BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= NP_001267818.1 acyl-CoA delta-9 desaturase [Bombus terrestris]

Length=351
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9U972_DROME  unnamed protein product                                 473     7e-168
Q94541_DROME  unnamed protein product                                 471     2e-167
Q7K4Y0_DROME  unnamed protein product                                 471     3e-167
Q9VTD4_DROME  unnamed protein product                                 395     2e-137
Q9NFT2_DROME  unnamed protein product                                 392     2e-136


>Q9U972_DROME unnamed protein product
Length=383

 Score = 473 bits (1217),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 219/352 (62%), Positives = 274/352 (78%), Gaps = 5/352 (1%)

Query  4    NITSSPTGVLFEG--ETLDES-SRVIDAPKTKYKR--QIVWRNVIIFAYLHIGAVYGLYL  58
             +    TGVLFE   ET D    + I   K   KR  ++VWRN+I+F Y H+ A+YG YL
Sbjct  32   KLQEDSTGVLFESDVETTDGGLVKDITVMKKAEKRRLKLVWRNIIVFGYFHLAALYGAYL  91

Query  59   ALTSAKWATLLFALCLHLFSALGITAGAHRLWAHRSYKAKWPLQLFLMIGNTIAFQDAAI  118
             +TSAKW T + A  L++ S LGITAGAHRLWAHRSYKAKWPL++ L+I NTIAFQDAA 
Sbjct  92   MVTSAKWQTCILAYFLYVISGLGITAGAHRLWAHRSYKAKWPLRVILVIFNTIAFQDAAY  151

Query  119  DWARDHRLHHKYSETNADPHNAKRGFFFAHVGWLLCRKHPDIRAKGKGIDLSDLKNNPIL  178
             WARDHR+HHKYSET+ADPHNA RGFFF+HVGWLLC+KHP+++AKGKG+DLSDL+ +PIL
Sbjct  152  HWARDHRVHHKYSETDADPHNATRGFFFSHVGWLLCKKHPEVKAKGKGVDLSDLRADPIL  211

Query  179  SFQKKYYAILMPLLCFIVPTLIPVYCWDESWGNAYFVPTVLRYVYTLNMTWLVNSAAHMF  238
             FQKKYY ILMP+ CFI+PT++P+Y W ES+ NA+FV T+ R+ + LN+TWLVNSAAH F
Sbjct  212  MFQKKYYMILMPIACFIIPTVVPMYAWGESFMNAWFVATMFRWCFILNVTWLVNSAAHKF  271

Query  239  GNKPYDKYINPVENKMVAITALGEGWHNYHHVFPWDYKTAELGNYKVNITTLFIDACSKL  298
            G +PYDK+INP EN  VAI A GEGWHNYHHVFPWDYKTAE G Y +N TT FID  +K+
Sbjct  272  GGRPYDKFINPSENISVAILAFGEGWHNYHHVFPWDYKTAEFGKYSLNFTTAFIDFFAKI  331

Query  299  GLAYDMKIVPQDLVRKRVERTGDGSHNVWGWGDKDQTQQDