Query  624  EIDKAIKRANTKSISNAQKVQKFQILPKDFSLATGELGPTLKLKRNVVYKKYENLIEDMY  683
             I+ AIKRAN +SISNAQKVQKF ILP DFS+ TGELGPTLK+KRNVV K Y + IE +Y
Sbjct  606  SIEDAIKRANKQSISNAQKVQKFTILPHDFSIPTGELGPTLKVKRNVVSKMYADEIEKLY  665


>BGML_DROME unnamed protein product
Length=681

 Score = 499 bits (1286),  Expect = 7e-169, Method: Compositional matrix adjust.
 Identities = 280/682 (41%), Positives = 398/682 (58%), Gaps = 48/682 (7%)

Query  45   PADSFTTTKIDGHVRIQLN-----NEDFKPISVPGLLSNTVRKYPNHIALAATPDETGHR  99
            PA S+ +T +   V+++L+     ++   P ++P     +  KY +  AL      +G+ 
Sbjct  6    PATSYRSTSLHDAVKLRLDEPSSFSQTVPPQTIPEFFKESCEKYSDLPALVWETPGSGND  65

Query  100  --KTYTFIEYENQIKTVAKAFLKLGLERFHGVCILGFNSPEWLFSNLGAIYAGGIAVGIY  157
               T TF EY+ +++  A   L +G+E    V IL FN PEW F+  GA+ AG +  G+Y
Sbjct  66   GWTTLTFGEYQERVEQAALMLLSVGVEERSSVGILAFNCPEWFFAEFGALRAGAVVAGVY  125

Query  158  ATNTPDACQHCLQISQANIVVVEDSKQLEKILQIRHNLPHLKAIIQYTG-----TPNEKD  212
             +N+ +A  H L   ++++ VV+D++Q+ K+  I+  LP LKA+IQ  G       +E  
Sbjct  126  PSNSAEAVHHVLATGESSVCVVDDAQQMAKLRAIKERLPRLKAVIQLHGPFEAFVDHEPG  185

Query  213  VLSWNDLIKIGEAESDDKLNEIL----KRIATNECCTLVFTSGTVGYPKAVMLSHDNLIY  268
              SW    K+ E     +L E L     RI  NEC  L+FTSGTVG PKAVMLSHDNL++
Sbjct  186  YFSWQ---KLQEQTFSSELKEELLARESRIRANECAMLIFTSGTVGMPKAVMLSHDNLVF  242

Query  269  NVRSMNRVFK-FKTACEHIISYLPLSHVAAQAIDIYYSIYIVATLHFADRNALKGSLINT  327
            + +S     +  +   E  +SYLPLSHVAAQ  D++  +     + FAD++ALKG+LI T
Sbjct  243  DTKSAAAHMQDIQVGKESFVSYLPLSHVAAQIFDVFLGLSHAGCVTFADKDALKGTLIKT  302

Query  328  LLEVRPTIFVGVPRVWEKIYSKL-QSEVNTGFIKTCIVSWATSQGYHYNVNKMNGNDHKH  386
              + RPT   GVPRV+EK+  +L  +E         +++ A +    +    M G     
Sbjct  303  FRKARPTKMFGVPRVFEKLQERLVAAEAKARPYSRLLLARARAAVAEHQTTLMAGKSPSI  362

Query  387  WGYIFAK-WL---IFNKIKTALGLDRCHRCITAAAPLSIQIKEYFLSLDIPILEAYGMSE  442
            +G   AK WL   +   I+  +G+D C    T  AP S ++K++FL LDI + E YGMSE
Sbjct  363  YGN--AKYWLACRVVKPIREMIGVDNCRVFFTGGAPTSEELKQFFLGLDIALGECYGMSE  420

Query  443  CSGGHILTAPDQFKLGSIGRTVPGLKTKLDNPDSNGEGEVCMYGRHIFMGYLNEPEKTGE  502
             SG   L   D   L S G+   G+  K+  PD NG+GE+ M GR +FMGYL  P+KT E
Sbjct  421  TSGAITLNV-DISNLYSAGQACEGVTLKIHEPDCNGQGEILMRGRLVFMGYLGLPDKTEE  479

Query  503  ALDGERWLHSGDVGKIDSNGFLHITGRIKEIIITAGGENIPPVHIEELVLAELPALSNAL  562
             +  + WLHSGD+G ID  G L I+GR+KE+IITAGGENIPPVHIEEL+  ELP +SN L
Sbjct  480  TVKEDGWLHSGDLGYIDPKGNLIISGRLKELIITAGGENIPPVHIEELIKKELPCVSNVL  539

Query  563  LIGDKRKYLTILVTLKTTVNTETSEPTDDFTEETLKWLQSIGSTSKTISDVLK-------  615
            LIGD RKYLT+L++LKT  + +T  P D   EET++WL+ +      +S++L        
Sbjct  540  LIGDHRKYLTVLLSLKTKCDAKTGIPLDALREETIEWLRDLDIHETRLSELLNIPADLQL  599

Query  616  -------------THDPLVYEEIDKAIKRANTKSISNAQKVQKFQILPKDFSLATGELGP  662
                         T  P + E I++ IKRAN  +ISNAQKVQKF ++  +FS+ATGELGP
Sbjct  600  PNDTAALAATLEITAKPKLLEAIEEGIKRANKYAISNAQKVQKFALIAHEFSVATGELGP  659

Query  663  TLKLKRNVVYKKYENLIEDMYK  684
            TLK++RN+V+ KY  +IE +YK
Sbjct  660  TLKIRRNIVHAKYAKVIERLYK  681


>FCSA_DICDI unnamed protein product
Length=667

 Score = 202 bits (513),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 162/610 (27%), Positives = 281/610 (46%), Gaps = 55/610 (9%)

Query  97   GHRKTYTFIEYEN---QIKTVAKAFLKLGLERFHGVCILGFNSPEWLFSNLGAIYAGGIA  153
            G R  Y +I Y+    +   +  A ++LGL +   + I   N PEW+ S++ A+    + 
Sbjct  80   GKRGDYKWISYKQACIRANNIGSALVQLGLNKGDRIGIFSINRPEWVLSDMAAMNHSLVP  139

Query  154  VGIYATNTPDACQHCLQISQANIVVVEDSKQLEKILQIRHNLPHLKAIIQYTGTPNEK-D  212
            V +YAT   +A ++ +  S+ ++++ E  K +EKIL +      +K I+ Y   P    D
Sbjct  140  VALYATLGANAIEYVVNHSEISVLLCE-GKNVEKILSMPGTT--IKTIVSYDPLPQATLD  196

Query  213  VLSWNDLIKIGEAESDDKLNEILKRIATNEC------CTLVFTSGTVGYPKAVMLSHDNL  266
                N+ +K+      +KL E  +  A +E       CTL++TSG+ G PK VML+H N+
Sbjct  197  KFKDNENVKLYLLSDFEKLGE--QNPAQHEVPSPEDLCTLLYTSGSTGNPKGVMLTHTNM  254

Query  267  IYNVRSMNRVFKFKTACEHIISYLPLSHVAAQAIDIYYSIYIVATLHFADRNALKGSLIN  326
            +  V   N         +  +SYLPL+H   +A+ +    Y+   + F   + L   L N
Sbjct  255  VSEVAGANFSPAGVIPEDVHMSYLPLAHSFERAV-VSLMCYVGGQIGFF--SGLIPELFN  311

Query  327  TLLEVRPTIFVGVPRVWEKIYSKLQSEVNTGFIKTCIVSWATSQGYHYNVNKMNGNDHKH  386
             +  +RPT   G PRVW++++ KL   VN         SW     +++ +N  +      
Sbjct  312  DIQVLRPTFLCGAPRVWQRLHDKLWFTVNND-------SWLKKFLFNWGLN--SKQSALR  362

Query  387  WGYIFAKW--LIFNKIKTALGLDRCHRCITAAAPLSIQIKEYFLS-LDIPILEAYGMSEC  443
             G     W  L+F+K K  LG  R    ++ +APL  ++ E+  +    P++  YG+SE 
Sbjct  363  LGSTTPIWDKLVFSKTKDRLG-GRVKFILSGSAPLDPKLAEFLRACFCCPVVSGYGLSEN  421

Query  444  SGGHILTAPDQFKLGSIGRTVPGLKTKL-DNPDSN--------GEGEVCMYGRHIFMGYL  494
             GG  +  P+   +G +G  +   + KL D P+ N          GEVC+ G ++F GY 
Sbjct  422  VGGASVAYPEDNNVGHVGPPLSACEMKLIDVPEMNYFSTDKPCPRGEVCIRGFNVFKGYF  481

Query  495  NEPEKTGEALDGERWLHSGDVGKIDSNGFLHITGRIKEIIITAGGENIPPVHIEELVLAE  554
             +PEKT E L  + W H+GD+G+ + NG L I  R K I   + GE +   ++E  V   
Sbjct  482  KDPEKTKEDLKEDGWFHTGDIGRWNENGTLSIIDRKKNIFKLSQGEYVAAEYLES-VFVR  540

Query  555  LPALSNALLIGDK-RKYLTILVTLKTTVNTETSEPTDDFTEETLKWLQSIGSTSKTISDV  613
             P  S   + GD    +L  +V     V  +       + E  +    ++  + +   ++
Sbjct  541  SPFASQVFVYGDSLNSFLVGVVVPDFEVVQKLF--ASKYPELDVSNHATLAKSKELYKEI  598

Query  614  LKTHDPLVYEEIDKAIKRANTKSISNAQKVQKFQILPKDFSLATGELGPTLKLKRNVVYK  673
            L + D    E             +   +K++   +  + F+     L P+ K KR  + +
Sbjct  599  LSSFDACAAE-----------AKLHGFEKLKHIYVEHEPFTEENNLLTPSFKPKRPQLKE  647

Query  674  KYENLIEDMY  683
            +Y+ +I+ +Y
Sbjct  648  RYQTIIDTLY  657



Lambda      K        H
   0.315    0.133    0.398 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5412849180


Query= XP_003393003.1 collagen type IV alpha-3-binding protein [Bombus
terrestris]

Length=590
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9Y128_DROME  unnamed protein product                                 665     0.0   
M9PEI8_DROME  unnamed protein product                                 379     3e-128
Q9VC05_DROME  unnamed protein product                                 99.0    2e-21 


>Q9Y128_DROME unnamed protein product
Length=601

 Score = 665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/575 (57%), Positives = 420/575 (73%), Gaps = 37/575 (6%)

Query  39   ELQGTLSKWTNYIHGWQTRFIVLKDGTLSYYKSEQDSGFGCRGSISLYKANIKAHEFDEC  98
            EL+G LSKWTNYI+GWQ R+IVLKDGTLSYYKSE +S FGCRG+ISL KA IKAHE DE 
Sbjct  41   ELRGYLSKWTNYIYGWQPRYIVLKDGTLSYYKSESESDFGCRGAISLTKATIKAHESDEL  100

Query  99   RFDVSVNDCLVWYLRASNPEEKQRWVDVLKSYKSESGYGSENSLKRHGSAISLISNTQSI  158
            RFDV VN+   W LRA   E++  WVDVL+ YK++SG     SL+RHGS +SL SNT S+
Sbjct  101  RFDVVVNNLNNWCLRAETSEDRMHWVDVLQLYKADSGSTDTTSLRRHGSTMSLQSNTISL  160

Query  159  TSAGSFTKRGVRGLKEKLAELETFRDILIKQIDTLQKYFDNCAENAKNISTKENKVETMF  218
            TS GS  K+  R L+EK+ ELETF+DIL  QI+TLQ+YFD C+E  KN     N      
Sbjct  161  TSGGSL-KKTQRNLREKVGELETFKDILFGQIETLQRYFDACSEVNKN-----NAQPLDL  214

Query  219  NPAEQSVDFKGEAITFKATSEGVLATLQHCVELMVQREDAWRRRWEKEIERKRKVQELYK  278
                +S+DFKGE+ITF+AT+ GVL TLQHC+E++ + +++W+R+ E+EI+++R+ ++  K
Sbjct  215  GDGLKSIDFKGESITFRATTSGVLTTLQHCLEIIAESDESWKRKLEREIDKRRRSEDQSK  274

Query  279  ALKEQV-TMQQSDFPRPRVLIHGGPDYEEGPHSALCDEEFYDAVETGLDKIDEENQLRDR  337
             LK++V  M++  +P        GPD+EEGPHS L ++EF+DAVETGLDKI+E+ QLR +
Sbjct  275  KLKDEVEKMKRLSYP--------GPDFEEGPHSTLPEDEFFDAVETGLDKIEEDMQLRFK  326

Query  338  LK---QKSVSILTTPIMS----------------AVKHRLWPEVTKITMEQLHYARLGVG  378
            LK   Q S +++  P  +                A  H LWPE+ ++  EQLHYAR GVG
Sbjct  327  LKLQSQISQTLVNVPHEAVAEGEEAREEFGTGAEATSHALWPEIDRVCKEQLHYAREGVG  386

Query  379  --AGGWQLFAEDGDMRMYRREEEADGLVVDPLKACHVVKGVTGHEVCEIFFSPEYRTGWE  436
                GWQ+FA++G+++MY+REEE +GLV+DPLKA H V+GVT  E+C  FF PE+R  WE
Sbjct  387  QDGNGWQIFADEGEIKMYKREEEVNGLVMDPLKAYHTVQGVTAREMCHYFFMPEFRNDWE  446

Query  437  ATLEDMTVVENISKDTLIFLQTHKRIWPASQRDALFWSHMRRVSDDQDPDAHDLWIVCNH  496
             TLED T++E IS DTL+FLQTHKRIWPASQRDA FWSHMR+++D+ +P A D+W+VCN+
Sbjct  447  TTLEDCTILEKISADTLLFLQTHKRIWPASQRDAQFWSHMRKITDNLEPGARDMWVVCNN  506

Query  497  STEHPDYPPNTGKCVRVYLTVCLVCQTFIDPPKDEDE-IKRENITCKITYCSVVNPGGWA  555
            STE+       GKCVR++LTV L CQT +     + + + R ++TCKITYCSVVNPGGWA
Sbjct  507  STEYAKQESKNGKCVRIFLTVILACQTHLPEGYVKGQPLNRNDLTCKITYCSVVNPGGWA  566

Query  556  PASVLRAVYKREYPKFLKRFTNFCIDQCKDKPIIF  590
            PAS LRAVYKREYPKFLKRFT + IDQCKDKPI+F
Sbjct  567  PASALRAVYKREYPKFLKRFTGYVIDQCKDKPIMF  601


>M9PEI8_DROME unnamed protein product
Length=329

 Score = 379 bits (974),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 180/308 (58%), Positives = 228/308 (74%), Gaps = 22/308 (7%)

Query  305  EEGPHSALCDEEFYDAVETGLDKIDEENQLRDRLK---QKSVSILTTPIMS---------  352
            +EGPHS L ++EF+DAVETGLDKI+E+ QLR +LK   Q S +++  P  +         
Sbjct  22   KEGPHSTLPEDEFFDAVETGLDKIEEDMQLRFKLKLQSQISQTLVNVPHEAVAEGEEARE  81

Query  353  -------AVKHRLWPEVTKITMEQLHYARLGVG--AGGWQLFAEDGDMRMYRREEEADGL  403
                   A  H LWPE+ ++  EQLHYAR GVG    GWQ+FA++G+++MY+REEE +GL
Sbjct  82   EFGTGAEATSHALWPEIDRVCKEQLHYAREGVGQDGNGWQIFADEGEIKMYKREEEVNGL  141

Query  404  VVDPLKACHVVKGVTGHEVCEIFFSPEYRTGWEATLEDMTVVENISKDTLIFLQTHKRIW  463
            V+DPLKA H V+GVT  E+C  FF PE+R  WE TLED T++E IS DTL+FLQTHKRIW
Sbjct  142  VMDPLKAYHTVQGVTAREMCHYFFMPEFRNDWETTLEDCTILEKISADTLLFLQTHKRIW  201

Query  464  PASQRDALFWSHMRRVSDDQDPDAHDLWIVCNHSTEHPDYPPNTGKCVRVYLTVCLVCQT  523
            PASQRDA FWSHMR+++D+ +P A D+W+VCN+STE+       GKCVR++LTV L CQT
Sbjct  202  PASQRDAQFWSHMRKITDNLEPGARDMWVVCNNSTEYAKQESKNGKCVRIFLTVILACQT  261

Query  524  FIDPPKDEDE-IKRENITCKITYCSVVNPGGWAPASVLRAVYKREYPKFLKRFTNFCIDQ  582
             +     + + + R ++TCKITYCSVVNPGGWAPAS LRAVYKREYPKFLKRFT + IDQ
Sbjct  262  HLPEGYVKGQPLNRNDLTCKITYCSVVNPGGWAPASALRAVYKREYPKFLKRFTGYVIDQ  321

Query  583  CKDKPIIF  590
            CKDKPI+F
Sbjct  322  CKDKPIMF  329


>Q9VC05_DROME unnamed protein product
Length=784

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 80/296 (27%), Positives = 134/296 (45%), Gaps = 34/296 (11%)

Query  37   VPELQGTLSKWTNYIHGWQTRFIVLKDGTLSYYKSEQDSGFGCRGSISLYKANIKAHEFD  96
            +PE++G L KWTNYI G+Q R+ VL  G LSYY+++ +    CRG+ISL+ A I  H  D
Sbjct  14   LPEMKGWLLKWTNYIKGYQRRWFVLSKGVLSYYRNQSEINHTCRGTISLHGALI--HTVD  71

Query  97   ECRFDVSVNDCLVWYLRASNPEEKQRWVDVLKSYKSESGYGSENSLKRHGSAISLISNTQ  156
             C F +S      ++++A    E+Q WV  L+  K+++    E   +       ++  +Q
Sbjct  72   SCTFVISNGGTQTFHIKAGTEVERQSWVTALELAKAKAIRAIECEEEEETETAHVVP-SQ  130

Query  157  SITSAGSFTKRGVRGLKEKLAELETFRDILIKQIDTLQKYFDNCAENAKNISTKENKVET  216
             I+S        VR L ++L  + T  D++ K    LQ+  ++   N +       K+  
Sbjct  131  EISSV-------VRDLTDRLESMRTCYDLITKHGAALQRALNDLETNEEESLGSRTKI--  181

Query  217  MFNPAEQSVDFKGEAITFKATSEGVLATLQHCVELMVQREDAWRRRWEKEIERKRKVQEL  276
                          A  F+ TS  ++      +     +   W +    E E++++++E+
Sbjct  182  ----------VNERATLFRITSNAMINAGNDYLHTAEAQGHKWSKMLHHEREQRQRLEEI  231

Query  277  YKALKEQVTMQQSDFPRPRVLIHGGPDYEE----GPHSALC--DE--EFYDAVETG  324
                 EQ+  QQS   +  VL+            G   +L   DE  EF+DA E G
Sbjct  232  I----EQMAKQQSQMEQAAVLVRQNKPVSSTSGAGTAGSLVTSDEEMEFFDAEEHG  283



Lambda      K        H
   0.315    0.133    0.398 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5412849180


Query= XP_003393005.1 actin-related protein 2 isoform X3 [Bombus
terrestris]

Length=400
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ARP2_DROME  unnamed protein product                                   705     0.0  
ARP2_CAEEL  unnamed protein product                                   608     0.0  
ARP2_DICDI  unnamed protein product                                   570     0.0  


>ARP2_DROME unnamed protein product
Length=399

 Score = 705 bits (1820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/395 (84%), Positives = 369/395 (93%), Gaps = 1/395 (0%)

Query  1    MDSKGRKIIVCDNGTGFVKCGYAGANFPAHIFPSIVGRPIIRAVNKIGDIDVKDVLNMPD  60
            MDSKGR +IVCDNGTGFVKCGYAG+NFP HIFPS+VGRP+IRAVNKIGDI+VKD L++ D
Sbjct  1    MDSKGRNVIVCDNGTGFVKCGYAGSNFPTHIFPSMVGRPMIRAVNKIGDIEVKD-LHVDD  59

Query  61   LMVGDEASKLRSMLEISYPMQNGIVRNWEDMCHVWDYTFGKEKMNINPRECKILLTEPPM  120
            LMVGDEAS+LRS+LE+SYPM+NG+VRNW+DMCHVWDYTFG +KM+I+P   KILLTEPPM
Sbjct  60   LMVGDEASQLRSLLEVSYPMENGVVRNWDDMCHVWDYTFGPKKMDIDPTNTKILLTEPPM  119

Query  121  NPITNREKMIEVMFEKYGFAGTYIAIQAVLTLYAQGLISGVVVDSGDGVTHICPVFEEYA  180
            NP  NREKMIEVMFEKYGF   YIAIQAVLTLYAQGLISGVV+DSGDGVTHICPV+EE+A
Sbjct  120  NPTKNREKMIEVMFEKYGFDSAYIAIQAVLTLYAQGLISGVVIDSGDGVTHICPVYEEFA  179

Query  181  LPHLTRRLDIAGRDITMYLIKLLLLRGYAFNHSADFETVRMLKEKLCYIGYNIETEEKLA  240
            LPHLTRRLDIAGRDIT YLIKLLLLRGYAFNHSADFETVR++KEKLCYIGY+IE E++LA
Sbjct  180  LPHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRIMKEKLCYIGYDIEMEQRLA  239

Query  241  LETTVLVESYTLPDGRVIKVGGERFAAPEALFQPHLINVEAQGIAELVFSTIQAADIDIR  300
            LETTVLVESYTLPDGRVIKVGGERF APEALFQPHLINVE  GIAEL F+TIQAADIDIR
Sbjct  240  LETTVLVESYTLPDGRVIKVGGERFEAPEALFQPHLINVEGPGIAELAFNTIQAADIDIR  299

Query  301  SELYKHIVLSGGSTMYPGLPSRLEREIKQLYLQRVLKNDTSKLNKFKIKIEDSPRRKDMV  360
             ELYKHIVLSGGSTMYPGLPSRLEREIKQLYL+RVLKNDT KL KFKI+IED PRRKDMV
Sbjct  300  PELYKHIVLSGGSTMYPGLPSRLEREIKQLYLERVLKNDTEKLAKFKIRIEDPPRRKDMV  359

Query  361  FMGGAVLAEITKDRESVWITREEYEEKGLSVLKKL  395
            F+GGAVLAE+TKDR+  W++++EY+E+GL VL+KL
Sbjct  360  FIGGAVLAEVTKDRDGFWMSKQEYQEQGLKVLQKL  394


>ARP2_CAEEL unnamed protein product
Length=395

 Score = 608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/398 (71%), Positives = 339/398 (85%), Gaps = 8/398 (2%)

Query  1    MDSKGRKIIVCDNGTGFVKCGYAGANFPAHIFPSIVGRPIIRAVNKIGDIDVKDVLNMPD  60
            MDS+GRK+IV DNGTGFVKCGYAG NFPAHIFPS+VGRPI+R+  ++G+I++KD      
Sbjct  1    MDSQGRKVIVVDNGTGFVKCGYAGTNFPAHIFPSMVGRPIVRSTQRVGNIEIKD------  54

Query  61   LMVGDEASKLRSMLEISYPMQNGIVRNWEDMCHVWDYTFGKEKMNINPRECKILLTEPPM  120
            LMVG+E S+LR ML+I+YPM NGIVRNW+DM HVWD+TFG EK++I+P+ECK+LLTEPP+
Sbjct  55   LMVGEECSQLRQMLDINYPMDNGIVRNWDDMAHVWDHTFGPEKLDIDPKECKLLLTEPPL  114

Query  121  NPITNREKMIEVMFEKYGFAGTYIAIQAVLTLYAQGLISGVVVDSGDGVTHICPVFEEYA  180
            NP +NREKM +VMFE+YGF   Y+A+QAVLTLYAQGL++GVVVDSGDGVTHICPV+E +A
Sbjct  115  NPNSNREKMFQVMFEQYGFNSIYVAVQAVLTLYAQGLLTGVVVDSGDGVTHICPVYEGFA  174

Query  181  LPHLTRRLDIAGRDITMYLIKLLLLRGYAFNHSADFETVRMLKEKLCYIGYNIETEEKLA  240
            L HLTRRLDIAGRDIT YLIKLLL RGY FNHSADFETVR +KEKLCYI Y++E EE+LA
Sbjct  175  LHHLTRRLDIAGRDITKYLIKLLLQRGYNFNHSADFETVRQMKEKLCYIAYDVEQEERLA  234

Query  241  LETTVLVESYTLPDGRVIKVGGERFAAPEALFQPHLINVEAQGIAELVFSTIQAADIDIR  300
            LETTVL + YTLPDGRVI++GGERF APE LFQPHLINVE  G++EL+F  IQA+DID R
Sbjct  235  LETTVLSQQYTLPDGRVIRLGGERFEAPEILFQPHLINVEKAGLSELLFGCIQASDIDTR  294

Query  301  SELYKHIVLSGGSTMYPGLPSRLEREIKQLYLQRVLKNDTSKLNKFKIKIEDSPRRKDMV  360
             + YKHIVLSGG+TMYPGLPSRLE+E+KQLYL RVL  +T    KFKI+IE  P RK MV
Sbjct  295  LDFYKHIVLSGGTTMYPGLPSRLEKELKQLYLDRVLHGNTDAFQKFKIRIEAPPSRKHMV  354

Query  361  FMGGAVLAEITKDR-ESVWITREEYEEKGLS-VLKKLG  396
            F+GGAVLA + KDR +  W++++EYEE G++  + KLG
Sbjct  355  FLGGAVLANLMKDRDQDFWVSKKEYEEGGIARCMAKLG  392


>ARP2_DICDI unnamed protein product
Length=392

 Score = 570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/396 (68%), Positives = 326/396 (82%), Gaps = 10/396 (3%)

Query  1    MDSKGRKIIVCDNGTGFVKCGYAGANFPAHIFPSIVGRPIIRAVNKIGDIDVKDVLNMPD  60
            MDS   K+IV DNGTGFVKCG+AGANFP  IFPS+VGRPI+R+  K+ ++++KD+     
Sbjct  1    MDSN--KVIVMDNGTGFVKCGFAGANFPTAIFPSMVGRPILRSEEKVENVEIKDI-----  53

Query  61   LMVGDEASKLRSMLEISYPMQNGIVRNWEDMCHVWDYTFGKEKMNI-NPRECKILLTEPP  119
             MVGDEA+KLRSML+I+YP++NGI+RNW+D+ HVWDY   KEK+ + +P ECKILLTEPP
Sbjct  54   -MVGDEAAKLRSMLQITYPLENGIIRNWDDITHVWDYAL-KEKLKVSDPTECKILLTEPP  111

Query  120  MNPITNREKMIEVMFEKYGFAGTYIAIQAVLTLYAQGLISGVVVDSGDGVTHICPVFEEY  179
            MNP+ NR+KMIE MFEKYGF   Y+AIQAVLTLYAQGL++GVVVDSGDGVTHI PV+E Y
Sbjct  112  MNPVANRQKMIECMFEKYGFQAVYVAIQAVLTLYAQGLLTGVVVDSGDGVTHIIPVYEGY  171

Query  180  ALPHLTRRLDIAGRDITMYLIKLLLLRGYAFNHSADFETVRMLKEKLCYIGYNIETEEKL  239
            ++PHLTRRLD+AGRD+T YLIKLLLLRGYAFN +ADFET+R +KEKLCY+ Y+++ E KL
Sbjct  172  SIPHLTRRLDVAGRDVTRYLIKLLLLRGYAFNRTADFETIRQIKEKLCYVAYDVQQEMKL  231

Query  240  ALETTVLVESYTLPDGRVIKVGGERFAAPEALFQPHLINVEAQGIAELVFSTIQAADIDI  299
            A ETTVLVE+YTLPDGRVIKVG ERF A EALF P L++VE  G+ E +F  I  AD D+
Sbjct  232  ASETTVLVENYTLPDGRVIKVGQERFQASEALFNPSLVDVEGGGVHEQLFDCITKADRDL  291

Query  300  RSELYKHIVLSGGSTMYPGLPSRLEREIKQLYLQRVLKNDTSKLNKFKIKIEDSPRRKDM  359
            +   Y+HIVLSGGS+MYPGLPSRLE+EI+ LYL+RVLK +   L KFK +IED PRRK M
Sbjct  292  QQGFYQHIVLSGGSSMYPGLPSRLEKEIRSLYLERVLKGNKEGLAKFKCRIEDPPRRKHM  351

Query  360  VFMGGAVLAEITKDRESVWITREEYEEKGLSVLKKL  395
            VF+GGAVLA++TKDR+  WIT+ EY EKG   L KL
Sbjct  352  VFLGGAVLADLTKDRDDFWITKAEYMEKGFGALDKL  387



Lambda      K        H
   0.315    0.133    0.398 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5412849180


Query= XP_003393006.1 RNA pseudouridylate synthase domain-containing
protein 4 [Bombus terrestris]

Length=347
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q38FJ3_TRYB2  unnamed protein product                                 42.7    3e-04
SERA_PLAF7  unnamed protein product                                   31.2    1.4  
Q381G5_TRYB2  unnamed protein product                                 31.2    1.5  


>Q38FJ3_TRYB2 unnamed protein product
Length=406

 Score = 42.7 bits (99),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 56/282 (20%), Positives = 109/282 (39%), Gaps = 46/282 (16%)

Query  53   NNIIYNKDGLVVLNKPYGIRRKSLDTSIIHVQSKVPNSVDYTLDDALPYIAKQLNYLNLT  112
            N +++  + ++V+NKP+G+     D           +  + ++   LP   K  N     
Sbjct  158  NMVLFKNEHVIVINKPHGLPMMPTD-----------DPQEMSIAAMLP-AWKFTNVAKPV  205

Query  113  IVKCPEIYMSGITLLAANEHVHRAIELAYARSHFQANTYWIVTVGISKQLEGQIRLGMKP  172
            +    +   SG  +LA   + HR +   + +     + YW   VG      G++R+    
Sbjct  206  VCHNLDRETSGCVVLARTRNAHRMLGRMFVKRVVPNSVYWSFCVGKPTVNYGRVRMHF--  263

Query  173  ISDPQFKHRKIILTSSWSRNEEKYRKIKLLKAEYKVLSNSTFNLCSLVELKSSTHAKNAI  232
              D    ++  I+ +  S  +      K+  AE+ V++ S     S +     T  ++  
Sbjct  264  --DITRGNKGDIIVARPSPTKTS----KVAIAEF-VVNASALEFGSFISFYPLTTRRHQE  316

Query  233  RLFAATYLYSPILGDNIYASRIQKIGNTYVRVDPFLSCPGLPKLDMKLLRLLNVRVKQQE  292
            R+ AA  L  P+LGD  Y        +  +  DP                       + +
Sbjct  317  RIMAAHALRCPVLGDAKYGGDAAFPSSLSLFWDP-----------------------ENK  353

Query  293  IIPAHIHLKSVVLP--SFFGKTLTIEAPLMPPFDWTCKQLDF  332
             +P H+H + + LP  +  G+ + + APL    + T K+L +
Sbjct  354  GLPLHLHHRKIQLPYKNTAGEFICVTAPLPTQMEKTFKKLGW  395


>SERA_PLAF7 unnamed protein product
Length=997

 Score = 31.2 bits (69),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 17/52 (33%), Positives = 27/52 (52%), Gaps = 1/52 (2%)

Query  163  EGQIRLGMKPISDPQFKHRKIILTSSWSRNEEKYRK-IKLLKAEYKVLSNST  213
            +G+IR+GM+   D Q  ++K   T S++ N E Y K + L    +K     T
Sbjct  926  DGKIRMGMRKYIDTQDVNKKHSCTRSYAFNPENYEKCVNLCNVNWKTCEEKT  977


>Q381G5_TRYB2 unnamed protein product
Length=705

 Score = 31.2 bits (69),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 30/63 (48%), Gaps = 8/63 (13%)

Query  25   LKRNYLKNHPYKHIHPWISFTQFSDDLLNNIIYNKDGLVVLNKPYGIRRKSLDTSIIHVQ  84
            L+  +L++ PY        F QFS+  L NII   + +V+ N  +   +  LD S   +Q
Sbjct  373  LRVEFLRSFPY--------FVQFSNAALENIISKAEPIVLHNNDHLFSKSELDPSAYFIQ  424

Query  85   SKV  87
              V
Sbjct  425  DGV  427



Lambda      K        H
   0.315    0.133    0.398 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5412849180


Query= XP_003393007.1 alkaline ceramidase isoform X2 [Bombus terrestris]

Length=269
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ACASE_DROME  unnamed protein product                                  348     2e-121
G5EFK9_CAEEL  unnamed protein product                                 28.5    7.0   
Q38AX3_TRYB2  unnamed protein product                                 28.5    7.0   


>ACASE_DROME unnamed protein product
Length=283

 Score = 348 bits (892),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 161/266 (61%), Positives = 202/266 (76%), Gaps = 0/266 (0%)

Query  2    WKPFEAGSSPIDWCERNYSISSSIAEFMNTLSNVVFLLLPPVLMHLFRDYGRFVNPGIHV  61
            W+    GSSP+DWCE NY ISS+IAEF+NT SN +F+LLPPVL+ LF++YGRFV PGIHV
Sbjct  17   WEHLRPGSSPVDWCEGNYLISSNIAEFVNTFSNFLFILLPPVLIMLFKEYGRFVTPGIHV  76

Query  62   IWFLLMIVGLSSAYFHATLSLIGQLLDELAILWVYMAGFCMFLPRRYFPNILHNDRKLLA  121
            IW LL++VGLSS YFHATLSLIGQLLDELAILWV+MA F +F P+RY+P  + NDRK  +
Sbjct  77   IWVLLIVVGLSSMYFHATLSLIGQLLDELAILWVFMAAFSLFYPKRYYPKFVKNDRKTFS  136

Query  122  ICATLPTLIATGLSFIHPAINAFALMSLGIPAFGFMIIELKRTKSMRVYRLGLRCGAVWL  181
                L  + ATGLS+  P +NAF LM + +P    +  EL+R    RVYRLG+R   VW 
Sbjct  137  WLMLLSAIAATGLSWWKPIVNAFVLMFMSVPTMVMLYTELQRVSDQRVYRLGIRSTTVWA  196

Query  182  LAVACWLNDRLFCDTWLNLNFPYLHALWHLFIFIASYTAAVLFAYFSVKEEKPQQSPVLK  241
            +AV CW+NDR+FC+ W ++NFPYLH  WH+FIFIA+YT  VLFAYF V+ E PQ+ P+LK
Sbjct  197  VAVFCWINDRIFCEAWSSINFPYLHGFWHIFIFIAAYTVLVLFAYFYVESELPQRQPLLK  256

Query  242  YWPKNDFELGIPYVTIRSYVKLDINT  267
            YWPKN+FE GIP+++IR+  K   NT
Sbjct  257  YWPKNEFEFGIPFISIRNPGKALRNT  282


>G5EFK9_CAEEL unnamed protein product
Length=901

 Score = 28.5 bits (62),  Expect = 7.0, Method: Composition-based stats.
 Identities = 21/84 (25%), Positives = 39/84 (46%), Gaps = 7/84 (8%)

Query  163  RTKSMRVYRLGLRCGAVWLLAVACWLNDRLFCDTWLNLNFPYLHALWHLF--IFIASYTA  220
            R+    ++++GLR   ++ LAV+  L  +L    W  L   +      LF  IF+ + T+
Sbjct  813  RSSRKMIWQIGLRRNRMFSLAVSASLICQLLVIYWAPLQHIFQTEALSLFDLIFLTTITS  872

Query  221  AVLF-----AYFSVKEEKPQQSPV  239
            +V        YFS++ +     P+
Sbjct  873  SVFIFNETRKYFSLRSKSLNHDPL  896


>Q38AX3_TRYB2 unnamed protein product
Length=1594

 Score = 28.5 bits (62),  Expect = 7.0, Method: Composition-based stats.
 Identities = 23/83 (28%), Positives = 34/83 (41%), Gaps = 12/83 (14%)

Query  41   PPVLMHLFRDYGRFVNPGIHVIWFLLMIVGLSSAYFHATLSLIGQLLDEL--AILWVYMA  98
            P V MHL+R   R   PG+          G S+ Y+    ++I   LD++    L +   
Sbjct  329  PAVRMHLYRKLLRLCTPGM----------GTSNPYYLCICAIIQPFLDDVTEGSLEIVSL  378

Query  99   GFCMFLPRRYFPNILHNDRKLLA  121
              C+     YF   L  D +L A
Sbjct  379  VKCLMPHAAYFVATLTLDTRLQA  401



Lambda      K        H
   0.315    0.133    0.398 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5412849180


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jan 6, 2022  5:12 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_003393008.2 alkaline ceramidase isoform X1 [Bombus terrestris]

Length=305
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ACASE_DROME  unnamed protein product                                  350     7e-122
G5EDU1_CAEEL  unnamed protein product                                 28.5    8.5   
Q38AX3_TRYB2  unnamed protein product                                 28.5    8.5   


>ACASE_DROME unnamed protein product
Length=283

 Score = 350 bits (899),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 163/272 (60%), Positives = 205/272 (75%), Gaps = 0/272 (0%)

Query  32   NIYFDMWKPFEAGSSPIDWCERNYSISSSIAEFMNTLSNVVFLLLPPVLMHLFRDYGRFV  91
            +IY   W+    GSSP+DWCE NY ISS+IAEF+NT SN +F+LLPPVL+ LF++YGRFV
Sbjct  11   DIYAMAWEHLRPGSSPVDWCEGNYLISSNIAEFVNTFSNFLFILLPPVLIMLFKEYGRFV  70

Query  92   NPGIHVIWFLLMIVGLSSAYFHATLSLIGQLLDELAILWVYMAGFCMFLPRRYFPNILHN  151
             PGIHVIW LL++VGLSS YFHATLSLIGQLLDELAILWV+MA F +F P+RY+P  + N
Sbjct  71   TPGIHVIWVLLIVVGLSSMYFHATLSLIGQLLDELAILWVFMAAFSLFYPKRYYPKFVKN  130

Query  152  DRKLLAICATLPTLIATGLSFIHPAINAFALMSLGIPAFGFMIIELKRTKSMRVYRLGLR  211
            DRK  +    L  + ATGLS+  P +NAF LM + +P    +  EL+R    RVYRLG+R
Sbjct  131  DRKTFSWLMLLSAIAATGLSWWKPIVNAFVLMFMSVPTMVMLYTELQRVSDQRVYRLGIR  190

Query  212  CGAVWLLAVACWLNDRLFCDTWLNLNFPYLHALWHLFIFIASYTAAVLFAYFSVKEEKPQ  271
               VW +AV CW+NDR+FC+ W ++NFPYLH  WH+FIFIA+YT  VLFAYF V+ E PQ
Sbjct  191  STTVWAVAVFCWINDRIFCEAWSSINFPYLHGFWHIFIFIAAYTVLVLFAYFYVESELPQ  250

Query  272  QSPVLKYWPKNDFELGIPYVTIRSYVKLDINT  303
            + P+LKYWPKN+FE GIP+++IR+  K   NT
Sbjct  251  RQPLLKYWPKNEFEFGIPFISIRNPGKALRNT  282


>G5EDU1_CAEEL unnamed protein product
Length=978

 Score = 28.5 bits (62),  Expect = 8.5, Method: Composition-based stats.
 Identities = 21/84 (25%), Positives = 39/84 (46%), Gaps = 7/84 (8%)

Query  199  RTKSMRVYRLGLRCGAVWLLAVACWLNDRLFCDTWLNLNFPYLHALWHLF--IFIASYTA  256
            R+    ++++GLR   ++ LAV+  L  +L    W  L   +      LF  IF+ + T+
Sbjct  890  RSSRKMIWQIGLRRNRMFSLAVSASLICQLLVIYWAPLQHIFQTEALSLFDLIFLTTITS  949

Query  257  AVLF-----AYFSVKEEKPQQSPV  275
            +V        YFS++ +     P+
Sbjct  950  SVFIFNETRKYFSLRSKSLNHDPL  973


>Q38AX3_TRYB2 unnamed protein product
Length=1594

 Score = 28.5 bits (62),  Expect = 8.5, Method: Composition-based stats.
 Identities = 23/83 (28%), Positives = 34/83 (41%), Gaps = 12/83 (14%)

Query  77   PPVLMHLFRDYGRFVNPGIHVIWFLLMIVGLSSAYFHATLSLIGQLLDEL--AILWVYMA  134
            P V MHL+R   R   PG+          G S+ Y+    ++I   LD++    L +   
Sbjct  329  PAVRMHLYRKLLRLCTPGM----------GTSNPYYLCICAIIQPFLDDVTEGSLEIVSL  378

Query  135  GFCMFLPRRYFPNILHNDRKLLA  157
              C+     YF   L  D +L A
Sbjct  379  VKCLMPHAAYFVATLTLDTRLQA  401



Lambda      K        H
   0.331    0.143    0.476 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2966327756


Query= XP_003393009.1 translocon-associated protein subunit beta [Bombus
terrestris]

Length=199
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VUZ0_DROME  unnamed protein product                                 215     1e-71
SSRB_DICDI  unnamed protein product                                   69.3    9e-15
GDPP1_CAEEL  unnamed protein product                                  30.4    1.1  


>Q9VUZ0_DROME unnamed protein product
Length=190

 Score = 215 bits (548),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 137/188 (73%), Gaps = 1/188 (1%)

Query  12   HIIFIAFAAFLLTTYAEEEEEAARLLVSKQLLNKYLVQNMDIVIKYTVYNIGSAAALEVK  71
            H++ +     + +T   E+E  ARLLVSKQ+LNKYLV+  D++++YT++N+GS AA +V+
Sbjct  4    HLLTLFALCAVFSTCLSEDETRARLLVSKQILNKYLVEKSDLLVRYTIFNVGSGAATKVR  63

Query  72   ITDNSFHPDYFTHVSGELNARIDRVPPYTNVSHIVIVRSRKFGYFNFTSAEVLYKRKEDA  131
            + D+ FHP+ F  V G+  A +DR+ P TN +H+++VR + FGYFNFT+AEV YK  E++
Sbjct  64   LVDSGFHPEAFDVVGGQPTAVVDRIAPQTNFTHVLVVRPKAFGYFNFTAAEVSYKAVEES  123

Query  132  PNLQFAASSEPGTAIIVSFRDYDKQFSSHVVDWAAFAVMTLPSLAIPFALWYSSKSKYEK  191
              LQ A SSEPG   IV+  +Y+K+FSSH  DW AFAVMTLPSLAIP ALW+ SKSKYE+
Sbjct  124  ETLQLAVSSEPGEGGIVNLNEYNKRFSSHFFDWVAFAVMTLPSLAIPLALWHQSKSKYER  183

Query  192  LLKTTKKH  199
              K  KKH
Sbjct  184  SGK-NKKH  190


>SSRB_DICDI unnamed protein product
Length=184

 Score = 69.3 bits (168),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 83/164 (51%), Gaps = 1/164 (1%)

Query  31   EEAARLLVSKQLLNKYLVQNMDIVIKYTVYNIGSAAALEVKITDNSFHPDYFTHVSGELN  90
            E  A LL  K+++   +V   ++ I++ +YN+GS  A ++   DN F    F  VSG   
Sbjct  21   ENGAELLFHKKIVEGPVV-GKELPIQFIIYNVGSEPAYDISFIDNDFSNAEFEFVSGSSE  79

Query  91   ARIDRVPPYTNVSHIVIVRSRKFGYFNFTSAEVLYKRKEDAPNLQFAASSEPGTAIIVSF  150
             + + + P + V   + V  +K G ++ TS  + Y++ + +     ++++      + S 
Sbjct  80   GKWETLAPNSQVQTNLTVIPKKSGIYSLTSTVLNYRKTQTSSEFTVSSAASYSGMYVESQ  139

Query  151  RDYDKQFSSHVVDWAAFAVMTLPSLAIPFALWYSSKSKYEKLLK  194
             DY+K+ S  + +W  F V+   ++A+P+++    K  YE  +K
Sbjct  140  ADYEKRTSLLIKEWITFFVLCAGAIALPYSISTYYKKNYENGIK  183


>GDPP1_CAEEL unnamed protein product
Length=482

 Score = 30.4 bits (67),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 20/61 (33%), Positives = 32/61 (52%), Gaps = 2/61 (3%)

Query  6    TKSMKWHIIFIAFAAFLLTTYAEEEEEAARLLVSKQLLNKYLVQNMDIVIKYTVYNIGSA  65
            T+S + H +F+A A  + TT AE+EE+  R     QL+  Y+   M+++      N   A
Sbjct  319  TESNQAHNLFLARAQPIRTTGAEKEED--RRGERPQLVTCYVFPRMNMIGAKPPSNFNPA  376

Query  66   A  66
            A
Sbjct  377  A  377



Lambda      K        H
   0.331    0.143    0.476 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2966327756


Query= XP_003393010.1 BLOC-1-related complex subunit 8 homolog [Bombus
terrestris]

Length=170
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

IPLA_DICDI  unnamed protein product                                   28.1    5.2  
Q389X2_TRYB2  unnamed protein product                                 27.7    5.3  
NCBP2_DROME  unnamed protein product                                  27.3    5.6  


>IPLA_DICDI unnamed protein product
Length=3177

 Score = 28.1 bits (61),  Expect = 5.2, Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 21/34 (62%), Gaps = 0/34 (0%)

Query  123   SVYKRLSAHIPTLDHLPNEISDVVRETANKVESM  156
             S+Y  L + I  L  LPNE++   +E+  K+ES+
Sbjct  1340  SIYAMLWSPIQKLFLLPNELTPTYKESLQKMESL  1373


>Q389X2_TRYB2 unnamed protein product
Length=1221

 Score = 27.7 bits (60),  Expect = 5.3, Method: Composition-based stats.
 Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 1/50 (2%)

Query  103  LKQQLNYEEQRRH-KKDVNRDSVYKRLSAHIPTLDHLPNEISDVVRETAN  151
            LKQ+   E +RR  +KD  R +   +    IP+L ++  ++ D  RE  N
Sbjct  842  LKQKEKVESRRRKDEKDPTRCTSDSKPKQFIPSLQNIGAQVGDNCREDGN  891


>NCBP2_DROME unnamed protein product
Length=154

 Score = 27.3 bits (59),  Expect = 5.6, Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 26/47 (55%), Gaps = 4/47 (9%)

Query  36  LAFYRLQEHVRKILPPMVDKRVEVLGL---QQQLLGRCFDVDYAVSA  79
           L+FY  +E + ++     D RV V+GL   ++   G CF V+Y V +
Sbjct  37  LSFYTTEEQIHELFSRCGDVRVIVMGLDKYKKTPCGFCF-VEYYVRS  82



Lambda      K        H
   0.331    0.143    0.476 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2966327756


Query= XP_003393011.1 LOW QUALITY PROTEIN: alpha-endosulfine [Bombus
terrestris]

Length=109
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VUB8_DROME  unnamed protein product                                 110     1e-32
Q389Z5_TRYB2  unnamed protein product                                 27.7    2.2  
GR08A_DROME  unnamed protein product                                  26.6    4.8  


>Q9VUB8_DROME unnamed protein product
Length=119

 Score = 110 bits (275),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 75/106 (71%), Gaps = 5/106 (5%)

Query  5    QANELSETVELSSNDIEKIEEAKLRAKFPNTGRPISGHSAFLQKRLAKGQKYFDSGDYQM  64
            Q  E +E   L+  D+EKIEE KL++K+P+  R   GHSAFLQKRL KGQK+FDSGDYQM
Sbjct  16   QDTETTEQANLT--DLEKIEEEKLKSKYPSGMRVPGGHSAFLQKRLQKGQKFFDSGDYQM  73

Query  65   AKQKYTA-KPKPAGVLPTGDAIPTPETVPQRKTSIIQ--QKFNTTS  107
            AKQK    K   A  + TG+AIPTPETVP RKTSIIQ   KF  TS
Sbjct  74   AKQKGGGVKQVFANKVTTGEAIPTPETVPARKTSIIQPCNKFPATS  119


>Q389Z5_TRYB2 unnamed protein product
Length=301

 Score = 27.7 bits (60),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 17/33 (52%), Gaps = 0/33 (0%)

Query  37   RPISGHSAFLQKRLAKGQKYFDSGDYQMAKQKY  69
            R +    A L+      Q YF SGDYQ A++ Y
Sbjct  230  RAVENDPANLEFACRLAQAYFHSGDYQNARRWY  262


>GR08A_DROME unnamed protein product
Length=385

 Score = 26.6 bits (57),  Expect = 4.8, Method: Composition-based stats.
 Identities = 13/32 (41%), Positives = 19/32 (59%), Gaps = 1/32 (3%)

Query  35   TGRPISGHSAFLQKRLAKGQKYFDSGDYQMAK  66
            TGR   G  +FL++RL + Q+ + S  Y M K
Sbjct  211  TGRSFPGFESFLRRRLVQKQRIY-SHVYDMLK  241



Lambda      K        H
   0.331    0.143    0.476 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2966327756


Query= XP_003393014.1 uncharacterized protein LOC100651549 [Bombus
terrestris]

Length=155


***** No hits found *****



Lambda      K        H
   0.331    0.143    0.476 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2966327756


Query= XP_003393015.1 39S ribosomal protein L34, mitochondrial [Bombus
terrestris]

Length=80
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

X2JKQ8_DROME  unnamed protein product                                 28.1    0.78 
Q9VXE3_DROME  unnamed protein product                                 28.1    0.81 
Q9U779_DROME  unnamed protein product                                 28.1    0.81 


>X2JKQ8_DROME unnamed protein product
Length=1381

 Score = 28.1 bits (61),  Expect = 0.78, Method: Composition-based stats.
 Identities = 10/25 (40%), Positives = 16/25 (64%), Gaps = 0/25 (0%)

Query  43    PNERRRIKRHGWDTRMSTLSGRKIL  67
             PN++ R + HGW  +   +S RKI+
Sbjct  1134  PNKQNRRRGHGWKRQYVIVSSRKII  1158


>Q9VXE3_DROME unnamed protein product
Length=1390

 Score = 28.1 bits (61),  Expect = 0.81, Method: Composition-based stats.
 Identities = 10/25 (40%), Positives = 16/25 (64%), Gaps = 0/25 (0%)

Query  43    PNERRRIKRHGWDTRMSTLSGRKIL  67
             PN++ R + HGW  +   +S RKI+
Sbjct  1143  PNKQNRRRGHGWKRQYVIVSSRKII  1167


>Q9U779_DROME unnamed protein product
Length=1390

 Score = 28.1 bits (61),  Expect = 0.81, Method: Composition-based stats.
 Identities = 10/25 (40%), Positives = 16/25 (64%), Gaps = 0/25 (0%)

Query  43    PNERRRIKRHGWDTRMSTLSGRKIL  67
             PN++ R + HGW  +   +S RKI+
Sbjct  1143  PNKQNRRRGHGWKRQYVIVSSRKII  1167



Lambda      K        H
   0.331    0.143    0.476 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2966327756


Query= XP_003393017.1 DNA repair protein complementing XP-A cells homolog
[Bombus terrestris]

Length=274
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

XPA_DROME  unnamed protein product                                    284     5e-96
Q21302_CAEEL  unnamed protein product                                 176     3e-54
G5EBR0_CAEEL  unnamed protein product                                 33.9    0.12 


>XPA_DROME unnamed protein product
Length=296

 Score = 284 bits (727),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 149/298 (50%), Positives = 196/298 (66%), Gaps = 26/298 (9%)

Query  1    MSITLDVND---PSKDEELIENCQHFKERAERNRQKALLLRKSKIVSHPYIR-SENEDSG  56
            MS  +  N+   P++ +  + N Q  K R ERN+ KA  LR++K+VSHP+   + N++ G
Sbjct  1    MSAEVSTNESAPPAEKKSKLTNAQ--KARIERNQAKAQKLREAKLVSHPFKELASNKEGG  58

Query  57   K---------STSYKVQGQRVIDSGGGFLIEES-----------DELEQQMLQIISKPAP  96
                      S+  KVQG + IDSGGGFL+E+            ++  ++   I+     
Sbjct  59   THPEAALSQGSSVIKVQGTKYIDSGGGFLLEQPVMPTGVGPAGLNKSGEEAPPILDDAIA  118

Query  97   ILIDFPHCDECKNEFKDSYLLQTFNLSVCDNCRDPKGKHSLITKTEAKQEYLLKDCDLDK  156
            I + +  C EC + F DSYL   F  SVCD CRD   +++LIT+TEAK EYLLKDCD DK
Sbjct  119  IPVQYEECLECGDMFADSYLFNNFGHSVCDKCRDKDERYALITRTEAKAEYLLKDCDFDK  178

Query  157  REPPLKCIIKKNPHNANWGEMKLYLQLQIEERALQVWGSEEKLLKEKELRDVKREGAKIK  216
            REP L+ I +KNPHN  WGEMKLYL LQI +RAL+VWGSEE+L+++ E R+ KRE  K +
Sbjct  179  REPKLRYISRKNPHNVRWGEMKLYLHLQIHQRALEVWGSEEELVRQHEAREDKREEGKAR  238

Query  217  KFNKKIKQLRMQVRSSLYDKTSKASHMHEFGEDTYNEHDDTYTHTCITCGYEETYEKM  274
            K+NKK+KQLRM+VRSS+Y K +   H HEFG DTY+E +DTYTHTCITC Y ETYEKM
Sbjct  239  KYNKKMKQLRMEVRSSIYTKKTHEVHEHEFGPDTYDEEEDTYTHTCITCPYSETYEKM  296


>Q21302_CAEEL unnamed protein product
Length=241

 Score = 176 bits (445),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 99/210 (47%), Positives = 133/210 (63%), Gaps = 8/210 (4%)

Query  72   GGGFL-----IEESDELEQQMLQIISKPAPILIDFP-HCDECKNEFKDSYLLQTFNLSVC  125
            GGGF      ++E  E   +M Q   + A  LI  P +C++C     DS+L + +N +VC
Sbjct  33   GGGFCDDDDEVQERREQISEMRQKREEAAHNLIQAPENCEKCDKGLMDSWLWERYNCAVC  92

Query  126  DNCRDPKGKHSLITKTEAKQEYLLKDCDLDKREPPLKCIIKKNPHNANWGEMKLYLQLQI  185
            D CRD KG+H L+ +TE K  YLLKDCDLD R+P L+   KKNPHN  +G+MKLYL+ QI
Sbjct  93   DACRDDKGEHKLLARTEVKNTYLLKDCDLDLRKPKLRYWAKKNPHNPRYGDMKLYLKCQI  152

Query  186  EERALQVWGSEEKLLKEKELRDVKREGAKIKKFNKKIKQLRMQVRSSLYDKTSKA-SHMH  244
            E R L+V GS E L  +KELR+  +E    K+F KK+K LR Q+R +   K      H H
Sbjct  153  ETRVLEVHGSWEDLELKKELREQSKEVRSEKRFEKKLKDLRQQIRGTSGVKVDFGRPHTH  212

Query  245  EFGEDTYNEHDDTYTHTCITCGYEETYEKM  274
            EFG++T+ E +DT+  TCITC YEE +EK+
Sbjct  213  EFGKETHVE-EDTWRRTCITCEYEEVFEKL  241


>G5EBR0_CAEEL unnamed protein product
Length=309

 Score = 33.9 bits (76),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 49/94 (52%), Gaps = 16/94 (17%)

Query  3   ITLDVNDPSKDEELIENCQHFKERAERNRQKALLLRKSKIVSHPYIRSENEDSGKSTSYK  62
           + +++ND +   +L+  C       ++N ++  LL  +++  HPY+R + +     T  +
Sbjct  5   VVIELNDDAATIDLLSYC------VKKNFERVSLL--TRLEDHPYLRDDQDVVQDDT--Q  54

Query  63  VQGQRVIDSGGGFLIEESDELEQQMLQIISKPAP  96
            QG        G L++ +DE  Q+++++IS P P
Sbjct  55  SQGT------DGMLLQLNDEERQRLMKMISTPGP  82



Lambda      K        H
   0.331    0.143    0.476 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2966327756


Query= XP_003393020.1 UDP-glucuronosyltransferase 1-8 [Bombus terrestris]

Length=516
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VGT3_DROME  unnamed protein product                                 268     2e-83
Q9V9X9_DROME  unnamed protein product                                 207     1e-60
Q93242_CAEEL  unnamed protein product                                 114     4e-27


>Q9VGT3_DROME unnamed protein product
Length=528

 Score = 268 bits (686),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 161/478 (34%), Positives = 263/478 (55%), Gaps = 9/478 (2%)

Query  19   GFNILGICPSASYSHQQPFQALMKALAVRGHNVTVISTIPSKQAIKNYEDVDLS--FSYR  76
             +N L +  +A+ SH     AL K LA  GH VT+IS    K+ IKN +DV      +  
Sbjct  24   AYNYLVVLHTAARSHYHVGSALAKGLAAAGHQVTIISPFELKKPIKNIKDVPAKSILTSM  83

Query  77   KKDCTGLRHMGAFTLLRK--NMREAN-ELCEEQLFSPAIEHLISRNKSFDAVVIEQLWYQ  133
            +     L       ++++  N  E   E+ E  L  P++  L+  N++FDAV+ E    +
Sbjct  84   QGRIANLLQSSKEPIIKQIINFHEMGIEITELLLKEPSVIELMKSNQTFDAVISEVFLNE  143

Query  134  CYYALVKHYNSPVLIGFLSVGNLPYVMDSVGNPDDPLLNPDMAYPFTNKMSLNERIWNIV  193
             ++   +H+ +P LIG  + G + +  D VG+P  P   P     F+++MSL ER+ N  
Sbjct  144  AHFGFAEHFKAP-LIGLGTFGAISWNTDLVGSPSPPSYVPSALLKFSDRMSLVERVGNQA  202

Query  194  YTTWTRMYYKYWHLPRAQEIVNKWMPDVSIE--DIDRNFSLVILGNNHVFGYPKPLLPNV  251
            + T+  ++  Y++LPR + +  K+ P+   +  D+ +N +LV+L  +    +P+P  PN+
Sbjct  203  FLTYEYIFLNYFYLPRQEVLYRKYFPNNKQDFYDMRKNTALVLLNQHVSLSFPRPYSPNM  262

Query  252  IEVHSLQITEKRETLPKDIEEFLDKAEHGAIYFSLGSNLQTHQLPVGPLTALCNALSSLR  311
            IEV  + I  KR+ LPKDI EF++ AEHG IYFS+GSNL++  LP+    AL +  + L+
Sbjct  263  IEVGGMHINRKRQPLPKDILEFIEGAEHGVIYFSMGSNLKSKTLPLEKRQALIDTFAQLK  322

Query  312  QRVLWK-HSGDMAIHPANIKFVKWAPQQAILAHPKLMVYVMQGGLQSLQEAVYYSVPVVA  370
            QRVLWK    D+   PAN+    W PQ  ILAH  ++ ++  GGL S  E++Y+  P V 
Sbjct  323  QRVLWKFEDTDLPGKPANVFISDWFPQDDILAHDNVLAFITHGGLLSTTESIYHRKPFVG  382

Query  371  IPFFGDQLFNARKILDAGIGLTLNIDTITEESVVRTLTEVIENKTYYNNIKEMSEIVKDE  430
            IP FGDQ  N  +    G G+T++ + ++   ++  + ++I N      +++MS+  +D+
Sbjct  383  IPIFGDQFLNMARAEQNGYGVTVHYEELSSAKLLAAIQKIINNPEATQRVRDMSDRYRDQ  442

Query  431  LIKPMDRAIWNVEHVIKFSKSKHLRYYGHDISLIDYYATIAILILPLFFIICYACFVL  488
               P++RA++ VEHV +   +K+LR    D++ I Y+   A+LIL    I    C  L
Sbjct  443  QQTPLERAVYWVEHVSRHKGAKYLRSASQDLNFIQYHNLDAMLILYGGIIFVLYCIFL  500


>Q9V9X9_DROME unnamed protein product
Length=521

 Score = 207 bits (528),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 129/470 (27%), Positives = 230/470 (49%), Gaps = 30/470 (6%)

Query  19   GFNILGICPSASYSHQQPFQALMKALAVRGHNVTVISTIPSKQAIKNYEDVDLS------  72
            G  IL + P  S SH       +K+LA  GH +T +S  P ++  +N  D+ +       
Sbjct  17   GARILAVFPLPSSSHYFFALPYLKSLASLGHEITSVSPYPQREPFRNIHDIPVPEVFENF  76

Query  73   ------FSYRKKDCTGLRHMGAFTLLRKNMREANELCEEQLFSPAIEHLISRNKSFDAVV  126
                   S  +        +  + L        NE     +  P   H       FD V+
Sbjct  77   NEVLRIASTPRSTWQSSDFINEYVLNLTKTVLNNEGVRRDILGPQKPH-------FDLVI  129

Query  127  IEQLWYQCYYALVKHYNSPVLIGFLSVGNLPYVMDSVGN--PDDPLLNPDMAYPFTNKMS  184
            ++         L  ++++P+ IG  S G    + + +GN  P   L +P     F +  +
Sbjct  130  MDLWRMDVLSGLAAYFDAPI-IGMASYGTDWKIDELMGNVSPISYLQSPSSR--FYDLEA  186

Query  185  LNERIWNIVYTTWTRMYYKYWHLPRAQEIVNKWMPDVS----IEDIDRNFSLVILGNNHV  240
              ER+ +++  T++ M YK+ H+ + + + +++ P V+    + +I RNF LV++  +  
Sbjct  187  YGERLLHLMERTFSYMNYKWRHVRKQETLYSQFFPSVAERKPLSEISRNFDLVLVNQHFT  246

Query  241  FGYPKPLLPNVIEVHSLQITEKRETLPKDIEEFLDKA-EHGAIYFSLGSNLQTHQLPVGP  299
             G P+P +PN+I+V  L +    E L  +++ F+  A E G IYFSLG+N+++  L    
Sbjct  247  LGPPRPYVPNMIQVGGLHVDHSTEALSAELDHFIQGAGESGVIYFSLGTNVKSKSLSEDR  306

Query  300  LTALCNALSSLRQRVLWKHSGDM-AIHPANIKFVKWAPQQAILAHPKLMVYVMQGGLQSL  358
               L    +SL QR++WK   ++    P N+   KW PQQAILAHP + +++  GGL S 
Sbjct  307  RKVLLETFASLPQRIVWKFEDELLPGKPPNVFISKWFPQQAILAHPNVKLFITHGGLLST  366

Query  359  QEAVYYSVPVVAIPFFGDQLFNARKILDAGIGLTLNIDTITEESVVRTLTEVIENKTYYN  418
             E++++  P++ +P   DQ  N   +   G+GL LNI  +T E    T+  ++ NK++  
Sbjct  367  IESIHHGKPMLGLPCLFDQFRNMDHVRQVGLGLVLNIKQMTSEEFRSTIIRLLTNKSFEE  426

Query  419  NIKEMSEIVKDELIKPMDRAIWNVEHVIKFSKSKHLRYYGHDISLIDYYA  468
              +  +   +D+ +KPM+ AIW  E+V+    + H++  G D+  + Y++
Sbjct  427  TARITAARYRDQPMKPMETAIWWTEYVLSHKGAAHMQVAGKDLGFVRYHS  476


>Q93242_CAEEL unnamed protein product
Length=530

 Score = 114 bits (286),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 111/513 (22%), Positives = 217/513 (42%), Gaps = 54/513 (11%)

Query  30   SYSHQQPFQALMKALAVRGHNVTVI-----STIPSKQAIKNY---------EDVDLSFSY  75
             +SH +   +++  L   GH+VTV+     ST  ++ +IK+          E+V   FS 
Sbjct  29   GHSHIKFVGSVVDTLVDAGHDVTVVLPVIDSTQKNRTSIKSGAKQIIIDADEEVVEIFSQ  88

Query  76   RKKDCTGLRHMGAFTLLRKNMREANELCEEQLFSPAIEHLIS--------RNKSFDAVVI  127
             +K    L +M    +    M   N     QLF      ++         +++ FD  + 
Sbjct  89   TEK---FLSNMWTMEMSNPLMMWMNPRILTQLFGKQCTKVMKLSELLDQLKSEKFDLAIT  145

Query  128  EQLWYQCYYALVKHYNSPVLIGFLSVGNLPYVMDSVGNPDDPLLNPDMAYPFTNKMSLNE  187
            E  +  C Y + ++   P  +  LS   + +V D +G P  P   P     ++++M++ +
Sbjct  146  EA-FDSCGYGIFEYLQIPAHVSILSCARMDHVSDVLGQPIAPSYVPGTQSLYSDRMTMTQ  204

Query  188  RIWN-IVYTTWTRMY-----YKYWHLPRAQEIVNKWMPDVSIEDIDRNFSLVILGNNHVF  241
            R  N + +     M+     Y+  +  +   +   W       +I    S ++  +  V 
Sbjct  205  RFLNYLQFLNGNSMFSDIGDYESANAKKLLGVERSW------REILPESSFLLTNHIPVL  258

Query  242  GYPKPLLPNVIEVHSLQITEKRETLPKDIEEFLD---KAEHGAIYFSLGSNLQTHQLPVG  298
             +P P    ++ +  + + + +ETL   +E + D         +  S GSN+++  +P  
Sbjct  259  EFPAPTFDKIVPIGGISVNKNKETL--KLEHYFDTMVSMRKKNVIISFGSNIKSMDMPDE  316

Query  299  PLTALCNALSSLRQ-RVLWKHSG----DMAIHPANIKFVKWAPQQAILAHPKLMVYVMQG  353
               +L      +     +WK+             NI  V+W PQ  +LA  ++  ++  G
Sbjct  317  YKKSLAELFQLMPDVTFIWKYENLADKKYTCGIMNINRVEWIPQTELLADSRVDAFITHG  376

Query  354  GLQSLQEAVYYSVPVVAIPFFGDQLFNARKILDAGIGLTLN-IDTITEESVVRTLTEVIE  412
            GL S+ E      P V IP F DQ  NA  +   G    L+  D    E++ +TL +V++
Sbjct  377  GLGSVTELATMGKPAVVIPIFADQTRNAEMLKRHGGAEVLHKTDLANPETLRKTLRKVMD  436

Query  413  NKTYYNNIKEMSEIVKDELIKPMDRAIWNVEHVIKFSKSKHLRYYGHDISLIDYY-----  467
            + +Y  N + ++E++ ++   P +  + +VE   +F K   +  YG   ++I+YY     
Sbjct  437  DPSYRQNAQRLAEMLNNQPTNPKETLVKHVEFAARFGKLPSMDPYGRHQNIIEYYNLDIL  496

Query  468  ATIAILILPLFFIICYACFVLNNLGDKRKRSSF  500
            A   IL+  + ++  +A  V+      +K+  F
Sbjct  497  AIATILLTLVVYLKIFAVGVVVRCCCGKKKVKF  529



Lambda      K        H
   0.331    0.143    0.476 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2966327756


Query= XP_003393022.1 43 kDa receptor-associated protein of the synapse
homolog isoform X2 [Bombus terrestris]

Length=537
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RAPSN_CAEEL  unnamed protein product                                  240     9e-72
Q8T089_DROME  unnamed protein product                                 36.6    0.047
Q9VI20_DROME  unnamed protein product                                 36.6    0.050


>RAPSN_CAEEL unnamed protein product
Length=596

 Score = 240 bits (612),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 135/421 (32%), Positives = 232/421 (55%), Gaps = 12/421 (3%)

Query  77   LDQHMARRRVEQGLKLYRAHKQQAAVRKWRGALKNIRQREDKFALLGYLYQAYMDWGKYR  136
            + Q  A++ ++ G+KLY       A+ KWR +L  +   ED+F  LGYL QA  D G+Y 
Sbjct  1    MGQRQAKQHMQAGVKLYHQRHYAQAINKWRQSLNRLNNAEDRFITLGYLAQALCDQGEYE  60

Query  137  DSIDFGHKQLCISEELDSPNMRAEAYLNLARAHERLGALDRALDYARHSLYNECDQCATA  196
              + +   Q+ ++ + +   M+ EA+LNLA+A+ERL    +AL Y + SL +      T 
Sbjct  61   GMLSYALSQMQLATDQNDSAMKCEAFLNLAKAYERLADFTKALQYGKASLEHPSMDPRTP  120

Query  197  GLVHLTVGRVHLELAGFCKALEAFQRAHKIAHSIQDPSLELQVYVGLSELFCRLHDADKS  256
            G  HLT+   HL ++ F + LE+F+ A  +A+   D  LELQ+ VGL  LF  L D  K+
Sbjct  121  GYAHLTIALAHLGMSQFQQCLESFESAMNVANETSDRLLELQICVGLGSLFTLLRDITKA  180

Query  257  ARYAARAYDLSRSLQLGDLNSRHHRAALLQMAAALRKKGELGDAHDYCSEATRLSLVSGD  316
              +   A  + +S+ + D+++++    L  ++ ALR KG L DA + C EA++L++  G+
Sbjct  181  LIFLRNALAIVQSVTVDDVHAKYRCLILYHLSVALRMKGSLVDAKEACDEASQLAVEMGN  240

Query  317  QASYARSIRIMGDIYRK------KSDINKAFRQYESAMGSAAATGDRLCQMEAMDGAARC  370
            +A +AR +  + DIYR+      K  I K++ +YE A        D++ ++  +   A+ 
Sbjct  241  RAIHARCMCSLADIYRELGESEAKETITKSWARYEDAYRVMRGANDKMGEVLVLSSMAKS  300

Query  371  LEALRLQHK-ICNCRPLEFNTRLLEVAGSVGAKFLVRTVRSRLSRIYGSLGDEEQKAHHE  429
                R  +   C C+ ++ N + +E+A  +G K +V     RL+ +Y  L D++ +    
Sbjct  301  ASESRSHYTGQCECQAIQLNKKCIEIANQIGCKHVVLKCHLRLAELYSQLNDDDSEETAR  360

Query  430  RLATAMEEDLELRCGGCNEPFGLEADSLEALPCSHILHARCAYD-ILKRRDKKKKRLCPD  488
            R A+ + ++++L C  C + +GL+ +SL+AL CSHI H +C +  +L+R D+     CP 
Sbjct  361  RAASRLTQEMQLFCNFCGQRYGLKDESLQALRCSHIFHEKCLHTYLLQRTDQT----CPK  416

Query  489  C  489
            C
Sbjct  417  C  417


>Q8T089_DROME unnamed protein product
Length=352

 Score = 36.6 bits (83),  Expect = 0.047, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 27/54 (50%), Gaps = 5/54 (9%)

Query  443  CGGCNEPFGLEADSLEALPCSHILHARCAYDILKRRDKKKKRLCPDCHKSVSSR  496
            C  C E F +E D L  LPCSH  H  C    L     + +R+CP C + V ++
Sbjct  51   CVICLEDF-IEDDKLRVLPCSHPYHTHCIDPWL----TENRRVCPICKRKVFTK  99


>Q9VI20_DROME unnamed protein product
Length=536

 Score = 36.6 bits (83),  Expect = 0.050, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 27/54 (50%), Gaps = 5/54 (9%)

Query  443  CGGCNEPFGLEADSLEALPCSHILHARCAYDILKRRDKKKKRLCPDCHKSVSSR  496
            C  C E F +E D L  LPCSH  H  C    L     + +R+CP C + V ++
Sbjct  235  CVICLEDF-IEDDKLRVLPCSHPYHTHCIDPWL----TENRRVCPICKRKVFTK  283



Lambda      K        H
   0.331    0.143    0.476 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2966327756


Query= XP_003393025.1 rhophilin-2 isoform X2 [Bombus terrestris]

Length=654
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ALIX_DICDI  unnamed protein product                                   112     2e-25
Q9NA90_CAEEL  unnamed protein product                                 95.9    8e-22
H8ESG1_CAEEL  unnamed protein product                                 93.6    2e-19


>ALIX_DICDI unnamed protein product
Length=794

 Score = 112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 78/260 (30%), Positives = 132/260 (51%), Gaps = 12/260 (5%)

Query  100  MIPLGLKETKDIDFRDPFKDFILEHYSE-DGTNYEEAIADLMETRQATRT-PTRDAAGIA  157
            M+ +  K T+ +DF  P   +I E +S+ +   +E  IA L   R+  R    R      
Sbjct  1    MLSIERKRTEKVDFSKPLTKYIKEQFSKAESDQHETQIATLNGLREDVRNLQERTETSKE  60

Query  158  LLLRYYNQLYFVERRFFPPDRSLGIYFEWFDSLTGVPSCQRTVAFEKASILFNAAALYTQ  217
            ++ +YY+ L  +E RF   + ++ I F W DS     S   ++ FE+AS+LFN  ++ +Q
Sbjct  61   MVWKYYSILSSLELRFPISENNVRISFPWTDSYRQRKSTLYSIYFERASVLFNYGSIVSQ  120

Query  218  LAAKQDRLSTRGLDQAIDAFLRAAGTFRYIHENFTNAP----SMDLGPDMLEMLVQLMLA  273
            +A+  +R +  G+ +A + F  AAG F  + E  +  P    S D   + L+ LV +MLA
Sbjct  121  IASSTNRSNIEGVKKACNQFQLAAGVFNKLREYASLHPECSTSADFSSESLQALVTIMLA  180

Query  274  QARECLFEKLELQSRDGRNIDVSLDLAQEASQVAAVYSDVHGLISREPVRDYVPETWISL  333
            QA+EC++EK  +      N+  S+ L++ A+QVA  Y   + L++   ++  V   W   
Sbjct  181  QAQECIYEKASMD-----NLSDSI-LSKLAAQVAEYYDTFNQLLNSNSLKSIVDRNWNIT  234

Query  334  ILVKREHHLALAHKHLALGL  353
              VK   + A++    A GL
Sbjct  235  ATVKSYLYKAISLYCHAKGL  254


>Q9NA90_CAEEL unnamed protein product
Length=266

 Score = 95.9 bits (237),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 76/231 (33%), Positives = 112/231 (48%), Gaps = 20/231 (9%)

Query  96   PAMPMIP-------LGLKETKDIDFRDPFKDFILEHYSEDGTNYEEAIADLMETRQATRT  148
            P MPM+        L      + DFR   K++IL  ++ D  +Y+ A  +L + +     
Sbjct  5    PIMPMLAPQSRSSTLSYDNIPNFDFRLRMKEYILLTFNADPHDYDSAFDELTQMKFEANV  64

Query  149  PTRDAAGIALLLRYYNQLYFVERRF-FPPDRSLGIYFEWFDSLTGVPSCQRTVA-----F  202
            PT        L RYY QL  +++RF       L   F W D L  + S Q  V      F
Sbjct  65   PTPSVEQTLKLKRYYGQLCMMQKRFPMGAGEQLETPFAWHDGLIDIRSAQSEVTICDIEF  124

Query  203  EKASILFNAAALYTQLAAKQDRLSTRGLDQAIDAFLRAAGTFRYIHENFTNA----PSMD  258
            EKAS++FN  A + Q AA+Q R +   +  A   F  AA  F  ++ +F N+    PS+D
Sbjct  125  EKASVMFNIGACHAQYAAEQTRDTQDCIKAAFMHFQYAAYAFEQLN-SFRNSDIFYPSVD  183

Query  259  LGPDMLEMLVQLMLAQARECLFEKLELQSRDGRNI-DVSLDLAQEASQVAA  308
            L  +++    ++M+AQA+ECL +K  L +R    I  +SL L QEA   AA
Sbjct  184  LDANVISFYYKVMIAQAQECLVQKSLLDNRSAIVIAKLSLWL-QEAYDSAA  233


>H8ESG1_CAEEL unnamed protein product
Length=1494

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 80/248 (32%), Positives = 118/248 (48%), Gaps = 20/248 (8%)

Query  96   PAMPMIP-------LGLKETKDIDFRDPFKDFILEHYSEDGTNYEEAIADLMETRQATRT  148
            P MPM+        L      + DFR   K++IL  ++ D  +Y+ A  +L + +     
Sbjct  5    PIMPMLAPQSRSSTLSYDNIPNFDFRLRMKEYILLTFNADPHDYDSAFDELTQMKFEANV  64

Query  149  PTRDAAGIALLLRYYNQLYFVERRF-FPPDRSLGIYFEWFDSLTGVPSCQRTVA-----F  202
            PT        L RYY QL  +++RF       L   F W D L  + S Q  V      F
Sbjct  65   PTPSVEQTLKLKRYYGQLCMMQKRFPMGAGEQLETPFAWHDGLIDIRSAQSEVTICDIEF  124

Query  203  EKASILFNAAALYTQLAAKQDRLSTRGLDQAIDAFLRAAGTFRYIHENFTNA----PSMD  258
            EKAS++FN  A + Q AA+Q R +   +  A   F  AA  F  ++ +F N+    PS+D
Sbjct  125  EKASVMFNIGACHAQYAAEQTRDTQDCIKAAFMHFQYAAYAFEQLN-SFRNSDIFYPSVD  183

Query  259  LGPDMLEMLVQLMLAQARECLFEKLELQSRDGRNI-DVSLDLAQEASQVAAVYSDVHGLI  317
            L  +++    ++M+AQA+ECL +K  L +R    I  +SL L QEA   AA   D   + 
Sbjct  184  LDANVISFYYKVMIAQAQECLVQKSLLDNRSAIVIAKLSLWL-QEAYDSAAKIVDEWSVN  242

Query  318  SREPVRDY  325
              E V+ Y
Sbjct  243  IPESVQRY  250



Lambda      K        H
   0.331    0.143    0.476 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2966327756


Query= XP_003393026.1 protein tilB homolog [Bombus terrestris]

Length=449
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TILB_DROME  unnamed protein product                                   276     3e-89
Q582Q8_TRYB2  unnamed protein product                                 212     2e-64
TILB_TRYBB  unnamed protein product                                   211     6e-64


>TILB_DROME unnamed protein product
Length=395

 Score = 276 bits (707),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 164/369 (44%), Positives = 228/369 (62%), Gaps = 32/369 (9%)

Query  1    MSRITLDLLRKRSEHNEGEISTLEEIALHQENIEKIELIDRTCKHLKILLLQNNLISKIE  60
            M  IT +L+RK+SEHNE  ISTLEEI+LHQE+IE IE I   C+ LKILLLQ+NLI+++E
Sbjct  1    MVLITEELVRKKSEHNERLISTLEEISLHQEDIEVIEHIQNWCRDLKILLLQSNLIARLE  60

Query  61   NLSKLKKLEYLNLALNNIETIENLQGLESLKKLDLTVNFIGDLRGIKTLRYNERLEQLFL  120
            NL KLK+LEYLN+A+NNIE +ENL+G ESL KLDLT+NFI +L  +++L  N  L +L L
Sbjct  61   NLHKLKRLEYLNVAINNIERVENLEGCESLSKLDLTLNFIRELTSVESLCGNYNLRELVL  120

Query  121  MGNPCADYEGYRQYAIATLTRLKELDGTPIDRSERIRALQSYAESEGEIVRSCARYKKIR  180
            +GNPC DY  YR Y +ATL +L  LD   I  SER+RAL+  +++   IV          
Sbjct  121  IGNPCVDYPHYRDYVVATLPQLNSLDCVEITPSERLRALRELSKNRSIIV----------  170

Query  181  EAELLDYQEQTAKSRADRERAEKEVNEEQEEEEEEEEE---EEEEEEDESFWNRTSRHTP  237
                   Q+Q  +   D ER E+ +   +++    E     E+EEE  ++FW   S H P
Sbjct  171  -------QKQVEQ---DIERDEQRIRVAKQQSALAEHCAGIEDEEERIKAFWQAKSEHCP  220

Query  238  EERVAIAERFMRKEKRRNREKDRSVEPRTTYKLK--LFDPQGKPYNMNQPKVPFKLNEEQ  295
            E R  IA     ++ R  RE+  +  P    K +  LF P G+PYN+NQ K+PFK  +E 
Sbjct  221  EIRTEIA-----RQHRLGRERHETKSPLDPLKPQRNLFAPCGRPYNLNQAKLPFKFRDE-  274

Query  296  YSDRIVLEVALYKYLDTCHVDADVHPEYVRVTIKGKVLQLTLPCEVSVKDSTARRNTTNG  355
             +D  +L++ +Y++LDT  +D DV   Y RVT+K K+ Q+    EV   +ST +R+   G
Sbjct  275  -ADHYLLQLEVYRHLDTSLIDVDVQTTYTRVTVKKKIFQIAYSEEVKPDESTVQRSQITG  333

Query  356  RLVVTMPRL  364
             LVV + +L
Sbjct  334  HLVVNLKKL  342


>Q582Q8_TRYB2 unnamed protein product
Length=383

 Score = 212 bits (540),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 142/390 (36%), Positives = 205/390 (53%), Gaps = 68/390 (17%)

Query  1    MSRITLDLLRKRSEHNEGEISTLEEIALHQENIEKIELIDRTCKHLKILLLQNNLISKIE  60
            M RIT DLLR+R+EHNEG +S L+E+ALHQ++IE+IELI   C+ L+IL L NN IS+IE
Sbjct  1    MGRITTDLLRRRAEHNEGCLSNLKEVALHQQDIERIELIGDACRELEILYLCNNYISRIE  60

Query  61   NLSKLKKLEYLNLALNNIETIENLQGLESLKKLDLTVNFIGDLRGIKTLRYNERLEQLFL  120
             L  LK L+YLNLA+NNI  IE L+G E+L++LDLT+NF+ D+  ++ LR N  L+QL L
Sbjct  61   GLQHLKYLKYLNLAVNNITYIEGLEGCEALERLDLTLNFVADVTCVERLRANAFLDQLHL  120

Query  121  MGNPCADYEGYRQYAIATLTRLKELDGTPIDRSERIRALQSYAESEGEIVRSCARYKKIR  180
             GNPC    GYR Y +  L +L+ELDG  + ++ER+ A QS  +    +     R   ++
Sbjct  121  TGNPCTKVAGYRAYVVHALPQLRELDGEEVIKTERLEARQSKDDISVAVNEEALR---LQ  177

Query  181  EAELLDYQEQTAKSRADRERAEKEVNEEQEEEEEEEEEEEEEEEDESFWNRTSRHTPEER  240
            EAE           R   E   + V+       E+ E             R   HTPEER
Sbjct  178  EAE-----------RIKSEMVARGVDPFPPRYNEKGE-------------RLYGHTPEER  213

Query  241  V---------------------------AIAERFMRKEKRRNREKDRSVEPRTTYKLKLF  273
            +                           AI E   RK +R   E++ +   R   +    
Sbjct  214  LQMLREKEEEERRKREEQRERERSSQFGAIREELERKPQRLTAEEEIAKHGRLLLR----  269

Query  274  DPQGKPYNMNQPKVPFKLNEEQ-YSDRIVLEVALYKYLDTCHVDADVHPEYVRVTIKGKV  332
                     N+PK+PF L+EE    + +VL V + ++L T  +D  V   Y+RV +K K+
Sbjct  270  ---------NEPKLPFTLDEEADDGEAVVLTVKVPRFLSTTLIDVQVEVNYIRVFVKEKL  320

Query  333  LQLTLPCEVSVKDSTARRNTTNGRLVVTMP  362
            +Q+ L  EV+      +R++ NG L + +P
Sbjct  321  IQVPLSQEVAPSGVNVQRSSVNGELRIRIP  350


>TILB_TRYBB unnamed protein product
Length=383

 Score = 211 bits (537),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 140/390 (36%), Positives = 202/390 (52%), Gaps = 68/390 (17%)

Query  1    MSRITLDLLRKRSEHNEGEISTLEEIALHQENIEKIELIDRTCKHLKILLLQNNLISKIE  60
            M RIT DLLR+R+EHNEG +S L+E+ALHQ++IE+IELI   C+ L+IL L NN IS+IE
Sbjct  1    MGRITTDLLRRRAEHNEGCLSNLKEVALHQQDIERIELIGDACRELEILYLCNNYISRIE  60

Query  61   NLSKLKKLEYLNLALNNIETIENLQGLESLKKLDLTVNFIGDLRGIKTLRYNERLEQLFL  120
             L  LK L+YLNLA+NNI  IE L+G E+L++LDLT+NF+ D+  ++ LR N  L+QL L
Sbjct  61   GLQHLKYLKYLNLAVNNITYIEGLEGCEALERLDLTLNFVADVTCVERLRANAFLDQLHL  120

Query  121  MGNPCADYEGYRQYAIATLTRLKELDGTPIDRSERIRALQSYAESEGEIVRSCARYKKIR  180
             GNPC    GYR Y +  L +L+ELDG  + ++ER+ A QS  +    +           
Sbjct  121  TGNPCTKVAGYRAYVVHALPQLRELDGEEVIKTERLEARQSKDDISVAV-----------  169

Query  181  EAELLDYQEQTAKSRADRERAEKEVNEEQEEEEEEEEEEEEEEEDESFWNRTSRHTPEER  240
              E L  Q+++  S+     A         E+ E                R   HTPEER
Sbjct  170  NEEALRLQKRSVSSQRWLHEALTAFPPRYNEKGE----------------RLYGHTPEER  213

Query  241  V---------------------------AIAERFMRKEKRRNREKDRSVEPRTTYKLKLF  273
            +                           AI E   RK +R   E++              
Sbjct  214  LQMLREKEEEERRKREEQRERERSSQFGAIREELERKPQRLTAEEE-------------I  260

Query  274  DPQGKPYNMNQPKVPFKLNEEQ-YSDRIVLEVALYKYLDTCHVDADVHPEYVRVTIKGKV  332
               G+    N+PK+PF L+EE    + +VL V + ++L T  +D  V   Y+RV +K K+
Sbjct  261  AKHGRLLLRNEPKLPFTLDEEADDGEAVVLTVKVPRFLSTTLIDVQVEVNYIRVFVKEKL  320

Query  333  LQLTLPCEVSVKDSTARRNTTNGRLVVTMP  362
            +Q+ L  EV+      +R++ NG L + +P
Sbjct  321  IQVPLSQEVAPSGVNVQRSSVNGELRIRIP  350



Lambda      K        H
   0.331    0.143    0.476 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2966327756


Query= XP_003393028.1 clavesin-2 [Bombus terrestris]

Length=314
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VM12_DROME  unnamed protein product                                 118     3e-31
PINTA_DROME  unnamed protein product                                  73.2    9e-15
Q9W324_DROME  unnamed protein product                                 50.8    7e-07


>Q9VM12_DROME unnamed protein product
Length=294

 Score = 118 bits (296),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 83/248 (33%), Positives = 123/248 (50%), Gaps = 4/248 (2%)

Query  13   LSESTRTIARVELREDDAIREETLKQFRDWIQKHPNIKRCRTDAAFLLRFLRTKKFSVPM  72
            L   T  IARVELRE + ++ E + + R+ ++  P +   + D AFL  FLR   F    
Sbjct  18   LKPETVEIARVELRETEEVKAEAIIKLRELLKATPELNY-KDDDAFLTVFLRACHFYPEG  76

Query  73   AEEMLERYLTIRQLYPNWFQNLDVEDKDIEAIIDAGYLIPLMQRDRHGRRV-ILSCAGRF  131
            A E ++   + R+ Y +  + L VE    E  +    +  L   D+ GRRV I++C   +
Sbjct  77   ALEKMKTTASFRKEYASLVRGLLVEQVK-EKFVKGSVINVLKNCDQKGRRVLIVNCGKLW  135

Query  132  DPYKYTSAQMARAHSLVVESLMDDEENQVRGYTHINDESGLTMGHLSAWSLTDIRNMLRC  191
            DP   TS +M R   +V  +   +EE QVRG   I D  GL+M  + A S +  + +L  
Sbjct  136  DPSDITSDEMFRMLYMVHLAAQLEEETQVRGVVCIMDFEGLSMKQVKALSPSFSKRLLTF  195

Query  192  IQNSTPMRHKETHFVNIPSCAIKVIEFGISLLNDKLKNRILVHKS-LDELKTAIDPRILP  250
            IQ + P+R KE HFV  P     V       +  KL NR+  H S +  L+  +DP +LP
Sbjct  196  IQEAMPLRMKEVHFVKQPFIFNMVWSLFKPFVKQKLNNRMHFHGSDMKSLQKFLDPSVLP  255

Query  251  KEYGGEIP  258
              Y G +P
Sbjct  256  ANYKGTLP  263


>PINTA_DROME unnamed protein product
Length=273

 Score = 73.2 bits (178),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 71/280 (25%), Positives = 122/280 (44%), Gaps = 28/280 (10%)

Query  14   SESTRTIARVELREDDAIREETLKQFRD---WIQKHPNIKRCRTDAAFLLRFLRTKKFSV  70
            S S R +A       D   E  L Q +D   W+  +P I  C T    L  FLRT KF V
Sbjct  6    SSSKRQVATT-----DGDPERVLAQVQDLSDWLVANPQINGCNTFEN-LHFFLRTSKFDV  59

Query  71   PMAEEMLERYLTIRQLYPNWFQNLDVEDKDIEAIIDAGYLIPLMQRDRHGRRVILSCAGR  130
              A++ L+ +  +R     WF N D +  +I+ ++  G  +P+   D   R V++     
Sbjct  60   ERAKKKLKTFYQMRAERTEWFDNRDPQLPEIQDLLKLGVFLPI-GPDAEQRMVVVIRTAA  118

Query  131  FDPYKYTSAQMARAHSLVVESLMD-DEENQVRGYTHINDESGLTMGHLSAWSLTDIRNML  189
             DP  ++   + +   ++++ L+  D E   RG   I D  G+ +GH    +   I+   
Sbjct  119  HDPKLHSQNNVFKTSKMILDLLLKLDPETCARGMVAILDMQGVQLGHALQMNPKLIK---  175

Query  190  RCIQNST--PMRHKETHFVNIPSCAIKVIEFGISLLNDKLKNRILVHKSLDELKTAIDPR  247
            R +++ T  P + K   F N P      +      +  K+++R+ V +      T++   
Sbjct  176  RSVESWTAYPCQPKLLEFTNAPRHVNFFLNTFRIFMTPKIRSRLFVRRE----GTSVSCD  231

Query  248  ILPKEYGGE-IPLCEMIANFKKTLREQRNRIKELDDMYIE  286
             LPKE GG+ +   E+   +K+ + E         D Y+E
Sbjct  232  QLPKELGGQGLSYMELSVKWKQLVEENA-------DFYVE  264


>Q9W324_DROME unnamed protein product
Length=802

 Score = 50.8 bits (120),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 45/201 (22%), Positives = 84/201 (42%), Gaps = 12/201 (6%)

Query  60   LRFLRTKKFSVPMAEEMLERYLTIRQLYPNWFQNLDVEDKDIEAIIDAGYLIPLMQRDRH  119
            ++FL  +KF +P A  + E++  IR     +  N+D + + + + +  G    L  R   
Sbjct  99   VKFLYARKFDIPRAVSLYEQHEQIR--LKEYLYNIDPDVEPLRSELQTGKFTILPARTSS  156

Query  120  GRRVILSCAGRFDPYKYTSAQMARAHSLVVESLMDDEENQVRGYTHINDESGLTMGHLSA  179
            G  + L  A R  P   +     +     ++S + D E Q  G   I D SG    +   
Sbjct  157  GAAIALFTANRHSPLSVSHTTTLQGIVYQLDSALQDSETQRAGLVFIYDMSGSKYSNFD-  215

Query  180  WSLTDIRNMLRCIQNSTPMRHKETHFVNIP---SCAIKVIEFGISLLNDKLKNRILVHKS  236
            + L+  + +L  ++   P R K+   V  P       K++      + +KL+ R+    S
Sbjct  216  YDLS--QKILTLLKGGYPARLKKVLIVTAPLWFKAPFKILRL---FVREKLRERVFT-VS  269

Query  237  LDELKTAIDPRILPKEYGGEI  257
            + +L   +  + LP   GG +
Sbjct  270  VPQLALHVPRKALPIHLGGTL  290



Lambda      K        H
   0.331    0.143    0.476 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2966327756


Query= XP_003393030.1 facilitated trehalose transporter Tret1 isoform X2
[Bombus terrestris]

Length=639
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TRET1_APILI  unnamed protein product                                  813     0.0  
TRET1_ANOGA  unnamed protein product                                  666     0.0  
TRE12_DROME  unnamed protein product                                  635     0.0  


>TRET1_APILI unnamed protein product
Length=502

 Score = 813 bits (2100),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/501 (78%), Positives = 450/501 (90%), Gaps = 2/501 (0%)

Query  137  GVELTKPSMSSQNVKPTKDSDTVMRTQFQKEPKPSIMRYANQVLAALSVSMCSMVVGYSS  196
            GVE TK +MSSQN+KP KDSD V+ TQF KE K S MRY  Q+LAAL+VSM S+++GYSS
Sbjct  2    GVENTKQTMSSQNIKPAKDSDDVLHTQF-KEVKRSPMRYTMQLLAALAVSMASLMIGYSS  60

Query  197  SYTSPGLVSMRDNATATFEVTKETGMWIGSIMPLSALFGGMIGGPSIEYLGRRNTILATA  256
            SYTSP LVSMRDN TATFEVT +  MWIGSIMPLSAL GG+IGGP IEY+GRRNTIL+TA
Sbjct  61   SYTSPALVSMRDNTTATFEVTMDMAMWIGSIMPLSALIGGIIGGPCIEYIGRRNTILSTA  120

Query  257  LPFIAAWLLISLAANVAMVLAGRALCGFCVGIASLSLPVYLGETIQAEVRGTLGLLPTAF  316
            LPF+A WL I+LA NVAM+L GR++CGFCVG+ASLSLPVYLGE+IQ EVRG+LGLLPT F
Sbjct  121  LPFLAGWLFIALATNVAMILVGRSICGFCVGVASLSLPVYLGESIQPEVRGSLGLLPTVF  180

Query  317  GNTGILVCFIAGMYLDWRNLALLGAALPIPFMILMFVIPETPRWYISKGKTKRARKSLQW  376
            GN+GIL+CF AGMYL WRNLALLGA +PI F+ILMF+IPETPRWYISKGK K ARKSLQW
Sbjct  181  GNSGILMCFTAGMYLAWRNLALLGACIPIIFLILMFLIPETPRWYISKGKIKEARKSLQW  240

Query  377  LRGKGTDITDELSSVQKLHTESERNVSQGAFMQLFKKNHLKPLFISLGLMFFQQFSGINA  436
            LRGK  DI++EL S+QK+H ESER  ++GA ++LF+KNH+KP+FISLGLMFFQQFSGINA
Sbjct  241  LRGKTADISEELDSIQKMHIESERIATEGALIELFRKNHIKPVFISLGLMFFQQFSGINA  300

Query  437  VIFYTVQIFRDAGSSIDENISTIVVGIVNFISTFVAASVIDRLGRKMLLYISAISMCLTL  496
            VIFYTVQIF+D+GS++DEN+STI+VG+VNFISTFVAA +IDRLGRKMLLYIS+I MC+TL
Sbjct  301  VIFYTVQIFKDSGSTVDENLSTIIVGLVNFISTFVAAMIIDRLGRKMLLYISSILMCITL  360

Query  497  FTFGTFFYVKATGVDVTAFGWIPLMSLIVYVIGFSLGFGPIPWLMMGEILPVKIRGSAAS  556
            FTFGTFFYVK   +DVTAFGWIPLMSLIVYVIGFS GFGPIPWLMMGEILPVKIRG+AAS
Sbjct  361  FTFGTFFYVKEL-MDVTAFGWIPLMSLIVYVIGFSFGFGPIPWLMMGEILPVKIRGTAAS  419

Query  557  VATAFNWSCTFIVTKTYEDIVSVIGPYGTFWMFGTIVLVGFVFVIVSVPETRGRSLEEIE  616
            VATAFNWSCTF+VTKTYED+V  IGPYGTFW+FGT+V V F+FVI+ VPETRGRSLEEIE
Sbjct  420  VATAFNWSCTFVVTKTYEDLVLHIGPYGTFWLFGTLVAVAFIFVIICVPETRGRSLEEIE  479

Query  617  KRFTGPVRRMSAVANMKPMPM  637
            +RF GPVRR SA+AN+KPMP+
Sbjct  480  RRFAGPVRRTSAIANLKPMPI  500


>TRET1_ANOGA unnamed protein product
Length=793

 Score = 666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/482 (67%), Positives = 389/482 (81%), Gaps = 9/482 (2%)

Query  163  QFQKEPKPSIMRYA---------NQVLAALSVSMCSMVVGYSSSYTSPGLVSMRDNATAT  213
            Q  +E KP +  Y           QVLAALSVS+ SMVVG+SS+YTSP LVSM+D    +
Sbjct  308  QITEEGKPKLEVYRPTTNPIYIWTQVLAALSVSLGSMVVGFSSAYTSPALVSMKDRNITS  367

Query  214  FEVTKETGMWIGSIMPLSALFGGMIGGPSIEYLGRRNTILATALPFIAAWLLISLAANVA  273
            FEVT ++G W+G IMPL+ L GG++GGP IEYLGR+NTILATA PFI +WLLI  A +VA
Sbjct  368  FEVTDQSGSWVGGIMPLAGLAGGILGGPMIEYLGRKNTILATATPFIISWLLIGCATHVA  427

Query  274  MVLAGRALCGFCVGIASLSLPVYLGETIQAEVRGTLGLLPTAFGNTGILVCFIAGMYLDW  333
            MVL GRAL G CVGIASLSLPVYLGET+Q EVRGTLGLLPTAFGN GIL+CF+AG YLDW
Sbjct  428  MVLVGRALSGLCVGIASLSLPVYLGETVQPEVRGTLGLLPTAFGNIGILLCFVAGKYLDW  487

Query  334  RNLALLGAALPIPFMILMFVIPETPRWYISKGKTKRARKSLQWLRGKGTDITDELSSVQK  393
              LA LGAALPIPF++LMF+IPETPRWY+S+ +  RARK+LQWLRG+  D+  EL  + K
Sbjct  488  SGLAFLGAALPIPFLLLMFLIPETPRWYVSRNREDRARKALQWLRGRKADVEPELKGISK  547

Query  394  LHTESERNVSQGAFMQLFKKNHLKPLFISLGLMFFQQFSGINAVIFYTVQIFRDAGSSID  453
             H ++ER+ S  A + L  K +LKPL ISLGLMFFQQ SGINAVIFYTVQIF+ AGS+ID
Sbjct  548  SHQDAERHASSSAMLDLLNKANLKPLLISLGLMFFQQLSGINAVIFYTVQIFQSAGSTID  607

Query  454  ENISTIVVGIVNFISTFVAASVIDRLGRKMLLYISAISMCLTLFTFGTFFYVKATGVDVT  513
            E + TI+VG+VNFI+TF+A  +IDRLGRK+LLYIS ++M +TL T GTFFY+K  G DV+
Sbjct  608  EKLCTIIVGVVNFIATFIATVLIDRLGRKILLYISDVAMIITLMTLGTFFYMKNNGDDVS  667

Query  514  AFGWIPLMSLIVYVIGFSLGFGPIPWLMMGEILPVKIRGSAASVATAFNWSCTFIVTKTY  573
              GW+PL + +V+V+GFSLGFGPIPWLMMGEILP KIRGSAASVATAFNWSCTF+VTKT+
Sbjct  668  EIGWLPLAAFVVFVVGFSLGFGPIPWLMMGEILPGKIRGSAASVATAFNWSCTFVVTKTF  727

Query  574  EDIVSVIGPYGTFWMFGTIVLVGFVFVIVSVPETRGRSLEEIEKRFTGPVRRMSAVANMK  633
             DI + IG +G FWMFG+I +VG +FVIV VPET+G+SLE+IE++  G VRRMS+VAN+K
Sbjct  728  ADITASIGNHGAFWMFGSICIVGLLFVIVYVPETQGKSLEDIERKMMGRVRRMSSVANIK  787

Query  634  PM  635
            P+
Sbjct  788  PL  789


>TRE12_DROME unnamed protein product
Length=488

 Score = 635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/460 (65%), Positives = 374/460 (81%), Gaps = 1/460 (0%)

Query  177  NQVLAALSVSMCSMVVGYSSSYTSPGLVSMRDNATATFEVTKETGMWIGSIMPLSALFGG  236
            +QVLAALSVS+CS+VVG+ S+YTSP LVSM D    +FEVTK+ G W+G IMPL+AL GG
Sbjct  27   SQVLAALSVSLCSLVVGFVSAYTSPALVSMTDRTITSFEVTKDAGSWVGGIMPLAALAGG  86

Query  237  MIGGPSIEYLGRRNTILATALPFIAAWLLISLAANVAMVLAGRALCGFCVGIASLSLPVY  296
            + GGP IEYLGRR+TILATA+PFI + LLI+ A NV M+L GR L GFCVGIASLSLPVY
Sbjct  87   ITGGPLIEYLGRRSTILATAVPFIVSSLLIACAVNVIMILCGRFLTGFCVGIASLSLPVY  146

Query  297  LGETIQAEVRGTLGLLPTAFGNTGILVCFIAGMYLDWRNLALLGAALPIPFMILMFVIPE  356
            LGET+Q EVRGTLGLLPTA GN GILVC++AG +++W  LA LGAALP+PF+ILM +IPE
Sbjct  147  LGETLQPEVRGTLGLLPTALGNIGILVCYVAGSFMNWSMLAFLGAALPVPFLILMIIIPE  206

Query  357  TPRWYISKGKTKRARKSLQWLRGKGTDITDELSSVQKLHTESERNVSQGAFMQLFKKNHL  416
            TPRW++++G+ +RARK+L+WLRGK  D+  EL  + +   +++R  +Q   ++LFK+N+L
Sbjct  207  TPRWFVNRGQEERARKALKWLRGKEADVEPELKELMQSQADADRQATQNTCLELFKRNNL  266

Query  417  KPLFISLGLMFFQQFSGINAVIFYTVQIFRDAGSSIDENISTIVVGIVNFISTFVAASVI  476
            KPL ISLGLMFFQQFSGINAVIFYTVQIF+DAGS+ID N+STI+VG+VNF +TF+   +I
Sbjct  267  KPLSISLGLMFFQQFSGINAVIFYTVQIFKDAGSTIDSNLSTIIVGVVNFFATFMGIILI  326

Query  477  DRLGRKMLLYISAISMCLTLFTFGTFFYVKATGVDVTAFGWIPLMSLIVYVIGFSLGFGP  536
            DRLGRK+LLY+S I+M +TL   G FFY KA G DV+  GW+PL   ++Y++GFSLGFGP
Sbjct  327  DRLGRKILLYVSDIAMIVTLSILGGFFYCKAHGPDVSHLGWLPLTCFVIYILGFSLGFGP  386

Query  537  IPWLMMGEILPVKIRGSAASVATAFNWSCTFIVTKTYEDIVSVIGPYGTFWMFGTIVLVG  596
            IPWLMMGEILP KIRG AASV TAFNW CTF+VTKT++D+   +G +G FW+FG I +VG
Sbjct  387  IPWLMMGEILPAKIRGPAASVVTAFNWFCTFVVTKTFQDLTVAMGAHGAFWLFGAICIVG  446

Query  597  FVFVIVSVPETRGRSLEEIEKRFTGPVRRMSAVANMKPMP  636
              FVI+ VPETRG+SLEEIE++  G V  MS+V N+KP P
Sbjct  447  LFFVIIFVPETRGKSLEEIERKMMGRV-PMSSVVNIKPFP  485



Lambda      K        H
   0.331    0.143    0.476 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2966327756


Query= XP_003393031.1 RING-box protein 2 [Bombus terrestris]

Length=110
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7JWH5_DROME  unnamed protein product                                 175     3e-58
RBX1A_DROME  unnamed protein product                                  100     5e-29
RBX1_CAEEL  unnamed protein product                                   99.8    2e-28


>Q7JWH5_DROME unnamed protein product
Length=113

 Score = 175 bits (443),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 98/113 (87%), Gaps = 3/113 (3%)

Query  1    MAETEQDLGDRA--DNDNLKPDKLFILKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQ  58
            MA+  ++  DR   D D  KP+K+F LKKWNAVAMWSWDVECD CAICRVQVMD+CLRCQ
Sbjct  1    MADDPENSVDRPTDDGDAGKPEKMFTLKKWNAVAMWSWDVECDICAICRVQVMDSCLRCQ  60

Query  59   AESKKDD-SRQDCVVVWGECNHSFHYCCMSLWVQQNNRCPLCQQEWSIQRMGK  110
            A++K+D   RQDCVVVWGECNHSFH+CCMSLWV+QNNRCPLCQQEWSIQRMGK
Sbjct  61   ADNKRDVMGRQDCVVVWGECNHSFHHCCMSLWVKQNNRCPLCQQEWSIQRMGK  113


>RBX1A_DROME unnamed protein product
Length=108

 Score = 100 bits (250),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 68/107 (64%), Gaps = 1/107 (1%)

Query  3    ETEQDLGDRADNDNLKPDKLFILKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAESK  62
            E ++D  +   + +    K F +KKWNAVA+W+WD+  D CAICR  +MD C+ CQA ++
Sbjct  2    EVDEDGYEVPSSSSKGDKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQA-NQ  60

Query  63   KDDSRQDCVVVWGECNHSFHYCCMSLWVQQNNRCPLCQQEWSIQRMG  109
               + ++C V WG CNH+FH+ C+S W++    CPL  +EW  Q+ G
Sbjct  61   ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWDFQKYG  107


>RBX1_CAEEL unnamed protein product
Length=110

 Score = 99.8 bits (247),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 66/100 (66%), Gaps = 3/100 (3%)

Query  10   DRADNDNLKPDKLFILKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAESKKDDSRQD  69
            + A N  +K  K F +KKW+AVA+W+WD++ D CAICR  +MD C+ CQA ++    + +
Sbjct  13   EEATNQTVK--KRFEVKKWSAVALWAWDIQVDNCAICRNHIMDLCIECQA-NQAAGLKDE  69

Query  70   CVVVWGECNHSFHYCCMSLWVQQNNRCPLCQQEWSIQRMG  109
            C V WG CNH+FH+ C+S W++    CPL  +EW  Q+ G
Sbjct  70   CTVAWGNCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYG  109



Lambda      K        H
   0.331    0.143    0.476 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2966327756


Query= XP_003393032.1 gastrula zinc finger protein XlCGF57.1 isoform X1
[Bombus terrestris]

Length=576
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9PD94_DROME  unnamed protein product                                 298     1e-90
O61360_DROME  unnamed protein product                                 298     5e-90
O61361_DROME  unnamed protein product                                 290     1e-87


>M9PD94_DROME unnamed protein product
Length=907

 Score = 298 bits (764),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 170/448 (38%), Positives = 220/448 (49%), Gaps = 9/448 (2%)

Query  136  CSICKKWFLNNDSMVTHLRMHCSGN--QCEVCQQNFQDNSSLHAHMLTHVGMSPLECNVC  193
            C IC K F     ++ H R H       C+VC Q F  +  L  H   H+G     C VC
Sbjct  223  CDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTCIVC  282

Query  194  QKRFAYKWCLRSHMQMHVLEKPYDNDALQQVFMKRPDSEHDQSLNIEERVFECDVCHATF  253
               FA    L  HM+ H  +KP+     Q+ F ++   ++    +  E  F C  C  TF
Sbjct  283  FNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYCAKTF  342

Query  254  KEKSSLNRHVLTHTEERPYKCDVCFAAFREKAKLNMHMTLHSGNKQFKCTMCHRSFTQKT  313
              K  +  HV  HT + P++CDVC   +  K  L  HM  H+    F+C +C +SF++K 
Sbjct  343  TRKEHMVNHVRKHTGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKE  402

Query  314  ALNNHMLAHS-GEKPHACNICEKTYKRKSELIRHTMVHTGERPYECKECLMTFREKAKLN  372
               NH+L H+ GE PH C+ C KT+ RK  L+ H   HTGE P+ C  C+ TF  K  L 
Sbjct  403  HFTNHILWHTAGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLV  462

Query  373  SHMLVHTGEKPHACQICHKACARKSDLNSHMLLHTG-GQYDCKVCDKIFTRKSDLNRHTL  431
            +H+  HTGE PH C  C K   RK  L +H+  HTG   + C  C K FTRK  L  H  
Sbjct  463  NHIRQHTGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHVR  522

Query  432  IHTGEKPFACELCDMAFREKTRLNSHMLVHTGDKRHACHICQKSFKEKSSLRKHMLS-HT  490
            +HTG+ P  CE C   F  K  LN+HM  H+ D  H C++C K F  K  L  HM   HT
Sbjct  523  LHTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHT  582

Query  491  GDRPYECYVCHKAFTQKTTL----NSHILVHAGERPYECSACQKIFKDKATLKKHLSVHI  546
            GDRP+ C  C K+F  K  L     SH      ERP+ C  C K F  K  L  H+  H 
Sbjct  583  GDRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHS  642

Query  547  NEKTHECLICLKKFTHKAALNSHLSTNH  574
             EK H C +C K F  +  L  H+  NH
Sbjct  643  GEKPHACTLCSKAFVERGNLKRHMKMNH  670


 Score = 168 bits (425),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 90/245 (37%), Positives = 123/245 (50%), Gaps = 2/245 (1%)

Query  328  HACNICEKTYKRKSELIRHTMVHTGERPYECKECLMTFREKAKLNSHMLVHTGEKPHACQ  387
            H C+IC K ++ + +LI H   H+  +P+ C+ C   F     L  H  +H G     C 
Sbjct  221  HVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTCI  280

Query  388  ICHKACARKSDLNSHMLLH-TGGQYDCKVCDKIFTRKSDLNRHTLIHTGEKPFACELCDM  446
            +C    A  + L  HM  H T   + C +C K F RK  L+ H   HTGE PF C+ C  
Sbjct  281  VCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYCAK  340

Query  447  AFREKTRLNSHMLVHTGDKRHACHICQKSFKEKSSLRKHMLSHTGDRPYECYVCHKAFTQ  506
             F  K  + +H+  HTG   H C +C K +  K  L  HM SHT + P+ C +C K+F++
Sbjct  341  TFTRKEHMVNHVRKHTGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSR  400

Query  507  KTTLNSHILVH-AGERPYECSACQKIFKDKATLKKHLSVHINEKTHECLICLKKFTHKAA  565
            K    +HIL H AGE P+ C  C K F  K  L  H+  H  E  H C  C+K FT K  
Sbjct  401  KEHFTNHILWHTAGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEH  460

Query  566  LNSHL  570
            L +H+
Sbjct  461  LVNHI  465


 Score = 117 bits (292),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/164 (34%), Positives = 83/164 (51%), Gaps = 0/164 (0%)

Query  409  GQYDCKVCDKIFTRKSDLNRHTLIHTGEKPFACELCDMAFREKTRLNSHMLVHTGDKRHA  468
            G + C +C K+F  +  L  H   H+  KPF C++C   F     L  H  +H G     
Sbjct  219  GTHVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFT  278

Query  469  CHICQKSFKEKSSLRKHMLSHTGDRPYECYVCHKAFTQKTTLNSHILVHAGERPYECSAC  528
            C +C   F   +SL +HM  H+ D+P+ C +C K F +K  L++H   H GE P+ C  C
Sbjct  279  CIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYC  338

Query  529  QKIFKDKATLKKHLSVHINEKTHECLICLKKFTHKAALNSHLST  572
             K F  K  +  H+  H  +  H+C +C KK+T K  L +H+ +
Sbjct  339  AKTFTRKEHMVNHVRKHTGQTPHQCDVCGKKYTRKEHLANHMRS  382


>O61360_DROME unnamed protein product
Length=962

 Score = 298 bits (762),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 162/447 (36%), Positives = 224/447 (50%), Gaps = 8/447 (2%)

Query  136  CSICKKWFLNNDSMVTHLRMHCSGNQ--CEVCQQNFQDNSSLHAHMLTHVGMSPLECNVC  193
            C +C   F NN S+  H++ H +     C +CQ+ F     L  H  +H G +P  C  C
Sbjct  279  CIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYC  338

Query  194  QKRFAYKWCLRSHMQMHVLEKPYDNDALQQVFMKRPDSEHDQSLNIEERVFECDVCHATF  253
             K F  K  + +H++ H  E P+  D  ++ F ++    +    +  +   +CDVC   +
Sbjct  339  AKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHYMWHTGQTPHQCDVCGKKY  398

Query  254  KEKSSLNRHVLTHTEERPYKCDVCFAAFREKAKLNMHMTLHSGNKQFKCTMCHRSFTQKT  313
              K  L  H+ +HT E P++C++C  +F  K     H+  H+G    +C  C ++FT+K 
Sbjct  399  TRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTFTRKE  458

Query  314  ALNNHMLAHSGEKPHACNICEKTYKRKSELIRHTMVHTGERPYECKECLMTFREKAKLNS  373
             L NH+  H+GE PH C+ C KT+ RK  L+ H   HTGE P++C  C   F  K  + +
Sbjct  459  HLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTRKDHMVN  518

Query  374  HMLVHTGEKPHACQICHKACARKSDLNSHMLLHTG-GQYDCKVCDKIFTRKSDLNRHTLI  432
            H+  HTGE PH C  C K   RK  L +H+  HTG   + C  C K FTRK  L  H  +
Sbjct  519  HVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRL  578

Query  433  HTGEKPFACELCDMAFREKTRLNSHMLVHTGDKRHACHICQKSFKEKSSLRKHMLS-HTG  491
            HTG+ P  CE C   F  K  LN+HM  H+ D  H C++C K F  K  L  HM   HTG
Sbjct  579  HTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTG  638

Query  492  DRPYECYVCHKAFTQKTTL----NSHILVHAGERPYECSACQKIFKDKATLKKHLSVHIN  547
            DRP+ C  C K+F  K  L     SH      ERP+ C  C K F  K  L  H+  H  
Sbjct  639  DRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSG  698

Query  548  EKTHECLICLKKFTHKAALNSHLSTNH  574
            EK H C +C K F  +  L  H+  NH
Sbjct  699  EKPHACTLCSKAFVERGNLKRHMKMNH  725


 Score = 286 bits (732),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 162/444 (36%), Positives = 214/444 (48%), Gaps = 31/444 (7%)

Query  136  CSICKKWFLNNDSMVTHLRMHCSGN--QCEVCQQNFQDNSSLHAHMLTHVGMSPLECNVC  193
            C IC K F     ++ H R H       C+VC Q F  +  L  H   H+G     C VC
Sbjct  223  CDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTCIVC  282

Query  194  QKRFAYKWCLRSHMQMHVLEKPYDNDALQQVFMKRPDSEHDQSLNIEERVFECDVCHATF  253
               FA    L  HM+ H  +KP                            F C +C  TF
Sbjct  283  FNVFANNTSLERHMKRHSTDKP----------------------------FACTICQKTF  314

Query  254  KEKSSLNRHVLTHTEERPYKCDVCFAAFREKAKLNMHMTLHSGNKQFKCTMCHRSFTQKT  313
              K  L+ H  +HT E P++C  C   F  K  +  H+  H+G    +C +C +SFT+K 
Sbjct  315  ARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKE  374

Query  314  ALNNHMLAHSGEKPHACNICEKTYKRKSELIRHTMVHTGERPYECKECLMTFREKAKLNS  373
               NH + H+G+ PH C++C K Y RK  L  H   HT E P+ C+ C  +F  K    +
Sbjct  375  HYVNHYMWHTGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTN  434

Query  374  HMLVHTGEKPHACQICHKACARKSDLNSHMLLHTG-GQYDCKVCDKIFTRKSDLNRHTLI  432
            H+L HTGE PH C  C K   RK  L +H+  HTG   + C  C K FTRK  L  H   
Sbjct  435  HILWHTGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQ  494

Query  433  HTGEKPFACELCDMAFREKTRLNSHMLVHTGDKRHACHICQKSFKEKSSLRKHMLSHTGD  492
            HTGE PF C  C  AF  K  + +H+  HTG+  H C  C K+F  K  L  H+  HTGD
Sbjct  495  HTGETPFKCTYCTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQHTGD  554

Query  493  RPYECYVCHKAFTQKTTLNSHILVHAGERPYECSACQKIFKDKATLKKHLSVHINEKTHE  552
             P+ C  C K FT+K  L +H+ +H G+ P++C  CQK F  K  L  H+  H ++  H 
Sbjct  555  SPHRCSYCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHC  614

Query  553  CLICLKKFTHKAALNSHLSTNHTS  576
            C +C K FT K  L +H+S  HT 
Sbjct  615  CNVCNKPFTRKEHLINHMSRCHTG  638


 Score = 256 bits (655),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 143/389 (37%), Positives = 206/389 (53%), Gaps = 8/389 (2%)

Query  134  IQCSICKKWFLNNDSMVTHLRMHC--SGNQCEVCQQNFQDNSSLHAHMLTHVGMSPLECN  191
             +C  C K F   + MV H+R H   + ++C++C+++F        H + H G +P +C+
Sbjct  333  FRCQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHYMWHTGQTPHQCD  392

Query  192  VCQKRFAYKWCLRSHMQMHVLEKPYDNDALQQVFMKRPDSEHDQSLNIEERVFECDVCHA  251
            VC K++  K  L +HM+ H  E P+  +   + F ++    +    +  E    CD C  
Sbjct  393  VCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTGETPHRCDFCSK  452

Query  252  TFKEKSSLNRHVLTHTEERPYKCDVCFAAFREKAKLNMHMTLHSGNKQFKCTMCHRSFTQ  311
            TF  K  L  HV  HT E P++C  C   F  K  L  H+  H+G   FKCT C ++FT+
Sbjct  453  TFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTR  512

Query  312  KTALNNHMLAHSGEKPHACNICEKTYKRKSELIRHTMVHTGERPYECKECLMTFREKAKL  371
            K  + NH+  H+GE PH C  C KT+ RK  L  H   HTG+ P+ C  C  TF  K  L
Sbjct  513  KDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHL  572

Query  372  NSHMLVHTGEKPHACQICHKACARKSDLNSHMLLHTG-GQYDCKVCDKIFTRKSDLNRH-  429
             +H+ +HTG+ PH C+ C K   RK  LN+HM  H+    + C VC+K FTRK  L  H 
Sbjct  573  TNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHM  632

Query  430  TLIHTGEKPFACELCDMAFREKTRLNSHMLVHTG----DKRHACHICQKSFKEKSSLRKH  485
            +  HTG++PF CE C  +F  K  L  H   HT     ++  AC  C K+F  K  L  H
Sbjct  633  SRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSH  692

Query  486  MLSHTGDRPYECYVCHKAFTQKTTLNSHI  514
            M SH+G++P+ C +C KAF ++  L  H+
Sbjct  693  MRSHSGEKPHACTLCSKAFVERGNLKRHM  721


 Score = 171 bits (434),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 96/272 (35%), Positives = 129/272 (47%), Gaps = 29/272 (11%)

Query  328  HACNICEKTYKRKSELI----------------------------RHTMVHTGERPYECK  359
            H C+IC K ++ + +LI                            RH  +H G   + C 
Sbjct  221  HVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTCI  280

Query  360  ECLMTFREKAKLNSHMLVHTGEKPHACQICHKACARKSDLNSHMLLHTG-GQYDCKVCDK  418
             C   F     L  HM  H+ +KP AC IC K  ARK  L++H   HTG   + C+ C K
Sbjct  281  VCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYCAK  340

Query  419  IFTRKSDLNRHTLIHTGEKPFACELCDMAFREKTRLNSHMLVHTGDKRHACHICQKSFKE  478
             FTRK  +  H   HTGE P  C++C  +F  K    +H + HTG   H C +C K +  
Sbjct  341  TFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHYMWHTGQTPHQCDVCGKKYTR  400

Query  479  KSSLRKHMLSHTGDRPYECYVCHKAFTQKTTLNSHILVHAGERPYECSACQKIFKDKATL  538
            K  L  HM SHT + P+ C +C K+F++K    +HIL H GE P+ C  C K F  K  L
Sbjct  401  KEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTFTRKEHL  460

Query  539  KKHLSVHINEKTHECLICLKKFTHKAALNSHL  570
              H+  H  E  H C  C+K FT K  L +H+
Sbjct  461  LNHVRQHTGESPHRCSYCMKTFTRKEHLVNHI  492


 Score = 166 bits (419),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 99/307 (32%), Positives = 141/307 (46%), Gaps = 35/307 (11%)

Query  134  IQCSICKKWFLNNDSMVTHLRMHC--SGNQCEVCQQNFQDNSSLHAHMLTHVGMSPLECN  191
             +C IC K F   +    H+  H   + ++C+ C + F     L  H+  H G SP  C+
Sbjct  417  FRCEICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCS  476

Query  192  VCQKRFAYKWCLRSHMQMHVLEKPYDNDALQQVFMKRPDSEHDQSLNIEERVFECDVCHA  251
             C K F  K  L +H++ H  E P+      + F ++    +    +  E   +C  C  
Sbjct  477  YCMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTRKDHMVNHVRQHTGESPHKCTYCTK  536

Query  252  TFKEKSSLNRHVLTHTEERPYKCDVCFAAFREKAKLNMHMTLHSGNKQFKCTMCHRSFTQ  311
            TF  K  L  HV  HT + P++C  C   F  K  L  H+ LH+G+   KC  C ++FT+
Sbjct  537  TFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTR  596

Query  312  KTALNNHMLAHSGEKPHACNICEKTYKRKSELIRH-TMVHTGERPYECKECLMTFREKAK  370
            K  LNNHM  HS + PH CN+C K + RK  LI H +  HTG+RP+ C+ C  +F  K  
Sbjct  597  KEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGN  656

Query  371  L--------------------------------NSHMLVHTGEKPHACQICHKACARKSD  398
            L                                 SHM  H+GEKPHAC +C KA   + +
Sbjct  657  LLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSKAFVERGN  716

Query  399  LNSHMLL  405
            L  HM +
Sbjct  717  LKRHMKM  723


 Score = 114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/161 (35%), Positives = 78/161 (48%), Gaps = 0/161 (0%)

Query  409  GQYDCKVCDKIFTRKSDLNRHTLIHTGEKPFACELCDMAFREKTRLNSHMLVHTGDKRHA  468
            G + C +C K+F  +  L  H   H+  KPF C++C   F     L  H  +H G     
Sbjct  219  GTHVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFT  278

Query  469  CHICQKSFKEKSSLRKHMLSHTGDRPYECYVCHKAFTQKTTLNSHILVHAGERPYECSAC  528
            C +C   F   +SL +HM  H+ D+P+ C +C K F +K  L++H   H GE P+ C  C
Sbjct  279  CIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYC  338

Query  529  QKIFKDKATLKKHLSVHINEKTHECLICLKKFTHKAALNSH  569
             K F  K  +  H+  H  E  H C IC K FT K    +H
Sbjct  339  AKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNH  379


 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 52/106 (49%), Gaps = 0/106 (0%)

Query  467  HACHICQKSFKEKSSLRKHMLSHTGDRPYECYVCHKAFTQKTTLNSHILVHAGERPYECS  526
            H C IC K F+ +  L  H   H+  +P+ C VC + FT    L  H  +H G   + C 
Sbjct  221  HVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTCI  280

Query  527  ACQKIFKDKATLKKHLSVHINEKTHECLICLKKFTHKAALNSHLST  572
             C  +F +  +L++H+  H  +K   C IC K F  K  L++H  +
Sbjct  281  VCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRS  326


>O61361_DROME unnamed protein product
Length=891

 Score = 290 bits (742),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 165/448 (37%), Positives = 224/448 (50%), Gaps = 8/448 (2%)

Query  136  CSICKKWFLNNDSMVTHLRMHCSGNQ--CEVCQQNFQDNSSLHAHMLTHVGMSPLECNVC  193
            C +C + F  +  +  H ++H  G    C VC   F +N+SL  HM  H    P  C +C
Sbjct  251  CQVCGQGFTTSQDLTRHGKIHIGGPMFTCIVCFNVFANNTSLERHMKRHSTDKPFACTIC  310

Query  194  QKRFAYKWCLRSHMQMHVLEKPYDNDALQQVFMKRPDSEHDQSLNIEERVFECDVCHATF  253
            QK FA K  L +H + H  E P+      + F ++    +    +  E    CD+C  +F
Sbjct  311  QKTFARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSF  370

Query  254  KEKSSLNRHVLTHTEERPYKCDVCFAAFREKAKLNMHMTLHSGNKQFKCTMCHRSFTQKT  313
              K     H + HT + P++CDVC   +  K  L  HM  H+    F+C +C +SF++K 
Sbjct  371  TRKEHYVNHYMWHTGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKE  430

Query  314  ALNNHMLAHSGEKPHACNICEKTYKRKSELIRHTMVHTGERPYECKECLMTFREKAKLNS  373
               NH+L H+GE PH C+ C KT+ RK  L+ H   HTGE P+ C  C+ TF  K  L +
Sbjct  431  HFTNHILWHTGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVN  490

Query  374  HMLVHTGEKPHACQICHKACARKSDLNSHMLLHTG-GQYDCKVCDKIFTRKSDLNRHTLI  432
            H+  HTGE P  C  C KA  RK  + +H+  HTG   + C  C K FTRK  L  H   
Sbjct  491  HIRQHTGETPFKCTYCTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQ  550

Query  433  HTGEKPFACELCDMAFREKTRLNSHMLVHTGDKRHACHICQKSFKEKSSLRKHMLSHTGD  492
            HTG+ P  C  C   F  K  L +H+ +HTGD  H C  CQK+F  K  L  HM  H+ D
Sbjct  551  HTGDSPHRCSYCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSD  610

Query  493  RPYECYVCHKAFTQKTTLNSHI-LVHAGERPYECSACQKIFKDKATLKKHLSVHIN----  547
             P+ C VC+K FT+K  L +H+   H G+RP+ C  C K F  K  L  H   H      
Sbjct  611  NPHCCNVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQEM  670

Query  548  EKTHECLICLKKFTHKAALNSHLSTNHT  575
            E+   C  C K F  K   +S  +T HT
Sbjct  671  ERPFACEKCPKNFICKVPHHSATTTMHT  698


 Score = 286 bits (733),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 162/444 (36%), Positives = 214/444 (48%), Gaps = 31/444 (7%)

Query  136  CSICKKWFLNNDSMVTHLRMHCSGN--QCEVCQQNFQDNSSLHAHMLTHVGMSPLECNVC  193
            C IC K F     ++ H R H       C+VC Q F  +  L  H   H+G     C VC
Sbjct  223  CDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTCIVC  282

Query  194  QKRFAYKWCLRSHMQMHVLEKPYDNDALQQVFMKRPDSEHDQSLNIEERVFECDVCHATF  253
               FA    L  HM+ H  +KP                            F C +C  TF
Sbjct  283  FNVFANNTSLERHMKRHSTDKP----------------------------FACTICQKTF  314

Query  254  KEKSSLNRHVLTHTEERPYKCDVCFAAFREKAKLNMHMTLHSGNKQFKCTMCHRSFTQKT  313
              K  L+ H  +HT E P++C  C   F  K  +  H+  H+G    +C +C +SFT+K 
Sbjct  315  ARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKE  374

Query  314  ALNNHMLAHSGEKPHACNICEKTYKRKSELIRHTMVHTGERPYECKECLMTFREKAKLNS  373
               NH + H+G+ PH C++C K Y RK  L  H   HT E P+ C+ C  +F  K    +
Sbjct  375  HYVNHYMWHTGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTN  434

Query  374  HMLVHTGEKPHACQICHKACARKSDLNSHMLLHTG-GQYDCKVCDKIFTRKSDLNRHTLI  432
            H+L HTGE PH C  C K   RK  L +H+  HTG   + C  C K FTRK  L  H   
Sbjct  435  HILWHTGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQ  494

Query  433  HTGEKPFACELCDMAFREKTRLNSHMLVHTGDKRHACHICQKSFKEKSSLRKHMLSHTGD  492
            HTGE PF C  C  AF  K  + +H+  HTG+  H C  C K+F  K  L  H+  HTGD
Sbjct  495  HTGETPFKCTYCTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQHTGD  554

Query  493  RPYECYVCHKAFTQKTTLNSHILVHAGERPYECSACQKIFKDKATLKKHLSVHINEKTHE  552
             P+ C  C K FT+K  L +H+ +H G+ P++C  CQK F  K  L  H+  H ++  H 
Sbjct  555  SPHRCSYCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHC  614

Query  553  CLICLKKFTHKAALNSHLSTNHTS  576
            C +C K FT K  L +H+S  HT 
Sbjct  615  CNVCNKPFTRKEHLINHMSRCHTG  638


 Score = 227 bits (579),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 128/351 (36%), Positives = 183/351 (52%), Gaps = 8/351 (2%)

Query  134  IQCSICKKWFLNNDSMVTHLRMHC--SGNQCEVCQQNFQDNSSLHAHMLTHVGMSPLECN  191
             +C  C K F   + MV H+R H   + ++C++C+++F        H + H G +P +C+
Sbjct  333  FRCQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHYMWHTGQTPHQCD  392

Query  192  VCQKRFAYKWCLRSHMQMHVLEKPYDNDALQQVFMKRPDSEHDQSLNIEERVFECDVCHA  251
            VC K++  K  L +HM+ H  E P+  +   + F ++    +    +  E    CD C  
Sbjct  393  VCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTGETPHRCDFCSK  452

Query  252  TFKEKSSLNRHVLTHTEERPYKCDVCFAAFREKAKLNMHMTLHSGNKQFKCTMCHRSFTQ  311
            TF  K  L  HV  HT E P++C  C   F  K  L  H+  H+G   FKCT C ++FT+
Sbjct  453  TFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTR  512

Query  312  KTALNNHMLAHSGEKPHACNICEKTYKRKSELIRHTMVHTGERPYECKECLMTFREKAKL  371
            K  + NH+  H+GE PH C  C KT+ RK  L  H   HTG+ P+ C  C  TF  K  L
Sbjct  513  KDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHL  572

Query  372  NSHMLVHTGEKPHACQICHKACARKSDLNSHMLLHTG-GQYDCKVCDKIFTRKSDLNRH-  429
             +H+ +HTG+ PH C+ C K   RK  LN+HM  H+    + C VC+K FTRK  L  H 
Sbjct  573  TNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHM  632

Query  430  TLIHTGEKPFACELCDMAFREKTRLNSHMLVHTG----DKRHACHICQKSF  476
            +  HTG++PF CE C  +F  K  L  H   HT     ++  AC  C K+F
Sbjct  633  SRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNF  683


 Score = 171 bits (434),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 96/272 (35%), Positives = 129/272 (47%), Gaps = 29/272 (11%)

Query  328  HACNICEKTYKRKSELI----------------------------RHTMVHTGERPYECK  359
            H C+IC K ++ + +LI                            RH  +H G   + C 
Sbjct  221  HVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTCI  280

Query  360  ECLMTFREKAKLNSHMLVHTGEKPHACQICHKACARKSDLNSHMLLHTG-GQYDCKVCDK  418
             C   F     L  HM  H+ +KP AC IC K  ARK  L++H   HTG   + C+ C K
Sbjct  281  VCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYCAK  340

Query  419  IFTRKSDLNRHTLIHTGEKPFACELCDMAFREKTRLNSHMLVHTGDKRHACHICQKSFKE  478
             FTRK  +  H   HTGE P  C++C  +F  K    +H + HTG   H C +C K +  
Sbjct  341  TFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHYMWHTGQTPHQCDVCGKKYTR  400

Query  479  KSSLRKHMLSHTGDRPYECYVCHKAFTQKTTLNSHILVHAGERPYECSACQKIFKDKATL  538
            K  L  HM SHT + P+ C +C K+F++K    +HIL H GE P+ C  C K F  K  L
Sbjct  401  KEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTFTRKEHL  460

Query  539  KKHLSVHINEKTHECLICLKKFTHKAALNSHL  570
              H+  H  E  H C  C+K FT K  L +H+
Sbjct  461  LNHVRQHTGESPHRCSYCMKTFTRKEHLVNHI  492


 Score = 114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/161 (35%), Positives = 78/161 (48%), Gaps = 0/161 (0%)

Query  409  GQYDCKVCDKIFTRKSDLNRHTLIHTGEKPFACELCDMAFREKTRLNSHMLVHTGDKRHA  468
            G + C +C K+F  +  L  H   H+  KPF C++C   F     L  H  +H G     
Sbjct  219  GTHVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFT  278

Query  469  CHICQKSFKEKSSLRKHMLSHTGDRPYECYVCHKAFTQKTTLNSHILVHAGERPYECSAC  528
            C +C   F   +SL +HM  H+ D+P+ C +C K F +K  L++H   H GE P+ C  C
Sbjct  279  CIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYC  338

Query  529  QKIFKDKATLKKHLSVHINEKTHECLICLKKFTHKAALNSH  569
             K F  K  +  H+  H  E  H C IC K FT K    +H
Sbjct  339  AKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNH  379


 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 52/106 (49%), Gaps = 0/106 (0%)

Query  467  HACHICQKSFKEKSSLRKHMLSHTGDRPYECYVCHKAFTQKTTLNSHILVHAGERPYECS  526
            H C IC K F+ +  L  H   H+  +P+ C VC + FT    L  H  +H G   + C 
Sbjct  221  HVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTCI  280

Query  527  ACQKIFKDKATLKKHLSVHINEKTHECLICLKKFTHKAALNSHLST  572
             C  +F +  +L++H+  H  +K   C IC K F  K  L++H  +
Sbjct  281  VCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRS  326



Lambda      K        H
   0.331    0.143    0.476 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2966327756


Query= XP_003393033.1 plasma protease C1 inhibitor [Bombus terrestris]

Length=848
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SP27A_DROME  unnamed protein product                                  229     1e-66
SP42D_DROME  unnamed protein product                                  186     4e-52
Q7KA66_DROME  unnamed protein product                                 169     7e-46


>SP27A_DROME unnamed protein product
Length=447

 Score = 229 bits (584),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 140/391 (36%), Positives = 234/391 (60%), Gaps = 16/391 (4%)

Query  57   EDDEIFIPYQGERFNIFDWALFRTMSKKYSG--NMLLSPISLKIVLVLLYEGAQD--ETA  112
            +D + F+P++ +  + F W L +T+ +  +   N+++SP S+K+VL LL E A    +T 
Sbjct  60   DDIDTFVPFRSDSHDPFSWHLLKTVLQNETADKNVIISPFSVKLVLALLAEAAGAGTQTQ  119

Query  113  HELATAMQLPANENVIRKRFSTILQSLQ-SNPPAYILNIGTRIYIDSNILIRQKYEATVK  171
             ELA       ++N +R+ +   L S +  N     L++ T+++ DS I  +QK+ AT+K
Sbjct  120  VELANTQTDIRSQNNVREFYRKTLNSFKKENQLHETLSVRTKLFTDSFIETQQKFTATLK  179

Query  172  AYYDTDVISANLSDAQPVVQAINDWVSNITDANIDQMIKDENNVKNSLMLIMNTLFFKGS  231
             +YD++V + + ++ +    AIN W +NIT   + Q++  +N V++S+ML+ N ++F G 
Sbjct  180  HFYDSEVEALDFTNPEAAADAINAWAANITQGRLQQLVAPDN-VRSSVMLLTNLIYFNGL  238

Query  232  WRRKYFSPENTRTGKFYTIDNRTIDVPFMHTFGRFYYANSPELDATILRIPYDGRKFALY  291
            WRR++ +   T  G F+   +      FM     FYY  S +L A ILR+PY G+  +L+
Sbjct  239  WRRQFAT---TFQGSFFRSKDDQSRAEFMEQTDYFYYTTSEKLKAQILRLPYKGKN-SLF  294

Query  292  LLLPRNKTLDGIEHLVNEVTPFVLTRYVWQMQNLPIAVTIPKFKYQFSSHMEPVLREVGI  351
            +LLP    L+GI  LV  +    L    W M+ + + VT+PKF + +  +++  LR +G+
Sbjct  295  VLLPY--ALNGIHDLVKNLENDELKSAQWAMEEVKVKVTLPKFHFDYQQNLKETLRSLGV  352

Query  352  RNIFDDTATLTGIAQTRRISSNLKVSDILQKTGIEVNENGTTAYVATEVDIGNKIGE---  408
            R IF+D+A+L G+ +   ++  +KVS+ILQK GI VNE GT AY AT V+I NK G    
Sbjct  353  REIFEDSASLPGLTRGADVAGKVKVSNILQKAGINVNEKGTEAYAATVVEIENKFGGSTA  412

Query  409  -EIFHADHPFVFYIEDESTGTVIYIGRMMNP  438
             E F+ + PFVF+IE+ESTG +++ G++ +P
Sbjct  413  IEEFNVNRPFVFFIEEESTGNILFAGKVHSP  443


 Score = 100 bits (248),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 97/371 (26%), Positives = 181/371 (49%), Gaps = 27/371 (7%)

Query  491  LTKKYKDGNLVSSPASVKTILTMLMEGANGNTKSEIISVLRLPEGKSRRG--ELAQRILA  548
            L  +  D N++ SP SVK +L +L E A   T++++       + +S+    E  ++ L 
Sbjct  85   LQNETADKNVIISPFSVKLVLALLAEAAGAGTQTQVELANTQTDIRSQNNVREFYRKTLN  144

Query  549  SLNR-NENGTEIALTTRLWIHENLRVSNNYKNILRSRYQGDIESVNFMESQSTARHINEW  607
            S  + N+    +++ T+L+    +     +   L+  Y  ++E+++F   ++ A  IN W
Sbjct  145  SFKKENQLHETLSVRTKLFTDSFIETQQKFTATLKHFYDSEVEALDFTNPEAAADAINAW  204

Query  608  VRRVTHNTISSALLLNELPPDTR---LILTSVIYFKGLWLKSFDKANTKLQCFYIPNGEC  664
               +T   +   +     P + R   ++LT++IYF GLW + F  A T    F+    + 
Sbjct  205  AANITQGRLQQLVA----PDNVRSSVMLLTNLIYFNGLWRRQF--ATTFQGSFFRSKDDQ  258

Query  665  RNTYFMKHGSIYRYAYIPSIEAHVLEIPYSDGKTSMLTLMPRSRK--NDPYLRILSDDLI  722
                FM+    + Y     ++A +L +PY  GK S+  L+P +    +D    + +D+L 
Sbjct  259  SRAEFMEQTDYFYYTTSEKLKAQILRLPYK-GKNSLFVLLPYALNGIHDLVKNLENDEL-  316

Query  723  TVPVSAILANLKKQDITIHLPKFNIENNLDLVPTLRHLGIENIFQPNTNLSKMISDS---  779
                SA  A +++  + + LPKF+ +   +L  TLR LG+  IF+ + +L  +   +   
Sbjct  317  ---KSAQWA-MEEVKVKVTLPKFHFDYQQNLKETLRSLGVREIFEDSASLPGLTRGADVA  372

Query  780  -SIHVASILQNVKLEIDEEGT--LAATDTEIGYKLLSSWS-NDVKMDRPFLFMIIDSVLN  835
              + V++ILQ   + ++E+GT   AAT  EI  K   S +  +  ++RPF+F I +    
Sbjct  373  GKVKVSNILQKAGINVNEKGTEAYAATVVEIENKFGGSTAIEEFNVNRPFVFFIEEESTG  432

Query  836  MTLFSGRFIEP  846
              LF+G+   P
Sbjct  433  NILFAGKVHSP  443


>SP42D_DROME unnamed protein product
Length=372

 Score = 186 bits (473),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 108/365 (30%), Positives = 190/365 (52%), Gaps = 16/365 (4%)

Query  77   LFRTMSKKYSG-NMLLSPISLKIVLVLLYEGAQDETAHELATAMQLPA-NENVIRKRFST  134
            +++ +SK ++  N+++SP+S++ +L +++ GA+  TA EL +A+ LP+ ++  +  R+  
Sbjct  21   IYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALGLPSEDKEAVAARYGA  80

Query  135  ILQSLQSNPPAYILNIGTRIYIDSNILIRQKYEATVKAYYDTDVISANLSDAQPVVQAIN  194
            +L  LQ      IL +  RIY++    + Q Y   V+  + ++  S +L++     + IN
Sbjct  81   LLNDLQGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTNGPVAAERIN  140

Query  195  DWVSNITDANIDQMIKDENNVKNSLMLIMNTLFFKGSWRRKYFSPENTRTGKFYTIDNRT  254
             WV + T   I  MI   +   +   L++N ++FKG W  K F P  TR   F    N++
Sbjct  141  QWVLDQTSGKIKGMIDPGSMTSDVKALLVNAIYFKGQWESK-FDPAKTRASTFQVTANKS  199

Query  255  IDVPFMHTFGRFYYANSPELDATILRIPYDGRKFALYLLLPRNKTLDGIEHLVNEVTPFV  314
            + V  M   G F      +LDA ++ +PY     ++ + LPR   ++G+  L  ++  F 
Sbjct  200  VPVQMMAQMGTFRANYFRDLDAQVIELPYLNSNLSMTIFLPRE--VEGLSALEEKIVGFA  257

Query  315  LTRYVWQMQNLPIAVTIPKFKYQFSSHMEPVLREVGIRNIFDDTATLTGIAQTRRISSNL  374
                  +     + + +PKFK +F   ++  L ++GIR +F D + L+G+   +   S  
Sbjct  258  RPLVAKE-----VYLKLPKFKIEFRDELKETLEKLGIRELFTDKSDLSGLFADK---SGG  309

Query  375  KVSDILQKTGIEVNENGTTAYVATEVDIGNKIGEEIF-HADHPFVFYIEDESTGTVIYIG  433
            KVS +  K  +EVNE G  A  AT V + N+ G   F  ADHPF F I D    T+ + G
Sbjct  310  KVSQVSHKAFLEVNEEGAEAAGATSVAVTNRAGFSTFLMADHPFAFVIRD--ANTIYFQG  367

Query  434  RMMNP  438
            R+++P
Sbjct  368  RVVSP  372


 Score = 172 bits (437),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 108/360 (30%), Positives = 173/360 (48%), Gaps = 12/360 (3%)

Query  489  QALTKKYKDGNLVSSPASVKTILTMLMEGANGNTKSEIISVLRLP-EGKSRRGELAQRIL  547
            Q L+K + + NLV SP S++TIL+M+  GA G+T  E+ S L LP E K         +L
Sbjct  23   QLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALGLPSEDKEAVAARYGALL  82

Query  548  ASLNRNENGTEIALTTRLWIHENLRVSNNYKNILRSRYQGDIESVNFMESQSTARHINEW  607
              L   E G  + L  R+++++   ++ NY   +R  ++ + ES++       A  IN+W
Sbjct  83   NDLQGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTNGPVAAERINQW  142

Query  608  VRRVTHNTISSALLLNELPPDTRLILTSVIYFKGLWLKSFDKANTKLQCFYIPNGECRNT  667
            V   T   I   +    +  D + +L + IYFKG W   FD A T+   F +   +    
Sbjct  143  VLDQTSGKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTFQVTANKSVPV  202

Query  668  YFMKHGSIYRYAYIPSIEAHVLEIPYSDGKTSMLTLMPRSRKNDPYLRILSDDLITVPVS  727
              M     +R  Y   ++A V+E+PY +   SM   +PR  +    L  L + ++     
Sbjct  203  QMMAQMGTFRANYFRDLDAQVIELPYLNSNLSMTIFLPREVEG---LSALEEKIV-----  254

Query  728  AILANLKKQDITIHLPKFNIENNLDLVPTLRHLGIENIFQPNTNLSKMISD-SSIHVASI  786
                 L  +++ + LPKF IE   +L  TL  LGI  +F   ++LS + +D S   V+ +
Sbjct  255  GFARPLVAKEVYLKLPKFKIEFRDELKETLEKLGIRELFTDKSDLSGLFADKSGGKVSQV  314

Query  787  LQNVKLEIDEEGTLAATDTEIGYKLLSSWSNDVKMDRPFLFMIIDSVLNMTLFSGRFIEP  846
                 LE++EEG  AA  T +     + +S  +  D PF F+I D+  N   F GR + P
Sbjct  315  SHKAFLEVNEEGAEAAGATSVAVTNRAGFSTFLMADHPFAFVIRDA--NTIYFQGRVVSP  372


>Q7KA66_DROME unnamed protein product
Length=390

 Score = 169 bits (428),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 108/373 (29%), Positives = 198/373 (53%), Gaps = 19/373 (5%)

Query  71   NIFDWALFRTMS-KKYSGNMLLSPISLKIVLVLLYEGAQDETAHELATAMQLPANE--NV  127
            N+F   LF+T++  +   N+++SP+S+++ L L Y GA+  TA EL   +   A E  + 
Sbjct  28   NLFATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKTLHASAKESKDG  87

Query  128  IRKRFSTILQSLQSNPPAYILNIGTRIYIDSNILIRQKYEATVKAYYDTDVISANLSDAQ  187
            + + +  +L S   +    +L I  ++Y   N+ +   +    + Y+D++V   + S   
Sbjct  88   LAESYHNLLHSYIKSKT--VLEIANKVYTRQNLTVSSHFREVAQKYFDSEVEPLDFSRET  145

Query  188  PVVQAINDWVSNITDANIDQMIKDENNVKNSLMLIMNTLFFKGSWRRKYFSPENTRTGKF  247
              V+ IN WV   T+  I++++  E+   ++ + ++N ++FK  W R  F+ E+TR  +F
Sbjct  146  EAVEQINRWVKQQTENKIERVV--ESLEPDTNVALVNAIYFKARWARP-FNDEDTRDREF  202

Query  248  YTIDNRTIDVPFMHTFGRFYYANSPELDATILRIPYDGRKFALYLLLPRNKT-LDGIEHL  306
            +  ++R+I VP M     +YYA+ PELDA  + + ++     ++ +LP  ++ L  +E  
Sbjct  203  WLSESRSIQVPTMFADNWYYYADYPELDAKAIELFFENINLTMWFILPNQRSGLQALEQK  262

Query  307  VNEVTPFVLTRYVWQMQNLPIAVTIPKFKYQFSSHMEPVLREVGIRNIFDDTATLTGIAQ  366
            +  V  F L    WQ Q+  ++V +PKFK++F + + P L ++GI  +F D A  + I Q
Sbjct  263  LKGVD-FNLLEDRWQWQS--VSVYLPKFKFEFDTDLRPTLHKMGISAMFSDAADFSNIFQ  319

Query  367  TRRISSNLKVSDILQKTGIEVNENGTTAY---VATEVDIGNKIGEEIFHADHPFVFYIED  423
               I +  +++ +  KT I+VNE G  A     A  V +   +  + F ADHPF F I D
Sbjct  320  DSPIGT--RITKVQHKTFIDVNEIGCEAAGASYAAGVPMSLPLDPKTFVADHPFAFIIRD  377

Query  424  ESTGTVIYIGRMM  436
            +    V + G ++
Sbjct  378  KH--AVYFTGHIV  388


 Score = 142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 104/402 (26%), Positives = 187/402 (47%), Gaps = 37/402 (9%)

Query  459  LNAGISSADSISQAGLNAEDRNNLFNMYFPQALTKKYKDGNLVSSPASVKTILTMLMEGA  518
            L   IS+ + +   G   +DRN LF     Q L    +D N++ SP S++  L +   GA
Sbjct  10   LGVWISAPEGL---GNTIKDRN-LFATELFQTLATDRQDENVIISPVSIQLALGLAYYGA  65

Query  519  NGNTKSEIISVLRLPEGKSRRG--ELAQRILASLNRNENGTEIALTTRLWIHENLRVSNN  576
             G T +E+   L     +S+ G  E    +L S  +++   EIA   +++  +NL VS++
Sbjct  66   EGRTAAELQKTLHASAKESKDGLAESYHNLLHSYIKSKTVLEIA--NKVYTRQNLTVSSH  123

Query  577  YKNILRSRYQGDIESVNFMESQSTARHINEWVRRVTHNTISSALLLNELPPDTRLILTSV  636
            ++ + +  +  ++E ++F         IN WV++ T N I    ++  L PDT + L + 
Sbjct  124  FREVAQKYFDSEVEPLDFSRETEAVEQINRWVKQQTENKIER--VVESLEPDTNVALVNA  181

Query  637  IYFKGLWLKSFDKANTKLQCFYIPNGECRNTYFMKHGSIYRYAYIPSIEAHVLEIPYSDG  696
            IYFK  W + F+  +T+ + F++          M   + Y YA  P ++A  +E+ + + 
Sbjct  182  IYFKARWARPFNDEDTRDREFWLSESRSIQVPTMFADNWYYYADYPELDAKAIELFFENI  241

Query  697  KTSMLTLMPRSRKNDPYLRILSDDLITVPVSAILANLKKQDITIHLPKFNIENNLDLVPT  756
              +M  ++P  R     L+ L   L  V  + +    + Q ++++LPKF  E + DL PT
Sbjct  242  NLTMWFILPNQRSG---LQALEQKLKGVDFNLLEDRWQWQSVSVYLPKFKFEFDTDLRPT  298

Query  757  LRHLGIENIFQPNTNLSKMISDSSI--HVASILQNVKLEIDEEGTLAATDTEIGYKLLSS  814
            L  +GI  +F    + S +  DS I   +  +     ++++E G  AA          +S
Sbjct  299  LHKMGISAMFSDAADFSNIFQDSPIGTRITKVQHKTFIDVNEIGCEAAG---------AS  349

Query  815  WSNDVKM-----------DRPFLFMIIDSVLNMTLFSGRFIE  845
            ++  V M           D PF F+I D   +   F+G  ++
Sbjct  350  YAAGVPMSLPLDPKTFVADHPFAFIIRDK--HAVYFTGHIVK  389



Lambda      K        H
   0.331    0.143    0.476 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2966327756


Query= XP_003393034.1 cytochrome b-c1 complex subunit 9 [Bombus terrestris]

Length=56
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CAD96_DROME  unnamed protein product                                  25.0    3.6  
TOP1_DROME  unnamed protein product                                   25.0    4.1  
5NTC_DICDI  unnamed protein product                                   24.3    7.7  


>CAD96_DROME unnamed protein product
Length=773

 Score = 25.0 bits (53),  Expect = 3.6, Method: Composition-based stats.
 Identities = 13/25 (52%), Positives = 17/25 (68%), Gaps = 2/25 (8%)

Query  21   ATFFFERGFDMIGDKIFDRLNEGKL  45
            A F F R  D+I  KI++R +EGKL
Sbjct  627  ADFGFAR--DVITSKIYERKSEGKL  649


>TOP1_DROME unnamed protein product
Length=972

 Score = 25.0 bits (53),  Expect = 4.1, Method: Composition-based stats.
 Identities = 11/22 (50%), Positives = 14/22 (64%), Gaps = 0/22 (0%)

Query  33   GDKIFDRLNEGKLWKHIKHQYE  54
            GD +FDRLN   L +H+K   E
Sbjct  783  GDDLFDRLNTQVLNEHLKELME  804


>5NTC_DICDI unnamed protein product
Length=592

 Score = 24.3 bits (51),  Expect = 7.7, Method: Composition-based stats.
 Identities = 11/32 (34%), Positives = 17/32 (53%), Gaps = 0/32 (0%)

Query  7    FFKRSSTFTLGILAATFFFERGFDMIGDKIFD  38
            FF     +TL +  +  F E  +DM+ DK+ D
Sbjct  118  FFGFDMDYTLAVYNSPDFEELAYDMVLDKLID  149



Lambda      K        H
   0.331    0.143    0.476 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2966327756


Query= XP_003393035.1 group XV phospholipase A2 [Bombus terrestris]

Length=407
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

C6KTC8_PLAF7  unnamed protein product                                 102     3e-23
Q17936_CAEEL  unnamed protein product                                 32.0    0.93 
Q585D5_TRYB2  unnamed protein product                                 30.4    3.1  


>C6KTC8_PLAF7 unnamed protein product
Length=863

 Score = 102 bits (254),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 110/420 (26%), Positives = 183/420 (44%), Gaps = 64/420 (15%)

Query  34   LVPGDGGSQVEAKINKTTVVHYLCEK--VSAEYFNIWLNLELLVPVI--IDCWIDNMKLT  89
            L+PG GGS + A+    T+  + C +  ++++ F IW++L  L+ +   I C  D ++L 
Sbjct  448  LLPGLGGSTLIAEYKNATI--HSCSRYLLNSKPFRIWISLSRLLSIQSNIYCTFDTIRLK  505

Query  90   YDNITRTTRNQDGVDIRIPGWGDPFVVEYLD---PSKASPGAYFKDIGNMLVNQLGYVRN  146
            YD       NQ GV I +  +G+   +EYLD    +      YF  +G    +  GYV  
Sbjct  506  YDEKKNIYYNQPGVFIDVEKFGNLKGIEYLDYFNNTGIGITKYFNVVGQYFTSH-GYVDG  564

Query  147  HSLRGAPYDFRKAPNENEMFFNRLKDLVEETYNNNNQVPVTLLAHSMGGPMSLIFLQR-Q  205
             S+ GAPYD+R   ++    +  LK+ +E  Y   N   V L+ HS+GG     FL R  
Sbjct  565  ESIIGAPYDWRYPLSQQN--YKILKEHIEYIYEKRNGTKVNLIGHSLGGLYLNFFLSRVV  622

Query  206  SQKWKDKYINCLITLSAVWGGSVKALKVFAVG-DDLGAYLLR--------QSILKDEQIT  256
            S+KWK K+++ +I +S  + GSVK ++       D  ++ +         +S++K    +
Sbjct  623  SKKWKQKHLSKIIFISTPFKGSVKTIRALIQSRKDFISFRITKLIKLSIPESMMKALGNS  682

Query  257  SPSLGWLLPSRLFWKDTEILV------------------------------QSEQKNYTL  286
              SL  +LP R ++K  ++++                                   N  +
Sbjct  683  LGSLFDILPYREYYKRDQVVILINMSNTPIDEDHVQYLVTLCGIYKPECYRNRADVNLKV  742

Query  287  LTLQDY--LIDINVPNGWEFRK--DNEKYQLDFTAPEVEVHCLYGS-GIDTVEKLYYKPG  341
             TL+++  L+D  +   +E  K      Y  D   P   ++CLY +      E L Y   
Sbjct  743  YTLKNWHELLDDKLKAKYENYKLYRERYYNKDHGVP---IYCLYSTINKKETEYLLYFET  799

Query  342  ISIEGTPQLIPGDGDGTVNLRSLEGCKYWQGKQKRKVYSQVFPGVNHMEILNNSSVLNYI  401
             +    P +  G GDGTV   SL+ C  +       V +  F   +H+ IL  +    YI
Sbjct  800  QNTREEPTIYYGTGDGTVGTESLQACSNF----YNTVLTHHFSDTSHVGILYTNETAKYI  855


>Q17936_CAEEL unnamed protein product
Length=611

 Score = 32.0 bits (71),  Expect = 0.93, Method: Compositional matrix adjust.
 Identities = 18/65 (28%), Positives = 29/65 (45%), Gaps = 3/65 (5%)

Query  304  FRKDNEKYQLDFTAPEVEVHCLYGSGIDTVEKLYYKPGISIEGTPQLIPGDGDGTVNLRS  363
            F  DNE     +  PE  V  + G G   ++ +  K G  ++ +P   P  G   V + +
Sbjct  63   FMDDNEAVNEKYPIPESAVGIVIGRGGSEIQGIQAKAGCRVQMSPDADPSSG---VRMVT  119

Query  364  LEGCK  368
            LEG +
Sbjct  120  LEGSR  124


>Q585D5_TRYB2 unnamed protein product
Length=739

 Score = 30.4 bits (67),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 20/61 (33%), Positives = 30/61 (49%), Gaps = 4/61 (7%)

Query  3    LYLVIYTIISLSCFISVKSWHSRNKQISPVILVPGD---GGSQVEAKINKTTVVHYLCEK  59
            L L++Y I SLS    V+    R +    V+L+P D   GG+ +E  +      HY C K
Sbjct  253  LTLLLYDISSLSALCRVRQSTRRTRIRFSVLLLPDDLAYGGALLEESLRGPMSCHY-CVK  311

Query  60   V  60
            +
Sbjct  312  L  312



Lambda      K        H
   0.331    0.143    0.476 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2966327756


Query= XP_003393036.1 TBC1 domain family member 20 isoform X2 [Bombus
terrestris]

Length=453
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9W5H8_DROME  unnamed protein product                                 166     6e-47
A0A0B4KEC2_DROME  unnamed protein product                             163     7e-46
A0A0B4KEH8_DROME  unnamed protein product                             156     2e-43


>Q9W5H8_DROME unnamed protein product
Length=378

 Score = 166 bits (420),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 104/328 (32%), Positives = 162/328 (49%), Gaps = 4/328 (1%)

Query  95   RERMKISVIRGSVANPNLTLGELKLLGCSSEGLVNDDIRRALWPTLLRLSEETTFSINGL  154
            ++R++I  +     + N++   L  L  +  GLVNDD RR LWP L  +          L
Sbjct  22   KKRLEIEKLINKNIDKNISFDVLVKLSLAPYGLVNDDFRRILWPQLAGVDINHLGQAPTL  81

Query  155  ETIHSHIPNEVYQQILKDVARSGSHISQNATQHEIDHFHEQLTQLMCWVLHKHSMLNYYQ  214
            +    H P   Y Q++ DV RS           +     +QLT L+  V+ K+  L YYQ
Sbjct  82   DKFQCH-PE--YNQVVLDVNRSLKRFPPGIPYEQRIALQDQLTVLILRVIQKYPNLRYYQ  138

Query  215  GYNDIAATVLLVMGLEKGLRVLESISLEFLERFMEKTMEKVNQELFYIFALLERVHPTLL  274
            GY+D+A T LLV+G E    ++E +S       M++TME   + L +I+ +++  +P L 
Sbjct  139  GYHDVAVTFLLVVGEEIAFAIMEQLSTTHFSECMQETMEATQRRLMFIWPIIKFENPELY  198

Query  275  EHLENVELFPHFALAEYTTWYAHKYAENRKLLHRLFDYFLGSPPLMPLYLSTVIVAHRAT  334
            + L+N  +   F+L  Y TW+ H     R ++ RL+DYFL SP    ++++  I+ +R+ 
Sbjct  199  QFLQNSTVGTLFSLPWYLTWFGHSLTSYRTVV-RLYDYFLASPIYTSIFVTAAILLYRSD  257

Query  335  EIFNTTPDMGHTHKVLCTLPDDLPFETLLVEAKNLYREYPPESISNDVREFDRKRKCKEQ  394
            EI     DM   H +L  +P+DLPFE LL  + +L  +Y    I  DV E   + + K +
Sbjct  258  EILKEDCDMASVHCLLSVIPEDLPFEDLLKTSSSLLNKYSLTLIEKDVEELICQERRKRK  317

Query  395  EWKAKAEASRQEREKQRQLRIVKSAPRI  422
              +A     RQ     R   I K  P I
Sbjct  318  TDEALIVKRRQPATSNRIPIITKWLPNI  345


>A0A0B4KEC2_DROME unnamed protein product
Length=376

 Score = 163 bits (413),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 108/331 (33%), Positives = 164/331 (50%), Gaps = 12/331 (4%)

Query  95   RERMKISVIRGSVANPNLTLGELKLLGCSSEGLVNDDIRRALWPTLLRLSEETTFSINGL  154
            ++R++I  +     + N++   L  L  +  GLVNDD RR LWP L  +          L
Sbjct  22   KKRLEIEKLINKNIDKNISFDVLVKLSLAPYGLVNDDFRRILWPQLAGVDINHLGQAPTL  81

Query  155  ETIHSHIPNEVYQQILKDVARSGSHISQNATQHEIDHFHEQLTQLMCWVLHKHSMLNYYQ  214
            +    H P   Y Q++ DV RS           +     +QLT L+  V+ K+  L YYQ
Sbjct  82   DKFQCH-PE--YNQVVLDVNRSLKRFPPGIPYEQRIALQDQLTVLILRVIQKYPNLRYYQ  138

Query  215  GYNDIAATVLLVMGLEKGLRVLESISLEFLERFMEKTMEKVNQELFYIFALLERVHPTLL  274
            GY+D+A T LLV+G E    ++E +S       M++TME   + L +I+ +++  +P L 
Sbjct  139  GYHDVAVTFLLVVGEEIAFAIMEQLSTTHFSECMQETMEATQRRLMFIWPIIKFENPELY  198

Query  275  EHLENVELFPHFALAEYTTWYAHKYAENRKLLHRLFDYFLGSPPLMPLYLSTVIVAHRAT  334
            + L+N  +   F+L  Y TW+ H     R ++ RL+DYFL SP    ++++  I+ +R+ 
Sbjct  199  QFLQNSTVGTLFSLPWYLTWFGHSLTSYRTVV-RLYDYFLASPIYTSIFVTAAILLYRSD  257

Query  335  EIFNTTPDMGHTHKVLCTLPDDLPFETLLVEAKNLYREYPPESISNDVREF---DRKRKC  391
            EI     DM   H +L ++P+DLPFE LL  + +L  +Y    I  DV E    +RKRK 
Sbjct  258  EILKEDCDMASVHCLL-SIPEDLPFEDLLKTSSSLLNKYSLTLIEKDVEELICQERKRKT  316

Query  392  KEQEWKAKAEASRQEREKQRQLRIVKSAPRI  422
             E    A     RQ     R   I K  P I
Sbjct  317  DE----ALIVKRRQPATSNRIPIITKWLPNI  343


>A0A0B4KEH8_DROME unnamed protein product
Length=371

 Score = 156 bits (395),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 102/328 (31%), Positives = 160/328 (49%), Gaps = 11/328 (3%)

Query  95   RERMKISVIRGSVANPNLTLGELKLLGCSSEGLVNDDIRRALWPTLLRLSEETTFSINGL  154
            ++R++I  +     + N++   L  L  +  GLVNDD RR LWP L  +          L
Sbjct  22   KKRLEIEKLINKNIDKNISFDVLVKLSLAPYGLVNDDFRRILWPQLAGVDINHLGQAPTL  81

Query  155  ETIHSHIPNEVYQQILKDVARSGSHISQNATQHEIDHFHEQLTQLMCWVLHKHSMLNYYQ  214
            +    H P   Y Q++ DV RS           +     +QLT L+  V+ K+  L YYQ
Sbjct  82   DKFQCH-PE--YNQVVLDVNRSLKRFPPGIPYEQRIALQDQLTVLILRVIQKYPNLRYYQ  138

Query  215  GYNDIAATVLLVMGLEKGLRVLESISLEFLERFMEKTMEKVNQELFYIFALLERVHPTLL  274
            GY+D+A T LLV+G E    ++E +S       M++TME   + L +I+ +++  +P L 
Sbjct  139  GYHDVAVTFLLVVGEEIAFAIMEQLSTTHFSECMQETMEATQRRLMFIWPIIKFENPELY  198

Query  275  EHLENVELFPHFALAEYTTWYAHKYAENRKLLHRLFDYFLGSPPLMPLYLSTVIVAHRAT  334
            + L+N  +   F+L  Y TW+ H     R ++ RL+DYFL SP    ++++  I+ +R+ 
Sbjct  199  QFLQNSTVGTLFSLPWYLTWFGHSLTSYRTVV-RLYDYFLASPIYTSIFVTAAILLYRSD  257

Query  335  EIFNTTPDMGHTHKVLCTLPDDLPFETLLVEAKNLYREYPPESISNDVREFDRKRKCKEQ  394
            EI     DM        ++P+DLPFE LL  + +L  +Y    I  DV E   + + K +
Sbjct  258  EILKEDCDMA-------SIPEDLPFEDLLKTSSSLLNKYSLTLIEKDVEELICQERRKRK  310

Query  395  EWKAKAEASRQEREKQRQLRIVKSAPRI  422
              +A     RQ     R   I K  P I
Sbjct  311  TDEALIVKRRQPATSNRIPIITKWLPNI  338



Lambda      K        H
   0.331    0.143    0.476 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2966327756


Query= XP_003393038.1 suppressor of cytokine signaling 5 [Bombus
terrestris]

Length=516
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VJA1_DROME  unnamed protein product                                 275     5e-85
Q86P82_DROME  unnamed protein product                                 275     6e-85
Q8INY1_DROME  unnamed protein product                                 275     4e-84


>Q9VJA1_DROME unnamed protein product
Length=633

 Score = 275 bits (703),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 141/171 (82%), Gaps = 0/171 (0%)

Query  328  AHTQVDYVHCLVPDLRSITACSFYWGKMDRYEAERLLEGKQEGTFLLRDSAQEEFIFSVS  387
             H+Q+D++HCLVPDL  IT  SFYWGKMDRYEAE LLEGK EGTFLLRDSAQEEF+FSV+
Sbjct  452  VHSQIDFMHCLVPDLEKITNSSFYWGKMDRYEAEHLLEGKPEGTFLLRDSAQEEFLFSVT  511

Query  388  FRKYGRSLHARIEQWNHKFSFDSHDPGVYASETVCGLIEHYKHPSCSMFFEPMLTIPFHR  447
            FRKYGRSLHARIEQ  HKFSFD HDP V+ + TV GL+EHYK P+C MFFEP LTIP HR
Sbjct  512  FRKYGRSLHARIEQSGHKFSFDCHDPCVFTAPTVTGLLEHYKDPACVMFFEPCLTIPLHR  571

Query  448  NFAFPLQHLCRAVITTRTTYDGINKLQLPKTLKSYLKEYHYKQRVRVRRLD  498
               F LQ L RA I + T+YDGIN+++LP  LKSYLKEYHYKQ++RV+ +D
Sbjct  572  RQTFSLQQLSRATIVSNTSYDGINQMELPGRLKSYLKEYHYKQKLRVKPID  622


>Q86P82_DROME unnamed protein product
Length=634

 Score = 275 bits (703),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 141/171 (82%), Gaps = 0/171 (0%)

Query  328  AHTQVDYVHCLVPDLRSITACSFYWGKMDRYEAERLLEGKQEGTFLLRDSAQEEFIFSVS  387
             H+Q+D++HCLVPDL  IT  SFYWGKMDRYEAE LLEGK EGTFLLRDSAQEEF+FSV+
Sbjct  453  VHSQIDFMHCLVPDLEKITNSSFYWGKMDRYEAEHLLEGKPEGTFLLRDSAQEEFLFSVT  512

Query  388  FRKYGRSLHARIEQWNHKFSFDSHDPGVYASETVCGLIEHYKHPSCSMFFEPMLTIPFHR  447
            FRKYGRSLHARIEQ  HKFSFD HDP V+ + TV GL+EHYK P+C MFFEP LTIP HR
Sbjct  513  FRKYGRSLHARIEQSGHKFSFDCHDPCVFTAPTVTGLLEHYKDPACVMFFEPCLTIPLHR  572

Query  448  NFAFPLQHLCRAVITTRTTYDGINKLQLPKTLKSYLKEYHYKQRVRVRRLD  498
               F LQ L RA I + T+YDGIN+++LP  LKSYLKEYHYKQ++RV+ +D
Sbjct  573  RQTFSLQQLSRATIVSNTSYDGINQMELPGRLKSYLKEYHYKQKLRVKPID  623


>Q8INY1_DROME unnamed protein product
Length=737

 Score = 275 bits (704),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 141/171 (82%), Gaps = 0/171 (0%)

Query  328  AHTQVDYVHCLVPDLRSITACSFYWGKMDRYEAERLLEGKQEGTFLLRDSAQEEFIFSVS  387
             H+Q+D++HCLVPDL  IT  SFYWGKMDRYEAE LLEGK EGTFLLRDSAQEEF+FSV+
Sbjct  452  VHSQIDFMHCLVPDLEKITNSSFYWGKMDRYEAEHLLEGKPEGTFLLRDSAQEEFLFSVT  511

Query  388  FRKYGRSLHARIEQWNHKFSFDSHDPGVYASETVCGLIEHYKHPSCSMFFEPMLTIPFHR  447
            FRKYGRSLHARIEQ  HKFSFD HDP V+ + TV GL+EHYK P+C MFFEP LTIP HR
Sbjct  512  FRKYGRSLHARIEQSGHKFSFDCHDPCVFTAPTVTGLLEHYKDPACVMFFEPCLTIPLHR  571

Query  448  NFAFPLQHLCRAVITTRTTYDGINKLQLPKTLKSYLKEYHYKQRVRVRRLD  498
               F LQ L RA I + T+YDGIN+++LP  LKSYLKEYHYKQ++RV+ +D
Sbjct  572  RQTFSLQQLSRATIVSNTSYDGINQMELPGRLKSYLKEYHYKQKLRVKPID  622



Lambda      K        H
   0.331    0.143    0.476 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2966327756


Query= XP_003393040.1 bis(5'-nucleosyl)-tetraphosphatase [asymmetrical]
[Bombus terrestris]

Length=141
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

AP4A_CAEEL  unnamed protein product                                   149     4e-47
C0H4F3_PLAF7  unnamed protein product                                 74.7    9e-18
Q9VUU4_DROME  unnamed protein product                                 35.0    0.013


>AP4A_CAEEL unnamed protein product
Length=138

 Score = 149 bits (376),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 95/136 (70%), Gaps = 1/136 (1%)

Query  1    MTTRACGFVVFRRVQGIIEYLLMQVSYGTHHWTPPKGHVDPGESDMEAALRETEEEAGLL  60
            M  +A G V++R++ G IE+LL+Q SY  HHWTPPKGHVDPGE + +AA+RET+EEA + 
Sbjct  1    MVVKAAGLVIYRKLAGKIEFLLLQASYPPHHWTPPKGHVDPGEDEWQAAIRETKEEANIT  60

Query  61   VNDLNIFENVKEEQNYKANGKPKVVIYWLAELLDPKKPIRLSHEHQAFKWLPLEEACSVA  120
               L I E+  E   Y+A GKPK V YWLA+L +P   ++LSHEHQ +KW  LE+A  +A
Sbjct  61   KEQLTIHEDCHETLFYEAKGKPKSVKYWLAKLNNPDD-VQLSHEHQNWKWCELEDAIKIA  119

Query  121  KYEEMQNTLRNFNDYI  136
             Y EM + LR F+ ++
Sbjct  120  DYAEMGSLLRKFSAFL  135


>C0H4F3_PLAF7 unnamed protein product
Length=152

 Score = 74.7 bits (182),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 67/121 (55%), Gaps = 1/121 (1%)

Query  18   IEYLLMQVSYGTHHWTPPKGHVDPGESDMEAALRETEEEAGLLVNDLNIFENVKEEQNYK  77
             E+L ++ SY   HWTPPKG  +  ES +E A+RET EE G+  +   +  N ++   Y 
Sbjct  30   FEFLFLKASYADKHWTPPKGLHENNESGLETAVRETLEETGINKDKYKLL-NYQKTLKYN  88

Query  78   ANGKPKVVIYWLAELLDPKKPIRLSHEHQAFKWLPLEEACSVAKYEEMQNTLRNFNDYIL  137
               KPK   Y+LA LL+ ++ + LS EH  +KW+   E+ +    E + + L+   +++ 
Sbjct  89   VKDKPKETTYYLAMLLNNEENVILSDEHTDYKWIGSHESDTYNLPESLADLLKEAEEFLN  148

Query  138  K  138
            K
Sbjct  149  K  149


>Q9VUU4_DROME unnamed protein product
Length=791

 Score = 35.0 bits (79),  Expect = 0.013, Method: Composition-based stats.
 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 0/44 (0%)

Query  21   LLMQVSYGTHHWTPPKGHVDPGESDMEAALRETEEEAGLLVNDL  64
            LL+Q  +  + W  PKG ++  E     A RE  EE G  + DL
Sbjct  326  LLVQSYFARNSWGFPKGKINENEDPAHCATREVYEETGFDITDL  369



Lambda      K        H
   0.331    0.143    0.476 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2966327756


Query= XP_003393042.1 uncharacterized protein LOC100645359 isoform X1
[Bombus terrestris]

Length=371
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9V9S0_DROME  unnamed protein product                                 47.4    8e-06
Q8SZP0_DROME  unnamed protein product                                 46.6    2e-05
Q580M4_TRYB2  unnamed protein product                                 32.3    0.58 


>Q9V9S0_DROME unnamed protein product
Length=318

 Score = 47.4 bits (111),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 50/209 (24%), Positives = 91/209 (44%), Gaps = 20/209 (10%)

Query  160  GNNGQACILLQVDALITVKYRTKKGEDDEANIYVPTDATVT-GNCDNENTVTMLLKWDAY  218
            G    +CI+LQ+ A +   Y  ++G        +P++A+V    C ++ T  + L W   
Sbjct  109  GAWNTSCIMLQMAAQLNFTYEAREGNFTTGLYNIPSNASVEDAECKSQTTQFIHLIWGPE  168

Query  219  I----LSWSFAKTPGGERWYVEKIELTYNSSDRHFVNIDQPNKTIRLSTGQKHSSMLFPT  274
                 L   F K+         +I L     D  F +  + N+T++L T    S   F T
Sbjct  169  TSKQSLIMYFNKSNDTTVLSFMQIHLALLPED--FPDAKE-NQTVQLIT---RSDGAFKT  222

Query  275  PVGKSYACSEETEVQLTDGKNHAIVL----LRDMKLQPFKFKNNE-FAVEFSCTSLSARG  329
            P   SY C+   ++ +T+  +   ++    +  ++++ F+  N+  F+V   C S     
Sbjct  223  PENMSYHCTRVQKINMTETLDAEQLIGWISVSHVQVEAFRRANDTGFSVGHDCDSSET--  280

Query  330  FRDETAPVAVGSTLAAAVLLTITGYAAYR  358
               +  P+AVG  LAA +L+ +  Y   R
Sbjct  281  --SDVVPIAVGIALAALILVVLISYLCAR  307


>Q8SZP0_DROME unnamed protein product
Length=318

 Score = 46.6 bits (109),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 50/209 (24%), Positives = 91/209 (44%), Gaps = 20/209 (10%)

Query  160  GNNGQACILLQVDALITVKYRTKKGEDDEANIYVPTDATVT-GNCDNENTVTMLLKWDAY  218
            G    +CI+LQ+ A +   Y  ++G        +P++A+V    C ++ T  + L W   
Sbjct  109  GAWNTSCIMLQMAAQLNFTYEAREGNFTTGLDNIPSNASVEDAECKSQTTQFIHLIWGPE  168

Query  219  I----LSWSFAKTPGGERWYVEKIELTYNSSDRHFVNIDQPNKTIRLSTGQKHSSMLFPT  274
                 L   F K+         +I L     D  F +  + N+T++L T    S   F T
Sbjct  169  TSKQSLIMYFNKSNDTTVLSFMQIHLALLPED--FPDAKE-NQTVQLIT---RSDGAFKT  222

Query  275  PVGKSYACSEETEVQLTDGKNHAIVL----LRDMKLQPFKFKNNE-FAVEFSCTSLSARG  329
            P   SY C+   ++ +T+  +   ++    +  ++++ F+  N+  F+V   C S     
Sbjct  223  PENMSYHCTRVQKINMTETLDAEQLIGWISVSHVQVEAFRRANDTGFSVGHDCDSSET--  280

Query  330  FRDETAPVAVGSTLAAAVLLTITGYAAYR  358
               +  P+AVG  LAA +L+ +  Y   R
Sbjct  281  --SDVVPIAVGIALAALILVVLISYLCAR  307


>Q580M4_TRYB2 unnamed protein product
Length=408

 Score = 32.3 bits (72),  Expect = 0.58, Method: Compositional matrix adjust.
 Identities = 19/60 (32%), Positives = 32/60 (53%), Gaps = 1/60 (2%)

Query  125  LVGNLNEAKSTTTMSSESTTTHRS-SSVEQPLYRLDGNNGQACILLQVDALITVKYRTKK  183
            ++G+++ A +   + S   TTH+   SV  PLYR DG  G +C   +  +  ++  RT K
Sbjct  115  IIGSIDMAAAINVLRSRLGTTHKKVMSVGSPLYRRDGKGGCSCKSPRASSPGSMTSRTFK  174



Lambda      K        H
   0.331    0.143    0.476 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2966327756


Query= XP_003393044.1 uncharacterized protein LOC100645477 isoform X2
[Bombus terrestris]

Length=230
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q57ZT5_TRYB2  unnamed protein product                                 186     2e-58
Q55AK6_DICDI  unnamed protein product                                 92.4    3e-21
Q583Q5_TRYB2  unnamed protein product                                 32.0    0.35 


>Q57ZT5_TRYB2 unnamed protein product
Length=265

 Score = 186 bits (471),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 82/179 (46%), Positives = 127/179 (71%), Gaps = 2/179 (1%)

Query  49   MNLEKVEKVE--EEMAKKISIWQGDITSLEIDAIVNAANSSLLGGGGVDGAIHKAAGPNL  106
            + +E++  V+  + + + I++++G +T L++DAIVNAAN+  LGGGGVDGAIH+ AGP L
Sbjct  84   VTIEQLRPVDPSDAILRHIALYRGPVTDLQLDAIVNAANTRCLGGGGVDGAIHRVAGPLL  143

Query  107  KKECATLGGCRVGEAKITGAYMLPAKHVIHTVGPQGEKPEKLKECYENSLTVARANELRT  166
             +ECAT  GC+ GE ++T  Y LPA++V+HTVGP GEKP+ L++CY + L++A  N LR+
Sbjct  144  LRECATFNGCQTGECRLTKGYQLPARYVLHTVGPVGEKPDMLRKCYRSILSLALKNGLRS  203

Query  167  IAFPCISTGIYGYPQKPAAKVALSTVKKFLLDNKDSVDRVIFCLFLKSDKDIYEELLQK  225
            I F C+STG+YGYP  PA ++AL   +KFL ++  ++D   F  F + +   YE+ + +
Sbjct  204  IGFCCVSTGVYGYPLLPATRIALGETRKFLEEHGGALDMCCFACFQEDEYKTYEKCVGR  262


>Q55AK6_DICDI unnamed protein product
Length=1618

 Score = 92.4 bits (228),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 79/250 (32%), Positives = 121/250 (48%), Gaps = 28/250 (11%)

Query  1     MSFEVEKQKFLTMPLEEKRKYYKGSV----ITLDQIPTWVEYWTKNKGNIGIMNLEKVE-  55
             +S + E  K + + L +++  Y+ S+    IT+D+I   + +  K  G +       VE 
Sbjct  841   ISGDPENIKIIYLELLKEKYSYENSIETRAITIDKIRHDILFDLKKVGKLQKETFTLVEL  900

Query  56    KVEEEM--------AKKISIWQGDITSLEIDAIVNAANSSLLGGGGVDGAIHKAAGPNLK  107
             KVE E          K I I +GDIT  +  AIVN AN  L   GG   +I +AAG   K
Sbjct  901   KVENETIISLNLSNGKIIRIIKGDITKQKTHAIVNPANEKLKNLGGAAFSIQEAAGATFK  960

Query  108   KECATL--------GGCRVGEAKITGAYMLPAKHVIHTVGPQGEKPEK---LKECYENSL  156
             + C +          GC V  +K     +     VI+TVGP+ + P K   L     +SL
Sbjct  961   EFCESYYEKNGPIGTGCSVYGSKFKMGNIF----VINTVGPKNDNPNKARILHMSIHSSL  1016

Query  157   TVARANELRTIAFPCISTGIYGYPQKPAAKVALSTVKKFLLDNKDSVDRVIFCLFLKSDK  216
               A A   ++I+ P ISTGI+GY  K A  + + +  +FLL N+ +++ V F    +S  
Sbjct  1017  RSATALNCQSISIPAISTGIFGYDPKEAVPIIIKSAIEFLLTNETTLNEVNFVDLNQSTA  1076

Query  217   DIYEELLQKY  226
             +I+E  L K+
Sbjct  1077  NIFENSLIKF  1086


>Q583Q5_TRYB2 unnamed protein product
Length=332

 Score = 32.0 bits (71),  Expect = 0.35, Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 32/68 (47%), Gaps = 7/68 (10%)

Query  48   IMNLEKVEKVEEEMAKKISIWQG-----DITSLEIDAIVNAANSSLLGGGGVDGAIHKAA  102
            IMN   V  V +   + +  W       D  S+ +  I++AA  +L GGG  D AIH   
Sbjct  148  IMNPSTVYGVTKVYTELLGTWYRQKYGVDFRSVRLPGIISAA--TLPGGGATDYAIHMYH  205

Query  103  GPNLKKEC  110
               L+K+C
Sbjct  206  SALLQKKC  213



Lambda      K        H
   0.331    0.143    0.476 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2966327756


Query= XP_003393045.1 uncharacterized protein LOC100645477 isoform X1
[Bombus terrestris]

Length=271
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q57ZT5_TRYB2  unnamed protein product                                 186     5e-58
Q55AK6_DICDI  unnamed protein product                                 93.2    4e-21
Q583Q5_TRYB2  unnamed protein product                                 32.0    0.48 


>Q57ZT5_TRYB2 unnamed protein product
Length=265

 Score = 186 bits (472),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 82/179 (46%), Positives = 127/179 (71%), Gaps = 2/179 (1%)

Query  90   MNLEKVEKVE--EEMAKKISIWQGDITSLEIDAIVNAANSSLLGGGGVDGAIHKAAGPNL  147
            + +E++  V+  + + + I++++G +T L++DAIVNAAN+  LGGGGVDGAIH+ AGP L
Sbjct  84   VTIEQLRPVDPSDAILRHIALYRGPVTDLQLDAIVNAANTRCLGGGGVDGAIHRVAGPLL  143

Query  148  KKECATLGGCRVGEAKITGAYMLPAKHVIHTVGPQGEKPEKLKECYENSLTVARANELRT  207
             +ECAT  GC+ GE ++T  Y LPA++V+HTVGP GEKP+ L++CY + L++A  N LR+
Sbjct  144  LRECATFNGCQTGECRLTKGYQLPARYVLHTVGPVGEKPDMLRKCYRSILSLALKNGLRS  203

Query  208  IAFPCISTGIYGYPQKPAAKVALSTVKKFLLDNKDSVDRVIFCLFLKSDKDIYEELLQK  266
            I F C+STG+YGYP  PA ++AL   +KFL ++  ++D   F  F + +   YE+ + +
Sbjct  204  IGFCCVSTGVYGYPLLPATRIALGETRKFLEEHGGALDMCCFACFQEDEYKTYEKCVGR  262


>Q55AK6_DICDI unnamed protein product
Length=1618

 Score = 93.2 bits (230),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 80/251 (32%), Positives = 122/251 (49%), Gaps = 28/251 (11%)

Query  41    KMSFEVEKQKFLTMPLEEKRKYYKGSV----ITLDQIPTWVEYWTKNKGNIGIMNLEKVE  96
             K+S + E  K + + L +++  Y+ S+    IT+D+I   + +  K  G +       VE
Sbjct  840   KISGDPENIKIIYLELLKEKYSYENSIETRAITIDKIRHDILFDLKKVGKLQKETFTLVE  899

Query  97    -KVEEEM--------AKKISIWQGDITSLEIDAIVNAANSSLLGGGGVDGAIHKAAGPNL  147
              KVE E          K I I +GDIT  +  AIVN AN  L   GG   +I +AAG   
Sbjct  900   LKVENETIISLNLSNGKIIRIIKGDITKQKTHAIVNPANEKLKNLGGAAFSIQEAAGATF  959

Query  148   KKECATL--------GGCRVGEAKITGAYMLPAKHVIHTVGPQGEKPEK---LKECYENS  196
             K+ C +          GC V  +K     +     VI+TVGP+ + P K   L     +S
Sbjct  960   KEFCESYYEKNGPIGTGCSVYGSKFKMGNIF----VINTVGPKNDNPNKARILHMSIHSS  1015

Query  197   LTVARANELRTIAFPCISTGIYGYPQKPAAKVALSTVKKFLLDNKDSVDRVIFCLFLKSD  256
             L  A A   ++I+ P ISTGI+GY  K A  + + +  +FLL N+ +++ V F    +S 
Sbjct  1016  LRSATALNCQSISIPAISTGIFGYDPKEAVPIIIKSAIEFLLTNETTLNEVNFVDLNQST  1075

Query  257   KDIYEELLQKY  267
              +I+E  L K+
Sbjct  1076  ANIFENSLIKF  1086


>Q583Q5_TRYB2 unnamed protein product
Length=332

 Score = 32.0 bits (71),  Expect = 0.48, Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 32/68 (47%), Gaps = 7/68 (10%)

Query  89   IMNLEKVEKVEEEMAKKISIWQG-----DITSLEIDAIVNAANSSLLGGGGVDGAIHKAA  143
            IMN   V  V +   + +  W       D  S+ +  I++AA  +L GGG  D AIH   
Sbjct  148  IMNPSTVYGVTKVYTELLGTWYRQKYGVDFRSVRLPGIISAA--TLPGGGATDYAIHMYH  205

Query  144  GPNLKKEC  151
               L+K+C
Sbjct  206  SALLQKKC  213



Lambda      K        H
   0.331    0.143    0.476 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2966327756


Query= XP_003393047.1 homeobox protein six1 [Bombus terrestris]

Length=434
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9Y1P6_DROME  unnamed protein product                                 283     6e-92
SO_DROME  unnamed protein product                                     235     6e-73
OPTIX_DROME  unnamed protein product                                  193     3e-56


>Q9Y1P6_DROME unnamed protein product
Length=392

 Score = 283 bits (724),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 127/204 (62%), Positives = 157/204 (77%), Gaps = 0/204 (0%)

Query  68   SSANTSTNIGNIGGLSLGITASNYTPDQISCMCKALSQRQDIEKLTRLLWSLPPGELLRR  127
            S+   + N+  +    +      ++ DQI CMC+AL Q+ DIEKLT  L SLPP E  + 
Sbjct  158  SNLTAAHNMSAVSSFPIDAKMLQFSTDQIQCMCEALQQKGDIEKLTTFLCSLPPSEFFKT  217

Query  128  DENVLIARATVAFHRGAYHELYSILESHPFSPDRHPELQQMWFKSHYSEAEKIRGRPLGA  187
            +E+VL ARA VA++ G +HELY++LE+H FS   H +LQ +WFK+HY EAEK+RGRPLGA
Sbjct  218  NESVLRARAMVAYNLGQFHELYNLLETHCFSIKYHVDLQNLWFKAHYKEAEKVRGRPLGA  277

Query  188  VDKYRLRKKYPLPKTIWDGEEVVYCFKERSRNALKQCYMRTKYPLSEEKKNLAKETGLTL  247
            VDKYRLRKKYPLPKTIWDGEE VYCFKE+SRNALK CY+  +YP  +EKK LAK+TGLTL
Sbjct  278  VDKYRLRKKYPLPKTIWDGEETVYCFKEKSRNALKDCYLTNRYPTPDEKKTLAKKTGLTL  337

Query  248  TQVANWFKNRRQRDRTPQTRTDML  271
            TQV+NWFKNRRQRDRTPQ R D++
Sbjct  338  TQVSNWFKNRRQRDRTPQQRPDIM  361


>SO_DROME unnamed protein product
Length=416

 Score = 235 bits (599),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 133/175 (76%), Gaps = 0/175 (0%)

Query  91   YTPDQISCMCKALSQRQDIEKLTRLLWSLPPGELLRRDENVLIARATVAFHRGAYHELYS  150
            +T +Q++C+C+ L Q  +IE+L R LWSLP  + L+ +E+VL A+A VAFHRG Y ELY 
Sbjct  103  FTQEQVACVCEVLQQAGNIERLGRFLWSLPQCDKLQLNESVLKAKAVVAFHRGQYKELYR  162

Query  151  ILESHPFSPDRHPELQQMWFKSHYSEAEKIRGRPLGAVDKYRLRKKYPLPKTIWDGEEVV  210
            +LE H FS   H +LQ +W K+HY EAEK+RGRPLGAV KYR+R+K+PLP+TIWDGEE  
Sbjct  163  LLEHHHFSAQNHAKLQALWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETS  222

Query  211  YCFKERSRNALKQCYMRTKYPLSEEKKNLAKETGLTLTQVANWFKNRRQRDRTPQ  265
            YCFKE+SR+ L+  Y    YP   EK++LA+ TGLT TQV+NWFKNRRQRDR  +
Sbjct  223  YCFKEKSRSVLRDWYSHNPYPSPREKRDLAEATGLTTTQVSNWFKNRRQRDRAAE  277


>OPTIX_DROME unnamed protein product
Length=487

 Score = 193 bits (491),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/179 (51%), Positives = 122/179 (68%), Gaps = 6/179 (3%)

Query  84   LGITASNYTPDQISCMCKALSQRQDIEKLTRLLWSLPPG-----ELLRRDENVLIARATV  138
            L +    ++  Q+  +CK L    DIE+L R LWSLP       E+L   E VL ARA V
Sbjct  30   LAVPTLAFSAAQVEIVCKTLEDSGDIERLARFLWSLPVALPNMHEILN-CEAVLRARAVV  88

Query  139  AFHRGAYHELYSILESHPFSPDRHPELQQMWFKSHYSEAEKIRGRPLGAVDKYRLRKKYP  198
            A+H G + ELY+I+E+H F+   + +LQ MW ++HY EAEK+RGR LG VDKYR+RKK+P
Sbjct  89   AYHVGNFRELYAIIENHKFTKASYGKLQAMWLEAHYIEAEKLRGRSLGPVDKYRVRKKFP  148

Query  199  LPKTIWDGEEVVYCFKERSRNALKQCYMRTKYPLSEEKKNLAKETGLTLTQVANWFKNR  257
            LP TIWDGE+  +CFKER+R+ L++ Y++  YP   +K+ LAK TGL  TQV NWFKNR
Sbjct  149  LPPTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPTKKRELAKATGLNPTQVGNWFKNR  207



Lambda      K        H
   0.331    0.143    0.476 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2966327756


Query= XP_003393048.1 nucleoporin NUP188 homolog [Bombus terrestris]

Length=1901
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7KTG2_DROME  unnamed protein product                                 38.1    0.10 
Q8MRJ0_DROME  unnamed protein product                                 36.6    0.26 
GRP1_CAEEL  unnamed protein product                                   35.0    0.62 


>Q7KTG2_DROME unnamed protein product
Length=4333

 Score = 38.1 bits (87),  Expect = 0.10, Method: Compositional matrix adjust.
 Identities = 36/150 (24%), Positives = 61/150 (41%), Gaps = 37/150 (25%)

Query  1205  LLLGCVQCVKSTLREDVTS-LEYLLSHSCIIAASELEELKEAATEFEKRKQQQYSVERKG  1263
             +LL C +C    +R D TS L+YLL          L  L +   +FE+ K+ ++     G
Sbjct  4153  ILLSCSKCAARDMRFDYTSILQYLLEEGV-----NLHILADTEFDFERNKKLRHFF---G  4204

Query  1264  IDKTITIDSVIAQKNADERNAETVRGIRESLPATLAVCMVTQLLRSYVERSSTLKHQRKS  1323
             +D  +       + +A+ RN   +        + L +C             +TL  + + 
Sbjct  4205  LDSKLVYSKRFPEGDAETRNTTHIP------KSNLGIC-------------TTLAVETQG  4245

Query  1324  SCVQLRQMIPELMTCIGITLQKYPYLRFST  1353
             S    R++ PE         +KYP  RF+T
Sbjct  4246  SVFSARKLQPE---------RKYPIKRFAT  4266


>Q8MRJ0_DROME unnamed protein product
Length=719

 Score = 36.6 bits (83),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 36/150 (24%), Positives = 61/150 (41%), Gaps = 37/150 (25%)

Query  1205  LLLGCVQCVKSTLREDVTS-LEYLLSHSCIIAASELEELKEAATEFEKRKQQQYSVERKG  1263
             +LL C +C    +R D TS L+YLL          L  L +   +FE+ K+ ++     G
Sbjct  539   ILLSCSKCAARDMRFDYTSILQYLLEEGV-----NLHILADTEFDFERNKKLRHFF---G  590

Query  1264  IDKTITIDSVIAQKNADERNAETVRGIRESLPATLAVCMVTQLLRSYVERSSTLKHQRKS  1323
             +D  +       + +A+ RN   +        + L +C             +TL  + + 
Sbjct  591   LDSKLVYSKRFPEGDAETRNTTHIP------KSNLGIC-------------TTLAVETQG  631

Query  1324  SCVQLRQMIPELMTCIGITLQKYPYLRFST  1353
             S    R++ PE         +KYP  RF+T
Sbjct  632   SVFSARKLQPE---------RKYPIKRFAT  652


>GRP1_CAEEL unnamed protein product
Length=393

 Score = 35.0 bits (79),  Expect = 0.62, Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 44/114 (39%), Gaps = 17/114 (15%)

Query  769  KLIRTGERTLHNKMMAETDWIRGKGFKAMKSVQLAL----------SVVNRLLIFRKSLG  818
            K++  G +  +       DW+  +   A     LAL          S +  +L   +   
Sbjct  62   KIVVNGRKKFNQDPWKALDWLASRNVVAKDPQALALWMKAGEGLSKSAIGEILGDNRPFA  121

Query  819  LEIRDRSPLEAALYSSPRVPNGLLIVPTIVNYLYVWFSPPLQAMAVRLLKKFAE  872
            LE  DR   E  L+  P       IVP +  YL+ +  P       R+L+KFAE
Sbjct  122  LETLDRFTKEHKLHDVP-------IVPALRQYLFSFRLPGESQKINRILEKFAE  168



Lambda      K        H
   0.331    0.143    0.476 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2966327756


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jan 6, 2022  5:12 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_003393051.3 LOW QUALITY PROTEIN: carnitine O-palmitoyltransferase
2, mitochondrial [Bombus terrestris]

Length=664
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VZW7_DROME  unnamed protein product                                 583     0.0  
Q8MQY1_DROME  unnamed protein product                                 581     0.0  
Q57WC6_TRYB2  unnamed protein product                                 246     2e-72


>Q9VZW7_DROME unnamed protein product
Length=667

 Score = 583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/633 (45%), Positives = 413/633 (65%), Gaps = 12/633 (2%)

Query  39   YQYIEKSKTPTMHFQPSLPRLPIPKLEDTCKRYLNAQKPLLSKEQLEKTEIYVNEFLTKD  98
            YQY++ SK PT++FQ SLPRLPIP LE++C+R+L A KPLLS  +  +T+  V +F    
Sbjct  28   YQYLQCSKLPTLYFQRSLPRLPIPLLENSCRRFLEATKPLLSPAEQAQTQQTVEQFRQGI  87

Query  99   GIRLHKELIEKDTKNHDTSYISEPWFDMYLRDRRPLPINYNPFLVLNPASNPEHNIQLVK  158
            G+ LH +L   D +N  TSYIS+PWFDMYL DR PLP+NYNP LV+   + PE+  Q+V+
Sbjct  88   GMELHAKLKSHDAENKHTSYISQPWFDMYLADRAPLPLNYNPLLVMKSDARPEYQQQVVR  147

Query  159  ATNLIVSSLRFMKSLKDNVLRPEVFYLKPKTNENNVYHTITRLLPPQFSWYGAYLFKAFP  218
            ATNLI+SSLRF +SL+ ++L PEV+++  K ++ + Y    ++ P  F+ Y +Y FKAFP
Sbjct  148  ATNLIISSLRFWRSLQADLLEPEVYHMNAKKSDTSSYRRWMKVAPKAFATYASYAFKAFP  207

Query  219  LDMSQYHNLFNTTRLPKPEKDQIYENATSRNIIVMRKGHFYSFNVIDENGYIRKPKEIAS  278
            LDMSQY+ LF T+R+P+  KD++ ++  +++I+VMR+GH Y+ NV+D +GYI  P  I  
Sbjct  208  LDMSQYNRLFGTSRIPRIGKDELVQSPDAKHILVMRRGHMYAVNVLDSSGYIESPSVILG  267

Query  279  CLESILK--ATISINERPIGILTTSERDLWANTRT-YLSQIGNQEILQK-IDSAIFTMIL  334
             L ++LK  A       P+G+LT+ +RD WA TR  ++S   N ++L++ +D+A+F + L
Sbjct  268  RLRAVLKLDADREAASVPLGVLTSGQRDEWAKTRQHFVSNTKNADLLEREVDAALFCVCL  327

Query  335  DDIHVGTDYNE-----LIRTYLHADGTNRWFDKSFSLIVTNDGYAGINFEHSWGDGVAVL  389
            D    G  +NE     L++  L     NRWFDKS SL+++ DG   INFEHSWGDGVAVL
Sbjct  328  DGEEDGV-FNENQQEPLLKHLLAGKAQNRWFDKSISLLISADGTTAINFEHSWGDGVAVL  386

Query  390  RFLKDIGNDITKQPKFCADDIKYLQKGAVE-VEKLNFVIDDKVQNIVNRQKEKFGEWIGE  448
            R+  ++  D  KQP    + +    +G    V  +NF IDD  ++ V+    K    +  
Sbjct  387  RYFNELYKDTLKQPFVSTETVHTPAEGDFSNVRPINFEIDDATKSAVSEAYNKNASIVDN  446

Query  449  LSVDHMIFNEFGKNECKTFGVSPDAIMQLAFQLALYYQRNCVVPTYESCSTAAFKHGRTE  508
            L ++ + +    K  CK +G+SPD+I+QL+FQLA     +  V +YESCST+AF+HGRTE
Sbjct  447  LDMNVLKYPHINKPTCKQYGLSPDSIIQLSFQLAYRQAYSGYVGSYESCSTSAFRHGRTE  506

Query  509  TLRSCTIETKKACEAIAQ-KNNNLSKSELKNLIINCSNVHNKLSKEAVMGQGFDRHLFAL  567
            T+R CT  T+  CEAI Q + +  S  EL+ +I NCS VH +L+KEA MGQGFDRHLFAL
Sbjct  507  TMRPCTNATRDFCEAILQPERSKPSAGELRAMIDNCSKVHGQLTKEAAMGQGFDRHLFAL  566

Query  568  KKIWEHSNTPKPAIFSDPAYDNINHNILSTSTLSDPAICAGGFGPVVSNGYGIAYMIQDE  627
            +   +    P P ++   AY  IN+NI+STSTL   A+ AG FGPVV NG+GI Y IQ++
Sbjct  567  RHTAQKEGIPIPDLYETEAYKRINNNIISTSTLGSDALLAGSFGPVVKNGFGIGYSIQND  626

Query  628  RLGAVVTSYKRNNNANEYVKCLEKAFKNIHSIM  660
              GA+VT+YK   +   ++  LE AF  I +++
Sbjct  627  FAGAIVTTYKNQADGKVFIDSLESAFDKICAVI  659


>Q8MQY1_DROME unnamed protein product
Length=696

 Score = 581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/633 (45%), Positives = 413/633 (65%), Gaps = 12/633 (2%)

Query  39   YQYIEKSKTPTMHFQPSLPRLPIPKLEDTCKRYLNAQKPLLSKEQLEKTEIYVNEFLTKD  98
            YQY++ SK PT++FQ SLPRLPIP LE++C+R+L A KPLLS  +  +T+  V +F    
Sbjct  57   YQYLQCSKLPTLYFQRSLPRLPIPLLENSCRRFLEATKPLLSPAEQAETQQTVEQFRQGI  116

Query  99   GIRLHKELIEKDTKNHDTSYISEPWFDMYLRDRRPLPINYNPFLVLNPASNPEHNIQLVK  158
            G+ LH +L   D +N  TSYIS+PWFDMYL DR PLP+NYNP LV+   + PE+  Q+V+
Sbjct  117  GMELHAKLKSHDAQNKHTSYISQPWFDMYLADRAPLPLNYNPLLVMKSDTRPEYQQQVVR  176

Query  159  ATNLIVSSLRFMKSLKDNVLRPEVFYLKPKTNENNVYHTITRLLPPQFSWYGAYLFKAFP  218
            ATNLI+SSLRF +SL+ ++L PEV+++  K ++ + Y    ++ P  F+ Y +Y FKAFP
Sbjct  177  ATNLIISSLRFWRSLQADLLEPEVYHMNAKKSDTSSYRRWMKVAPKAFATYASYAFKAFP  236

Query  219  LDMSQYHNLFNTTRLPKPEKDQIYENATSRNIIVMRKGHFYSFNVIDENGYIRKPKEIAS  278
            LDMSQY+ LF T+R+P+  KD++ ++  +++I+VMR+GH Y+ NV+D +GYI  P  I  
Sbjct  237  LDMSQYNRLFGTSRIPRIGKDELVQSPDAKHILVMRRGHMYAVNVLDSSGYIESPSVILG  296

Query  279  CLESILK--ATISINERPIGILTTSERDLWANTRT-YLSQIGNQEILQK-IDSAIFTMIL  334
             L ++LK  A       P+G+LT+ +RD WA TR  ++S   N ++L++ +D+A+F + L
Sbjct  297  RLRAVLKLDADREAASVPLGVLTSGQRDEWAKTRQHFVSNNKNADLLEREVDAALFCVCL  356

Query  335  DDIHVGTDYNE-----LIRTYLHADGTNRWFDKSFSLIVTNDGYAGINFEHSWGDGVAVL  389
            D    G  +NE     L++  L     NRWFDKS SL+++ DG   INFEHSWGDGVAVL
Sbjct  357  DGEEDGV-FNENQQEPLLKHLLAGKAQNRWFDKSISLLISADGTTAINFEHSWGDGVAVL  415

Query  390  RFLKDIGNDITKQPKFCADDIKYLQKGAVE-VEKLNFVIDDKVQNIVNRQKEKFGEWIGE  448
            R+  ++  D  KQP    + +    +G    V  +NF IDD  ++ V+    K    +  
Sbjct  416  RYFNELYKDTLKQPFVSTETVHTPAEGDFSNVRPINFEIDDATKSAVSEAYNKNASIVDN  475

Query  449  LSVDHMIFNEFGKNECKTFGVSPDAIMQLAFQLALYYQRNCVVPTYESCSTAAFKHGRTE  508
            L ++ + +    K  CK +G+SPD+I+QL+FQLA     +  V +YESCST+AF+HGRTE
Sbjct  476  LDMNVLKYPHINKPTCKQYGLSPDSIIQLSFQLAYRQAYSGYVGSYESCSTSAFRHGRTE  535

Query  509  TLRSCTIETKKACEAIAQ-KNNNLSKSELKNLIINCSNVHNKLSKEAVMGQGFDRHLFAL  567
            T+R CT  T+  CEAI Q + +  S  EL+ +I NCS VH +L+KEA MGQGFDRHLFAL
Sbjct  536  TMRPCTNATRDFCEAILQPERSKPSAGELRAMIDNCSKVHGQLTKEAAMGQGFDRHLFAL  595

Query  568  KKIWEHSNTPKPAIFSDPAYDNINHNILSTSTLSDPAICAGGFGPVVSNGYGIAYMIQDE  627
            +   +    P P ++   AY  IN+NI+STSTL   A+ AG FGPVV NG+GI Y IQ++
Sbjct  596  RHTAQKEGIPIPDLYETEAYKRINNNIISTSTLGSDALLAGSFGPVVKNGFGIGYSIQND  655

Query  628  RLGAVVTSYKRNNNANEYVKCLEKAFKNIHSIM  660
              GA+VT+YK   +   ++  LE AF  I +++
Sbjct  656  FAGAIVTTYKNQADGKVFIDSLESAFDKICAVI  688


>Q57WC6_TRYB2 unnamed protein product
Length=621

 Score = 246 bits (627),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 193/638 (30%), Positives = 292/638 (46%), Gaps = 66/638 (10%)

Query  56   LPRLPIPKLEDTCKRYLNAQKPLLSKEQLEKTEIYVNEFLTKDGIRLHKELIEKDTKN--  113
            LPRLPIP LE T +RY  +  PL S E ++      + FLT     L   L+E DT    
Sbjct  16   LPRLPIPTLEATAERYRASIWPLKSAEMVKNHLQKFDTFLTSSAGGLQAALVEADTAAAA  75

Query  114  ---HDTSYISEPWFDMYLRDRRPLPINYNPFLVLNPASNPEHNIQLVKATNLIVSSLRFM  170
               +  SYI   W DMYL +R P+ +N NP +      N   + Q      ++ S  R++
Sbjct  76   CGVYPYSYIEALWEDMYLSNREPVLVNVNPAITTKKLKNA-GDTQAAVGAAVVHSIARWV  134

Query  171  KSLKDNVLRPEVFYLKPKTNENNVYHTITRLLPPQFSWYGAYLFKAFPLDMSQYHNLFNT  230
             +  +  +  EVF      +E       TR + P    +GA +         +  + F+T
Sbjct  135  YNAVNKGV--EVF------DE-------TRDVSPLLRQFGASVIPG------EKKDTFHT  173

Query  231  TRLPKPEKDQIYENATSRNIIVMRKGHFYSFNVIDENGYIRKPKEIASCLESILKATISI  290
            T + K            R+IIV+  GH Y+  V D+         +   +E +L  T   
Sbjct  174  TPMEK-----------LRHIIVLHDGHPYAVRVFDDKQVPLDRAVVQKSIEYVLSITPDA  222

Query  291  -NERPIGILTTSERDLWANTRTYLSQI-GNQEILQKIDSAIFTMILDDIHVGTDYNELIR  348
             N  P+ +LT   R  WA     L +   N E L+KI   I  + LD    G D   +  
Sbjct  223  DNTTPVSVLTAGNRQTWAGAYAELVKTPENAENLKKIQEGIVVVCLDTESWGGDGKLVDG  282

Query  349  TYLHADGT---NRWFDKSFSLIVTNDGYAGINFEHSWGDGVAVLRFLKDIGNDI----TK  401
              LH + T   NRW+DK   +IV+ DG    NFEHS  DGV  LR++ DI +D+      
Sbjct  283  ASLHGNNTEFENRWYDK-HQIIVSADGRVAFNFEHSGSDGVQWLRWISDIISDVEGGDGS  341

Query  402  QPKFCADDIKYLQKGAVEVEKLNFVIDDKVQNIVNRQKEKFGEWIGELSVDHMIFNEFGK  461
                 A  +   + G + V+ L           +   +    E I   +++ +    +GK
Sbjct  342  SVSTSATSLDPAKVGTL-VQPLTLTFGKTFAAHIRAARAGALELIAGTALEDVTI-PYGK  399

Query  462  NECKTFGVSPDAIMQLAFQLALYYQRNCVVPTYESCSTAAFKHGRTETLRSCTIETKKAC  521
             + K  GVSPDA +Q+  Q+A +  RN + PTYE+ ST  F HGRTET+RS T E +   
Sbjct  400  TQLKQLGVSPDAFVQMCLQVAHHKCRNKLAPTYEAASTGRFFHGRTETIRSATREMQLVA  459

Query  522  EAIAQ--KNNNLSKSELKN-----------LIINCSNVHNKLSKEAVMGQGFDRHLFALK  568
            EA+ +  K N  S  E              L+   +  H +L+K A  G+G DRHL ALK
Sbjct  460  EAVNRMTKANAASDEEGSTTYVASVEEQVALLKAAAERHVRLAKAAANGEGIDRHLTALK  519

Query  569  KIW-EHSNTPKPAIFSDPAYDNINHNILSTSTLSDPAICAGGFGPVVSNGYGIAYMIQDE  627
            ++  E ++    A F+D  Y + +   LSTS L+ P +    FGPV +NGYG+ Y I   
Sbjct  520  RLAVERNDAAALAFFNDETYTSCSTWRLSTSNLTAPWVERFMFGPVTANGYGLGYTIDGT  579

Query  628  RLGAVVTSYKR--NNNANEYVKCLEKAFKNIHSIMTCG  663
             +   V+++ R  + +A +    + +A  N++ ++  G
Sbjct  580  EVRLTVSAFTRSPSTDAGDMKLAVSEAASNVYGLLKAG  617



Lambda      K        H
   0.319    0.136    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8012016630


Query= XP_003393053.1 V-type proton ATPase 21 kDa proteolipid subunit
[Bombus terrestris]

Length=206
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VFE3_DROME  unnamed protein product                                 284     3e-98
G5EDB8_CAEEL  unnamed protein product                                 208     2e-68
Q586H7_TRYB2  unnamed protein product                                 157     2e-48


>Q9VFE3_DROME unnamed protein product
Length=212

 Score = 284 bits (726),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 158/207 (76%), Positives = 178/207 (86%), Gaps = 2/207 (1%)

Query  1    MRYILGTTFAGTASATTLVLVLYHVFTGKGERVSVAWFLENTSPHMWATLGIGLAVALSV  60
            +R ++  TF     A   +L LY V TGKGERVSV WFL +++P+MWA LGIGL+V+LSV
Sbjct  5    IRTVVSQTFLWLFLAVATILTLYFVMTGKGERVSVGWFLASSNPYMWACLGIGLSVSLSV  64

Query  61   VGAALGINTTGVSIIGGGVKAPRIKTKNLISVIFCEAVAIYGLITAIVLSGMLDEFSYP-  119
            VGAALGI+TTG SI+GGGVKAPRIKTKNLISVIFCEAVAIYGLITAIVLSG L++FS   
Sbjct  65   VGAALGIHTTGTSIVGGGVKAPRIKTKNLISVIFCEAVAIYGLITAIVLSGQLEQFSMET  124

Query  120  -IQKEEVRNQNWLAGYLIFGAGLAVGLVNLFCGIAVGIVGSGAALSDAANSALFVKILIV  178
             + +  ++N NW +GYLIFGAGLAVGLVNLFCGIAVGIVGSGAALSDAAN+ALFVKILIV
Sbjct  125  ALSQAAIQNTNWFSGYLIFGAGLAVGLVNLFCGIAVGIVGSGAALSDAANAALFVKILIV  184

Query  179  EIFGSAIGLFGLIVGIYMTSKVKMGDK  205
            EIFGSAIGLFGLIVGIYMTSK KMGDK
Sbjct  185  EIFGSAIGLFGLIVGIYMTSKSKMGDK  211


>G5EDB8_CAEEL unnamed protein product
Length=214

 Score = 208 bits (529),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 115/193 (60%), Positives = 148/193 (77%), Gaps = 13/193 (7%)

Query  22   LYHVFTGKGERVSVAWFLENTSPHMWATLGIGLAVALSVVGAALGINTTGVSIIGGGVKA  81
            L+++ +G+G R  + WFL +TSPHMWA LGIG +++LSV+GA  GI TTG SI+GGGVKA
Sbjct  26   LFYMLSGQGHRFDIGWFLTSTSPHMWAGLGIGFSLSLSVLGAGWGIFTTGSSILGGGVKA  85

Query  82   PRIKTKNLISVIFCEAVAIYGLITAIVLSGMLDEFSYPIQKEEVRN---------QNWLA  132
            PRI+TKNL+S+IFCEAVAI+G+I A V  G L EF    ++E++ +         +N  +
Sbjct  86   PRIRTKNLVSIIFCEAVAIFGIIMAFVFVGKLAEF----RREDLPDTEDGMAILARNLAS  141

Query  133  GYLIFGAGLAVGLVNLFCGIAVGIVGSGAALSDAANSALFVKILIVEIFGSAIGLFGLIV  192
            GY+IFG GL VGL NL CG+AVGIVGSGAA++DAAN ALFVKILI+EIF SAIGLFG+I+
Sbjct  142  GYMIFGGGLTVGLSNLVCGLAVGIVGSGAAIADAANPALFVKILIIEIFASAIGLFGMII  201

Query  193  GIYMTSKVKMGDK  205
            GI  T+K   G+K
Sbjct  202  GIVQTNKASFGNK  214


>Q586H7_TRYB2 unnamed protein product
Length=224

 Score = 157 bits (398),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 118/161 (73%), Gaps = 1/161 (1%)

Query  43   SPHMWATLGIGLAVALSVVGAALGINTTGVSIIGGGVKAPRIKTKNLISVIFCEAVAIYG  102
            SP+ W ++GIG+ ++LS+ GAA GI TT  S+ G  ++AP+I++KNLIS+IFCEAVAIYG
Sbjct  63   SPYTWGSVGIGIGISLSIGGAAWGILTTASSLSGAAIRAPQIRSKNLISIIFCEAVAIYG  122

Query  103  LITAIVLSGMLDEFSYPIQKEEVRN-QNWLAGYLIFGAGLAVGLVNLFCGIAVGIVGSGA  161
            +I +I++ G ++     +    +   +   AG+ +F AGLAVGL N+ CGIAVG+VGS  
Sbjct  123  VILSIIMMGKMEADGKAVDSSGIFTYRAAAAGFTLFAAGLAVGLGNMCCGIAVGVVGSSC  182

Query  162  ALSDAANSALFVKILIVEIFGSAIGLFGLIVGIYMTSKVKM  202
            A++DA +S+LFVKIL++EIF SA+G+F +IVGI M  K  M
Sbjct  183  AIADAHSSSLFVKILVIEIFASALGIFSVIVGILMAQKAVM  223



Lambda      K        H
   0.319    0.136    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8012016630


Query= XP_003393055.1 SET and MYND domain-containing protein 4-like [Bombus
terrestris]

Length=673
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q95RZ8_DROME  unnamed protein product                                 133     1e-32
A1Z8L3_DROME  unnamed protein product                                 133     2e-32
Q7KMH5_DROME  unnamed protein product                                 104     3e-23


>Q95RZ8_DROME unnamed protein product
Length=567

 Score = 133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 121/462 (26%), Positives = 201/462 (44%), Gaps = 58/462 (13%)

Query  222  SDAVELQFDEKRGRHLIATRNIKAGSVLIVETPFAFSTNKEALDRNCLHCHITLKSSESV  281
            S  V +  + + GR   A+ ++K G  L+VE PF     ++    +C +C +       V
Sbjct  145  SPLVRIDSNRQEGRFARASADVKPGEELLVERPFVSVLLEKFAKTHCENCFM----RTVV  200

Query  282  KIPCHFCQTVSFCSEKCRREAWQMYHQYECFIFDAFYGNDFESMQHTSHLLLAYRMIISA  341
             + C  C  V +CSE+CR EA + YH+YEC I    + +      H +  ++A +  +  
Sbjct  201  PVACPRCADVLYCSEQCREEASKKYHKYECGIVPIIWRSGASINNHIALRIIASKP-LDY  259

Query  342  FLSLNTEQINNNTEKSKIPFMNDNFLRDYVTIKNNEYKDLGINKAYCTYDYHTILNLETH  401
            FL L        T +  I    D+F R                          +  LE H
Sbjct  260  FLKLKPTIDEELTPEQLISLPKDDFRR--------------------------VAQLERH  293

Query  402  CTKIESSINLARAIEAIFLAKC-----FTFVLSKMDVICLKESFIYLAVAMLHNLQAINC  456
              + + S      + A FL  C     +     K D + +  S +      L +LQ I  
Sbjct  294  QGERQPSNFFQHVLMARFLTNCLRAGGYFGSEPKPDEVSIICSLV------LRSLQFIQF  347

Query  457  NAYEIVENIYDKKTHVWEPRHIGGAIYPSISLINHSCYPNVVRHSYPSGTVVLRTLRFIG  516
            N +E+ E      +   +   IGGAIYP+++L NHSC P VVR+ +   T+ + ++R I 
Sbjct  348  NTHEVAELHKFSSSGREKSIFIGGAIYPTLALFNHSCDPGVVRY-FRGTTIHINSVRPIE  406

Query  517  KGTEILDCYGPHWLSEKRLSRLEYLWKKYRFLCACEACTQNW-QF-PLP-ETMNYKCKM-  572
             G  I + YGP +  ++R  R   L   Y F C+C+AC  NW +F  LP + + ++C   
Sbjct  407  AGLPINENYGPMYTQDERSERQARLKDLYWFECSCDACIDNWPKFDDLPRDVIRFRCDAP  466

Query  573  --CSEIISTITLDEKHTQNVSSKQCCKCNKKTD-LKKIKNQFRKSVEKRLDAISKMYE-G  628
              CS +I         + N    +C  C + T+ LK +K    +  E       ++YE G
Sbjct  467  NNCSAVIEV-----PPSCNDFMVKCVTCGEITNILKGLK--VMQDTEMMTRTAKRLYETG  519

Query  629  HYEQALPQLLEHIQFIEKCFTTPNMEAIKTQQCIIQCYNQFG  670
             Y +AL + ++ I+ + +    P  +  ++QQ +  C+   G
Sbjct  520  EYPKALAKFVDLIRIMYEVLAPPFPDFCESQQHLKDCFLNLG  561


>A1Z8L3_DROME unnamed protein product
Length=660

 Score = 133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 121/462 (26%), Positives = 201/462 (44%), Gaps = 58/462 (13%)

Query  222  SDAVELQFDEKRGRHLIATRNIKAGSVLIVETPFAFSTNKEALDRNCLHCHITLKSSESV  281
            S  V +  + + GR   A+ ++K G  L+VE PF     ++    +C +C +       V
Sbjct  238  SPLVRIDSNRQEGRFARASADVKPGEELLVERPFVSVLLEKFAKTHCENCFM----RTVV  293

Query  282  KIPCHFCQTVSFCSEKCRREAWQMYHQYECFIFDAFYGNDFESMQHTSHLLLAYRMIISA  341
             + C  C  V +CSE+CR EA + YH+YEC I    + +      H +  ++A +  +  
Sbjct  294  PVACPRCADVLYCSEQCREEASKKYHKYECGIVPIIWRSGASINNHIALRIIASKP-LDY  352

Query  342  FLSLNTEQINNNTEKSKIPFMNDNFLRDYVTIKNNEYKDLGINKAYCTYDYHTILNLETH  401
            FL L        T +  I    D+F R                          +  LE H
Sbjct  353  FLKLKPTIDEELTPEQLISLPKDDFRR--------------------------VAQLERH  386

Query  402  CTKIESSINLARAIEAIFLAKC-----FTFVLSKMDVICLKESFIYLAVAMLHNLQAINC  456
              + + S      + A FL  C     +     K D + +  S +      L +LQ I  
Sbjct  387  QGERQPSNFFQHVLMARFLTNCLRAGGYFGSEPKPDEVSIICSLV------LRSLQFIQF  440

Query  457  NAYEIVENIYDKKTHVWEPRHIGGAIYPSISLINHSCYPNVVRHSYPSGTVVLRTLRFIG  516
            N +E+ E      +   +   IGGAIYP+++L NHSC P VVR+ +   T+ + ++R I 
Sbjct  441  NTHEVAELHKFSSSGREKSIFIGGAIYPTLALFNHSCDPGVVRY-FRGTTIHINSVRPIE  499

Query  517  KGTEILDCYGPHWLSEKRLSRLEYLWKKYRFLCACEACTQNW-QF-PLP-ETMNYKCKM-  572
             G  I + YGP +  ++R  R   L   Y F C+C+AC  NW +F  LP + + ++C   
Sbjct  500  AGLPINENYGPMYTQDERSERQARLKDLYWFECSCDACIDNWPKFDDLPRDVIRFRCDAP  559

Query  573  --CSEIISTITLDEKHTQNVSSKQCCKCNKKTD-LKKIKNQFRKSVEKRLDAISKMYE-G  628
              CS +I         + N    +C  C + T+ LK +K    +  E       ++YE G
Sbjct  560  NNCSAVIEV-----PPSCNDFMVKCVTCGEITNILKGLK--VMQDTEMMTRTAKRLYETG  612

Query  629  HYEQALPQLLEHIQFIEKCFTTPNMEAIKTQQCIIQCYNQFG  670
             Y +AL + ++ I+ + +    P  +  ++QQ +  C+   G
Sbjct  613  EYPKALAKFVDLIRIMYEVLAPPFPDFCESQQHLKDCFLNLG  654


>Q7KMH5_DROME unnamed protein product
Length=573

 Score = 104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 110/418 (26%), Positives = 176/418 (42%), Gaps = 43/418 (10%)

Query  167  RECYKNLKVSSSQD--KRLRRKYNKSQSVTFENALIEKSASVIPI---VDGKQHTILKSC  221
            R+C  N+K++   +   RL  K +K +    +  L ++   V+P    +  + H  +   
Sbjct  125  RQCLDNIKLARQANYPARLSHKLDKRER-DCQQLLDQQPPDVVPYEFKLSFEPHAQVPFI  183

Query  222  SDAVELQFDEKRGRHLIATRNIKAGSVLIVETPFAFSTNKEALDRNCLHCHITLKSSESV  281
            +D +EL+     GR ++  R++  G ++ VE PF  +         C  C    + +   
Sbjct  184  ADCLELRETAAEGRFVVTNRDLAVGDLVSVEEPFCSTLLTPMRYIRCATCK---RENYLT  240

Query  282  KIPCHFCQTVSFCSEKCRREAWQMYHQYECFIFDAFYGNDFESMQHTSHLLLAYRMIISA  341
             IPC  C +  FCSE+C+  A Q YH+YEC I D F    F  +       +A R   + 
Sbjct  241  LIPCDSCCSTMFCSEECKSIAMQTYHRYECPIID-FLNRMFNKIH-----CIALR---TT  291

Query  342  FLSLNTEQINNNTEKSKIPFMNDNFLRDYVTIKNNEYK---DLGINKAYCTYDYHTILNL  398
             ++LN              F +   L D+   + N+ K   DL  N+      Y  I  L
Sbjct  292  LVALNI-------------FPSIEELIDFCEQEQNQDKCAFDLNYNELTPEEHYRAIHGL  338

Query  399  ETHCTKIESSINLARAIEAIFLAKCFTFVLSKMDVICLKESFIYLAVAMLHNLQ--AINC  456
             T+      S    R++    L           + +  +E   +    +  +LQ    N 
Sbjct  339  VTNQHLRSVSDLFQRSVVCAVLKHFIIEYTPVKEYLGGEEGVNFFTDLLFRHLQTSPSNM  398

Query  457  NAYEIVENIYDKKTHVWEPRHIGGAIYPSISLINHSCYPNVVRHSYPSGTVVLRTLRFIG  516
            +  ++VE + + K    +  H  GA Y  +SLINHSC PN VR  Y      +  LR I 
Sbjct  399  HGIDLVEQVNETKD---DQTHSSGA-YAFLSLINHSCAPNTVR-IYEGTKAYMFVLRPIK  453

Query  517  KGTEILDCYGPHWLSEKRLSRLEYLWKKYRFLCACEACTQNWQFPLPETMNYKCKMCS  574
             G  + D YG H+    +  RL+ L  +YRF C CE C  N+  P+   M +K  + S
Sbjct  454  AGNVLYDNYGAHFAICSKEQRLKRLSLQYRFDCKCEGCELNY--PMFGMMPHKATVPS  509



Lambda      K        H
   0.319    0.136    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8012016630


Query= XP_003393058.1 acetyl-CoA acetyltransferase, mitochondrial isoform
X1 [Bombus terrestris]

Length=502
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9W3N9_DROME  unnamed protein product                                 584     0.0   
THILH_CAEEL  unnamed protein product                                  472     7e-165
THIL1_DICDI  unnamed protein product                                  394     6e-134


>Q9W3N9_DROME unnamed protein product
Length=410

 Score = 584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/398 (70%), Positives = 329/398 (83%), Gaps = 3/398 (1%)

Query  16   RSYSSKVKLNDVVIVSATRTPMGSFLGGLSSLTAPKLGAITIKAAIERAGISKDEVTEVY  75
            R+YSSK+   +VV+VSA RTP+GSF   L+ LTA +LGA  I+AAIE+AGI+K +V EV 
Sbjct  16   RNYSSKIA--EVVVVSAARTPIGSFQSQLAPLTATQLGARAIEAAIEKAGIAKTDVQEVI  73

Query  76   MGNVCQAALGQAPARQATLFAGLPKSTICTTVNKVCASGMKSIMLASQSLQCGHQEIVLA  135
            MGNV  A LGQAPARQA +FAGLP +  CTTVNKVC+SGMK++ML +QSL  G+ ++V+A
Sbjct  74   MGNVVSAGLGQAPARQAAIFAGLPTNVCCTTVNKVCSSGMKAVMLGAQSLMLGYADVVVA  133

Query  136  GGMESMSNVPFYLPRGEIKYGGTKLEDGIVFDGLTDVYNKFHMGNCAENTAKKLNITRDE  195
            GGMESMSNVP+YL RG   YGG  L DGIVFDGL DVYNKFHMGNCAENTAKKL ITR +
Sbjct  134  GGMESMSNVPYYLKRGATPYGGVNLTDGIVFDGLWDVYNKFHMGNCAENTAKKLEITRQQ  193

Query  196  QDRYAINSYKRSATAYANKIFQDELVPVPVPQKRGNPDIVFNEDEEYKKVNFDKFGKLNT  255
            QD +AI SYKRSA A+ANK+FQDE+ PV + QKR  P+IV +EDEEYK+VNFDKFG+L T
Sbjct  194  QDDFAIESYKRSAAAWANKVFQDEIAPVKIQQKR-KPEIVISEDEEYKRVNFDKFGQLAT  252

Query  256  VFQKENGTVTAGNASTLNDGAAALILTTTVVAQKMNLKPLARVIAFQDAATDPIDFPTAP  315
            VFQ+ENGTVTAGNASTLNDG AA++L +   AQK  +KPLAR++AFQDA TDPIDFP AP
Sbjct  253  VFQRENGTVTAGNASTLNDGGAAVVLMSAEAAQKAGIKPLARIVAFQDAETDPIDFPIAP  312

Query  316  SFGISKLLEKTGLNKNDIALWEINEAFSVVVIANQKLLDLDPNTVNIHGGAVSLGHPIGM  375
            +  I KLL++ G+ K D+A+WE+NEAFS+VV+AN K LD+DP  VN+HGGAVS+GHPIGM
Sbjct  313  ALAIPKLLKRAGVRKEDVAMWEVNEAFSLVVLANIKKLDVDPAKVNVHGGAVSIGHPIGM  372

Query  376  SGARLVVHLVHALKAGEKGIASICNGGGGASSILIEKL  413
            SGARLV HL H+LK GE G ASICNGGGGASSILIEKL
Sbjct  373  SGARLVAHLSHSLKKGELGCASICNGGGGASSILIEKL  410


>THILH_CAEEL unnamed protein product
Length=407

 Score = 472 bits (1215),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 226/385 (59%), Positives = 292/385 (76%), Gaps = 3/385 (1%)

Query  29   IVSATRTPMGSFLGGLSSLTAPKLGAITIKAAIERAGISKDEVTEVYMGNVCQAALGQAP  88
            IV A RTP+GSF   LSS+TAP+L ++ IKAA+ER  +    + EV++G VCQA  GQAP
Sbjct  26   IVGAARTPIGSFRSSLSSVTAPELASVAIKAALERGAVKPSSIQEVFLGQVCQANAGQAP  85

Query  89   ARQATLFAGLPKSTICTTVNKVCASGMKSIMLASQSLQCGHQEIVLAGGMESMSNVPFYL  148
            ARQA L AGL  S   TTVNKVC+SG+K+I+LA+Q +Q GHQ+  + GGMESMS VPFY+
Sbjct  86   ARQAALGAGLDLSVAVTTVNKVCSSGLKAIILAAQQIQTGHQDFAIGGGMESMSQVPFYV  145

Query  149  PRGEIKYGGTKLEDGIVFDGLTDVYNKFHMGNCAENTAKKLNITRDEQDRYAINSYKRSA  208
             RGEI YGG ++ DGIV DGLTD Y+K HMGNC E T+K++ ITR +QD YAINSYK+SA
Sbjct  146  QRGEIPYGGFQVIDGIVKDGLTDAYDKVHMGNCGEKTSKEMGITRKDQDEYAINSYKKSA  205

Query  209  TAYANKIFQDELVPVPVPQKRGNPDIVFNEDEEYKKVNFDKFGKLNTVFQKENGTVTAGN  268
             A+ N     E+VPV V  K+G    + ++DEE+ KVNFDKF  L TVFQK+ GT+TA N
Sbjct  206  KAWENGNIGPEVVPVNVKSKKGV--TIVDKDEEFTKVNFDKFTSLRTVFQKD-GTITAAN  262

Query  269  ASTLNDGAAALILTTTVVAQKMNLKPLARVIAFQDAATDPIDFPTAPSFGISKLLEKTGL  328
            ASTLNDGAAA+I+ +     + +LKPLAR++A+ DAAT P+DF  AP+    K+LE+ G+
Sbjct  263  ASTLNDGAAAVIVASQEAVSEQSLKPLARILAYGDAATHPLDFAVAPTLMFPKILERAGV  322

Query  329  NKNDIALWEINEAFSVVVIANQKLLDLDPNTVNIHGGAVSLGHPIGMSGARLVVHLVHAL  388
             ++D+A WE+NEAFS V +A  K L +DP+ VN HGGAVS+GHPIGMSGARL+ HLVH L
Sbjct  323  KQSDVAQWEVNEAFSCVPLAFIKKLGVDPSLVNPHGGAVSIGHPIGMSGARLITHLVHTL  382

Query  389  KAGEKGIASICNGGGGASSILIEKL  413
            K+G+ G+A+ICNGGGG+S ++I+KL
Sbjct  383  KSGQIGVAAICNGGGGSSGMVIQKL  407


>THIL1_DICDI unnamed protein product
Length=414

 Score = 394 bits (1012),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 207/402 (51%), Positives = 275/402 (68%), Gaps = 6/402 (1%)

Query  16   RSYSSKVKLNDVVIVSATRTPMGSFLGGLSSLTAPKLGAITIKAAIERAGISKDEVTEVY  75
            R Y++   L  VVIVSA RTP+GS  G LS++   KL +ITI+ A++RAGI   +V E  
Sbjct  15   RMYTTAKNLESVVIVSAVRTPIGSIGGSLSTIPGTKLSSITIEEAVKRAGIKPSDVDEAI  74

Query  76   MGNVCQAALGQAPARQATLFAGLPKSTICTTVNKVCASGMKSIMLASQSLQCGHQEIVLA  135
            +GNV  A LGQAPARQ  L AGL + TI TT+NKVC+SGMK+I+  +QS+  GH + V+A
Sbjct  75   IGNVISANLGQAPARQCALGAGLEQKTITTTINKVCSSGMKAIVFGAQSIALGHSKTVVA  134

Query  136  GGMESMSNVPFYLP--RGEIKYGGTKLEDGIVFDGLTDVYNKFHMGNCAENTAKKLNITR  193
            GG ESMS VP+Y    R   KYG     DG+V DGL D YN   MG C ++ A K  ITR
Sbjct  135  GGFESMSQVPYYADKMRFGAKYGNQTFIDGLVRDGLADAYNGSAMGVCGDDCADKYKITR  194

Query  194  DEQDRYAINSYKRSATAYANKIFQDELVPVPVPQKRGNPDIVFNEDEEYKKVNFDKFGKL  253
            ++QD++A++SY R+  A  N  F DE+V VP+  + G    V  EDEE KKV FDK   L
Sbjct  195  EQQDKFAVDSYLRALEAQKNGFFNDEIVQVPIVGRGGKVTYVV-EDEEPKKVLFDKIPNL  253

Query  254  NTVFQKENGTVTAGNASTLNDGAAALILTTTVVAQKMNLKPLARVIAFQDAATDPIDFPT  313
               F   NGTVT  NAS LNDGA+++IL +   A+++ LKPLAR+I + DA   PI+FPT
Sbjct  254  KPAFT-PNGTVTPANASKLNDGASSVILMSESHAKELGLKPLARIIGYADAEQAPIEFPT  312

Query  314  APSFGISKLLEKTGLNKNDIALWEINEAFSVVVIANQKLLDLDPNTVNIHGGAVSLGHPI  373
            AP+  I K L+  G+N + + L+EINEAF+VV +AN K+LD+D N +N++GGAV+LGHPI
Sbjct  313  APALAIPKALKNAGINMSQVDLFEINEAFAVVGLANAKILDIDHNKLNVNGGAVALGHPI  372

Query  374  GMSGARLVVHLVHAL--KAGEKGIASICNGGGGASSILIEKL  413
            G SG R+VV L H L  K  + G+A+ICNGGGG++++++EKL
Sbjct  373  GSSGCRIVVTLTHLLQNKNLKYGVAAICNGGGGSTALVLEKL  414



Lambda      K        H
   0.319    0.136    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8012016630


Query= XP_003393059.1 baculoviral IAP repeat-containing protein 7 isoform
X3 [Bombus terrestris]

Length=523
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DIAP2_DROME  unnamed protein product                                  335     2e-109
DIAP1_DROME  unnamed protein product                                  111     3e-26 
Q9VEM2_DROME  unnamed protein product                                 54.3    1e-08 


>DIAP2_DROME unnamed protein product
Length=498

 Score = 335 bits (858),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 194/549 (35%), Positives = 276/549 (50%), Gaps = 82/549 (15%)

Query  1    MNVEESRLRTFTDWPVNATVDAARIAKAGFYYTGHALEVQCFLCGVKISDWNYGDQAIVR  60
            M +E  RL TF +WP+NA V A  +   GF+ TG+ LE +C  C V+I  W YGDQ   R
Sbjct  6    MELESVRLATFGEWPLNAPVSAEDLVANGFFATGNWLEAECHFCHVRIDRWEYGDQVAER  65

Query  61   HRLAEPNCPFVQNPSSTCNVPLIPIPINNLGLASSSTETSQDNNIVE----CQSINLYQN  116
            HR + P C  V  P+   NVP             S    ++ N++V+    C   +L   
Sbjct  66   HRRSSPICSMVLAPNHCGNVP------------RSQESDNEGNSVVDSPESCSCPDLL--  111

Query  117  KEPQKECRVMSQRLQSFTNWPISSIVSPEKLAKAGFYYLQHDDEVQCTYCGGILRKWKLG  176
                    + + RL +F +WP  +I +P+ LAKAGFYYL   D V+C +C G++ KW+  
Sbjct  112  --------LEANRLVTFKDWPNPNI-TPQALAKAGFYYLNRLDHVKCVWCNGVIAKWEKN  162

Query  177  DDPERKHREYFPNCNFYVHQDKDDNLYLTNVKLMP----GATSNLSDLGIQIHTTPKKPD  232
            D+   +H+ +FP C                V++ P        NL +LGIQ  T P +P 
Sbjct  163  DNAFEEHKRFFPQC--------------PRVQMGPLIEFATGKNLDELGIQPTTLPLRPK  208

Query  233  CATYEGRLRTFNGWPENIKQTPEILASAGFYYDGFGDHVRCFHCDGGLRNWEATDDAWTE  292
             A  + RLRTF  WP +  Q    LA AG YY   GD VRCFHC+ GLR+W+  D+ W E
Sbjct  209  YACVDARLRTFTDWPISNIQPASALAQAGLYYQKIGDQVRCFHCNIGLRSWQKEDEPWFE  268

Query  293  HARWFPKCEFVNLVRGQEFIKQCINNRPPLDQSIFEGVTEDESTDITDTRATTIPSLEIT  352
            HA+W PKC+FV L +G  ++ +           +      + S+      A T+ +    
Sbjct  269  HAKWSPKCQFVLLAKGPAYVSE-----------VLATTAANASSQPATAPAPTLQA----  313

Query  353  EATLKKLLESPPAMEALEIGLHVGRVKRALKKRMEEIGTPYTNSDQLIEDVLCDQIMEEL  412
                  L++  PA EAL +G+  G V+ A+++++   G  ++  D+L+ D+  D      
Sbjct  314  ----DVLMDEAPAKEALALGIDGGVVRNAIQRKLLSSGCAFSTLDELLHDIFDDAGAGAA  369

Query  413  TR-----EQTNSDIEQCNTDKKDEYSV-CSVEDE-------NSVISNDKSNTDKKANFKE  459
                   E +   IE C        SV   V D           ++N    TD+      
Sbjct  370  LEVREPPEPSAPFIEPCQATTSKAASVPIPVADSIPAKPQAAEAVANISKITDEIQKMSV  429

Query  460  ST-----ALEEENRKLKEARLCKICMDREIAIVFLPCGHLATCVYCAPSLTYCLMCRQEI  514
            +T     +LEEENR+LK+ARLCK+C+D E+ +VFLPCGHLATC  CAPS+  C MCR +I
Sbjct  430  ATPNGNLSLEEENRQLKDARLCKVCLDEEVGVVFLPCGHLATCNQCAPSVANCPMCRADI  489

Query  515  KATVRTFLS  523
            K  VRTFLS
Sbjct  490  KGFVRTFLS  498


>DIAP1_DROME unnamed protein product
Length=438

 Score = 111 bits (278),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 63/184 (34%), Positives = 89/184 (48%), Gaps = 16/184 (9%)

Query  228  PKKPDCATYEGRLRTFNGWPENIKQTPEILASAGFYYDGFGDHVRCFHCDGGLRNWEATD  287
            P+ P+ A    RLRTF  WP N+KQ P  LA AGF+Y G GD VRCF C GGL +W   D
Sbjct  218  PQYPEYAIETARLRTFEAWPRNLKQKPHQLAEAGFFYTGVGDRVRCFSCGGGLMDWNDND  277

Query  288  DAWTEHARWFPKCEFVNLVRGQEFIKQCINNRPPLDQSIFEGVTEDESTDITDTRATTIP  347
            + W +HA W  +C FV L++GQ +I          D    + V  +E  + +      + 
Sbjct  278  EPWEQHALWLSQCRFVKLMKGQLYI----------DTVAAKPVLAEEKEESSSIGGVAVA  327

Query  348  SLEITEATLKKLLESPPAMEA-LEIGLHVGRVKRALKKRME--EIGTPYTNSD---QLIE  401
            S + +E   +  L S  A+   +   +      R   K +E   + TP TNS     + E
Sbjct  328  STQASEEEQQTSLSSEEAVSGDVAPSVAPTAATRIFNKIVEATAVATPSTNSSGSTSIPE  387

Query  402  DVLC  405
            + LC
Sbjct  388  EKLC  391


 Score = 107 bits (267),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 78/273 (29%), Positives = 115/273 (42%), Gaps = 66/273 (24%)

Query  1    MNVEESRLRTFTDWPVNATVDAARIAKAGFYYTGHALEVQCFLCGVKISDWNYGDQAIVR  60
            +N EE+RL+TFTDWP++  +D  ++A+ G Y+T    +V+CF CGV+I  W   DQ +  
Sbjct  41   LNREETRLKTFTDWPLD-WLDKRQLAQTGMYFTHAGDKVKCFFCGVEIGCWEQEDQPVPE  99

Query  61   HRLAEPNCPFVQNPSSTCNVPL-----------------------------------IP-  84
            H+   PNCP ++   +T NVP+                                   IP 
Sbjct  100  HQRWSPNCPLLRR-RTTNNVPINAEALDRILPPISYDICGANDSTLEMREHAYAEGVIPM  158

Query  85   ------IPINNLGLASSSTETSQDNNIV-------------------ECQSINLYQNKEP  119
                  I +N +  A S T T+     V                    C+      N  P
Sbjct  159  SQLIQSIGMNAVNAAGSVTGTAAPQPRVTVATHASTATQATGDVQPETCRPSAASGNYFP  218

Query  120  Q-KECRVMSQRLQSFTNWPISSIVSPEKLAKAGFYYLQHDDEVQCTYCGGILRKWKLGDD  178
            Q  E  + + RL++F  WP +    P +LA+AGF+Y    D V+C  CGG L  W   D+
Sbjct  219  QYPEYAIETARLRTFEAWPRNLKQKPHQLAEAGFFYTGVGDRVRCFSCGGGLMDWNDNDE  278

Query  179  PERKHREYFPNCNFYVHQDKDDNLYLTNVKLMP  211
            P  +H  +   C F   +     LY+  V   P
Sbjct  279  PWEQHALWLSQCRFV--KLMKGQLYIDTVAAKP  309


 Score = 57.8 bits (138),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 31/54 (57%), Gaps = 0/54 (0%)

Query  470  LKEARLCKICMDREIAIVFLPCGHLATCVYCAPSLTYCLMCRQEIKATVRTFLS  523
            + E +LCKIC   E    FLPCGH+  C  CA S+T C +CR+     +R + S
Sbjct  385  IPEEKLCKICYGAEYNTAFLPCGHVVACAKCASSVTKCPLCRKPFTDVMRVYFS  438


 Score = 55.1 bits (131),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 45/89 (51%), Gaps = 1/89 (1%)

Query  102  DNNIVECQSINLYQNKEPQKECRVMSQRLQSFTNWPISSIVSPEKLAKAGFYYLQHDDEV  161
            DNN    Q      NK    +      RL++FT+WP+  +    +LA+ G Y+    D+V
Sbjct  20   DNNTNATQLFKNNINKTRMNDLNREETRLKTFTDWPLDWL-DKRQLAQTGMYFTHAGDKV  78

Query  162  QCTYCGGILRKWKLGDDPERKHREYFPNC  190
            +C +CG  +  W+  D P  +H+ + PNC
Sbjct  79   KCFFCGVEIGCWEQEDQPVPEHQRWSPNC  107


 Score = 53.9 bits (128),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 47/110 (43%), Gaps = 10/110 (9%)

Query  237  EGRLRTFNGWPENIKQTPEILASAGFYYDGFGDHVRCFHCDGGLRNWEATDDAWTEHARW  296
            E RL+TF  WP +     + LA  G Y+   GD V+CF C   +  WE  D    EH RW
Sbjct  45   ETRLKTFTDWPLDWLDKRQ-LAQTGMYFTHAGDKVKCFFCGVEIGCWEQEDQPVPEHQRW  103

Query  297  FPKCEFVNLVRGQEFIKQCINNRPPLDQSIFEGVTEDESTDITDTRATTI  346
             P C           +++   N  P++    + +    S DI     +T+
Sbjct  104  SPNC---------PLLRRRTTNNVPINAEALDRILPPISYDICGANDSTL  144


>Q9VEM2_DROME unnamed protein product
Length=153

 Score = 54.3 bits (129),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 35/72 (49%), Gaps = 5/72 (7%)

Query  239  RLRTFNGWP--ENIKQTPEILASAGFYYDGF---GDHVRCFHCDGGLRNWEATDDAWTEH  293
            R+ ++  WP  E    +   +A AGFY+ G     D   CF C   L  WE  DD W EH
Sbjct  31   RVESYKSWPFPETASCSISKMAEAGFYWTGTKRENDTATCFVCGKTLDGWEPEDDPWKEH  90

Query  294  ARWFPKCEFVNL  305
             +  P+CEF  L
Sbjct  91   VKHAPQCEFAKL  102


 Score = 51.6 bits (122),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 40/70 (57%), Gaps = 5/70 (7%)

Query  128  QRLQSFTNWPI--SSIVSPEKLAKAGFYYL---QHDDEVQCTYCGGILRKWKLGDDPERK  182
             R++S+ +WP   ++  S  K+A+AGFY+    + +D   C  CG  L  W+  DDP ++
Sbjct  30   HRVESYKSWPFPETASCSISKMAEAGFYWTGTKRENDTATCFVCGKTLDGWEPEDDPWKE  89

Query  183  HREYFPNCNF  192
            H ++ P C F
Sbjct  90   HVKHAPQCEF  99


 Score = 48.5 bits (114),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/75 (31%), Positives = 37/75 (49%), Gaps = 5/75 (7%)

Query  3    VEESRLRTFTDWPV--NATVDAARIAKAGFYYTGHALE---VQCFLCGVKISDWNYGDQA  57
            +E+ R+ ++  WP    A+   +++A+AGFY+TG   E     CF+CG  +  W   D  
Sbjct  27   LEQHRVESYKSWPFPETASCSISKMAEAGFYWTGTKRENDTATCFVCGKTLDGWEPEDDP  86

Query  58   IVRHRLAEPNCPFVQ  72
               H    P C F +
Sbjct  87   WKEHVKHAPQCEFAK  101



Lambda      K        H
   0.319    0.136    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8012016630


Query= XP_003393060.1 death-associated inhibitor of apoptosis 1 [Bombus
terrestris]

Length=406
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DIAP1_DROME  unnamed protein product                                  236     2e-73
DIAP2_DROME  unnamed protein product                                  144     3e-38
Q9VEM2_DROME  unnamed protein product                                 57.4    7e-10


>DIAP1_DROME unnamed protein product
Length=438

 Score = 236 bits (602),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 140/407 (34%), Positives = 203/407 (50%), Gaps = 53/407 (13%)

Query  43   DYHFEAARLQSFENWPVTYIEPEKLAAAGFYYTGESDKVKCFECQVEICKWVEGDIPMVD  102
            D + E  RL++F +WP+ +++  +LA  G Y+T   DKVKCF C VEI  W + D P+ +
Sbjct  40   DLNREETRLKTFTDWPLDWLDKRQLAQTGMYFTHAGDKVKCFFCGVEIGCWEQEDQPVPE  99

Query  103  HQRWSARCRFIRKLNCGNVPIGVDP-DTVTPPRPRSRDVCSP--YGLEYR---------P  150
            HQRWS  C  +R+    NVPI  +  D + PP   S D+C      LE R         P
Sbjct  100  HQRWSPNCPLLRRRTTNNVPINAEALDRILPPI--SYDICGANDSTLEMREHAYAEGVIP  157

Query  151  TS------GPDDHNFSM----------ELQLASTAKLGCLGLGRTK-------------G  181
             S      G +  N +            + +A+ A       G  +              
Sbjct  158  MSQLIQSIGMNAVNAAGSVTGTAAPQPRVTVATHASTATQATGDVQPETCRPSAASGNYF  217

Query  182  PVHPEYASYDARLHTFVTWPKSMPQTKEQLADAGFFYTGKGDQTLCYHCGGGLKDWEPED  241
            P +PEYA   ARL TF  WP+++ Q   QLA+AGFFYTG GD+  C+ CGGGL DW   D
Sbjct  218  PQYPEYAIETARLRTFEAWPRNLKQKPHQLAEAGFFYTGVGDRVRCFSCGGGLMDWNDND  277

Query  242  DPWEQHAKWFSKCCYLLMVQGQDYISKITGQHVSPPSKEETMQMNLPSFIKKVQPTSVEV  301
            +PWEQHA W S+C ++ +++GQ YI  +  + V    KEE+      S I  V   S + 
Sbjct  278  EPWEQHALWLSQCRFVKLMKGQLYIDTVAAKPVLAEEKEES------SSIGGVAVASTQA  331

Query  302  ERKEETESNPGSSSQNNDIW---GIASNTEPIKRSLESEPTENPSNIKTQNTKPTDDARM  358
              +E+  S     + + D+       + T    + +E+     PS   + +T   ++ ++
Sbjct  332  SEEEQQTSLSSEEAVSGDVAPSVAPTAATRIFNKIVEATAVATPSTNSSGSTSIPEE-KL  390

Query  359  CKICYNGELGVVFLPCGHMVACVKCAPGMTTCAVCREPVTMTVRAFI  405
            CKICY  E    FLPCGH+VAC KCA  +T C +CR+P T  +R + 
Sbjct  391  CKICYGAEYNTAFLPCGHVVACAKCASSVTKCPLCRKPFTDVMRVYF  437


 Score = 75.1 bits (183),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 53/95 (56%), Gaps = 8/95 (8%)

Query  30   VTPDTCHDEADNVDYH-------FEAARLQSFENWPVTYIE-PEKLAAAGFYYTGESDKV  81
            V P+TC   A + +Y         E ARL++FE WP    + P +LA AGF+YTG  D+V
Sbjct  202  VQPETCRPSAASGNYFPQYPEYAIETARLRTFEAWPRNLKQKPHQLAEAGFFYTGVGDRV  261

Query  82   KCFECQVEICKWVEGDIPMVDHQRWSARCRFIRKL  116
            +CF C   +  W + D P   H  W ++CRF++ +
Sbjct  262  RCFSCGGGLMDWNDNDEPWEQHALWLSQCRFVKLM  296


>DIAP2_DROME unnamed protein product
Length=498

 Score = 144 bits (363),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 85/254 (33%), Positives = 119/254 (47%), Gaps = 48/254 (19%)

Query  27   SVSVTPDTCHDEADNVDYHFEAARLQSFENWPVTYIEPEKLAAAGFYYTGESDKVKCFEC  86
            SV  +P++C       D   EA RL +F++WP   I P+ LA AGFYY    D VKC  C
Sbjct  97   SVVDSPESCSCP----DLLLEANRLVTFKDWPNPNITPQALAKAGFYYLNRLDHVKCVWC  152

Query  87   QVEICKWVEGDIPMVDHQRWSARCRFIRKLNCGNVPIGVDPDTVTPPRPRSRDVCSPYGL  146
               I KW + D    +H+R+  +C                        PR +        
Sbjct  153  NGVIAKWEKNDNAFEEHKRFFPQC------------------------PRVQ--------  180

Query  147  EYRPTSGPDDHNFSMELQLASTAKLGCLGLGRTKGPVHPEYASYDARLHTFVTWPKSMPQ  206
                  GP        ++ A+   L  LG+  T  P+ P+YA  DARL TF  WP S  Q
Sbjct  181  -----MGP-------LIEFATGKNLDELGIQPTTLPLRPKYACVDARLRTFTDWPISNIQ  228

Query  207  TKEQLADAGFFYTGKGDQTLCYHCGGGLKDWEPEDDPWEQHAKWFSKCCYLLMVQGQDYI  266
                LA AG +Y   GDQ  C+HC  GL+ W+ ED+PW +HAKW  KC ++L+ +G  Y+
Sbjct  229  PASALAQAGLYYQKIGDQVRCFHCNIGLRSWQKEDEPWFEHAKWSPKCQFVLLAKGPAYV  288

Query  267  SKITGQHVSPPSKE  280
            S++     +  S +
Sbjct  289  SEVLATTAANASSQ  302


 Score = 80.9 bits (198),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 64/235 (27%), Positives = 91/235 (39%), Gaps = 47/235 (20%)

Query  42   VDYHFEAARLQSFENWPVTY-IEPEKLAAAGFYYTGESDKVKCFECQVEICKWVEGDIPM  100
            +    E+ RL +F  WP+   +  E L A GF+ TG   + +C  C V I +W  GD   
Sbjct  4    LGMELESVRLATFGEWPLNAPVSAEDLVANGFFATGNWLEAECHFCHVRIDRWEYGDQVA  63

Query  101  VDHQRWSARCRFIRKLN-CGNVPIGVDPDTVTPPRPRSRDVCSPYGLEYRPTSGPDDHNF  159
              H+R S  C  +   N CGNVP   + D        S + CS                 
Sbjct  64   ERHRRSSPICSMVLAPNHCGNVPRSQESDNEGNSVVDSPESCS-----------------  106

Query  160  SMELQLASTAKLGCLGLGRTKGPVHPEYASYDARLHTFVTWPKSMPQTKEQLADAGFFYT  219
                                     P+      RL TF  WP     T + LA AGF+Y 
Sbjct  107  ------------------------CPDLLLEANRLVTFKDWPNPN-ITPQALAKAGFYYL  141

Query  220  GKGDQTLCYHCGGGLKDWEPEDDPWEQHAKWFSKCCYLLMVQGQDYISKITGQHV  274
             + D   C  C G +  WE  D+ +E+H ++F +C     VQ    I   TG+++
Sbjct  142  NRLDHVKCVWCNGVIAKWEKNDNAFEEHKRFFPQC---PRVQMGPLIEFATGKNL  193


 Score = 71.2 bits (173),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 56/99 (57%), Gaps = 2/99 (2%)

Query  307  TESNPGSSSQNNDIWGIASNTEPIKRSLESEPTENPSNIKTQNTKPTDDARMCKICYNGE  366
             +S P        +  I+  T+ I++   + P  N S ++ +N +   DAR+CK+C + E
Sbjct  401  ADSIPAKPQAAEAVANISKITDEIQKMSVATPNGNLS-LEEEN-RQLKDARLCKVCLDEE  458

Query  367  LGVVFLPCGHMVACVKCAPGMTTCAVCREPVTMTVRAFI  405
            +GVVFLPCGH+  C +CAP +  C +CR  +   VR F+
Sbjct  459  VGVVFLPCGHLATCNQCAPSVANCPMCRADIKGFVRTFL  497


>Q9VEM2_DROME unnamed protein product
Length=153

 Score = 57.4 bits (137),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 43/71 (61%), Gaps = 9/71 (13%)

Query  193  RLHTFVTWPKSMPQTKE----QLADAGFFYTG---KGDQTLCYHCGGGLKDWEPEDDPWE  245
            R+ ++ +WP   P+T      ++A+AGF++TG   + D   C+ CG  L  WEPEDDPW+
Sbjct  31   RVESYKSWP--FPETASCSISKMAEAGFYWTGTKRENDTATCFVCGKTLDGWEPEDDPWK  88

Query  246  QHAKWFSKCCY  256
            +H K   +C +
Sbjct  89   EHVKHAPQCEF  99


 Score = 43.9 bits (102),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 41/79 (52%), Gaps = 7/79 (9%)

Query  46   FEAARLQSFENWP---VTYIEPEKLAAAGFYYTG---ESDKVKCFECQVEICKWVEGDIP  99
             E  R++S+++WP          K+A AGFY+TG   E+D   CF C   +  W   D P
Sbjct  27   LEQHRVESYKSWPFPETASCSISKMAEAGFYWTGTKRENDTATCFVCGKTLDGWEPEDDP  86

Query  100  MVDHQRWSARCRFIRKLNC  118
              +H + + +C F  KL+C
Sbjct  87   WKEHVKHAPQCEFA-KLSC  104



Lambda      K        H
   0.319    0.136    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8012016630


Query= XP_003393061.1 death-associated inhibitor of apoptosis 1 [Bombus
terrestris]

Length=406
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DIAP1_DROME  unnamed protein product                                  236     2e-73
DIAP2_DROME  unnamed protein product                                  144     3e-38
Q9VEM2_DROME  unnamed protein product                                 57.4    7e-10


>DIAP1_DROME unnamed protein product
Length=438

 Score = 236 bits (602),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 140/407 (34%), Positives = 203/407 (50%), Gaps = 53/407 (13%)

Query  43   DYHFEAARLQSFENWPVTYIEPEKLAAAGFYYTGESDKVKCFECQVEICKWVEGDIPMVD  102
            D + E  RL++F +WP+ +++  +LA  G Y+T   DKVKCF C VEI  W + D P+ +
Sbjct  40   DLNREETRLKTFTDWPLDWLDKRQLAQTGMYFTHAGDKVKCFFCGVEIGCWEQEDQPVPE  99

Query  103  HQRWSARCRFIRKLNCGNVPIGVDP-DTVTPPRPRSRDVCSP--YGLEYR---------P  150
            HQRWS  C  +R+    NVPI  +  D + PP   S D+C      LE R         P
Sbjct  100  HQRWSPNCPLLRRRTTNNVPINAEALDRILPPI--SYDICGANDSTLEMREHAYAEGVIP  157

Query  151  TS------GPDDHNFSM----------ELQLASTAKLGCLGLGRTK-------------G  181
             S      G +  N +            + +A+ A       G  +              
Sbjct  158  MSQLIQSIGMNAVNAAGSVTGTAAPQPRVTVATHASTATQATGDVQPETCRPSAASGNYF  217

Query  182  PVHPEYASYDARLHTFVTWPKSMPQTKEQLADAGFFYTGKGDQTLCYHCGGGLKDWEPED  241
            P +PEYA   ARL TF  WP+++ Q   QLA+AGFFYTG GD+  C+ CGGGL DW   D
Sbjct  218  PQYPEYAIETARLRTFEAWPRNLKQKPHQLAEAGFFYTGVGDRVRCFSCGGGLMDWNDND  277

Query  242  DPWEQHAKWFSKCCYLLMVQGQDYISKITGQHVSPPSKEETMQMNLPSFIKKVQPTSVEV  301
            +PWEQHA W S+C ++ +++GQ YI  +  + V    KEE+      S I  V   S + 
Sbjct  278  EPWEQHALWLSQCRFVKLMKGQLYIDTVAAKPVLAEEKEES------SSIGGVAVASTQA  331

Query  302  ERKEETESNPGSSSQNNDIW---GIASNTEPIKRSLESEPTENPSNIKTQNTKPTDDARM  358
              +E+  S     + + D+       + T    + +E+     PS   + +T   ++ ++
Sbjct  332  SEEEQQTSLSSEEAVSGDVAPSVAPTAATRIFNKIVEATAVATPSTNSSGSTSIPEE-KL  390

Query  359  CKICYNGELGVVFLPCGHMVACVKCAPGMTTCAVCREPVTMTVRAFI  405
            CKICY  E    FLPCGH+VAC KCA  +T C +CR+P T  +R + 
Sbjct  391  CKICYGAEYNTAFLPCGHVVACAKCASSVTKCPLCRKPFTDVMRVYF  437


 Score = 75.1 bits (183),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 53/95 (56%), Gaps = 8/95 (8%)

Query  30   VTPDTCHDEADNVDYH-------FEAARLQSFENWPVTYIE-PEKLAAAGFYYTGESDKV  81
            V P+TC   A + +Y         E ARL++FE WP    + P +LA AGF+YTG  D+V
Sbjct  202  VQPETCRPSAASGNYFPQYPEYAIETARLRTFEAWPRNLKQKPHQLAEAGFFYTGVGDRV  261

Query  82   KCFECQVEICKWVEGDIPMVDHQRWSARCRFIRKL  116
            +CF C   +  W + D P   H  W ++CRF++ +
Sbjct  262  RCFSCGGGLMDWNDNDEPWEQHALWLSQCRFVKLM  296


>DIAP2_DROME unnamed protein product
Length=498

 Score = 144 bits (363),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 85/254 (33%), Positives = 119/254 (47%), Gaps = 48/254 (19%)

Query  27   SVSVTPDTCHDEADNVDYHFEAARLQSFENWPVTYIEPEKLAAAGFYYTGESDKVKCFEC  86
            SV  +P++C       D   EA RL +F++WP   I P+ LA AGFYY    D VKC  C
Sbjct  97   SVVDSPESCSCP----DLLLEANRLVTFKDWPNPNITPQALAKAGFYYLNRLDHVKCVWC  152

Query  87   QVEICKWVEGDIPMVDHQRWSARCRFIRKLNCGNVPIGVDPDTVTPPRPRSRDVCSPYGL  146
               I KW + D    +H+R+  +C                        PR +        
Sbjct  153  NGVIAKWEKNDNAFEEHKRFFPQC------------------------PRVQ--------  180

Query  147  EYRPTSGPDDHNFSMELQLASTAKLGCLGLGRTKGPVHPEYASYDARLHTFVTWPKSMPQ  206
                  GP        ++ A+   L  LG+  T  P+ P+YA  DARL TF  WP S  Q
Sbjct  181  -----MGP-------LIEFATGKNLDELGIQPTTLPLRPKYACVDARLRTFTDWPISNIQ  228

Query  207  TKEQLADAGFFYTGKGDQTLCYHCGGGLKDWEPEDDPWEQHAKWFSKCCYLLMVQGQDYI  266
                LA AG +Y   GDQ  C+HC  GL+ W+ ED+PW +HAKW  KC ++L+ +G  Y+
Sbjct  229  PASALAQAGLYYQKIGDQVRCFHCNIGLRSWQKEDEPWFEHAKWSPKCQFVLLAKGPAYV  288

Query  267  SKITGQHVSPPSKE  280
            S++     +  S +
Sbjct  289  SEVLATTAANASSQ  302


 Score = 80.9 bits (198),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 64/235 (27%), Positives = 91/235 (39%), Gaps = 47/235 (20%)

Query  42   VDYHFEAARLQSFENWPVTY-IEPEKLAAAGFYYTGESDKVKCFECQVEICKWVEGDIPM  100
            +    E+ RL +F  WP+   +  E L A GF+ TG   + +C  C V I +W  GD   
Sbjct  4    LGMELESVRLATFGEWPLNAPVSAEDLVANGFFATGNWLEAECHFCHVRIDRWEYGDQVA  63

Query  101  VDHQRWSARCRFIRKLN-CGNVPIGVDPDTVTPPRPRSRDVCSPYGLEYRPTSGPDDHNF  159
              H+R S  C  +   N CGNVP   + D        S + CS                 
Sbjct  64   ERHRRSSPICSMVLAPNHCGNVPRSQESDNEGNSVVDSPESCS-----------------  106

Query  160  SMELQLASTAKLGCLGLGRTKGPVHPEYASYDARLHTFVTWPKSMPQTKEQLADAGFFYT  219
                                     P+      RL TF  WP     T + LA AGF+Y 
Sbjct  107  ------------------------CPDLLLEANRLVTFKDWPNPN-ITPQALAKAGFYYL  141

Query  220  GKGDQTLCYHCGGGLKDWEPEDDPWEQHAKWFSKCCYLLMVQGQDYISKITGQHV  274
             + D   C  C G +  WE  D+ +E+H ++F +C     VQ    I   TG+++
Sbjct  142  NRLDHVKCVWCNGVIAKWEKNDNAFEEHKRFFPQC---PRVQMGPLIEFATGKNL  193


 Score = 71.2 bits (173),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 56/99 (57%), Gaps = 2/99 (2%)

Query  307  TESNPGSSSQNNDIWGIASNTEPIKRSLESEPTENPSNIKTQNTKPTDDARMCKICYNGE  366
             +S P        +  I+  T+ I++   + P  N S ++ +N +   DAR+CK+C + E
Sbjct  401  ADSIPAKPQAAEAVANISKITDEIQKMSVATPNGNLS-LEEEN-RQLKDARLCKVCLDEE  458

Query  367  LGVVFLPCGHMVACVKCAPGMTTCAVCREPVTMTVRAFI  405
            +GVVFLPCGH+  C +CAP +  C +CR  +   VR F+
Sbjct  459  VGVVFLPCGHLATCNQCAPSVANCPMCRADIKGFVRTFL  497


>Q9VEM2_DROME unnamed protein product
Length=153

 Score = 57.4 bits (137),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 43/71 (61%), Gaps = 9/71 (13%)

Query  193  RLHTFVTWPKSMPQTKE----QLADAGFFYTG---KGDQTLCYHCGGGLKDWEPEDDPWE  245
            R+ ++ +WP   P+T      ++A+AGF++TG   + D   C+ CG  L  WEPEDDPW+
Sbjct  31   RVESYKSWP--FPETASCSISKMAEAGFYWTGTKRENDTATCFVCGKTLDGWEPEDDPWK  88

Query  246  QHAKWFSKCCY  256
            +H K   +C +
Sbjct  89   EHVKHAPQCEF  99


 Score = 43.9 bits (102),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 41/79 (52%), Gaps = 7/79 (9%)

Query  46   FEAARLQSFENWP---VTYIEPEKLAAAGFYYTG---ESDKVKCFECQVEICKWVEGDIP  99
             E  R++S+++WP          K+A AGFY+TG   E+D   CF C   +  W   D P
Sbjct  27   LEQHRVESYKSWPFPETASCSISKMAEAGFYWTGTKRENDTATCFVCGKTLDGWEPEDDP  86

Query  100  MVDHQRWSARCRFIRKLNC  118
              +H + + +C F  KL+C
Sbjct  87   WKEHVKHAPQCEFA-KLSC  104



Lambda      K        H
   0.319    0.136    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8012016630


Query= XP_003393062.1 uncharacterized protein LOC100647953 [Bombus
terrestris]

Length=1613
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

XMAS2_DROME  unnamed protein product                                  432     3e-127
Q8I3S3_PLAF7  unnamed protein product                                 32.3    5.1   
Q8MMR8_DICDI  unnamed protein product                                 31.2    9.9   


>XMAS2_DROME unnamed protein product
Length=1370

 Score = 432 bits (1111),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 239/614 (39%), Positives = 362/614 (59%), Gaps = 47/614 (8%)

Query  129  SITCTNVPQSLLTKATAKRYFIQFGSPVKICIRSRKQIITVIYTTKEEANIAYSKSGEYL  188
            ++ C N+P+  L K  A+ +F +FG+ V   +R R+   TV Y +++EA  A      + 
Sbjct  13   TLLCRNIPELFLDKYVARSHFGRFGTLVNFVLRPRRMTCTVSYASEDEAARALLDGASFQ  72

Query  189  GEKFNVEWTKLSLPAKSPTKKKDLQKNKIYNVSQIVSNFFKSSDDEIKSELDAMTNLEYN  248
            G  F++ +        +P +K +                 +  D +I++EL A+ +   N
Sbjct  73   GHLFDISYADNE---TAPAQKTE-----------------EWVDPDIQAELSALQSGWRN  112

Query  249  LHSRNNFDETLAKRHKILQSKSMSKSFTRLEKTSAKAEKLKVESQISDLLPNATIEELQN  308
             +      +            SM  +   +   +A   + +  +Q+ DL         +N
Sbjct  113  EYGSGKPIKKPQNGSSGSGGSSMLPAIP-VGPATAPVSRDRTPAQLRDL---------EN  162

Query  309  IIQQPAYTSEDKYKVLEARDRLIRMRQIKSHTLAAAKVMIGTCPDMCPEKERLMRESKRQ  368
            ++++PA+TSE+K+ VL+ARD+L+R+ + + H L+ A    G C DMCPEKER++RE +RQ
Sbjct  163  MMRRPAHTSEEKFSVLDARDKLLRLNRTQ-HKLSGATQ--GHCADMCPEKERVLREFQRQ  219

Query  369  VALYEQLQINEYRINHMVAVKQYSRSSADQEEPMAHELRPIKSLKMTMSYLLHEIVNLCD  428
            VA YE    ++  I H  A+KQYSRSSADQE P+ HELR   +L MTMSYL+HEI+++ +
Sbjct  220  VAYYELQPGSDELICHERALKQYSRSSADQETPLPHELRNETALHMTMSYLMHEIMDISE  279

Query  429  QQG--TNLGEWYHFLWDRTRGIRKDITQQELCCIDSVELVEQCARFHIVCSERLCAEQPS  486
            +Q   +++G+W+HF+WDRTR IRK+ITQQELC + +V+LVEQCARFHI C+ RL    PS
Sbjct  280  RQDPQSHMGDWFHFVWDRTRSIRKEITQQELCSLGAVKLVEQCARFHIHCAARLVDADPS  339

Query  487  VFDKKINSDNLTKCLQSLKYMYHDLRVKEITCKNEPEFRAYIILLNLNNGNFMWDLQRLP  546
            VFD KIN++NLTKCLQ+LKYMYHDLR+K + C  E EFR YI+LLNL + NF+WD+ +LP
Sbjct  340  VFDSKINAENLTKCLQTLKYMYHDLRIKGVPCPKEAEFRGYIVLLNLADANFLWDIGQLP  399

Query  547  NNIQKSSEVQFALDTYSALESNNYYKFFKLV--QETTYLNACILLRYFYQVRLKALSVLV  604
              +Q   EV+ A+  Y AL+  N+ +FF+L+  ++T+YL+ACIL+ YF ++R+  L  L+
Sbjct  400  AELQSCPEVRQAIQFYLALQDTNFVRFFQLLADKDTSYLSACILVNYFTRLRVLGLHRLI  459

Query  605  KAY---CRTASTAYPLYELIDILGFEDENEAIYFCEQVGLNVSEDGLHVLLNRHNFTMPV  661
            +AY    +   ++ PL  + ++L F  E EA  F +  GL ++E G  VL   H      
Sbjct  460  QAYRSPRKDEVSSLPLSYIAELLSFASEQEAADFVQHYGLQINEAGRVVLSRMHTVET--  517

Query  662  LHVKQKRACNLIDSKRTMQHLSIGESIAGGKMPER-AYKYHKPHNSFDSHGYLMPDSINA  720
               K  R   L++ KR     S+GE ++G  +P R  Y  H+PHNSFD +G L   +  A
Sbjct  518  -EYKLPRQYELVEVKRVK---SVGEVVSGEPLPPRDLYLNHRPHNSFDDYGMLKSIAWTA  573

Query  721  EDQNKSIVSSSTDP  734
            +DQ   +      P
Sbjct  574  KDQLAGMQQEEMQP  587


 Score = 40.4 bits (93),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 46/213 (22%), Positives = 96/213 (45%), Gaps = 26/213 (12%)

Query  1345  PKFIIDLHNEAVSHVIDIILDPESFMYTKFAPEFRKFVKNQYMMPCS-------YEHFDD  1397
             P+  +DL NEAV H + ++   +   + +F  E R FV+    +P          EHF+ 
Sbjct  1110  PQRCVDLFNEAV-HRLQLVAGEDLSDWPQFPEELRVFVQP---LPIESSLNTNRLEHFEP  1165

Query  1398  VWKSEEYKAKLERVMSSFKLPQWKYP-WPINNSIIFR--QYITNYCQEALFTSGSDEISD  1454
              W   E + ++ +++   KLP  K P  P ++S+     Q++ +Y Q +      ++I+ 
Sbjct  1166  GWHLPERRQRIVQLLERCKLP--KMPVLPRSSSLAEAQCQWVLDYAQISQQEDCVEQIAL  1223

Query  1455  NILSNLFLTTGISTVSNFIDVLLYIIKQKI-YLLAKDL----KVIYNKNDMKCFRTLPWW  1509
               +  L   T      ++++ + Y+  +++ Y+L ++      ++YN   +K      W+
Sbjct  1224  QAIKILQYDT-----DDYLNFVEYLAGERMQYILRQERNPPQGIVYNTKTLKRRFLSAWY  1278

Query  1510  LKSNLLTEYKIVPKNINVQETEKENKKTIDINE  1542
              +      Y+ VP   N Q  EK+     ++ +
Sbjct  1279  YEFREPQIYEPVPAEENAQMLEKQPSSQAEVQQ  1311


>Q8I3S3_PLAF7 unnamed protein product
Length=1894

 Score = 32.3 bits (72),  Expect = 5.1, Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 23/31 (74%), Gaps = 2/31 (6%)

Query  1338  LLHALEK--PKFIIDLHNEAVSHVIDIILDP  1366
             L   LEK  PK I +++NEA+ H+I++++DP
Sbjct  841   LQRILEKKNPKHIEEIYNEALDHIIELMVDP  871


>Q8MMR8_DICDI unnamed protein product
Length=637

 Score = 31.2 bits (69),  Expect = 9.9, Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 58/126 (46%), Gaps = 17/126 (13%)

Query  920   LMGKTIPNETSNFFVKRQVPQEEKTGKLKLEEQESIKRMQQINDIAKDILNTLETELVQA  979
             + GK  PNE +NFF++ +   +E++  LK      IK ++  +DI    + + E     +
Sbjct  161   MTGKITPNEIANFFIECKNHSDEQSPPLK----AFIKILE--DDIKSQAMASAERWKSGS  214

Query  980   HCSTI------VKEETDKIYIYNTFSEDISNEIFNEVTSE---ICDNLLQKE--IVNARK  1028
               S I      +K+E D+I  + T       ++F  V +E   +   L Q+   +V    
Sbjct  215   PLSLIDGVPISLKDEIDQIGYHTTCGTTFLEKVFPNVKTEDSGVAKMLRQQGAILVGKNN  274

Query  1029  LHEISV  1034
             +HEI +
Sbjct  275   MHEIGI  280



Lambda      K        H
   0.319    0.136    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8012016630


Query= XP_003393064.1 protein-serine O-palmitoleoyltransferase porcupine
isoform X1 [Bombus terrestris]

Length=461
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PORCN_DROME  unnamed protein product                                  178     5e-50
PORCN_CAEEL  unnamed protein product                                  127     6e-32
SNF12_DICDI  unnamed protein product                                  33.1    0.54 


>PORCN_DROME unnamed protein product
Length=525

 Score = 178 bits (452),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 117/345 (34%), Positives = 181/345 (52%), Gaps = 37/345 (11%)

Query  148  WHKIRSVVMTMAMKTISIAIDRSDTNDL----PNIFAYMGYMFCSVTCLFGPWISFKDYI  203
            W ++R + M + MK IS+  D + +  L    P  FAY+GY++   TC  GPW+SF  Y+
Sbjct  185  WPQLRGIQMVVNMKLISLGFDLTASGQLQARIPGPFAYLGYIYSPATCALGPWVSFGCYM  244

Query  204  SIRYTTHQDKWWV--LYTIQYVFLSFLFLSISNCWAQWVIA--ETSWKWLLAYRDALSFR  259
                   ++ W V     +  V +  L +++SNC A  +      S  +L+ Y DALS R
Sbjct  245  DC--LVPRNSWLVSLRRLLPNVVICVLAVTVSNCVAPALSDFFGDSSHFLVMYWDALSVR  302

Query  260  MSHYFISYIASSLLLLGGFPYALST---------VVKPLKIELPHSLVHVVICWNIPMHF  310
             SHYF+  +A +LL+        +T         + +P +IE P S+  +V  WNIPMH 
Sbjct  303  SSHYFVGMMAQALLVASDQRLDGATKESDMLGPLISQPWRIEWPRSISSLVRSWNIPMHE  362

Query  311  WLKTYIFRP----SIKYLGKFGAVTM-TYLTSALLHGLNFQLAAVLLSLGFYTYVEFQFR  365
            WLK YI+ P    +    G+   V + TYL S+LLHG++ ++  VL+SL F    E   R
Sbjct  363  WLKRYIYAPCKPTASTSRGRILVVVLSTYLVSSLLHGMDLRIYLVLISLAFLAEGESLLR  422

Query  366  YMLANIFDACVASKQCT-KTKCTHAY-------NIHNSWWVLLINMMFSGLSIFHLAYLG  417
              LA++ +AC+ +  C  K +C +++       N  + W   L N+ F+ L+IFHLAYLG
Sbjct  423  RQLASLLNACITANLCPGKERCRYSHCPSKRRLNSLSYWLARLTNLAFTALAIFHLAYLG  482

Query  418  --LMFDTSELQETGYSYIHTIEKWSQLGFASHWVVFATYCIYFLI  460
              L+ D  E+ E G S++     W Q G+ SH++   T+ +Y  I
Sbjct  483  VVLLGDDLEVGEDGDSFLW---HWQQAGYLSHYIGLGTFVLYLFI  524


>PORCN_CAEEL unnamed protein product
Length=442

 Score = 127 bits (318),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 94/330 (28%), Positives = 160/330 (48%), Gaps = 26/330 (8%)

Query  137  TYCEFTMSSIVWHKIRSVVMT--MAMKTISIAIDRSDTNDLP--NIFAYMGYMFCSVTCL  192
             +C    S   +  IR ++M   M + T++  ++++++N        +Y+ Y++     +
Sbjct  115  NFCRHYRSEDYFLSIRGILMIHIMRLTTVAFNLEKANSNKFRFVQFSSYVEYIYFPPFII  174

Query  193  FGPWISFKDYISIRYTTHQDKWWVLYTIQYVFLSFLFLSISNCWAQWVIA-------ETS  245
            FGP++SF+ +  +R     DK W     +  F+    L+I N     +I+       E S
Sbjct  175  FGPYLSFEQFFKMR-----DKKWTGSENELGFIIQSLLAIFNAITLAIISSCHFEFFEPS  229

Query  246  WKWLLAYRDALSFRMSHYFISYIASSLLLLGGFPYALSTVVKPLKIELPHSLVHVVICWN  305
             +++     A+SFR SHYF+     + +L+ G   +   V  PL IE   S +  V  WN
Sbjct  230  SQFMEDALTAMSFRFSHYFVCLSTQAFVLMLG---SDVVVANPLNIEFSRSTLQTVSEWN  286

Query  306  IPMHFWLKTYIFRPSIKYLGKFGAVTMTYLTSALLHGLNFQLAAVLLSLGFYTYVEFQFR  365
             P H +L   IF+  + +      V  T+  S+LLHGL+FQ+   LL+LGF  Y E  FR
Sbjct  287  KPFHTFLHENIFKRRL-FNSTACNVFFTFAVSSLLHGLDFQMTITLLALGFIAYSETVFR  345

Query  366  YMLANIFDACVASKQC----TKTKCTHAYNIHNSWWVLLINMMFSGLSIFHLAYLGLMFD  421
              L+  +  CVA+K C        C H ++ + +   L+IN+ F  LS++HL + G+ F 
Sbjct  346  KRLSARYSMCVAAKACPVRSNSLSCKHRHS-NKTGRALIINLFFLMLSMYHLVFTGMTF-  403

Query  422  TSELQETGYSYIHTIEKWSQLGFASHWVVF  451
            T +    GY + H  + W    ++S  + F
Sbjct  404  TDDYSAIGYPFDHAWKIWGSHYYSSFMISF  433


>SNF12_DICDI unnamed protein product
Length=456

 Score = 33.1 bits (74),  Expect = 0.54, Method: Compositional matrix adjust.
 Identities = 27/94 (29%), Positives = 43/94 (46%), Gaps = 6/94 (6%)

Query  117  HIPKKYCKYMGIFLPSLFIITYCEFTMSSIVWHKIRSVVMTMAMKTISIAIDRSDTNDLP  176
            H+P+KY K +G     L I T  +  +   +WH I+S  + +  +T  I  D     +L 
Sbjct  234  HVPQKY-KVLGGLSQLLNIHTDTKPRIILALWHYIKSNTL-LDAETKKITCDE----NLK  287

Query  177  NIFAYMGYMFCSVTCLFGPWISFKDYISIRYTTH  210
            NIF+     F  +  L    +S  D +  +YT H
Sbjct  288  NIFSLEELQFNQIPQLLREHLSPPDPLEFQYTLH  321



Lambda      K        H
   0.319    0.136    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8012016630


Query= XP_003393065.1 cell division cycle protein 20 homolog [Bombus
terrestris]

Length=525
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q6NR32_DROME  unnamed protein product                                 596     0.0   
Q24044_DROME  unnamed protein product                                 595     0.0   
CDC20_DICDI  unnamed protein product                                  432     3e-147


>Q6NR32_DROME unnamed protein product
Length=526

 Score = 596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/539 (54%), Positives = 381/539 (71%), Gaps = 27/539 (5%)

Query  1    MSHLKYMKEINNLTRMDETIKGPLPRWQKKCLETSNSSVNLSINSSRKITNGSFTNSTTG  60
            MS   ++ ++ N   MD   +GP PRW+KK LE   +S+N S+N++R + + S+  S +G
Sbjct  1    MSQFNFVSDLQNALIMDGETRGPAPRWKKK-LE---ASLNGSVNTTRSVLSVSYNTSFSG  56

Query  61   -KTPTKKSDTRMKKTPSKTSK-KSPSRASTPAKTPSGGDRFIPSRATTNFDLGYYKIQQQ  118
             + PTK        TP K+S+ K+    +TP+KTP GGDRFIP+RA TNF+L ++ + + 
Sbjct  57   VQAPTK--------TPGKSSEGKTKKSNTTPSKTPGGGDRFIPNRAATNFELAHFLVNKD  108

Query  119  PNTEKNEEKV---------DNISPS--KREMQRLMGENLHGGDINQMRVLSYQNKAPAPP  167
               + +EE            N+  S  K + Q+L+ E    GD    R+L YQNKAPA P
Sbjct  109  SGDKSDEENYKATSSNSNESNVQASAHKGDRQKLISEVAQVGDSKGGRILCYQNKAPAAP  168

Query  168  EGYQNPLRVVYSQSKTPASIKASTRHIPQTPDRILDAPEIVDDYYLNLIDWSENNILAVA  227
            E + NPL+VVYS  KTP S K+ +R+IP T +RILDAP+ ++DYYLNL+DWS +NI+AVA
Sbjct  169  ETHNNPLKVVYSI-KTPISTKSGSRYIPTTSERILDAPDFINDYYLNLMDWSADNIVAVA  227

Query  228  LGASVYLWNAATGTIEQLLELNGNDYVCSVAWIQEGPYLAVGTTVGNTELWDCSQIKRVR  287
            LG+ VYLWNA TG IEQL E    DY  S++WIQEG  LA+G + G  ELWDCS++KR+R
Sbjct  228  LGSCVYLWNAQTGNIEQLTEFEEGDYAGSLSWIQEGQILAIGNSTGAVELWDCSKVKRLR  287

Query  288  VMNGHAARVGSLSWNSHVLTSGCRAGQIVHHDVRQRDHLISTINAHAQEVCGLKWSPDGK  347
            VM+GH+ARVGSL+WNS +++SG R G IVHHDVR R+H +ST++ H QEVCGLKWS D K
Sbjct  288  VMDGHSARVGSLAWNSFLVSSGSRDGTIVHHDVRAREHKLSTLSGHTQEVCGLKWSTDFK  347

Query  348  YLASGGNDNMLQIWPSISVQSHSNTQPIYSLNQHQAAVKALAWCPWQNNILASGGGTADR  407
            YLASGGNDN++ +W + S    + T P++  N HQAAV+ALAWCPWQ + LASGGGTADR
Sbjct  348  YLASGGNDNLVNVWSAASGGVGTATDPLHKFNDHQAAVRALAWCPWQPSTLASGGGTADR  407

Query  408  TIRFWNCNTGACLNMVDTKSQVCSLLWSTTYKEIVSGHGYAQNQLTIWKYPAMTKVAELT  467
             I+FWN N G  +  VD+KSQVCSLL+S  YKE++S HG+A NQLTIWKYP M K A+LT
Sbjct  408  CIKFWNVNNGTLMKSVDSKSQVCSLLFSRHYKELISAHGFANNQLTIWKYPTMVKQADLT  467

Query  468  GHSSRVLHLAMSPDGTTILSAGADETLRLWKCFLPDP-HKKKDTNEIKSVASRLKQSIR  525
            GH+SRVL +AMSPDG+T++SAGADETLRLW CF PDP   KK  +  K   S  +QSIR
Sbjct  468  GHTSRVLQMAMSPDGSTVISAGADETLRLWNCFAPDPLASKKAVSTSKGKQSVFRQSIR  526


>Q24044_DROME unnamed protein product
Length=526

 Score = 595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/539 (54%), Positives = 381/539 (71%), Gaps = 27/539 (5%)

Query  1    MSHLKYMKEINNLTRMDETIKGPLPRWQKKCLETSNSSVNLSINSSRKITNGSFTNSTTG  60
            MS   ++ ++ N   MD   +GP PRW+KK LE   +S+N S+N++R + + S+  S +G
Sbjct  1    MSQFNFVSDLQNALIMDGETRGPAPRWKKK-LE---ASLNGSVNTTRSVLSVSYNTSFSG  56

Query  61   -KTPTKKSDTRMKKTPSKTSK-KSPSRASTPAKTPSGGDRFIPSRATTNFDLGYYKIQQQ  118
             + PTK        TP K+S+ K+    +TP+KTP GGDRFIP+RA TNF+L ++ + + 
Sbjct  57   VQAPTK--------TPGKSSEGKTKKSNTTPSKTPGGGDRFIPNRAATNFELAHFLVNKD  108

Query  119  PNTEKNEEK---------VDNISPS--KREMQRLMGENLHGGDINQMRVLSYQNKAPAPP  167
               + +EE            N+  S  K + Q+L+ E    GD    R+L YQNKAPA P
Sbjct  109  SGDKSDEENDKATSSNSNESNVQASAHKGDRQKLISEVAQVGDSKGGRILCYQNKAPAAP  168

Query  168  EGYQNPLRVVYSQSKTPASIKASTRHIPQTPDRILDAPEIVDDYYLNLIDWSENNILAVA  227
            E + NPL+VVYS  KTP S K+ +R+IP T +RILDAP+ ++DYYLNL+DWS +NI+AVA
Sbjct  169  ETHNNPLKVVYSI-KTPISTKSGSRYIPTTSERILDAPDFINDYYLNLMDWSADNIVAVA  227

Query  228  LGASVYLWNAATGTIEQLLELNGNDYVCSVAWIQEGPYLAVGTTVGNTELWDCSQIKRVR  287
            LG+ VYLWNA TG IEQL E    DY  S++WIQEG  LA+G + G  ELWDCS++KR+R
Sbjct  228  LGSCVYLWNAQTGNIEQLTEFEEGDYAGSLSWIQEGQILAIGNSTGAVELWDCSKVKRLR  287

Query  288  VMNGHAARVGSLSWNSHVLTSGCRAGQIVHHDVRQRDHLISTINAHAQEVCGLKWSPDGK  347
            VM+GH+ARVGSL+WNS +++SG R G IVHHDVR R+H +ST++ H QEVCGLKWS D K
Sbjct  288  VMDGHSARVGSLAWNSFLVSSGSRDGTIVHHDVRAREHKLSTLSGHTQEVCGLKWSTDFK  347

Query  348  YLASGGNDNMLQIWPSISVQSHSNTQPIYSLNQHQAAVKALAWCPWQNNILASGGGTADR  407
            YLASGGNDN++ +W + S    + T P++  N HQAAV+ALAWCPWQ + LASGGGTADR
Sbjct  348  YLASGGNDNLVNVWSAASGGVGTATDPLHKFNDHQAAVRALAWCPWQPSTLASGGGTADR  407

Query  408  TIRFWNCNTGACLNMVDTKSQVCSLLWSTTYKEIVSGHGYAQNQLTIWKYPAMTKVAELT  467
             I+FWN N G  +  VD+KSQVCSLL+S  YKE++S HG+A NQLTIWKYP M K A+LT
Sbjct  408  CIKFWNVNNGTLMKSVDSKSQVCSLLFSRHYKELISAHGFANNQLTIWKYPTMVKQADLT  467

Query  468  GHSSRVLHLAMSPDGTTILSAGADETLRLWKCFLPDP-HKKKDTNEIKSVASRLKQSIR  525
            GH+SRVL +AMSPDG+T++SAGADETLRLW CF PDP   KK  +  K   S  +QSIR
Sbjct  468  GHTSRVLQMAMSPDGSTVISAGADETLRLWNCFAPDPLASKKAVSTSKGKQSVFRQSIR  526


>CDC20_DICDI unnamed protein product
Length=499

 Score = 432 bits (1110),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 214/442 (48%), Positives = 293/442 (66%), Gaps = 39/442 (9%)

Query  97   DRFIPSRATTNFDLGYYKIQQQPNTEKNEEK-------------------VDNISPSKRE  137
            DRFIP++   N D+G++ + ++ +                          +++       
Sbjct  48   DRFIPNKM--NIDIGHFNLTKENSNPNPNAINNNSSTSTSTTATSSTTNNIESTLYKDTL  105

Query  138  MQRLMGENLHGGDINQMRVLSYQNKAPAP-PEGYQNPLRVVYSQSK-----TPASIKAST  191
              +L   N   GD+ + ++LS+++KAP        N LRV+YSQ++     T  S+K   
Sbjct  106  ANQLFESN--SGDL-ESKILSFKSKAPVGNVSSSTNSLRVLYSQNQVGSTPTDQSLKKQF  162

Query  192  RHIPQTPDRILDAPEIVDDYYLNLIDWSENNILAVALGASVYLWNAATGTIEQLLELNG-  250
            R IPQ P+RILDAP+IVDDYYLNL+DWS  N++A+ LG +VYLWNA T  I++L ++   
Sbjct  163  RQIPQQPERILDAPDIVDDYYLNLLDWSSQNVIAIPLGQTVYLWNATTSEIQRLFQVEQQ  222

Query  251  NDYVCSVAWIQEGPYLAVGTTVGNTELWDCSQIKRVRVMNGHAARVGSLSWNSHVLTSGC  310
            +DY+ S+ W ++G YLAVGT     +LWD +  K+VR + GHA RVG+L+WN ++L+SG 
Sbjct  223  DDYITSLQWTKDGNYLAVGTNSCTIQLWDVAHTKKVRELRGHAGRVGALAWNDYILSSGS  282

Query  311  RAGQIVHHDVRQRDHLISTINAHAQEVCGLKWSPDGKYLASGGNDNMLQIWPSISVQSHS  370
                I +HDVR ++H +ST++ H+QEVCGLKWS DG  LASGGNDN++ IW    + S +
Sbjct  283  SDTNIFNHDVRVQNHHVSTLSGHSQEVCGLKWSHDGGQLASGGNDNIINIW---DINSEN  339

Query  371  NTQPIYSLNQHQAAVKALAWCPWQNNILASGGGTADRTIRFWNCNTGACLNMVDTKSQVC  430
               P ++  QH AAV+ALAWCP+Q N+LA+GGG ADRTIRFWN  TG CLN VDT SQVC
Sbjct  340  FETPAHTFEQHTAAVRALAWCPFQPNLLATGGGAADRTIRFWNTITGVCLNTVDTMSQVC  399

Query  431  SLLWSTTYKEIVSGHGYAQNQLTIWKYPAMTKVAELTGHSSRVLHLAMSPDGTTILSAGA  490
            S+ WSTTY+E+VS HGY+QNQL +WKYP+M K AELTGH+SR LH A+SPDG T++SA A
Sbjct  400  SIQWSTTYRELVSSHGYSQNQLCVWKYPSMVKCAELTGHTSRALHTAISPDGETVVSASA  459

Query  491  DETLRLWKCF-----LPDPHKK  507
            DETLR W+ F     LP  ++K
Sbjct  460  DETLRFWRVFEKENKLPTANRK  481



Lambda      K        H
   0.319    0.136    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8012016630


Query= XP_003393067.3 LOW QUALITY PROTEIN: F-box only protein 44 [Bombus
terrestris]

Length=286
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q17962_CAEEL  unnamed protein product                                 76.6    1e-15
A8DYA6_DROME  unnamed protein product                                 39.7    0.002
A1Z8M8_DROME  unnamed protein product                                 39.3    0.003


>Q17962_CAEEL unnamed protein product
Length=384

 Score = 76.6 bits (187),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 74/311 (24%), Positives = 123/311 (40%), Gaps = 59/311 (19%)

Query  18   KSDNGLVLGGKYLPEELLAEIFCYVDYKSLLNCQLVCKLWKILIQT-YVWRKKAEISFGR  76
            K+D  +++  + +P E  + IF  +D KSLLNCQL C  +  LI +   W     I + R
Sbjct  15   KTDVPVIIDAETVPNECFSPIFRRLDKKSLLNCQLACHRFNDLISSDSFW-----IEYAR  69

Query  77   SLLLYKEVPWHVYYLMCKKKPFERNLVKNHSGECGRHKY----WKIISEGGDCWKV----  128
             L +   +P     L  ++   ++  V N   E     +     KI+  G     +    
Sbjct  70   ILNISNVLP----SLEWRRAATQKKFVGNEDNEIDTSSFNFNIKKIVLSGRGYSPITPLF  125

Query  129  --------ENPPVGVTPLPNNELIFEGKQF------------------CFVTSYRSCTKA  162
                    +N   G     +  +   G                     CFV S+   + +
Sbjct  126  ISHFENARDNTISGTLRSDDFSIRANGSGIHMERDGGNGCEPHPDVSKCFVFSFTESSIS  185

Query  163  QIIDLEVEGLTPYMLDELQPIIVVSEWYSCRWDCPALYECVIKL----------LGENNS  212
              IDL   G+ P++LD ++P I +++  + R DC A      +L           G   +
Sbjct  186  VFIDLVNSGIDPWILDHVRPRIRITQKVNHRNDCAARLSFAAQLNYHETQWIERFGHVQT  245

Query  213  VIDLFHFR-DSIEGE----KQNQWHQMSHEFKNYGPGLRKISFYHGGADKLFWAGHYGSK  267
            + +  H R  S+  E        W   + EF +Y  G+R ++  + G D+ FW G YG K
Sbjct  246  MSNTDHKRYKSVNKEWAQWTGQPWEDWTIEFDDYPSGIRHLTILNEGEDRQFWRGFYGPK  305

Query  268  MAGACVYVKIP  278
            +A   V V +P
Sbjct  306  VANIQVEVILP  316


>A8DYA6_DROME unnamed protein product
Length=651

 Score = 39.7 bits (91),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 28/52 (54%), Gaps = 1/52 (2%)

Query  28   KYLPEELLAEIFCYVDYKSLLNCQLVCKLWKIL-IQTYVWRKKAEISFGRSL  78
            K LP+E+L  +F Y+D  SL  C  VCK W +L +    W+K     F R +
Sbjct  241  KQLPKEVLLRVFSYLDVVSLCRCAQVCKYWNVLALDGSSWQKINLFDFQRDI  292


>A1Z8M8_DROME unnamed protein product
Length=464

 Score = 39.3 bits (90),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 28/52 (54%), Gaps = 1/52 (2%)

Query  28   KYLPEELLAEIFCYVDYKSLLNCQLVCKLWKIL-IQTYVWRKKAEISFGRSL  78
            K LP+E+L  +F Y+D  SL  C  VCK W +L +    W+K     F R +
Sbjct  54   KQLPKEVLLRVFSYLDVVSLCRCAQVCKYWNVLALDGSSWQKINLFDFQRDI  105



Lambda      K        H
   0.319    0.136    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8012016630


Query= XP_003393068.1 protein disulfide-isomerase A3 [Bombus terrestris]

Length=490
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q3YMU0_DROME  unnamed protein product                                 618     0.0   
G5ED07_CAEEL  unnamed protein product                                 470     6e-163
Q95T75_DROME  unnamed protein product                                 451     4e-157


>Q3YMU0_DROME unnamed protein product
Length=489

 Score = 618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/493 (61%), Positives = 380/493 (77%), Gaps = 7/493 (1%)

Query  1    MLLKYFTFLSLIFVNVLA-EEKDVVELTDDTFSHELERLENTLVMFYAPWCGHCKRLKPE  59
            M+ +    L L F+ + +  E+DV+EL DD F+  L++ E TLVMFYAPWCGHCKRLKPE
Sbjct  1    MMWRLAGVLLLGFIAISSGAEQDVLELGDDDFATTLKQHETTLVMFYAPWCGHCKRLKPE  60

Query  60   YAKAAEMLLGNDPPITLAKVDCTESGKDSCNKYSVSGYPTLKIFSRGDFVSDYNGPREAA  119
            YAKAAE++  +DPPI LAKVDCTE+GK++C+KYSVSGYPTLKIF + +   DYNGPREA+
Sbjct  61   YAKAAEIVKDDDPPIKLAKVDCTEAGKETCSKYSVSGYPTLKIFRQDEVSQDYNGPREAS  120

Query  120  GIAKYMKAQVGPASKELSGEACLKSFLDSDEVSVVGFFEKEDSALATSFHAVSKKLKEKV  179
            GIAKYM+AQVGPASK +   A LK FLD+ + ++ G+F   DS LA  F   + K +EK 
Sbjct  121  GIAKYMRAQVGPASKTVRTVAELKKFLDTKDTTLFGYFSDSDSKLAKIFLKFADKNREKY  180

Query  180  RFAHTTAKSLLEKEGHKNAIVLYRPKILQNKFESNTVEYV-ESMGDIQEFINKNYFGIAG  238
            RF H++ K +L+K+G  + IVL R   L NKFES+++++   S  D+  F+ +N+ G+ G
Sbjct  181  RFGHSSEKEVLDKQGETDKIVLIRAPHLSNKFESSSIKFEGSSESDLSTFVKENFHGLVG  240

Query  239  VRTRDNEREFKNPLVVAYYAVDYVKNPKGTNYWRNRIIKVAKDF-PKLNFAISSKDDFQH  297
             RT+D+ ++F+NPL+ AYY+VDY KNPKGTNYWRNR++KVAK+F  ++NFAI+SKDDFQH
Sbjct  241  HRTQDSVKDFQNPLITAYYSVDYQKNPKGTNYWRNRVLKVAKEFVGQINFAIASKDDFQH  300

Query  298  ELNDFGIDFVKGDKPVVLARNANNQKFVMKDEFSVDTFEAFLKDIEAGTLEPYLKSEPIP  357
            ELN++G DFV GDKPVVLAR+  N K+ +KDEFSV+  + F++ + A  LEPY+KSEPIP
Sbjct  301  ELNEYGYDFV-GDKPVVLARDEKNLKYALKDEFSVENLQDFVEKLLANELEPYIKSEPIP  359

Query  358  EDNTGDVKIGVARNFDEIVTNNNKDTLIEFYAPWCGHCKKLAPIYDELGEKLATEDVEIV  417
            E N   VK+ VA+NFD++V NN KDTLIEFYAPWCGHCKKL+PIY+EL EKL  EDV IV
Sbjct  360  ESNDAPVKVAVAKNFDDLVINNGKDTLIEFYAPWCGHCKKLSPIYEELAEKLQDEDVAIV  419

Query  418  KFDATANDVPAPYEVRGFPTLYWAPKNSKNNPVKYEGGRELDDFIKYIAKHATNELKGFD  477
            K DATANDVP  + VRGFPTL+W PK++KN PV Y GGRE+DDF+KYIAK AT ELKGFD
Sbjct  420  KMDATANDVPPEFNVRGFPTLFWLPKDAKNKPVSYNGGREVDDFLKYIAKEATTELKGFD  479

Query  478  RKGKTVKPKSDEL  490
            R G   KPK  EL
Sbjct  480  RSG---KPKKTEL  489


>G5ED07_CAEEL unnamed protein product
Length=488

 Score = 470 bits (1209),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 239/473 (51%), Positives = 323/473 (68%), Gaps = 11/473 (2%)

Query  23   VVELTDDTFSHELERLENTLVMFYAPWCGHCKRLKPEYAKAAEMLLGNDPPITLAKVDCT  82
            V+E TD  F   ++  +  LV FYAPWCGHCK++ PEY +AA  L  NDPP+ L KVDCT
Sbjct  22   VLEYTDGNFDDLIQTHDIALVKFYAPWCGHCKKIAPEYERAAPKLASNDPPVALVKVDCT  81

Query  83   ESGKDSCNKYSVSGYPTLKIFSRGDFVSDYNGPREAAGIAKYMKAQVGPASKELSGEACL  142
             + K  C+K+ V G+PTLKIF  G    DY+GPR+A GI K+M+ Q GP+SKEL   A  
Sbjct  82   -TEKTVCDKFGVKGFPTLKIFRNGVPAQDYDGPRDADGIVKFMRGQSGPSSKELKTVAEF  140

Query  143  KSFLDSDEVSVVGFFEKEDSALATSFHAVSKKLKEKVRFAHTTAKSLLEKEGHKNAIVLY  202
            + F   DE  V+GFFE E S L  S+  V+   +++  FAHT+ K +++K G+ + +V++
Sbjct  141  EKFTGGDENVVIGFFESE-SKLKDSYLKVADTERDRFSFAHTSNKDIIKKAGYSDDVVVF  199

Query  203  RPKILQNKFESNTVEYVES--MGDIQEFINKNYFGIAGVRTRDNEREF-KNPLVVAYYAV  259
             PK L NKF++N  +Y  +     I+ F+     G AG+RT+ N  +F + P+V+ YY V
Sbjct  200  VPKKLHNKFDTNEFKYDGNYDTDKIKNFLVHETVGFAGIRTQGNLFQFEQKPIVIVYYNV  259

Query  260  DYVKNPKGTNYWRNRIIKVAKDFP-KLNFAISSKDDFQHELNDFGIDFVK-GDKPVVLAR  317
            DYVK+PKG+NYWRNR++KVA+++  K+ FA+S+K++F  E+   G+   K  DKP+V A 
Sbjct  260  DYVKDPKGSNYWRNRVLKVAQNYKRKVQFAVSNKEEFSSEIETNGLGERKDSDKPIV-AI  318

Query  318  NANNQKFVMKDEFSVDTFEAFLKDIEAGTLEPYLKSEPIPEDNTGDVKIGVARNFDEIVT  377
              N  K+ M  EFSVD  + F+ ++ AG  EPY+KSEPIP D  GDVK+ V +NF E++ 
Sbjct  319  LTNEGKYPMDQEFSVDNLQQFVDEVLAGNAEPYMKSEPIP-DEQGDVKVAVGKNFKELIM  377

Query  378  NNNKDTLIEFYAPWCGHCKKLAPIYDELGEKLATEDVEIVKFDATANDVPAPYEVRGFPT  437
            + +KD LIEFYAPWCGHCK LAP Y+EL EKL  EDV I K DATANDVP  +EVRGFPT
Sbjct  378  DADKDVLIEFYAPWCGHCKSLAPKYEELAEKLNKEDVIIAKMDATANDVPPMFEVRGFPT  437

Query  438  LYWAPKNSKNNPVKYEGGRELDDFIKYIAKHATNELKGFDRKGKTVKPKSDEL  490
            L+W PKN+K+NP+ Y GGRE+ DF+ +I+KH+T+ LKGF R GK  K K  EL
Sbjct  438  LFWLPKNAKSNPIPYNGGREVKDFVSFISKHSTDGLKGFSRDGK--KKKKTEL  488


>Q95T75_DROME unnamed protein product
Length=364

 Score = 451 bits (1159),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 219/368 (60%), Positives = 280/368 (76%), Gaps = 6/368 (2%)

Query  125  MKAQVGPASKELSGEACLKSFLDSDEVSVVGFFEKEDSALATSFHAVSKKLKEKVRFAHT  184
            M+AQVGPASK +   A LK FLD+ + ++ G+F   DS LA  F   + K +EK RF H+
Sbjct  1    MRAQVGPASKTVRTVAELKKFLDTKDTTLFGYFSDSDSKLAKIFLKFADKNREKYRFGHS  60

Query  185  TAKSLLEKEGHKNAIVLYRPKILQNKFESNTVEYV-ESMGDIQEFINKNYFGIAGVRTRD  243
            + K +L+K+G  + IVL R   L NKFES+++++   S  D+  F+ +N+ G+ G RT+D
Sbjct  61   SEKEVLDKQGETDKIVLIRAPHLSNKFESSSIKFEGSSESDLSTFVKENFHGLVGHRTQD  120

Query  244  NEREFKNPLVVAYYAVDYVKNPKGTNYWRNRIIKVAKDF-PKLNFAISSKDDFQHELNDF  302
            + ++F+NPL+ AYY+VDY KNPKGTNYWRNR++KVAK+F  ++NFAI+SKDDFQHELN++
Sbjct  121  SVKDFQNPLITAYYSVDYQKNPKGTNYWRNRVLKVAKEFVGQINFAIASKDDFQHELNEY  180

Query  303  GIDFVKGDKPVVLARNANNQKFVMKDEFSVDTFEAFLKDIEAGTLEPYLKSEPIPEDNTG  362
            G DFV GDKPVVLAR+  N K+ +KDEFSV+  + F++ + A  LEPY+KSEPIPE N  
Sbjct  181  GYDFV-GDKPVVLARDEKNLKYALKDEFSVENLQDFVEKLLANELEPYIKSEPIPESNDA  239

Query  363  DVKIGVARNFDEIVTNNNKDTLIEFYAPWCGHCKKLAPIYDELGEKLATEDVEIVKFDAT  422
             VK+ VA+NFD++V NN KDTLIEFYAPWCGHCKKL+PIY+EL EKL  EDV IVK DAT
Sbjct  240  PVKVAVAKNFDDLVINNGKDTLIEFYAPWCGHCKKLSPIYEELAEKLQDEDVAIVKMDAT  299

Query  423  ANDVPAPYEVRGFPTLYWAPKNSKNNPVKYEGGRELDDFIKYIAKHATNELKGFDRKGKT  482
            ANDVP  + VRGFPTL+W PK++KN PV Y GGRE+DDF+KYIAK AT ELKGFDR G  
Sbjct  300  ANDVPPEFNVRGFPTLFWLPKDAKNKPVSYNGGREVDDFLKYIAKEATTELKGFDRSG--  357

Query  483  VKPKSDEL  490
             KPK  EL
Sbjct  358  -KPKKTEL  364


 Score = 67.0 bits (162),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 58/103 (56%), Gaps = 11/103 (11%)

Query  39   ENTLVMFYAPWCGHCKRLKPEYAKAAEMLLGNDPPITLAKVDCTESGKDSCNKYSVSGYP  98
            ++TL+ FYAPWCGHCK+L P Y + AE L   D  + + K+D T    D   +++V G+P
Sbjct  258  KDTLIEFYAPWCGHCKKLSPIYEELAEKL--QDEDVAIVKMDAT--ANDVPPEFNVRGFP  313

Query  99   TLKIF---SRGDFVSDYNGPREAAGIAKYMKAQVGPASKELSG  138
            TL      ++   VS YNG RE     KY+  +   A+ EL G
Sbjct  314  TLFWLPKDAKNKPVS-YNGGREVDDFLKYIAKE---ATTELKG  352



Lambda      K        H
   0.319    0.136    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8012016630


Query= XP_003393069.1 5-aminolevulinate synthase, erythroid-specific,
mitochondrial [Bombus terrestris]

Length=532
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8T4G6_DROME  unnamed protein product                                 639     0.0  
O18680_DROME  unnamed protein product                                 639     0.0  
Q8I4X1_PLAF7  unnamed protein product                                 283     5e-88


>Q8T4G6_DROME unnamed protein product
Length=539

 Score = 639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/505 (63%), Positives = 379/505 (75%), Gaps = 21/505 (4%)

Query  26   MPCPFLTHLSANYIRNYGASVIMNYRQLCPVMSQ----------FFSTQVNNTESEQIEK  75
            M CPFL   +A++IRNY  ++  +Y   CPV+ +            +  V  + S     
Sbjct  1    MQCPFLNRFTASFIRNYAETLCQSYGSHCPVVGKTLVSGEKKLLLVAASVTRSHSTGANA  60

Query  76   AINSQCPFLAKEQNAVKVASPMVEEDIINVSPLESKEKGSFPYEEFFHEQIMKKKKDHSY  135
              N+  P  A   NA    S     D     P ++  K +FPYE FF+EQIMKKK+DHSY
Sbjct  61   HANAGGPATA---NATAPVSAPASAD-----PGKASAKETFPYERFFNEQIMKKKRDHSY  112

Query  136  RVFKKVNRLAES--FPIGIEYS-WGEKPITVWCSNDYLGMSRHPAVTNSVREALNKFGAG  192
            RVFKKVNRLA    FP  +EYS   EKPITVWCSNDYLGMS HP V  +V++ALN+ G+G
Sbjct  113  RVFKKVNRLAGDGLFPHALEYSERTEKPITVWCSNDYLGMSAHPGVKRAVQDALNRHGSG  172

Query  193  AGGTRNISGNSVGHEILEKRLASLHQKEAGLLFTSCFVANDSTLYTLAKLLPHCHIFSDA  252
            AGGTRNISGNS+ HE LE +LA LHQKEA LLFTSCFVANDSTL+TLAKLLP C IFSDA
Sbjct  173  AGGTRNISGNSLHHERLESKLAELHQKEAALLFTSCFVANDSTLFTLAKLLPGCEIFSDA  232

Query  253  GNHASMIQGIRNSGVPKHIFRHNDVKHLEELLSKVDKTVPKIVAFETVHSMTGDICPLGD  312
            GNHASMI GIRNSGVPKHIFRHNDV HL +LL + DK+VPKIVAFETVHSMTG ICPL +
Sbjct  233  GNHASMIMGIRNSGVPKHIFRHNDVDHLHQLLKQTDKSVPKIVAFETVHSMTGAICPLEE  292

Query  313  LCDIAHKYNALTFVDEVHAVGLYGYSGAGIGERDRVLHKMDIISGTLGKAFGNMGGYIVG  372
            L D+AH++ A+TF+DEVHAVGLYG  GAG+GERD VLHKMDIISGTLGKAFGN+GGYI G
Sbjct  293  LLDVAHEHGAITFIDEVHAVGLYGDHGAGVGERDGVLHKMDIISGTLGKAFGNIGGYIAG  352

Query  373  STKLIDMIRSYAAGFIFTTSLPPTVLYGTLTAVEILTSDEGRSLRASHQKNVAYMKSILT  432
            +  L+DMIRSYAAGFIFTTSLPPTVL G L AV IL S+EGR LR  HQ+NV+Y+KS+L 
Sbjct  353  THNLVDMIRSYAAGFIFTTSLPPTVLCGALEAVNILASEEGRQLRHLHQRNVSYLKSLLK  412

Query  433  AAGLPLEQSPSHIIPIKIGDPLLCSQLADLLIKDKGHYVQAINYPTVPKGEEKLRLAPTP  492
              G P+E++PSHIIPIKIGDPL  SQ++++LI+  GHY+Q+INYPTV +G+EKLRLAPTP
Sbjct  413  REGFPVEETPSHIIPIKIGDPLKSSQISNVLIEQFGHYLQSINYPTVARGQEKLRLAPTP  472

Query  493  KHTLSMMDQFVKDILHVFHRLNIPT  517
             HT  MM+  V D+  V+  +++ T
Sbjct  473  FHTFEMMNALVTDLKKVWEMVDLST  497


>O18680_DROME unnamed protein product
Length=539

 Score = 639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/505 (63%), Positives = 379/505 (75%), Gaps = 21/505 (4%)

Query  26   MPCPFLTHLSANYIRNYGASVIMNYRQLCPVMSQ----------FFSTQVNNTESEQIEK  75
            M CPFL   +A++IRNY  ++  +Y   CPV+ +            +  V  + S     
Sbjct  1    MQCPFLNRFTASFIRNYAETLCQSYGSHCPVVGKTLVSGEKKLSLVAASVTRSHSTGANA  60

Query  76   AINSQCPFLAKEQNAVKVASPMVEEDIINVSPLESKEKGSFPYEEFFHEQIMKKKKDHSY  135
              N+  P  A   NA    S     D     P ++  K +FPYE FF+EQIMKKK+DHSY
Sbjct  61   HANAGGPATA---NATAPVSAPASAD-----PGKASAKETFPYERFFNEQIMKKKRDHSY  112

Query  136  RVFKKVNRLAES--FPIGIEYS-WGEKPITVWCSNDYLGMSRHPAVTNSVREALNKFGAG  192
            RVFKKVNRLA    FP  +EYS   EKPITVWCSNDYLGMS HP V  +V++ALN+ G+G
Sbjct  113  RVFKKVNRLAGDGLFPHALEYSERTEKPITVWCSNDYLGMSAHPGVKRAVQDALNRHGSG  172

Query  193  AGGTRNISGNSVGHEILEKRLASLHQKEAGLLFTSCFVANDSTLYTLAKLLPHCHIFSDA  252
            AGGTRNISGNS+ HE LE +LA LHQKEA LLFTSCFVANDSTL+TLAKLLP C IFSDA
Sbjct  173  AGGTRNISGNSLHHERLESKLAELHQKEAALLFTSCFVANDSTLFTLAKLLPGCEIFSDA  232

Query  253  GNHASMIQGIRNSGVPKHIFRHNDVKHLEELLSKVDKTVPKIVAFETVHSMTGDICPLGD  312
            GNHASMI GIRNSGVPKHIFRHNDV HL +LL + DK+VPKIVAFETVHSMTG ICPL +
Sbjct  233  GNHASMIMGIRNSGVPKHIFRHNDVDHLHQLLKQTDKSVPKIVAFETVHSMTGAICPLEE  292

Query  313  LCDIAHKYNALTFVDEVHAVGLYGYSGAGIGERDRVLHKMDIISGTLGKAFGNMGGYIVG  372
            L D+AH++ A+TF+DEVHAVGLYG  GAG+GERD VLHKMDIISGTLGKAFGN+GGYI G
Sbjct  293  LLDVAHEHGAITFIDEVHAVGLYGDHGAGVGERDGVLHKMDIISGTLGKAFGNIGGYIAG  352

Query  373  STKLIDMIRSYAAGFIFTTSLPPTVLYGTLTAVEILTSDEGRSLRASHQKNVAYMKSILT  432
            +  L+DMIRSYAAGFIFTTSLPPTVL G L AV IL S+EGR LR  HQ+NV+Y+KS+L 
Sbjct  353  THNLVDMIRSYAAGFIFTTSLPPTVLCGALEAVNILASEEGRQLRHLHQRNVSYLKSLLK  412

Query  433  AAGLPLEQSPSHIIPIKIGDPLLCSQLADLLIKDKGHYVQAINYPTVPKGEEKLRLAPTP  492
              G P+E++PSHIIPIKIGDPL  SQ++++LI+  GHY+Q+INYPTV +G+EKLRLAPTP
Sbjct  413  REGFPVEETPSHIIPIKIGDPLKSSQISNVLIEQFGHYLQSINYPTVARGQEKLRLAPTP  472

Query  493  KHTLSMMDQFVKDILHVFHRLNIPT  517
             HT  MM+  V D+  V+  +++ T
Sbjct  473  FHTFEMMNALVTDLKKVWEMVDLST  497


>Q8I4X1_PLAF7 unnamed protein product
Length=630

 Score = 283 bits (725),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 159/387 (41%), Positives = 230/387 (59%), Gaps = 9/387 (2%)

Query  140  KVNRLAESFPIGIEYSWGEKPITVWCSNDYLGMSRHPAVTNSVREALNKFGAGAGGTRNI  199
            K N L   + + I+    EK + VWCSNDYL +S +  +     E L K G  +GGTRNI
Sbjct  240  KENYLFNFWNLHIDNVSNEKTV-VWCSNDYLCLSNNEKIIEVGIETLKKIGNSSGGTRNI  298

Query  200  SGNSVGHEILEKRLASLHQKEAGLLFTSCFVANDSTLYTLAKLLPHCHIFSDAGNHASMI  259
            SG+ + H  LE  +A  + KE+ LLFTS ++AN   L TL KLL   +I SD  NHAS+I
Sbjct  299  SGSLLNHTHLEYIIAKWYNKESSLLFTSGYIANVGALETLGKLLNLIYI-SDEMNHASII  357

Query  260  QGIRNSGVPKHIFRHNDVKHLEELLS--KVDKTVPK---IVAFETVHSMTGDICPLGDLC  314
             GIR S   K IF+HND+  LE +L   +++K       ++ FE+++SM+G I  +  + 
Sbjct  358  NGIRESRCEKFIFKHNDMNDLERILYNLRINKQYENRKIMIVFESIYSMSGHISNIEYIV  417

Query  315  DIAHKYNALTFVDEVHAVGLYGYSGAGIGERDRVLHKMDIISGTLGKAFGNMGGYIVGST  374
             +A KYNALT+VDEVHAVGLYG  G+G  E   + + +DII+GTL KA G++GG+I  + 
Sbjct  418  QLAKKYNALTYVDEVHAVGLYGNKGSGYLEELHLCNHIDIINGTLSKAIGSLGGFICANK  477

Query  375  KLIDMIRSYAAGFIFTTSLPPTVLYGTLTAVEILTSDEGRSLRASHQKNVAYMKSILTAA  434
              ID+IRSY++ FIFTTSL P  +  +  A+ I+ +D   SLR    + V   K  L   
Sbjct  478  YYIDVIRSYSSHFIFTTSLTPVNINTSAEAIHIIQND--MSLRKKLTQVVNKTKQKLQER  535

Query  435  GLPLEQSPSHIIPIKIGDPLLCSQLADLLIKDKGHYVQAINYPTVPKGEEKLRLAPTPKH  494
            G+ +  + SHI+ + I     C Q+ D L+K+   Y+Q INYPTVP G E++R+ P+P H
Sbjct  536  GIQVLHNNSHIVVLMINSAEKCKQICDDLLKEYNIYIQPINYPTVPMGMERIRITPSPFH  595

Query  495  TLSMMDQFVKDILHVFHRLNIPTVEHK  521
            T   + + V  +  +F +  +   + K
Sbjct  596  TDEQIFKLVNSLYTLFKKYQVNMFDKK  622



Lambda      K        H
   0.319    0.136    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8012016630


Query= XP_003393070.1 60S ribosomal protein L18a [Bombus terrestris]

Length=177
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q382C4_TRYB2  unnamed protein product                                 122     2e-35
INA1_CAEEL  unnamed protein product                                   30.0    1.3  


>Q382C4_TRYB2 unnamed protein product
Length=179

 Score = 122 bits (305),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 58/153 (38%), Positives = 97/153 (63%), Gaps = 2/153 (1%)

Query  6    ELKEFEVIGRKLPTEKETTTPLYKMRIFAPDAIVAKSRFWYFLRQLKKFKKSTGEIVSLK  65
             L+ + V+GR+ P+EK     +YK  +FAP+ +VAKSRFW  +R+  K K + G+++S K
Sbjct  5    HLRHYCVVGRETPSEKNPQPTVYKFEVFAPNFVVAKSRFWRMMREKNKVKSTHGDVLSCK  64

Query  66   QIPEKSPVKIKNFGIWLRYDS-RSGTHNMYREYRDLSVSGAVTQCYRDMGARHRARAHSI  124
             + ++  +  +N+ + + Y S R G  +M +E+RD+  +GAV+Q Y D+ +RHRAR H+I
Sbjct  65   VVKDRK-LAARNYSVDIAYYSQRCGYTHMVKEFRDVCKAGAVSQAYNDLASRHRARYHNI  123

Query  125  QIIKVEVVKAANCRRPQVKQFHDSKIKFPLPKR  157
            +++ V+ +     RR  V QFH   + FPL +R
Sbjct  124  EVLGVKSIPNHEVRRLNVAQFHPHNLSFPLLQR  156


>INA1_CAEEL unnamed protein product
Length=1139

 Score = 30.0 bits (66),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 35/154 (23%), Positives = 61/154 (40%), Gaps = 26/154 (17%)

Query  16   KLPTEKETTTPLYKMRIFAPDAIVAKSRFWYFL--RQLKKFKKSTGEIVSLKQIPEKSPV  73
            KL       + L    + AP A       + +L  + ++KF+K   +++    +P   P 
Sbjct  398  KLGNVDGDKSKLNDFAVGAPFAFDGAGAVYIYLGTKNIEKFRKKPAQVIKGNDLPNLPPG  457

Query  74   KIKNFGIWLRYDSRSGTHNMYRE-YRDLSVSGAVTQCYRDMGARHRARA-------HSIQ  125
             +++FG      S SG  +M    Y DL +        ++  A  R+R        H ++
Sbjct  458  GMRSFGF-----SLSGGSDMDENGYPDLLIGSPS----KNFVALLRSRPVISIETKHKME  508

Query  126  IIKVEVVKAANCRRPQVKQFHDSKIKFPLPKRIH  159
               V++ K  NC R        +K  FPL   I+
Sbjct  509  KRMVDIDKGVNCPR-------GAKTCFPLDMVIY  535



Lambda      K        H
   0.319    0.136    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8012016630


Query= XP_003393071.1 small glutamine-rich tetratricopeptide
repeat-containing protein alpha isoform X2 [Bombus terrestris]

Length=299
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q21746_CAEEL  unnamed protein product                                 221     2e-70
Q9VJD4_DROME  unnamed protein product                                 162     1e-47
SGT_DICDI  unnamed protein product                                    142     6e-40


>Q21746_CAEEL unnamed protein product
Length=337

 Score = 221 bits (563),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 136/327 (42%), Positives = 198/327 (61%), Gaps = 50/327 (15%)

Query  6    LVAAIVQFLTQQLEEGDITADSRESLEVAIQCLESAYNVQASDTPTNFN----LYEIYKS  61
            LV + +QF+ Q++ +   TA+  E+LEVAIQCLE ++ +   D    F     + E++KS
Sbjct  26   LVVSFLQFIRQKVSQNQATAEQAEALEVAIQCLEHSFGL--DDASYAFQPSRPILELFKS  83

Query  62   SI-----ENAKPNLAPEATP-EAKI-EAERLKNEGNALMKAEKHHEALTNYTKAIQLDGR  114
            +      E+A P      TP ++ I +A +LK EGN LMKA +   A+  Y  AI+L+ R
Sbjct  84   AEGLPEGESALP------TPSDSDISQANKLKEEGNDLMKASQFEAAVQKYNAAIKLN-R  136

Query  115  NAVYYCNRAAAHSKIGNYQQAIKDCHTALSIDPSYSKAYGRLGLAYSSLQRHKEAKESYQ  174
            + VY+CNRAAA+ ++  Y  AI+DC TAL++DPSYSKA+GR+GLAYS   R++ A E+Y+
Sbjct  137  DPVYFCNRAAAYCRLEQYDLAIQDCRTALALDPSYSKAWGRMGLAYSCQNRYEHAAEAYK  196

Query  175  KALEMEPDNESYKNNLQVAEEKLAQPSMNNMGLSGGTLP--------------------G  214
            KALE+EP+ ESYKNNL++AE+KL +  + +   + G  P                     
Sbjct  197  KALELEPNQESYKNNLKIAEDKLKE--LESSRPAPGANPLAGLLGAMGGGPGGMPAMPGM  254

Query  215  MDLSSLLSNPALMNMARQMLSNPALQNMVSNFMSGQVEQGGHMDALIEAGQHFAQQLQNA  274
             ++ +L++ P LM  A QM+S+PAL +M +N MSG     G +  L+ AGQ  A ++Q  
Sbjct  255  PNMQNLMNEPGLMQAASQMMSDPALSDMFNNMMSG----NGSIADLMAAGQQMAARMQET  310

Query  275  NPELIESLRRQMG----GNPNDPDPPQ  297
            NPELIE+LRRQ G    G    P+PPQ
Sbjct  311  NPELIENLRRQFGPGADGGAPPPNPPQ  337


>Q9VJD4_DROME unnamed protein product
Length=331

 Score = 162 bits (410),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 99/290 (34%), Positives = 154/290 (53%), Gaps = 71/290 (24%)

Query  4    KGLVAAIVQFLTQQLEEGDI-TADSRESLEVAIQCLESAYNV------------------  44
            +  V + + +L +Q   GD+ + D  ES+EVAIQCL++A+++                  
Sbjct  7    QSFVRSFIDYLKKQ---GDVMSPDQTESIEVAIQCLQAAFDLGDDVEAAPAAAGEEQATT  63

Query  45   QASDT-----------------------PTNFNLYEIYKSSIENAKPNLAPEATPEAKIE  81
            Q+S T                       P N +++E+++S        L  E  PE+   
Sbjct  64   QSSSTASAPDDDAVASGSAGIGAAAAAVPNNIDMFELFQS--------LYTERNPESLAL  115

Query  82   AERLKNEGNALMKAEKHHEALTNYTKAIQLDGRNAVYYCNRAAAHSKIGNYQQAIKDCHT  141
            AE +KNEGN LMK  K++EAL  Y +AI  D +N ++YCNRAAAH ++G  ++A+ DC +
Sbjct  116  AESIKNEGNRLMKENKYNEALLQYNRAIAFDPKNPIFYCNRAAAHIRLGENERAVTDCKS  175

Query  142  ALSIDPSYSKAYGRLGLAYSSLQRHKEAKESYQKALEMEPDNESYKNNLQVAEEK-----  196
            AL  + +YSKAY RLG+AYS++   ++A+++Y KA+E+EPDNE YK+NL+ A        
Sbjct  176  ALVYNNNYSKAYCRLGVAYSNMGNFEKAEQAYAKAIELEPDNEVYKSNLEAARNARNQPP  235

Query  197  ------------LAQPSMNNMGLSGGTLPGMDLSSLLSNPALMNMARQML  234
                        L+QP + N+  +   +    L S+L NP +MN  RQ  
Sbjct  236  QTGRLREDLINMLSQPMVRNL-FNNAEIDVEQLLSMLQNPMIMNTIRQQF  284


>SGT_DICDI unnamed protein product
Length=334

 Score = 142 bits (358),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 78/180 (43%), Positives = 114/180 (63%), Gaps = 18/180 (10%)

Query  77   EAKIEAERLKNEGNALMKAEKHHEALTNYTKAIQLDGRNAVYYCNRAAAHSKIGNYQQAI  136
            E K  AE+LKNEGNA +   KH EAL+ Y KAI  D  NA+Y+ NRAA +S + N++++I
Sbjct  140  EVKAIAEKLKNEGNAKLNEGKHQEALSCYNKAILYDNTNAIYFANRAATYSALQNFEKSI  199

Query  137  KDCHTALSIDPSYSKAYGRLGLAYSSLQRHKEAKESYQKALEMEPDNESYKNNLQVAEEK  196
            +DC  A+  +P+Y KAY R+G AY+SL +  EA E+Y KA+E+EP+NE++K +L  AE  
Sbjct  200  EDCLEAIKRNPNYGKAYTRMGSAYTSLGKFSEAMEAYNKAIELEPNNETFKASLANAERL  259

Query  197  LAQ-----------PSMNNMGLSGGTLPGMDLSSLLSNPALMNMARQMLSNPALQNMVSN  245
             A            P M ++G       G+D  SLLSNPA+  +A  ++S+P ++ M+ N
Sbjct  260  AAAANNQAPAMPNIPGMPDLG-------GLDFGSLLSNPAIRGLANNLMSDPKMKEMMDN  312



Lambda      K        H
   0.319    0.136    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8012016630


Query= XP_003393073.1 guanine nucleotide-binding protein G(i) subunit alpha
[Bombus terrestris]

Length=356
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GNAI_DROME  unnamed protein product                                   627     0.0   
GNAO_CAEEL  unnamed protein product                                   477     6e-170
GPA16_CAEEL  unnamed protein product                                  474     8e-169


>GNAI_DROME unnamed protein product
Length=355

 Score = 627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/355 (84%), Positives = 323/355 (91%), Gaps = 0/355 (0%)

Query  1    MGCAVSTIGEKEAAERSKKIDKDLRADGERAASEVKLLLLGAGESGKSTIVKQMKIIHET  60
            MGCAVST  +KEA ERSK ID+ LRA+GERAASEVKLLLLGAGESGKSTIVKQMKIIH+T
Sbjct  1    MGCAVSTARDKEAIERSKNIDRALRAEGERAASEVKLLLLGAGESGKSTIVKQMKIIHDT  60

Query  61   GYSNEECEQYKPVVCSNTVQSLMTIIRAMGQLRIDFADPNKADIARQFFTLASAAEEGEL  120
            GYS EECE+Y+ VV SNTVQSLM IIRAMG+L+I+FADP++ DIARQFFT ASAA+EG L
Sbjct  61   GYSQEECEEYRRVVFSNTVQSLMVIIRAMGRLKIEFADPSRTDIARQFFTHASAADEGIL  120

Query  121  TGELALLMKRLWQDAGVQLCFTRSREYQLNDSAAYYLNALDRIAQPNYIPTQQDVLRTRV  180
              E+ LLMK+LW D GVQ  F RSREYQLNDSA YYLN+LDRIAQPNYIPTQQDVLRTRV
Sbjct  121  LPEIVLLMKKLWADGGVQQSFARSREYQLNDSAGYYLNSLDRIAQPNYIPTQQDVLRTRV  180

Query  181  KTTGIVETHFSFKGLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSGYDLVLAEDEE  240
            KTTGI+ETHFS K LHFK+FDVGGQRSERKKWIHCFEGVTAIIFCVALSGYDLVLAEDEE
Sbjct  181  KTTGIIETHFSCKQLHFKLFDVGGQRSERKKWIHCFEGVTAIIFCVALSGYDLVLAEDEE  240

Query  241  MNRMIESMKLFDSICNSKWFVETSIILFLNKKDLFEEKITRSPLTICFPEYKGANTYEEC  300
            MNRMIES+KLFDSICNSKWFVETSIILFLNKKDLFEEKI RSPLTICFPEY G NT+EE 
Sbjct  241  MNRMIESLKLFDSICNSKWFVETSIILFLNKKDLFEEKIKRSPLTICFPEYTGTNTFEEA  300

Query  301  ASYIQMKFENLNKRKDQKQIYTHFTCATDTSNIQFVFDAVTDVIIKNNLSNCGLL  355
            A+YI+MKFENLNKRKDQK+IYTH TCATDT+N++FVFDAVTDVIIKNNL   GL 
Sbjct  301  ANYIRMKFENLNKRKDQKEIYTHLTCATDTNNVKFVFDAVTDVIIKNNLKQIGLF  355


>GNAO_CAEEL unnamed protein product
Length=354

 Score = 477 bits (1228),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 234/355 (66%), Positives = 280/355 (79%), Gaps = 3/355 (1%)

Query  1    MGCAVSTIGEKEAAERSKKIDKDLRADGERAASEVKLLLLGAGESGKSTIVKQMKIIHET  60
            MGC +S   E+ A ERS+ I+K+L+ DG +AA ++KLLLLGAGESGKSTIVKQMKIIHE+
Sbjct  1    MGCTMSQ-EERAALERSRMIEKNLKEDGMQAAKDIKLLLLGAGESGKSTIVKQMKIIHES  59

Query  61   GYSNEECEQYKPVVCSNTVQSLMTIIRAMGQLRIDFADPNKADIARQFFTLASAAEEGE-  119
            G++ E+ +QYKPVV SNTVQSL+ I+RAM  L + F   ++   A+    + +  E+ E 
Sbjct  60   GFTAEDYKQYKPVVYSNTVQSLVAILRAMSNLGVSFGSADREVDAKLVMDVVARMEDTEP  119

Query  120  LTGELALLMKRLWQDAGVQLCFTRSREYQLNDSAAYYLNALDRIAQPNYIPTQQDVLRTR  179
             + EL   MKRLW DAGVQ CF+RS EYQLNDSA Y+L+ L+R+ +  Y PT+QD+LRTR
Sbjct  120  FSEELLSSMKRLWGDAGVQDCFSRSNEYQLNDSAKYFLDDLERLGEAIYQPTEQDILRTR  179

Query  180  VKTTGIVETHFSFKGLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSGYDLVLAEDE  239
            VKTTGIVE HF+FK L+FK+FDVGGQRSERKKWIHCFE VTAIIFCVA+S YD VL EDE
Sbjct  180  VKTTGIVEVHFTFKNLNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDE  239

Query  240  EMNRMIESMKLFDSICNSKWFVETSIILFLNKKDLFEEKITRSPLTICFPEYKGANTYEE  299
              NRM ES+KLFDSICN+KWF +TSIILFLNKKDLFEEKI +SPLTICFPEY G   Y E
Sbjct  240  TTNRMHESLKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICFPEYSGRQDYHE  299

Query  300  CASYIQMKFENLNKRKDQKQIYTHFTCATDTSNIQFVFDAVTDVIIKNNLSNCGL  354
             ++YIQ +FE  NK  + K+IY H TCATDT+NIQFVFDAVTDVII NNL  CGL
Sbjct  300  ASAYIQAQFEAKNKSAN-KEIYCHMTCATDTTNIQFVFDAVTDVIIANNLRGCGL  353


>GPA16_CAEEL unnamed protein product
Length=357

 Score = 474 bits (1221),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 232/358 (65%), Positives = 278/358 (78%), Gaps = 6/358 (2%)

Query  1    MGCAVSTIGEKEAAER-SKKIDKDLRADGERAASEVKLLLLGAGESGKSTIVKQMKIIHE  59
            MGC +S   E EAA+R SKKID+ L+ DGE +   +KLLLLGAGESGKSTI+KQM+IIH+
Sbjct  1    MGCIMSQ--EDEAAKRRSKKIDRLLKEDGENSMRTIKLLLLGAGESGKSTILKQMRIIHD  58

Query  60   TGYSNEECEQYKPVVCSNTVQSLMTIIRAMGQLRIDFADPNKADIARQFFTLASAAEEGE  119
             GY+ EE + ++ VV  N + SL  II AM QL+I F   +    AR+    ++  EE E
Sbjct  59   VGYTTEERKVFRGVVYGNIILSLNAIIHAMEQLKISFTTLDHESDARKLLMFSTTGEEDE  118

Query  120  LTGELALLMKRLWQDAGVQLCFTRSREYQLNDSAAYYLNALDRIAQPNYIPTQQDVLRTR  179
            L  EL +LMK +W D+G+Q    RSREYQLNDSA YYL+ LDRI  PNYIPTQ D+LRTR
Sbjct  119  LPEELVVLMKSVWSDSGIQKALERSREYQLNDSAGYYLSQLDRICAPNYIPTQDDILRTR  178

Query  180  VKTTGIVETHFSFKGLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSGYDLVLAEDE  239
            +KTTGIVET F +K   F +FDVGGQRSERKKWIHCFE VTA+IFCVALS YD+VL ED 
Sbjct  179  IKTTGIVETQFVYKDRLFLVFDVGGQRSERKKWIHCFEDVTALIFCVALSEYDMVLVEDC  238

Query  240  EMNRMIESMKLFDSICNSKWFVETSIILFLNKKDLFEEKITRSPLTICFPEYKGANTYEE  299
            + NRM ES+KLFDSICN+KWFVETSIILFLNKKDLFEEKI RSPLT CFPEY GAN YEE
Sbjct  239  QTNRMRESLKLFDSICNNKWFVETSIILFLNKKDLFEEKIVRSPLTHCFPEYTGANNYEE  298

Query  300  CASYIQMKFENLNKR---KDQKQIYTHFTCATDTSNIQFVFDAVTDVIIKNNLSNCGL  354
             ++YIQ +FE++NKR   +  ++IYT FTCATDT+NI+FVFDAVTD+II++NL  CGL
Sbjct  299  ASAYIQQQFEDMNKRTTGEKNQEIYTQFTCATDTNNIRFVFDAVTDIIIRDNLRTCGL  356



Lambda      K        H
   0.319    0.136    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8012016630


Query= XP_003393075.1 synaptojanin-1 [Bombus terrestris]

Length=1149
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q5U0V7_DROME  unnamed protein product                                 1428    0.0  
Q8MR94_DROME  unnamed protein product                                 1065    0.0  
SYNJ_CAEEL  unnamed protein product                                   816     0.0  


>Q5U0V7_DROME unnamed protein product
Length=1218

 Score = 1428 bits (3697),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 672/990 (68%), Positives = 812/990 (82%), Gaps = 20/990 (2%)

Query  1    MAMGKGFRVYEKLKPPSPHSLILEQRNRKETVLFESQAVAVLSAEETDTLKGKYTKLLDA  60
            MAM K  RV EK   PSPHS++LE RN+ +++LFES AVA+L+ +ETD ++ +YTK+ DA
Sbjct  1    MAMSKVIRVLEKSIAPSPHSVLLEHRNKSDSILFESHAVALLTQQETDVIRKQYTKVCDA  60

Query  61   YGCLGVLQLNAGENTLLYLVLVTGCFSVGKIGESEVFRITQTHFVPLHYTQSNEDRVSEV  120
            YGCLG LQLNAGE+T+L+LVLVTGC S+GKIG+ E+FRITQT FV L     NED++SEV
Sbjct  61   YGCLGALQLNAGESTVLFLVLVTGCVSMGKIGDIEIFRITQTTFVSLQNAAPNEDKISEV  120

Query  121  RKVLNSGTFYFSWSANQEP--------LDITLSAQRRCKSTTTDNRFFWNRMLHIHLLRY  172
            RK+LNSGTFYF+ +              DITL AQRR ++  TDNRFFWNRM+HIHL+R+
Sbjct  121  RKLLNSGTFYFAHTNASASASGASSYRFDITLCAQRRQQTQETDNRFFWNRMMHIHLMRF  180

Query  173  GVDTSHWLLKAMCGSVEIRTVYVGHRQARAVLMSRLSCERAGTRFNVRGTNDDGHVANFV  232
            G+D   WLL+AMCGSVE+RTVY+G +QARA ++SRLSCERAGTRFNVRGTND+G+VANFV
Sbjct  181  GIDCQSWLLQAMCGSVEVRTVYIGAKQARAAIISRLSCERAGTRFNVRGTNDEGYVANFV  240

Query  233  ETEQVIYLDNEVTSYVQTRGSVPLFWEQPGIQVGSHKVKISRGSEASAPAFNRHLNMIKQ  292
            ETEQVIY+D +VTSYVQTRGSVPLFWEQPG+QVGSHKVK+SRG E SA AF+RH++M++Q
Sbjct  241  ETEQVIYVDGDVTSYVQTRGSVPLFWEQPGVQVGSHKVKLSRGFETSAAAFDRHMSMMRQ  300

Query  293  RYGQQVIINLLGSSLIGSKEGEAMLSQLFQTHHNMSEHTDVPHILFDYHQECRGGNMKNL  352
            RYG Q ++NLLGSSL+GSKEGEAMLS  FQ HH MS H DVPH++FDYHQECRGGN   L
Sbjct  301  RYGYQTVVNLLGSSLVGSKEGEAMLSNEFQRHHGMSAHKDVPHVVFDYHQECRGGNFSAL  360

Query  353  SKLKTKVDKYLESFSLFYAAGNTVILEQTGTIRTNCLDCLDRTNCVQTFFALEILSKQLG  412
            +KLK ++     ++ +F+A+   V+ EQ G +RTNCLDCLDRTNCVQT+  L+ L  QL 
Sbjct  361  AKLKERIVACGANYGVFHASNGQVLREQFGVVRTNCLDCLDRTNCVQTYLGLDTLGIQLE  420

Query  413  LLKLLEKQQMVSRFEEVFRQMWINNGNEVSKIYAGTGAIQGSSKLMDGARSAARTIQNNL  472
             LK+  KQQ +SRFEE+FRQMWINNGNEVSKIYAGTGAIQG SKLMDGARSAARTIQNNL
Sbjct  421  ALKMGGKQQNISRFEEIFRQMWINNGNEVSKIYAGTGAIQGGSKLMDGARSAARTIQNNL  480

Query  473  LDSSKQEAIDILLLGSTLNTELADRARLLLPSNMLHAPPSVLREMCKRYNEYVATINLRI  532
            LD+SKQEAID+LL+GSTL++ELADRAR+LLPSNMLHAP +VLRE+CKRY EYV     R+
Sbjct  481  LDNSKQEAIDVLLVGSTLSSELADRARILLPSNMLHAPTTVLRELCKRYTEYVRPRMARV  540

Query  533  SVGTYNVNGGKHFRSVVYKDVSLSDWLLD--APRKSSSLVSV----EYDNIPVDIFAIGF  586
            +VGTYNVNGGKHFRS+V+KD SL+DWLLD  A  +S +LV V    E  + PVDI+AIGF
Sbjct  541  AVGTYNVNGGKHFRSIVFKD-SLADWLLDCHALARSKALVDVNNPSENVDHPVDIYAIGF  599

Query  587  EEIVDLNASNIMAASTDNAKAWAEELQKVLSRDTEYVLVTYQQLVGVCLYLFIRPEHAPY  646
            EEIVDLNASNIMAASTDNAK WAEELQK +SRD +YVL+TYQQLVGVCLY++IRPEHAP+
Sbjct  600  EEIVDLNASNIMAASTDNAKLWAEELQKTISRDNDYVLLTYQQLVGVCLYIYIRPEHAPH  659

Query  647  LRDVAVDCVKTGLGGATGNKGAAAIRCVLYSTSFCFVCAHFAAGQSQVNERNADYAEITR  706
            +RDVA+DCVKTGLGGATGNKGA AIR VL+ TS CFVCAHFAAGQSQV ERNADYAEITR
Sbjct  660  IRDVAIDCVKTGLGGATGNKGACAIRFVLHGTSMCFVCAHFAAGQSQVAERNADYAEITR  719

Query  707  KITFPMGRTLNTHDYVFWCGDFNYRVDMDKDEMKEMIKRNEFDQILQYDQLKVQQEQGNV  766
            K+ FPMGRTL +HD+VFWCGDFNYR+DM+KDE+KE ++  +   +L++DQL+ +QE GNV
Sbjct  720  KLAFPMGRTLKSHDWVFWCGDFNYRIDMEKDELKECVRNGDLSTVLEFDQLRKEQEAGNV  779

Query  767  FKNFLEGPINFAPTYKYDLFSGDYDTSEKCRQPAWTDRVLWKRRKQVPDID-SPTDWNPG  825
            F  FLEG I F PTYKYDLFS DYDTSEK R PAWTDRVLW+RRK + + D + + WNPG
Sbjct  780  FGEFLEGEITFDPTYKYDLFSDDYDTSEKQRAPAWTDRVLWRRRKALAEGDFAASAWNPG  839

Query  826  KLIHYGRAELKQSDHRPVIAIIDIDIHCVESEKRERVFKEVIQDLGPPDGTIVVKAVEES  885
            KLIHYGR+ELKQSDHRPVIAIID +I  ++ ++R  VF++VI+DLGPPD TIVV  +E S
Sbjct  840  KLIHYGRSELKQSDHRPVIAIIDAEIMEIDQQRRRAVFEQVIRDLGPPDSTIVVHVLESS  899

Query  886  ----DDMDSVFDENFMMALLQDFSHIGEVILVRFVGETIWVTFRDGQCALSAARKGMTQV  941
                +D  +++DEN M AL+ + S +GEV LVR+V +T+WVTFRDG+ AL+A+ K   QV
Sbjct  900  ATGDEDGPTIYDENVMSALITELSKMGEVTLVRYVEDTMWVTFRDGESALNASSKKSIQV  959

Query  942  CGQALKLSLKSPNWVQLIEKEIELCSNTTV  971
            CG  L L LKS +W  L++ EIELC+  T+
Sbjct  960  CGLDLILELKSKDWQHLVDSEIELCTTNTI  989


>Q8MR94_DROME unnamed protein product
Length=959

 Score = 1065 bits (2754),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 502/731 (69%), Positives = 602/731 (82%), Gaps = 12/731 (2%)

Query  252  GSVPLFWEQPGIQVGSHKVKISRGSEASAPAFNRHLNMIKQRYGQQVIINLLGSSLIGSK  311
            GSVPLFWEQPG+QVGSHKVK+SRG E SA AF+RH++M++QRYG Q ++NLLGSSL+GSK
Sbjct  1    GSVPLFWEQPGVQVGSHKVKLSRGFETSAAAFDRHMSMMRQRYGYQTVVNLLGSSLVGSK  60

Query  312  EGEAMLSQLFQTHHNMSEHTDVPHILFDYHQECRGGNMKNLSKLKTKVDKYLESFSLFYA  371
            EGEAMLS  FQ HH MS H DVPH++FDYHQECRGGN   L+KLK ++     ++ +F+A
Sbjct  61   EGEAMLSNEFQRHHGMSAHKDVPHVVFDYHQECRGGNFSALAKLKERIVACGANYGVFHA  120

Query  372  AGNTVILEQTGTIRTNCLDCLDRTNCVQTFFALEILSKQLGLLKLLEKQQMVSRFEEVFR  431
            +   V+ EQ G +RTNCLDCLDRTNCVQT+  L+ L  QL  LK+  KQQ +SRFEE+FR
Sbjct  121  SNGQVLREQFGVVRTNCLDCLDRTNCVQTYLGLDTLGIQLEALKMGGKQQNISRFEEIFR  180

Query  432  QMWINNGNEVSKIYAGTGAIQGSSKLMDGARSAARTIQNNLLDSSKQEAIDILLLGSTLN  491
            QMWINNGNEVSKIYAGTGAIQG SKLMDGARSAARTIQNNLLD+SKQEAID+LL+GSTL+
Sbjct  181  QMWINNGNEVSKIYAGTGAIQGGSKLMDGARSAARTIQNNLLDNSKQEAIDVLLVGSTLS  240

Query  492  TELADRARLLLPSNMLHAPPSVLREMCKRYNEYVATINLRISVGTYNVNGGKHFRSVVYK  551
            +ELADRAR+LLPSNMLHAP +VLRE+CKRY EYV     R++VGTYNVNGGKHFRS+V+K
Sbjct  241  SELADRARILLPSNMLHAPTTVLRELCKRYTEYVRPRMARVAVGTYNVNGGKHFRSIVFK  300

Query  552  DVSLSDWLLD--APRKSSSLVSV----EYDNIPVDIFAIGFEEIVDLNASNIMAASTDNA  605
            D SL+DWLLD  A  +S +LV V    E  + PVDI+AIGFEEIVDLNASNIMAASTDNA
Sbjct  301  D-SLADWLLDCHALARSKALVDVNNPSENVDHPVDIYAIGFEEIVDLNASNIMAASTDNA  359

Query  606  KAWAEELQKVLSRDTEYVLVTYQQLVGVCLYLFIRPEHAPYLRDVAVDCVKTGLGGATGN  665
            K WAEELQK +SRD +YVL+TYQQLVGVCLY++IRPEHAP++RDVA+DCVKTGLGGATGN
Sbjct  360  KLWAEELQKTISRDNDYVLLTYQQLVGVCLYIYIRPEHAPHIRDVAIDCVKTGLGGATGN  419

Query  666  KGAAAIRCVLYSTSFCFVCAHFAAGQSQVNERNADYAEITRKITFPMGRTLNTHDYVFWC  725
            KGA AIR VL+ TS CFVCAHFAAGQSQV ERNADYAEITRK+ FPMGRTL +HD+VFWC
Sbjct  420  KGACAIRFVLHGTSMCFVCAHFAAGQSQVAERNADYAEITRKLAFPMGRTLKSHDWVFWC  479

Query  726  GDFNYRVDMDKDEMKEMIKRNEFDQILQYDQLKVQQEQGNVFKNFLEGPINFAPTYKYDL  785
            GDFNYR+DM+KDE+KE ++  +   +L++DQL+ +QE GNVF  FLEG I F PTYKYDL
Sbjct  480  GDFNYRIDMEKDELKECVRNGDLSTVLEFDQLRKEQEAGNVFGEFLEGEITFDPTYKYDL  539

Query  786  FSGDYDTSEKCRQPAWTDRVLWKRRKQVPDID-SPTDWNPGKLIHYGRAELKQSDHRPVI  844
            FS DYDTSEK R PAWTDRVLW+RRK + + D + + WNPGKLIHYGR+ELKQSDHRPVI
Sbjct  540  FSDDYDTSEKQRAPAWTDRVLWRRRKALAEGDFAASAWNPGKLIHYGRSELKQSDHRPVI  599

Query  845  AIIDIDIHCVESEKRERVFKEVIQDLGPPDGTIVVKAVEES----DDMDSVFDENFMMAL  900
            AIID +I  ++ ++R  VF++VI+DLGPPD TIVV  +E S    +D  +++DEN M AL
Sbjct  600  AIIDAEIMEIDQQRRRAVFEQVIRDLGPPDSTIVVHVLESSATGDEDGPTIYDENVMSAL  659

Query  901  LQDFSHIGEVILVRFVGETIWVTFRDGQCALSAARKGMTQVCGQALKLSLKSPNWVQLIE  960
            + + S +GEV LVR+V +T+WVTFRDG+ AL+A+ K   QVCG  L L LKS +W  L++
Sbjct  660  ITELSKMGEVTLVRYVEDTMWVTFRDGESALNASSKKSIQVCGLDLILELKSKDWQHLVD  719

Query  961  KEIELCSNTTV  971
             EIELC+  T+
Sbjct  720  SEIELCTTNTI  730


>SYNJ_CAEEL unnamed protein product
Length=1119

 Score = 816 bits (2107),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/965 (44%), Positives = 601/965 (62%), Gaps = 44/965 (5%)

Query  5    KGFRVYEKLKPPSPHSLILEQRNRKETVLFESQAVAVLSAEETDTLKGKYTKLLDAYGCL  64
            +G R++ +       S+++E+     ++LF+  A+A L ++ TD  +  Y K++DAYG L
Sbjct  4    RGIRIWRRNDARFQPSILVEKNGLDGSLLFQGGAIATLDSDSTDVERRSYQKIVDAYGIL  63

Query  65   GVLQLNAGENTLLYLVLVTGCFSVGKIGESEVFRITQTHFVPLHYTQSNED---RVSEVR  121
            GVL +   E  L   V VTG  SVG++  +++ +IT   F+ L    S E+   R+ +++
Sbjct  64   GVLAITKDEAVL---VAVTGVLSVGQLYGADILKITNVEFISLRTFGSVENVDSRIIDLQ  120

Query  122  KVLNSGTFYFSWSANQEPLDITLSAQRRCKSTTTDNRFFWNRMLHIHLLRYGVDTSHWLL  181
            ++L+S  FYFS   + +  D+T SAQ R     +D RFFWNR LH    RYG+DT +WLL
Sbjct  121  RLLSSQMFYFS---SLQSYDLTRSAQHRDSHDCSDARFFWNRSLHFSFQRYGIDTDNWLL  177

Query  182  KAMCGSVEIRTVYVGHRQARAVLMSRLSCERAGTRFNVRGTNDDGHVANFVETEQVIYLD  241
            K M GSV +R VYVG    R  L+SRLSCER GTRFNVRG N  G+VANFVETEQ++  D
Sbjct  178  KCMAGSVLVRVVYVGANTGRVALISRLSCERVGTRFNVRGANYLGNVANFVETEQLLLFD  237

Query  242  NEVTSYVQTRGSVPLFWEQPGIQVGSHKVKISRGSEASAPAFNRHLNMIKQRYGQQVIIN  301
             +  S +Q RGS+PLFWEQPG+ VGSHKVK+ R  E S PA++RHL+ ++ RYG+  I+N
Sbjct  238  EKECSLLQIRGSIPLFWEQPGVNVGSHKVKL-RAFETSLPAYHRHLSQLQHRYGEFAIVN  296

Query  302  LLGSSLIGSKEGEAMLSQLFQTHHNMSEHTD-VPHILFDYHQECRGGNMKNLSKLKTKVD  360
            LLG      KEGE +L   F+T H  S     V  I FDYH + +    + + +LK K+ 
Sbjct  297  LLGR-----KEGERVLGDAFKTQHKSSHFAPLVDFIDFDYHAQMKISK-EAIVQLKKKMS  350

Query  361  KYLESFSLFYAAGNTVILEQTGTIRTNCLDCLDRTNCVQTFFALEILSKQLGLLKL-LEK  419
             ++     FY+ G  ++  QTG IRTNCLDCLDRTN VQT   L++   Q+  L L   K
Sbjct  351  PHMTKHGFFYSMGKEIVKRQTGVIRTNCLDCLDRTNAVQTAIGLQMSHDQVAFLNLNAGK  410

Query  420  QQMVSRFEEVFRQMWINNGNEVSKIYAGTGAIQGSSKLMDGARSAARTIQNNLLDSSKQE  479
              +  R EE+ R +W  NG++ S IYAGTGA+ G SKL D +RS ARTIQNNL+D +KQE
Sbjct  411  VNVEQRVEEILRDLWQKNGDQCSTIYAGTGALDGKSKLKDASRSLARTIQNNLMDGAKQE  470

Query  480  AIDILLLGSTLNTELADRARLLLPSNML------HAPPSVLREMCKRYNEYVATINLRIS  533
            + D+ L G+  +  L DRA  +LP +++      H     + ++ +R  E     +++I 
Sbjct  471  SFDLFLTGAAYDPRLFDRACNILPPSLIQESYYYHEYADAVSQLVERSPEIAEPQSIKIF  530

Query  534  VGTYNVNGGKHFRSVVYK-DVSLSDWLLDAPRKSSSLVSVEYDNIPVDIFAIGFEEIVDL  592
            VGT+NVNGGK+  +V ++ + SLS W+       + LVSVE D    DI AIG EE+VDL
Sbjct  531  VGTWNVNGGKNIHNVAFRNESSLSHWIF--ANSMTRLVSVE-DEQLADIVAIGVEELVDL  587

Query  593  NASNIMAASTDNAKAWAEELQKVLSRDTEYVLVTYQQLVGVCLYLFIRPEHAPYLRDVAV  652
            NASN++ AST N + W E ++K LS    +VL+  +QLVGVCL+LF RP  +PYL+D AV
Sbjct  588  NASNMVKASTTNQRMWCESIRKTLSEKAPFVLIGSEQLVGVCLFLFARPRVSPYLKDFAV  647

Query  653  DCVKTGLGGATGNKGAAAIRCVLYSTSFCFVCAHFAAGQSQVNERNADYAEITRKITFPM  712
              VKTG+GGATGNKG+ A R V++STS CF+C+HFAAGQ+++ +RN D+A   +KI FP+
Sbjct  648  ASVKTGMGGATGNKGSVAFRIVVFSTSICFICSHFAAGQNEIRDRNEDFATTLKKIRFPL  707

Query  713  GRTLNTHDYVFWCGDFNYRVDMDKDEMKEMIKRNEFDQILQYDQLKVQQEQGNVFKNFLE  772
            GR +++HD +FW GDFNYR+++  DE+K  ++  ++ ++++ DQL  Q+  G  F  F E
Sbjct  708  GREIDSHDVIFWLGDFNYRINLSGDEVKNAVRNGDYAKLVENDQLTQQKALGQTFVGFNE  767

Query  773  GPINFAPTYKYDLFSGDYDTSEKCRQPAWTDRVLWKRRKQVPDIDSPTDWNPGKLIHYGR  832
            G + FAPTYKYD FS DYDTSEKCR PAWTDR+LWK +++             +L+ Y R
Sbjct  768  GQLTFAPTYKYDTFSDDYDTSEKCRAPAWTDRILWKDQRKK---------GKTQLLSYDR  818

Query  833  AELKQSDHRPVIAIIDIDIHCVESEKRERVFKEVIQDLGPPDGTIVVKAVEESDDMDSVF  892
            +ELK SDHRPV A+  ++   V   K   + ++V++ +GPPDGTI+V    +       F
Sbjct  819  SELKTSDHRPVGAVFKVETFKVGGRKCVELIEDVVESMGPPDGTIIVSIAGKPR-----F  873

Query  893  DENFMMALLQDFSHIG-EVILVRFVGETIWVTFRDGQCALSAARKGMTQVCG-QALKLSL  950
                   + +    +G +V L +F    +W+    G+ AL+A      ++ G   + + L
Sbjct  874  PPQMFPPIHEKLKELGAQVQLSKFDDGDLWIVLNSGEMALAALSMDGLKIGGTDQINVKL  933

Query  951  KSPNW  955
            KSP+W
Sbjct  934  KSPDW  938



Lambda      K        H
   0.319    0.136    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8012016630


Query= XP_003393076.1 potential E3 ubiquitin-protein ligase ariadne-2
[Bombus terrestris]

Length=489
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ARI1_DROME  unnamed protein product                                   281     4e-89
O01965_CAEEL  unnamed protein product                                 271     4e-85
RBRA_DICDI  unnamed protein product                                   214     4e-63


>ARI1_DROME unnamed protein product
Length=503

 Score = 281 bits (720),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 156/456 (34%), Positives = 249/456 (55%), Gaps = 18/456 (4%)

Query  40   DNDQSRRDPEYAVYDCLRIEEVERLLNEDVELLSNSLHITPSLAKVLLHAHNWALQDIIA  99
            D    + D +Y V     I + +R + ++  LL   L +     ++LL+   W  + ++ 
Sbjct  39   DRQMDQDDYQYKVLTTDEIVQHQREIIDEANLL---LKLPTPTTRILLNHFKWDKEKLLE  95

Query  100  KYRTNASSLLINSKIRSLPPLDSLSALKGQRGGL----CSVCVTIYPAEKFSTLTCGHSF  155
            KY  + +          + P ++  A+K +        C +C +  P +  + L CGH F
Sbjct  96   KYFDDNTDEFFKC-AHVINPFNATEAIKQKTSRSQCEECEICFSQLPPDSMAGLECGHRF  154

Query  156  CKDCWCMHFEVQIT-QGISTGISCMAQDCNVLAPEDFVLSLLTKPNMRERYQQFAFCDYV  214
            C  CW  +   +I  +G+   ISC A  C++L  +  V +L+T   +R +YQQ     +V
Sbjct  155  CMPCWHEYLSTKIVAEGLGQTISCAAHGCDILVDDVTVANLVTDARVRVKYQQLITNSFV  214

Query  215  KSHPQLRFCPGPNCQMIMRSKEQRAKRVMCSSCRTVFCFRCGIDYHAPTDCNTMKKWLTK  274
            + +  LR+CP  +C   ++      +RV C  C  VFCF CG ++H P  C  +KKW+ K
Sbjct  215  ECNQLLRWCPSVDCTYAVKVPYAEPRRVHCK-CGHVFCFACGENWHDPVKCRWLKKWIKK  273

Query  275  CADDSETANYISAHTKDCPKCHICIEKNGGCNHMQC--YNCKYDFCWMCLGDWKAHGSEY  332
            C DDSET+N+I+A+TK+CP+C + IEK+GGCNHM C   NCK +FCW+CLG W+ HGS +
Sbjct  274  CDDDSETSNWIAANTKECPRCSVTIEKDGGCNHMVCKNQNCKNEFCWVCLGSWEPHGSSW  333

Query  333  YVCSRYKENPNIAHESVLAQAREALKKYLHYYERWENHSKSLKLEEQTLEAIKMQINKKV  392
            Y C+RY E+          + R +L +YLHYY R+ NH +S+K E +   ++K ++ +++
Sbjct  334  YNCNRYDEDEAKTARDAQEKLRSSLARYLHYYNRYMNHMQSMKFENKLYASVKQKM-EEM  392

Query  393  MNSSGTWIDWQHLFAAASLLTRCRYTLQYTYPYAYYMEPGPRKELFEYQQAQLEAEIEDL  452
               + +WI+ Q L  A  +L +CR TL YTY +AYY++   +  +FE  Q  LE+  E L
Sbjct  393  QQHNMSWIEVQFLKKAVDILCQCRQTLMYTYVFAYYLKKNNQSMIFEDNQKDLESATEML  452

Query  453  SWKIEHAETT-NRGDLENQMD----IAEKRRVTLLK  483
            S  +E   T+ N  D++ ++       EKR   LLK
Sbjct  453  SEYLERDITSENLADIKQKVQDKYRYCEKRCSVLLK  488


>O01965_CAEEL unnamed protein product
Length=494

 Score = 271 bits (692),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 146/447 (33%), Positives = 242/447 (54%), Gaps = 36/447 (8%)

Query  42   DQSRRDPEYAVYDCLRIEEVERLLNEDVELLSNSLHITPSLAKVLLHAHNWALQDIIAKY  101
            D    D E   +D L  E     + + +  +   L +   + ++LLH + W  + ++ ++
Sbjct  44   DNGEPDNEVLNHDSLEAE-----MKKTITDVQAVLQVKTGVCRILLHKYKWNKESLLERF  98

Query  102  --RTNASSLLINSKI-----RSLPPLDSLSALKGQRGGLCSVCVTIYPAEKFSTLTCGHS  154
                + ++ LI++ +       LP  D+           C +C ++    + S L+C H 
Sbjct  99   YEHPDTTTFLIDAHVIPRRQERLPAGDAE----------CDICCSL---GELSGLSCNHR  145

Query  155  FCKDCWCMHFEVQITQGISTGISCMAQDCNVLAPEDFVLSLLTKPNMRERYQQFAFCDYV  214
             C  CW  +   +I     + I CMA +C +L  ++ V+  +T P +   Y++     YV
Sbjct  146  ACTQCWKAYLTNKIANNAQSEIECMAPNCKLLIEDEKVMFYITDPTVIATYRKLIVASYV  205

Query  215  KSHPQLRFCPGPNCQMIMRSKEQRAKRVMCSSCRTVFCFRCGIDYHAPTDCNTMKKWLTK  274
            +++  L++CPG +C   +R      + V+CS C + FCF CG D+H P +C  +K WL K
Sbjct  206  ETNRLLKWCPGIDCGKAVRVSHWEPRLVVCS-CGSRFCFSCGHDWHEPVNCRLLKLWLKK  264

Query  275  CADDSETANYISAHTKDCPKCHICIEKNGGCNHMQCYN--CKYDFCWMCLGDWKAHGSEY  332
            C DDSET+N+I+A+TK+CPKC I IEK+GGCNHM C N  C+++FCWMCLG W+ HGS +
Sbjct  265  CNDDSETSNWINANTKECPKCMITIEKDGGCNHMTCKNTACRFEFCWMCLGPWEPHGSSW  324

Query  333  YVCSRYKENPNIAHESVLAQAREALKKYLHYYERWENHSKSLKLEEQTLEAIKMQINKKV  392
            Y C+R+ ++           +R  L++YL YY R+  H +SL+LE +    +K ++ +++
Sbjct  325  YSCNRFDDSAAKNARDAQEVSRANLQRYLFYYNRYMGHQQSLRLEGKLYATVKSKM-EQM  383

Query  393  MNSSGTWIDWQHLFAAASLLTRCRYTLQYTYPYAYYMEPGPRKELFEYQQAQLEAEIEDL  452
               S +WI+ Q L  A  +L+ CR TL +TY +A+Y++      +FE  Q  LE E E L
Sbjct  384  QTLSMSWIEVQFLRKAVDVLSECRRTLMFTYAFAFYLKRDNNAIIFESNQKDLEMETEQL  443

Query  453  SWKIEHAETTNRGDLENQMDIAEKRRV  479
            S  +E        DL+N+  +  K++V
Sbjct  444  SGFLER-------DLDNENLVTLKQKV  463


>RBRA_DICDI unnamed protein product
Length=520

 Score = 214 bits (544),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 142/484 (29%), Positives = 231/484 (48%), Gaps = 34/484 (7%)

Query  1    MTTEEYDTEMDCSDSDCGDPGYEDYYNVHPWDGEGDNDIDNDQSRRDPEYAVYDCLRIEE  60
            MT +E   + D  D    + G E   +   +D     + D D+++  P+ ++    R + 
Sbjct  1    MTDDEMYEDYDVDDDSAEESGNESLDDTE-YDDAATQEFDFDENQ--PQRSLGKLTRQKS  57

Query  61   VERLLNEDVELLSNSLHIT---------PSLAKV--LLHAHNWALQDIIAKYRTNASSLL  109
             E +LN+D +L S S  I          PS A V  LL    W  + +I +Y  N   L 
Sbjct  58   FE-VLNKD-DLFSESHKIIKEVKDVLSIPSEAAVSTLLRHMKWNKEKLIERYMENPEKLC  115

Query  110  INSKIRSLPPLDSLSALKGQRGG--LCSVCVTIYPAEKFSTLTCGHSFCKDCWCMHFEVQ  167
            I++ +   P +  L+A   ++ G   C +C+  YP  +   L C H +C  C+  + E++
Sbjct  116  IDAGV---PNVMKLNATIVEKSGNVSCLICLEDYPPTQTFALICNHRYCLPCYKNYLEIK  172

Query  168  ITQGIS-TGISCMAQDCNVLAPEDFVLSLLTKPNMRERYQQFAFCDYVKSHPQLRFCPGP  226
            +++G       C A  C V+  +D     +  P + ER+  F    YV  +PQ+++CP P
Sbjct  173  VSEGPECIYTPCPAPKCKVIVHQD-AFKQIVSPEVFERFNNFILKSYVDDNPQVKWCPAP  231

Query  227  NCQMIMRSKEQRAKRVMCSSCRTVFCFRCG---IDYHAPTDCNTMKKWLTKCADDSETAN  283
             C   +R   +  K  +   C   +CF C    I  H P  C+ + KWL K +D+SE   
Sbjct  232  GCIYSIRCDRKERKEAVNCKCGFQYCFNCNDYEIGDHMPCPCSQVDKWLQKASDESENVT  291

Query  284  YISAHTKDCPKCHICIEKNGGCNHMQCY----NCKYDFCWMCLGDWKAHGSE---YYVCS  336
            ++ A+TK CP+C   IEKNGGC HM C      C ++FCW+C G W  HGS    YY C+
Sbjct  292  WMLANTKKCPECRSPIEKNGGCMHMTCRKNAGGCGFEFCWLCRGPWTEHGSTTGGYYNCN  351

Query  337  RYKENPNIAHESVLAQAREALKKYLHYYERWENHSKSLKLEEQTLEAIKMQINKKVMNSS  396
            +Y ++     +     A+  L+ Y+ YY R+E+H  ++K+ ++      ++  + +    
Sbjct  352  KYDKSKAKEDDDKAHDAKTELEAYMFYYHRYESHRNAMKIADEQRRNAHLKEQQILSKFD  411

Query  397  GTWIDWQHLFAAASLLTRCRYTLQYTYPYAYYMEPGPR-KELFEYQQAQLEAEIEDLSWK  455
                D + L  A   L + R  LQY+Y Y YY++   + + LFEY Q  LE     LS +
Sbjct  412  VRSADTKFLMEATEQLLKNRRVLQYSYVYGYYLDKKSQERNLFEYLQEDLEKHTNLLSTQ  471

Query  456  IEHA  459
             E +
Sbjct  472  YEQS  475



Lambda      K        H
   0.319    0.136    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8012016630


Query= XP_003393077.1 DPH3 homolog [Bombus terrestris]

Length=84
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DPH3_CAEEL  unnamed protein product                                   75.1    2e-19
D3YT20_CAEEL  unnamed protein product                                 35.0    3e-04
POLK_CAEEL  unnamed protein product                                   29.6    0.26 


>DPH3_CAEEL unnamed protein product
Length=80

 Score = 75.1 bits (183),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 54/65 (83%), Gaps = 0/65 (0%)

Query  1   MSVYHDEVEIEDFEYDEDEEVYYYPCPCGDQFQISKAELAAGVEEATCPSCSLVIKVIYD  60
           MSV+HDEVEIEDFE+DE+++VY+YPCPCGD+F+I +  L  G + A CPSCSL+I+VIYD
Sbjct  1   MSVFHDEVEIEDFEFDEEKDVYHYPCPCGDRFEIPREMLEMGEDVAQCPSCSLLIRVIYD  60

Query  61  KETFA  65
            E F 
Sbjct  61  PEDFV  65


>D3YT20_CAEEL unnamed protein product
Length=43

 Score = 35.0 bits (79),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 16/26 (62%), Positives = 19/26 (73%), Gaps = 0/26 (0%)

Query  39  LAAGVEEATCPSCSLVIKVIYDKETF  64
           L  G + A CPSCSL+I+VIYD E F
Sbjct  2   LEMGEDVAQCPSCSLLIRVIYDPEDF  27


>POLK_CAEEL unnamed protein product
Length=596

 Score = 29.6 bits (65),  Expect = 0.26, Method: Composition-based stats.
 Identities = 12/32 (38%), Positives = 18/32 (56%), Gaps = 0/32 (0%)

Query  43   VEEATCPSCSLVIKVIYDKETFAVKQEEFVKD  74
            +EE+ CP C    K+ YD   F   +EE V++
Sbjct  227  IEESICPKCEKSRKIYYDHVEFGTGREEAVRE  258



Lambda      K        H
   0.319    0.136    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8012016630


Query= XP_003393078.1 F-BAR domain only protein 2 isoform X4 [Bombus
terrestris]

Length=888
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q6AWD5_DROME  unnamed protein product                                 576     0.0  
A0A0B4KFZ2_DROME  unnamed protein product                             575     0.0  
Q9VHC4_DROME  unnamed protein product                                 574     0.0  


>Q6AWD5_DROME unnamed protein product
Length=1220

 Score = 576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/563 (56%), Positives = 394/563 (70%), Gaps = 62/563 (11%)

Query  356   EVDEDGFCIRPKAE-PWENEK----GFYSSSDTDSED-ERERKIRVEIKPLSNGGAPMSA  409
             EVDE+GF I+P  E  WE  +     FYS SDTDS++ ++ER+I V IKPL NG APMSA
Sbjct  675   EVDEEGFSIQPAKEIAWEEGQDKSGSFYSDSDTDSDNDKQERRIHVSIKPLKNGQAPMSA  734

Query  410   SVDELRATVENLSLSPAPTGRRGSNNDSDHHMKRSQSVSQQLGGKPSSDLLGLNLFNPSS  469
             SVDELRATVEN+SLSP  TG         HH ++ Q+      G P+S          S 
Sbjct  735   SVDELRATVENISLSP--TGVF------SHHSQQLQAAR----GAPASR-------QQSP  775

Query  470   TPSSASTPTGS-HPYAPLQSPPPLSLSPTPQPQPPQSAPPTHPHPRFPD-GDLFSEVGDI  527
               S+ASTPT S HPYAPLQSP   +LS         ++       R+ D GD+FSE+GD+
Sbjct  776   EISNASTPTASVHPYAPLQSP---TLSNNNNANNTTNS-------RYADLGDIFSELGDM  825

Query  528   TPALP-------PKQSASSTPT-----GSIIIPRPPSRRGE----GPSP------RGRSS  565
             + + P       P      TPT     GSI IPRPPSRR +    GP+       RGR S
Sbjct  826   SMSAPSSATLGKPPGRQIPTPTSASTGGSIAIPRPPSRRSDMIAIGPAATGTAPGRGRMS  885

Query  566   PATIS---RADSVASLEFRTAGVGVGSSRGPSPLTIGLADTIPLAVAFHEIVHSYFRGTD  622
             PA ++   RA+S+ SLEFRTA  GVGSSRGPSPLTIG++DTIPLAVAFHEI+H+YFRG+D
Sbjct  886   PAPVTAMNRAESIGSLEFRTAIGGVGSSRGPSPLTIGISDTIPLAVAFHEIIHAYFRGSD  945

Query  623   ETRCQVKLSGDMMLSFPAGIVAVLANNPSPAKLTFRVRNSNRLEKLFPNNQLVSMDATQT  682
             E+RCQVK+SGDMMLSFPAGI  +LANNP+PAKL FR+++   LE L PN +LV +D  Q+
Sbjct  946   ESRCQVKVSGDMMLSFPAGIAGLLANNPNPAKLGFRIKHVQNLENLVPNGKLVQIDRQQS  1005

Query  683   TVDSTIFEFNMSALTTLLRKQAEQNPSASYFNVDILKYQIKCKEGAGSCPFQLVAYWKCE  742
             +  ST+ EFNM ALT LLR+QAE NP+ASYFNVDILKYQ++ K GA SCPFQLV+YWKCE
Sbjct  1006  SSVSTMLEFNMGALTALLRRQAENNPTASYFNVDILKYQVRTKPGASSCPFQLVSYWKCE  1065

Query  743   TTHTDLKIDYKYNSRAMASPSPLLNLHVAAPIDGGFKSLNSKPQAQWLQDTNRVLWKFTE  802
             +++T LK+DYKYN+ AMAS SPLLN+ ++ P++G  +++ SKP + WL ++NR++W FT+
Sbjct  1066  SSYTALKVDYKYNNHAMASASPLLNVTLSVPVNGSVRNVQSKPHSAWLGESNRLVWNFTD  1125

Query  803   LSQHSEGNGVGSLKARVELAHGPGNQGTIFTQFNCEGTTLSGVEFELLGPGYRLSLVKRR  862
             +SQ+S+  GVG+L+AR+EL  GP     + TQFNCEGTTLSG+EFEL G GYRLSLVKRR
Sbjct  1126  ISQNSQDGGVGTLRARLELNDGPSTPALLATQFNCEGTTLSGIEFELQGSGYRLSLVKRR  1185

Query  863   FVSGKYICDGDSDSRSRYAAPPS  885
             FVSGKY+C+GD         PPS
Sbjct  1186  FVSGKYVCEGDGIRSGATPTPPS  1208


 Score = 375 bits (963),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 179/286 (63%), Positives = 220/286 (77%), Gaps = 3/286 (1%)

Query  1    MTVDFADYFWGEKNNGYDVLYHNMKHGAVASKELAEFLKERSTIEENNYKVLSKLAKQAG  60
            MTVDF DYFWGEKNNGYDVLYHNMK G +ASKEL+EFL+E+S IEE N K++SKLA +AG
Sbjct  1    MTVDFNDYFWGEKNNGYDVLYHNMKFGLIASKELSEFLREKSNIEEQNSKMMSKLAHKAG  60

Query  61   SSSSTQGTFAPVWAALRGAAEKLAGLHLQMAQRVTELIKDVSKYTDELHKKHKAVKEEES  120
            + +ST   FAPVW  LR +AEKL+ LHLQM Q++TEL+KDV+KY DELHKKHK+VKEEES
Sbjct  61   TLNST---FAPVWTILRTSAEKLSTLHLQMVQKLTELVKDVAKYADELHKKHKSVKEEES  117

Query  121  STLEVVQSIQNITVTLHKAKDMRMQKGLELEKLRKDNASQKELEKAEIKFKKAQDDYKTL  180
             TLE VQ+IQ  TV + K +D+   K  ELEKLRKDN S K+ EK E K KK Q++YK L
Sbjct  118  QTLECVQAIQTSTVAVQKLRDLYASKVQELEKLRKDNGSHKDAEKLESKLKKLQEEYKAL  177

Query  181  VDKYMGIRNDFQTKMTQTCRRFQYVEETHLKHMKEFLNIYADVLQSNHEQVGQVHIDFKR  240
            +DK+  I+N+F+ +MTQTC+RFQ +EE HL+ MKEFL+ Y ++LQ+NH+ VGQVH DFKR
Sbjct  178  LDKHNPIKNEFERRMTQTCKRFQEIEEVHLRQMKEFLSTYLEMLQNNHDMVGQVHSDFKR  237

Query  241  QCSDMTVDKLLEQFVQSKYTGFEKPGTFEYEEIITGLGEMTSHSQL  286
            Q  DM+VDKLLEQFV +KYTG EKP   E E +    G      Q+
Sbjct  238  QFVDMSVDKLLEQFVLNKYTGLEKPEMPELEYVALSSGSRLQQPQV  283


>A0A0B4KFZ2_DROME unnamed protein product
Length=1161

 Score = 575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/563 (56%), Positives = 394/563 (70%), Gaps = 62/563 (11%)

Query  356   EVDEDGFCIRPKAE-PWENEK----GFYSSSDTDSED-ERERKIRVEIKPLSNGGAPMSA  409
             EVDE+GF I+P  E  WE  +     FYS SDTDS++ ++ER+I V IKPL NG APMSA
Sbjct  616   EVDEEGFSIQPAKEIAWEEGQDKSGSFYSDSDTDSDNDKQERRIHVSIKPLKNGQAPMSA  675

Query  410   SVDELRATVENLSLSPAPTGRRGSNNDSDHHMKRSQSVSQQLGGKPSSDLLGLNLFNPSS  469
             SVDELRATVEN+SLSP  TG         HH ++ Q+      G P+S          S 
Sbjct  676   SVDELRATVENISLSP--TGVF------SHHSQQLQAAR----GAPASR-------QQSP  716

Query  470   TPSSASTPTGS-HPYAPLQSPPPLSLSPTPQPQPPQSAPPTHPHPRFPD-GDLFSEVGDI  527
               S+ASTPT S HPYAPLQSP   +LS         ++       R+ D GD+FSE+GD+
Sbjct  717   EISNASTPTASVHPYAPLQSP---TLSNNNNANNTTNS-------RYADLGDIFSELGDM  766

Query  528   TPALP-------PKQSASSTPT-----GSIIIPRPPSRRGE----GPSP------RGRSS  565
             + + P       P      TPT     GSI IPRPPSRR +    GP+       RGR S
Sbjct  767   SMSAPSSATLGKPPGRQIPTPTSASTGGSIAIPRPPSRRSDMIAIGPAATGTAPGRGRMS  826

Query  566   PATIS---RADSVASLEFRTAGVGVGSSRGPSPLTIGLADTIPLAVAFHEIVHSYFRGTD  622
             PA ++   RA+S+ SLEFRTA  GVGSSRGPSPLTIG++DTIPLAVAFHEI+H+YFRG+D
Sbjct  827   PAPVTAMNRAESIGSLEFRTAIGGVGSSRGPSPLTIGISDTIPLAVAFHEIIHAYFRGSD  886

Query  623   ETRCQVKLSGDMMLSFPAGIVAVLANNPSPAKLTFRVRNSNRLEKLFPNNQLVSMDATQT  682
             E+RCQVK+SGDMMLSFPAGI  +LANNP+PAKL FR+++   LE L PN +LV +D  Q+
Sbjct  887   ESRCQVKVSGDMMLSFPAGIAGLLANNPNPAKLGFRIKHVQNLENLVPNGKLVQIDRQQS  946

Query  683   TVDSTIFEFNMSALTTLLRKQAEQNPSASYFNVDILKYQIKCKEGAGSCPFQLVAYWKCE  742
             +  ST+ EFNM ALT LLR+QAE NP+ASYFNVDILKYQ++ K GA SCPFQLV+YWKCE
Sbjct  947   SSVSTMLEFNMGALTALLRRQAENNPTASYFNVDILKYQVRTKPGASSCPFQLVSYWKCE  1006

Query  743   TTHTDLKIDYKYNSRAMASPSPLLNLHVAAPIDGGFKSLNSKPQAQWLQDTNRVLWKFTE  802
             +++T LK+DYKYN+ AMAS SPLLN+ ++ P++G  +++ SKP + WL ++NR++W FT+
Sbjct  1007  SSYTALKVDYKYNNHAMASASPLLNVTLSVPVNGSVRNVQSKPHSAWLGESNRLVWNFTD  1066

Query  803   LSQHSEGNGVGSLKARVELAHGPGNQGTIFTQFNCEGTTLSGVEFELLGPGYRLSLVKRR  862
             +SQ+S+  GVG+L+AR+EL  GP     + TQFNCEGTTLSG+EFEL G GYRLSLVKRR
Sbjct  1067  ISQNSQDGGVGTLRARLELNDGPSTPALLATQFNCEGTTLSGIEFELQGSGYRLSLVKRR  1126

Query  863   FVSGKYICDGDSDSRSRYAAPPS  885
             FVSGKY+C+GD         PPS
Sbjct  1127  FVSGKYVCEGDGIRSGATPTPPS  1149


 Score = 375 bits (962),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 179/286 (63%), Positives = 220/286 (77%), Gaps = 3/286 (1%)

Query  1    MTVDFADYFWGEKNNGYDVLYHNMKHGAVASKELAEFLKERSTIEENNYKVLSKLAKQAG  60
            MTVDF DYFWGEKNNGYDVLYHNMK G +ASKEL+EFL+E+S IEE N K++SKLA +AG
Sbjct  1    MTVDFNDYFWGEKNNGYDVLYHNMKFGLIASKELSEFLREKSNIEEQNSKMMSKLAHKAG  60

Query  61   SSSSTQGTFAPVWAALRGAAEKLAGLHLQMAQRVTELIKDVSKYTDELHKKHKAVKEEES  120
            + +ST   FAPVW  LR +AEKL+ LHLQM Q++TEL+KDV+KY DELHKKHK+VKEEES
Sbjct  61   TLNST---FAPVWTILRTSAEKLSTLHLQMVQKLTELVKDVAKYADELHKKHKSVKEEES  117

Query  121  STLEVVQSIQNITVTLHKAKDMRMQKGLELEKLRKDNASQKELEKAEIKFKKAQDDYKTL  180
             TLE VQ+IQ  TV + K +D+   K  ELEKLRKDN S K+ EK E K KK Q++YK L
Sbjct  118  QTLECVQAIQTSTVAVQKLRDLYASKVQELEKLRKDNGSHKDAEKLESKLKKLQEEYKAL  177

Query  181  VDKYMGIRNDFQTKMTQTCRRFQYVEETHLKHMKEFLNIYADVLQSNHEQVGQVHIDFKR  240
            +DK+  I+N+F+ +MTQTC+RFQ +EE HL+ MKEFL+ Y ++LQ+NH+ VGQVH DFKR
Sbjct  178  LDKHNPIKNEFERRMTQTCKRFQEIEEVHLRQMKEFLSTYLEMLQNNHDMVGQVHSDFKR  237

Query  241  QCSDMTVDKLLEQFVQSKYTGFEKPGTFEYEEIITGLGEMTSHSQL  286
            Q  DM+VDKLLEQFV +KYTG EKP   E E +    G      Q+
Sbjct  238  QFVDMSVDKLLEQFVLNKYTGLEKPEMPELEYVALSSGSRLQQPQV  283


>Q9VHC4_DROME unnamed protein product
Length=1133

 Score = 574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/563 (56%), Positives = 394/563 (70%), Gaps = 62/563 (11%)

Query  356   EVDEDGFCIRPKAE-PWENEK----GFYSSSDTDSED-ERERKIRVEIKPLSNGGAPMSA  409
             EVDE+GF I+P  E  WE  +     FYS SDTDS++ ++ER+I V IKPL NG APMSA
Sbjct  588   EVDEEGFSIQPAKEIAWEEGQDKSGSFYSDSDTDSDNDKQERRIHVSIKPLKNGQAPMSA  647

Query  410   SVDELRATVENLSLSPAPTGRRGSNNDSDHHMKRSQSVSQQLGGKPSSDLLGLNLFNPSS  469
             SVDELRATVEN+SLSP  TG         HH ++ Q+      G P+S          S 
Sbjct  648   SVDELRATVENISLSP--TGVF------SHHSQQLQAAR----GAPASR-------QQSP  688

Query  470   TPSSASTPTGS-HPYAPLQSPPPLSLSPTPQPQPPQSAPPTHPHPRFPD-GDLFSEVGDI  527
               S+ASTPT S HPYAPLQSP   +LS         ++       R+ D GD+FSE+GD+
Sbjct  689   EISNASTPTASVHPYAPLQSP---TLSNNNNANNTTNS-------RYADLGDIFSELGDM  738

Query  528   TPALP-------PKQSASSTPT-----GSIIIPRPPSRRGE----GPSP------RGRSS  565
             + + P       P      TPT     GSI IPRPPSRR +    GP+       RGR S
Sbjct  739   SMSAPSSATLGKPPGRQIPTPTSASTGGSIAIPRPPSRRSDMIAIGPAATGTAPGRGRMS  798

Query  566   PATIS---RADSVASLEFRTAGVGVGSSRGPSPLTIGLADTIPLAVAFHEIVHSYFRGTD  622
             PA ++   RA+S+ SLEFRTA  GVGSSRGPSPLTIG++DTIPLAVAFHEI+H+YFRG+D
Sbjct  799   PAPVTAMNRAESIGSLEFRTAIGGVGSSRGPSPLTIGISDTIPLAVAFHEIIHAYFRGSD  858

Query  623   ETRCQVKLSGDMMLSFPAGIVAVLANNPSPAKLTFRVRNSNRLEKLFPNNQLVSMDATQT  682
             E+RCQVK+SGDMMLSFPAGI  +LANNP+PAKL FR+++   LE L PN +LV +D  Q+
Sbjct  859   ESRCQVKVSGDMMLSFPAGIAGLLANNPNPAKLGFRIKHVQNLENLVPNGKLVQIDRQQS  918

Query  683   TVDSTIFEFNMSALTTLLRKQAEQNPSASYFNVDILKYQIKCKEGAGSCPFQLVAYWKCE  742
             +  ST+ EFNM ALT LLR+QAE NP+ASYFNVDILKYQ++ K GA SCPFQLV+YWKCE
Sbjct  919   SSVSTMLEFNMGALTALLRRQAENNPTASYFNVDILKYQVRTKPGASSCPFQLVSYWKCE  978

Query  743   TTHTDLKIDYKYNSRAMASPSPLLNLHVAAPIDGGFKSLNSKPQAQWLQDTNRVLWKFTE  802
             +++T LK+DYKYN+ AMAS SPLLN+ ++ P++G  +++ SKP + WL ++NR++W FT+
Sbjct  979   SSYTALKVDYKYNNHAMASASPLLNVTLSVPVNGSVRNVQSKPHSAWLGESNRLVWNFTD  1038

Query  803   LSQHSEGNGVGSLKARVELAHGPGNQGTIFTQFNCEGTTLSGVEFELLGPGYRLSLVKRR  862
             +SQ+S+  GVG+L+AR+EL  GP     + TQFNCEGTTLSG+EFEL G GYRLSLVKRR
Sbjct  1039  ISQNSQDGGVGTLRARLELNDGPSTPALLATQFNCEGTTLSGIEFELQGSGYRLSLVKRR  1098

Query  863   FVSGKYICDGDSDSRSRYAAPPS  885
             FVSGKY+C+GD         PPS
Sbjct  1099  FVSGKYVCEGDGIRSGATPTPPS  1121


 Score = 375 bits (963),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 179/286 (63%), Positives = 220/286 (77%), Gaps = 3/286 (1%)

Query  1    MTVDFADYFWGEKNNGYDVLYHNMKHGAVASKELAEFLKERSTIEENNYKVLSKLAKQAG  60
            MTVDF DYFWGEKNNGYDVLYHNMK G +ASKEL+EFL+E+S IEE N K++SKLA +AG
Sbjct  1    MTVDFNDYFWGEKNNGYDVLYHNMKFGLIASKELSEFLREKSNIEEQNSKMMSKLAHKAG  60

Query  61   SSSSTQGTFAPVWAALRGAAEKLAGLHLQMAQRVTELIKDVSKYTDELHKKHKAVKEEES  120
            + +ST   FAPVW  LR +AEKL+ LHLQM Q++TEL+KDV+KY DELHKKHK+VKEEES
Sbjct  61   TLNST---FAPVWTILRTSAEKLSTLHLQMVQKLTELVKDVAKYADELHKKHKSVKEEES  117

Query  121  STLEVVQSIQNITVTLHKAKDMRMQKGLELEKLRKDNASQKELEKAEIKFKKAQDDYKTL  180
             TLE VQ+IQ  TV + K +D+   K  ELEKLRKDN S K+ EK E K KK Q++YK L
Sbjct  118  QTLECVQAIQTSTVAVQKLRDLYASKVQELEKLRKDNGSHKDAEKLESKLKKLQEEYKAL  177

Query  181  VDKYMGIRNDFQTKMTQTCRRFQYVEETHLKHMKEFLNIYADVLQSNHEQVGQVHIDFKR  240
            +DK+  I+N+F+ +MTQTC+RFQ +EE HL+ MKEFL+ Y ++LQ+NH+ VGQVH DFKR
Sbjct  178  LDKHNPIKNEFERRMTQTCKRFQEIEEVHLRQMKEFLSTYLEMLQNNHDMVGQVHSDFKR  237

Query  241  QCSDMTVDKLLEQFVQSKYTGFEKPGTFEYEEIITGLGEMTSHSQL  286
            Q  DM+VDKLLEQFV +KYTG EKP   E E +    G      Q+
Sbjct  238  QFVDMSVDKLLEQFVLNKYTGLEKPEMPELEYVALSSGSRLQQPQV  283



Lambda      K        H
   0.319    0.136    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8012016630


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jan 6, 2022  5:12 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_003393080.1 F-BAR domain only protein 2 isoform X3 [Bombus
terrestris]

Length=953
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q6AWD5_DROME  unnamed protein product                                 577     0.0  
A0A0B4KFZ2_DROME  unnamed protein product                             576     0.0  
Q9VHC4_DROME  unnamed protein product                                 575     0.0  


>Q6AWD5_DROME unnamed protein product
Length=1220

 Score = 577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/563 (56%), Positives = 394/563 (70%), Gaps = 62/563 (11%)

Query  421   EVDEDGFCIRPKAE-PWENEK----GFYSSSDTDSED-ERERKIRVEIKPLSNGGAPMSA  474
             EVDE+GF I+P  E  WE  +     FYS SDTDS++ ++ER+I V IKPL NG APMSA
Sbjct  675   EVDEEGFSIQPAKEIAWEEGQDKSGSFYSDSDTDSDNDKQERRIHVSIKPLKNGQAPMSA  734

Query  475   SVDELRATVENLSLSPAPTGRRGSNNDSDHHMKRSQSVSQQLGGKPSSDLLGLNLFNPSS  534
             SVDELRATVEN+SLSP  TG         HH ++ Q+      G P+S          S 
Sbjct  735   SVDELRATVENISLSP--TGVF------SHHSQQLQAAR----GAPASR-------QQSP  775

Query  535   TPSSASTPTGS-HPYAPLQSPPPLSLSPTPQPQPPQSAPPTHPHPRFPD-GDLFSEVGDI  592
               S+ASTPT S HPYAPLQSP   +LS         ++       R+ D GD+FSE+GD+
Sbjct  776   EISNASTPTASVHPYAPLQSP---TLSNNNNANNTTNS-------RYADLGDIFSELGDM  825

Query  593   TPALP-------PKQSASSTPT-----GSIIIPRPPSRRGE----GPSP------RGRSS  630
             + + P       P      TPT     GSI IPRPPSRR +    GP+       RGR S
Sbjct  826   SMSAPSSATLGKPPGRQIPTPTSASTGGSIAIPRPPSRRSDMIAIGPAATGTAPGRGRMS  885

Query  631   PATIS---RADSVASLEFRTAGVGVGSSRGPSPLTIGLADTIPLAVAFHEIVHSYFRGTD  687
             PA ++   RA+S+ SLEFRTA  GVGSSRGPSPLTIG++DTIPLAVAFHEI+H+YFRG+D
Sbjct  886   PAPVTAMNRAESIGSLEFRTAIGGVGSSRGPSPLTIGISDTIPLAVAFHEIIHAYFRGSD  945

Query  688   ETRCQVKLSGDMMLSFPAGIVAVLANNPSPAKLTFRVRNSNRLEKLFPNNQLVSMDATQT  747
             E+RCQVK+SGDMMLSFPAGI  +LANNP+PAKL FR+++   LE L PN +LV +D  Q+
Sbjct  946   ESRCQVKVSGDMMLSFPAGIAGLLANNPNPAKLGFRIKHVQNLENLVPNGKLVQIDRQQS  1005

Query  748   TVDSTIFEFNMSALTTLLRKQAEQNPSASYFNVDILKYQIKCKEGAGSCPFQLVAYWKCE  807
             +  ST+ EFNM ALT LLR+QAE NP+ASYFNVDILKYQ++ K GA SCPFQLV+YWKCE
Sbjct  1006  SSVSTMLEFNMGALTALLRRQAENNPTASYFNVDILKYQVRTKPGASSCPFQLVSYWKCE  1065

Query  808   TTHTDLKIDYKYNSRAMASPSPLLNLHVAAPIDGGFKSLNSKPQAQWLQDTNRVLWKFTE  867
             +++T LK+DYKYN+ AMAS SPLLN+ ++ P++G  +++ SKP + WL ++NR++W FT+
Sbjct  1066  SSYTALKVDYKYNNHAMASASPLLNVTLSVPVNGSVRNVQSKPHSAWLGESNRLVWNFTD  1125

Query  868   LSQHSEGNGVGSLKARVELAHGPGNQGTIFTQFNCEGTTLSGVEFELLGPGYRLSLVKRR  927
             +SQ+S+  GVG+L+AR+EL  GP     + TQFNCEGTTLSG+EFEL G GYRLSLVKRR
Sbjct  1126  ISQNSQDGGVGTLRARLELNDGPSTPALLATQFNCEGTTLSGIEFELQGSGYRLSLVKRR  1185

Query  928   FVSGKYICDGDSDSRSRYAAPPS  950
             FVSGKY+C+GD         PPS
Sbjct  1186  FVSGKYVCEGDGIRSGATPTPPS  1208


 Score = 375 bits (963),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 179/286 (63%), Positives = 220/286 (77%), Gaps = 3/286 (1%)

Query  1    MTVDFADYFWGEKNNGYDVLYHNMKHGAVASKELAEFLKERSTIEENNYKVLSKLAKQAG  60
            MTVDF DYFWGEKNNGYDVLYHNMK G +ASKEL+EFL+E+S IEE N K++SKLA +AG
Sbjct  1    MTVDFNDYFWGEKNNGYDVLYHNMKFGLIASKELSEFLREKSNIEEQNSKMMSKLAHKAG  60

Query  61   SSSSTQGTFAPVWAALRGAAEKLAGLHLQMAQRVTELIKDVSKYTDELHKKHKAVKEEES  120
            + +ST   FAPVW  LR +AEKL+ LHLQM Q++TEL+KDV+KY DELHKKHK+VKEEES
Sbjct  61   TLNST---FAPVWTILRTSAEKLSTLHLQMVQKLTELVKDVAKYADELHKKHKSVKEEES  117

Query  121  STLEVVQSIQNITVTLHKAKDMRMQKGLELEKLRKDNASQKELEKAEIKFKKAQDDYKTL  180
             TLE VQ+IQ  TV + K +D+   K  ELEKLRKDN S K+ EK E K KK Q++YK L
Sbjct  118  QTLECVQAIQTSTVAVQKLRDLYASKVQELEKLRKDNGSHKDAEKLESKLKKLQEEYKAL  177

Query  181  VDKYMGIRNDFQTKMTQTCRRFQYVEETHLKHMKEFLNIYADVLQSNHEQVGQVHIDFKR  240
            +DK+  I+N+F+ +MTQTC+RFQ +EE HL+ MKEFL+ Y ++LQ+NH+ VGQVH DFKR
Sbjct  178  LDKHNPIKNEFERRMTQTCKRFQEIEEVHLRQMKEFLSTYLEMLQNNHDMVGQVHSDFKR  237

Query  241  QCSDMTVDKLLEQFVQSKYTGFEKPGTFEYEEIITGLGEMTSHSQL  286
            Q  DM+VDKLLEQFV +KYTG EKP   E E +    G      Q+
Sbjct  238  QFVDMSVDKLLEQFVLNKYTGLEKPEMPELEYVALSSGSRLQQPQV  283


>A0A0B4KFZ2_DROME unnamed protein product
Length=1161

 Score = 576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/563 (56%), Positives = 394/563 (70%), Gaps = 62/563 (11%)

Query  421   EVDEDGFCIRPKAE-PWENEK----GFYSSSDTDSED-ERERKIRVEIKPLSNGGAPMSA  474
             EVDE+GF I+P  E  WE  +     FYS SDTDS++ ++ER+I V IKPL NG APMSA
Sbjct  616   EVDEEGFSIQPAKEIAWEEGQDKSGSFYSDSDTDSDNDKQERRIHVSIKPLKNGQAPMSA  675

Query  475   SVDELRATVENLSLSPAPTGRRGSNNDSDHHMKRSQSVSQQLGGKPSSDLLGLNLFNPSS  534
             SVDELRATVEN+SLSP  TG         HH ++ Q+      G P+S          S 
Sbjct  676   SVDELRATVENISLSP--TGVF------SHHSQQLQAAR----GAPASR-------QQSP  716

Query  535   TPSSASTPTGS-HPYAPLQSPPPLSLSPTPQPQPPQSAPPTHPHPRFPD-GDLFSEVGDI  592
               S+ASTPT S HPYAPLQSP   +LS         ++       R+ D GD+FSE+GD+
Sbjct  717   EISNASTPTASVHPYAPLQSP---TLSNNNNANNTTNS-------RYADLGDIFSELGDM  766

Query  593   TPALP-------PKQSASSTPT-----GSIIIPRPPSRRGE----GPSP------RGRSS  630
             + + P       P      TPT     GSI IPRPPSRR +    GP+       RGR S
Sbjct  767   SMSAPSSATLGKPPGRQIPTPTSASTGGSIAIPRPPSRRSDMIAIGPAATGTAPGRGRMS  826

Query  631   PATIS---RADSVASLEFRTAGVGVGSSRGPSPLTIGLADTIPLAVAFHEIVHSYFRGTD  687
             PA ++   RA+S+ SLEFRTA  GVGSSRGPSPLTIG++DTIPLAVAFHEI+H+YFRG+D
Sbjct  827   PAPVTAMNRAESIGSLEFRTAIGGVGSSRGPSPLTIGISDTIPLAVAFHEIIHAYFRGSD  886

Query  688   ETRCQVKLSGDMMLSFPAGIVAVLANNPSPAKLTFRVRNSNRLEKLFPNNQLVSMDATQT  747
             E+RCQVK+SGDMMLSFPAGI  +LANNP+PAKL FR+++   LE L PN +LV +D  Q+
Sbjct  887   ESRCQVKVSGDMMLSFPAGIAGLLANNPNPAKLGFRIKHVQNLENLVPNGKLVQIDRQQS  946

Query  748   TVDSTIFEFNMSALTTLLRKQAEQNPSASYFNVDILKYQIKCKEGAGSCPFQLVAYWKCE  807
             +  ST+ EFNM ALT LLR+QAE NP+ASYFNVDILKYQ++ K GA SCPFQLV+YWKCE
Sbjct  947   SSVSTMLEFNMGALTALLRRQAENNPTASYFNVDILKYQVRTKPGASSCPFQLVSYWKCE  1006

Query  808   TTHTDLKIDYKYNSRAMASPSPLLNLHVAAPIDGGFKSLNSKPQAQWLQDTNRVLWKFTE  867
             +++T LK+DYKYN+ AMAS SPLLN+ ++ P++G  +++ SKP + WL ++NR++W FT+
Sbjct  1007  SSYTALKVDYKYNNHAMASASPLLNVTLSVPVNGSVRNVQSKPHSAWLGESNRLVWNFTD  1066

Query  868   LSQHSEGNGVGSLKARVELAHGPGNQGTIFTQFNCEGTTLSGVEFELLGPGYRLSLVKRR  927
             +SQ+S+  GVG+L+AR+EL  GP     + TQFNCEGTTLSG+EFEL G GYRLSLVKRR
Sbjct  1067  ISQNSQDGGVGTLRARLELNDGPSTPALLATQFNCEGTTLSGIEFELQGSGYRLSLVKRR  1126

Query  928   FVSGKYICDGDSDSRSRYAAPPS  950
             FVSGKY+C+GD         PPS
Sbjct  1127  FVSGKYVCEGDGIRSGATPTPPS  1149


 Score = 374 bits (961),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 179/286 (63%), Positives = 220/286 (77%), Gaps = 3/286 (1%)

Query  1    MTVDFADYFWGEKNNGYDVLYHNMKHGAVASKELAEFLKERSTIEENNYKVLSKLAKQAG  60
            MTVDF DYFWGEKNNGYDVLYHNMK G +ASKEL+EFL+E+S IEE N K++SKLA +AG
Sbjct  1    MTVDFNDYFWGEKNNGYDVLYHNMKFGLIASKELSEFLREKSNIEEQNSKMMSKLAHKAG  60

Query  61   SSSSTQGTFAPVWAALRGAAEKLAGLHLQMAQRVTELIKDVSKYTDELHKKHKAVKEEES  120
            + +ST   FAPVW  LR +AEKL+ LHLQM Q++TEL+KDV+KY DELHKKHK+VKEEES
Sbjct  61   TLNST---FAPVWTILRTSAEKLSTLHLQMVQKLTELVKDVAKYADELHKKHKSVKEEES  117

Query  121  STLEVVQSIQNITVTLHKAKDMRMQKGLELEKLRKDNASQKELEKAEIKFKKAQDDYKTL  180
             TLE VQ+IQ  TV + K +D+   K  ELEKLRKDN S K+ EK E K KK Q++YK L
Sbjct  118  QTLECVQAIQTSTVAVQKLRDLYASKVQELEKLRKDNGSHKDAEKLESKLKKLQEEYKAL  177

Query  181  VDKYMGIRNDFQTKMTQTCRRFQYVEETHLKHMKEFLNIYADVLQSNHEQVGQVHIDFKR  240
            +DK+  I+N+F+ +MTQTC+RFQ +EE HL+ MKEFL+ Y ++LQ+NH+ VGQVH DFKR
Sbjct  178  LDKHNPIKNEFERRMTQTCKRFQEIEEVHLRQMKEFLSTYLEMLQNNHDMVGQVHSDFKR  237

Query  241  QCSDMTVDKLLEQFVQSKYTGFEKPGTFEYEEIITGLGEMTSHSQL  286
            Q  DM+VDKLLEQFV +KYTG EKP   E E +    G      Q+
Sbjct  238  QFVDMSVDKLLEQFVLNKYTGLEKPEMPELEYVALSSGSRLQQPQV  283


>Q9VHC4_DROME unnamed protein product
Length=1133

 Score = 575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/563 (56%), Positives = 394/563 (70%), Gaps = 62/563 (11%)

Query  421   EVDEDGFCIRPKAE-PWENEK----GFYSSSDTDSEDER-ERKIRVEIKPLSNGGAPMSA  474
             EVDE+GF I+P  E  WE  +     FYS SDTDS++++ ER+I V IKPL NG APMSA
Sbjct  588   EVDEEGFSIQPAKEIAWEEGQDKSGSFYSDSDTDSDNDKQERRIHVSIKPLKNGQAPMSA  647

Query  475   SVDELRATVENLSLSPAPTGRRGSNNDSDHHMKRSQSVSQQLGGKPSSDLLGLNLFNPSS  534
             SVDELRATVEN+SLSP  TG         HH ++ Q+      G P+S          S 
Sbjct  648   SVDELRATVENISLSP--TGVF------SHHSQQLQAAR----GAPASR-------QQSP  688

Query  535   TPSSASTPTGS-HPYAPLQSPPPLSLSPTPQPQPPQSAPPTHPHPRFPD-GDLFSEVGDI  592
               S+ASTPT S HPYAPLQSP   +LS         ++       R+ D GD+FSE+GD+
Sbjct  689   EISNASTPTASVHPYAPLQSP---TLSNNNNANNTTNS-------RYADLGDIFSELGDM  738

Query  593   TPALP-------PKQSASSTPT-----GSIIIPRPPSRRGE----GPSP------RGRSS  630
             + + P       P      TPT     GSI IPRPPSRR +    GP+       RGR S
Sbjct  739   SMSAPSSATLGKPPGRQIPTPTSASTGGSIAIPRPPSRRSDMIAIGPAATGTAPGRGRMS  798

Query  631   PATIS---RADSVASLEFRTAGVGVGSSRGPSPLTIGLADTIPLAVAFHEIVHSYFRGTD  687
             PA ++   RA+S+ SLEFRTA  GVGSSRGPSPLTIG++DTIPLAVAFHEI+H+YFRG+D
Sbjct  799   PAPVTAMNRAESIGSLEFRTAIGGVGSSRGPSPLTIGISDTIPLAVAFHEIIHAYFRGSD  858

Query  688   ETRCQVKLSGDMMLSFPAGIVAVLANNPSPAKLTFRVRNSNRLEKLFPNNQLVSMDATQT  747
             E+RCQVK+SGDMMLSFPAGI  +LANNP+PAKL FR+++   LE L PN +LV +D  Q+
Sbjct  859   ESRCQVKVSGDMMLSFPAGIAGLLANNPNPAKLGFRIKHVQNLENLVPNGKLVQIDRQQS  918

Query  748   TVDSTIFEFNMSALTTLLRKQAEQNPSASYFNVDILKYQIKCKEGAGSCPFQLVAYWKCE  807
             +  ST+ EFNM ALT LLR+QAE NP+ASYFNVDILKYQ++ K GA SCPFQLV+YWKCE
Sbjct  919   SSVSTMLEFNMGALTALLRRQAENNPTASYFNVDILKYQVRTKPGASSCPFQLVSYWKCE  978

Query  808   TTHTDLKIDYKYNSRAMASPSPLLNLHVAAPIDGGFKSLNSKPQAQWLQDTNRVLWKFTE  867
             +++T LK+DYKYN+ AMAS SPLLN+ ++ P++G  +++ SKP + WL ++NR++W FT+
Sbjct  979   SSYTALKVDYKYNNHAMASASPLLNVTLSVPVNGSVRNVQSKPHSAWLGESNRLVWNFTD  1038

Query  868   LSQHSEGNGVGSLKARVELAHGPGNQGTIFTQFNCEGTTLSGVEFELLGPGYRLSLVKRR  927
             +SQ+S+  GVG+L+AR+EL  GP     + TQFNCEGTTLSG+EFEL G GYRLSLVKRR
Sbjct  1039  ISQNSQDGGVGTLRARLELNDGPSTPALLATQFNCEGTTLSGIEFELQGSGYRLSLVKRR  1098

Query  928   FVSGKYICDGDSDSRSRYAAPPS  950
             FVSGKY+C+GD         PPS
Sbjct  1099  FVSGKYVCEGDGIRSGATPTPPS  1121


 Score = 375 bits (963),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 179/286 (63%), Positives = 220/286 (77%), Gaps = 3/286 (1%)

Query  1    MTVDFADYFWGEKNNGYDVLYHNMKHGAVASKELAEFLKERSTIEENNYKVLSKLAKQAG  60
            MTVDF DYFWGEKNNGYDVLYHNMK G +ASKEL+EFL+E+S IEE N K++SKLA +AG
Sbjct  1    MTVDFNDYFWGEKNNGYDVLYHNMKFGLIASKELSEFLREKSNIEEQNSKMMSKLAHKAG  60

Query  61   SSSSTQGTFAPVWAALRGAAEKLAGLHLQMAQRVTELIKDVSKYTDELHKKHKAVKEEES  120
            + +ST   FAPVW  LR +AEKL+ LHLQM Q++TEL+KDV+KY DELHKKHK+VKEEES
Sbjct  61   TLNST---FAPVWTILRTSAEKLSTLHLQMVQKLTELVKDVAKYADELHKKHKSVKEEES  117

Query  121  STLEVVQSIQNITVTLHKAKDMRMQKGLELEKLRKDNASQKELEKAEIKFKKAQDDYKTL  180
             TLE VQ+IQ  TV + K +D+   K  ELEKLRKDN S K+ EK E K KK Q++YK L
Sbjct  118  QTLECVQAIQTSTVAVQKLRDLYASKVQELEKLRKDNGSHKDAEKLESKLKKLQEEYKAL  177

Query  181  VDKYMGIRNDFQTKMTQTCRRFQYVEETHLKHMKEFLNIYADVLQSNHEQVGQVHIDFKR  240
            +DK+  I+N+F+ +MTQTC+RFQ +EE HL+ MKEFL+ Y ++LQ+NH+ VGQVH DFKR
Sbjct  178  LDKHNPIKNEFERRMTQTCKRFQEIEEVHLRQMKEFLSTYLEMLQNNHDMVGQVHSDFKR  237

Query  241  QCSDMTVDKLLEQFVQSKYTGFEKPGTFEYEEIITGLGEMTSHSQL  286
            Q  DM+VDKLLEQFV +KYTG EKP   E E +    G      Q+
Sbjct  238  QFVDMSVDKLLEQFVLNKYTGLEKPEMPELEYVALSSGSRLQQPQV  283



Lambda      K        H
   0.311    0.128    0.365 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 12077156952


Query= XP_003393083.1 microtubule-associated serine/threonine-protein
kinase 3 isoform X3 [Bombus terrestris]

Length=1756
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VUQ9_DROME  unnamed protein product                                 658     0.0  
Q8MSY6_DROME  unnamed protein product                                 270     2e-75
Q8I4W3_PLAF7  unnamed protein product                                 252     3e-70


>Q9VUQ9_DROME unnamed protein product
Length=2139

 Score = 658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/346 (87%), Positives = 325/346 (94%), Gaps = 2/346 (1%)

Query  473   PCEGDYEVLKLISNGAYGAVYLVKEKTTRQRFAMKKINKNNLMLRNQVEQVFAERDIMSF  532
             P E D++++KLISNGAYGAVYLVK KTTRQRFAMKKINKNNL+LRNQVEQVFAERDI+SF
Sbjct  830   PQENDFDIVKLISNGAYGAVYLVKHKTTRQRFAMKKINKNNLILRNQVEQVFAERDILSF  889

Query  533   TDNPFVVSMYCSFETKKHLCLVMEYVEGGDCANLLKNIGPLPPDMARFYFAETVLAVEYL  592
              DNPFVVSMYCSFETKKHLCLVMEYVEGGDC  LLKNIGPLP DMARFYFAETVLAVEYL
Sbjct  890   ADNPFVVSMYCSFETKKHLCLVMEYVEGGDCGTLLKNIGPLPADMARFYFAETVLAVEYL  949

Query  593   HSYGIVHRDLKPDNLLITALGHIKLTDFGLSKMGLMSLATNLYEGYIDRDTRQFSDKQVF  652
             HSYGIVHRDLKPDNLLITALGHIKLTDFGLSKMGLMSLATNLYEGYID +TRQFSDKQV+
Sbjct  950   HSYGIVHRDLKPDNLLITALGHIKLTDFGLSKMGLMSLATNLYEGYIDSETRQFSDKQVY  1009

Query  653   GTPEYIAPEVILRQGYGKPVDWWSMGIILYEFLIGCVPFFGDTPEELFAHTVNDDIDWPD  712
             GTPEYIAPEVILRQGYGKPVDWWSMGIILYEFLIGCVPFFG+T EELFAHTVNDDI+WPD
Sbjct  1010  GTPEYIAPEVILRQGYGKPVDWWSMGIILYEFLIGCVPFFGETTEELFAHTVNDDIEWPD  1069

Query  713   EDDWPVQPEAKDIITALLQQSPRDRLGT-GGSHEVKEHPYFYGVNWNSLLRQKAEFVPQL  771
              +DWPVQ EAKDII+ LLQQ+PRDRLGT  G+ E+KEH YF G++WNSLLRQKAEFVPQL
Sbjct  1070  SEDWPVQAEAKDIISQLLQQNPRDRLGTQSGALEMKEHEYFLGMDWNSLLRQKAEFVPQL  1129

Query  772   INDEDTSYFDTRMDRYNHDIGDD-TDDTDDSPLFGSFSSYSPQSRK  816
              +D+DTSYFDTRMDRYNHD+G + TDDTDD+P+FGSF+SY+PQ RK
Sbjct  1130  SHDDDTSYFDTRMDRYNHDLGGEDTDDTDDTPVFGSFNSYTPQYRK  1175


 Score = 320 bits (821),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 179/302 (59%), Positives = 219/302 (73%), Gaps = 28/302 (9%)

Query  925   ISLSTPDSSQTESEDISPQIQRKRH-VHSRDKLPRLDLFAANRDTTEESKHNSSTDSFES  983
              S STP+SSQT+S+D SPQI RKR  V +RD LPR  +      + E+   ++ + S E+
Sbjct  1355  FSRSTPESSQTDSDDFSPQINRKRKGVCARDILPRFSI------SIEDETISAGSSSTEN  1408

Query  984   FN--------AISIIPSA-----------KQKSRSVIKSASTSGLSLVIPTSDFSYDASL  1024
              N        A+   P +             +SRS++KSAS  GLSL+    +    A L
Sbjct  1409  MNLPREQSPLALQHQPKSMDGSTSGSSVKHHRSRSIVKSASALGLSLMTSLDNSQLAAQL  1468

Query  1025  N--TQPIESPGGSSTASSRDTSPCRELSPLVTSLKPPIIIRRGPCGFGFTVHTIRVYYGD  1082
                  P     GSSTASSRDTSPCRELSPLVT+LKPPIIIRRGP GFGFTVHTIRVYYGD
Sbjct  1469  CGIQSPGGGGNGSSTASSRDTSPCRELSPLVTNLKPPIIIRRGPRGFGFTVHTIRVYYGD  1528

Query  1083  SDFYTMHHLVMAVDQSSPAFEAGLRPGDLITHINGEPVQGLYHIQVLQLMLSGGDHVTLR  1142
             +DFYTMHHLVMAVD+ SPAFEAGLRP DLITH+NGE VQGL+H QVLQL+LSGG+HVTLR
Sbjct  1529  TDFYTMHHLVMAVDEGSPAFEAGLRPADLITHVNGEAVQGLFHTQVLQLLLSGGEHVTLR  1588

Query  1143  STPLENTSIKTGGRRRDLTQSKMARRTLHKQRKLKRDHSDKKRKTSLFKRISSKRASVEM  1202
             +TPLE+TSI++GGR+RDL QSK+A++ +++Q+K  +   DKKRKTSLF+RISSKRA+ EM
Sbjct  1589  ATPLEHTSIQSGGRKRDLMQSKLAKKGVNRQKKQTKREHDKKRKTSLFRRISSKRANAEM  1648

Query  1203  QQ  1204
             QQ
Sbjct  1649  QQ  1650


 Score = 271 bits (693),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 147/208 (71%), Positives = 170/208 (82%), Gaps = 5/208 (2%)

Query  243  GRRSPLHRPRSRSLSSPSRSPVLDSEIVMMNTLYKERFPKATQQMEERLTNFINENKELD  302
            GR SP  RPRSRSLSSPSRSP++D+EI +MNTLYKERFPKATQQMEERL  FINENK   
Sbjct  513  GRMSPYFRPRSRSLSSPSRSPIVDNEIAVMNTLYKERFPKATQQMEERLKLFINENKS--  570

Query  303  EYEVMANMTQDSLPILRFVHHQVIEMARDCLQKSQEKLITTRYFYEMSENLEHLLMETKD  362
                  N  +DS PI+RFVHHQV+EMARDCL KS+ KLIT++YFYE+SENLE LL+ETK+
Sbjct  571  ---AACNSFRDSQPIVRFVHHQVLEMARDCLHKSEAKLITSQYFYELSENLERLLVETKE  627

Query  363  KSLDAAARLTGLIKKLLLVISRPARLLECLEFDPEEFYHLLEQAEGQAKINAGIKNDIPQ  422
            KS +AAA L G+IKKLLL+ISRPARLLECLEFDP+EFY LLE AEG AK    IK DIPQ
Sbjct  628  KSPEAAAELNGVIKKLLLIISRPARLLECLEFDPQEFYELLEAAEGHAKAMPVIKADIPQ  687

Query  423  YIINKLSLNRDPISELQEDLNKLEDSAS  450
            YII+KL LNRDPI+ELQ++L + +   S
Sbjct  688  YIIHKLGLNRDPIAELQQELRETQQMCS  715


 Score = 145 bits (367),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 130/261 (50%), Positives = 147/261 (56%), Gaps = 54/261 (21%)

Query  1313  YQRPSTLHGLKHKLHTAA----------------KNIHS------PNRRKSVGHIPLSPL  1350
             YQRPSTLHGLKHKLH A                 K +H+      PNRRKSVGHIPLSPL
Sbjct  1766  YQRPSTLHGLKHKLHAATAVIAGGGNANNPAGGLKTLHTTNNNSLPNRRKSVGHIPLSPL  1825

Query  1351  ARTPSPSPLPASPTRSPSPLAFP-TGHQPGSSNTTQSYSPGVCLST------PNNQKKSY  1403
             ARTPSPSPLP+SPTRSPSPLAFP  GHQPG+SNTTQSYSPG  L T       N +K  +
Sbjct  1826  ARTPSPSPLPSSPTRSPSPLAFPLVGHQPGASNTTQSYSPGSTLPTLQTAVNANTKKAGF  1885

Query  1404  GRPKSAEPGSPLLRRALSPDRLHPRSAENKTSISPLANT----------VVKVTPRATIA  1453
              R KSAEP SPLLRRALSPDRLHPRSAE K  ISPL  +          VV  T R+T  
Sbjct  1886  ARTKSAEPSSPLLRRALSPDRLHPRSAETK--ISPLCCSPPIKQPTHQRVVTTTWRST--  1941

Query  1454  QPYPETSEECSDSFKEPNDSKV--------EKKVSTESKSDYSKISHGISINLGNVGISN  1505
              P    S         P+   +        E +  T   +  S  + G   +   V    
Sbjct  1942  -PGGSASGAGGAVLGAPSVQPLQLVPAASEESQRQTAMATVVSTTAAGTDPSATAVVTLA  2000

Query  1506  SCGSTQLPRIAEEKDSPTGSK  1526
             +C    LPRIAEEKDSPT ++
Sbjct  2001  NC--EPLPRIAEEKDSPTSTQ  2019


 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 63/86 (73%), Gaps = 7/86 (8%)

Query  114  RCHSPLSAFVPIVGSPLESPRMSSSPHFAFAPIKRIGGGTTGTGDGRRWSVASLPSSGYG  173
            R HSP SA      SP++SPR++S   FAFAPIKRI        DGRRWSVASLPSSGYG
Sbjct  335  RTHSPYSA------SPVDSPRLNSPMPFAFAPIKRIASCRGVVADGRRWSVASLPSSGYG  388

Query  174  TTPGSSNVSSQYSSQERLHQLP-NVP  198
            TTPGSSN+SSQ SSQE L+QL  N+P
Sbjct  389  TTPGSSNLSSQCSSQEGLNQLAHNIP  414


 Score = 40.8 bits (94),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 24/27 (89%), Gaps = 0/27 (0%)

Query  57   VRPVSGELSNLVRMRNSAIGKSAPSLS  83
            +R VSGE SNL+RMR+S++GKSAP L+
Sbjct  216  LRAVSGETSNLLRMRHSSLGKSAPCLT  242


>Q8MSY6_DROME unnamed protein product
Length=870

 Score = 270 bits (691),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 147/208 (71%), Positives = 170/208 (82%), Gaps = 5/208 (2%)

Query  243  GRRSPLHRPRSRSLSSPSRSPVLDSEIVMMNTLYKERFPKATQQMEERLTNFINENKELD  302
            GR SP  RPRSRSLSSPSRSP++D+EI +MNTLYKERFPKATQQMEERL  FINENK   
Sbjct  513  GRMSPYFRPRSRSLSSPSRSPIVDNEIAVMNTLYKERFPKATQQMEERLKLFINENKS--  570

Query  303  EYEVMANMTQDSLPILRFVHHQVIEMARDCLQKSQEKLITTRYFYEMSENLEHLLMETKD  362
                  N  +DS PI+RFVHHQV+EMARDCL KS+ KLIT++YFYE+SENLE LL+ETK+
Sbjct  571  ---AACNSFRDSQPIVRFVHHQVLEMARDCLHKSEAKLITSQYFYELSENLERLLVETKE  627

Query  363  KSLDAAARLTGLIKKLLLVISRPARLLECLEFDPEEFYHLLEQAEGQAKINAGIKNDIPQ  422
            KS +AAA L G+IKKLLL+ISRPARLLECLEFDP+EFY LLE AEG AK    IK DIPQ
Sbjct  628  KSPEAAAELNGVIKKLLLIISRPARLLECLEFDPQEFYELLEAAEGHAKAMPVIKADIPQ  687

Query  423  YIINKLSLNRDPISELQEDLNKLEDSAS  450
            YII+KL LNRDPI+ELQ++L + +   S
Sbjct  688  YIIHKLGLNRDPIAELQQELRETQQMCS  715


 Score = 87.4 bits (215),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 63/86 (73%), Gaps = 7/86 (8%)

Query  114  RCHSPLSAFVPIVGSPLESPRMSSSPHFAFAPIKRIGGGTTGTGDGRRWSVASLPSSGYG  173
            R HSP SA      SP++SPR++S   FAFAPIKRI        DGRRWSVASLPSSGYG
Sbjct  335  RTHSPYSA------SPVDSPRLNSPMPFAFAPIKRIASCRGVVADGRRWSVASLPSSGYG  388

Query  174  TTPGSSNVSSQYSSQERLHQLP-NVP  198
            TTPGSSN+SSQ SSQE L+QL  N+P
Sbjct  389  TTPGSSNLSSQCSSQEGLNQLAHNIP  414


 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 31/34 (91%), Gaps = 0/34 (0%)

Query  473  PCEGDYEVLKLISNGAYGAVYLVKEKTTRQRFAM  506
            P E D++++KLISNGAYGAVYLVK KTTRQRFAM
Sbjct  830  PQENDFDIVKLISNGAYGAVYLVKHKTTRQRFAM  863


 Score = 40.8 bits (94),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 24/27 (89%), Gaps = 0/27 (0%)

Query  57   VRPVSGELSNLVRMRNSAIGKSAPSLS  83
            +R VSGE SNL+RMR+S++GKSAP L+
Sbjct  216  LRAVSGETSNLLRMRHSSLGKSAPCLT  242


>Q8I4W3_PLAF7 unnamed protein product
Length=735

 Score = 252 bits (643),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 123/297 (41%), Positives = 185/297 (62%), Gaps = 22/297 (7%)

Query  467  EKSHRVPCEGDYEVLKLISNGAYGAVYLVKEKTTRQRFAMKKINKNNLMLRNQVEQVFAE  526
            E+  R+  E  +  LK+I  G+YG V LVK    ++ +AMK + K N++ RNQ+E    E
Sbjct  393  ERKKRIRPES-FNYLKVIGEGSYGKVMLVKHVQNKKLYAMKILRKENILSRNQLEHTKVE  451

Query  527  RDIMSFTDNPFVVSMYCSFETKKHLCLVMEYVEGGDCANLLKNIGPLPPDMARFYFAETV  586
            R+I+    +PF+V MY +F+TK+ L  ++EY  GG+    L  +     + A+FY +E +
Sbjct  452  RNILKCVSHPFIVKMYYAFQTKQKLYFILEYCPGGELFFHLSKLREFSEETAKFYSSEII  511

Query  587  LAVEYLHSYGIVHRDLKPDNLLITALGHIKLTDFGLSKMGLMSLATNLYEGYIDRDTRQF  646
            LA+EYLH   I++RDLKP+N+L+  LGHI+LTDFGLSK G+    TNL            
Sbjct  512  LALEYLHDLNIIYRDLKPENVLLDELGHIRLTDFGLSKEGITE--TNL------------  557

Query  647  SDKQVFGTPEYIAPEVILRQGYGKPVDWWSMGIILYEFLIGCVPFFGDTPEELFAHTVND  706
              K + GTPEY+APE+I ++G+GK VDWWS+GI+LYE L G +PF       LF      
Sbjct  558  -TKSLCGTPEYLAPEIIEQKGHGKAVDWWSLGIMLYEMLTGELPFNNTNRNVLFESIKYQ  616

Query  707  DIDWPDEDDWPVQPEAKDIITALLQQSPRDRLGTGG--SHEVKEHPYFYGVNWNSLL  761
             +++P      + P+A D++T L +++P+ RLG+GG  + E+K+HP+F  +NWN +L
Sbjct  617  KLNYPKN----LSPKAVDLLTKLFEKNPKKRLGSGGTDAQEIKKHPFFKNINWNDVL  669



Lambda      K        H
   0.311    0.128    0.365 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 12077156952


Query= XP_003393084.1 microtubule-associated serine/threonine-protein
kinase 3 isoform X1 [Bombus terrestris]

Length=1766
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VUQ9_DROME  unnamed protein product                                 658     0.0  
Q8MSY6_DROME  unnamed protein product                                 270     2e-75
Q8I4W3_PLAF7  unnamed protein product                                 252     3e-70


>Q9VUQ9_DROME unnamed protein product
Length=2139

 Score = 658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/346 (87%), Positives = 325/346 (94%), Gaps = 2/346 (1%)

Query  473   PCEGDYEVLKLISNGAYGAVYLVKEKTTRQRFAMKKINKNNLMLRNQVEQVFAERDIMSF  532
             P E D++++KLISNGAYGAVYLVK KTTRQRFAMKKINKNNL+LRNQVEQVFAERDI+SF
Sbjct  830   PQENDFDIVKLISNGAYGAVYLVKHKTTRQRFAMKKINKNNLILRNQVEQVFAERDILSF  889

Query  533   TDNPFVVSMYCSFETKKHLCLVMEYVEGGDCANLLKNIGPLPPDMARFYFAETVLAVEYL  592
              DNPFVVSMYCSFETKKHLCLVMEYVEGGDC  LLKNIGPLP DMARFYFAETVLAVEYL
Sbjct  890   ADNPFVVSMYCSFETKKHLCLVMEYVEGGDCGTLLKNIGPLPADMARFYFAETVLAVEYL  949

Query  593   HSYGIVHRDLKPDNLLITALGHIKLTDFGLSKMGLMSLATNLYEGYIDRDTRQFSDKQVF  652
             HSYGIVHRDLKPDNLLITALGHIKLTDFGLSKMGLMSLATNLYEGYID +TRQFSDKQV+
Sbjct  950   HSYGIVHRDLKPDNLLITALGHIKLTDFGLSKMGLMSLATNLYEGYIDSETRQFSDKQVY  1009

Query  653   GTPEYIAPEVILRQGYGKPVDWWSMGIILYEFLIGCVPFFGDTPEELFAHTVNDDIDWPD  712
             GTPEYIAPEVILRQGYGKPVDWWSMGIILYEFLIGCVPFFG+T EELFAHTVNDDI+WPD
Sbjct  1010  GTPEYIAPEVILRQGYGKPVDWWSMGIILYEFLIGCVPFFGETTEELFAHTVNDDIEWPD  1069

Query  713   EDDWPVQPEAKDIITALLQQSPRDRLGT-GGSHEVKEHPYFYGVNWNSLLRQKAEFVPQL  771
              +DWPVQ EAKDII+ LLQQ+PRDRLGT  G+ E+KEH YF G++WNSLLRQKAEFVPQL
Sbjct  1070  SEDWPVQAEAKDIISQLLQQNPRDRLGTQSGALEMKEHEYFLGMDWNSLLRQKAEFVPQL  1129

Query  772   INDEDTSYFDTRMDRYNHDIGDD-TDDTDDSPLFGSFSSYSPQSRK  816
              +D+DTSYFDTRMDRYNHD+G + TDDTDD+P+FGSF+SY+PQ RK
Sbjct  1130  SHDDDTSYFDTRMDRYNHDLGGEDTDDTDDTPVFGSFNSYTPQYRK  1175


 Score = 332 bits (851),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 186/305 (61%), Positives = 225/305 (74%), Gaps = 24/305 (8%)

Query  925   ISLSTPDSSQTESEDISPQIQRKRH-VHSRDKLPRFSICIDDEHMLDLFAANRDTTEES-  982
              S STP+SSQT+S+D SPQI RKR  V +RD LPRFSI I+DE +    +A   +TE   
Sbjct  1355  FSRSTPESSQTDSDDFSPQINRKRKGVCARDILPRFSISIEDETI----SAGSSSTENMN  1410

Query  983   ----------KHN-SSTDSFESFNAISIIPSAKQKSRSVIKSASTSGLSLVIPTSDFSYD  1031
                       +H   S D   S +++        +SRS++KSAS  GLSL+    +    
Sbjct  1411  LPREQSPLALQHQPKSMDGSTSGSSVK-----HHRSRSIVKSASALGLSLMTSLDNSQLA  1465

Query  1032  ASLN--TQPIESPGGSSTASSRDTSPCRELSPLVTSLKPPIIIRRGPCGFGFTVHTIRVY  1089
             A L     P     GSSTASSRDTSPCRELSPLVT+LKPPIIIRRGP GFGFTVHTIRVY
Sbjct  1466  AQLCGIQSPGGGGNGSSTASSRDTSPCRELSPLVTNLKPPIIIRRGPRGFGFTVHTIRVY  1525

Query  1090  YGDSDFYTMHHLVMAVDQSSPAFEAGLRPGDLITHINGEPVQGLYHIQVLQLMLSGGDHV  1149
             YGD+DFYTMHHLVMAVD+ SPAFEAGLRP DLITH+NGE VQGL+H QVLQL+LSGG+HV
Sbjct  1526  YGDTDFYTMHHLVMAVDEGSPAFEAGLRPADLITHVNGEAVQGLFHTQVLQLLLSGGEHV  1585

Query  1150  TLRSTPLENTSIKTGGRRRDLTQSKMARRTLHKQRKLKRDHSDKKRKTSLFKRISSKRAS  1209
             TLR+TPLE+TSI++GGR+RDL QSK+A++ +++Q+K  +   DKKRKTSLF+RISSKRA+
Sbjct  1586  TLRATPLEHTSIQSGGRKRDLMQSKLAKKGVNRQKKQTKREHDKKRKTSLFRRISSKRAN  1645

Query  1210  VEMQQ  1214
              EMQQ
Sbjct  1646  AEMQQ  1650


 Score = 271 bits (693),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 147/208 (71%), Positives = 170/208 (82%), Gaps = 5/208 (2%)

Query  243  GRRSPLHRPRSRSLSSPSRSPVLDSEIVMMNTLYKERFPKATQQMEERLTNFINENKELD  302
            GR SP  RPRSRSLSSPSRSP++D+EI +MNTLYKERFPKATQQMEERL  FINENK   
Sbjct  513  GRMSPYFRPRSRSLSSPSRSPIVDNEIAVMNTLYKERFPKATQQMEERLKLFINENKS--  570

Query  303  EYEVMANMTQDSLPILRFVHHQVIEMARDCLQKSQEKLITTRYFYEMSENLEHLLMETKD  362
                  N  +DS PI+RFVHHQV+EMARDCL KS+ KLIT++YFYE+SENLE LL+ETK+
Sbjct  571  ---AACNSFRDSQPIVRFVHHQVLEMARDCLHKSEAKLITSQYFYELSENLERLLVETKE  627

Query  363  KSLDAAARLTGLIKKLLLVISRPARLLECLEFDPEEFYHLLEQAEGQAKINAGIKNDIPQ  422
            KS +AAA L G+IKKLLL+ISRPARLLECLEFDP+EFY LLE AEG AK    IK DIPQ
Sbjct  628  KSPEAAAELNGVIKKLLLIISRPARLLECLEFDPQEFYELLEAAEGHAKAMPVIKADIPQ  687

Query  423  YIINKLSLNRDPISELQEDLNKLEDSAS  450
            YII+KL LNRDPI+ELQ++L + +   S
Sbjct  688  YIIHKLGLNRDPIAELQQELRETQQMCS  715


 Score = 145 bits (367),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 130/261 (50%), Positives = 147/261 (56%), Gaps = 54/261 (21%)

Query  1323  YQRPSTLHGLKHKLHTAA----------------KNIHS------PNRRKSVGHIPLSPL  1360
             YQRPSTLHGLKHKLH A                 K +H+      PNRRKSVGHIPLSPL
Sbjct  1766  YQRPSTLHGLKHKLHAATAVIAGGGNANNPAGGLKTLHTTNNNSLPNRRKSVGHIPLSPL  1825

Query  1361  ARTPSPSPLPASPTRSPSPLAFP-TGHQPGSSNTTQSYSPGVCLST------PNNQKKSY  1413
             ARTPSPSPLP+SPTRSPSPLAFP  GHQPG+SNTTQSYSPG  L T       N +K  +
Sbjct  1826  ARTPSPSPLPSSPTRSPSPLAFPLVGHQPGASNTTQSYSPGSTLPTLQTAVNANTKKAGF  1885

Query  1414  GRPKSAEPGSPLLRRALSPDRLHPRSAENKTSISPLANT----------VVKVTPRATIA  1463
              R KSAEP SPLLRRALSPDRLHPRSAE K  ISPL  +          VV  T R+T  
Sbjct  1886  ARTKSAEPSSPLLRRALSPDRLHPRSAETK--ISPLCCSPPIKQPTHQRVVTTTWRST--  1941

Query  1464  QPYPETSEECSDSFKEPNDSKV--------EKKVSTESKSDYSKISHGISINLGNVGISN  1515
              P    S         P+   +        E +  T   +  S  + G   +   V    
Sbjct  1942  -PGGSASGAGGAVLGAPSVQPLQLVPAASEESQRQTAMATVVSTTAAGTDPSATAVVTLA  2000

Query  1516  SCGSTQLPRIAEEKDSPTGSK  1536
             +C    LPRIAEEKDSPT ++
Sbjct  2001  NC--EPLPRIAEEKDSPTSTQ  2019


 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 63/86 (73%), Gaps = 7/86 (8%)

Query  114  RCHSPLSAFVPIVGSPLESPRMSSSPHFAFAPIKRIGGGTTGTGDGRRWSVASLPSSGYG  173
            R HSP SA      SP++SPR++S   FAFAPIKRI        DGRRWSVASLPSSGYG
Sbjct  335  RTHSPYSA------SPVDSPRLNSPMPFAFAPIKRIASCRGVVADGRRWSVASLPSSGYG  388

Query  174  TTPGSSNVSSQYSSQERLHQLP-NVP  198
            TTPGSSN+SSQ SSQE L+QL  N+P
Sbjct  389  TTPGSSNLSSQCSSQEGLNQLAHNIP  414


 Score = 40.8 bits (94),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 24/27 (89%), Gaps = 0/27 (0%)

Query  57   VRPVSGELSNLVRMRNSAIGKSAPSLS  83
            +R VSGE SNL+RMR+S++GKSAP L+
Sbjct  216  LRAVSGETSNLLRMRHSSLGKSAPCLT  242


>Q8MSY6_DROME unnamed protein product
Length=870

 Score = 270 bits (691),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 147/208 (71%), Positives = 170/208 (82%), Gaps = 5/208 (2%)

Query  243  GRRSPLHRPRSRSLSSPSRSPVLDSEIVMMNTLYKERFPKATQQMEERLTNFINENKELD  302
            GR SP  RPRSRSLSSPSRSP++D+EI +MNTLYKERFPKATQQMEERL  FINENK   
Sbjct  513  GRMSPYFRPRSRSLSSPSRSPIVDNEIAVMNTLYKERFPKATQQMEERLKLFINENKS--  570

Query  303  EYEVMANMTQDSLPILRFVHHQVIEMARDCLQKSQEKLITTRYFYEMSENLEHLLMETKD  362
                  N  +DS PI+RFVHHQV+EMARDCL KS+ KLIT++YFYE+SENLE LL+ETK+
Sbjct  571  ---AACNSFRDSQPIVRFVHHQVLEMARDCLHKSEAKLITSQYFYELSENLERLLVETKE  627

Query  363  KSLDAAARLTGLIKKLLLVISRPARLLECLEFDPEEFYHLLEQAEGQAKINAGIKNDIPQ  422
            KS +AAA L G+IKKLLL+ISRPARLLECLEFDP+EFY LLE AEG AK    IK DIPQ
Sbjct  628  KSPEAAAELNGVIKKLLLIISRPARLLECLEFDPQEFYELLEAAEGHAKAMPVIKADIPQ  687

Query  423  YIINKLSLNRDPISELQEDLNKLEDSAS  450
            YII+KL LNRDPI+ELQ++L + +   S
Sbjct  688  YIIHKLGLNRDPIAELQQELRETQQMCS  715


 Score = 87.4 bits (215),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 63/86 (73%), Gaps = 7/86 (8%)

Query  114  RCHSPLSAFVPIVGSPLESPRMSSSPHFAFAPIKRIGGGTTGTGDGRRWSVASLPSSGYG  173
            R HSP SA      SP++SPR++S   FAFAPIKRI        DGRRWSVASLPSSGYG
Sbjct  335  RTHSPYSA------SPVDSPRLNSPMPFAFAPIKRIASCRGVVADGRRWSVASLPSSGYG  388

Query  174  TTPGSSNVSSQYSSQERLHQLP-NVP  198
            TTPGSSN+SSQ SSQE L+QL  N+P
Sbjct  389  TTPGSSNLSSQCSSQEGLNQLAHNIP  414


 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 31/34 (91%), Gaps = 0/34 (0%)

Query  473  PCEGDYEVLKLISNGAYGAVYLVKEKTTRQRFAM  506
            P E D++++KLISNGAYGAVYLVK KTTRQRFAM
Sbjct  830  PQENDFDIVKLISNGAYGAVYLVKHKTTRQRFAM  863


 Score = 40.8 bits (94),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 24/27 (89%), Gaps = 0/27 (0%)

Query  57   VRPVSGELSNLVRMRNSAIGKSAPSLS  83
            +R VSGE SNL+RMR+S++GKSAP L+
Sbjct  216  LRAVSGETSNLLRMRHSSLGKSAPCLT  242


>Q8I4W3_PLAF7 unnamed protein product
Length=735

 Score = 252 bits (643),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 123/297 (41%), Positives = 185/297 (62%), Gaps = 22/297 (7%)

Query  467  EKSHRVPCEGDYEVLKLISNGAYGAVYLVKEKTTRQRFAMKKINKNNLMLRNQVEQVFAE  526
            E+  R+  E  +  LK+I  G+YG V LVK    ++ +AMK + K N++ RNQ+E    E
Sbjct  393  ERKKRIRPES-FNYLKVIGEGSYGKVMLVKHVQNKKLYAMKILRKENILSRNQLEHTKVE  451

Query  527  RDIMSFTDNPFVVSMYCSFETKKHLCLVMEYVEGGDCANLLKNIGPLPPDMARFYFAETV  586
            R+I+    +PF+V MY +F+TK+ L  ++EY  GG+    L  +     + A+FY +E +
Sbjct  452  RNILKCVSHPFIVKMYYAFQTKQKLYFILEYCPGGELFFHLSKLREFSEETAKFYSSEII  511

Query  587  LAVEYLHSYGIVHRDLKPDNLLITALGHIKLTDFGLSKMGLMSLATNLYEGYIDRDTRQF  646
            LA+EYLH   I++RDLKP+N+L+  LGHI+LTDFGLSK G+    TNL            
Sbjct  512  LALEYLHDLNIIYRDLKPENVLLDELGHIRLTDFGLSKEGITE--TNL------------  557

Query  647  SDKQVFGTPEYIAPEVILRQGYGKPVDWWSMGIILYEFLIGCVPFFGDTPEELFAHTVND  706
              K + GTPEY+APE+I ++G+GK VDWWS+GI+LYE L G +PF       LF      
Sbjct  558  -TKSLCGTPEYLAPEIIEQKGHGKAVDWWSLGIMLYEMLTGELPFNNTNRNVLFESIKYQ  616

Query  707  DIDWPDEDDWPVQPEAKDIITALLQQSPRDRLGTGG--SHEVKEHPYFYGVNWNSLL  761
             +++P      + P+A D++T L +++P+ RLG+GG  + E+K+HP+F  +NWN +L
Sbjct  617  KLNYPKN----LSPKAVDLLTKLFEKNPKKRLGSGGTDAQEIKKHPFFKNINWNDVL  669



Lambda      K        H
   0.311    0.128    0.365 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 12077156952


Query= XP_003393086.1 metalloendopeptidase OMA1, mitochondrial-like [Bombus
terrestris]

Length=407
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SPZ2_DROME  unnamed protein product                                   30.4    2.9  
Q387G5_TRYB2  unnamed protein product                                 28.9    6.2  


>SPZ2_DROME unnamed protein product
Length=886

 Score = 30.4 bits (67),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 34/75 (45%), Gaps = 8/75 (11%)

Query  172  ALKRLINSNKNLFKDTDWTITIIHRMFNNIAFPNVMILPDRNIIIIIDIFNFIKSNDQLM  231
            AL  LI++  N  K  +     +  MF N      ++LP     I+ DI N IKS+ +  
Sbjct  131  ALSALISAQMNAKKGHELKFEQVRMMFGNE---KKLLLP-----IVFDIANLIKSSTRKY  182

Query  232  FILAHEMSHDMLLHT  246
              L  +++   L HT
Sbjct  183  INLGSDLASSALYHT  197


>Q387G5_TRYB2 unnamed protein product
Length=246

 Score = 28.9 bits (63),  Expect = 6.2, Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 33/70 (47%), Gaps = 12/70 (17%)

Query  338  KFQIPLFMDHPTLDK--REKRTIQLMPTALELRKQAKCPKLPAKDPRDRLPYYMKDIEKH  395
            K+++P    HPTLDK  RE+R+++      E R   +C K     P      Y  D E  
Sbjct  35   KYRLPKPYRHPTLDKRLREQRSVR------EARALVRCQKQGIAVP----AVYAIDRESC  84

Query  396  MLKDTKILGM  405
             +   +I+GM
Sbjct  85   AIVMERIIGM  94



Lambda      K        H
   0.311    0.128    0.365 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 12077156952


Query= XP_003393087.1 nuclear RNA export factor 1 [Bombus terrestris]

Length=650
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

NXF1_DROME  unnamed protein product                                   363     1e-116
NXF1_CAEEL  unnamed protein product                                   144     4e-36 
B5BM32_CAEEL  unnamed protein product                                 144     5e-36 


>NXF1_DROME unnamed protein product
Length=672

 Score = 363 bits (932),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 227/661 (34%), Positives = 356/661 (54%), Gaps = 85/661 (13%)

Query  43   NRPRVSFKTQARPTRDVPRSLTLACLDEDVQMATSSNNNNNNSRQVIITGRNRRTQRGRN  102
            N+ RVSFK    P++ +     +    ED++     ++ ++ +  V    ++R T R R 
Sbjct  44   NKRRVSFK----PSQCLHNKKDIKLRPEDLRRWDEDDDMSDMTTAV----KDRPTSRRRG  95

Query  103  SPVPHRRYRSSLAPRSKRFPIGEINWYKVTIPYGHKYDKDYIINNLLSYIAPETFLPIMY  162
            SP+P  ++   L P S         WY+VT+     Y+K+ +++ LL+ ++P  F+P  +
Sbjct  96   SPIPRGKF-GKLMPNS-------FGWYQVTLQNAQIYEKETLLSALLAAMSPHVFIPQYW  147

Query  163  RVFGSEANFYVDDEKIAVALLDCDRKITTTDGYKLLVRVSKSPFPQCEIDAKLKERLKQA  222
            RV  +   F+ DD + A  +    +     DGY+L+ RV +S  P   ID   KE++K  
Sbjct  148  RVERNCVIFFTDDYEAAERIQHLGKNGHLPDGYRLMPRV-RSGIPLVAIDDAFKEKMKVT  206

Query  223  MAKRYMHATNALDLSRFHRDPDLISDYFCALFQSPILKAVLDIVSEYIPNLEALNLDGNK  282
            MAKRY   T ALDLSRFH DPDL    FC LF+  ++ A +DI+ + IP+LEALNL+ N 
Sbjct  207  MAKRYNIQTKALDLSRFHADPDL-KQVFCPLFRQNVMGAAIDIMCDNIPDLEALNLNDNS  265

Query  283  LQTIQNLNILNRKFLKLKILYIGDNRIKDINQLDIIKDLKLEELKLAGNPICNKYKSRQN  342
            + +++    + ++   LKILY+GDN+I  +  L ++++L + EL L  NP  ++YK  Q 
Sbjct  266  ISSMEAFKGVEKRLPNLKILYLGDNKIPSLAHLVVLRNLSILELVLKNNPCRSRYKDSQQ  325

Query  343  DYISDVRKRFPKLLRLDGMDLPKPILFDVVDEGNKIPLSQRMFVANAKAQEVASQFLQQY  402
             +IS+VR++FPKL++LDG  L   I FD+ ++G ++  ++  ++ +    EV  QFL QY
Sbjct  326  -FISEVRRKFPKLVKLDGETLEPQITFDLSEQG-RLLETKASYLCDVAGAEVVRQFLDQY  383

Query  403  FLIFDSENRQPLLDAYVEHACFSMTVSYPPHYTNKLNGYLMENRNLMENKNLMDNRNLYR  462
            F IFDS NRQ LLDAY E A  S+++        +LN +   NRNL    N  +NR    
Sbjct  384  FRIFDSGNRQALLDAYHEKAMLSISMPSASQ-AGRLNSFWKFNRNLRRLLNGEENRT---  439

Query  463  INDTNRKQKLLKHGRLPVVSFISEMPQTSHYLNTFTMDISLITDGIMLITVTGLFKEL-D  521
                    + LK+GRL  VS + E P+T H   TFT+D+++    +M+ TVTGLFKEL D
Sbjct  440  --------RNLKYGRLACVSTLDEWPKTQHDRRTFTVDLTIYNTSMMVFTVTGLFKELND  491

Query  522  KKEQP-------VRYFNRTFIIVPEGNGYCIRNEQLHISQPTDAQLKQ------------  562
            +   P       VR+F RT+++VP+ NG+CIRNE + I+  T  Q+++            
Sbjct  492  ETNNPASMELYDVRHFARTYVVVPQNNGFCIRNETIFITNATHEQVREFKRSQHQPAPGA  551

Query  563  ---------------------------LSSQPQTQMIQDPGSQT-PSISGNEKSLTVQLS  594
                                       +++ P   +  DP + T P  SG+    T  ++
Sbjct  552  MPSTSSAVTSPQAGAAAGLQGRLNALGVATGPVAILSGDPLAATAPVNSGSAAISTTAVA  611

Query  595  -----EDVKQQMTMTLSQQTNMNLEWSLKCLEEVSWNYDNALSAFQEFYKRGQVPAEAFN  649
                 E  K QM   +S Q+ MN+ WS KCLEE +W++++A   F++ +K  ++P EAF 
Sbjct  612  PGAQDESTKMQMIEAMSAQSQMNVIWSRKCLEETNWDFNHAAFVFEKLFKENKIPPEAFM  671

Query  650  K  650
            K
Sbjct  672  K  672


>NXF1_CAEEL unnamed protein product
Length=628

 Score = 144 bits (362),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 128/534 (24%), Positives = 247/534 (46%), Gaps = 40/534 (7%)

Query  138  KYDKDYIINNLLSYIAPETFLPIMYRVFG-SEANFYVDDEKIAVALLDCDRKITTTD-GY  195
            K D  ++I  L   I  E F P+++      +  +YV DE  A  +   +R++   + G 
Sbjct  110  KVDAKWLIKQLNQII--ENFKPLLWTDNARGDFEWYVRDEDTASTIRANNRRVVHKESGT  167

Query  196  KLLVRVSKSPFPQCEIDAKLKERLKQAMAKRYMHATNALDLSRFHRDPDL-ISDYFCALF  254
            ++    SK P P  ++  +  E + + + KR+      LDLS FH D +    D    L 
Sbjct  168  RVEFYTSKVPAPWMKLKREEIEIIHRVVDKRHNAENRVLDLSNFHEDEEFKAKDMMMNLT  227

Query  255  QSPILKAVLDIVSEYIPNLEALNLDGNKLQTIQNLNILNRKFLKLKILYIGDNRIKDINQ  314
            +  ++  VLD + +   N+ AL+L  N+++ +   + L      +  L +  N I    +
Sbjct  228  KGNVMLTVLDHIDDKYGNIVALSLSNNRIRHLDYASALVSIAKFVMELDLSHNHISTEKE  287

Query  315  LDIIKDLKLEELKLAGNPICNKYKSRQNDYISDVRKRFPKLLRLDGMDLPKPILFDVVDE  374
            L+    L +E     GNP+   +  R   YIS + + FP+   LDG+++   ++   +D 
Sbjct  288  LEKFAGLPVERFFFEGNPVVESFTQRAA-YISYIHQSFPRCNMLDGVEVQPLVVGPDLDI  346

Query  375  GNKIPLSQRMFVANAKAQEVASQFLQQYFLIFDS----ENRQPLLDAY-VEHACFSMTV-  428
             + +P  +  +  N + + +  QF+  YF  +D       R+ L +AY  + + FS+T+ 
Sbjct  347  HDAMPF-RAGYYPNPQIRVLVEQFVTSYFDFYDGPDGQRTRRNLHNAYDADASTFSLTIE  405

Query  429  -----SYPPHYTNK-LNGYLMENRNLMENKNLMDNRNLYRINDTNRKQKLLKHGRLPVVS  482
                 S+  H+ ++    Y   + N+++ +    +R        +R  +    G + +  
Sbjct  406  HLRGSSHARHHNDECFAQYAGVSHNVLKQERFARHR-------ASRSAR----GAMDIAV  454

Query  483  FISEMPQTSHYLNTFTMDISLITDGIMLITVTGLFKELDKKEQPV-RYFNRTFIIVP-EG  540
             +S++P +SH  +TF +D+ L ++ ++  TV GLF + D  + P   +F+R+F++ P E 
Sbjct  455  ALSKLPTSSHMRDTFIVDVFLQSNDLLGFTVQGLFCDGDLTQTPSPSFFSRSFLVSPREN  514

Query  541  NGYCIRNEQLHISQPTDAQLKQL------SSQPQTQMIQDPGSQTPSISGNEKSLTVQLS  594
            +   + ++QL I+  +  +L++       S      + Q    Q   I  N        +
Sbjct  515  DSVAVISDQLFITVASLDRLEKFKKLYDQSIANGAAVEQVSAVQIAQIGVNGMGFDGAPA  574

Query  595  EDVKQQMTMTLSQQTNMNLEWSLKCLEEVSWNYDNALSAFQEFYKRGQVPAEAF  648
              ++++M   + Q + M   +S KCL + +WN+D A   F E   +  VPAEAF
Sbjct  575  LPIREEMIKAMCQFSGMIPPFSEKCLADCAWNFDFACQKFNEI--KSSVPAEAF  626


>B5BM32_CAEEL unnamed protein product
Length=609

 Score = 144 bits (362),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 128/534 (24%), Positives = 248/534 (46%), Gaps = 40/534 (7%)

Query  138  KYDKDYIINNLLSYIAPETFLPIMYRVFG-SEANFYVDDEKIAVALLDCDRKITTTD-GY  195
            K D  ++I  L   I  E F P+++      +  +YV DE  A  +   +R++   + G 
Sbjct  91   KVDAKWLIKQLNQII--ENFKPLLWTDNARGDFEWYVRDEDTASTIRANNRRVVHKESGT  148

Query  196  KLLVRVSKSPFPQCEIDAKLKERLKQAMAKRYMHATNALDLSRFHRDPDLIS-DYFCALF  254
            ++    SK P P  ++  +  E + + + KR+      LDLS FH D +  + D    L 
Sbjct  149  RVEFYTSKVPAPWMKLKREEIEIIHRVVDKRHNAENRVLDLSNFHEDEEFKAKDMMMNLT  208

Query  255  QSPILKAVLDIVSEYIPNLEALNLDGNKLQTIQNLNILNRKFLKLKILYIGDNRIKDINQ  314
            +  ++  VLD + +   N+ AL+L  N+++ +   + L      +  L +  N I    +
Sbjct  209  KGNVMLTVLDHIDDKYGNIVALSLSNNRIRHLDYASALVSIAKFVMELDLSHNHISTEKE  268

Query  315  LDIIKDLKLEELKLAGNPICNKYKSRQNDYISDVRKRFPKLLRLDGMDLPKPILFDVVDE  374
            L+    L +E     GNP+   +  R   YIS + + FP+   LDG+++   ++   +D 
Sbjct  269  LEKFAGLPVERFFFEGNPVVESFTQRAA-YISYIHQSFPRCNMLDGVEVQPLVVGPDLDI  327

Query  375  GNKIPLSQRMFVANAKAQEVASQFLQQYFLIFDS----ENRQPLLDAY-VEHACFSMTV-  428
             + +P  +  +  N + + +  QF+  YF  +D       R+ L +AY  + + FS+T+ 
Sbjct  328  HDAMPF-RAGYYPNPQIRVLVEQFVTSYFDFYDGPDGQRTRRNLHNAYDADASTFSLTIE  386

Query  429  -----SYPPHYTNK-LNGYLMENRNLMENKNLMDNRNLYRINDTNRKQKLLKHGRLPVVS  482
                 S+  H+ ++    Y   + N+++ +    +R        +R  +    G + +  
Sbjct  387  HLRGSSHARHHNDECFAQYAGVSHNVLKQERFARHR-------ASRSAR----GAMDIAV  435

Query  483  FISEMPQTSHYLNTFTMDISLITDGIMLITVTGLFKELDKKEQPV-RYFNRTFIIVP-EG  540
             +S++P +SH  +TF +D+ L ++ ++  TV GLF + D  + P   +F+R+F++ P E 
Sbjct  436  ALSKLPTSSHMRDTFIVDVFLQSNDLLGFTVQGLFCDGDLTQTPSPSFFSRSFLVSPREN  495

Query  541  NGYCIRNEQLHISQPTDAQLKQL------SSQPQTQMIQDPGSQTPSISGNEKSLTVQLS  594
            +   + ++QL I+  +  +L++       S      + Q    Q   I  N        +
Sbjct  496  DSVAVISDQLFITVASLDRLEKFKKLYDQSIANGAAVEQVSAVQIAQIGVNGMGFDGAPA  555

Query  595  EDVKQQMTMTLSQQTNMNLEWSLKCLEEVSWNYDNALSAFQEFYKRGQVPAEAF  648
              ++++M   + Q + M   +S KCL + +WN+D A   F E   +  VPAEAF
Sbjct  556  LPIREEMIKAMCQFSGMIPPFSEKCLADCAWNFDFACQKFNEI--KSSVPAEAF  607



Lambda      K        H
   0.311    0.128    0.365 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 12077156952


Query= XP_003393089.1 rRNA-processing protein FCF1 homolog [Bombus
terrestris]

Length=203
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q387T3_TRYB2  unnamed protein product                                 212     6e-70
Q9VUM1_DROME  unnamed protein product                                 36.6    0.011
Q9VF56_DROME  unnamed protein product                                 32.0    0.37 


>Q387T3_TRYB2 unnamed protein product
Length=207

 Score = 212 bits (539),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 103/208 (50%), Positives = 142/208 (68%), Gaps = 9/208 (4%)

Query  1    MGKNKRTRKFVIQRFAQMKRMISLTDSRIKPEHRAPPRKV--KKENPTEIK-----ITEA  53
            MGK K T    I+     ++ ++    R    H   P +V  K ++   ++     +T A
Sbjct  1    MGKKKNTAMHAIKTVLMKEKNLAQKKKREMDSHHEVPEQVLTKVKDTAAVRFQRNQLTVA  60

Query  54   PQQSSALFFHYNTQLGPPYHILVDTNFINFSIKNKLDIIENMMECLYAKCIPYITDCVLG  113
                + +F  YN  LGPP+HI +DTNFINFS++NK++I+E +M+C+ AK IP + DCV+ 
Sbjct  61   APLQTNMFLSYNKSLGPPFHIWLDTNFINFSMQNKIEIVEGLMDCMLAKVIPCVCDCVMA  120

Query  114  EMEKLGQKYKIALKIMKDPRFERLNCMHKGTYADDCIVNRVTQHKCYIVATNDKDLKRRI  173
            E+EKLG+K++IALKI +D RF+RL C   G YADDC+V  VTQH  YIVAT D++LKRR+
Sbjct  121  ELEKLGKKFRIALKIARDKRFKRLTC--DGKYADDCVVRTVTQHPIYIVATCDQELKRRL  178

Query  174  RKIPGVPIMYVAHHRYTIERMPDAYGAP  201
            RKIPGVPIMY++ HRYTIER+P+ YGAP
Sbjct  179  RKIPGVPIMYISKHRYTIERLPEVYGAP  206


>Q9VUM1_DROME unnamed protein product
Length=501

 Score = 36.6 bits (83),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 19/66 (29%), Positives = 33/66 (50%), Gaps = 0/66 (0%)

Query  53   APQQSSALFFHYNTQLGPPYHILVDTNFINFSIKNKLDIIENMMECLYAKCIPYITDCVL  112
            A +Q +A     + +  P Y ++VD N I   I N++ I+    +  Y K  P +   ++
Sbjct  79   ASRQRTAAEMLGSVESDPEYCLIVDANAIAVDIDNEISIVHKFTKEKYQKRFPELDSLIV  138

Query  113  GEMEKL  118
            GE+E L
Sbjct  139  GEIEYL  144


>Q9VF56_DROME unnamed protein product
Length=2183

 Score = 32.0 bits (71),  Expect = 0.37, Method: Composition-based stats.
 Identities = 13/49 (27%), Positives = 27/49 (55%), Gaps = 3/49 (6%)

Query  61   FFHYNTQLGPPYHILVDTNFINFSIKNKLDIIENMMECLYAKCIPYITD  109
             F+++++  P   + +DTNF+      +L  I +M +C Y KC+  + +
Sbjct  679  LFYFDSRFRP---VPLDTNFVGIKSVKQLQQIADMDQCCYQKCVEMVQE  724



Lambda      K        H
   0.311    0.128    0.365 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 12077156952


Query= XP_003393090.1 cadherin-related tumor suppressor [Bombus terrestris]

Length=5085
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

FAT_DROME  unnamed protein product                                    5522    0.0  
FAT2_DROME  unnamed protein product                                   898     0.0  
X2J8E9_DROME  unnamed protein product                                 847     0.0  


>FAT_DROME unnamed protein product
Length=5147

 Score = 5522 bits (14326),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 2875/5180 (56%), Positives = 3660/5180 (71%), Gaps = 253/5180 (5%)

Query  67    MQSRAVDTRVQLEVREGEPKGTLVGLIPVKPGFTYRFNEPPQEFVLDPETGKIRTAKVLD  126
             MQSRAVDT    EV EG+P+GT VG IP KP F+YRFNEPP+EF LDP TG+++T  VLD
Sbjct  60    MQSRAVDTSADFEVLEGQPRGTTVGFIPTKPKFSYRFNEPPREFTLDPVTGEVKTNVVLD  119

Query  127   REALSSDRFDLVVLSSQPTYPIEVRILVLDINDNDPEFPESSIAVSFSESAVVGTKLLLD  186
             RE +  D +DLVVLSSQPTYPIEVRI VLD+NDN PEFPE SIA+SFSESA  GT+LLLD
Sbjct  120   REGMR-DHYDLVVLSSQPTYPIEVRIKVLDVNDNSPEFPEPSIAISFSESATSGTRLLLD  178

Query  187   AATDKDTLENGVVDDYFIVNGNTDEKFRLEVTGNPTGETSYLHLETTGKLDREQVEFYSL  246
             AATD D  ENGV D Y IV GN D KFRL  T NP+G+TSYLHLETTG LDRE    Y L
Sbjct  179   AATDADVGENGVTDQYEIVAGNVDNKFRLVTTANPSGDTSYLHLETTGNLDRESRGSYQL  238

Query  247   NVCARDRGRPPRLGYLLVNVTVLDVNDNPPIFQQSDYVVALNESAPVGTKVLTVHATDKD  306
             N+ ARD G PPR GYL VNVT+LDVNDNPPIF  SDY V+LNE+A  GT V+TV A+D D
Sbjct  239   NISARDGGSPPRFGYLQVNVTILDVNDNPPIFDHSDYNVSLNETALPGTPVVTVMASDND  298

Query  307   SEDNSKLTYYLPDTERQFTIDPETGTITTVEPLDCPQQSCTIAARLGDGCPKSCVITVFA  366
               DNSK+TYYL +TE QFT++PETG I+T E ++CPQQ+   ++       KSCV TVFA
Sbjct  299   LGDNSKITYYLAETEHQFTVNPETGVISTTERVNCPQQTNVKSS----ASQKSCVFTVFA  354

Query  367   RDHGSPRQDGRTYVTVNLLDANDHDPEIKFSYFPSTPGFATVDENAAKDSIVAAVAVIDN  426
             RDHGSPRQDGRTYVTVNLLD NDHDP I F +FP     ATVDENA   ++VAAVAV D+
Sbjct  355   RDHGSPRQDGRTYVTVNLLDTNDHDPIISFRFFPDGGKVATVDENAVNGTVVAAVAVKDS  414

Query  427   DEGLNGETTVEIRAGNELGHFRLDNTPSFDIVRVNGRLDREEIPKYNLTVVATDKGTPPR  486
             D GLNG T+V I +GNELGHFRL+      IVRVNG LDREEI KYNLTVVA D+GTP R
Sbjct  415   DSGLNGRTSVRIVSGNELGHFRLEEAADLHIVRVNGVLDREEIGKYNLTVVAMDQGTPAR  474

Query  487   SATAYLVIHVNDVNDHEPVFQQSEYSAVLSELSPTGSFVASISATDADSGLNARIYYDFD  546
             + TA+L+I VNDVNDHEPVF++SEYSAVLSEL+PTGSFVASI+ATD D+G+NA+++YD  
Sbjct  475   TTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDIL  534

Query  547   SGNEQGWFAIDQDTGLVTTVATLDREVQGSIELHVSARDGGPNPKYASTHLKVTILDEND  606
             SGNE  WF++D  TGL+ T   LDRE++ ++EL +SARDGGPNPK+A T LKV ILDEND
Sbjct  535   SGNELKWFSMDPLTGLIVTTGPLDREIRDTVELSISARDGGPNPKFAYTQLKVIILDEND  594

Query  607   EAPRFSQNVVRVTLSENTPPQSLVATLTAVDNDQGTNGSVAYSFHSSVSRDYPKTFALDG  666
             EAP+FSQ    VTL E+ PPQ++VA +TA D+DQGTNGSV ++   SV R YP  FALD 
Sbjct  595   EAPQFSQREQNVTLGEDAPPQTIVALMTATDHDQGTNGSVTFALAPSVERLYPLQFALDA  654

Query  667   LTGQLTTKVNLDRETTAEYQILVIAKDQGTP-PQSSTATVILTLEDVNDNSPVFYPWRYL  725
             LTGQLTT+  LDRE  ++Y+I VIA+DQG P PQS+TATV L + DVNDN P FYP  Y+
Sbjct  655   LTGQLTTRRPLDREKMSQYEISVIARDQGAPTPQSATATVWLNVADVNDNDPQFYPRHYI  714

Query  726   ---------MPIPEDAPPGTSVGKVTATDADARENAQVRYSLESGGEGLFTVDERTGEIT  776
                      + + ++      +  VTA+D D  +NA + Y LESGGEGLF +D R+G I+
Sbjct  715   YSLADDDDDIKLKKEVEKERILLHVTASDKDDGDNALIEYRLESGGEGLFQLDARSGAIS  774

Query  777   LQGSLRAAH--KTLYELNISAKDTGDRVAGRNALVEIIREEDLEHLEFDTYN--GYEFRI  832
             L+G   A+   K  Y+L +SA+D G R + ++A+VEI+ +  LE LE       GYEF++
Sbjct  775   LRGDAPASMHWKPHYKLLVSARDAGQRRSQQDAIVEIVLKSKLEMLECGQAQAGGYEFQM  834

Query  833   AEDRGECGAMSNVFARDAGTVQITQYD---SSKISYAIVFGDPKGNFKIDESTGTISTSG  889
              ED  +    ++   R+ G VQ+   +   +S I Y I+ GD   NF+ID  +G I+T+ 
Sbjct  835   VEDHEQ--QRNSQPNREVGIVQVKSTNGKANSHIEYDIIQGDRAQNFRIDTRSGRITTAR  892

Query  890   CLDREQVAYYSLQL---------SARAGLAYGQTSVNITVLDINDNPPRFP-KGEIGDEV  939
              LDRE+ A Y L +         +A + ++YGQ  VNI ++D+NDN P F    E    +
Sbjct  893   PLDREEQANYRLTILASSSSSSSAAASSVSYGQCIVNIAIIDLNDNAPVFALDRESEPTI  952

Query  940   LLKENAAVGQEVCLARARDRDASANARIVYSLTHNPGGQFRVAENSGIIYLDKPIRAAPG  999
              L ENAAVGQE+ L+R RDRDA  N+RI YSLT+NP  QFR+   +G++YL +PIRA PG
Sbjct  953   SLPENAAVGQEIYLSRVRDRDAGVNSRISYSLTNNPNQQFRIGPVTGVLYLQRPIRAEPG  1012

Query  1000  TVLHLEVTATDSGNQPLSAQHQVRVTIEDVNDHTPVFKLTSYETSLPESTPVNDRFFSLT  1059
             +++H+E+ ATD+G+ PLS++  + V I DVNDHTPVF  TSYETSLPE+T VN RFF+L 
Sbjct  1013  SLIHVELMATDAGSPPLSSKLSLSVLIADVNDHTPVFDHTSYETSLPETTKVNTRFFALA  1072

Query  1060  AIDVDLGANGRVLYSITDGNTEDRFGIFPDGQLYVKNVLDREELDYYALEVTATDQGSPS  1119
             A D+DLG NGR+ Y I +GNTE  FG+FPDG L+V+  LDREE DYYAL V+  D G PS
Sbjct  1073  ATDIDLGDNGRISYEIIEGNTERMFGVFPDGYLFVRAPLDREERDYYALTVSCRDAGQPS  1132

Query  1120  RSSVVPVVVHIIDENDNAPEFTNSSFVLHLRENEPPDTFVGKLLATDRDVGRNADLVFSL  1179
             RSSVVPVV+H+IDENDNAP+FTNS+F   + EN P DTFVGKL A DRD+GRNA+L F+L
Sbjct  1133  RSSVVPVVIHVIDENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRDIGRNAELSFTL  1192

Query  1180  PASQQDFTVDPRNGFIKSLRVFDRELLVT----------------NTGSSYITLEATVTD  1223
              +  QDFT+D RNGFIK+LR FDRE LV                 +   +Y+ LEATV+D
Sbjct  1193  SSQTQDFTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSD  1252

Query  1224  NGVNRLRDRVKVVIYITDVNDNIPQFQRLPYRVQVNEGAAIGTQLLRVYTTDADEGLNGD  1283
             NG+ RL+D+VKV + +TDVNDN P+F R PY V ++EGA+ GT +  V+T DADEGLNGD
Sbjct  1253  NGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHITHVFTQDADEGLNGD  1312

Query  1284  VFYSLEDGNQHGRFAIDEATGQISLTKELDRETTDAYVLTVVAHDAGLETRLSSSTTVHI  1343
             V+YSL  GN+ G+F +D ATGQ+SL + LDRE+ + + L VVA DA L+  LSS+ ++ I
Sbjct  1313  VYYSLAKGNEAGQFNLDSATGQLSLGRRLDRESQEIHHLIVVAKDAALKHPLSSNASITI  1372

Query  1344  EVLDENDNVPLFVDDKSSISVLETTPTNTELLRFKATDNDLGPNSELAFAISAGNRRDTF  1403
              VLDENDN P F    S +SVLET+PT TEL+RF+A+D D G NS++ F+ISAGNRRDTF
Sbjct  1373  VVLDENDNAPEFTQSSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISAGNRRDTF  1432

Query  1404  YIDPLTGTLYLRKPLDYEELEKYTLNVTCSDGGHPRLSSVTTLIVEVIDANDNPPVFPNT  1463
             +ID +TG+LYL KPLDYE++  YTLN+T SD G P LS+     V V+D NDNPP+FP+T
Sbjct  1433  HIDSITGSLYLHKPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPIFPST  1492

Query  1464  AIARQIREGILVHTPIVTITAEDPDSNENGVVTYSIASQDPE-DQVRRFGINPSTGVIHT  1522
             AI RQI+EGI + TPIVT+TA+DPDS  NG V+Y+I+ Q+P+  Q R FGIN  TGVIHT
Sbjct  1493  AIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGINTETGVIHT  1552

Query  1523  LLPIDREEVDTYKLVVVATDSAQPASARLSAEKLVIVIVEDINDNAPIFVSMSAVVLPLK  1582
             L  IDRE +DT++L VVATD AQP+  +LS EKLV VIVEDINDNAP+FVSM+A +LP K
Sbjct  1553  LREIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPK  1612

Query  1583  GNYYQYQKEITVTQLVARDLDSSTNGLVTYELLRSSINYPDMFRIHRNTGHLTIRLPRSL  1642
              +  +      V Q+ A+D DSS+NGLVTYE++       ++F++ RNTG +T     + 
Sbjct  1613  FSTSK-GSSTAVMQVHAKDADSSSNGLVTYEIVSGP---QELFKLQRNTGIITF----TP  1664

Query  1643  KSSFERVSKYQVGIRATDEAVQAERRSTETYLTLIVPGEDGDDQ--PIWEHRGQIEGNVY  1700
                F++  +YQ+ +++TDEAVQ+ERRS+E Y+T+I PG  G +   P +E R ++ G+VY
Sbjct  1665  GPQFKQEVRYQLTLKSTDEAVQSERRSSEVYITIITPGSGGSESSVPQFEQRSKLSGSVY  1724

Query  1701  ENEPIGTSILRVSARSRRSNIDLEYYVTNVTAGSGGPQVDRLFDVDTKTGILSTAAALDR  1760
             ENEPIGTSIL V+A    ++ ++EY+VTNVTA     QVDRLFD+D K GILSTAA LDR
Sbjct  1725  ENEPIGTSILTVTAH--LASAEIEYFVTNVTATGSRGQVDRLFDIDAKLGILSTAAELDR  1782

Query  1761  ETGIQWYEVELYAIGVGGTRPSTTSTKVRVTVLDKNDVAPTWGTGTWKFKISEEAPPNTV  1820
             E G + YEVE+YAI +GG +P T+ TKVRVTVLDKND  P +    + + +SE+      
Sbjct  1783  EAGPEEYEVEVYAIALGG-QPRTSRTKVRVTVLDKNDSPPQFLDTPFVYNVSEDLQIGHT  1841

Query  1821  VTVLKAYDPDTIGTLTYTLVPNHRPDPGPGTALGFYPASQHELQDESQCQFRLHPTTGQL  1880
             ++ L+A+DPDT+G++T+ L+  H                          +F L P+TG+L
Sbjct  1842  ISTLRAHDPDTLGSVTFLLMDGH------------------------DGKFLLEPSTGKL  1877

Query  1881  TLAEALDRETREKYVLKVRADDGLQHTDIALTIQVTDTNDNAPTFQSTAYSFDVPENVPR  1940
              L + LDRET+ KY L++R  DG+Q+T+   TIQV+DTNDN P F+ T YSFD+PEN  R
Sbjct  1878  ILNDTLDRETKSKYELRIRVSDGVQYTEAYATIQVSDTNDNPPLFEDTVYSFDIPENAQR  1937

Query  1941  GSRIGQVVATDADANGPNSQLSYTLISDWANDVFSLNPSTGVFTLTASLDYEQVQHYILV  2000
             G ++GQ+VA DAD  G N+QLSY ++SDWANDVFSLNP TG+ TLTA LDYE+VQHYIL+
Sbjct  1938  GYQVGQIVARDADL-GQNAQLSYGVVSDWANDVFSLNPQTGMLTLTARLDYEEVQHYILI  1996

Query  2001  VQATDGGIPALSSTVTVYCNVVDLNDNAPIFEAGPHAADIVENTTIGTPILSVAAQDLDS  2060
             VQA D G P+LS+T+TVYCNV+DLNDNAPIF+   +++++ EN  I T +++V+A+D+DS
Sbjct  1997  VQAQDNGQPSLSTTITVYCNVLDLNDNAPIFDPMSYSSEVFENVPIATEVVTVSAKDIDS  2056

Query  2061  GDNGRVIYAVAGGDENGDFGVAPNGTLFTRKLLDREQKPLYNLILSATDSP---------  2111
             G+NG + Y++  GD + +FG+  NGT+ TR+ LDRE +  Y L ++A D           
Sbjct  2057  GNNGLIEYSITAGDVDSEFGIDSNGTIRTRRNLDREHRSTYTLTVTARDCADEFASFSEL  2116

Query  2112  ------LPPALP------------------LSSTVQVTVVLLDVNDMSPEFISPTKISII  2147
                   L    P                  LSSTV+VT+++ DVND  P FIS  + +I+
Sbjct  2117  EETQLKLKYRSPRKYQQTRQEFLAHQKQQRLSSTVKVTILIKDVNDEVPVFISANETAIM  2176

Query  2148  ENAPSNTVVMAIKAVDRDEGRNGYVEYSLEDTT---------LPFTVGPVDGLLRVSGSL  2198
             EN   NTVV+A+KAVD DEGRNGY++Y +++           LPF++ P DG LRV  +L
Sbjct  2177  ENVAINTVVIAVKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLPFSLNPTDGQLRVVDAL  2236

Query  2199  DRELRSNYTLEVTAKDRGEPPRSSSTAVTVTVLDENDNSPVFDPRQYSATVAENASIGAS  2258
             DRELRS+Y L +TA+DRGEPP+S+ + + + +LDENDNSPVFDP+QYSA+VAENASIGA 
Sbjct  2237  DRELRSSYLLNITARDRGEPPQSTESQLLIRILDENDNSPVFDPKQYSASVAENASIGAM  2296

Query  2259  VLQVSAMDRDEGANGRVRYSIAMGDDNRDFTISEDGGVIRVAKNLNFERKSRYYLTIRGE  2318
             VLQVSA D DEGANGR+RYSI +GD N DF+ISED GV+RVAKNLN+ER SRY LT+R E
Sbjct  2297  VLQVSATDVDEGANGRIRYSIVLGDQNHDFSISEDTGVVRVAKNLNYERLSRYSLTVRAE  2356

Query  2319  DCASEVGETPRGDTAQVTITVIDINDNAPVFLDSPYLAHVMENMVPPGGGFVIQVKAYDA  2378
             DCA E    P GDTA++TI ++DINDN P FLDSPYLA VMEN VPP GG+V+ V AYDA
Sbjct  2357  DCALE---NPAGDTAELTINILDINDNRPTFLDSPYLARVMENTVPPNGGYVLTVNAYDA  2413

Query  2379  DTPPYNDQVRYFLKEGDTDLFRINASTGDIFLLRPLDRELVAEYTLTLVAMDTGSPPLTG  2438
             DTPP N QVRYFLKEGD+DLFRINAS+GDI LL+PLDRE  +EYTLTLVAMDTGSPPLTG
Sbjct  2414  DTPPLNSQVRYFLKEGDSDLFRINASSGDIALLKPLDREQQSEYTLTLVAMDTGSPPLTG  2473

Query  2439  SGIVRIVVLDVNDHIPEFTRQEYRATVTENLASGTWVTKPHATDKDEGLNAKIRYSLLGE  2498
             +GIVR+ V D+ND+ P F  Q Y ATV ENL SGT V  P ATDKDEGLNAK+R++LLGE
Sbjct  2474  TGIVRVEVQDINDNDPVFELQSYHATVRENLPSGTHVLTPRATDKDEGLNAKLRFNLLGE  2533

Query  2499  NSERFTVEPETGEVLTVVPLDREQTAVYHLTLVAQDSSPTEPQASAVNLTIFVKDVNDNA  2558
             +  RF ++ ETGE+ T   LDRE+T+VYHLTL+AQDSS TEP+AS+VNLTI V DVNDN 
Sbjct  2534  HMHRFHIDSETGEISTATTLDREETSVYHLTLMAQDSSITEPRASSVNLTISVSDVNDNI  2593

Query  2559  PRFSSPRYTAYVPGATKPGDFVFGAKAVDDDDGENSRIVYRLQGIDAEKFVIDPNSGVIR  2618
             P+F S  Y   VP     G+FVFGA+A+D DDGEN+ + Y + G D   F I+  +GV+ 
Sbjct  2594  PKFDSTTYNVAVPERISKGEFVFGARALDLDDGENAVVHYTISGRDQHYFDINTKTGVVS  2653

Query  2619  TTQEL-----ANDETTYQLQIQASDCGVKPQTVTADLVIHLWERQLFPSFRSTISTRFTL  2673
             T  EL     ++D+ TY + I A D G +  +  A+L + L   +LFP+F    ++ F +
Sbjct  2654  TKLELKTKTKSHDDLTYTIVISAMDQGEQSLSSKAELTVILRPPELFPTFAYMANSHFAM  2713

Query  2674  PEDVPEGRVITKLSATTPKVGTASNLVYGMAGGNVGDALKIDPHTGEVLVAS-GFDYETA  2732
              EDV  G++ITK+SAT+PK G    + Y +AGG +GD+L++DP++G + V   G DYE  
Sbjct  2714  SEDVRPGKMITKVSATSPKKGLVGKIRYAIAGGIMGDSLRVDPNSGLLSVGQDGLDYELT  2773

Query  2733  PFYEAWVEVRDSDTPALRSVVQLLVNVTDANDNAPIMEAAIYNATVPEDEYPPLFVNKVS  2792
               YE W+E  D DTP+LRSV  + +NVTDANDNAP+ME  IYNA V E+E PP  +  V 
Sbjct  2774  HLYEIWIEAADGDTPSLRSVTLITLNVTDANDNAPVMEQLIYNAEVLEEESPPQLIAVVK  2833

Query  2793  ANDRDSGENGQVSYYLVNDFTETFVIDSDTGEISTNAKLDREEIASYELIVEARDQGQPS  2852
             A+DRDSG+NG V Y L NDF  TF I +++GEI T  +LDREEI  Y  +VEA DQG P 
Sbjct  2834  ASDRDSGDNGNVIYRLQNDFDGTFEI-TESGEIYTRMRLDREEIGDYAFVVEAVDQGVPH  2892

Query  2853  LTGTATVLLTVLDKNDNPPQFTRLFSVNVTENAEIGTFVIRITSSDLDIGQNANVTYRFT  2912
             +TGTA+VLL +LDKNDNPP+FTRLFS+NVTENAEIG+FVIR+TSSDLD+G NAN +Y F+
Sbjct  2893  MTGTASVLLHLLDKNDNPPKFTRLFSLNVTENAEIGSFVIRVTSSDLDLGANANASYSFS  2952

Query  2913  ENPGEKFAMDALSGNVTVNGHLDREEQDEYLLKLVAADGAWQAATALTITIQDQNDNPPE  2972
             ENPGEKF ++  SGN+TV GHLDRE+QDEY+LK+VA+DGAW+A T +TITIQDQNDN PE
Sbjct  2953  ENPGEKFRIEPQSGNITVAGHLDREQQDEYILKVVASDGAWRAETPITITIQDQNDNAPE  3012

Query  2973  FDEESYHFHFPELQPPVAHVGQVTAIDRDKQGPNSVISYSLLQPSDLFTVDPATGDVFSK  3032
             F+   Y F FPELQ  +A VGQ+ A DRDKQGPNSVISYSL QPS +F++DPATG+VFSK
Sbjct  3013  FEHSFYSFSFPELQQSIALVGQIIATDRDKQGPNSVISYSLQQPSPMFSIDPATGEVFSK  3072

Query  3033  KTLKYKHTHRPSSPENLYSLTVVATDNGKPPLSSKTVVYVNVVDANNNAPRFDQRSYLYP  3092
             K +++KH+    SPEN+Y+LTV+ATDNGKPPL S+ +V +N+VDA+NN P+F+Q  YL P
Sbjct  3073  KAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNPPKFEQAEYLAP  3132

Query  3093  VPENYGVGKRVVQLMAKDDADFGVNAEISYFMTNVNGSEYFSIDEKSGWVYVRNTLSNVP  3152
             +P++   G+R+V++ A D  D G N E+ Y +   N S  FS+    GW+ +   +  VP
Sbjct  3133  LPQDAVRGQRIVRVHANDKQDLGTN-EMDYSLMTFNLSSIFSVGRHDGWITLVKPI-QVP  3190

Query  3153  VRTTFLLKVQAIDKGVPPQKDEVSLTLVISGENKHAPTFAAVSHQVRVPENEPVNTTILT  3212
               T + L V+A D+GVPPQ DE  + +V++GEN   P F+  S+QV VPENEPV +TILT
Sbjct  3191  PNTRYELVVRATDRGVPPQSDETRVVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILT  3250

Query  3213  VSATDGDDGPNGMIRYKISAGNEKNEFFVHSITGAVTILEPLDYDLVQEYKLNITATDLG  3272
             V ATD D GPNGM+RY IS GNE+ +F V   TG + I + LDYDL+QEY LNIT  DLG
Sbjct  3251  VGATDDDTGPNGMLRYSISGGNERQDFSVDERTGGIVIQQQLDYDLIQEYHLNITVQDLG  3310

Query  3273  FEPKQAVAILTVNVSDINDNPPTFNQSIYEAYLPENSPPDSFVYKVIARDIDSPKYAVIQ  3332
             + P  +VA+LT+ ++D+NDNPP FN   Y  Y+PEN P  +FV++  A D DSPK A+I 
Sbjct  3311  YHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIH  3370

Query  3333  YKIL-GGTGKDHFRIREDTGEIASLISFDYEEANEYTLDIVAANPDSNPQMVGFTTVLVH  3391
             Y  L  G  +  F + +  G I+S +SFDYEE   YTL I A NPDS+  M  +  + VH
Sbjct  3371  YAFLPSGPDRHFFIMNQSNGTISSAVSFDYEERRIYTLQIKAKNPDSS--MESYANLYVH  3428

Query  3392  ITGVNEYYPKFIQPVFHMDVSESAEVGTSVGLVQATDQDAGEDGRVYYLFVGSSNDRGFS  3451
             + GVNE+YP+F+QPVFH DVSE++ VGT VG VQATD+D+GEDGRVYYL VGSSND+GF 
Sbjct  3429  VLGVNEFYPQFLQPVFHFDVSETSAVGTRVGAVQATDKDSGEDGRVYYLLVGSSNDKGFR  3488

Query  3452  IGSETGIIRVSRRLDRETQNRVVLTVMTKNGGGIRGNDTDEAQVIVSIQDGNDPPEFLQS  3511
             I + TG+I V+R LDRETQNRVVLTVM KN G IRGNDTDEAQVI+SIQDGNDPPEF++ 
Sbjct  3489  IDTNTGLIYVARHLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGNDPPEFIKH  3548

Query  3512  TYDATVSEGATHGTRVLTVRAVDKDIKPQNNQFSYSIISGNLGQAFKVDPQTGDIETAKQ  3571
              Y +T+SE A  GT+V TV+A+DKD++ QNNQFSYSII+GNL Q+FK+D QTG+I TA +
Sbjct  3549  YYTSTISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIINGNLKQSFKIDVQTGEISTASR  3608

Query  3572  LDRETIPIYDLTIGAIDTGSPPQTGTAAIHIELLDINDNGPTFDPPEVVGYVNENEPAGT  3631
             LDRE    Y+L IGAIDTG PPQTG+A +HIEL D+NDNGPTF P  + GY++ENEPAGT
Sbjct  3609  LDREETSTYNLVIGAIDTGLPPQTGSATVHIELEDVNDNGPTFTPEGLNGYISENEPAGT  3668

Query  3632  IVMTLSATDPDLPPNGAPFTYKLVGGRQSDMVTLDKHTGVLKTTRSLDREAMPQLDLVVE  3691
              +MTL A+DPDLP NG PFTY+L+GG+    +++D+++GV+++T S DRE  P L+ ++E
Sbjct  3669  SIMTLIASDPDLPRNGGPFTYQLIGGKHKSWLSVDRNSGVVRSTTSFDREMTPILEAIIE  3728

Query  3692  VEDSGVPRMRSEHTITVIVTDQNDSPSSPRSVHVIVHSFNELIPLG-KIADVHPNDPDVT  3750
             VEDSG P+ +S+H +T+ V DQND+PS+ RS+H+ V  FN  +P   K+ADV PND D+ 
Sbjct  3729  VEDSGKPKQKSQHLLTITVLDQNDNPSTTRSLHIAVSLFNGDLPSNVKLADVRPNDIDIV  3788

Query  3751  GSYSCKILQGSNPK----ILSIPSACDLHTKKITPGVGYSLSVSGNDGRHPNVVSKVTVE  3806
             G Y C++ +  NP      L+IP ACDL T   T  +    S +GNDG+H +V SKV+V 
Sbjct  3789  GDYRCRLQK--NPAQSQLQLAIPRACDLITTSHTTPIASVFSYTGNDGKHGDVSSKVSVA  3846

Query  3807  FLVFTNSTIENSVTLQVTKLSSRDFLGQYYRALLDVLQEEVDVGDTLKIFSLGETGS---  3863
             F  F N T+ NSV++ V  +++  FL  +YR +L++++  +   D + ++SL E GS   
Sbjct  3847  FQSFNNETLANSVSIMVRNMTAYHFLANHYRPILEMIKSRMSNEDEVILYSLLEGGSGNS  3906

Query  3864  -DLNIHVAVE-SPEGYRSKYEVTELLNRNRDKIRSLLQGMTFTVGYSPCKHIP-CENGGS  3920
              +L + +AV  +   Y+    + E L   R     LLQ     VGY PC     CENGG 
Sbjct  3907  TNLQLLMAVRLAKTSYQQPKYLIERLREKRSAFSELLQKEVI-VGYEPCSEPDVCENGGV  3965

Query  3921  CSDKLVIYDDAR--ITDSQALILTSPRMMHEMTCKCRDGFTGDKCERRQDPCSPNPCLLG  3978
             CS  + + D     I DS AL+L+ PR++H+ +C+C  GF+G++C RRQDPC PNPC   
Sbjct  3966  CSATMRLLDAHSFVIQDSPALVLSGPRVVHDYSCQCTSGFSGEQCSRRQDPCLPNPCHSQ  4025

Query  3979  GQCRRLGYDFQCTCPIDRDGKLCELERGDACASNPCRNGGSCRKSPDSFSFFCLCRAGYR  4038
              QCRRLG DFQC CP +RDGK CE ER D C S PCRNGGSC++SPD  S+FCLCR G+R
Sbjct  4026  VQCRRLGSDFQCMCPANRDGKHCEKERSDVCYSKPCRNGGSCQRSPDGSSYFCLCRPGFR  4085

Query  4039  GNHCEAVTDSCRPNPCLYGGLCVGEKPGYTCSCPEGRYGRHCERSTFGFEELSYMTFPAL  4098
             GN CE+V+DSCRPNPCL+GGLCV  KPGY C+C  GRYGRHCER ++GF+ LSYMTFPAL
Sbjct  4086  GNQCESVSDSCRPNPCLHGGLCVSLKPGYKCNCTPGRYGRHCERFSYGFQPLSYMTFPAL  4145

Query  4099  DSNTNDITIVFATTKPDALLLYNYAPQAGGRSDFVVLELVDGRVVFSYGGARSAITSVTI  4158
             D  TNDI+IVFATTKP++LLLYNY  Q+GGRSDF+ +ELV GR  FS GGAR+AI+  T+
Sbjct  4146  DVTTNDISIVFATTKPNSLLLYNYGMQSGGRSDFLAIELVHGRAYFSSGGARTAIS--TV  4203

Query  4159  KTENSVSDGEWRKVTATRNGRVVSLSVSMCREHGDICDDCRPGDGTCYADDVGPTGTLNF  4218
                 +++DG W KVTATRNGRV+SLSV+ C + GD+C +C PGD +CYAD+VGP GTLNF
Sbjct  4204  IAGRNLADGGWHKVTATRNGRVMSLSVAKCADSGDVCTECLPGDSSCYADEVGPVGTLNF  4263

Query  4219  NNNPLLVGGLENADPVLERPGQVHSDDFVGCVHSVSINGRALNLSNPLASRGVKSTCIRS  4278
             N  PL++GGL +ADP+LERPGQVHSDD VGC+HSV I GRALNLS PL  +G+ + C   
Sbjct  4264  NKQPLMIGGLSSADPILERPGQVHSDDLVGCLHSVHIGGRALNLSLPLQQKGILAGC---  4320

Query  4279  NNNSCSKGGKDSASVCGANS-KCYDKWHQVTCQCGS-VTAPNCEAALESITLSEGGYVEF  4336
             N  +C      +A  CG  + +C D+W    CQCG  + +P+C  +LE ITL EG +VEF
Sbjct  4321  NRQACQPAL--AAERCGGFAGQCIDRWSSSLCQCGGHLQSPDCSDSLEPITLGEGAFVEF  4378

Query  4337  KISEKHRRMQLLEYLYRGSTLWHKNRTKRTVSEDTSFITNPSPF---KTIGLMFRTVKPD  4393
             +ISE +RRMQLL+ LY   + W  N+  R     ++F T    +   K + ++FRT K  
Sbjct  4379  RISEIYRRMQLLDNLYNSKSAWLDNQQMRERRAVSNFSTASQIYEAPKMLSMLFRTYKDQ  4438

Query  4394  GVLVYAATNKHFTSVELRNGQLFYASLLGSPVNMTANIEGGLADGHWHNLTLHSYFRGLR  4453
             G ++YAATN+ FTS+ LR G+L Y S     +NMT      L DG WHN++L S  R LR
Sbjct  4439  GQILYAATNQMFTSLSLREGRLVYYSKQHLTINMTVQETSTLNDGKWHNVSLFSESRSLR  4498

Query  4454  LFVDGVQTGEELDPVGVHDFLDPYLSVLSIGGVSQDLYYAHSAGAGSFEGCLANFTINNE  4513
             L VDG Q G+ELD  GVHDFLDPYL++L++GG              +F GCLAN T+NNE
Sbjct  4499  LIVDGRQVGDELDIAGVHDFLDPYLTILNVGG-------------EAFVGCLANVTVNNE  4545

Query  4514  IQPFNGSGSIFKEVLYHAKVSTGCRGPIGMSAAATADPLRIGITLVVVFFIILLIAILAS  4573
             +QP NGSGSIF EV YH K+ +GCRG IG  AA  ADPL IG TLV+VFF+IL++AIL S
Sbjct  4546  LQPLNGSGSIFPEVRYHGKIESGCRGDIGQDAAQVADPLSIGFTLVIVFFVILVVAILGS  4605

Query  4574  FVVFRLRRQNKEKSAPSVVNKNTNAIMTGNPLVGSGNDNLMSRHENTYISDTSDLRGVGH  4633
             +V++R R + ++  + S           G P+  S  D+++ R+ +   + +  +    H
Sbjct  4606  YVIYRFRGKQEKIGSLSCGVPGFKIKHPGGPVTQSQVDHVLVRNLHPSEAPSPPVGAGDH  4665

Query  4634  M----------GPELISKKYK----EREINATTEHRPQRPDIIEREVTKSPPIRDEHPPL  4679
             M          GPEL++KK+K    E       + RPQRPDIIERE   SP IR++H   
Sbjct  4666  MRPPVGSHHLVGPELLTKKFKEPTAEMPQPQQQQQRPQRPDIIERE---SPLIREDHHLP  4722

Query  4680  PPPAQTSLHSHEHNPE--PDMPEHYDLENASSIAPSDIDIVYHYKGYRD--GMRKYKATP  4735
              PP       H  + +   + PEHYDLENASSIAPSDIDIVYHYKGYR+  G+RKYKA+ 
Sbjct  4723  IPPLHPLPLEHASSVDMGSEYPEHYDLENASSIAPSDIDIVYHYKGYREAAGLRKYKASV  4782

Query  4736  PPINNYANHHKHAGQ-------QHRHTGPFPPRALPPPNVSQPPGPTQKLLQSTPLARLS  4788
             PP++ Y  HHKH          QHRHT PF  R         P   + +  QSTPLARLS
Sbjct  4783  PPVSAYT-HHKHQNSGSQQQQQQHRHTAPFVTRNQGGQPPPPPTSAS-RTHQSTPLARLS  4840

Query  4789  PSSELSAQQPRILTLHDISGKPLQSALLATTSSSGGVGKDALNSNSERSLNSPIMSQLSG  4848
             PSSELS+QQPRILTLHDISGKPLQSALLATTSSSGGVGKD ++SNSERSLNSP+MSQLSG
Sbjct  4841  PSSELSSQQPRILTLHDISGKPLQSALLATTSSSGGVGKD-VHSNSERSLNSPVMSQLSG  4899

Query  4849  --STASRKAPQSNNENSVNNVSSGPMGLTAEEIERLNSRPRTSSLVSTLDAVSSSSEARG  4906
               S+ASR+ P    + +        MGLTAEEIERLN RPRT SL+STLDAVSSSSEA  
Sbjct  4900  QSSSASRQKPGVPQQQA----QQTSMGLTAEEIERLNGRPRTCSLISTLDAVSSSSEA--  4953

Query  4907  PPTHGPLHLHRRHTPPVERLERRNSSTTDESGNDSFTCS--EYDNTSLVGDKRSDNPFAK  4964
              P      LH      V   +  +S++TDESGNDSFTCS  EYDN SL GD +     + 
Sbjct  4954  -PRVSSSALHMSLGGDV---DAHSSTSTDESGNDSFTCSEIEYDNNSLSGDGKYSTSKSL  5009

Query  4965  QDDEEVNQRSNESSQTTK---------PPLPPNVNYDGFDSSFRGSLSTLVASDDDLSTH  5015
              D      R+    +T++         PP+PP+  YDGF+SSFRGSLSTLVASDDD++ H
Sbjct  5010  LDGRSPVSRALSGGETSRNPPTTVVKTPPIPPHA-YDGFESSFRGSLSTLVASDDDIANH  5068

Query  5016  MGGLYRPNNSGSPSTTTTALSWDYLLNWGLNFDSLVGVFIDIAELPDS---------ANR  5066
             + G+YR  N G+ S + T L W+YLLNWG ++++L+GVF DIAELPD+           +
Sbjct  5069  LSGIYRKAN-GAASPSATTLGWEYLLNWGPSYENLMGVFKDIAELPDTNGPSQQQQQQTQ  5127

Query  5067  VPSTLRLPASI-PKPSEEYV  5085
             V STLR+P+S  P   EEYV
Sbjct  5128  VVSTLRMPSSNGPAAPEEYV  5147


>FAT2_DROME unnamed protein product
Length=4699

 Score = 898 bits (2321),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 946/3523 (27%), Positives = 1576/3523 (45%), Gaps = 366/3523 (10%)

Query  862   KISYAIVFGDPKGNFKIDESTGTISTSGCLDREQVAYYSLQLSAR-AGLAYGQTS--VNI  918
             K+ +AI  GD    F+ID   G +   G LDRE+   Y L ++    G     TS  + I
Sbjct  806   KLVFAISDGDYDSVFRIDPDRGELQIIGYLDRERQNEYVLNITVYDLGNPTKSTSKMLPI  865

Query  919   TVLDINDNPPRFPKGEIGDEVLLKENAAVGQEVCLARARDRDASANARIVYSLTHNPGGQ  978
             T+LD+NDN P   K        L E+A +G  V    A D D+  NA++ Y+L+      
Sbjct  866   TILDVNDNRPVIQKTLA--TFRLTESARIGTVVHCLHATDADSGINAQVTYALSVE-CSD  922

Query  979   FRVAENSGIIYLDKPIRAAPGTVLHLEVTATDSGNQPLSAQHQVRVTIEDVNDHTPVFKL  1038
             F V   +G + L+KP+         L +TA D G+  LS++  V V ++DVND+ PVF +
Sbjct  923   FTVNATTGCLRLNKPLDREKQDNYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGV  982

Query  1039  TSYETSLPESTPVNDRFFSLTAIDVDLGANGRVLYSITDGNT-EDRFGIFPD-GQLYVKN  1096
               Y   + E  P       + A+D D+G N  + +S+ +    E+ F I    G +  + 
Sbjct  983   QEYIFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLKEETQDEELFRIDKHTGAIRTQG  1042

Query  1097  VLDREELDYYALEVTATDQGSPSRSSVVPVVVHIIDENDN--APEFTNSSFVLHLRENEP  1154
              LD E    + L V+A D G PS +S + +V+ IID N+N  APEF +  +   ++EN+P
Sbjct  1043  YLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNENRFAPEFDDFVYEGKVKENKP  1102

Query  1155  PDTFVGKLLATDRD-VGRNADLVFSLPASQQ--DFTVDPRNGFIKSLRVFDRELLVTNTG  1211
               TFV  + A D D V  N+ + +S+        F V+ + G I SL   D E       
Sbjct  1103  KGTFVMNVTARDMDTVDLNSKITYSITGGDGLGIFAVNDQ-GSITSLSQLDAET------  1155

Query  1212  SSYITLEATVTDNGVNRLRDRVKVVIYITDVNDNIPQFQRLPYRVQVNEGAAIGTQLLRV  1271
              ++  L     D  +  L + V+V I + + NDNIP   +  Y V V E +    +++ +
Sbjct  1156  KNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNIPLTDKPVYYVNVTEASVENVEIITL  1215

Query  1272  YTTDADEGLNGDVFYSLEDGNQHGRFAIDEATGQISLT-KELDRETTDAYVLTVVAHDAG  1330
                D D      + Y++  GN  G F ID  TG I  T ++LDRE    ++L V   D G
Sbjct  1216  KAFDPDIDPTQTITYNIVSGNLVGYFEIDSKTGVIKTTERKLDRENQAEHILEVAISDNG  1275

Query  1331  LETRLSSSTTVHIEVLDENDNVPLFVDDKSSISVLETTPTNTELLRFKATDNDLGPNSEL  1390
                 LSS++ + + VLD NDN P F      + V  +   N  + +  A D+D G N  +
Sbjct  1276  -SPVLSSTSRIVVSVLDINDNSPEFDQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRI  1334

Query  1391  AFAISAGNRRDTFYIDPLTGTLYLRKPLDYEELEKYTLNVTCSDGGHPRLSSVT---TLI  1447
              ++I +G  ++ F ID   G +++ KPLD +   ++ +++   D G P+ S       ++
Sbjct  1335  TYSIKSGKGKNKFRIDSQRGHIHIAKPLDSDN--EFEIHIKAEDNGIPKKSQTARVNIVV  1392

Query  1448  VEVIDANDNPPVFPNTAIARQIREGILVHTP-------IVTITAEDPDSNENGVVTYSIA  1500
             V V   + N P+     I R+  E ++  T        +  I A D D+++   + Y+I+
Sbjct  1393  VPVNPNSQNAPL-----IVRKTSENVVDLTENDKPGFLVTQILAVDDDNDQ---LWYNIS  1444

Query  1501  SQDPEDQVRRFGINPSTGVIHTLLPIDREEVDTYKLVVVATDSAQPASARLSAEKLVIVI  1560
             + + ++    F I    G I     +D E   +Y L +  TD    A   L      +V 
Sbjct  1445  NGNDDNT---FYIGQDNGNILLSKYLDYETQQSYNLTISVTDGTFTAFTNL------LVQ  1495

Query  1561  VEDINDNAPIFVSMSAVVLPLKGNYYQYQKEITVTQLVARDLDSSTNGLVTYELLRSSIN  1620
             V DINDN P F +     + +  N    ++E  + QL A D D            +   +
Sbjct  1496  VIDINDNPPQF-AKDVYHVNISENI---EEESVIMQLHATDRDEDKKLFYHLHATQDPSS  1551

Query  1621  YPDMFRIHRNTGHLTIRLPRSLKSSFERVSKYQVGIRATDEAVQAERRSTETYLTLIVPG  1680
                +FRI   +G++ +    + +  FE+ +++ + +   D+    +R     Y  +IV  
Sbjct  1552  LA-LFRIDSISGNVIV----TQRLDFEKTAQHILIVFVKDQGAPGKR----NYAKIIVNV  1602

Query  1681  EDGDDQPIWEHRGQIEGNVYENEPIGTSILRVSARSRRS--NIDLEYYVTNVTAGSGGPQ  1738
              D +D         I+  V E+  IG+ +  V A  R S  N +++Y +     GS    
Sbjct  1603  HDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAIDRDSGHNAEIQYSIITGNVGS----  1658

Query  1739  VDRLFDVDTKTGILSTAAALDRETGIQWYEVELYAIGVGGTRPSTTSTKVRVTVLDKNDV  1798
                +F++D   GI++ A  L+    IQ Y +++ A+ +G   P ++   V + V    + 
Sbjct  1659  ---VFEIDPTFGIITLAGNLNINK-IQEYMLQVKAVDLGNP-PLSSQIPVHIIVTMSEND  1713

Query  1799  APTWGTGTWKFKISEEAPPNTVVTVLKAYDPDTIGTLTYTLVPNHRPDPGPGTALGFYPA  1858
              P + T     +I E  P  T VT + A    +I                      F+  
Sbjct  1714  PPKFPTNNIAIEIFENLPIGTFVTQVTARSSSSI----------------------FFNI  1751

Query  1859  SQHELQDESQCQFRLHPTTGQLTLAEALDRETREKYVLKVRADDGLQHTDIA-LTIQVTD  1917
                 + +     FR++P+TG + +   +D E+ + + L V+  +    +    + I + D
Sbjct  1752  ISGNINE----SFRINPSTGVIVINGNIDYESIKVFNLTVKGTNMAAESSCQNIIIHILD  1807

Query  1918  TNDNAPTFQSTAYSFDVPENVPRGSRIGQV----------VATDADANGPNSQLSYTLIS  1967
              NDN P F    Y   +PE+   GS + +V             DAD  G N  + Y ++ 
Sbjct  1808  ANDNIPYFVQNEYVGALPESAAIGSYVLKVHDSSKDHLTLQVKDADV-GVNGMVEYHIVD  1866

Query  1968  DWANDVFSLNPSTGVFTLTASLDYEQVQHYILVVQATDGGIPALSSTVTVYCN--VVDLN  2025
             D A + F ++ +TG   L   LDYE    Y   V  +D G P L ST T +    V+++N
Sbjct  1867  DLAKNFFKIDSTTGAIELLRQLDYETNAGYTFDVTVSDMGKPKLHSTTTAHVTIRVINVN  1926

Query  2026  DNAPIFEAGPHAADIVENTTIGTPILSVAAQDLDSGDNGRVIYAVAGGDENGDFGVAP-N  2084
             D  P+F        +   T     +  V+A+D    DN  + + +  G+ N  F +    
Sbjct  1927  DCPPVFNERELNVTLFLPTFENVFVRQVSAKD---ADNDTLRFDIVDGNTNECFQIEKYT  1983

Query  2085  GTLFTR--KLLDREQKPLYNLILSATDSPLPPALPLSSTVQVTVVLLDVNDMSPEFISPT  2142
             G + TR  ++L+ E    Y L + A+D         S+ + V + +L   D +  F   +
Sbjct  1984  GIITTRNFEILNNENDRDYALHVRASDGIF------SAILIVKIKVLSAIDSNFAFQRES  2037

Query  2143  -KISIIENAPSNTVVMAIKAVDRDEGRNGYVEYSLEDTTLPFTVGPVDGLLRVSGSL-DR  2200
              + S  EN      +  +  +      N  VEY + + T  F +G   G L+ +G + DR
Sbjct  2038  YRFSAFENNTKVATIGLVNVIGNTLDEN--VEYRILNPTQLFDIGISSGALKTTGVIFDR  2095

Query  2201  ELRSNYTLEVTAKDR-----GEPPRSSSTAVTVTVLDENDNSPVFDPRQYSATVAENASI  2255
             E++  Y L V AK           R + T++ ++VLD NDN P+F    Y ATV+ +   
Sbjct  2096  EVKDLYRLFVEAKSMLYDGMNSNVRRAVTSIDISVLDVNDNCPLFVNMPYYATVSIDDPK  2155

Query  2256  GASVLQVSAMDRDEGANGRVRYSIAMGDDNRDFTISEDGGVIRVAKNLNFERKSRYYLTI  2315
             G  ++QV A+D D   NG VRY +  G+    F +    G + + +++    ++ Y LT+
Sbjct  2156  GTIIMQVKAIDLDSAENGEVRYELKKGNGEL-FKLDRKSGELSIKQHVEGHNRN-YELTV  2213

Query  2316  RGEDCASEVGETPRGDTAQVTITVIDINDNAPVFLDSPYLAHVMENMVPPGGGFVIQVKA  2375
                D A     TP    A + + VID   + PVF    Y   V E+ V       + ++A
Sbjct  2214  AAYDGAI----TPCSSEAPLQVKVID--RSMPVFEKQFYTVSVKED-VEMYSALSVSIEA  2266

Query  2376  YDADTPPYNDQVRYFLKEGDTDLFRINASTGDIFLLRPLDRELVAEYTLTLVAMDTGSPP  2435
                   P    + Y +   ++  F I+ +TG IF++  LD E ++ + +++ A D+ S  
Sbjct  2267  ----ESPLGRSLIYTIS-SESQSFEIDYNTGSIFVVNELDYEKISSHDVSIRATDSLSG-  2320

Query  2436  LTGSGIVRIVVLDVNDHIPEFTRQEYRATVTENLASGTWVTKPHATDKDEGLNAKIRY--  2493
             +    ++ + ++DVND  PE     Y  T+ EN + GT + K +ATD D G NAK+ Y  
Sbjct  2321  VYAEVVLSVSIMDVNDCYPEIESDIYNLTIPENASFGTQILKINATDNDSGANAKLSYYI  2380

Query  2494  -SLLGEN-SERFTVEPETGEVLTVVPLDREQTAVYHLTLVAQD-SSPTEPQASAVNLTIF  2550
              S+ G+N SE F ++   G +    PLD EQ   +H+ +  +D  SP+   +S  N+ I 
Sbjct  2381  ESINGQNNSELFYIDVTDGNLYLKTPLDYEQIKYHHIVVNVKDHGSPS--LSSRSNVFIT  2438

Query  2551  VKDVNDNAPRFSSPRYTAYVPGATKPGDFVFGAKAVDDDDGENSRIVYRL-QGIDAEKFV  2609
             VKD+NDNAP F  P Y   V  A   G FV   KA D D  +   + Y++  G + + + 
Sbjct  2439  VKDLNDNAPCFVEPSYFTKVSVAAVRGQFVALPKAYDKDISDTDSLEYKIVYGNELQTYS  2498

Query  2610  IDPNSGVIRTTQELAN--DETTYQLQIQASDCGVKPQTVTADLVIHLWERQLFPSFRSTI  2667
             ID  +GVI + Q + N  D+++  L I  SD GV   T  A L I L    ++       
Sbjct  2499  IDKLTGVI-SLQNMLNFTDKSSTVLNISVSD-GV--HTAYARLKISLLPENVYSPLFDQS  2554

Query  2668  STRFTLPEDVPEGRVITKLSATTPKVGTASNLVYGMAGGNVGDALKIDPHTGEVLVASGF  2727
             +    +PE++  G  I  + A+    GT +NL Y +    +     ID  TG +     F
Sbjct  2555  TYEAQVPENLLHGHNIITVKASDGDFGTYANLYYEIVSEEMKKIFLIDQTTGVITSKVTF  2614

Query  2728  DYETAPFYEAWVEVRDSDTPALRSVVQLLVNVTDANDNAPIMEAAIYNATVPEDEYPPLF  2787
             D E    Y   ++V  SD         L V V D NDN P      Y   V         
Sbjct  2615  DREKKDEYVVLLKV--SDGGGKFGFASLKVIVVDVNDNVPYFLLKEYKMVVSTTVEANQT  2672

Query  2788  VNKVSANDRDSGENGQVSYYLVNDFTETFV-----IDSDTGEISTNAKLDREEIASYELI  2842
             +  V A D D  +NG V + +V    +  V     I+  TG+I   +K +   + SY+  
Sbjct  2673  ILTVKAKDDDIVDNGSVHFQIVQKSNDKAVKDVIEINEKTGDIVFKSKAESYGVNSYQFF  2732

Query  2843  VEARDQGQPSLTGTATVLLTVLDKNDNPPQFTRL-FSVNVTENAEIGTFVIRITSSDLDI  2901
             V A D+G+P       V + +++ + N P F +    + + E+   GT + ++      I
Sbjct  2733  VRASDRGEPQFHSEVPVSIEIIETDANIPTFEKSSVLLKIIESTPPGTVLTKLHM----I  2788

Query  2902  GQNANVTYRFTENPGEKFAMDALSGNVTVNGHLDREEQDEYLLKLVAADG---AWQAATA  2958
             G   N T++F+    +   M + SG + +   LDRE+Q+ + L +VA       + A   
Sbjct  2789  G---NYTFKFSIAADQDHFMISDSGELILQQTLDREQQESHNLIVVAETSTVPVFFAYAD  2845

Query  2959  LTITIQDQNDNPPEFDEESYHFHFPELQPPVAHVGQVTAIDRDKQGPNSVISYSLLQPSD  3018
             + I ++D+NDN P+FD   Y     E    V  + +V+A D D  GPN  I Y L   ++
Sbjct  2846  VLIDVRDENDNYPKFDNTFYSASVAENSEKVISLVKVSATDADT-GPNGDIRYYLESDTE  2904

Query  3019  ----LFTVDPATGDVFSKKTLKYKHTHRPSSPENLYSLTVVATDNGKPPLSSKTVVYVNV  3074
                 +F +D  +G +    +L      R    E  Y+  V+A DNG P   +K  V + +
Sbjct  2905  NIQNIFDIDIYSGWITLLTSLD-----REVQSE--YNFKVIAADNGHPKHDAKVPVTIKI  2957

Query  3075  VDANNNAPRFDQRSYLYPVPENYGVGKRVVQLMAKD-DADFGVNAEISYFMTNVNGSEYF  3133
             VD N+NAP F        V EN   G  ++ L+  D D +     E+ +F+ + +    F
Sbjct  2958  VDYNDNAPVFKLPIEGLSVFENALPGTVLINLLLIDPDIE---KQEMDFFIVSGDKQAQF  3014

Query  3134  SIDEKSGWVYVRNTLSNVPVRTTFLLKVQAIDKGVPPQKDEVSLTLVISGENKHAPTFAA  3193
              I  KSG +++   L    +   + L + A D     + +   + + +   N + P    
Sbjct  3015  QIG-KSGELFIAKPLDREQL-MFYNLSIIATDGKFTAKAN---VEIDVKDINDNTPYCLK  3069

Query  3194  VSHQVRVPENEPVNTTILTVSATDGDDGPNGMIRYKISAGNEKNEFFVHSITGAVTILEP  3253
               + +   E+  + TT++ V A D D      +R+ +S G   ++F +   +G + +   
Sbjct  3070  PRYHISTNESISIGTTLVEVKAIDFD--FQSKLRFYLS-GKGADDFSIGKESGILKVASA  3126

Query  3254  LDYDLVQEYKLNITATDLGFEPKQAVAILTVNVSDINDNPPTFNQSIYEAYLPENSPPDS  3313
             LD +   +YKL     D     ++  + + + V+DINDN P F+ + Y   +PE++  ++
Sbjct  3127  LDRETTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIFSMAQYRVSVPEDAQLNT  3186

Query  3314  FVYKVIARDIDSPKYAVIQYKILGGTGKDHFRIREDTGEIASLISFDYEEANEYTLDIVA  3373
              + KV A D D      I+Y ++G    D+F+I + TG I    S D E  + + L + A
Sbjct  3187  LITKVHAMDKDFGVNRQIKYSLMG-ENHDYFKISKSTGIIRLHKSLDRETISLFNLTVKA  3245

Query  3374  ANPDSNPQMVGFTTVLVHITGVNEYYPKFIQPVFHMDVSESAEVGTSVGLVQATDQDAGE  3433
              +    P++    TV V+I  +N+  P+F    +   + E+A  GT V  V AT  D G 
Sbjct  3246  EDCGV-PKLHSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSIDIGV  3304

Query  3434  DGRVYYLFVGSSNDRG-FSIGSETGIIRVSRRLDRETQNRVVLTVMTKNGGG--IRGNDT  3490
             +  ++Y F+ S N++G F + S TG + ++  LD E      LT+   +GG   +  N  
Sbjct  3305  NADIHY-FIMSGNEQGKFKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNN--  3361

Query  3491  DEAQVIVSIQDGND-PPEFLQSTYDATVSEGATHGTRVLTVRAVDKDIKPQNNQFSYSII  3549
               A V +SI D ND  P FLQ+ Y   V+E    G+++L V+A D+D    N   +Y+I 
Sbjct  3362  --AYVNISILDINDNSPTFLQNLYRINVNEDIFVGSKILDVKATDED-SDVNGLVTYNIE  3418

Query  3550  SG-NLGQAFKVDPQTGDIETAKQLDRETIPIYDLTIGAIDTGSPPQTGTAAIHIELLDIN  3608
              G N+GQ F +DP+ G I  ++ LDRETI  Y L I A D G P +  +  I+I +LD N
Sbjct  3419  RGDNIGQ-FSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQRCNSVPININILDTN  3477

Query  3609  DNGPTFDPPEVVGYVNENEPAGTIVMTLSATDPDLPPNGAPFTYKLVGGRQSDMVTLDKH  3668
             DN P F        + EN   G + +T   +D D  PN  P+T+ +  G +  +  L++ 
Sbjct  3478  DNAPIFSSSNYSVVLQENRLLGYVFLTFKISDADETPNTTPYTFDIRSGNEGGLFRLEQD  3537

Query  3669  TGVLKTTRSLDREAMPQLDLVVEVEDSGVPRMRSEHTITVIVTDQNDSPSSPRSVHVIVH  3728
              G L+T    +     +  + V V D+G P + S+  + V + +++  P     + V ++
Sbjct  3538  -GSLRTASRFNHNLQDEFVIQVRVFDNGTPPLYSDAWVVVKIIEESQYPPIVTPLEVTIN  3596

Query  3729  SFNELIPLGKIADVHPNDPDVTGSYSCKILQG-----SNPKILSIPSACDLHTKKITP--  3781
             SF +      I  VH +D D     +  ++ G      + K+ +I +    +T KI    
Sbjct  3597  SFEDDFSGAFIGKVHASDQDKYDELNFSLVSGPDDMYQSSKLFNISN----NTGKIYAIS  3652

Query  3782  --GVG-YSLSVSGNDGR-HPNVVSKVTVEFLVFTNSTIENSVTLQVTKLSSRDFL----G  3833
                +G Y L+VS +DG+ H   + K+ VE +  TN  ++ SV ++  ++S+ +FL     
Sbjct  3653  NLDIGLYKLNVSVSDGKFHVFSIVKINVELV--TNDMLKESVVIRFRRISASEFLLSHRK  3710

Query  3834  QYYRALLDVLQ-EEVDV------GDTLKI--FSLG-----ETGSDLNIHVAV-------E  3872
              + R++ ++++  + DV       D  K    ++G        SDLN+  AV       +
Sbjct  3711  TFMRSIRNIMRCRQKDVILITLQSDYQKASQHAVGNRRARSIDSDLNVVFAVRKQQIIPD  3770

Query  3873  SPEGYRSKYEVTELLNRNRDKIRSLLQGMTFTVGYSPCKHIP--CENGGSCSDKL-VIYD  3929
             S E + S  E+ + L   +++I +    +   V  S C+     C +G  C   L ++ +
Sbjct  3771  SDEFFTSD-EIRQTLIDKKNEIENETNLVVEDVLPSTCQSNKNDCVHG-ECKQILQILKN  3828

Query  3930  DARITDSQALILTSPRMMHEMTCKCRDGFTGDKCERRQDPCSPNPCLLGGQCRRLGYDFQ  3989
             +   T +  +   +P  +   TC CR GF                               
Sbjct  3829  NVTTTFTDVISFAAPSYIPVNTCVCRPGF-------------------------------  3857

Query  3990  CTCPIDRDGKLCELERGDACASNPCRNGGSCRKSPDSFSFFCLCRAGYRGNHCEAVTDSC  4049
                    DGK C+ E  +AC+++PC     C  S  +  + C+C  G+ G +CE  +  C
Sbjct  3858  -------DGKHCK-ETVNACSTDPCSPQRICMPSGSALGYQCVCPKGFSGTYCERKSSKC  3909

Query  4050  RPNPC---LYGGLCVGEKPGYTCSCPEGRYGRHCERSTFGFEE-LSYMTFPALDSNTNDI  4105
                 C   L+  +  G K           Y  +  ++ F  E   SY             
Sbjct  3910  SNESCDMGLFTAVSFGGK-------SYAHYKINKVKAKFTLENGFSY-------------  3949

Query  4106  TIVFATTKPDALLLYNYAPQAGGRSDFVVLELVDGRVVFSY--GGARSAITSVTIKTENS  4163
             ++   T +    LLY     A G+ D+ +LE+++G V + +  G     I+  +I    +
Sbjct  3950  SLQIRTVQQTGTLLY-----ASGKVDYNILEIINGAVQYRFDLGSGEGVISVSSI----N  4000

Query  4164  VSDGEWRKVTATRNGRVVSLSVSMCREHGDICDDCRPGDGTCYADDVGPTGTLNFNNNPL  4223
             +SDGEW +++  R+  + S  V +  +H              +    G  G LN  +N +
Sbjct  4001  ISDGEWHQISLERS--LNSAKVMVDNKH------------VSHGSAPGVNGILNIQSNDI  4046

Query  4224  LVGGLENADPVLERPGQVHSDD----FVGCVHSVSINGRALNL  4262
              VG       V   P  +  +D    F+GC+ ++ I   +L L
Sbjct  4047  FVGA-----EVRPHPSIIGYEDIQRGFIGCMANIKIAKESLPL  4084


 Score = 874 bits (2257),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 910/3403 (27%), Positives = 1529/3403 (45%), Gaps = 345/3403 (10%)

Query  109   EFVLDPETGKIRTAKVLDREALSS-----DRFDLVVLSSQPTYPIEVRILVLDINDNDPE  163
             EF ++P++G + TAK LD E  SS        D   + S+     +V+I V D+NDNDP 
Sbjct  447   EFRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPI  506

Query  164   FPESSIAVSFSESAVVGTKLLLDAATDKDTLENGVVDDYFIVNGNTDEKFRLEVTGNPTG  223
             F   +  +S +E+ + G+ ++   A D+D+ EN  +  Y I N N    F ++       
Sbjct  507   FENVNKVISINENNLAGSFVVKLTAKDRDSGENSYI-SYSIANLNA-VPFEIDHFSGIVK  564

Query  224   ETSYLHLETTGKLDREQVEFYSLNVCARDRGRP-PRLGYLLVNVTVLDVNDNPPIFQQSD  282
              TS L  ET  +        Y L + A D G P  R   + +++ V D+NDN P F++ +
Sbjct  565   TTSLLDFETMKR-------NYELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQFERVN  617

Query  283   YVVALNESAPVGTKVLTVHATDKDSEDNSKLTYYLPDTERQ--FTIDPETGTITTVEPLD  340
                 + +SAP+GT+V    A D D+ D   ++Y L D      F +DP +G+++    + 
Sbjct  618   CYGKVTKSAPMGTEVFVTSAIDFDAGD--IISYRLSDGNEDGCFNLDPTSGSLS----IS  671

Query  341   CPQQSCTIAARL-------GDGCPKSCVITVF--------------------ARDHGSPR  373
             C  +  T+  R+       G       +I V                      R+ G  R
Sbjct  672   CDLKKTTLTNRILKVSATDGTHFSDDLIINVHLMPEDLGGDSSILHGFGSFECRETGVAR  731

Query  374   QDGRTY--------------------VTVNLLDANDHDPEIKFSYFPSTPGFATVDENAA  413
             +   T                     +T +    N H PE     F + P   +++E+  
Sbjct  732   RLAETLSLAEKNNVKSASPSVFSDLSLTPSRYGQNVHRPE-----FVNFPQELSINESVQ  786

Query  414   KDSIVAAVAVIDNDEGLNGETTVEIRAGNELGHFRLDNTPSFDIVRVNGRLDREEIPKYN  473
                 VA +   D D G NG+    I  G+    FR+D  P    +++ G LDRE   +Y 
Sbjct  787   LGETVAWIEAKDRDLGYNGKLVFAISDGDYDSVFRID--PDRGELQIIGYLDRERQNEYV  844

Query  474   LTVVATDKGTPPRSATAYLVIHVNDVNDHEPVFQQSEYSAVLSELSPTGSFVASISATDA  533
             L +   D G P +S +  L I + DVND+ PV Q++  +  L+E +  G+ V  + ATDA
Sbjct  845   LNITVYDLGNPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTESARIGTVVHCLHATDA  904

Query  534   DSGLNARIYYDFDSGNEQGWFAIDQDTGLVTTVATLDREVQGSIELHVSARDGGPNPKYA  593
             DSG+NA++ Y      E   F ++  TG +     LDRE Q +  LH++A+DGG +P  +
Sbjct  905   DSGINAQVTYALSV--ECSDFTVNATTGCLRLNKPLDREKQDNYALHITAKDGG-SPVLS  961

Query  594   STHLKVTILDE-NDEAPRFSQNVVRVTLSENTPPQSLVATLTAVDNDQGTNGSVAYSFHS  652
             S  L   ++D+ ND AP F        + E+ P  +++A + AVD D G N  + +S   
Sbjct  962   SEALVYVLVDDVNDNAPVFGVQEYIFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLKE  1021

Query  653   SVSRDYPKTFALDGLTGQLTTKVNLDRETTAEYQILVIAKDQGTPPQSSTATVILTLEDV  712
                 +  + F +D  TG + T+  LD E    + ++V A D G P  +S  ++++ + DV
Sbjct  1022  ETQDE--ELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDV  1079

Query  713   NDN--SPVFYPWRYLMPIPEDAPPGTSVGKVTATDADARE-NAQVRYSLESG-GEGLFTV  768
             N+N  +P F  + Y   + E+ P GT V  VTA D D  + N+++ YS+  G G G+F V
Sbjct  1080  NENRFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGDGLGIFAV  1139

Query  769   DERTGEITLQGSLRAAHKTLYELNISAKDTGDRVAGRNALVEIIREEDLEHLEFDTYNGY  828
             +++ G IT    L A  K  Y L + A+D           V I  E + +++       Y
Sbjct  1140  NDQ-GSITSLSQLDAETKNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNIPLTDKPVY  1198

Query  829   EFRIAEDRGECGAMSNVFARDAGTVQITQYDSSKISYAIVFGDPKGNFKIDESTGTISTS  888
                + E   E   +  + A D   +  TQ     I+Y IV G+  G F+ID  TG I T+
Sbjct  1199  YVNVTEASVENVEIITLKAFDPD-IDPTQ----TITYNIVSGNLVGYFEIDSKTGVIKTT  1253

Query  889   G-CLDREQVAYYSLQLSAR---AGLAYGQTSVNITVLDINDNPPRFPKGEIGDEVLLKEN  944
                LDRE  A + L+++     + +    + + ++VLDINDN P F +     +V +  +
Sbjct  1254  ERKLDRENQAEHILEVAISDNGSPVLSSTSRIVVSVLDINDNSPEFDQRVY--KVQVPSS  1311

Query  945   AAVGQEVCLARARDRDASANARIVYSLTHNPG-GQFRVAENSGIIYLDKPIRAAPGTVLH  1003
             A V Q +    A D D+  N RI YS+    G  +FR+    G I++ KP+ +     +H
Sbjct  1312  ATVNQSIFQVHAIDSDSGENGRITYSIKSGKGKNKFRIDSQRGHIHIAKPLDSDNEFEIH  1371

Query  1004  LEVTATDSG----------------------NQPLSAQHQVRVTIEDVNDHT----PVFK  1037
             ++  A D+G                      N PL     VR T E+V D T    P F 
Sbjct  1372  IK--AEDNGIPKKSQTARVNIVVVPVNPNSQNAPLI----VRKTSENVVDLTENDKPGFL  1425

Query  1038  LTSYETSLPESTPVNDRFFSLTAIDVDLGANGRVLYSITDGNTEDRFGIFPD-GQLYVKN  1096
             +T                  + A+D D   N ++ Y+I++GN ++ F I  D G + +  
Sbjct  1426  VT-----------------QILAVDDD---NDQLWYNISNGNDDNTFYIGQDNGNILLSK  1465

Query  1097  VLDREELDYYALEVTATDQGSPSRSSVVPVVVHIIDENDNAPEFTNSSFVLHLRENEPPD  1156
              LD E    Y L ++ TD    + ++   ++V +ID NDN P+F    + +++ EN   +
Sbjct  1466  YLDYETQQSYNLTISVTD---GTFTAFTNLLVQVIDINDNPPQFAKDVYHVNISENIEEE  1522

Query  1157  TFVGKLLATDRDVGRNADLVFSLPASQQD-----FTVDPRNGFIKSLRVFDRELLVTNTG  1211
             + + +L ATDRD   +  L + L A+Q       F +D  +G +   +  D E       
Sbjct  1523  SVIMQLHATDRD--EDKKLFYHLHATQDPSSLALFRIDSISGNVIVTQRLDFE------K  1574

Query  1212  SSYITLEATVTDNGVNRLRDRVKVVIYITDVNDNIPQFQRLPYRVQVNEGAAIGTQLLRV  1271
             ++   L   V D G    R+  K+++ + D ND+ P+F     + +V E AAIG++L  V
Sbjct  1575  TAQHILIVFVKDQGAPGKRNYAKIIVNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEV  1634

Query  1272  YTTDADEGLNGDVFYSLEDGNQHGRFAIDEATGQISLTKELDRETTDAYVLTVVAHDAGL  1331
                D D G N ++ YS+  GN    F ID   G I+L   L+      Y+L V A D G 
Sbjct  1635  RAIDRDSGHNAEIQYSIITGNVGSVFEIDPTFGIITLAGNLNINKIQEYMLQVKAVDLG-  1693

Query  1332  ETRLSSSTTVHIEVLDENDNVPLFVDDKSSISVLETTPTNTELLRFKATDNDLGPNSELA  1391
                LSS   VHI V    ++ P F  +  +I + E  P  T + +  A       +S + 
Sbjct  1694  NPPLSSQIPVHIIVTMSENDPPKFPTNNIAIEIFENLPIGTFVTQVTAR-----SSSSIF  1748

Query  1392  FAISAGNRRDTFYIDPLTGTLYLRKPLDYEELEKYTLNVTCSDGGHPRLSSVTTLIVEVI  1451
             F I +GN  ++F I+P TG + +   +DYE ++ + L V  ++      SS   +I+ ++
Sbjct  1749  FNIISGNINESFRINPSTGVIVINGNIDYESIKVFNLTVKGTNMAAE--SSCQNIIIHIL  1806

Query  1452  DANDNPPVFPNTAIARQIREGILVHTPI----------VTITAEDPDSNENGVVTYSIAS  1501
             DANDN P F        + E   + + +          +T+  +D D   NG+V Y I  
Sbjct  1807  DANDNIPYFVQNEYVGALPESAAIGSYVLKVHDSSKDHLTLQVKDADVGVNGMVEYHIV-  1865

Query  1502  QDPEDQVRR-FGINPSTGVIHTLLPIDREEVDTYKLVVVATDSAQPASARLSAEKLVIVI  1560
                +D  +  F I+ +TG I  L  +D E    Y   V  +D  +P     +   + I +
Sbjct  1866  ---DDLAKNFFKIDSTTGAIELLRQLDYETNAGYTFDVTVSDMGKPKLHSTTTAHVTIRV  1922

Query  1561  VEDINDNAPIFVSMS---AVVLPLKGNYYQYQKEITVTQLVARDLDSSTNGLVTYELLRS  1617
             + ++ND  P+F        + LP   N +       V Q+ A+D D+ T   + ++++  
Sbjct  1923  I-NVNDCPPVFNERELNVTLFLPTFENVF-------VRQVSAKDADNDT---LRFDIVDG  1971

Query  1618  SINYPDMFRIHRNTGHLTIRLPRSLKSSFERVSKYQVGIRATDEAVQAERRSTETYLTLI  1677
             + N  + F+I + TG +T R    L +  +R   Y + +RA+D    A        L + 
Sbjct  1972  NTN--ECFQIEKYTGIITTRNFEILNNENDR--DYALHVRASDGIFSA-------ILIVK  2020

Query  1678  VPGEDGDDQPIWEHRGQIEGNVYENEPIGTSILRVSARSRRSNIDLEYYVTNVTAGSGGP  1737
             +      D      R     + +EN     +I  V+      + ++EY + N T      
Sbjct  2021  IKVLSAIDSNFAFQRESYRFSAFENNTKVATIGLVNVIGNTLDENVEYRILNPT------  2074

Query  1738  QVDRLFDVDTKTGILSTAAAL-DRETG-IQWYEVELYAIGVGGTRPST--TSTKVRVTVL  1793
                +LFD+   +G L T   + DRE   +    VE  ++   G   +     T + ++VL
Sbjct  2075  ---QLFDIGISSGALKTTGVIFDREVKDLYRLFVEAKSMLYDGMNSNVRRAVTSIDISVL  2131

Query  1794  DKNDVAPTWGTGTWKFKISEEAPPNTVVTVLKAYDPDTI--GTLTYTLVPNHRPDPGPGT  1851
             D ND  P +    +   +S + P  T++  +KA D D+   G + Y L        G G 
Sbjct  2132  DVNDNCPLFVNMPYYATVSIDDPKGTIIMQVKAIDLDSAENGEVRYEL------KKGNG-  2184

Query  1852  ALGFYPASQHELQDESQCQFRLHPTTGQLTLAEALDRETREKYVLKVRADDGL---QHTD  1908
                       EL       F+L   +G+L++ + ++   R  Y L V A DG      ++
Sbjct  2185  ----------EL-------FKLDRKSGELSIKQHVEGHNR-NYELTVAAYDGAITPCSSE  2226

Query  1909  IALTIQVTDTNDNAPTFQSTAYSFDVPENVPRGSRIGQVVATDADANGP-NSQLSYTLIS  1967
               L ++V D   + P F+   Y+  V E+V   S     ++   +A  P    L YT+ S
Sbjct  2227  APLQVKVIDR--SMPVFEKQFYTVSVKEDVEMYS----ALSVSIEAESPLGRSLIYTISS  2280

Query  1968  DWANDVFSLNPSTGVFTLTASLDYEQVQHYILVVQATDGGIPALSSTVTVYCNVVDLNDN  2027
             +  +  F ++ +TG   +   LDYE++  + + ++ATD  +  + + V +  +++D+ND 
Sbjct  2281  ESQS--FEIDYNTGSIFVVNELDYEKISSHDVSIRATD-SLSGVYAEVVLSVSIMDVNDC  2337

Query  2028  APIFEAGPHAADIVENTTIGTPILSVAAQDLDSGDNGRVIYAVAG--GDENGDFGV--AP  2083
              P  E+  +   I EN + GT IL + A D DSG N ++ Y +    G  N +       
Sbjct  2338  YPEIESDIYNLTIPENASFGTQILKINATDNDSGANAKLSYYIESINGQNNSELFYIDVT  2397

Query  2084  NGTLFTRKLLDREQKPLYNLILSATDSPLPPALPLSSTVQVTVVLLDVNDMSPEFISPTK  2143
             +G L+ +  LD EQ   ++++++  D   P    LSS   V + + D+ND +P F+ P+ 
Sbjct  2398  DGNLYLKTPLDYEQIKYHHIVVNVKDHGSP---SLSSRSNVFITVKDLNDNAPCFVEPSY  2454

Query  2144  ISIIENAPSNTVVMAI-KAVDRDEGRNGYVEYSL--EDTTLPFTVGPVDGLLRVSGSLDR  2200
              + +  A      +A+ KA D+D      +EY +   +    +++  + G++ +   L+ 
Sbjct  2455  FTKVSVAAVRGQFVALPKAYDKDISDTDSLEYKIVYGNELQTYSIDKLTGVISLQNMLNF  2514

Query  2201  ELRSNYTLEVTAKDRGEPPRSSSTAVTVTVLDENDNSPVFDPRQYSATVAENASIGASVL  2260
               +S+  L ++  D      ++   + +++L EN  SP+FD   Y A V EN   G +++
Sbjct  2515  TDKSSTVLNISVSD---GVHTAYARLKISLLPENVYSPLFDQSTYEAQVPENLLHGHNII  2571

Query  2261  QVSAMDRDEGANGRVRYSIAMGDDNRDFTISEDGGVIRVAKNLNFERKSRYYLTIRGEDC  2320
              V A D D G    + Y I   +  + F I +  GVI      + E+K  Y + ++  D 
Sbjct  2572  TVKASDGDFGTYANLYYEIVSEEMKKIFLIDQTTGVITSKVTFDREKKDEYVVLLKVSDG  2631

Query  2321  ASEVGETPRGDTAQVTITVIDINDNAPVFLDSPYLAHVMENMVPPGGGFVIQVKAYDADT  2380
               + G       A + + V+D+NDN P FL   Y   ++ +        ++ VKA D D 
Sbjct  2632  GGKFG------FASLKVIVVDVNDNVPYFLLKEY--KMVVSTTVEANQTILTVKAKDDDI  2683

Query  2381  PPYNDQVRYFL--KEGD---TDLFRINASTGDIFLLRPLDRELVAEYTLTLVAMDTGSPP  2435
                N  V + +  K  D    D+  IN  TGDI      +   V  Y   + A D G P 
Sbjct  2684  VD-NGSVHFQIVQKSNDKAVKDVIEINEKTGDIVFKSKAESYGVNSYQFFVRASDRGEPQ  2742

Query  2436  LTGSGIVRIVVLDVNDHIPEFTRQEYRATVTENLASGTWVTKPHATDKDEGLNAKIRYSL  2495
                   V I +++ + +IP F +      + E+   GT +TK H        N   ++S+
Sbjct  2743  FHSEVPVSIEIIETDANIPTFEKSSVLLKIIESTPPGTVLTKLHMIG-----NYTFKFSI  2797

Query  2496  LGENSERFTVEPETGEVLTVVPLDREQTAVYHLTLVAQDSSPTEPQASAVNLTIFVKDVN  2555
               +  + F +  ++GE++    LDREQ   ++L +VA+ S+     A A ++ I V+D N
Sbjct  2798  AAD-QDHFMIS-DSGELILQQTLDREQQESHNLIVVAETSTVPVFFAYA-DVLIDVRDEN  2854

Query  2556  DNAPRFSSPRYTAYVPGATKPGDFVFGAKAVDDDDGENSRIVYRLQGIDAEK----FVID  2611
             DN P+F +  Y+A V   ++    +    A D D G N  I Y L+  D E     F ID
Sbjct  2855  DNYPKFDNTFYSASVAENSEKVISLVKVSATDADTGPNGDIRYYLES-DTENIQNIFDID  2913

Query  2612  PNSGVIRTTQELAND-ETTYQLQIQASDCGVKPQTVTADLVIHLWE-RQLFPSFRSTIST  2669
               SG I     L  + ++ Y  ++ A+D G         + I + +     P F+  I  
Sbjct  2914  IYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLPIEG  2973

Query  2670  RFTLPEDVPEGRVITKLSATTPKVGTASNLVYGMAGGNVGDALKIDPHTGEVLVASGFDY  2729
                    +P G V+  L    P +     + + +  G+     +I   +GE+ +A   D 
Sbjct  2974  LSVFENALP-GTVLINLLLIDPDI-EKQEMDFFIVSGDKQAQFQIGK-SGELFIAKPLDR  3030

Query  2730  ETAPFYEAWVEVRDSDTPALRSVVQLLVNVTDANDNAPIMEAAIYNATVPEDEYPPLFVN  2789
             E   FY   +   D    A  +V    ++V D NDN P      Y+ +  E       + 
Sbjct  3031  EQLMFYNLSIIATDGKFTAKANVE---IDVKDINDNTPYCLKPRYHISTNESISIGTTLV  3087

Query  2790  KVSANDRDSGENGQVSYYLVNDFTETFVIDSDTGEISTNAKLDREEIASYELIVEARDQG  2849
             +V A D D     ++ +YL     + F I  ++G +   + LDRE    Y+L+   +D  
Sbjct  3088  EVKAIDFDF--QSKLRFYLSGKGADDFSIGKESGILKVASALDRETTPKYKLVAHVQDGK  3145

Query  2850  QPSLTGTATVLLTVLDKNDNPPQFTRL-FSVNVTENAEIGTFVIRITSSDLDIGQNANVT  2908
               +    + +++TV D NDN P F+   + V+V E+A++ T + ++ + D D G N  + 
Sbjct  3146  DFTQECFSEIIITVNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIK  3205

Query  2909  YRFTENPGEKFAMDALSGNVTVNGHLDREEQDEYLLKLVAADGA---WQAATALTITIQD  2965
             Y       + F +   +G + ++  LDRE    + L + A D       +   + + I D
Sbjct  3206  YSLMGENHDYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILD  3265

Query  2966  QNDNPPEFDEESYHFHFPELQPPVAHVGQVTAIDRDKQGPNSVISYSLLQPSDL--FTVD  3023
              NDNPPEF    Y     E       V +V A   D  G N+ I Y ++  ++   F +D
Sbjct  3266  INDNPPEFSMRQYSCKILENATHGTEVCKVYATSIDI-GVNADIHYFIMSGNEQGKFKMD  3324

Query  3024  PATGDVFSKKTLKYKHTHRPSSPENLYSLTVVATDNGKPPLSSKTVVYVNVVDANNNAPR  3083
               TGD+    TL Y+ +         Y LT+ A D G PPLS+   V ++++D N+N+P 
Sbjct  3325  STTGDLVLNATLDYEMS-------KFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSPT  3377

Query  3084  FDQRSYLYPVPENYGVGKRVVQLMAKDDADFGVNAEISYFMTNVNGSEYFSIDEKSGWVY  3143
             F Q  Y   V E+  VG +++ + A D+ D  VN  ++Y +   +    FSID K+G + 
Sbjct  3378  FLQNLYRINVNEDIFVGSKILDVKATDE-DSDVNGLVTYNIERGDNIGQFSIDPKNGTIS  3436

Query  3144  VRNTLSNVPVRTTFLLKVQAIDKGVPPQKDEVSLTLVISGENKHAPTFAAVSHQVRVPEN  3203
             V   L    + + + L++QA D+G P + + V + + I   N +AP F++ ++ V + EN
Sbjct  3437  VSRPLDRETI-SHYTLEIQACDQGDPQRCNSVPININILDTNDNAPIFSSSNYSVVLQEN  3495

Query  3204  EPVNTTILTVSATDGDDGPNGM-IRYKISAGNEKNEFFVHSITGAVTILEPLDYDLVQEY  3262
               +    LT   +D D+ PN     + I +GNE   F +    G++      +++L  E+
Sbjct  3496  RLLGYVFLTFKISDADETPNTTPYTFDIRSGNEGGLFRLEQ-DGSLRTASRFNHNLQDEF  3554

Query  3263  KLNITATDLGFEPKQAVAILTVNVSDINDNPPTFNQSIYEAYLPENSPPDSFVYKVIARD  3322
              + +   D G  P  + A + V + + +  PP            E+    +F+ KV A D
Sbjct  3555  VIQVRVFDNGTPPLYSDAWVVVKIIEESQYPPIVTPLEVTINSFEDDFSGAFIGKVHASD  3614

Query  3323  IDSPKYAVIQYKILGG-----TGKDHFRIREDTGEIASLISFD  3360
              D  KY  + + ++ G          F I  +TG+I ++ + D
Sbjct  3615  QD--KYDELNFSLVSGPDDMYQSSKLFNISNNTGKIYAISNLD  3655


 Score = 864 bits (2232),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 972/3661 (27%), Positives = 1600/3661 (44%), Gaps = 371/3661 (10%)

Query  110   FVLDPETGKIRTAKVL--------DREALSSDRFDLVVLSSQPTYPIEVRILVLDINDND  161
             F + P TG+I   + L        +   ++ DR   V   +      +V I V  +N   
Sbjct  229   FAIHPTTGEITLLQQLQYAENSHFELTVVAYDRGSWVNHQNHQASKTKVSISVKQVNFYA  288

Query  162   PEFPESSIAVSFSESAVVGTKLL--LDAATDKDTLENGVVDDYFIVNGNTDEKFRLEVTG  219
             PE        +FS        L+  +    DKDT  NG +    IV+GN D  F L+   
Sbjct  289   PEI----FTKTFSSVTPTSNPLIYGIVRVNDKDTGINGNIGRLEIVDGNPDGTFLLKAA-  343

Query  220   NPTGETSYLHLETTGKLDREQVEFYSLNVCARDRGRPPRLGYLLVNVTVLDVNDNPPIFQ  279
               T +  Y+ L     L+++    Y+L + A D G P R  Y  V + +   + N PIF 
Sbjct  344   -ETKDEYYIELNQFAHLNQQHF-IYNLTLLAEDLGTPRRFAYKSVPIQIKPESKNIPIFT  401

Query  280   QSDYVVALNESAPVGTKVLTVHATDKDSEDNSKLTYYLP----DTERQFTIDPETGTITT  335
             Q  Y V++ E+AP+   V+ +  +D D   N+ +  YL     +   +F I+P++G + T
Sbjct  402   QEIYEVSIPETAPINMPVIRLKVSDPDLGKNALV--YLEIVGGNEGDEFRINPDSGMLYT  459

Query  336   VEPLDCPQQSCTIAARLGDGCPKSCVITVFARDHGS--PRQDGRTYVTVNLLDANDHDPE  393
              + LD  ++S             S  +TV A D  +   R+     V +++ D ND+DP 
Sbjct  460   AKQLDAEKKS-------------SYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDP-  505

Query  394   IKFSYFPSTPGFATVDENAAKDSIVAAVAVIDNDEGLNGETTVEIRAGN----ELGHFRL  449
                  F +     +++EN    S V  +   D D G N   +  I   N    E+ HF  
Sbjct  506   ----IFENVNKVISINENNLAGSFVVKLTAKDRDSGENSYISYSIANLNAVPFEIDHFS-  560

Query  450   DNTPSFDIVRVNGRLDREEIPK-YNLTVVATDKGTPPRSATAY-LVIHVNDVNDHEPVFQ  507
                    IV+    LD E + + Y L + A+D G P R  T   L I V D+ND+ P F+
Sbjct  561   ------GIVKTTSLLDFETMKRNYELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQFE  614

Query  508   QSEYSAVLSELSPTGSFVASISATDADSGLNARIYYDFDSGNEQGWFAIDQDTGLVTTVA  567
             +      +++ +P G+ V   SA D D+G    I Y    GNE G F +D  +G ++   
Sbjct  615   RVNCYGKVTKSAPMGTEVFVTSAIDFDAG--DIISYRLSDGNEDGCFNLDPTSGSLSISC  672

Query  568   TLDREVQGSIELHVSA------------------------------------RDGGPNPK  591
              L +    +  L VSA                                    R+ G   +
Sbjct  673   DLKKTTLTNRILKVSATDGTHFSDDLIINVHLMPEDLGGDSSILHGFGSFECRETGVARR  732

Query  592   YASTHLKVTILDEND---EAP-----------RFSQNVVR---------VTLSENTPPQS  628
              A T   +++ ++N+    +P           R+ QNV R         ++++E+     
Sbjct  733   LAET---LSLAEKNNVKSASPSVFSDLSLTPSRYGQNVHRPEFVNFPQELSINESVQLGE  789

Query  629   LVATLTAVDNDQGTNGSVAYSFHSSVSRDYPKTFALDGLTGQLTTKVNLDRETTAEYQIL  688
              VA + A D D G NG + ++       DY   F +D   G+L     LDRE   EY + 
Sbjct  790   TVAWIEAKDRDLGYNGKLVFAISDG---DYDSVFRIDPDRGELQIIGYLDRERQNEYVLN  846

Query  689   VIAKDQGTPPQSSTATVILTLEDVNDNSPVFYPWRYLMPIPEDAPPGTSVGKVTATDADA  748
             +   D G P +S++  + +T+ DVNDN PV         + E A  GT V  + ATDAD+
Sbjct  847   ITVYDLGNPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTESARIGTVVHCLHATDADS  906

Query  749   RENAQVRYSLESGGEGLFTVDERTGEITLQGSLRAAHKTLYELNISAKDTGDRVAGRNAL  808
               NAQV Y+L       FTV+  TG + L   L    +  Y L+I+AKD G  V    AL
Sbjct  907   GINAQVTYALSVECSD-FTVNATTGCLRLNKPLDREKQDNYALHITAKDGGSPVLSSEAL  965

Query  809   VEIIREEDLEHLEFDTYNGYEFRIAED--RGECGAMSNVFARDAGTVQITQYDSSKISYA  866
             V ++ ++  ++        Y F++ ED  RG   A+      D G     Q+   + +  
Sbjct  966   VYVLVDDVNDNAPVFGVQEYIFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLKEET--  1023

Query  867   IVFGDPKGNFKIDESTGTISTSGCLDREQVAYYSLQLSARAG---LAYGQTSVNITVLDI  923
                   +  F+ID+ TG I T G LD E    ++L +SA  G         S+ I ++D+
Sbjct  1024  ----QDEELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDV  1079

Query  924   NDNPPRFPKGEIGDEVL---LKENAAVGQEVCLARARDRD-ASANARIVYSLTHNPG-GQ  978
             N+N  RF   E  D V    +KEN   G  V    ARD D    N++I YS+T   G G 
Sbjct  1080  NEN--RFAP-EFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGDGLGI  1136

Query  979   FRVAENSGIIYLDKPIRAAPGTVLHLEVTATDSGNQPLSAQHQVRVTIEDVNDHTPVFKL  1038
             F V +   I  L + + A       L + A D    PLS   +V + +E+ ND+ P+   
Sbjct  1137  FAVNDQGSITSLSQ-LDAETKNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNIPLTDK  1195

Query  1039  TSYETSLPESTPVNDRFFSLTAIDVDLGANGRVLYSITDGNTEDRFGIFPDGQLYV----  1094
               Y  ++ E++  N    +L A D D+     + Y+I  GN    F I  D +  V    
Sbjct  1196  PVYYVNVTEASVENVEIITLKAFDPDIDPTQTITYNIVSGNLVGYFEI--DSKTGVIKTT  1253

Query  1095  KNVLDREELDYYALEVTATDQGSPSRSSVVPVVVHIIDENDNAPEFTNSSFVLHLRENEP  1154
             +  LDRE    + LEV  +D GSP  SS   +VV ++D NDN+PEF    + + +  +  
Sbjct  1254  ERKLDRENQAEHILEVAISDNGSPVLSSTSRIVVSVLDINDNSPEFDQRVYKVQVPSSAT  1313

Query  1155  PDTFVGKLLATDRDVGRNADLVFSLPASQ--QDFTVDPRNGFIKSLRVFDRELLVTNTGS  1212
              +  + ++ A D D G N  + +S+ + +    F +D + G I   +  D +    N   
Sbjct  1314  VNQSIFQVHAIDSDSGENGRITYSIKSGKGKNKFRIDSQRGHIHIAKPLDSD----NEFE  1369

Query  1213  SYITLEATVTDNGVNRLRDRVKVVIYITDV---NDNIPQFQRLPYR--VQVNEGAAIGTQ  1267
              +I  E    DNG+ +     +V I +  V   + N P   R      V + E    G  
Sbjct  1370  IHIKAE----DNGIPKKSQTARVNIVVVPVNPNSQNAPLIVRKTSENVVDLTENDKPGFL  1425

Query  1268  LLRVYTTDADEGLNGDVFYSLEDGNQHGRFAIDEATGQISLTKELDRETTDAYVLTVVAH  1327
             + ++   D D   N  ++Y++ +GN    F I +  G I L+K LD ET  +Y LT+   
Sbjct  1426  VTQILAVDDD---NDQLWYNISNGNDDNTFYIGQDNGNILLSKYLDYETQQSYNLTISVT  1482

Query  1328  DAGLETRLSSSTTVHIEVLDENDNVPLFVDDKSSISVLETTPTNTELLRFKATDNDLGPN  1387
             D       ++ T + ++V+D NDN P F  D   +++ E     + +++  ATD D   +
Sbjct  1483  DG----TFTAFTNLLVQVIDINDNPPQFAKDVYHVNISENIEEESVIMQLHATDRD--ED  1536

Query  1388  SELAFAISAGNRRDT---FYIDPLTGTLYLRKPLDYEELEKYTLNVTCSDGGHPRLSSVT  1444
              +L + + A     +   F ID ++G + + + LD+E+  ++ L V   D G P   +  
Sbjct  1537  KKLFYHLHATQDPSSLALFRIDSISGNVIVTQRLDFEKTAQHILIVFVKDQGAPGKRNYA  1596

Query  1445  TLIVEVIDANDNPPVFPNTAIARQIREGILVHTPIVTITAEDPDSNENGVVTYSIASQDP  1504
              +IV V D ND+ P F    I  ++ E   + + +  + A D DS  N  + YSI + + 
Sbjct  1597  KIIVNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAIDRDSGHNAEIQYSIITGNV  1656

Query  1505  EDQVRRFGINPSTGVIHTLLPIDREEVDTYKLVVVATDSAQPASARLSAEKLVIVIVEDI  1564
                   F I+P+ G+I     ++  ++  Y L V A D   P    LS++  V +IV   
Sbjct  1657  G---SVFEIDPTFGIITLAGNLNINKIQEYMLQVKAVDLGNPP---LSSQIPVHIIVTMS  1710

Query  1565  NDNAPIFVSMSAVV-----LPLKGNYYQYQKEITVTQLVARDLDSSTNGLVTYELLRSSI  1619
              ++ P F + +  +     LP+ G +        VTQ+ AR   S     + + ++  +I
Sbjct  1711  ENDPPKFPTNNIAIEIFENLPI-GTF--------VTQVTARSSSS-----IFFNIISGNI  1756

Query  1620  NYPDMFRIHRNTGHLTIRLPRSLKSSFERVSKYQVGIRATDEAVQAERRSTETYLTLIVP  1679
             N  + FRI+ +TG + I    +    +E +  + + ++ T+ A ++  ++      +I+ 
Sbjct  1757  N--ESFRINPSTGVIVI----NGNIDYESIKVFNLTVKGTNMAAESSCQN------IIIH  1804

Query  1680  GEDGDDQPIWEHRGQIEGNVYENEPIGTSILRVSARSRRSNIDLEYYVTNVTAGSGGPQ-  1738
               D +D   +  + +  G + E+  IG+ +L+V   S+     L   V +   G  G   
Sbjct  1805  ILDANDNIPYFVQNEYVGALPESAAIGSYVLKVHDSSKDH---LTLQVKDADVGVNGMVE  1861

Query  1739  ---VDRL----FDVDTKTGILSTAAALDRETGIQW-YEVELYAIGVGGTRP---STTSTK  1787
                VD L    F +D+ TG +     LD ET   + ++V +  +G    +P   STT+  
Sbjct  1862  YHIVDDLAKNFFKIDSTTGAIELLRQLDYETNAGYTFDVTVSDMG----KPKLHSTTTAH  1917

Query  1788  VRVTVLDKNDVAPTWGTGTWKFKISEEAPPNTVVTVLKAYDPDTIGTLTYTLVPNHRPDP  1847
             V + V++ ND  P +        +      N  V  + A D D   TL + +V       
Sbjct  1918  VTIRVINVNDCPPVFNERELNVTLFLPTFENVFVRQVSAKDADN-DTLRFDIVDG-----  1971

Query  1848  GPGTALGFYPASQHELQDESQCQFRLHPTTGQLTLA--EALDRETREKYVLKVRADDGLQ  1905
                              + ++C F++   TG +T    E L+ E    Y L VRA DG+ 
Sbjct  1972  -----------------NTNEC-FQIEKYTGIITTRNFEILNNENDRDYALHVRASDGIF  2013

Query  1906  HTDIALTIQVTDTNDNAPTFQSTAYSFDVPENVPRGSRIGQVVATDADANGPNSQLSYTL  1965
                + + I+V    D+   FQ  +Y F   EN  + + IG V   +   N  +  + Y +
Sbjct  2014  SAILIVKIKVLSAIDSNFAFQRESYRFSAFENNTKVATIGLV---NVIGNTLDENVEYRI  2070

Query  1966  ISDWANDVFSLNPSTGVFTLTASL-DYEQVQHYILVVQATDGGIPALSSTV-----TVYC  2019
             ++     +F +  S+G    T  + D E    Y L V+A       ++S V     ++  
Sbjct  2071  LN--PTQLFDIGISSGALKTTGVIFDREVKDLYRLFVEAKSMLYDGMNSNVRRAVTSIDI  2128

Query  2020  NVVDLNDNAPIFEAGPHAADIVENTTIGTPILSVAAQDLDSGDNGRVIYAVAGGDENGDF  2079
             +V+D+NDN P+F   P+ A +  +   GT I+ V A DLDS +NG V Y +  G      
Sbjct  2129  SVLDVNDNCPLFVNMPYYATVSIDDPKGTIIMQVKAIDLDSAENGEVRYELKKG------  2182

Query  2080  GVAPNGTLFTRKLLDREQKPL------------YNLILSATDSPLPPALPLSSTVQVTVV  2127
                 NG LF    LDR+   L            Y L ++A D  + P     + +QV V+
Sbjct  2183  ----NGELFK---LDRKSGELSIKQHVEGHNRNYELTVAAYDGAITPCSS-EAPLQVKVI  2234

Query  2128  LLDVNDMSPEFISPTKISIIENAPSNTVVMAIKAVDRDEGRNGYVEYSLEDTTLPFTVGP  2187
                +     +F +   +S+ E+    + +      +   GR+  + Y++   +  F +  
Sbjct  2235  DRSMPVFEKQFYT---VSVKEDVEMYSALSVSIEAESPLGRS--LIYTISSESQSFEIDY  2289

Query  2188  VDGLLRVSGSLDRELRSNYTLEVTAKDRGEPPRSSSTAVTVTVLDENDNSPVFDPRQYSA  2247
               G + V   LD E  S++ + + A D      +    ++V+++D ND  P  +   Y+ 
Sbjct  2290  NTGSIFVVNELDYEKISSHDVSIRATDSLSGVYAE-VVLSVSIMDVNDCYPEIESDIYNL  2348

Query  2248  TVAENASIGASVLQVSAMDRDEGANGRVRYSIAM--GDDNRD-FTISEDGGVIRVAKNLN  2304
             T+ ENAS G  +L+++A D D GAN ++ Y I    G +N + F I    G + +   L+
Sbjct  2349  TIPENASFGTQILKINATDNDSGANAKLSYYIESINGQNNSELFYIDVTDGNLYLKTPLD  2408

Query  2305  FERKSRYYLTIRGEDCASEVGETPRGDTAQVTITVIDINDNAPVFLDSPYLAHVMENMVP  2364
             +E+   +++ +  +D     G       + V ITV D+NDNAP F++  Y   V  ++  
Sbjct  2409  YEQIKYHHIVVNVKDH----GSPSLSSRSNVFITVKDLNDNAPCFVEPSYFTKV--SVAA  2462

Query  2365  PGGGFVIQVKAYDADTPPYNDQVRYFLKEG-DTDLFRINASTGDIFLLRPLDRELVAEYT  2423
               G FV   KAYD D     D + Y +  G +   + I+  TG I L   L+     + +
Sbjct  2463  VRGQFVALPKAYDKDISD-TDSLEYKIVYGNELQTYSIDKLTGVISLQNMLN---FTDKS  2518

Query  2424  LTLVAMDTGSPPLTGSGIVRIVVLDVNDHIPEFTRQEYRATVTENLASGTWVTKPHATDK  2483
              T++ +       T    ++I +L  N + P F +  Y A V ENL  G  +    A+D 
Sbjct  2519  STVLNISVSDGVHTAYARLKISLLPENVYSPLFDQSTYEAQVPENLLHGHNIITVKASDG  2578

Query  2484  DEGLNAKIRYSLLGENSER-FTVEPETGEVLTVVPLDREQTAVYHLTLVAQDSSPTEPQA  2542
             D G  A + Y ++ E  ++ F ++  TG + + V  DRE+   Y + L   D       A
Sbjct  2579  DFGTYANLYYEIVSEEMKKIFLIDQTTGVITSKVTFDREKKDEYVVLLKVSDGGGKFGFA  2638

Query  2543  SAVNLTIFVKDVNDNAPRFSSPRYTAYVPGATKPGDFVFGAKAVDDDDGENSRIVYRLQG  2602
             S   L + V DVNDN P F    Y   V    +    +   KA DDD  +N  + +++  
Sbjct  2639  S---LKVIVVDVNDNVPYFLLKEYKMVVSTTVEANQTILTVKAKDDDIVDNGSVHFQIVQ  2695

Query  2603  IDAEKFV-----IDPNSG-VIRTTQELANDETTYQLQIQASDCGVKPQTVTADLVIHLWE  2656
                +K V     I+  +G ++  ++  +    +YQ  ++ASD G         + I + E
Sbjct  2696  KSNDKAVKDVIEINEKTGDIVFKSKAESYGVNSYQFFVRASDRGEPQFHSEVPVSIEIIE  2755

Query  2657  RQL-FPSFRSTISTRFTLPEDVPEGRVITKLSATTPKVGTASNLVYGMAGGNVGDALKID  2715
                  P+F  + S    + E  P G V+TKL           N  +  +     D   I 
Sbjct  2756  TDANIPTFEKS-SVLLKIIESTPPGTVLTKLHMI-------GNYTFKFSIAADQDHFMI-  2806

Query  2716  PHTGEVLVASGFDYETAPFYEAWVEVRDSDTPALRSVVQLLVNVTDANDNAPIMEAAIYN  2775
               +GE+++    D E    +   V    S  P   +   +L++V D NDN P  +   Y+
Sbjct  2807  SDSGELILQQTLDREQQESHNLIVVAETSTVPVFFAYADVLIDVRDENDNYPKFDNTFYS  2866

Query  2776  ATVPEDEYPPLFVNKVSANDRDSGENGQVSYYLVND---FTETFVIDSDTGEISTNAKLD  2832
             A+V E+    + + KVSA D D+G NG + YYL +D       F ID  +G I+    LD
Sbjct  2867  ASVAENSEKVISLVKVSATDADTGPNGDIRYYLESDTENIQNIFDIDIYSGWITLLTSLD  2926

Query  2833  REEIASYELIVEARDQGQPSLTGTATVLLTVLDKNDNPPQFTR-LFSVNVTENAEIGTFV  2891
             RE  + Y   V A D G P       V + ++D NDN P F   +  ++V ENA  GT +
Sbjct  2927  REVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLPIEGLSVFENALPGTVL  2986

Query  2892  IRITSSDLDIGQNANVTYRFTENPGEKFAMDALSGNVTVNGHLDREEQDEYLLKLVAADG  2951
             I +   D DI +     +  + +   +F +   SG + +   LDRE+   Y L ++A DG
Sbjct  2987  INLLLIDPDIEKQEMDFFIVSGDKQAQFQI-GKSGELFIAKPLDREQLMFYNLSIIATDG  3045

Query  2952  AWQAATALTITIQDQNDNPPEFDEESYHFHFPELQPPVAHVGQVTAIDRDKQGPNSVISY  3011
              + A   + I ++D NDN P   +  YH    E       + +V AID D Q  + +  Y
Sbjct  3046  KFTAKANVEIDVKDINDNTPYCLKPRYHISTNESISIGTTLVEVKAIDFDFQ--SKLRFY  3103

Query  3012  SLLQPSDLFTVDPATGDVFSKKTLKYKHTHRPSSPENLYSLTVVATDNGKPPLSSKTVVY  3071
                + +D F++   +G +     L      R ++P+  Y L     D         + + 
Sbjct  3104  LSGKGADDFSIGKESGILKVASALD-----RETTPK--YKLVAHVQDGKDFTQECFSEII  3156

Query  3072  VNVVDANNNAPRFDQRSYLYPVPENYGVGKRVVQLMAKDDADFGVNAEISYFMTNVNGSE  3131
             + V D N+N P F    Y   VPE+  +   + ++ A D  DFGVN +I Y +   N  +
Sbjct  3157  ITVNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMD-KDFGVNRQIKYSLMGEN-HD  3214

Query  3132  YFSIDEKSGWVYVRNTLSNVPVRTTFLLKVQAIDKGVPPQKDEVSLTLVISGENKHAPTF  3191
             YF I + +G + +  +L    + + F L V+A D GVP      ++ + I   N + P F
Sbjct  3215  YFKISKSTGIIRLHKSLDRETI-SLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEF  3273

Query  3192  AAVSHQVRVPENEPVNTTILTVSATDGDDGPNGMIRYKISAGNEKNEFFVHSITGAVTIL  3251
             +   +  ++ EN    T +  V AT  D G N  I Y I +GNE+ +F + S TG + + 
Sbjct  3274  SMRQYSCKILENATHGTEVCKVYATSIDIGVNADIHYFIMSGNEQGKFKMDSTTGDLVLN  3333

Query  3252  EPLDYDLVQEYKLNITATDLGFEPKQAVAILTVNVSDINDNPPTFNQSIYEAYLPENSPP  3311
               LDY++ + Y L I A D G  P    A + +++ DINDN PTF Q++Y   + E+   
Sbjct  3334  ATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSPTFLQNLYRINVNEDIFV  3393

Query  3312  DSFVYKVIARDIDSPKYAVIQYKILGGTGKDHFRIREDTGEIASLISFDYEEANEYTLDI  3371
              S +  V A D DS    ++ Y I  G     F I    G I+     D E  + YTL+I
Sbjct  3394  GSKILDVKATDEDSDVNGLVTYNIERGDNIGQFSIDPKNGTISVSRPLDRETISHYTLEI  3453

Query  3372  VAANPDSNPQMVGFTTVLVHITGVNEYYPKFIQPVFHMDVSESAEVGTSVGLVQATDQDA  3431
              A +   +PQ      + ++I   N+  P F    + + + E+  +G      + +D D 
Sbjct  3454  QACD-QGDPQRCNSVPININILDTNDNAPIFSSSNYSVVLQENRLLGYVFLTFKISDADE  3512

Query  3432  GEDGRVYYLFVGSSNDRGFSIGSETGIIRVSRRLDRETQNRVVLTVMTKNGGGIRGNDTD  3491
               +   Y   + S N+ G     + G +R + R +   Q+  V+ V   + G      +D
Sbjct  3513  TPNTTPYTFDIRSGNEGGLFRLEQDGSLRTASRFNHNLQDEFVIQVRVFDNGTPPLY-SD  3571

Query  3492  EAQVIVSIQDGNDPPEFLQSTYDATVS--EGATHGTRVLTVRAVDKDIKPQNNQFSYSII  3549
                V+  I++   PP  + +  + T++  E    G  +  V A D+D   + ++ ++S++
Sbjct  3572  AWVVVKIIEESQYPP--IVTPLEVTINSFEDDFSGAFIGKVHASDQD---KYDELNFSLV  3626

Query  3550  SG-----NLGQAFKVDPQTGDIETAKQLDRETIPIYDLTIGAIDTGSPPQTGTAAIHIEL  3604
             SG        + F +   TG I     LD   I +Y L +   D G         I++EL
Sbjct  3627  SGPDDMYQSSKLFNISNNTGKIYAISNLD---IGLYKLNVSVSD-GKFHVFSIVKINVEL  3682

Query  3605  L  3605
             +
Sbjct  3683  V  3683


 Score = 685 bits (1768),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 813/3144 (26%), Positives = 1374/3144 (44%), Gaps = 324/3144 (10%)

Query  687   ILVIAKDQGTPPQSSTATVILTLEDVNDNSPVFYPWRYLMPIPEDAPPGT-SVGKVTATD  745
             + +I   Q    +  TAT+   LE+   +   F    Y + IPE++   T + G +    
Sbjct  30    LWLIPTVQSKADEKHTATLEYRLENQLQDLYRFSHSVYNVTIPENSLGKTYAKGVLHERL  89

Query  746   ADARE--NAQVRYSLESG-GEGLFTVDE-------------RTGEITL------QGSLRA  783
             A  R   NA+V+Y + SG  E LF  +E             RT  + L      +  +R 
Sbjct  90    AGLRVGLNAEVKYRIISGDKEKLFKAEEKLVGDFAFLAIRTRTNNVVLNREKTEEYVIRV  149

Query  784   -AHKTLYELNISAKDTGDRVAGRNALVEIIREEDLEHLEFDTYNGYEFRIAEDRGECGAM  842
              AH  L++ N+S+ +T       N  ++++   DL  L + T   Y   I ED  +  ++
Sbjct  150   KAHVHLHDRNVSSYETE-----ANIHIKVLDRNDLSPLFYPT--QYTVVIPEDTPKYQSI  202

Query  843   SNVFARDAGTVQITQYDSSKISYAIVFGDPKGNFKIDESTGTISTSGCLDREQVAYYSLQ  902
               V A DA         + +I Y+++       F I  +TG I+    L   + +++ L 
Sbjct  203   LKVTADDADLGI-----NGEIYYSLLMDSEY--FAIHPTTGEITLLQQLQYAENSHFELT  255

Query  903   LSARAGLAY--------GQTSVNITVLDINDNPPRFPKGEIGDEVLLKENAAVGQE----  950
             + A    ++         +T V+I+V  +N   P         E+  K  ++V       
Sbjct  256   VVAYDRGSWVNHQNHQASKTKVSISVKQVNFYAP---------EIFTKTFSSVTPTSNPL  306

Query  951   -VCLARARDRDASANARI--VYSLTHNPGGQF--RVAENSGIIYLDKPIRAAPGT---VL  1002
                + R  D+D   N  I  +  +  NP G F  + AE     Y++    A       + 
Sbjct  307   IYGIVRVNDKDTGINGNIGRLEIVDGNPDGTFLLKAAETKDEYYIELNQFAHLNQQHFIY  366

Query  1003  HLEVTATDSGNQPLSAQHQVRVTIEDVNDHTPVFKLTSYETSLPESTPVNDRFFSLTAID  1062
             +L + A D G     A   V + I+  + + P+F    YE S+PE+ P+N     L   D
Sbjct  367   NLTLLAEDLGTPRRFAYKSVPIQIKPESKNIPIFTQEIYEVSIPETAPINMPVIRLKVSD  426

Query  1063  VDLGANGRVLYSITDGNTEDRFGIFPD-GQLYVKNVLDREELDYYALEVTATDQ---GSP  1118
              DLG N  V   I  GN  D F I PD G LY    LD E+   Y L V+A DQ   GS 
Sbjct  427   PDLGKNALVYLEIVGGNEGDEFRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSR  486

Query  1119  SRSSVVPVVVHIIDENDNAPEFTNSSFVLHLRENEPPDTFVGKLLATDRDVGRNADLVFS  1178
              +SS   V + + D NDN P F N + V+ + EN    +FV KL A DRD G N+ + +S
Sbjct  487   KQSS-AKVKISVQDMNDNDPIFENVNKVISINENNLAGSFVVKLTAKDRDSGENSYISYS  545

Query  1179  LP-ASQQDFTVDPRNGFIKSLRVFDRELLVTNTGSSYITLEATVTDNGV-NRLRDRVKVV  1236
             +   +   F +D  +G +K+  + D E +  N       L    +D G+  R +  +K+ 
Sbjct  546   IANLNAVPFEIDHFSGIVKTTSLLDFETMKRN-----YELIIRASDWGLPYRRQTEIKLS  600

Query  1237  IYITDVNDNIPQFQRLPYRVQVNEGAAIGTQLLRVYTTDADEGLNGDVF-YSLEDGNQHG  1295
             I + D+NDN PQF+R+    +V + A +GT++      D D    GD+  Y L DGN+ G
Sbjct  601   IVVKDINDNRPQFERVNCYGKVTKSAPMGTEVFVTSAIDFDA---GDIISYRLSDGNEDG  657

Query  1296  RFAIDEATGQISLTKELDRETTDAYVLTVVAHDAGLETRLSSSTTVHIEVLDENDNVPLF  1355
              F +D  +G +S++ +L + T    +L V A D    T  S    +++ ++ E       
Sbjct  658   CFNLDPTSGSLSISCDLKKTTLTNRILKVSATDG---THFSDDLIINVHLMPE-------  707

Query  1356  VDDKSSISVLETTPTNTELLRFKATDNDLGPNSELAFAISAGNRRDTFYIDPLTGTLYLR  1415
                                        DLG +S +     +   R+T     L  TL L 
Sbjct  708   ---------------------------DLGGDSSILHGFGSFECRETGVARRLAETLSLA  740

Query  1416  KPLDYEELEKYTLNVTCSDGGHPRLSSVTTLIVEVIDANDNPPVFPNTAIARQIREGILV  1475
             +  + +                P + S  +L       N + P F N      I E + +
Sbjct  741   EKNNVK-------------SASPSVFSDLSLTPSRYGQNVHRPEFVNFPQELSINESVQL  787

Query  1476  HTPIVTITAEDPDSNENGVVTYSIASQDPEDQVRRFGINPSTGVIHTLLPIDREEVDTYK  1535
                +  I A+D D   NG + ++I+  D +   R   I+P  G +  +  +DRE  + Y 
Sbjct  788   GETVAWIEAKDRDLGYNGKLVFAISDGDYDSVFR---IDPDRGELQIIGYLDRERQNEYV  844

Query  1536  LVVVATDSAQPASARLSAEKLVIVIVEDINDNAPIFVSMSAVVLPLKGNYYQYQKEITVT  1595
             L +   D   P     S  K++ + + D+NDN P+     A     +      +    V 
Sbjct  845   LNITVYDLGNPTK---STSKMLPITILDVNDNRPVIQKTLATFRLTES----ARIGTVVH  897

Query  1596  QLVARDLDSSTNGLVTYELLRSSINYPDMFRIHRNTGHLTIRLPRSLKSSFERVSKYQVG  1655
              L A D DS  N  VTY L   S+   D F ++  TG L  RL + L    E+   Y + 
Sbjct  898   CLHATDADSGINAQVTYAL---SVECSD-FTVNATTGCL--RLNKPLDR--EKQDNYALH  949

Query  1656  IRATDEAVQAERRSTETYLTLIVPGEDGDDQPIWEHRGQIEGNVYENEPIGTSILRVSAR  1715
             I A D    +   S+E  L  ++  +  D+ P++  +  I   V E+ P GT +  + A 
Sbjct  950   ITAKDGG--SPVLSSEA-LVYVLVDDVNDNAPVFGVQEYI-FKVREDLPRGTVLAVIEAV  1005

Query  1716  SRR--SNIDLEYYVTNVTAGSGGPQVDRLFDVDTKTGILSTAAALDRETGIQWYEVELYA  1773
                   N ++++ +   T      Q + LF +D  TG + T   LD E   Q + + + A
Sbjct  1006  DEDIGPNAEIQFSLKEET------QDEELFRIDKHTGAIRTQGYLDYENK-QVHNLIVSA  1058

Query  1774  IGVGGTRPSTTSTKVRVTVLDKND--VAPTWGTGTWKFKISEEAPPNTVVTVLKAYDPDT  1831
             I  GG    T+   + + ++D N+   AP +    ++ K+ E  P  T V  + A D DT
Sbjct  1059  ID-GGDPSLTSDMSIVIMIIDVNENRFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDT  1117

Query  1832  I---GTLTYTLVPNHRPDPGPGTALGFYPASQHELQDESQCQFRLHPTTGQLTLAEALDR  1888
             +     +TY++          G  LG +  +                  G +T    LD 
Sbjct  1118  VDLNSKITYSIT--------GGDGLGIFAVNDQ----------------GSITSLSQLDA  1153

Query  1889  ETREKYVLKVRADDGL---QHTDIALTIQVTDTNDNAPTFQSTAYSFDVPENVPRGSRIG  1945
             ET+  Y L + A D         + + IQV + NDN P      Y  +V E       I 
Sbjct  1154  ETKNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNIPLTDKPVYYVNVTEASVENVEII  1213

Query  1946  QVVATDADANGPNSQLSYTLISDWANDVFSLNPSTGVFTLTA-SLDYEQVQHYILVVQAT  2004
              + A D D + P   ++Y ++S      F ++  TGV   T   LD E    +IL V  +
Sbjct  1214  TLKAFDPDID-PTQTITYNIVSGNLVGYFEIDSKTGVIKTTERKLDRENQAEHILEVAIS  1272

Query  2005  DGGIPALSSTVTVYCNVVDLNDNAPIFEAGPHAADIVENTTIGTPILSVAAQDLDSGDNG  2064
             D G P LSST  +  +V+D+NDN+P F+   +   +  + T+   I  V A D DSG+NG
Sbjct  1273  DNGSPVLSSTSRIVVSVLDINDNSPEFDQRVYKVQVPSSATVNQSIFQVHAIDSDSGENG  1332

Query  2065  RVIYAVAGGDENGDFGV-APNGTLFTRKLLDREQKPLYNLILSATDSPLPPALPLSSTVQ  2123
             R+ Y++  G     F + +  G +   K LD + +  + + + A D+ +P     +    
Sbjct  1333  RITYSIKSGKGKNKFRIDSQRGHIHIAKPLDSDNE--FEIHIKAEDNGIPKKSQTARVNI  1390

Query  2124  VTVVLLDVNDMSPEFISPTK---ISIIENAPSNTVVMAIKAVDRDEGRNGY-VEYSLEDT  2179
             V V +   +  +P  +  T    + + EN     +V  I AVD D  +  Y +    +D 
Sbjct  1391  VVVPVNPNSQNAPLIVRKTSENVVDLTENDKPGFLVTQILAVDDDNDQLWYNISNGNDDN  1450

Query  2180  TLPFTVGPVDGLLRVSGSLDRELRSNYTLEVTAKDRGEPPRSSSTAVTVTVLDENDNSPV  2239
             T  F +G  +G + +S  LD E + +Y L ++  D      ++ T + V V+D NDN P 
Sbjct  1451  T--FYIGQDNGNILLSKYLDYETQQSYNLTISVTD---GTFTAFTNLLVQVIDINDNPPQ  1505

Query  2240  FDPRQYSATVAENASIGASVLQVSAMDRDEGANGRVRYSIAMGDDNRD---FTISEDGGV  2296
             F    Y   ++EN    + ++Q+ A DRDE  + ++ Y +    D      F I    G 
Sbjct  1506  FAKDVYHVNISENIEEESVIMQLHATDRDE--DKKLFYHLHATQDPSSLALFRIDSISGN  1563

Query  2297  IRVAKNLNFERKSRYYLTIRGEDCASEVGETPRGDTAQVTITVIDINDNAPVFLDSPYLA  2356
             + V + L+FE+ +++ L +  +D     G   + + A++ + V D ND+ P F      A
Sbjct  1564  VIVTQRLDFEKTAQHILIVFVKD----QGAPGKRNYAKIIVNVHDHNDHHPEF-----TA  1614

Query  2357  HVMENMVPPG---GGFVIQVKAYDADTPPYNDQVRYFLKEGDT-DLFRINASTGDIFLLR  2412
              ++++ VP     G  + +V+A D D+  +N +++Y +  G+   +F I+ + G I L  
Sbjct  1615  KIIQSKVPESAAIGSKLAEVRAIDRDS-GHNAEIQYSIITGNVGSVFEIDPTFGIITLAG  1673

Query  2413  PLDRELVAEYTLTLVAMDTGSPPLTGSGIVRIVVLDVNDHIPEFTRQEYRATVTENLASG  2472
              L+   + EY L + A+D G+PPL+    V I+V    +  P+F        + ENL  G
Sbjct  1674  NLNINKIQEYMLQVKAVDLGNPPLSSQIPVHIIVTMSENDPPKFPTNNIAIEIFENLPIG  1733

Query  2473  TWVTKPHATDKDEGLNAKIRYSLLGEN-SERFTVEPETGEVLTVVPLDREQTAVYHLTLV  2531
             T+VT+  A       ++ I ++++  N +E F + P TG ++    +D E   V++LT+ 
Sbjct  1734  TFVTQVTARS-----SSSIFFNIISGNINESFRINPSTGVIVINGNIDYESIKVFNLTVK  1788

Query  2532  AQDSSPTEPQASAVNLTIFVKDVNDNAPRFSSPRYTAYVPGATKPGDFVFGA--------  2583
               + +    ++S  N+ I + D NDN P F    Y   +P +   G +V           
Sbjct  1789  GTNMA---AESSCQNIIIHILDANDNIPYFVQNEYVGALPESAAIGSYVLKVHDSSKDHL  1845

Query  2584  --KAVDDDDGENSRIVYRLQGIDAEKFV-IDPNSGVIRTTQELANDETT-YQLQIQASDC  2639
               +  D D G N  + Y +    A+ F  ID  +G I   ++L  +    Y   +  SD 
Sbjct  1846  TLQVKDADVGVNGMVEYHIVDDLAKNFFKIDSTTGAIELLRQLDYETNAGYTFDVTVSDM  1905

Query  2640  GVKPQ---TVTADLVIHLWERQLFPSFRSTISTRFTLPEDVPEGRVITKLSATTPKVGTA  2696
             G KP+   T TA + I +      P   +      TL     E   + ++SA   K    
Sbjct  1906  G-KPKLHSTTTAHVTIRVINVNDCPPVFNERELNVTLFLPTFENVFVRQVSA---KDADN  1961

Query  2697  SNLVYGMAGGNVGDALKIDPHTGEVLVASGFD-YETAPFYEAWVEVRDSDTPALRSVVQL  2755
               L + +  GN  +  +I+ +TG ++    F+        +  + VR SD     +++ +
Sbjct  1962  DTLRFDIVDGNTNECFQIEKYTG-IITTRNFEILNNENDRDYALHVRASDG-IFSAILIV  2019

Query  2756  LVNVTDANDNAPIMEAAIYNATVPEDEYPPLFVNKVSANDRDSGENGQVSYYLVNDFTET  2815
              + V  A D+    +   Y  +  E+      +  V+       EN  V Y ++N  T+ 
Sbjct  2020  KIKVLSAIDSNFAFQRESYRFSAFENNTKVATIGLVNVIGNTLDEN--VEYRILNP-TQL  2076

Query  2816  FVIDSDTGEISTNAKL-DREEIASYELIVEARDQGQPSLT-----GTATVLLTVLDKNDN  2869
             F I   +G + T   + DRE    Y L VEA+      +         ++ ++VLD NDN
Sbjct  2077  FDIGISSGALKTTGVIFDREVKDLYRLFVEAKSMLYDGMNSNVRRAVTSIDISVLDVNDN  2136

Query  2870  PPQFTRL-FSVNVTENAEIGTFVIRITSSDLDIGQNANVTYRFTENPGEKFAMDALSGNV  2928
              P F  + +   V+ +   GT ++++ + DLD  +N  V Y   +  GE F +D  SG +
Sbjct  2137  CPLFVNMPYYATVSIDDPKGTIIMQVKAIDLDSAENGEVRYELKKGNGELFKLDRKSGEL  2196

Query  2929  TVNGHLDREEQDEYLLKLVAADGAWQAATA---LTITIQDQNDNPPEFDEESYHFHFPEL  2985
             ++  H++   ++ Y L + A DGA    ++   L + + D+  + P F+++ Y     E 
Sbjct  2197  SIKQHVEGHNRN-YELTVAAYDGAITPCSSEAPLQVKVIDR--SMPVFEKQFYTVSVKED  2253

Query  2986  QPPVAHVGQVTAIDRDKQGPNSVISYSLLQPSDLFTVDPATGDVFSKKTLKYKHTHRPSS  3045
                 + +    +I+ +     S+I Y++   S  F +D  TG +F    L Y+   + SS
Sbjct  2254  VEMYSALS--VSIEAESPLGRSLI-YTISSESQSFEIDYNTGSIFVVNELDYE---KISS  2307

Query  3046  PENLYSLTVVATDNGKPPLSSKTVVYVNVVDANNNAPRFDQRSYLYPVPENYGVGKRVVQ  3105
                 + +++ ATD+    + ++ V+ V+++D N+  P  +   Y   +PEN   G ++++
Sbjct  2308  ----HDVSIRATDS-LSGVYAEVVLSVSIMDVNDCYPEIESDIYNLTIPENASFGTQILK  2362

Query  3106  LMAKDDADFGVNAEISYFMTNVNG---SEYFSIDEKSGWVYVRNTLSNVPVRTTFLLKVQ  3162
             + A D+ D G NA++SY++ ++NG   SE F ID   G +Y++  L    ++   ++ V 
Sbjct  2363  INATDN-DSGANAKLSYYIESINGQNNSELFYIDVTDGNLYLKTPLDYEQIKYHHIV-VN  2420

Query  3163  AIDKGVPPQKDEVSLTLVISGENKHAPTFAAVSHQVRVPENEPVNTTILTVSATDGDDGP  3222
               D G P      ++ + +   N +AP F   S+  +V         +    A D D   
Sbjct  2421  VKDHGSPSLSSRSNVFITVKDLNDNAPCFVEPSYFTKVSVAAVRGQFVALPKAYDKDISD  2480

Query  3223  NGMIRYKISAGNEKNEFFVHSITGAVTILEPLDYDLVQEYKLNITATDLGFEPKQAVAIL  3282
                + YKI  GNE   + +  +TG +++   L++       LNI+ +D       A A L
Sbjct  2481  TDSLEYKIVYGNELQTYSIDKLTGVISLQNMLNFTDKSSTVLNISVSD---GVHTAYARL  2537

Query  3283  TVNVSDINDNPPTFNQSIYEAYLPENSPPDSFVYKVIARDIDSPKYAVIQYKILGGTGKD  3342
              +++   N   P F+QS YEA +PEN      +  V A D D   YA + Y+I+    K 
Sbjct  2538  KISLLPENVYSPLFDQSTYEAQVPENLLHGHNIITVKASDGDFGTYANLYYEIVSEEMKK  2597

Query  3343  HFRIREDTGEIASLISFDYEEANEYTLDIVAANPDSNPQMVGFTTVLVHITGVNEYYPKF  3402
              F I + TG I S ++FD E+ +EY   +V           GF ++ V +  VN+  P F
Sbjct  2598  IFLIDQTTGVITSKVTFDREKKDEY---VVLLKVSDGGGKFGFASLKVIVVDVNDNVPYF  2654

Query  3403  IQPVFHMDVSESAEVGTSVGLVQATDQDAGEDGRVYYLFVGSSNDRG----FSIGSETGI  3458
             +   + M VS + E   ++  V+A D D  ++G V++  V  SND+       I  +TG 
Sbjct  2655  LLKEYKMVVSTTVEANQTILTVKAKDDDIVDNGSVHFQIVQKSNDKAVKDVIEINEKTGD  2714

Query  3459  IRVSRRLDRETQNRVVLTVMTKNGGGIRGNDTDEAQVIVSIQ----DGNDPPEFLQSTYD  3514
             I    + +    N     V   +    RG     ++V VSI+    D N  P F +S+  
Sbjct  2715  IVFKSKAESYGVNSYQFFVRASD----RGEPQFHSEVPVSIEIIETDAN-IPTFEKSSVL  2769

Query  3515  ATVSEGATHGTRVLTVRAVDKDIKPQNNQFSYSIISGNLGQAFKVDPQTGDIETAKQLDR  3574
               + E    GT +  +  +       N  F +SI +    Q   +   +G++   + LDR
Sbjct  2770  LKIIESTPPGTVLTKLHMIG------NYTFKFSIAA---DQDHFMISDSGELILQQTLDR  2820

Query  3575  ETIPIYDLTIGAIDTGSPPQTGTAAIHIELLDINDNGPTFDPPEVVGYVNENEPAGTIVM  3634
             E    ++L + A  +  P     A + I++ D NDN P FD       V EN      ++
Sbjct  2821  EQQESHNLIVVAETSTVPVFFAYADVLIDVRDENDNYPKFDNTFYSASVAENSEKVISLV  2880

Query  3635  TLSATDPDLPPNGAPFTYKLVGGRQS--DMVTLDKHTGVLKTTRSLDREAMPQLDLVVEV  3692
              +SATD D  PNG    Y L    ++  ++  +D ++G +    SLDRE   + +  V  
Sbjct  2881  KVSATDADTGPNG-DIRYYLESDTENIQNIFDIDIYSGWITLLTSLDREVQSEYNFKVIA  2939

Query  3693  EDSGVPRMRSEHTITVIVTDQNDS  3716
              D+G P+  ++  +T+ + D ND+
Sbjct  2940  ADNGHPKHDAKVPVTIKIVDYNDN  2963


 Score = 664 bits (1714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 771/2958 (26%), Positives = 1290/2958 (44%), Gaps = 282/2958 (10%)

Query  100   TYRFNEPPQEFVLDPETGKIRTAKVLDREALSSDRFDLVVLSSQPTYPI-----EVRILV  154
             TY  +    +F ++  TG +R  K LDRE    D + L + +     P+      V +LV
Sbjct  913   TYALSVECSDFTVNATTGCLRLNKPLDRE--KQDNYALHITAKDGGSPVLSSEALVYVLV  970

Query  155   LDINDNDPEFPESSIAVSFSESAVVGTKLLLDAATDKDTLENGVVDDYFIVNGNTDEKFR  214
              D+NDN P F          E    GT L +  A D+D   N  +          +E FR
Sbjct  971   DDVNDNAPVFGVQEYIFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLKEETQDEELFR  1030

Query  215   LEVTGNPTGETSYLHLETTGKLDREQVEFYSLNVCARDRGRPPRLGYLLVNVTVLDVNDN  274
             ++     TG      + T G LD E  + ++L V A D G P     + + + ++DVN+N
Sbjct  1031  ID---KHTGA-----IRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNEN  1082

Query  275   --PPIFQQSDYVVALNESAPVGTKVLTVHATDKDSED-NSKLTYYLP--DTERQFTIDPE  329
                P F    Y   + E+ P GT V+ V A D D+ D NSK+TY +   D    F ++ +
Sbjct  1083  RFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGDGLGIFAVNDQ  1142

Query  330   TGTITTVEPLDCPQQSCTIAARLGDGCPKSCVITVFARDHGSPRQDGRTYVTVNLLDAND  389
              G+IT++  LD   ++          C + C I   +             V + + + ND
Sbjct  1143  -GSITSLSQLDAETKNFYWLTL----CAQDCAIVPLS---------NCVEVYIQVENEND  1188

Query  390   HDPEIKFSYFPSTPGFATVDENAAKDSIVAAVAVIDNDEGLNGETTVEIRAGNELGHFRL  449
             + P      +     +  V E + ++  +  +   D D       T  I +GN +G+F +
Sbjct  1189  NIPLTDKPVY-----YVNVTEASVENVEIITLKAFDPDIDPTQTITYNIVSGNLVGYFEI  1243

Query  450   DNTPSFDIVRVNGRLDREEIPKYNLTVVATDKGTPPRSATAYLVIHVNDVNDHEPVFQQS  509
             D+     I     +LDRE   ++ L V  +D G+P  S+T+ +V+ V D+ND+ P F Q 
Sbjct  1244  DSKTGV-IKTTERKLDRENQAEHILEVAISDNGSPVLSSTSRIVVSVLDINDNSPEFDQR  1302

Query  510   EYSAVLSELSPTGSFVASISATDADSGLNARIYYDFDSGNEQGWFAIDQDTGLVTTVATL  569
              Y   +   +     +  + A D+DSG N RI Y   SG  +  F ID   G +     L
Sbjct  1303  VYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYSIKSGKGKNKFRIDSQRGHIHIAKPL  1362

Query  570   DREVQGSIELHVSARDGGPNPKYAST----HLKVTILDENDEAP----RFSQNVVRVTLS  621
             D +     E+H+ A D G  PK + T     + V +   +  AP    + S+NV  V L+
Sbjct  1363  DSD--NEFEIHIKAEDNGI-PKKSQTARVNIVVVPVNPNSQNAPLIVRKTSENV--VDLT  1417

Query  622   ENTPPQSLVATLTAVDNDQGTNGSVAYSFHSSVSRDYPKTFALDGLTGQLTTKVNLDRET  681
             EN  P  LV  + AVD+D   N  + Y+  +    +   TF +    G +     LD ET
Sbjct  1418  ENDKPGFLVTQILAVDDD---NDQLWYNISNG---NDDNTFYIGQDNGNILLSKYLDYET  1471

Query  682   TAEYQILVIAKDQGTPPQSSTATVILTLEDVNDNSPVFYPWRYLMPIPEDAPPGTSVGKV  741
                Y  L I+   GT   ++   +++ + D+NDN P F    Y + I E+    + + ++
Sbjct  1472  QQSYN-LTISVTDGT--FTAFTNLLVQVIDINDNPPQFAKDVYHVNISENIEEESVIMQL  1528

Query  742   TATDADARENAQVRYSLESGGE----GLFTVDERTGEITLQGSLRAAHKTLYELNISAKD  797
              ATD D  E+ ++ Y L +  +     LF +D  +G + +   L       + L +  KD
Sbjct  1529  HATDRD--EDKKLFYHLHATQDPSSLALFRIDSISGNVIVTQRLDFEKTAQHILIVFVKD  1586

Query  798   TGDRVAGRNALVEII---REEDLEHLEFDTYNGYEFRIAEDRGECGAMSNVFA--RDAGT  852
              G    G+    +II    + +  H EF T    + ++ E       ++ V A  RD+G 
Sbjct  1587  QG--APGKRNYAKIIVNVHDHNDHHPEF-TAKIIQSKVPESAAIGSKLAEVRAIDRDSG-  1642

Query  853   VQITQYDSSKISYAIVFGDPKGNFKIDESTGTISTSGCLDREQVAYYSLQLSARAGLA--  910
                    +++I Y+I+ G+    F+ID + G I+ +G L+  ++  Y LQ+ A   L   
Sbjct  1643  ------HNAEIQYSIITGNVGSVFEIDPTFGIITLAGNLNINKIQEYMLQVKA-VDLGNP  1695

Query  911   --YGQTSVNITVLDINDNPPRFPKGEIGDEVLLKENAAVGQEVCLARARDRDASANARIV  968
                 Q  V+I V    ++PP+FP   I  E+   EN  +G  V    AR    S+++   
Sbjct  1696  PLSSQIPVHIIVTMSENDPPKFPTNNIAIEIF--ENLPIGTFVTQVTAR----SSSSIFF  1749

Query  969   YSLTHNPGGQFRVAENSGIIYLDKPIRAAPGTVLHLEVTATDSGNQPLSAQHQVRVTIED  1028
               ++ N    FR+  ++G+I ++  I      V +L V  T+   +  S+   + + I D
Sbjct  1750  NIISGNINESFRINPSTGVIVINGNIDYESIKVFNLTVKGTNMAAE--SSCQNIIIHILD  1807

Query  1029  VNDHTPVFKLTSYETSLPESTPV----------NDRFFSLTAIDVDLGANGRVLYSITDG  1078
              ND+ P F    Y  +LPES  +          +    +L   D D+G NG V Y I D 
Sbjct  1808  ANDNIPYFVQNEYVGALPESAAIGSYVLKVHDSSKDHLTLQVKDADVGVNGMVEYHIVDD  1867

Query  1079  NTEDRFGI-FPDGQLYVKNVLDREELDYYALEVTATDQGSPSRSSVVP--VVVHIIDEND  1135
               ++ F I    G + +   LD E    Y  +VT +D G P   S     V + +I+ ND
Sbjct  1868  LAKNFFKIDSTTGAIELLRQLDYETNAGYTFDVTVSDMGKPKLHSTTTAHVTIRVINVND  1927

Query  1136  NAPEFTNSSFVLHLRENEPPDTFVGKLLATDRDVGRNADLVFSLP--ASQQDFTVDPRNG  1193
               P F      + L      + FV ++ A D D   N  L F +    + + F ++   G
Sbjct  1928  CPPVFNERELNVTLFLPTFENVFVRQVSAKDAD---NDTLRFDIVDGNTNECFQIEKYTG  1984

Query  1194  FIKSLRVFDRELLVTNTGSSYITLEATVTDNGVNRLRDRVKVVIYITDVNDNIPQFQRLP  1253
              I + R F+   ++ N       L    +D G+      VK+ + ++ ++ N   FQR  
Sbjct  1985  IITT-RNFE---ILNNENDRDYALHVRASD-GIFSAILIVKIKV-LSAIDSNFA-FQRES  2037

Query  1254  YRVQVNEG----AAIGTQLLRVYTTDADEGLNGDVFYSLEDGNQHGRFAIDEATGQISLT  1309
             YR    E     A IG  L+ V     DE +   +       N    F I  ++G +  T
Sbjct  2038  YRFSAFENNTKVATIG--LVNVIGNTLDENVEYRIL------NPTQLFDIGISSGALKTT  2089

Query  1310  KEL-DRETTDAYVLTVVAHDA---GLETRLSSS-TTVHIEVLDENDNVPLFVDDKSSISV  1364
               + DRE  D Y L V A      G+ + +  + T++ I VLD NDN PLFV+     +V
Sbjct  2090  GVIFDREVKDLYRLFVEAKSMLYDGMNSNVRRAVTSIDISVLDVNDNCPLFVNMPYYATV  2149

Query  1365  LETTPTNTELLRFKATDNDLGPNSELAFAISAGNRRDTFYIDPLTGTLYLRKPLDYEELE  1424
                 P  T +++ KA D D   N E+ + +  GN  + F +D  +G L +++ ++     
Sbjct  2150  SIDDPKGTIIMQVKAIDLDSAENGEVRYELKKGN-GELFKLDRKSGELSIKQHVEGHN-R  2207

Query  1425  KYTLNVTCSDGGHPRLSSVTTLIVEVIDANDNPPVFPNTAIARQIREGILVHTPI-VTIT  1483
              Y L V   DG     SS   L V+VID   + PVF        ++E + +++ + V+I 
Sbjct  2208  NYELTVAAYDGAITPCSSEAPLQVKVIDR--SMPVFEKQFYTVSVKEDVEMYSALSVSIE  2265

Query  1484  AEDPDSNENGVVTYSIASQDPEDQVRRFGINPSTGVIHTLLPIDREEVDTYKLVVVATDS  1543
             AE P       + Y+I+S+      + F I+ +TG I  +  +D E++ ++ + + ATDS
Sbjct  2266  AESPLGRS---LIYTISSES-----QSFEIDYNTGSIFVVNELDYEKISSHDVSIRATDS  2317

Query  1544  AQPASARLSAEKLVIVIVEDINDNAP-IFVSMSAVVLPLKGNYYQYQKEITVTQLVARDL  1602
                  + + AE ++ V + D+ND  P I   +  + +P   ++        + ++ A D 
Sbjct  2318  L----SGVYAEVVLSVSIMDVNDCYPEIESDIYNLTIPENASF-----GTQILKINATDN  2368

Query  1603  DSSTNGLVTYELLRSSI---NYPDMFRIHRNTGHLTIRLPRSLKSSFERVSKYQVGIRAT  1659
             DS  N  ++Y +   SI   N  ++F I    G+L ++ P      +E++  + + +   
Sbjct  2369  DSGANAKLSYYI--ESINGQNNSELFYIDVTDGNLYLKTPL----DYEQIKYHHIVVNVK  2422

Query  1660  DEAVQAERRSTETYLTLIVPGEDGDDQPIWEHRGQIEGNVYENEPIGTSILRVSARSRRS  1719
             D    +    +  ++T+    +  D+ P +     +E + +    +     +  A  +  
Sbjct  2423  DHGSPSLSSRSNVFITV---KDLNDNAPCF-----VEPSYFTKVSVAAVRGQFVALPKAY  2474

Query  1720  NID------LEYYVTNVTAGSGGPQVDRLFDVDTKTGILSTAAAL---DRETGIQWYEVE  1770
             + D      LEY +        G ++ + + +D  TG++S    L   D+ + +    V 
Sbjct  2475  DKDISDTDSLEYKIVY------GNEL-QTYSIDKLTGVISLQNMLNFTDKSSTVLNISV-  2526

Query  1771  LYAIGVGGTRPSTTSTKVRVTVLDKNDVAPTWGTGTWKFKISEEAPPNTVVTVLKAYDPD  1830
               + GV      T   ++++++L +N  +P +   T++ ++ E       +  +KA D D
Sbjct  2527  --SDGV-----HTAYARLKISLLPENVYSPLFDQSTYEAQVPENLLHGHNIITVKASDGD  2579

Query  1831  --TIGTLTYTLVPNHRPDPGPGTALGFYPASQHELQDESQCQFRLHPTTGQLTLAEALDR  1888
               T   L Y +V                        +E +  F +  TTG +T     DR
Sbjct  2580  FGTYANLYYEIV-----------------------SEEMKKIFLIDQTTGVITSKVTFDR  2616

Query  1889  ETREKYVLKVRADDGLQHTDIA-LTIQVTDTNDNAPTFQSTAYSFDVPENVPRGSRIGQV  1947
             E +++YV+ ++  DG      A L + V D NDN P F    Y   V   V     I  V
Sbjct  2617  EKKDEYVVLLKVSDGGGKFGFASLKVIVVDVNDNVPYFLLKEYKMVVSTTVEANQTILTV  2676

Query  1948  VATDADANGPNSQLSYTLI---SDWA-NDVFSLNPSTGVFTLTASLDYEQVQHYILVVQA  2003
              A D D    N  + + ++   +D A  DV  +N  TG     +  +   V  Y   V+A
Sbjct  2677  KAKDDDI-VDNGSVHFQIVQKSNDKAVKDVIEINEKTGDIVFKSKAESYGVNSYQFFVRA  2735

Query  2004  TDGGIPALSSTVTVYCNVVDLNDNAPIFEAGPHAADIVENTTIGTPILSVAAQDLDSGDN  2063
             +D G P   S V V   +++ + N P FE       I+E+T  GT +  +          
Sbjct  2736  SDRGEPQFHSEVPVSIEIIETDANIPTFEKSSVLLKIIESTPPGTVLTKLHMI-------  2788

Query  2064  GRVIYAVAGGDENGDFGVAPNGTLFTRKLLDREQKPLYNLILSATDSPLPPALPLSSTVQ  2123
             G   +  +   +   F ++ +G L  ++ LDREQ+  +NLI+ A  S +P     +    
Sbjct  2789  GNYTFKFSIAADQDHFMISDSGELILQQTLDREQQESHNLIVVAETSTVPVFFAYA---D  2845

Query  2124  VTVVLLDVNDMSPEFISP-TKISIIENAPSNTVVMAIKAVDRDEGRNGYVEYSLEDTTLP  2182
             V + + D ND  P+F +     S+ EN+     ++ + A D D G NG + Y LE  T  
Sbjct  2846  VLIDVRDENDNYPKFDNTFYSASVAENSEKVISLVKVSATDADTGPNGDIRYYLESDTEN  2905

Query  2183  ----FTVGPVDGLLRVSGSLDRELRSNYTLEVTAKDRGEPPRSSSTAVTVTVLDENDNSP  2238
                 F +    G + +  SLDRE++S Y  +V A D G P   +   VT+ ++D NDN+P
Sbjct  2906  IQNIFDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAP  2965

Query  2239  VFDPRQYSATVAENASIGASVLQVSAMDRDEGANGRVRYSIAMGDDNRDFTISEDGGVIR  2298
             VF       +V ENA  G  ++ +  +D D      + + I  GD    F I + G +  
Sbjct  2966  VFKLPIEGLSVFENALPGTVLINLLLIDPD-IEKQEMDFFIVSGDKQAQFQIGKSGELF-  3023

Query  2299  VAKNLNFERKSRYYLTIRGEDCASEVGETPRGDTAQVTITVIDINDNAPVFLDSPYLAHV  2358
             +AK L+ E+   Y L+I   D             A V I V DINDN P  L   Y  H+
Sbjct  3024  IAKPLDREQLMFYNLSIIATDGKFTA-------KANVEIDVKDINDNTPYCLKPRY--HI  3074

Query  2359  MENMVPPGGGFVIQVKAYDADTPPYNDQVRYFLKEGDTDLFRINASTGDIFLLRPLDREL  2418
               N     G  +++VKA D D   +  ++R++L     D F I   +G + +   LDRE 
Sbjct  3075  STNESISIGTTLVEVKAIDFD---FQSKLRFYLSGKGADDFSIGKESGILKVASALDRET  3131

Query  2419  VAEYTLTLVAMDTGSPPLTGSGIVRIVVLDVNDHIPEFTRQEYRATVTENLASGTWVTKP  2478
               +Y L     D           + I V D+ND++P F+  +YR +V E+    T +TK 
Sbjct  3132  TPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIFSMAQYRVSVPEDAQLNTLITKV  3191

Query  2479  HATDKDEGLNAKIRYSLLGENSERFTVEPETGEVLTVVPLDREQTAVYHLTLVAQDSSPT  2538
             HA DKD G+N +I+YSL+GEN + F +   TG +     LDRE  ++++LT+ A+D    
Sbjct  3192  HAMDKDFGVNRQIKYSLMGENHDYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVP  3251

Query  2539  EPQASAVNLTIFVKDVNDNAPRFSSPRYTAYVPGATKPGDFVFGAKAVDDDDGENSRIVY  2598
             +  + A  + + + D+NDN P FS  +Y+  +      G  V    A   D G N+ I Y
Sbjct  3252  KLHSIAT-VAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSIDIGVNADIHY  3310

Query  2599  R-LQGIDAEKFVIDPNSGVIRTTQELANDETT-YQLQIQASDCGVKPQTVTADLVIHLWE  2656
               + G +  KF +D  +G +     L  + +  Y L IQA D G  P +  A + I + +
Sbjct  3311  FIMSGNEQGKFKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILD  3370

Query  2657  -RQLFPSFRSTISTRFTLPEDVPEGRVITKLSATTPKVGTASNLVYGMAGGNVGDALKID  2715
                  P+F   +  R  + ED+  G  I  + AT         + Y +  G+      ID
Sbjct  3371  INDNSPTFLQNL-YRINVNEDIFVGSKILDVKATDEDSDVNGLVTYNIERGDNIGQFSID  3429

Query  2716  PHTGEVLVASGFDYETAPFYEAWVEVRDSDTPALRSVVQLLVNVTDANDNAPIMEAAIYN  2775
             P  G + V+   D ET   Y   ++  D   P   + V + +N+ D NDNAPI  ++ Y+
Sbjct  3430  PKNGTISVSRPLDRETISHYTLEIQACDQGDPQRCNSVPININILDTNDNAPIFSSSNYS  3489

Query  2776  ATVPEDEYPPLFVNKVSANDRDSGENGQVSYYLVNDFTE--TFVIDSDTGEISTNAKLDR  2833
               + E+            +D D   N     + +    E   F ++ D G + T ++ + 
Sbjct  3490  VVLQENRLLGYVFLTFKISDADETPNTTPYTFDIRSGNEGGLFRLEQD-GSLRTASRFNH  3548

Query  2834  EEIASYELIVEARDQGQPSLTGTATVLLTVLDKNDNPPQFTRL-FSVNVTENAEIGTFVI  2892
                  + + V   D G P L   A V++ +++++  PP  T L  ++N  E+   G F+ 
Sbjct  3549  NLQDEFVIQVRVFDNGTPPLYSDAWVVVKIIEESQYPPIVTPLEVTINSFEDDFSGAFIG  3608

Query  2893  RITSSDLDIGQNANVTYRFTENPGEKFAMDAL------SGNVTVNGHLDREEQDEYLLKL  2946
             ++ +SD D     N  +     P + +    L      +G +    +LD      Y L +
Sbjct  3609  KVHASDQDKYDELN--FSLVSGPDDMYQSSKLFNISNNTGKIYAISNLDI---GLYKLNV  3663

Query  2947  VAADGAWQAATALTITIQ  2964
               +DG +   + + I ++
Sbjct  3664  SVSDGKFHVFSIVKINVE  3681


 Score = 625 bits (1612),  Expect = 7e-179, Method: Compositional matrix adjust.
 Identities = 727/2692 (27%), Positives = 1175/2692 (44%), Gaps = 291/2692 (11%)

Query  1279  GLNGDVFYSLEDGNQHGRFAIDEA-TGQISLTK--------ELDRETTDAYVLTVVAHDA  1329
             GLN +V Y +  G++   F  +E   G  +            L+RE T+ YV+ V AH  
Sbjct  95    GLNAEVKYRIISGDKEKLFKAEEKLVGDFAFLAIRTRTNNVVLNREKTEEYVIRVKAHVH  154

Query  1330  GLETRLSSSTT---VHIEVLDENDNVPLFVDDKSSISVLETTPTNTELLRFKATDNDLGP  1386
               +  +SS  T   +HI+VLD ND  PLF   + ++ + E TP    +L+  A D DLG 
Sbjct  155   LHDRNVSSYETEANIHIKVLDRNDLSPLFYPTQYTVVIPEDTPKYQSILKVTADDADLGI  214

Query  1387  NSELAFAISAGNRRDTFYIDPLTGTLYLRKPLDYEELEKYTLNVTCSDGG-----HPRLS  1441
             N E+ +++   +  + F I P TG + L + L Y E   + L V   D G         +
Sbjct  215   NGEIYYSLLMDS--EYFAIHPTTGEITLLQQLQYAENSHFELTVVAYDRGSWVNHQNHQA  272

Query  1442  SVTTLIVEVIDAN-DNPPVFPNTAIARQIREGILVHTPIVTITAEDPDSNENGVV-----  1495
             S T + + V   N   P +F  T  +       L++     +   D D+  NG +     
Sbjct  273   SKTKVSISVKQVNFYAPEIFTKTFSSVTPTSNPLIYG---IVRVNDKDTGINGNIGRLEI  329

Query  1496  -------TYSIASQDPEDQVRRFGINPSTGVIHTLLPIDREEVDTYKLVVVATDSAQPAS  1548
                    T+ + + + +D+   + I      ++    ++++    Y L ++A D   P  
Sbjct  330   VDGNPDGTFLLKAAETKDE---YYIE-----LNQFAHLNQQHF-IYNLTLLAEDLGTP--  378

Query  1549  ARLSAEKLVIVIVEDINDNAPIFVS-MSAVVLPLKGNYYQYQKEITVTQLVARDLDSSTN  1607
              R  A K V + ++  + N PIF   +  V +P           + V +L   D D   N
Sbjct  379   -RRFAYKSVPIQIKPESKNIPIFTQEIYEVSIPETA-----PINMPVIRLKVSDPDLGKN  432

Query  1608  GLVTYELLRSSINYPDMFRIHRNTGHLTIRLPRSLKSSFERVSKYQVGIRATDEAVQAER  1667
              LV  E++    N  D FRI+ ++G L     + L +  E+ S Y + + A D+A    R
Sbjct  433   ALVYLEIVGG--NEGDEFRINPDSGML--YTAKQLDA--EKKSSYTLTVSAIDQANVGSR  486

Query  1668  RSTETYLTLIVPGEDGDDQPIWEHRGQIEGNVYENEPIGTSILRVSARSRRS--NIDLEY  1725
             + +   + + V  +  D+ PI+E+  ++  ++ EN   G+ +++++A+ R S  N  + Y
Sbjct  487   KQSSAKVKISVQ-DMNDNDPIFENVNKV-ISINENNLAGSFVVKLTAKDRDSGENSYISY  544

Query  1726  YVTNVTAGSGGPQVDRLFDVDTKTGILSTAAALDRETGIQWYEVELYAIGVGGTRPSTTS  1785
              + N+ A          F++D  +GI+ T + LD ET  + YE+ + A   G      T 
Sbjct  545   SIANLNAVP--------FEIDHFSGIVKTTSLLDFETMKRNYELIIRASDWGLPYRRQTE  596

Query  1786  TKVRVTVLDKNDVAPTWGTGTWKFKISEEAPPNTVVTVLKAYDPDTIGTLTYTLVPNHRP  1845
              K+ + V D ND  P +       K+++ AP  T V V  A D D    ++Y L      
Sbjct  597   IKLSIVVKDINDNRPQFERVNCYGKVTKSAPMGTEVFVTSAIDFDAGDIISYRLSDG---  653

Query  1846  DPGPGTALGFYPASQHELQDESQCQFRLHPTTGQLTLAEALDRETREKYVLKVRADDGLQ  1905
                                +E  C F L PT+G L+++  L + T    +LKV A DG  
Sbjct  654   -------------------NEDGC-FNLDPTSGSLSISCDLKKTTLTNRILKVSATDGTH  693

Query  1906  HTDIALTIQVTDTNDNAPTFQSTAYSFDVPENVPRGSRIGQVVAT-DADANGPNSQLSYT  1964
              +D  L I V                  +PE++   S I     + +    G   +L+ T
Sbjct  694   FSD-DLIINV----------------HLMPEDLGGDSSILHGFGSFECRETGVARRLAET  736

Query  1965  LISDWANDVFSLNPSTGVFTLTASLDYEQVQHYILVVQATDGGIPALSSTVTVYCNVVDL  2024
             L     N+V S +PS  VF+                          LS T + Y      
Sbjct  737   LSLAEKNNVKSASPS--VFS-------------------------DLSLTPSRYGQ----  765

Query  2025  NDNAPIFEAGPHAADIVENTTIGTPILSVAAQDLDSGDNGRVIYAVAGGDENGDFGVAPN  2084
             N + P F   P    I E+  +G  +  + A+D D G NG++++A++ GD +  F + P+
Sbjct  766   NVHRPEFVNFPQELSINESVQLGETVAWIEAKDRDLGYNGKLVFAISDGDYDSVFRIDPD  825

Query  2085  -GTLFTRKLLDREQKPLYNLILSATDSPLPPALPLSSTVQVTVVLLDVNDMSPEFISPT-  2142
              G L     LDRE++  Y L ++  D   P     S++  + + +LDVND  P  I  T 
Sbjct  826   RGELQIIGYLDRERQNEYVLNITVYDLGNPTK---STSKMLPITILDVNDNRP-VIQKTL  881

Query  2143  -KISIIENAPSNTVVMAIKAVDRDEGRNGYVEYSLEDTTLPFTVGPVDGLLRVSGSLDRE  2201
                 + E+A   TVV  + A D D G N  V Y+L      FTV    G LR++  LDRE
Sbjct  882   ATFRLTESARIGTVVHCLHATDADSGINAQVTYALSVECSDFTVNATTGCLRLNKPLDRE  941

Query  2202  LRSNYTLEVTAKDRGEPPRSSSTAVTVTVLDENDNSPVFDPRQYSATVAENASIGASVLQ  2261
              + NY L +TAKD G P  SS   V V V D NDN+PVF  ++Y   V E+   G  +  
Sbjct  942   KQDNYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQEYIFKVREDLPRGTVLAV  1001

Query  2262  VSAMDRDEGANGRVRYSIA-MGDDNRDFTISEDGGVIRVAKNLNFERKSRYYLTIRGEDC  2320
             + A+D D G N  +++S+     D   F I +  G IR    L++E K  + L +   D 
Sbjct  1002  IEAVDEDIGPNAEIQFSLKEETQDEELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAIDG  1061

Query  2321  ASEVGETPRGDTAQVTITVIDINDN--APVFLDSPYLAHVMENMVPPGGGFVIQVKAYDA  2378
                 G+        + I +ID+N+N  AP F D  Y   V EN   P G FV+ V A D 
Sbjct  1062  ----GDPSLTSDMSIVIMIIDVNENRFAPEFDDFVYEGKVKEN--KPKGTFVMNVTARDM  1115

Query  2379  DTPPYNDQVRYFLKEGD-TDLFRINASTGDIFLLRPLDRELVAEYTLTLVAMDTGSPPLT  2437
             DT   N ++ Y +  GD   +F +N   G I  L  LD E    Y LTL A D    PL+
Sbjct  1116  DTVDLNSKITYSITGGDGLGIFAVN-DQGSITSLSQLDAETKNFYWLTLCAQDCAIVPLS  1174

Query  2438  GSGIVRIVVLDVNDHIPEFTRQEYRATVTENLASGTWVTKPHATDKDEGLNAKIRYSLLG  2497
                 V I V + ND+IP   +  Y   VTE       +    A D D      I Y+++ 
Sbjct  1175  NCVEVYIQVENENDNIPLTDKPVYYVNVTEASVENVEIITLKAFDPDIDPTQTITYNIVS  1234

Query  2498  EN-SERFTVEPETGEVLTV-VPLDREQTAVYHLTLVAQDSSPTEPQASAVNLTIFVKDVN  2555
              N    F ++ +TG + T    LDRE  A  H+  VA   + +   +S   + + V D+N
Sbjct  1235  GNLVGYFEIDSKTGVIKTTERKLDRENQA-EHILEVAISDNGSPVLSSTSRIVVSVLDIN  1293

Query  2556  DNAPRFSSPRYTAYVPGATKPGDFVFGAKAVDDDDGENSRIVYRLQ-GIDAEKFVIDPNS  2614
             DN+P F    Y   VP +      +F   A+D D GEN RI Y ++ G    KF ID   
Sbjct  1294  DNSPEFDQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYSIKSGKGKNKFRIDSQR  1353

Query  2615  GVIRTTQELANDETTYQLQIQASDCGVKPQTVTADLVIHLWERQLFPS-----FRSTIST  2669
             G I   + L +D   +++ I+A D G+  ++ TA + I +              R T   
Sbjct  1354  GHIHIAKPLDSD-NEFEIHIKAEDNGIPKKSQTARVNIVVVPVNPNSQNAPLIVRKTSEN  1412

Query  2670  RFTLPEDVPEGRVITKLSATTPKVGTASNLVYGMAGGNVGDALKIDPHTGEVLVASGFDY  2729
                L E+   G ++T++ A          L Y ++ GN  +   I    G +L++   DY
Sbjct  1413  VVDLTENDKPGFLVTQILAVDDD---NDQLWYNISNGNDDNTFYIGQDNGNILLSKYLDY  1469

Query  2730  ETAPFYEAWVEVRDSDTPALRSVVQLLVNVTDANDNAPIMEAAIYNATVPEDEYPPLFVN  2789
             ET   Y   + V D    A      LLV V D NDN P     +Y+  + E+      + 
Sbjct  1470  ETQQSYNLTISVTDGTFTAF---TNLLVQVIDINDNPPQFAKDVYHVNISENIEEESVIM  1526

Query  2790  KVSANDRDSGENGQVSYYL--VNDFTE--TFVIDSDTGEISTNAKLDREEIASYELIVEA  2845
             ++ A DRD  E+ ++ Y+L    D +    F IDS +G +    +LD E+ A + LIV  
Sbjct  1527  QLHATDRD--EDKKLFYHLHATQDPSSLALFRIDSISGNVIVTQRLDFEKTAQHILIVFV  1584

Query  2846  RDQGQPSLTGTATVLLTVLDKNDNPPQFT-RLFSVNVTENAEIGTFVIRITSSDLDIGQN  2904
             +DQG P     A +++ V D ND+ P+FT ++    V E+A IG+ +  + + D D G N
Sbjct  1585  KDQGAPGKRNYAKIIVNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAIDRDSGHN  1644

Query  2905  ANVTYR-FTENPGEKFAMDALSGNVTVNGHLDREEQDEYLLKLVAADGA---WQAATALT  2960
             A + Y   T N G  F +D   G +T+ G+L+  +  EY+L++ A D       +   + 
Sbjct  1645  AEIQYSIITGNVGSVFEIDPTFGIITLAGNLNINKIQEYMLQVKAVDLGNPPLSSQIPVH  1704

Query  2961  ITIQDQNDNPPEFDEESYHFHFPELQPPVAHVGQVTAIDRDKQGPNSVISYSLL--QPSD  3018
             I +    ++PP+F   +      E  P    V QVTA        +S I ++++    ++
Sbjct  1705  IIVTMSENDPPKFPTNNIAIEIFENLPIGTFVTQVTA------RSSSSIFFNIISGNINE  1758

Query  3019  LFTVDPATGDVFSKKTLKYKHTHRPSSPENLYSLTVVATDNGKPPLSSKTVVYVNVVDAN  3078
              F ++P+TG +     + Y+          +++LTV  T+      SS   + ++++DAN
Sbjct  1759  SFRINPSTGVIVINGNIDYESI-------KVFNLTVKGTNMAAE--SSCQNIIIHILDAN  1809

Query  3079  NNAPRFDQRSYLYPVPENYGVGKRVVQLM--AKD-------DADFGVNAEISYFMTNVNG  3129
             +N P F Q  Y+  +PE+  +G  V+++   +KD       DAD GVN  + Y + +   
Sbjct  1810  DNIPYFVQNEYVGALPESAAIGSYVLKVHDSSKDHLTLQVKDADVGVNGMVEYHIVDDLA  1869

Query  3130  SEYFSIDEKSGWVYVRNTLSNVPVRTTFLLKVQAIDKGVPPQKDEVS--LTLVISGENKH  3187
               +F ID  +G + +   L +      +   V   D G P      +  +T+ +   N  
Sbjct  1870  KNFFKIDSTTGAIELLRQL-DYETNAGYTFDVTVSDMGKPKLHSTTTAHVTIRVINVNDC  1928

Query  3188  APTFAAVSHQVRVPENEPVNTTILTVSATDGDDGPNGMIRYKISAGNEKNEFFVHSITGA  3247
              P F      V +      N  +  VSA D D   N  +R+ I  GN    F +   TG 
Sbjct  1929  PPVFNERELNVTLFLPTFENVFVRQVSAKDAD---NDTLRFDIVDGNTNECFQIEKYTGI  1985

Query  3248  VTI--LEPLDYDLVQEYKLNITATDLGFEPKQAVAILTVNVSDINDNPPTFNQSIYEAYL  3305
             +T    E L+ +  ++Y L++ A+D  F    A+ I+ + V    D+   F +  Y    
Sbjct  1986  ITTRNFEILNNENDRDYALHVRASDGIF---SAILIVKIKVLSAIDSNFAFQRESYRFSA  2042

Query  3306  PENSPPDSFV--YKVIARDIDSPKYAVIQYKILGGTGKDHFRIREDTGEIASL-ISFDYE  3362
              EN+   + +    VI   +D      ++Y+IL  T    F I   +G + +  + FD E
Sbjct  2043  FENNTKVATIGLVNVIGNTLDEN----VEYRILNPT--QLFDIGISSGALKTTGVIFDRE  2096

Query  3363  EANEYTLDIVAAN-----PDSNPQMVGFTTVLVHITGVNEYYPKFIQPVFHMDVSESAEV  3417
               + Y L + A +      +SN +    T++ + +  VN+  P F+   ++  VS     
Sbjct  2097  VKDLYRLFVEAKSMLYDGMNSNVRR-AVTSIDISVLDVNDNCPLFVNMPYYATVSIDDPK  2155

Query  3418  GTSVGLVQATDQDAGEDGRVYYLFVGSSNDRGFSIGSETGIIRVSRRLDRETQNRVVLTV  3477
             GT +  V+A D D+ E+G V Y  +   N   F +  ++G + + + ++   +N   LTV
Sbjct  2156  GTIIMQVKAIDLDSAENGEVRYE-LKKGNGELFKLDRKSGELSIKQHVEGHNRN-YELTV  2213

Query  3478  MTKNGGGIRGNDTDEAQVIVSIQDGNDPPEFLQSTYDATVSEGA-THGTRVLTVRAVDKD  3536
                +G       + EA + V + D    P F +  Y  +V E    +    +++ A    
Sbjct  2214  AAYDGAITPC--SSEAPLQVKVID-RSMPVFEKQFYTVSVKEDVEMYSALSVSIEAE---  2267

Query  3537  IKPQNNQFSYSIISGNLGQAFKVDPQTGDIETAKQLDRETIPIYDLTIGAIDTGSPPQTG  3596
               P      Y+I S +  Q+F++D  TG I    +LD E I  +D++I A D+ S     
Sbjct  2268  -SPLGRSLIYTISSES--QSFEIDYNTGSIFVVNELDYEKISSHDVSIRATDSLSGVY-A  2323

Query  3597  TAAIHIELLDINDNGPTFDPPEVVGYVNENEPAGTIVMTLSATDPDLPPNGAPFTY--KL  3654
                + + ++D+ND  P  +       + EN   GT ++ ++ATD D   N     Y   +
Sbjct  2324  EVVLSVSIMDVNDCYPEIESDIYNLTIPENASFGTQILKINATDNDSGANAKLSYYIESI  2383

Query  3655  VGGRQSDMVTLDKHTGVLKTTRSLDREAMPQLDLVVEVEDSGVPRMRSEHTITVIVTDQN  3714
              G   S++  +D   G L     LD E +    +VV V+D G P + S   + + V D N
Sbjct  2384  NGQNNSELFYIDVTDGNLYLKTPLDYEQIKYHHIVVNVKDHGSPSLSSRSNVFITVKDLN  2443

Query  3715  DS------PSSPRSVHVIVHSFNELIPLGKIADVHPNDPDVTGSYSCKILQGSNPKILSI  3768
             D+      PS    V V      + + L K  D   +D D   S   KI+ G+  +  SI
Sbjct  2444  DNAPCFVEPSYFTKVSVAAVR-GQFVALPKAYDKDISDTD---SLEYKIVYGNELQTYSI  2499

Query  3769  PSACDL----HTKKITPGVGYSLSVSGNDGRHPNVVSKVTVEFL-------VFTNSTIEN  3817
                  +    +    T      L++S +DG H    +++ +  L       +F  ST E 
Sbjct  2500  DKLTGVISLQNMLNFTDKSSTVLNISVSDGVH-TAYARLKISLLPENVYSPLFDQSTYEA  2558

Query  3818  SV--------TLQVTKLSSRDFLGQYYRALLDVLQEEVDVGDTLKIFSLGET  3861
              V         +   K S  DF G Y     +++ EE+      KIF + +T
Sbjct  2559  QVPENLLHGHNIITVKASDGDF-GTYANLYYEIVSEEMK-----KIFLIDQT  2604


 Score = 454 bits (1169),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 453/1541 (29%), Positives = 697/1541 (45%), Gaps = 135/1541 (9%)

Query  82    EGEPKGTLVGLIPV-----KPGFTYRFNEPPQEFVLDPETGKIRTAKVL-DREALSSDRF  135
             E   K   +GL+ V          YR   P Q F +   +G ++T  V+ DRE    D +
Sbjct  2044  ENNTKVATIGLVNVIGNTLDENVEYRILNPTQLFDIGISSGALKTTGVIFDREV--KDLY  2101

Query  136   DLVVLSSQPTYP----------IEVRILVLDINDNDPEFPESSIAVSFSESAVVGTKLLL  185
              L V +    Y             + I VLD+NDN P F       + S     GT ++ 
Sbjct  2102  RLFVEAKSMLYDGMNSNVRRAVTSIDISVLDVNDNCPLFVNMPYYATVSIDDPKGTIIMQ  2161

Query  186   DAATDKDTLENGVVDDYFIVNGNTDEKFRLEVTGNPTGETSY-LHLETTGKLDREQVEFY  244
               A D D+ ENG V  Y +  GN  E F+L+     +GE S   H+E   +        Y
Sbjct  2162  VKAIDLDSAENGEVR-YELKKGN-GELFKLD---RKSGELSIKQHVEGHNR-------NY  2209

Query  245   SLNVCARDRGRPPRLGYLLVNVTVLDVNDNPPIFQQSDYVVALNESAPVGTKVLTVHATD  304
              L V A D    P      + V V+D   + P+F++  Y V++ E   + +  L+V + +
Sbjct  2210  ELTVAAYDGAITPCSSEAPLQVKVID--RSMPVFEKQFYTVSVKEDVEMYS-ALSV-SIE  2265

Query  305   KDSEDNSKLTYYLPDTERQFTIDPETGTITTVEPLDCPQ-QSCTIAARLGDGCPKSCVIT  363
              +S     L Y +    + F ID  TG+I  V  LD  +  S  ++ R  D         
Sbjct  2266  AESPLGRSLIYTISSESQSFEIDYNTGSIFVVNELDYEKISSHDVSIRATDSLSG-----  2320

Query  364   VFARDHGSPRQDGRTYVTVNLLDANDHDPEIKFSYFPSTPGFATVDENAAKDSIVAAVAV  423
             V+A             ++V+++D ND  PEI+   +       T+ ENA+  + +  +  
Sbjct  2321  VYAE----------VVLSVSIMDVNDCYPEIESDIYN-----LTIPENASFGTQILKINA  2365

Query  424   IDNDEGLNGETTVEIRAGNELGHFRLDNTPSFDIVRVNGRL------DREEIPKYNLTVV  477
              DND G N + +  I + N  G    +N+  F I   +G L      D E+I  +++ V 
Sbjct  2366  TDNDSGANAKLSYYIESIN--GQ---NNSELFYIDVTDGNLYLKTPLDYEQIKYHHIVVN  2420

Query  478   ATDKGTPPRSATAYLVIHVNDVNDHEPVFQQSEYSAVLSELSPTGSFVASISATDADSGL  537
               D G+P  S+ + + I V D+ND+ P F +  Y   +S  +  G FVA   A D D   
Sbjct  2421  VKDHGSPSLSSRSNVFITVKDLNDNAPCFVEPSYFTKVSVAAVRGQFVALPKAYDKDISD  2480

Query  538   NARIYYDFDSGNEQGWFAIDQDTGLVTTVATLDREVQGSIELHVSARDGGPNPKYASTHL  597
                + Y    GNE   ++ID+ TG+++    L+   + S  L++S  DG      A   L
Sbjct  2481  TDSLEYKIVYGNELQTYSIDKLTGVISLQNMLNFTDKSSTVLNISVSDG---VHTAYARL  2537

Query  598   KVTILDENDEAPRFSQNVVRVTLSENTPPQSLVATLTAVDNDQGTNGSVAYSFHSSVSRD  657
             K+++L EN  +P F Q+     + EN      + T+ A D D GT  ++ Y     VS +
Sbjct  2538  KISLLPENVYSPLFDQSTYEAQVPENLLHGHNIITVKASDGDFGTYANLYYEI---VSEE  2594

Query  658   YPKTFALDGLTGQLTTKVNLDRETTAEYQILVIAKDQGTPPQSSTATVILTLEDVNDNSP  717
               K F +D  TG +T+KV  DRE   EY +L+   D G   +   A++ + + DVNDN P
Sbjct  2595  MKKIFLIDQTTGVITSKVTFDREKKDEYVVLLKVSDGGG--KFGFASLKVIVVDVNDNVP  2652

Query  718   VFYPWRYLMPIPEDAPPGTSVGKVTATDADARENAQVRYSL-----ESGGEGLFTVDERT  772
              F    Y M +        ++  V A D D  +N  V + +     +   + +  ++E+T
Sbjct  2653  YFLLKEYKMVVSTTVEANQTILTVKAKDDDIVDNGSVHFQIVQKSNDKAVKDVIEINEKT  2712

Query  773   GEITLQGSLRAAHKTLYELNISAKDTGDRVAGRNALVEI-IREEDLEHLEFDTYNGYEFR  831
             G+I  +    +     Y+  + A D G+        V I I E D     F+  +    +
Sbjct  2713  GDIVFKSKAESYGVNSYQFFVRASDRGEPQFHSEVPVSIEIIETDANIPTFEK-SSVLLK  2771

Query  832   IAEDRGECGAMSNVFARDAGTVQITQYDSSKISYAIVFGDPKGNFKIDESTGTISTSGCL  891
             I E            +   GTV    +     ++       + +F I +S G +     L
Sbjct  2772  IIE------------STPPGTVLTKLHMIGNYTFKFSIAADQDHFMISDS-GELILQQTL  2818

Query  892   DREQVAYYSLQLSARAG---LAYGQTSVNITVLDINDNPPRFPKGEIGDEVLLKENAAVG  948
             DREQ   ++L + A      + +    V I V D NDN P+F        V   EN+   
Sbjct  2819  DREQQESHNLIVVAETSTVPVFFAYADVLIDVRDENDNYPKFDNTFYSASV--AENSEKV  2876

Query  949   QEVCLARARDRDASANARIVYSL---THNPGGQFRVAENSGIIYLDKPIRAAPGTVLHLE  1005
               +    A D D   N  I Y L   T N    F +   SG I L   +     +  + +
Sbjct  2877  ISLVKVSATDADTGPNGDIRYYLESDTENIQNIFDIDIYSGWITLLTSLDREVQSEYNFK  2936

Query  1006  VTATDSGNQPLSAQHQVRVTIEDVNDHTPVFKL-----TSYETSLPESTPVNDRFFSLTA  1060
             V A D+G+    A+  V + I D ND+ PVFKL     + +E +LP +  +N     L  
Sbjct  2937  VIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLPIEGLSVFENALPGTVLIN-----LLL  2991

Query  1061  IDVDLGANGRVLYSITDGNTEDRFGIFPDGQLYVKNVLDREELDYYALEVTATDQGSPSR  1120
             ID D+     + + I  G+ + +F I   G+L++   LDRE+L +Y L + ATD    ++
Sbjct  2992  IDPDI-EKQEMDFFIVSGDKQAQFQIGKSGELFIAKPLDREQLMFYNLSIIATDGKFTAK  3050

Query  1121  SSVVPVVVHIIDENDNAPEFTNSSFVLHLRENEPPDTFVGKLLATDRDVGRNADLVFSLP  1180
             ++V    + + D NDN P      + +   E+    T + ++ A D D    + L F L 
Sbjct  3051  ANVE---IDVKDINDNTPYCLKPRYHISTNESISIGTTLVEVKAIDFDF--QSKLRFYLS  3105

Query  1181  AS-QQDFTVDPRNGFIKSLRVFDRELLVTNTGSSYITLEATVTDNGVNRLRDRVKVVIYI  1239
                  DF++   +G +K     DRE     T   Y  L A V D          +++I +
Sbjct  3106  GKGADDFSIGKESGILKVASALDRE-----TTPKY-KLVAHVQDGKDFTQECFSEIIITV  3159

Query  1240  TDVNDNIPQFQRLPYRVQVNEGAAIGTQLLRVYTTDADEGLNGDVFYSLEDGNQHGRFAI  1299
              D+NDN+P F    YRV V E A + T + +V+  D D G+N  + YSL  G  H  F I
Sbjct  3160  NDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLM-GENHDYFKI  3218

Query  1300  DEATGQISLTKELDRETTDAYVLTVVAHDAGLETRLSSSTTVHIEVLDENDNVPLFVDDK  1359
              ++TG I L K LDRET   + LTV A D G+  +L S  TV + +LD NDN P F   +
Sbjct  3219  SKSTGIIRLHKSLDRETISLFNLTVKAEDCGV-PKLHSIATVAVNILDINDNPPEFSMRQ  3277

Query  1360  SSISVLETTPTNTELLRFKATDNDLGPNSELAFAISAGNRRDTFYIDPLTGTLYLRKPLD  1419
              S  +LE     TE+ +  AT  D+G N+++ + I +GN +  F +D  TG L L   LD
Sbjct  3278  YSCKILENATHGTEVCKVYATSIDIGVNADIHYFIMSGNEQGKFKMDSTTGDLVLNATLD  3337

Query  1420  YEELEKYTLNVTCSDGGHPRLSSVTTLIVEVIDANDNPPVFPNTAIARQIREGILVHTPI  1479
             YE  + Y L +   DGG P LS+   + + ++D NDN P F        + E I V + I
Sbjct  3338  YEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSPTFLQNLYRINVNEDIFVGSKI  3397

Query  1480  VTITAEDPDSNENGVVTYSIASQDPEDQVRRFGINPSTGVIHTLLPIDREEVDTYKLVVV  1539
             + + A D DS+ NG+VTY+I   +  D + +F I+P  G I    P+DRE +  Y L + 
Sbjct  3398  LDVKATDEDSDVNGLVTYNI---ERGDNIGQFSIDPKNGTISVSRPLDRETISHYTLEIQ  3454

Query  1540  ATDSAQPASARLSAEKLVIVIVEDINDNAPIFVSMS-AVVL  1579
             A D   P   R ++  + I I+ D NDNAPIF S + +VVL
Sbjct  3455  ACDQGDP--QRCNSVPININIL-DTNDNAPIFSSSNYSVVL  3492


 Score = 240 bits (613),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 209/744 (28%), Positives = 346/744 (47%), Gaps = 66/744 (9%)

Query  74    TRVQLEVREGEPKGTLVGLIPVKPGFTYRFN-EPPQEFVLDPETGKIRTAKVLDREALSS  132
             + V L++ E  P GT++  + +   +T++F+    Q+  +  ++G++   + LDRE   S
Sbjct  2766  SSVLLKIIESTPPGTVLTKLHMIGNYTFKFSIAADQDHFMISDSGELILQQTLDREQQES  2825

Query  133   DRFDLVVLSSQPTYPI-----EVRILVLDINDNDPEFPESSIAVSFSESAVVGTKLLLDA  187
                +L+V++   T P+     +V I V D NDN P+F  +  + S +E++     L+  +
Sbjct  2826  --HNLIVVAETSTVPVFFAYADVLIDVRDENDNYPKFDNTFYSASVAENSEKVISLVKVS  2883

Query  188   ATDKDTLENGVVDDYFIVNG-NTDEKFRLEVTGNPTGETSYLHLETTGKLDREQVEFYSL  246
             ATD DT  NG +  Y   +  N    F +++       + ++ L T+  LDRE    Y+ 
Sbjct  2884  ATDADTGPNGDIRYYLESDTENIQNIFDIDIY------SGWITLLTS--LDREVQSEYNF  2935

Query  247   NVCARDRGRPPRLGYLLVNVTVLDVNDNPPIFQQSDYVVALNESAPVGTKVLTVHATDKD  306
              V A D G P     + V + ++D NDN P+F+     +++ E+A  GT ++ +   D D
Sbjct  2936  KVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLPIEGLSVFENALPGTVLINLLLIDPD  2995

Query  307   SEDNSKLTYYLP--DTERQFTIDPETGTITTVEPLDCPQQSCTIAARLGDGCPKSCVITV  364
              E   ++ +++   D + QF I  ++G +   +PLD  Q                  +++
Sbjct  2996  IE-KQEMDFFIVSGDKQAQFQIG-KSGELFIAKPLDREQLMFY-------------NLSI  3040

Query  365   FARDHGSPRQDGRTYVTVNLLDANDHDPE-IKFSYFPSTPGFATVDENAAKDSIVAAVAV  423
              A D    +   +  V +++ D ND+ P  +K  Y  ST      +E+ +  + +  V  
Sbjct  3041  IATD---GKFTAKANVEIDVKDINDNTPYCLKPRYHIST------NESISIGTTLVEVKA  3091

Query  424   IDNDEG------LNGETTVEIRAGNELGHFRLDNTPSFDIVRVNGRLDREEIPKYNLTVV  477
             ID D        L+G+   +   G E G           I++V   LDRE  PKY L   
Sbjct  3092  IDFDFQSKLRFYLSGKGADDFSIGKESG-----------ILKVASALDRETTPKYKLVAH  3140

Query  478   ATDKGTPPRSATAYLVIHVNDVNDHEPVFQQSEYSAVLSELSPTGSFVASISATDADSGL  537
               D     +   + ++I VND+ND+ P+F  ++Y   + E +   + +  + A D D G+
Sbjct  3141  VQDGKDFTQECFSEIIITVNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKDFGV  3200

Query  538   NARIYYDFDSGNEQGWFAIDQDTGLVTTVATLDREVQGSIELHVSARDGGPNPKYASTHL  597
             N +I Y    G    +F I + TG++    +LDRE      L V A D G    ++   +
Sbjct  3201  NRQIKYSL-MGENHDYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHSIATV  3259

Query  598   KVTILDENDEAPRFSQNVVRVTLSENTPPQSLVATLTAVDNDQGTNGSVAYSFHSSVSRD  657
              V ILD ND  P FS       + EN    + V  + A   D G N  + Y     +S +
Sbjct  3260  AVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSIDIGVNADIHYFI---MSGN  3316

Query  658   YPKTFALDGLTGQLTTKVNLDRETTAEYQILVIAKDQGTPPQSSTATVILTLEDVNDNSP  717
                 F +D  TG L     LD E +  Y + + A D GTPP S+ A V +++ D+NDNSP
Sbjct  3317  EQGKFKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSP  3376

Query  718   VFYPWRYLMPIPEDAPPGTSVGKVTATDADARENAQVRYSLESGGE-GLFTVDERTGEIT  776
              F    Y + + ED   G+ +  V ATD D+  N  V Y++E G   G F++D + G I+
Sbjct  3377  TFLQNLYRINVNEDIFVGSKILDVKATDEDSDVNGLVTYNIERGDNIGQFSIDPKNGTIS  3436

Query  777   LQGSLRAAHKTLYELNISAKDTGD  800
             +   L     + Y L I A D GD
Sbjct  3437  VSRPLDRETISHYTLEIQACDQGD  3460


 Score = 204 bits (519),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 189/620 (30%), Positives = 288/620 (46%), Gaps = 55/620 (9%)

Query  202  YFIVNGNTDEKFRLEVTGNPTGETSYLHLETTGK---LDREQVEFYSLNVCAR----DRG  254
            Y I++G+ ++ F+ E      G+ ++L + T      L+RE+ E Y + V A     DR 
Sbjct  102  YRIISGDKEKLFKAE--EKLVGDFAFLAIRTRTNNVVLNREKTEEYVIRVKAHVHLHDRN  159

Query  255  RPPRLGYLLVNVTVLDVNDNPPIFQQSDYVVALNESAPVGTKVLTVHATDKDSEDNSKLT  314
                     +++ VLD ND  P+F  + Y V + E  P    +L V A D D   N ++ 
Sbjct  160  VSSYETEANIHIKVLDRNDLSPLFYPTQYTVVIPEDTPKYQSILKVTADDADLGINGEIY  219

Query  315  YYLPDTERQFTIDPETGTITTVEPLDCPQQSCTIAARLGDGCPKSCVITVFARDHGS---  371
            Y L      F I P TG IT ++ L   + S                +TV A D GS   
Sbjct  220  YSLLMDSEYFAIHPTTGEITLLQQLQYAENS-------------HFELTVVAYDRGSWVN  266

Query  372  --PRQDGRTYVTVNLLDANDHDPEIKFSYFPS-TPGFATVDENAAKDSIVAAVAVIDNDE  428
                Q  +T V++++   N + PEI    F S TP         +   I   V V D D 
Sbjct  267  HQNHQASKTKVSISVKQVNFYAPEIFTKTFSSVTP--------TSNPLIYGIVRVNDKDT  318

Query  429  GLNGET-TVEIRAGNELGHFRLDNTPSFD--IVRVN--GRLDREEIPKYNLTVVATDKGT  483
            G+NG    +EI  GN  G F L    + D   + +N    L+++    YNLT++A D GT
Sbjct  319  GINGNIGRLEIVDGNPDGTFLLKAAETKDEYYIELNQFAHLNQQHFI-YNLTLLAEDLGT  377

Query  484  PPRSATAYLVIHVNDVNDHEPVFQQSEYSAVLSELSPTGSFVASISATDADSGLNARIYY  543
            P R A   + I +   + + P+F Q  Y   + E +P    V  +  +D D G NA +Y 
Sbjct  378  PRRFAYKSVPIQIKPESKNIPIFTQEIYEVSIPETAPINMPVIRLKVSDPDLGKNALVYL  437

Query  544  DFDSGNEQGWFAIDQDTGLVTTVATLDREVQGSIELHVSARDGGP--NPKYASTHLKVTI  601
            +   GNE   F I+ D+G++ T   LD E + S  L VSA D     + K +S  +K+++
Sbjct  438  EIVGGNEGDEFRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISV  497

Query  602  LDENDEAPRFSQNVVRV-TLSENTPPQSLVATLTAVDNDQGTNGSVAYSFHSSVSRDYPK  660
             D ND  P F +NV +V +++EN    S V  LTA D D G N  ++Y    S++     
Sbjct  498  QDMNDNDPIF-ENVNKVISINENNLAGSFVVKLTAKDRDSGENSYISY----SIANLNAV  552

Query  661  TFALDGLTGQLTTKVNLDRETTAE-YQILVIAKDQGTPPQSSTATVI-LTLEDVNDNSPV  718
             F +D  +G + T   LD ET    Y++++ A D G P +  T   + + ++D+NDN P 
Sbjct  553  PFEIDHFSGIVKTTSLLDFETMKRNYELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQ  612

Query  719  FYPWRYLMPIPEDAPPGTSVGKVTATDADARENAQVRYSLESGGE-GLFTVDERTGEITL  777
            F        + + AP GT V   +A D DA +   + Y L  G E G F +D  +G +++
Sbjct  613  FERVNCYGKVTKSAPMGTEVFVTSAIDFDAGD--IISYRLSDGNEDGCFNLDPTSGSLSI  670

Query  778  QGSLRAAHKTLYELNISAKD  797
               L+    T   L +SA D
Sbjct  671  SCDLKKTTLTNRILKVSATD  690


 Score = 124 bits (312),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 75/223 (34%), Positives = 91/223 (41%), Gaps = 28/223 (13%)

Query  3859  GETGSDLNIHVAVESPEGYRSKYEVTELLNRNRDKIRSLLQGMTFTVGYSPCKHIPCENG  3918
             G  G   NI +A ES   Y S       L R  + +          V    C   PC N 
Sbjct  4067  GFIGCMANIKIAKESLPLYISGGSTIAALKRFTN-VEFKCDPSNVLVRLGICGSQPCANS  4125

Query  3919  GSCSDKLVIYDDARITDSQALILTSPRMMHEMTCKCRDGFTGDKCERRQDPCSPNPCLLG  3978
             G C +           D+               C C+  ++G  CE   DPCS  PCL G
Sbjct  4126  GICKE----------LDTDVF-----------ECACQPRYSGKHCEIDLDPCSSGPCLFG  4164

Query  3979  GQCRRLG-YDFQCTCPIDRDGKLCELERGDACASNPCRNGGSCRKSPDSFSFFCLCRAGY  4037
             G+C   G  ++ CTCPI   GK CE   G  C  NPC+NGG C +  D  S  C+CR GY
Sbjct  4165  GRCDYHGPNNYSCTCPIHLSGKRCEY--GKFCTPNPCKNGGICEEG-DGIS-HCMCR-GY  4219

Query  4038  RGNHCEAVTDSCRPNPCLYGGLCVGEKPGYTCSCPEGRYGRHC  4080
              G  CE   D C   PC  G  C+ E   + C CP    G  C
Sbjct  4220  TGPTCEIDVDECENQPCGNGATCINEPGSFRCICPSYLTGASC  4262


 Score = 92.8 bits (229),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 112/466 (24%), Positives = 197/466 (42%), Gaps = 38/466 (8%)

Query  3296  FNQSIYEAYLPENSPPDSFVYKVIARDIDSPKY---AVIQYKILGGTGKDHFRIRED-TG  3351
             F+ S+Y   +PENS   ++   V+   +   +    A ++Y+I+ G  +  F+  E   G
Sbjct  62    FSHSVYNVTIPENSLGKTYAKGVLHERLAGLRVGLNAEVKYRIISGDKEKLFKAEEKLVG  121

Query  3352  EIASL--------ISFDYEEANEYTLDIVAANPDSNPQMVGFTT---VLVHITGVNEYYP  3400
             + A L        +  + E+  EY + + A     +  +  + T   + + +   N+  P
Sbjct  122   DFAFLAIRTRTNNVVLNREKTEEYVIRVKAHVHLHDRNVSSYETEANIHIKVLDRNDLSP  181

Query  3401  KFIQPVFHMDVSESAEVGTSVGLVQATDQDAGEDGRVYYLFVGSSNDRGFSIGSETGIIR  3460
              F    + + + E      S+  V A D D G +G +YY  +  S    F+I   TG I 
Sbjct  182   LFYPTQYTVVIPEDTPKYQSILKVTADDADLGINGEIYYSLLMDS--EYFAIHPTTGEIT  239

Query  3461  VSRRLDRETQNRVVLTVMTKNGGGIRGNDTDEA---QVIVSIQDGN-DPPEFLQSTYDAT  3516
             + ++L     +   LTV+  + G    +   +A   +V +S++  N   PE    T+ + 
Sbjct  240   LLQQLQYAENSHFELTVVAYDRGSWVNHQNHQASKTKVSISVKQVNFYAPEIFTKTFSSV  299

Query  3517  V--SEGATHGTRVLTVRAVDKDIKPQNNQFSYSIISGN------LGQAFKVDPQTGDIET  3568
                S    +G     VR  DKD     N     I+ GN      L  A   D    ++  
Sbjct  300   TPTSNPLIYGI----VRVNDKDTGINGNIGRLEIVDGNPDGTFLLKAAETKDEYYIELNQ  355

Query  3569  AKQLDRETIPIYDLTIGAIDTGSPPQTGTAAIHIELLDINDNGPTFDPPEVVGYVNENEP  3628
                L+++   IY+LT+ A D G+P +    ++ I++   + N P F        + E  P
Sbjct  356   FAHLNQQHF-IYNLTLLAEDLGTPRRFAYKSVPIQIKPESKNIPIFTQEIYEVSIPETAP  414

Query  3629  AGTIVMTLSATDPDLPPNGAPFTYKLVGGRQSDMVTLDKHTGVLKTTRSLDREAMPQLDL  3688
                 V+ L  +DPDL  N   +  ++VGG + D   ++  +G+L T + LD E      L
Sbjct  415   INMPVIRLKVSDPDLGKNALVY-LEIVGGNEGDEFRINPDSGMLYTAKQLDAEKKSSYTL  473

Query  3689  VVEVEDSGV--PRMRSEHTITVIVTDQNDSPSSPRSVHVIVHSFNE  3732
              V   D      R +S   + + V D ND+     +V+ ++ S NE
Sbjct  474   TVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFENVNKVI-SINE  518


 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 42/84 (50%), Gaps = 2/84 (2%)

Query  4003  LERGDACASNPCRNGGSCRKSPDSFSFFCLCRAGYRGNHCEAVTDSCRPNPCLYGGLCVG  4062
             L R   C S PC N G C K  D+  F C C+  Y G HCE   D C   PCL+GG C  
Sbjct  4111  LVRLGICGSQPCANSGIC-KELDTDVFECACQPRYSGKHCEIDLDPCSSGPCLFGGRCDY  4169

Query  4063  EKP-GYTCSCPEGRYGRHCERSTF  4085
               P  Y+C+CP    G+ CE   F
Sbjct  4170  HGPNNYSCTCPIHLSGKRCEYGKF  4193


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 62/143 (43%), Gaps = 11/143 (8%)

Query  4385  LMFRTVKPDGVLVYAATNKHFTSVELRNGQLFYASLLGSPVNMTANIEGGLADGHWHNLT  4444
             L  RTV+  G L+YA+    +  +E+ NG + Y   LGS   + +     ++DG WH ++
Sbjct  3951  LQIRTVQQTGTLLYASGKVDYNILEIINGAVQYRFDLGSGEGVISVSSINISDGEWHQIS  4010

Query  4445  LHSYFRGLRLFVDGVQTGEELDPVGVHDFLDPYLSVLSIGGVSQDLYYAHSAGAG-----  4499
             L       ++ VD         P GV+  L+   + + +G   +     H +  G     
Sbjct  4011  LERSLNSAKVMVDNKHVSHGSAP-GVNGILNIQSNDIFVGAEVR----PHPSIIGYEDIQ  4065

Query  4500  -SFEGCLANFTINNEIQPFNGSG  4521
               F GC+AN  I  E  P   SG
Sbjct  4066  RGFIGCMANIKIAKESLPLYISG  4088


>X2J8E9_DROME unnamed protein product
Length=3556

 Score = 847 bits (2188),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 875/3047 (29%), Positives = 1333/3047 (44%), Gaps = 390/3047 (13%)

Query  554   FAIDQDTGLVTTVATLDREVQGSIELHVSARDGGPNPKYASTHLKVTILDENDEAPRFSQ  613
              AID+ TG + T   LDRE + S  L V+    G N +     + VT+ DEND AP F Q
Sbjct  123   LAIDRATGEIRTKVKLDRETRASYSL-VAIPLSGRNIR-----VLVTVKDENDNAPTFPQ  176

Query  614   NVVRVTLSENTPPQSLVATLTAVD------NDQGTN---GSVAYSFHSSVSRDYPKTFAL  664
               + +   ENTP +     L A D      N Q  N   G+V  +F  S  R+      L
Sbjct  177   TSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYL  236

Query  665   DGLTGQLTTKVNLDRETTAEYQILVIAKDQGTPPQSSTATVILTLEDVNDNSPVFYPWRY  724
             D     L     LDRETT  Y +L+ A D GTPP     TV +T++DVNDN P+F   RY
Sbjct  237   D-----LQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRY  291

Query  725   LMPIPEDAPPGTSVGKVTATDADARENAQVRYSL---ESGGEGLFTVDERTGEITLQGSL  781
                +PE+A  GTSV +V A+D DA EN  V Y++   +S  E +F +D RTG I +  +L
Sbjct  292   FATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKAL  351

Query  782   RAAHKTLYELNISAKDTGDRVAGRNALVEIIREEDLEHLEFDTYNGYEFRIAEDRGECGA  841
                 K L+EL + AKD G++     A V I                   R+ +       
Sbjct  352   DFETKELHELVVVAKDHGEQPLETTAFVSI-------------------RVTDVNDNQPT  392

Query  842   MSNVFARDAGTVQITQ-------------YD-SSKISYA---IVFGDPKGNFKI---DES  881
             ++ +F  D  + +I++             +D  SK  YA   +      G+F +   D S
Sbjct  393   INVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNS  452

Query  882   TGTISTSGCLDREQVAYYSLQLSARAGLA---YGQTSVNITVLDINDNPPRFPKGEIGDE  938
                +     LDRE V+ Y+L + A        +   S+ + + D+NDNPP F +      
Sbjct  453   IYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHAN  512

Query  939   VLLKENAAVGQEVCLARARDRDASANARIVYSLTHNP---GGQFRVAENSGIIYLDKPIR  995
             V+  E A  G  V    A DRD   N+ + YSL   P      F++   +G+I     I 
Sbjct  513   VM--EVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHID  570

Query  996   AAPGTVLHLEVTATDSGNQPLSAQHQVRVTIEDVNDHTPVFKLTSYETSLPESTPVNDRF  1055
                  V  L V A D G  PLS+   V VTI DVND+ P+F  + Y  S+ E+ PV    
Sbjct  571   CETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCI  630

Query  1056  FSLTAIDVDLGANGRVLYSITDGNTE-DRFGI-FPDGQLYVKNVLDREELDYYALEVTAT  1113
               ++A D D G N  V Y+I +G      F +    G++ +   LD E    Y   V AT
Sbjct  631   LKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLAT  690

Query  1114  DQGSPSRSSVVPVVVHIIDENDNAPEFTNSSFVLHLREN-----EPPDTFVGKLLATDRD  1168
             D+G  S ++++ +   + D NDN P F    + + LRE+     +   T +  ++ATD D
Sbjct  691   DRGGLSTTAMIKM--QLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPD  748

Query  1169  VGRNADLVFSLPASQQD--FTVDPRNGFIKSLRVFDRELLVTNTGSSYITLEATVTDNGV  1226
              G    + + + A  +   F +D   G I  +R    ++L   T   ++ L  + TD G 
Sbjct  749   YGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVR---PDMLSVRTQPMHM-LNISATDGGN  804

Query  1227  NRLRDRVKVVIYITDVNDNIPQFQRLPYRVQVNEGAAIGTQLLRVYTTDADEGLNGDVFY  1286
              R      V + I D     P F++  Y   V E    GT +  V     D      V Y
Sbjct  805   LRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRY  864

Query  1287  SLEDGNQHGRFAIDEATGQISLTKELDRETTDAYVLTVVAHDAGLETRLSSSTTVHIEVL  1346
             S+  G+  G F+I+  +G I + K LD E     +L + A     E  +   T V+IEV 
Sbjct  865   SIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLG--EPPVYGHTQVNIEVE  922

Query  1347  DENDNVPLFVDDKSSISVLETTPTNTELLRFKATDNDLGPNSELAFAISAGNRRDTFYID  1406
             D NDN P F      ISV E+      L    A D D G + ++ +++   + +  F ID
Sbjct  923   DVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAID  982

Query  1407  PLTGTLYLRKPLDYEELEKYTLNVTCSDGGHPRLSSVTTLIVEVIDANDNPPVFPNTAIA  1466
               +G L L + LDYE  +++TL VT +DGG P LS+  T++V+V D NDNPPVF     +
Sbjct  983   ARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYS  1042

Query  1467  RQIREGILVHTPIVTITAEDPDSNENGVVTYSIA---------SQDPEDQVRRFGINPST  1517
               + E   ++  I+ + A D D+  N  +TY I          S    D  + FGI P++
Sbjct  1043  VNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNS  1102

Query  1518  GVIHTLLPIDREEVDTYKLVVVATDSAQPASARLSAEKLVIVIVEDINDNAPIFVSMSAV  1577
             G I+   P+DRE  D Y+L V+ATD+  PA+    A+  VIV V D NDN P F      
Sbjct  1103  GWIYLRAPLDRETRDRYQLTVLATDNGTPAA---HAKTRVIVRVLDANDNDPKF------  1153

Query  1578  VLPLKGNYYQYQKEITVTQ------LVARDLDSSTNGLVTYELLRSSINYPDMFRIHRNT  1631
                 + + Y+++ E  + +      + A DLD   N  + Y LL   IN    F++H  T
Sbjct  1154  ----QKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLL--PIN--SSFQVHPVT  1205

Query  1632  GHLTIRLP--RSLKSSFERVSKYQVGIRATDEAVQAERRSTETYLTLIVPGEDGDDQPIW  1689
             G ++ R P  R L+  ++ V    V  R     V++ R     +++ +      D+ P  
Sbjct  1206  GEISTREPLDRELRELYDLV----VEARDQGTPVRSARVPVRIHVSDV-----NDNAPEI  1256

Query  1690  EHRGQIEGNVYENEPIGTSILRVSA--RSRRSNIDLEYYVTNVTAGSGGPQVDRLFDVDT  1747
                 +   +V E +P GT ++RV A  R    N  + Y +       G      LF +D 
Sbjct  1257  ADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDG----HGLFSIDP  1312

Query  1748  KTGILSTAAALDRETGIQWYEVELYAIGV----GGTRPSTTSTKVRVTVLDKNDVAPTWG  1803
              +G++ T   LD E      E  +Y +GV    GG  P  T   +RV VLD ND  PT+ 
Sbjct  1313  TSGVIRTRVVLDHE------ERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFT  1366

Query  1804  TGTWKFKISEEAPPNTVVTVLKAYD--PDTIGT----------LTYTLVPNHRPDPGPGT  1851
             + +  F++ E+A    VV  +   +   D +            +TYTL P          
Sbjct  1367  SSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNP----------  1416

Query  1852  ALGFYPASQHELQDESQCQFRLHPTTGQLTLAEALDRETREKYVLKVRADDGL-----QH  1906
                         +D  +  F +   +G L +A  LDRE + ++ L++RA D       Q 
Sbjct  1417  ----------LTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQS  1466

Query  1907  TDIALTIQVTDTNDNAPTFQSTAYSFDVPENVPRGSRIGQVVATDADANGPNSQLSYTLI  1966
             + I + I+V D NDNAP +        V E  P G+ I    ATDAD  G N  L Y LI
Sbjct  1467  SAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADT-GTNGDLQYRLI  1525

Query  1967  ---------SDWANDVFSLNPSTGVFTLTASLDYEQVQHYILVVQATDGG---IPALSST  2014
                       + A  +F ++  TG  +L A LD+E VQ Y+L+VQA D        L ++
Sbjct  1526  RYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTS  1585

Query  2015  VTVYCNVVDLNDNAPIF----EAGPHAAD--IVENTTIGTPILSVAAQDLDSGDNGRVIY  2068
             VTV   ++D ND+AP F     +G   A   I + T IG  +  + A D DSGDNG++ Y
Sbjct  1586  VTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTY  1645

Query  2069  AVAGGDENGDFGV-APNGTLFTRKLL-----DREQKPLYNLILSATDSPLPPALPLSSTV  2122
              + GG+  G F + +  G +   K L     D E+   +NLI+ A D   P   P  S++
Sbjct  1646  EITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPE--PKKSSL  1703

Query  2123  QVTVVLLDVNDMSPEFISPT-KISIIENAPSNTVVMAIKAVDRDEGRNGYVEYSLEDTTL  2181
              + +++   ++  P F+    + +I+EN PS + V+ + A       N  + Y +     
Sbjct  1704  NLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVA  1763

Query  2182  P--FTVGPVDGLLRVSGSLDRELRSNYTLEVTAKDRGEPPRSSSTAVT------------  2227
                F V    G++   G  DRE +++Y L V  +D       SS+AV             
Sbjct  1764  NDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTS  1823

Query  2228  -----------VTVLDENDNSPVFDPRQ-YSATVAENASIGASVLQVSAMDRDEGANGRV  2275
                        +TV D NDNSP F P   Y  +V EN+  G  +  V A D DEG N  +
Sbjct  1824  NGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGV-IHTVVASDLDEGPNADL  1882

Query  2276  RYSIAMGDDNRDFTISEDGGVIRVAKNLNFERKSRYYLTIRGEDCASEVGE-TPRGDTAQ  2334
              YSI  G+    F+I    G +  A+ L+ E+ SRY L I+    AS+ G+   R     
Sbjct  1883  IYSITGGNLGNKFSIDSSSGELS-ARPLDREQHSRYTLQIQ----ASDRGQPKSRQGHCN  1937

Query  2335  VTITVIDINDNAPVFLDSPYLAHVMENMVPPGGGFVIQVKAYDADTPPYNDQVRYFLKEG  2394
             +TI V D NDNAP F  S Y   V E+   P G  V+Q+ A DAD    N ++ Y L   
Sbjct  1938  ITIFVEDQNDNAPRFKLSKYTGSVQEDA--PLGTSVVQISAVDADL-GVNARLVYSLANE  1994

Query  2395  DTDLFRINASTGDIFLLRPLDRELVAEYTLTLVAMDTGSPPLTGSGI-VRIVVLDVNDHI  2453
                 F I+  +G I  +  LDREL A Y   ++A D G   +  + + V+I VLD+ND+ 
Sbjct  1995  TQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNR  2054

Query  2454  PEFTRQEYRATVTENLASGTWVTKPHATDKDEGLNAKIRYSLLGEN---SERFTVEPETG  2510
             P F R  Y   V   +  G  + K  A D D G NA+I YSL  EN   S +F + P TG
Sbjct  2055  PIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTG  2114

Query  2511  EVLTVVPLDREQTAVYHLTLVAQDSSPTEPQASAVNLTIFVKDVNDNAP--RFSSPRYTA  2568
              +     L  E   + HL +VA+D     PQ+S   + + + +     P  RF +  Y  
Sbjct  2115  ALSASQSLASESGKLLHLEVVARDKG-NPPQSSLGLIELLIGEAPQGTPVLRFQNETYRV  2173

Query  2569  YVPGATKPGDFVFGAKAVDDDDGENSRIVYRLQGIDAEKFV-IDPNSGVIRTTQ------  2621
              +   +  G  +    A+   DG   ++ +     + +  + +D  SG IR  +      
Sbjct  2174  MLKENSPSGTRLLQVVAL-RSDGRRQKVQFSFGAGNEDGILSLDSLSGEIRVNKPHLLDY  2232

Query  2622  ----------------------------ELANDETTYQLQIQASDCGV---KPQTVTADL  2650
                                         E  N+ T  Q  + +S   +   +P  +   L
Sbjct  2233  DRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVL  2292

Query  2651  VIHLWERQLFPSFRSTI---------STRF-------TLPEDVPEGRVITKLSATTPKVG  2694
             V    +     S+   +         S +F       T+ E   +G  + ++ A     G
Sbjct  2293  VARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAG  2352

Query  2695  TASNLVYGMAGGNVGDALKIDP-HTGEVLVASGFDYETAPFYEAWVEVRDSDTPALRSVV  2753
             + + L Y +  GN  +A  I+P  +G V      D E    Y+  +   D   P +    
Sbjct  2353  SNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTA  2412

Query  2754  QLLVNVTDANDNAPIMEAAIYNATVPEDEYPPLFVNKVSANDRDSGENGQVSYYLVNDFT  2813
              + V + D NDN P         TV E       +  +SAND D+     ++Y L  + T
Sbjct  2413  TIRVQIVDVNDNQPTFPPNNL-VTVSEATELGAVITSISANDVDTYP--ALTYRLGAEST  2469

Query  2814  ------ETFVIDSDTGEISTNAKLDREEIASYELIVEARDQGQPSLTGTATVLLTVLDKN  2867
                     F +D  +G++    +LD E    YEL V A D    + T    + + V D+N
Sbjct  2470  VDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEART---VLTVRVNDEN  2526

Query  2868  DNPPQFT-----RLFSV-----NVTENAEIGTFVIRITSSDLDI-GQNANVTYRFTENPG  2916
             DN P F        F++      ++E+  +   ++ + ++D D  G N+ V Y   E   
Sbjct  2527  DNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIY-IIEPAQ  2585

Query  2917  EKFAMDALSGNVTVNGHLDREE-----QDEYLLKLVAADG---AWQAATALTITIQDQND  2968
             E F++   +G V+VN  + R +       +Y ++++A D    A +++T L +   D   
Sbjct  2586  EGFSVHPSNGVVSVN--MSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGS  2643

Query  2969  NPPEFDEESYHFHFPELQP---PVAHVGQVTAIDRDKQ--GPNSVISYSLLQPSDLFTVD  3023
                +F +  Y     E  P    V  +GQ  A+D+       N   ++ LLQ   +  V 
Sbjct  2644  GRSQFLQNQYRAQISEAAPLGSVVLQLGQ-DALDQSLAIIAGNEESAFELLQSKAIVLVK  2702

Query  3024  PATGDVFSKKTLKYKHTHRPSSPENLYSLTVVATDNGKPP------LSSKTVVYVNVVDA  3077
             P   +                   +LY L +V +    PP       SS   V + ++DA
Sbjct  2703  PLDRE-----------------RNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDA  2745

Query  3078  NNNAPRFDQRS-YLYPVPENYGVGKRVVQLMAKD-DADFGVNAEISYFMTNVNGSEYFSI  3135
             N+N P FD+ + Y   + E   +   + QL A D D +   N+E+ Y +T+ N    F+I
Sbjct  2746  NDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTI  2805

Query  3136  DEKSGWVYVRNTLSNVPVRTTFLLKVQAIDKGVPPQKDEVSLT---LVISGENKHAPTFA  3192
             D  +G ++V N L       ++ L ++A D     Q+   SL    L +  EN + P F 
Sbjct  2806  DLVTGVLFVNNRLDYDSGAKSYELIIRACDSH--HQRPLCSLQPFRLELHDENDNEPKFP  2863

Query  3193  AVSHQVRVPENEPVNTTILTVSATDGDDGPNGMIRYKI----SAGNEKNEFFVHSITGAV  3248
                +   + ENEPV +++    A+D D GP G + Y I    S  +    F V S +G V
Sbjct  2864  LTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLV  2923

Query  3249  TILEPLDYDLVQEYKLNITATDLGFEPKQAVAILTVNVSDINDNPPTFNQSIYEAYLPEN  3308
             T     DY+  Q Y + + A+D+G   K+A   + V +   ++  P F +  Y   LP  
Sbjct  2924  TSAFVFDYEQRQRYDMELLASDMG--GKKASVAVRVEIESRDEFTPQFTERTYRFVLPAA  2981

Query  3309  S--PPDSFVYKVIARDIDSPKYAVIQYKILGGTGKDHFRIREDTGEI  3353
                P    V +V A D DS     + Y++       HF++   +G +
Sbjct  2982  VALPQGYVVGQVTATDSDSGPDGRVVYQL--SAPHSHFKVNRSSGAV  3026


 Score = 839 bits (2167),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 888/3068 (29%), Positives = 1370/3068 (45%), Gaps = 353/3068 (12%)

Query  230   LETTGKLDREQVEFYSLNVCARDRGRPPRLGYLLVNVTVLDVNDNPPIFQQSDYVVALNE  289
             + T  KLDRE    YSL V     GR  R     V VTV D NDN P F Q+   +   E
Sbjct  132   IRTKVKLDRETRASYSL-VAIPLSGRNIR-----VLVTVKDENDNAPTFPQTSMHIEFPE  185

Query  290   SAPVGTKVLTVHATDKDSEDNSKLTYYLPDTERQFTIDPETGTITTVEPLDCPQQ-----  344
             + P   K   + A D D E         P   +++ I   +G +     L   ++     
Sbjct  186   NTPREVKRTLLPARDLDLE---------PYNTQRYNI--VSGNVNDAFRLSSHRERDGVL  234

Query  345   --SCTIAARLGDGCPKSCVITVFARDHGSPRQDGRTYVTVNLLDANDHDPEIKFSYFPST  402
                  I+  L         + + A D G+P   G   V + + D ND+ P    S +   
Sbjct  235   YLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRY---  291

Query  403   PGFATVDENAAKDSIVAAVAVIDNDEGLNG--ETTVEIRAGNELGHFRLDNTPSFDIVRV  460
               FATV ENA   + V  V   D D   NG  E  +  R  ++   FR+D  P    + +
Sbjct  292   --FATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRID--PRTGAIYI  347

Query  461   NGRLDREEIPKYNLTVVATDKGTPPRSATAYLVIHVNDVNDHEP----VFQQSEYSAVLS  516
             N  LD E    + L VVA D G  P   TA++ I V DVND++P    +F   + S  +S
Sbjct  348   NKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKIS  407

Query  517   ELSPTGSFVASISATDADSGLN-ARIYYDFDSGNEQGWFAI---DQDTGLVTTVATLDRE  572
             E +  G FVA IS  D DS    A +    + G+  G FA+   D    LV     LDRE
Sbjct  408   ESAQPGEFVARISVHDPDSKTEYANVNVTLNGGD--GHFALTTRDNSIYLVIVHLPLDRE  465

Query  573   VQGSIELHVSARDGGPNPKYASTHLKVTILDENDEAPRFSQNVVRVTLSENTPPQSLVAT  632
             +  +  L V A D G  P +AS  + + I D ND  P F Q++    + E   P + V  
Sbjct  466   IVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQ  525

Query  633   LTAVDNDQGTNGSVAYSFHSSVSRDYPKTFALDGLTGQLTTKVNLDRETTAEYQILVIAK  692
             + A D D+G N ++ YS  +     + + F +D  TG +TT+ ++D ET    Q+ V+A+
Sbjct  526   VLAHDRDEGLNSALTYSL-AETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVAR  584

Query  693   DQGTPPQSSTATVILTLEDVNDNSPVFYPWRYLMPIPEDAPPGTSVGKVTATDADARENA  752
             D G PP SSTATV++T+ DVNDN P+F    Y + + E+ P G  + KV+A+D D   NA
Sbjct  585   DGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNA  644

Query  753   QVRYSLESGGEGL--FTVDERTGEITLQGSLRAAHKTLYELNISAKDTGDRVAGRNALVE  810
              V Y++  G + L  F V   +GEI + G L    ++ YE  + A D G         ++
Sbjct  645   MVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLSTTAMIKMQ  704

Query  811   IIREEDLEHLEFDTYNGYEFRIAEDRGECGAMSNVFARDAGTVQITQYDSSKISYAIVFG  870
             +    D   + +        R +       + + + A  A       +   ++SY IV G
Sbjct  705   LTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNF--GQVSYRIVAG  762

Query  871   DPKGNFKIDESTGTIST--SGCLDREQVAYYSLQLSARAG---LAYGQTSVNITVLDIND  925
             +  G F+ID STG I       L       + L +SA  G    +     V ++++D   
Sbjct  763   NEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQ  822

Query  926   NPPRFPKGEIGDEVLLKENAAVGQEVCLARARDRDASANARIVYSL-THNPGGQFRVAEN  984
              PP F K        +KE+   G  V    A   D +  + + YS+ + +P G F +  N
Sbjct  823   RPPIFEKARYN--YYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETN  880

Query  985   SGIIYLDKPIRAAPGTVLHLEVTATDSGNQPLSAQHQVRVTIEDVNDHTPVFKLTSYETS  1044
             SG I + KP+     + + L + AT  G  P+    QV + +EDVND+ P F+ +    S
Sbjct  881   SGNIRIAKPLDHEAKSQVLLNIQAT-LGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRIS  939

Query  1045  LPESTPVNDRFFSLTAIDVDLGANGRVLYSITDGNTEDRFGI-FPDGQLYVKNVLDREEL  1103
             +PES  +    ++  A D D G++G+V YS+   + +  F I    G L +   LD E  
Sbjct  940   VPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYESS  999

Query  1104  DYYALEVTATDQGSPSRSSVVPVVVHIIDENDNAPEFTNSSFVLHLRENEPPDTFVGKLL  1163
               + L VTATD G PS S+ + ++V + D NDN P F    + +++ E+   +  + ++ 
Sbjct  1000  QRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVN  1059

Query  1164  ATDRDVGRNADLVF------------SLPAS--QQDFTVDPRNGFIKSLRVFDRELLVTN  1209
             A+D D G NA + +            S+ +S   Q F + P +G+I      DRE     
Sbjct  1060  ASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRE-----  1114

Query  1210  TGSSYITLEATVTDNGVNRLRDRVKVVIYITDVNDNIPQFQRLPYRVQVNEGAAIGTQLL  1269
             T   Y  L    TDNG      + +V++ + D NDN P+FQ+  Y  ++ E    G+ + 
Sbjct  1115  TRDRY-QLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVG  1173

Query  1270  RVYTTDADEGLNGDVFYSLEDGNQHGRFAIDEATGQISLTKELDRETTDAYVLTVVAHDA  1329
              V  +D D G N  + YSL   N    F +   TG+IS  + LDRE  + Y L V A D 
Sbjct  1174  VVTASDLDLGENAAIRYSLLPIN--SSFQVHPVTGEISTREPLDRELRELYDLVVEARDQ  1231

Query  1330  GLETRLSSSTTVHIEVLDENDNVPLFVDDKSSI-SVLETTPTNTELLRFKATDNDLGPNS  1388
             G   R S+   V I V D NDN P   D +  + SV E  P  TE++R +A D D G N+
Sbjct  1232  GTPVR-SARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNA  1290

Query  1389  ELAFAISAGNRRD---TFYIDPLTGTLYLRKPLDYEELEKYTLNVTCSDGGHPRLSSVTT  1445
              + ++I  G   D    F IDP +G +  R  LD+EE   Y L V  SDGG+P   +V  
Sbjct  1291  SITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRM  1350

Query  1446  LIVEVIDANDNPPVFPNTAIARQIREGILVHTPIVTIT-AEDP---------DSNENGVV  1495
             L VEV+D NDN P F ++++  ++RE   +   + +I+  E P         +S E+  V
Sbjct  1351  LRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRV  1410

Query  1496  TYSIASQDPEDQVRRFGINPSTGVIHTLLPIDREEVDTYKLVVVATDSAQPASARLSAEK  1555
             TY++     +     F I+  +G +     +DRE    ++L + A D+    + + SA  
Sbjct  1411  TYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSA-I  1469

Query  1556  LVIVIVEDINDNAPIFVSMSAVVLPLKGNYYQYQKEITVTQLV----ARDLDSSTNGLVT  1611
              V + V D+NDNAP +        P      Q  +   V  ++    A D D+ TNG + 
Sbjct  1470  TVKIEVADVNDNAPEW--------PQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQ  1521

Query  1612  YELLR-------SSINYPDMFRIHRNTGHLTIRLPRSLKSSFERVSKYQVGIRATDEAVQ  1664
             Y L+R       S      +FR+   TG L+++ P      FE V +Y + ++A D++  
Sbjct  1522  YRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLD----FEAVQEYLLIVQALDQSSN  1577

Query  1665  AERRSTETYLTLIVPGEDGDDQ-PIWEHRGQIEGN-----VYENEPIGTSILRVSARSRR  1718
                R  +T +T+ +   D +D  P +       G      + +   IG  +  + A    
Sbjct  1578  VTER-LQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDED  1636

Query  1719  S--NIDLEYYVTNVTAGSGGPQVDRLFDVDTKTGILSTAAAL-----DRETGIQWYEVEL  1771
             S  N  L Y    +T G+G    +  F ++++TGI+    +L     D E G + + + +
Sbjct  1637  SGDNGQLTY---EITGGNG----EGRFRINSQTGIIELVKSLPPATEDVEKGGR-FNLII  1688

Query  1772  YAIGVGGTRPSTTSTKVRVTVLDKNDVAPTWGTGTWKFKISEEAPPNTVVTVLKAYDPDT  1831
              A   G   P  +S  + + V   ++  P +    ++  I E  P  + V  +       
Sbjct  1689  GAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQV-------  1741

Query  1832  IGTLTYTLVPNHRPDPGPGTALGFYPASQHELQDE-----SQCQFRLHPTTGQLTLAEAL  1886
                                TA   + A    L  E     +   F +    G +T     
Sbjct  1742  -------------------TAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQF  1782

Query  1887  DRETREKYVL-------------------KVRADDGL------QHTDIA-LTIQVTDTND  1920
             DRE++  YVL                   K R+ D +      QH D+A + I V D ND
Sbjct  1783  DRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVND  1842

Query  1921  NAPTFQ-STAYSFDVPENVPRGSRIGQVVATDADANGPNSQLSYTLISDWANDVFSLNPS  1979
             N+P F+  + Y   VPEN   G  I  VVA+D D  GPN+ L Y++      + FS++ S
Sbjct  1843  NSPEFRPGSCYGLSVPENSEPGV-IHTVVASDLD-EGPNADLIYSITGGNLGNKFSIDSS  1900

Query  1980  TGVFTLTASLDYEQVQHYILVVQATDGGIPALSSTVTVYCNVV----DLNDNAPIFEAGP  2035
             +G  +    LD EQ   Y L +QA+D G P    +   +CN+     D NDNAP F+   
Sbjct  1901  SGELS-ARPLDREQHSRYTLQIQASDRGQP---KSRQGHCNITIFVEDQNDNAPRFKLSK  1956

Query  2036  HAADIVENTTIGTPILSVAAQDLDSGDNGRVIYAVAGGDENGDFGV-APNGTLFTRKLLD  2094
             +   + E+  +GT ++ ++A D D G N R++Y++A  +    F +   +G + T   LD
Sbjct  1957  YTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLAN-ETQWQFAIDGQSGLITTVGKLD  2015

Query  2095  REQKPLYNLILSATDSPLPPALPLSSTVQVTVVLLDVNDMSPEFISPTKISIIENAPS--  2152
             RE +  YN ++ ATD         S+TV V + +LD+ND  P F    +   I   P+  
Sbjct  2016  RELQASYNFMVLATDGGRYEVR--SATVPVQINVLDINDNRPIF---ERYPYIGQVPALI  2070

Query  2153  --NTVVMAIKAVDRDEGRNGYVEYSL----EDTTLPFTVGPVDGLLRVSGSLDRELRSNY  2206
                  ++ ++A+D D G N  + YSL       +  F + P  G L  S SL  E     
Sbjct  2071  QPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLL  2130

Query  2207  TLEVTAKDRGEPPRSSSTAVTVTVLDENDNSPV--FDPRQYSATVAENASIGASVLQVSA  2264
              LEV A+D+G PP+SS   + + + +    +PV  F    Y   + EN+  G  +LQV A
Sbjct  2131  HLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVA  2190

Query  2265  MDRDEGANGRVRYSIAMGDDNRDFTISEDGGVIRVAKN--LNFER---------------  2307
             + R +G   +V++S   G+++   ++    G IRV K   L+++R               
Sbjct  2191  L-RSDGRRQKVQFSFGAGNEDGILSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRAL  2249

Query  2308  -------------------------KSRYYLT------IRGEDCASEVGETPRGDTAQVT  2336
                                       S + LT      IR    A           A++ 
Sbjct  2250  HYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELV  2309

Query  2337  ITVIDINDNAPVFLDSPYLAHVMENMVPPGGGFVIQVKAYDADTPPYNDQVRYFLKEGDT  2396
             I + D NDN+P F    ++A V E      G FV QV A+D+D    N ++RY + +G+ 
Sbjct  2310  IELEDENDNSPKFSQKQFVATVSEGN--NKGTFVAQVHAFDSDAGS-NARLRYHIVDGNH  2366

Query  2397  D-LFRIN-ASTGDIFLLRPLDRELVAEYTLTLVAMDTGSPPLTGSGIVRIVVLDVNDHIP  2454
             D  F I  A +G +     LDRE+   Y L ++A D G P +TG+  +R+ ++DVND+ P
Sbjct  2367  DNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQP  2426

Query  2455  EFTRQEYRATVTENLASGTWVTKPHATDKDEGLNAKIRYSLLGE------NSERFTVEPE  2508
              F       TV+E    G  +T   A D D      + Y L  E      N   F ++  
Sbjct  2427  TFPPNNL-VTVSEATELGAVITSISANDVDT--YPALTYRLGAESTVDIENMSIFALDRY  2483

Query  2509  TGEVLTVVPLDREQTAVYHLTLVAQDSSPTEPQASAVNLTIFVKDVNDNAPRFSS---PR  2565
             +G+++    LD E    Y L ++A D++      +   LT+ V D NDNAP F +   P 
Sbjct  2484  SGKLVLKRRLDYELQQEYELDVIASDAA----HEARTVLTVRVNDENDNAPVFLAQQPPA  2539

Query  2566  YTAYVPGATKPG-----DF-VFGAKAVD-DDDGENSRIVYRLQGIDAEKFVIDPNSGVIR  2618
             Y A +P  ++       DF +    A D D +G NS+++Y ++    E F + P++GV+ 
Sbjct  2540  YFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQ-EGFSVHPSNGVVS  2598

Query  2619  TT----QELANDETTYQLQIQASDCGVKPQTVTADLVIHLWERQLFPSFRSTI---STRF  2671
                   Q   +    Y ++I A D G KP   ++ L+    +     S RS       R 
Sbjct  2599  VNMSRLQPAVSSSGDYFVRIIAKDAG-KPALKSSTLL--RVQANDNGSGRSQFLQNQYRA  2655

Query  2672  TLPEDVPEGRVITKLSATTPKVGTASNLVYGMAGGNVGDALKIDPHTGEVLVASGFDYET  2731
              + E  P G V+ +L         A +    +  GN   A ++      VLV    D E 
Sbjct  2656  QISEAAPLGSVVLQLGQD------ALDQSLAIIAGNEESAFELLQSKAIVLVKP-LDRER  2708

Query  2732  APFYEAWVEVRDSDTP------ALRSVVQLLVNVTDANDNAPIME-AAIYNATVPEDEYP  2784
                Y+  + +     P         S + +++ + DANDN PI + +A Y A + E    
Sbjct  2709  NDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPL  2768

Query  2785  PLFVNKVSANDRDSGE--NGQVSYYLVNDFTE-TFVIDSDTGEISTNAKLDREEIA-SYE  2840
                + ++ A D D     N +V Y + +   E  F ID  TG +  N +LD +  A SYE
Sbjct  2769  RYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYE  2828

Query  2841  LIVEARD-QGQPSLTGTATVLLTVLDKNDNPPQFTRLFSVN-VTENAEIGTFVIRITSSD  2898
             LI+ A D   Q  L       L + D+NDN P+F     V+ + EN  +G+ V R  +SD
Sbjct  2829  LIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASD  2888

Query  2899  LDIGQNANVTYRFTENPGEK-----FAMDALSGNVTVNGHLDREEQDEYLLKLVAAD-GA  2952
             LD G    + Y     P ++     F +D+ SG VT     D E++  Y ++L+A+D G 
Sbjct  2889  LDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGG  2948

Query  2953  WQAATALTITIQDQNDNPPEFDEESYHFHFPEL--QPPVAHVGQVTAIDRDKQGPNSVIS  3010
              +A+ A+ + I+ +++  P+F E +Y F  P     P    VGQVTA D D  GP+  + 
Sbjct  2949  KKASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDS-GPDGRVV  3007

Query  3011  YSLLQPSDLFTVDPATGDVFSKKTLKYKHTHRPSSPENLY------SLTVVATDNGKPPL  3064
             Y L  P   F V+ ++G V  K+ LK           NLY      SL + A+      L
Sbjct  3008  YQLSAPHSHFKVNRSSGAVLIKRKLKLDG----DGDGNLYMDGRDISLVISASSGRHNSL  3063

Query  3065  SSKTVVYV  3072
             SS  VV +
Sbjct  3064  SSMAVVEI  3071


 Score = 821 bits (2121),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 709/2208 (32%), Positives = 1047/2208 (47%), Gaps = 215/2208 (10%)

Query  109   EFVLDPETGKIRTAKVLDREALSSDRFDLVVLSSQPTYPIEVRILVLDINDNDPEFPESS  168
             +  +D  TG+IRT   LDRE  +S     + LS +    I V + V D NDN P FP++S
Sbjct  122   DLAIDRATGEIRTKVKLDRETRASYSLVAIPLSGRN---IRVLVTVKDENDNAPTFPQTS  178

Query  169   IAVSFSESAVVGTKLLLDAATDKDTLENGVVDDYFIVNGNTDEKFRLEVTGNPTGETSYL  228
             + + F E+     K  L  A D D LE      Y IV+GN ++ FRL       G   YL
Sbjct  179   MHIEFPENTPREVKRTLLPARDLD-LEPYNTQRYNIVSGNVNDAFRLSSHRERDG-VLYL  236

Query  229   HLETTGKLDREQVEFYSLNVCARDRGRPPRLGYLLVNVTVLDVNDNPPIFQQSDYVVALN  288
              L+ +G LDRE    YSL + A D G PP  G++ VN+T+ DVNDN PIF QS Y   + 
Sbjct  237   DLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVP  296

Query  289   ESAPVGTKVLTVHATDKDSEDNSKLTYYL----PDTERQFTIDPETGTITTVEPLDCPQQ  344
             E+A VGT VL V+A+D D+++N  + Y +     D E+ F IDP TG I   + LD   +
Sbjct  297   ENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETK  356

Query  345   SCTIAARLGDGCPKSCVITVFARDHGSPRQDGRTYVTVNLLDANDHDPEIKFSYFPSTPG  404
                              + V A+DHG    +   +V++ + D ND+ P I    F S   
Sbjct  357   EL-------------HELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINV-IFLSDDA  402

Query  405   FATVDENAAKDSIVAAVAVIDNDEGLN-GETTVEIRAGNELGHFRL---DNTPSFDIVRV  460
                + E+A     VA ++V D D         V +  G+  GHF L   DN  S  +V V
Sbjct  403   SPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGD--GHFALTTRDN--SIYLVIV  458

Query  461   NGRLDREEIPKYNLTVVATDKGTPPRSATAYLVIHVNDVNDHEPVFQQSEYSAVLSELSP  520
             +  LDRE +  Y L+VVATDKGTPP  A+  + + + DVND+ P F+Q  Y A + E++ 
Sbjct  459   HLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVAD  518

Query  521   TGSFVASISATDADSGLNARIYYDFDSGNE--QGWFAIDQDTGLVTTVATLDREVQGSIE  578
              G+ V  + A D D GLN+ + Y      E    WF ID  TGL+TT + +D E +   +
Sbjct  519   PGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQ  578

Query  579   LHVSARDGGPNPKYASTHLKVTILDENDEAPRFSQNVVRVTLSENTPPQSLVATLTAVDN  638
             L V ARDGG  P  ++  + VTI D ND  P F Q+   V+++EN P    +  ++A D 
Sbjct  579   LTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDP  638

Query  639   DQGTNGSVAYSFHSSVSRDYPKTFALDGLTGQLTTKVNLDRETTAEYQILVIAKDQGTPP  698
             D G N  V Y+        +   F +   +G++     LD E  + Y+  V+A D+G   
Sbjct  639   DCGVNAMVNYTIGEGFK--HLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGG--  694

Query  699   QSSTATVILTLEDVNDNSPVFYPWRYLMPIPEDAPPGTS------VGKVTATDADARENA  752
              S+TA + + L DVNDN PVFYP  Y + + E +P  +S      +  V ATD D     
Sbjct  695   LSTTAMIKMQLTDVNDNRPVFYPREYKVSLRE-SPKASSQASSTPIVAVVATDPDYGNFG  753

Query  753   QVRYSLESGGE-GLFTVDERTGEITL--QGSLRAAHKTLYELNISAKDTGDRVAGRNALV  809
             QV Y + +G E G+F +D  TGEI +     L    + ++ LNISA D G+  +  +A+V
Sbjct  754   QVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVV  813

Query  810   EIIREEDLEHLEFDTYNGYEFRIAEDRGECGAMSNVFARDAGTVQITQYDSSKISYAIVF  869
              +   + ++         Y + + ED      + +V A             S + Y+I  
Sbjct  814   FLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAH-----RSPVRYSIYS  868

Query  870   GDPKGNFKIDESTGTISTSGCLDREQVAYYSLQLSARAGL--AYGQTSVNITVLDINDNP  927
             GDP G F I+ ++G I  +  LD E  +   L + A  G    YG T VNI V D+NDN 
Sbjct  869   GDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVYGHTQVNIEVEDVNDNA  928

Query  928   PRFPKGEIGDEVLLKENAAVGQEVCLARARDRDASANARIVYSLTHNPG-GQFRVAENSG  986
             P F    +   + + E+A +G  +  A A D+D+ ++ ++ YSL    G G F +   SG
Sbjct  929   PEFEASMV--RISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSG  986

Query  987   IIYLDKPIRAAPGTVLHLEVTATDSGNQPLSAQHQVRVTIEDVNDHTPVFKLTSYETSLP  1046
              + L + +         L VTATD G   LS    + V ++DVND+ PVF+   Y  ++ 
Sbjct  987   HLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVS  1046

Query  1047  ESTPVNDRFFSLTAIDVDLGANGRVLYSITDGNTED------------RFGIFPD-GQLY  1093
             ES  +N +   + A D+D G N R+ Y I D   ++             FGIFP+ G +Y
Sbjct  1047  ESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIY  1106

Query  1094  VKNVLDREELDYYALEVTATDQGSPSRSSVVPVVVHIIDENDNAPEFTNSSFVLHLRENE  1153
             ++  LDRE  D Y L V ATD G+P+  +   V+V ++D NDN P+F  S +   + EN 
Sbjct  1107  LRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENL  1166

Query  1154  PPDTFVGKLLATDRDVGRNADLVFSLPASQQDFTVDPRNGFIKSLRVFDRELLVTNTGSS  1213
                + VG + A+D D+G NA + +SL      F V P  G I +    DREL        
Sbjct  1167  RRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQVHPVTGEISTREPLDREL------RE  1220

Query  1214  YITLEATVTDNGVNRLRDRVKVVIYITDVNDNIPQFQRLPYR--VQVNEGAAIGTQLLRV  1271
                L     D G      RV V I+++DVNDN P+    P    V V E    GT+++RV
Sbjct  1221  LYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIAD-PQEDVVSVREEQPPGTEVVRV  1279

Query  1272  YTTDADEGLNGDVFYSL---EDGNQHGRFAIDEATGQISLTKELDRETTDAYVLTVVAHD  1328
                D D G N  + YS+    D + HG F+ID  +G I     LD E    Y L V A D
Sbjct  1280  RAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASD  1339

Query  1329  AGLETRLSSSTTVHIEVLDENDNVPLFVDDKSSISVLETTPTNTELLRFKATDN--DLGP  1386
              G   R  +   + +EVLD NDN P F        V E       +      +   D+  
Sbjct  1340  GGNPPR-ETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVR  1398

Query  1387  NS-ELAFAISAGNRRDTFYIDPLT--------------GTLYLRKPLDYEELEKYTLNVT  1431
             NS E +F     + R T+ ++PLT              G L + + LD E   ++ L + 
Sbjct  1399  NSVEESFE----DLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIR  1454

Query  1432  CSD---GGHPRLSSVTTLIVEVIDANDNPPVFPNTAIARQIREGILVHTPIVTITAEDPD  1488
               D     +P+ SS  T+ +EV D NDN P +P   I  Q+ E   V T I   TA D D
Sbjct  1455  ALDTTASNNPQ-SSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDAD  1513

Query  1489  SNENGVVTYSIASQDP------EDQVRRFGINPSTGVIHTLLPIDREEVDTYKLVVVATD  1542
             +  NG + Y +    P      E  +  F ++  TG +    P+D E V  Y L+V A D
Sbjct  1514  TGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALD  1573

Query  1543  SAQPASARLSAEKLVIVIVEDINDNAPIFVSMSAVVLPLKGNYYQYQKEI--TVTQLVAR  1600
              +   + RL     V + + D ND+AP FVS ++        +      I   V  +VA 
Sbjct  1574  QSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAV  1633

Query  1601  DLDSSTNGLVTYELLRSSINYPDMFRIHRNTGHLTIRLPRSLKSSFERVSK---YQVGIR  1657
             D DS  NG +TYE+  +  N    FRI+  TG   I L +SL  + E V K   + + I 
Sbjct  1634  DEDSGDNGQLTYEI--TGGNGEGRFRINSQTG--IIELVKSLPPATEDVEKGGRFNLIIG  1689

Query  1658  ATDEAVQAERRSTETYLTLIVPGEDGDDQPIWEHRGQIEGNVYENEPIGTSILRVSARSR  1717
             A D   Q E + +   L LIV G    + P    +      + EN P G+ +L+V+A+S 
Sbjct  1690  AKDHG-QPEPKKSSLNLHLIVQG--SHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSL  1746

Query  1718  R--SNIDLEYYVTNVTAGSGGPQVDRLFDVDTKTGILSTAAALDRETGIQWY--------  1767
                 N +L Y    + AG      + LF VD + GI++T    DRE+   +         
Sbjct  1747  HGAENANLSY---EIPAGVA----NDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDA  1799

Query  1768  --EVELYAIGVGGTRPSTT-----------STKVRVTVLDKNDVAPTWGTGT-WKFKISE  1813
               +  L +  V   R S +              + +TV D ND +P +  G+ +   + E
Sbjct  1800  NRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPE  1859

Query  1814  EAPPNTVVTVLKA-YDPDTIGTLTYTLVPNHRPDPGPGTALGFYPASQHELQDESQCQFR  1872
              + P  + TV+ +  D      L Y++          G  LG               +F 
Sbjct  1860  NSEPGVIHTVVASDLDEGPNADLIYSIT---------GGNLG--------------NKFS  1896

Query  1873  LHPTTGQLTLAEALDRETREKYVLKVRADDGLQ------HTDIALTIQVTDTNDNAPTFQ  1926
             +  ++G+L+ A  LDRE   +Y L+++A D  Q      H +I  TI V D NDNAP F+
Sbjct  1897  IDSSSGELS-ARPLDREQHSRYTLQIQASDRGQPKSRQGHCNI--TIFVEDQNDNAPRFK  1953

Query  1927  STAYSFDVPENVPRGSRIGQVVATDADANGPNSQLSYTLISD--WANDVFSLNPSTGVFT  1984
              + Y+  V E+ P G+ + Q+ A DAD  G N++L Y+L ++  W    F+++  +G+ T
Sbjct  1954  LSKYTGSVQEDAPLGTSVVQISAVDADL-GVNARLVYSLANETQWQ---FAIDGQSGLIT  2009

Query  1985  LTASLDYEQVQHYILVVQATDGG-IPALSSTVTVYCNVVDLNDNAPIFEAGPHAADIVEN  2043
                 LD E    Y  +V ATDGG     S+TV V  NV+D+NDN PIFE  P+   +   
Sbjct  2010  TVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPAL  2069

Query  2044  TTIGTPILSVAAQDLDSGDNGRVIYAVAGGDE--NGDFGVAPN-GTLFTRKLLDREQKPL  2100
                G  +L V A D D G N  ++Y++   +   +  F + P+ G L   + L  E   L
Sbjct  2070  IQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKL  2129

Query  2101  YNLILSATDSPLPPALPLSSTVQVTVVLLDVNDMSP--EFISPT-KISIIENAPSNTVVM  2157
              +L + A D   PP    SS   + +++ +    +P   F + T ++ + EN+PS T ++
Sbjct  2130  LHLEVVARDKGNPPQ---SSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLL  2186

Query  2158  AIKAVDRDEGRNGYVEYSLEDTTLPFTVGPVDGLLRVSGSLDRELRSN  2205
              + A+ R +GR   V++S       F  G  DG+L +  SL  E+R N
Sbjct  2187  QVVAL-RSDGRRQKVQFS-------FGAGNEDGILSLD-SLSGEIRVN  2225


 Score = 818 bits (2112),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 832/2887 (29%), Positives = 1266/2887 (44%), Gaps = 296/2887 (10%)

Query  1015  PLSAQH-QVRVTIEDVNDHTPVFKLTSYETSLPESTPVNDRFFSLTAIDVDLGANGRVLY  1073
             PLS ++ +V VT++D ND+ P F  TS     PE+TP   +   L A D+DL       Y
Sbjct  152   PLSGRNIRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRY  211

Query  1074  SITDGNTEDRFGIFP----DGQLY----VKNVLDREELDYYALEVTATDQGSPSRSSVVP  1125
             +I  GN  D F +      DG LY    +   LDRE    Y+L + A D G+P     + 
Sbjct  212   NIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMT  271

Query  1126  VVVHIIDENDNAPEFTNSSFVLHLRENEPPDTFVGKLLATDRDVGRNADLVFSLPASQQD  1185
             V + I D NDN P F  S +   + EN    T V ++ A+D D   N  + +++   Q D
Sbjct  272   VNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSD  331

Query  1186  ----FTVDPRNGFIKSLRVFDRELLVTNTGSSYITLEATVTDNGVNRLRDRVKVVIYITD  1241
                 F +DPR G I   +  D E            L     D+G   L     V I +TD
Sbjct  332   KEQMFRIDPRTGAIYINKALDFET------KELHELVVVAKDHGEQPLETTAFVSIRVTD  385

Query  1242  VNDNIPQ----FQRLPYRVQVNEGAAIGTQLLRVYTTDADEGLN-GDVFYSLEDGNQHGR  1296
             VNDN P     F       +++E A  G  + R+   D D      +V  +L  G+ H  
Sbjct  386   VNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGH--  443

Query  1297  FAIDEATGQISLT---KELDRETTDAYVLTVVAHDAGLETRLSSSTTVHIEVLDENDNVP  1353
             FA+      I L      LDRE    Y L+VVA D G    L +S ++ + + D NDN P
Sbjct  444   FALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPP-LHASKSIFLRITDVNDNPP  502

Query  1354  LFVDDKSSISVLETTPTNTELLRFKATDNDLGPNSELAFAISAG--NRRDTFYIDPLTGT  1411
              F  D    +V+E     T +L+  A D D G NS L ++++         F IDP TG 
Sbjct  503   EFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGL  562

Query  1412  LYLRKPLDYEELEKYTLNVTCSDGGHPRLSSVTTLIVEVIDANDNPPVFPNTAIARQIRE  1471
             +  R  +D E      L V   DGG P LSS  T++V + D NDN P+F  +     + E
Sbjct  563   ITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAE  622

Query  1472  GILVHTPIVTITAEDPDSNENGVVTYSIASQDPEDQVRRFGINPSTGVIHTLLPIDREEV  1531
                V   I+ ++A DPD   N +V Y+I   +    +  F +  ++G I     +D E  
Sbjct  623   NEPVGRCILKVSASDPDCGVNAMVNYTIG--EGFKHLTEFEVRSASGEICIAGELDFERR  680

Query  1532  DTYKLVVVATDSAQPASARLSAEKLVIVIVEDINDNAPIFVSMSAVVLPLKGNYYQYQKE  1591
              +Y+  V+ATD        LS   ++ + + D+NDN P+F      V   +      Q  
Sbjct  681   SSYEFPVLATDRGG-----LSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQAS  735

Query  1592  IT-VTQLVARDLDSSTNGLVTYELLRSSINYPDMFRIHRNTGHLTIRLPRSLKSSFERVS  1650
              T +  +VA D D    G V+Y ++    N   +FRI R+TG + +  P  L  S     
Sbjct  736   STPIVAVVATDPDYGNFGQVSYRIVAG--NEAGIFRIDRSTGEIFVVRPDML--SVRTQP  791

Query  1651  KYQVGIRATDEAVQAERRSTETYLTLIVPGEDGDDQPIWEHRGQIEGNVYENEPIGTSIL  1710
              + + I ATD            +L++I    D   +P    + +    V E+ P GT + 
Sbjct  792   MHMLNISATDGGNLRSNADAVVFLSII----DAMQRPPIFEKARYNYYVKEDIPRGTVVG  847

Query  1711  RVSARS----RRSNIDLEYYVTNVTAGSGGPQVDRLFDVDTKTGILSTAAALDRETGIQW  1766
              V A S     RS +    Y       SG P  D  F ++T +G +  A  LD E   Q 
Sbjct  848   SVIAASGDVAHRSPVRYSIY-------SGDP--DGYFSIETNSGNIRIAKPLDHEAKSQ-  897

Query  1767  YEVELYAIGVGGTRPSTTSTKVRVTVLDKNDVAPTWGTGTWKFKISEEAPPNTVVTVLKA  1826
               V L      G  P    T+V + V D ND AP +     +  + E A     +    A
Sbjct  898   --VLLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHA  955

Query  1827  YDPDT--IGTLTYTLVPNHRPDPGPGTALGFYPASQHELQDESQCQFRLHPTTGQLTLAE  1884
             +D D+   G +TY+LV                       ++  +  F +   +G L L++
Sbjct  956   HDKDSGSSGQVTYSLV-----------------------KESGKGLFAIDARSGHLILSQ  992

Query  1885  ALDRETREKYVLKVRADDG---LQHTDIALTIQVTDTNDNAPTFQSTAYSFDVPENVPRG  1941
              LD E+ +++ L V A DG      T++ + + V D NDN P F+   YS +V E+    
Sbjct  993   HLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSIN  1052

Query  1942  SRIGQVVATDADANGPNSQLSYTLISDWANDV------------FSLNPSTGVFTLTASL  1989
             ++I QV A+D D  G N++++Y ++    ++V            F + P++G   L A L
Sbjct  1053  AQIIQVNASDLDT-GNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPL  1111

Query  1990  DYEQVQHYILVVQATDGGIPALSSTVTVYCNVVDLNDNAPIFEAGPHAADIVENTTIGTP  2049
             D E    Y L V ATD G PA  +   V   V+D NDN P F+   +   I EN   G+ 
Sbjct  1112  DRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSV  1171

Query  2050  ILSVAAQDLDSGDNGRVIYAVAGGDENGDFGVAP-NGTLFTRKLLDREQKPLYNLILSAT  2108
             +  V A DLD G+N  + Y++     N  F V P  G + TR+ LDRE + LY+L++ A 
Sbjct  1172  VGVVTASDLDLGENAAIRYSLL--PINSSFQVHPVTGEISTREPLDRELRELYDLVVEAR  1229

Query  2109  DSPLPPALPLSSTVQVTVVLLDVNDMSPEFISPTK--ISIIENAPSNTVVMAIKAVDRDE  2166
             D   P     S+ V V + + DVND +PE   P +  +S+ E  P  T V+ ++AVDRD 
Sbjct  1230  DQGTPVR---SARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDH  1286

Query  2167  GRNGYVEYSL-----EDTTLPFTVGPVDGLLRVSGSLDRELRSNYTLEVTAKDRGEPPRS  2221
             G+N  + YS+      D    F++ P  G++R    LD E RS Y L V A D G PPR 
Sbjct  1287  GQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRE  1346

Query  2222  SSTAVTVTVLDENDNSPVFDPRQYSATVAENASIGASVLQVSAMDRD--------EGANG  2273
             +   + V VLD NDN P F        V E+A++G  V  +S ++R         E +  
Sbjct  1347  TVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFE  1406

Query  2274  RVRYSIAMGDDNRD-----FTISEDGGVIRVAKNLNFERKSRYYLTIRGEDCASEVGETP  2328
              +R +  +    +D     F I    G + VA+ L+ E +S + L IR  D  +     P
Sbjct  1407  DLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTA--SNNP  1464

Query  2329  RGDTAQVTITVIDINDNAPVFLDSPYLAHVMENMVPPGGGFVIQVKAYDADTPPYNDQ--  2386
             +     V I V D+NDNAP +   P    V E    P G  +    A DADT    D   
Sbjct  1465  QSSAITVKIEVADVNDNAPEWPQDPIDLQVSE--ATPVGTIIHNFTATDADTGTNGDLQY  1522

Query  2387  --VRYF-----LKEGDTDLFRINASTGDIFLLRPLDRELVAEYTLTLVAMDTGS---PPL  2436
               +RYF      +E    LFR+++ TG + L  PLD E V EY L + A+D  S     L
Sbjct  1523  RLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERL  1582

Query  2437  TGSGIVRIVVLDVNDHIPEFTRQEYRATVTENL------ASGTWVTKPHATDKDEGLNAK  2490
               S  VR+ +LD NDH P F         T +L        G  V    A D+D G N +
Sbjct  1583  QTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQ  1642

Query  2491  IRYSLLGENSE-RFTVEPETGEVLTVVPL-----DREQTAVYHLTLVAQDSSPTEPQASA  2544
             + Y + G N E RF +  +TG +  V  L     D E+   ++L + A+D    EP+ S+
Sbjct  1643  LTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSS  1702

Query  2545  VNLTIFVKDVNDNAPRFSSPRYTAYVPGATKPGDFVFGAKAVDDDDGENSRIVYRL-QGI  2603
             +NL + V+  ++N PRF    Y A +      G FV    A      EN+ + Y +  G+
Sbjct  1703  LNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGV  1762

Query  2604  DAEKFVIDPNSGVIRTTQELAND-ETTYQLQIQASDC---------GVKPQTVTADLVIH  2653
               + F +D   G+I T  +   + + +Y L +   D           V+ Q  ++D +  
Sbjct  1763  ANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQR-SSDSIGD  1821

Query  2654  LWERQLF----------------PSFRSTISTRFTLPEDVPEGRVITKLSATTPKVGTAS  2697
                 Q F                P FR       ++PE+   G VI  + A+    G  +
Sbjct  1822  TSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPG-VIHTVVASDLDEGPNA  1880

Query  2698  NLVYGMAGGNVGDALKIDPHTGEVLVASGFDYETAPFYEAWVEVRDSDTPALRS-VVQLL  2756
             +L+Y + GGN+G+   ID  +GE L A   D E    Y   ++  D   P  R     + 
Sbjct  1881  DLIYSITGGNLGNKFSIDSSSGE-LSARPLDREQHSRYTLQIQASDRGQPKSRQGHCNIT  1939

Query  2757  VNVTDANDNAPIMEAAIYNATVPEDEYPPLFVNKVSANDRDSGENGQVSYYLVNDFTETF  2816
             + V D NDNAP  + + Y  +V ED      V ++SA D D G N ++ Y L N+    F
Sbjct  1940  IFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQF  1999

Query  2817  VIDSDTGEISTNAKLDREEIASYELIVEARDQGQPSL-TGTATVLLTVLDKNDNPPQFTR  2875
              ID  +G I+T  KLDRE  ASY  +V A D G+  + + T  V + VLD NDN P F R
Sbjct  2000  AIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFER  2059

Query  2876  L-FSVNVTENAEIGTFVIRITSSDLDIGQNANVTYRF-TENPG--EKFAMDALSGNVTVN  2931
               +   V    + G  ++++ + D D+G NA + Y    EN     KF ++  +G ++ +
Sbjct  2060  YPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSAS  2119

Query  2932  GHLDREEQDEYLLKLVAADGAWQAATAL---TITIQDQNDNPP--EFDEESYHFHFPELQ  2986
               L  E      L++VA D      ++L    + I +     P   F  E+Y     E  
Sbjct  2120  QSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENS  2179

Query  2987  PPVAHVGQVTAIDRDKQGPNSVISYSLLQPSDLFTVDPATGDVFSKK--TLKYKHTHRPS  3044
             P    + QV A+  D +      S+       + ++D  +G++   K   L Y     PS
Sbjct  2180  PSGTRLLQVVALRSDGRRQKVQFSFGAGNEDGILSLDSLSGEIRVNKPHLLDYDRFSTPS  2239

Query  3045  -------------------------------------------SPENLYSLTVVATDNGK  3061
                                                        S  N   + +VA     
Sbjct  2240  MSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADA  2299

Query  3062  PPLSSKTVVYVNVVDANNNAPRFDQRSYLYPVPENYGVGKRVVQLMAKDDADFGVNAEIS  3121
             P L+S   + + + D N+N+P+F Q+ ++  V E    G  V Q+ A D +D G NA + 
Sbjct  2300  PFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFD-SDAGSNARLR  2358

Query  3122  YFMTNVNGSEYFSIDEKSGWVYVRNTLSNVPVRTTFLLKVQAIDKGVPPQKDEVSLTLVI  3181
             Y + + N    F I+     +   N + +  +R  + LK+ A D+GVP      ++ + I
Sbjct  2359  YHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQI  2418

Query  3182  SGENKHAPTFAAVSHQVRVPENEPVNTTILTVSATDGDDGPNGMIRYKISAGN-----EK  3236
                N + PTF   ++ V V E   +   I ++SA D D  P   + Y++ A +       
Sbjct  2419  VDVNDNQPTFPP-NNLVTVSEATELGAVITSISANDVDTYP--ALTYRLGAESTVDIENM  2475

Query  3237  NEFFVHSITGAVTILEPLDYDLVQEYKLNITATDLGFEPKQAVAILTVNVSDINDNPPTF  3296
             + F +   +G + +   LDY+L QEY+L++ A+D   E   A  +LTV V+D NDN P F
Sbjct  2476  SIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHE---ARTVLTVRVNDENDNAPVF  2532

Query  3297  ---NQSIYEAYLP------ENSPPDSFVYKVIARDIDSP-KYAVIQYKILGGTGKDHFRI  3346
                    Y A LP      E+   D  +  V A D DS    + + Y I     ++ F +
Sbjct  2533  LAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYII--EPAQEGFSV  2590

Query  3347  REDTGEIA---SLISFDYEEANEYTLDIVAANPDSNPQMVGFTTVLVHITGVNEYYPKFI  3403
                 G ++   S +      + +Y + I+A +    P +   T + V          +F+
Sbjct  2591  HPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDA-GKPALKSSTLLRVQANDNGSGRSQFL  2649

Query  3404  QPVFHMDVSESAEVGTSVGLVQATDQDAGEDGRVYYLFVGSSNDRGFSIGSETGIIRVSR  3463
             Q  +   +SE+A +G+   +V    QDA +        +  + +  F +     I+ V +
Sbjct  2650  QNQYRAQISEAAPLGS---VVLQLGQDALDQS---LAIIAGNEESAFELLQSKAIVLV-K  2702

Query  3464  RLDRETQNRVVLTVMTKNGGG----IRGNDTDEAQVIVSIQDGNDP-PEFLQST-YDATV  3517
              LDRE  +   L ++  +  G       N +    VI++I D ND  P F +S  Y+A +
Sbjct  2703  PLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEI  2762

Query  3518  SEGATHGTRVLTVRAVDKDIK-PQNNQFSYSIISGNLGQAFKVDPQTGDIETAKQLDRET  3576
             SE A     +  ++A+D D +   N++  Y I SGN    F +D  TG +    +LD ++
Sbjct  2763  SELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDS  2822

Query  3577  -IPIYDLTIGAIDTGSP-PQTGTAAIHIELLDINDNGPTFDPPEVVGYVNENEPAGTIVM  3634
                 Y+L I A D+    P        +EL D NDN P F   E V ++ ENEP G+ V 
Sbjct  2823  GAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVF  2882

Query  3635  TLSATDPDLPPNGAPFTYKLVGGRQSD-----MVTLDKHTGVLKTTRSLDREAMPQLDLV  3689
                A+D D  P G    Y  +G   SD     M  +D  +G++ +    D E   + D+ 
Sbjct  2883  RAHASDLDKGPFGQ-LNYS-IGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDME  2940

Query  3690  VEVEDSG  3696
             +   D G
Sbjct  2941  LLASDMG  2947


 Score = 765 bits (1976),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 831/3042 (27%), Positives = 1332/3042 (44%), Gaps = 353/3042 (12%)

Query  759   ESGGEGLFTVDERTGEITLQGSLRAAHKTLYELNISAKDTGDRVAGRNALVEIIREEDLE  818
             E+G E    +D  TGEI  +  L    +  Y L          ++GRN  V +  +++ +
Sbjct  116   EAGVETDLAIDRATGEIRTKVKLDRETRASYSL------VAIPLSGRNIRVLVTVKDEND  169

Query  819   HLEFDTYNGYEFRIAEDRGECGAMSNVFARDAGTVQITQYDSSKISYAIVFGDPKGNFKI  878
             +              E+       + + ARD   + +  Y++ +  Y IV G+    F++
Sbjct  170   NAPTFPQTSMHIEFPENTPREVKRTLLPARD---LDLEPYNTQR--YNIVSGNVNDAFRL  224

Query  879   D---ESTGTI----STSGCLDREQVAYYSLQLSARAGLA---YGQTSVNITVLDINDNPP  928
                 E  G +      SG LDRE    YSL + A  G      G  +VNIT+ D+NDN P
Sbjct  225   SSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQP  284

Query  929   RFPKGEIGDEVLLKENAAVGQEVCLARARDRDASANARIVYSLTHNPGGQ---FRVAENS  985
              F +      V   ENA VG  V    A D DA  N  + Y++      +   FR+   +
Sbjct  285   IFNQSRYFATV--PENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRT  342

Query  986   GIIYLDKPIRAAPGTVLHLEVTATDSGNQPLSAQHQVRVTIEDVNDHTP----VFKLTSY  1041
             G IY++K +      +  L V A D G QPL     V + + DVND+ P    +F     
Sbjct  343   GAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDA  402

Query  1042  ETSLPESTPVNDRFFSLTAIDVDLG---ANGRVLYSITDGNTEDRFGIFP-DGQLYVKNV  1097
                + ES    +    ++  D D     AN  V  +  DG+    F +   D  +Y+  V
Sbjct  403   SPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGH----FALTTRDNSIYLVIV  458

Query  1098  ---LDREELDYYALEVTATDQGSPSRSSVVPVVVHIIDENDNAPEFTNSSFVLHLRENEP  1154
                LDRE +  Y L V ATD+G+P   +   + + I D NDN PEF    +  ++ E   
Sbjct  459   HLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVAD  518

Query  1155  PDTFVGKLLATDRDVGRNADLVFSLPAS----QQDFTVDPRNGFIKSLRVFDRELLVTNT  1210
             P T V ++LA DRD G N+ L +SL  +     Q F +DP+ G I +    D E      
Sbjct  519   PGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCET-----  573

Query  1211  GSSYITLEATVTDNGVNRLRDRVKVVIYITDVNDNIPQFQRLPYRVQVNEGAAIGTQLLR  1270
                   L     D GV  L     V++ I DVNDN P F +  Y V V E   +G  +L+
Sbjct  574   -EPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILK  632

Query  1271  VYTTDADEGLNGDVFYSLEDGNQH-GRFAIDEATGQISLTKELDRETTDAYVLTVVAHDA  1329
             V  +D D G+N  V Y++ +G +H   F +  A+G+I +  ELD E   +Y   V+A D 
Sbjct  633   VSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDR  692

Query  1330  GLETRLSSSTTVHIEVLDENDNVPLFVDDKSSISVLET-----TPTNTELLRFKATDNDL  1384
             G    LS++  + +++ D NDN P+F   +  +S+ E+       ++T ++   ATD D 
Sbjct  693   G---GLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDY  749

Query  1385  GPNSELAFAISAGNRRDTFYIDPLTGTLYLRKP--LDYEELEKYTLNVTCSDGGHPRLSS  1442
             G   ++++ I AGN    F ID  TG +++ +P  L       + LN++ +DGG+ R ++
Sbjct  750   GNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNA  809

Query  1443  VTTLIVEVIDANDNPPVFPNTAIARQIREGILVHTPIVTITAEDPDSNENGVVTYSIASQ  1502
                + + +IDA   PP+F        ++E I   T + ++ A   D      V YSI S 
Sbjct  810   DAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSG  869

Query  1503  DPEDQVRRFGINPSTGVIHTLLPIDREEVDTYKLVVVATDSAQPASARLSAEKLVIVIVE  1562
             DP+     F I  ++G I    P+D E      L + AT    P    +     V + VE
Sbjct  870   DPDGY---FSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPP----VYGHTQVNIEVE  922

Query  1563  DINDNAPIF-VSMSAVVLP----LKGNYYQYQKEITVTQLVARDLDSSTNGLVTYELLRS  1617
             D+NDNAP F  SM  + +P    L    Y            A D DS ++G VTY L++ 
Sbjct  923   DVNDNAPEFEASMVRISVPESAELGAPLYAAH---------AHDKDSGSSGQVTYSLVKE  973

Query  1618  SINYPDMFRIHRNTGHLTIRLPRSLKSSFERVSKYQVGIRATDEAVQAERRSTETYLTLI  1677
             S     +F I   +GHL +    S    +E   ++ + + ATD  V     S  T LT++
Sbjct  974   SGK--GLFAIDARSGHLIL----SQHLDYESSQRHTLIVTATDGGVP----SLSTNLTIL  1023

Query  1678  VPGEDGDDQPIWEHRGQIEGNVYENEPIGTSILRVSARSRRS--NIDLEYYVT-----NV  1730
             V  +D +D P    + +   NV E+  I   I++V+A    +  N  + Y +      NV
Sbjct  1024  VDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNV  1083

Query  1731  TAGSGGPQVDRLFDVDTKTGILSTAAALDRETGIQWYEVELYAIGVGGTRPSTTSTKVRV  1790
             T       V + F +   +G +   A LDRET    Y++ + A    GT  +   T+V V
Sbjct  1084  TNSISSSDVSQHFGIFPNSGWIYLRAPLDRETR-DRYQLTVLATD-NGTPAAHAKTRVIV  1141

Query  1791  TVLDKNDVAPTWGTGTWKFKISEEAPPNTVVTVLKAYDPDT--IGTLTYTLVPNHRPDPG  1848
              VLD ND  P +    ++F+I E     +VV V+ A D D      + Y+L+P       
Sbjct  1142  RVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLP-------  1194

Query  1849  PGTALGFYPASQHELQDESQCQFRLHPTTGQLTLAEALDRETREKYVLKVRADDG---LQ  1905
                                   F++HP TG+++  E LDRE RE Y L V A D    ++
Sbjct  1195  ------------------INSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVR  1236

Query  1906  HTDIALTIQVTDTNDNAPTFQSTAYSF-DVPENVPRGSRIGQVVATDADANGPNSQLSYT  1964
                + + I V+D NDNAP           V E  P G+ + +V A D D +G N+ ++Y+
Sbjct  1237  SARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRD-HGQNASITYS  1295

Query  1965  LISDWAND---VFSLNPSTGVFTLTASLDYEQVQHYILVVQATDGGIPALSSTVTVYCNV  2021
             ++    +D   +FS++P++GV      LD+E+   Y L V A+DGG P   +   +   V
Sbjct  1296  IVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEV  1355

Query  2022  VDLNDNAPIFEAGPHAADIVENTTIGTPILSVAAQDL----------DSGDNGRVIYAVA  2071
             +DLNDN P F +      + E+  +G  + S++  +           +S ++ RV Y + 
Sbjct  1356  LDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLN  1415

Query  2072  GGDEN---GDFGV-APNGTLFTRKLLDREQKPLYNLILSATDSPLPPALPLSSTVQVTVV  2127
                ++     F +   +G L   +LLDRE +  + L + A D+      P SS + V + 
Sbjct  1416  PLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNN-PQSSAITVKIE  1474

Query  2128  LLDVNDMSPEFIS-PTKISIIENAPSNTVVMAIKAVDRDEGRNGYVEYSL----------  2176
             + DVND +PE+   P  + + E  P  T++    A D D G NG ++Y L          
Sbjct  1475  VADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNES  1534

Query  2177  -EDTTLPFTVGPVDGLLRVSGSLDRELRSNYTLEVTAKDRGE---PPRSSSTAVTVTVLD  2232
              E     F +  + G L +   LD E    Y L V A D+         +S  V + +LD
Sbjct  1535  QEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILD  1594

Query  2233  ENDNSPVF------DPRQYSATVAENASIGASVLQVSAMDRDEGANGRVRYSIAMGDDNR  2286
              ND++P F        +  S  +++   IG  V  + A+D D G NG++ Y I  G+   
Sbjct  1595  ANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEG  1654

Query  2287  DFTISEDGGVIRVAKNL-----NFERKSRYYLTIRGEDCASEVGETPRGDTAQVTITVID  2341
              F I+   G+I + K+L     + E+  R+ L I  +D        P+  +  + + V  
Sbjct  1655  RFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQP---EPKKSSLNLHLIVQG  1711

Query  2342  INDNAPVFLDSPYLAHVMENMVPPGGGFVIQVKAYDADTPPYNDQVRYFLKEG-DTDLFR  2400
              ++N P FL + Y A ++EN+  P G FV+QV A        N  + Y +  G   DLF 
Sbjct  1712  SHNNPPRFLQAVYRATILENV--PSGSFVLQVTAKSLHGAE-NANLSYEIPAGVANDLFH  1768

Query  2401  INASTGDIFLLRPLDRELVAEYTLTLVAMDTGSPPLTGSGIVR-----------------  2443
             ++   G I      DRE  A Y L +   D        S  VR                 
Sbjct  1769  VDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHF  1828

Query  2444  ------IVVLDVNDHIPEFTRQE-YRATVTENLASGTWVTKPHATDKDEGLNAKIRYSLL  2496
                   I V DVND+ PEF     Y  +V EN   G   T   A+D DEG NA + YS+ 
Sbjct  1829  DVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHTVV-ASDLDEGPNADLIYSIT  1887

Query  2497  GEN-SERFTVEPETGEVLTVVPLDREQTAVYHLTLVAQDSSPTEPQASAVNLTIFVKDVN  2555
             G N   +F+++  +GE L+  PLDREQ + Y L + A D    + +    N+TIFV+D N
Sbjct  1888  GGNLGNKFSIDSSSGE-LSARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQN  1946

Query  2556  DNAPRFSSPRYTAYVPGATKPGDFVFGAKAVDDDDGENSRIVYRLQGIDAEKFVIDPNSG  2615
             DNAPRF   +YT  V      G  V    AVD D G N+R+VY L      +F ID  SG
Sbjct  1947  DNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSG  2006

Query  2616  VIRTTQELAND-ETTYQLQIQASDCG-VKPQTVTADLVIHLWE----RQLFPSFRSTIST  2669
             +I T  +L  + + +Y   + A+D G  + ++ T  + I++ +    R +F  +      
Sbjct  2007  LITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYI---  2063

Query  2670  RFTLPEDVPEGRVITKLSATTPKVGTASNLVYGMAGGN--VGDALKIDPHTGEVLVASGF  2727
                +P  +  G+ + K+ A    +G  + +VY +   N  V    +I+P TG +  +   
Sbjct  2064  -GQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSL  2122

Query  2728  DYETAPFYEAWVEVRDSDTPALRSVVQLLVNVTDANDNAPIM--EAAIYNATVPEDEYPP  2785
               E+       V  RD   P   S+  + + + +A    P++  +   Y   + E+    
Sbjct  2123  ASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSG  2182

Query  2786  LFVNKVSANDRDSGENGQVSY-YLVNDFTETFVIDSDTGEISTN---------------A  2829
               + +V A  R  G   +V + +   +      +DS +GEI  N               +
Sbjct  2183  TRLLQVVAL-RSDGRRQKVQFSFGAGNEDGILSLDSLSGEIRVNKPHLLDYDRFSTPSMS  2241

Query  2830  KLDREEIASY-------------------------------------ELIVEARDQGQPS  2852
              L R     Y                                      +++ AR    P 
Sbjct  2242  ALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPF  2301

Query  2853  LTGTATVLLTVLDKNDNPPQFT-RLFSVNVTENAEIGTFVIRITSSDLDIGQNANVTYRF  2911
             L   A +++ + D+NDN P+F+ + F   V+E    GTFV ++ + D D G NA + Y  
Sbjct  2302  LASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHI  2361

Query  2912  TE-NPGEKFAMD-ALSGNVTVNGHLDREEQDEYLLKLVAAD-GAWQAATALTITIQ--DQ  2966
              + N    F ++ A SG V  N  LDRE +D Y LK++A D G  Q     TI +Q  D 
Sbjct  2362  VDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDV  2421

Query  2967  NDNPPEFDEESYHFHFPELQPPVAHVGQVTAIDRD-------KQGPNSVISYSLLQPSDL  3019
             NDN P F   +      E     A +  ++A D D       + G  S +    ++   +
Sbjct  2422  NDNQPTFPPNNL-VTVSEATELGAVITSISANDVDTYPALTYRLGAESTVD---IENMSI  2477

Query  3020  FTVDPATGDVFSKKTLKYKHTHRPSSPENLYSLTVVATDNGKPPLSSKTVVYVNVVDANN  3079
             F +D  +G +  K+ L Y+           Y L V+A+D       ++TV+ V V D N+
Sbjct  2478  FALDRYSGKLVLKRRLDYELQQE-------YELDVIASDAAH---EARTVLTVRVNDEND  2527

Query  3080  NAPRFDQR---SYLYPVP------ENYGVGKRVVQLMAKDDADFGVNAEISYFMTNVNGS  3130
             NAP F  +   +Y   +P      E+  V   ++ + A D    G N+++ Y +      
Sbjct  2528  NAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIE--PAQ  2585

Query  3131  EYFSIDEKSGWVYVRNTLSNVPVRTT--FLLKVQAIDKGVPPQKDEVSLTLVISGENKHA  3188
             E FS+   +G V V  +     V ++  + +++ A D G P  K    L +  +      
Sbjct  2586  EGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGR  2645

Query  3189  PTFAAVSHQVRVPENEPVNTTILTVSATDGDDGPNGMIRYKISAGNEKNEFFVHSITGAV  3248
               F    ++ ++ E  P+ + +L +    G D  +  +   I AGNE++ F +   + A+
Sbjct  2646  SQFLQNQYRAQISEAAPLGSVVLQL----GQDALDQSL--AIIAGNEESAFELLQ-SKAI  2698

Query  3249  TILEPLDYDLVQEYKLNITATDLGFEP------KQAVAILTVNVSDINDNPPTFNQSI-Y  3301
              +++PLD +    YKL +  +     P        +   + + + D NDN P F++S  Y
Sbjct  2699  VLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKY  2758

Query  3302  EAYLPENSPPDSFVYKVIARDID---SPKYAVIQYKILGGTGKDHFRIREDTGEIASLIS  3358
             EA + E +P    + ++ A D D   +P   V+ Y I  G  +  F I   TG +     
Sbjct  2759  EAEISELAPLRYSIAQLQAIDADQENTPNSEVV-YDITSGNDEHMFTIDLVTGVLFVNNR  2817

Query  3359  FDYEE-ANEYTLDIVAANPDSNPQMVGFTTVLVHITGVNEYYPKFIQPVFHMDVSESAEV  3417
              DY+  A  Y L I A +      +       + +   N+  PKF    +   ++E+  V
Sbjct  2818  LDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPV  2877

Query  3418  GTSVGLVQATDQDAGEDGRVYYLFVGSSND----RGFSIGSETGIIRVSRRLDRETQNRV  3473
             G+SV    A+D D G  G++ Y    + +D    + F + SE+G++  +   D E + R 
Sbjct  2878  GSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRY  2937

Query  3474  VLTVMTKNGGGIRGNDTDEAQVIVSIQDGND-PPEFLQSTYDATVSEGAT--HGTRVLTV  3530
              + ++  + GG + +      V V I+  ++  P+F + TY   +        G  V  V
Sbjct  2938  DMELLASDMGGKKAS----VAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQV  2993

Query  3531  RAVDKDIKPQNNQFSYSIISGNLGQAFKVDPQTGDIETAKQL  3572
              A D D  P + +  Y + + +    FKV+  +G +   ++L
Sbjct  2994  TATDSDSGP-DGRVVYQLSAPH--SHFKVNRSSGAVLIKRKL  3032


 Score = 748 bits (1932),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 812/2924 (28%), Positives = 1270/2924 (43%), Gaps = 369/2924 (13%)

Query  148   IEVRILVLDINDNDPEFPESSIAVSFSESAVVGTKLLLDAATDKDTLENGVVDDYFIVNG  207
             + V I + D+NDN P F +S    +  E+A VGT +L   A+D D  ENG+V+ Y I   
Sbjct  270   MTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVE-YAINRR  328

Query  208   NTDEK--FRLEVTGNPTGETSYLHLETTGKLDREQVEFYSLNVCARDRGRPPRLGYLLVN  265
              +D++  FR++    P     Y++      LD E  E + L V A+D G  P      V+
Sbjct  329   QSDKEQMFRID----PRTGAIYIN----KALDFETKELHELVVVAKDHGEQPLETTAFVS  380

Query  266   VTVLDVNDNPP----IFQQSDYVVALNESAPVGTKVLTVHATDKDSE-DNSKLTYYLPDT  320
             + V DVNDN P    IF   D    ++ESA  G  V  +   D DS+ + + +   L   
Sbjct  381   IRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGG  440

Query  321   ERQFTIDPETGTITTVEPLDCPQQSCTIAARLGDGCPKSCVITVFARDHGSPRQDGRTYV  380
             +  F +     +I  V           +   L      +  ++V A D G+P       +
Sbjct  441   DGHFALTTRDNSIYLV----------IVHLPLDREIVSNYTLSVVATDKGTPPLHASKSI  490

Query  381   TVNLLDANDHDPEIKFSYFPSTPGFATVDENAAKDSIVAAVAVIDNDEGLNGETTVEIRA  440
              + + D ND+ PE +   +      A V E A   + V  V   D DEGLN   T  +  
Sbjct  491   FLRITDVNDNPPEFEQDLY-----HANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAE  545

Query  441   GNELGHFRLDNTPSFDIVRVNGRLDREEIPKYNLTVVATDKGTPPRSATAYLVIHVNDVN  500
               E         P   ++     +D E  P   LTVVA D G PP S+TA +++ ++DVN
Sbjct  546   TPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVN  605

Query  501   DHEPVFQQSEYSAVLSELSPTGSFVASISATDADSGLNARIYYDFDSGNEQ-GWFAIDQD  559
             D+EP+F QS Y+  ++E  P G  +  +SA+D D G+NA + Y    G +    F +   
Sbjct  606   DNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSA  665

Query  560   TGLVTTVATLDREVQGSIELHVSARDGGPNPKYASTHLKVTILDENDEAPRFSQNVVRVT  619
             +G +     LD E + S E  V A D G     A   +++T  D ND  P F     +V+
Sbjct  666   SGEICIAGELDFERRSSYEFPVLATDRGGLSTTAMIKMQLT--DVNDNRPVFYPREYKVS  723

Query  620   LSENTPPQSL-----VATLTAVDNDQGTNGSVAYSFHSSVSRDYPKTFALDGLTGQL--T  672
             L E+    S      +  + A D D G  G V+Y     V+ +    F +D  TG++   
Sbjct  724   LRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRI---VAGNEAGIFRIDRSTGEIFVV  780

Query  673   TKVNLDRETTAEYQILVIAKDQGTPPQSSTATVILTLEDVNDNSPVFYPWRYLMPIPEDA  732
                 L   T   + + + A D G    ++ A V L++ D     P+F   RY   + ED 
Sbjct  781   RPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDI  840

Query  733   PPGTSVGKVTATDADARENAQVRYSLESGG-EGLFTVDERTGEITLQGSLRAAHKTLYEL  791
             P GT VG V A   D    + VRYS+ SG  +G F+++  +G I +   L    K+   L
Sbjct  841   PRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLL  900

Query  792   NISAKDTGDRVAGR---NALVEIIREEDLEHLEFDTYNGYEFRIA-EDRGECGA---MSN  844
             NI A      V G    N  VE + +   E      +     RI+  +  E GA    ++
Sbjct  901   NIQATLGEPPVYGHTQVNIEVEDVNDNAPE------FEASMVRISVPESAELGAPLYAAH  954

Query  845   VFARDAGTVQITQYDSSKISYAIVFGDPKGNFKIDESTGTISTSGCLDREQVAYYSLQLS  904
                +D+G+       S +++Y++V    KG F ID  +G +  S  LD E    ++L ++
Sbjct  955   AHDKDSGS-------SGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVT  1007

Query  905   ARAGLAYGQTSVNITVL----DINDNPPRFPKGEIGDEVLLKENAAVGQEVCLARARDRD  960
             A  G      S N+T+L    D+NDNPP F K E    V + E+ ++  ++    A D D
Sbjct  1008  ATDG-GVPSLSTNLTILVDVQDVNDNPPVFEKDEYS--VNVSESRSINAQIIQVNASDLD  1064

Query  961   ASANARIVYSL-------------THNPGGQFRVAENSGIIYLDKPIRAAPGTVLHLEVT  1007
                NARI Y +             + +    F +  NSG IYL  P+         L V 
Sbjct  1065  TGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVL  1124

Query  1008  ATDSGNQPLSAQHQVRVTIEDVNDHTPVFKLTSYETSLPESTPVNDRFFSLTAIDVDLGA  1067
             ATD+G     A+ +V V + D ND+ P F+ + YE  + E+         +TA D+DLG 
Sbjct  1125  ATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGE  1184

Query  1068  NGRVLYSITDGNTEDRFGIFP-DGQLYVKNVLDREELDYYALEVTATDQGSPSRSSVVPV  1126
             N  + YS+   N+   F + P  G++  +  LDRE  + Y L V A DQG+P RS+ VPV
Sbjct  1185  NAAIRYSLLPINSS--FQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPV  1242

Query  1127  VVHIIDENDNAPEFTN-SSFVLHLRENEPPDTFVGKLLATDRDVGRNADLVFSLPASQQD  1185
              +H+ D NDNAPE  +    V+ +RE +PP T V ++ A DRD G+NA + +S+   +  
Sbjct  1243  RIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDS  1302

Query  1186  -----FTVDPRNGFIKSLRVFDRELLVTNTGSSYITLEATVTDNGVNRLRDRVKVV-IYI  1239
                  F++DP +G I++  V D E        S   L    +D G N  R+ V+++ + +
Sbjct  1303  DGHGLFSIDPTSGVIRTRVVLDHE------ERSIYRLGVAASDGG-NPPRETVRMLRVEV  1355

Query  1240  TDVNDNIPQFQRLPYRVQVNEGAAIG------------TQLLRVYTTDADEGLNGDVFYS  1287
              D+NDN P F       +V E AA+G              ++R    ++ E L   V Y+
Sbjct  1356  LDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLR--VTYT  1413

Query  1288  LEDGNQ---HGRFAIDEATGQISLTKELDRETTDAYVLTVVAHDAGLETR-LSSSTTVHI  1343
             L    +      F ID  +G + + + LDRE    + L + A D        SS+ TV I
Sbjct  1414  LNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKI  1473

Query  1344  EVLDENDNVPLFVDDKSSISVLETTPTNTELLRFKATDNDLGPNSELAFAI---------  1394
             EV D NDN P +  D   + V E TP  T +  F ATD D G N +L + +         
Sbjct  1474  EVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNE  1533

Query  1395  SAGNRRDTFYIDPLTGTLYLRKPLDYEELEKYTLNVTCSDGGH---PRLSSVTTLIVEVI  1451
             S       F +D LTG L L+ PLD+E +++Y L V   D       RL +  T+ + ++
Sbjct  1534  SQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRIL  1593

Query  1452  DANDNPPVF--PNTAIARQ----IREGILVHTPIVTITAEDPDSNENGVVTYSIASQDPE  1505
             DAND+ P F  PN++  +     I +   +   +  I A D DS +NG +TY I   + E
Sbjct  1594  DANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGE  1653

Query  1506  DQVRRFGINPSTGVIHTL--LPIDREEVDT---YKLVVVATDSAQPASARLSAEKLVIVI  1560
                 RF IN  TG+I  +  LP   E+V+    + L++ A D  QP   + S    + +I
Sbjct  1654  G---RFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLN--LHLI  1708

Query  1561  VEDINDNAPIFVSMSAVVLPLK----GNYYQYQKEITVTQLVARDLDSSTNGLVTYELLR  1616
             V+  ++N P F+        L+    G++        V Q+ A+ L  + N  ++YE+  
Sbjct  1709  VQGSHNNPPRFLQAVYRATILENVPSGSF--------VLQVTAKSLHGAENANLSYEIPA  1760

Query  1617  SSINYPDMFRIHRNTGHLTIRLPRSLKSSFERVSK--YQVGIRATD---------EAVQA  1665
                N  D+F +    G +T R        F+R S+  Y + +   D          AV+ 
Sbjct  1761  GVAN--DLFHVDWQRGIITTR------GQFDRESQASYVLPVYVRDANRQSTLSSSAVRK  1812

Query  1666  ERRST-----------ETYLTLIVPGEDGDDQPIWEHRGQIEGNVYEN-EPIGTSILRVS  1713
             +R S            +     I  G+  D+ P +        +V EN EP     +  S
Sbjct  1813  QRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHTVVAS  1872

Query  1714  ARSRRSNIDLEYYVTNVTAGSGGPQVDRLFDVDTKTGILSTAAALDRETGIQWYEVELYA  1773
                   N DL Y +T       G  +   F +D+ +G LS A  LDRE   + Y +++ A
Sbjct  1873  DLDEGPNADLIYSIT-------GGNLGNKFSIDSSSGELS-ARPLDREQHSR-YTLQIQA  1923

Query  1774  IGVGGTRPSTTSTKVRVTVLDKNDVAPTWGTGTWKFKISEEAPPNTVVTVLKAYDPDTIG  1833
                G  +       + + V D+ND AP +    +   + E+AP  T V  + A D D   
Sbjct  1924  SDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDAD---  1980

Query  1834  TLTYTLVPNHRPDPGPGTALGFYPASQHELQDESQCQFRLHPTTGQLTLAEALDRETREK  1893
                                LG      + L +E+Q QF +   +G +T    LDRE +  
Sbjct  1981  -------------------LGVNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQAS  2021

Query  1894  YVLKVRADDG----LQHTDIALTIQVTDTNDNAPTFQSTAYSFDVPENVPRGSRIGQVVA  1949
             Y   V A DG    ++   + + I V D NDN P F+   Y   VP  +  G  + +V A
Sbjct  2022  YNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQA  2081

Query  1950  TDADANGPNSQLSYTLISD--WANDVFSLNPSTGVFTLTASLDYEQVQHYILVVQATDGG  2007
              DAD  G N+++ Y+L ++    +  F +NPSTG  + + SL  E  +   L V A D G
Sbjct  2082  LDADL-GANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKG  2140

Query  2008  IPALSSTVT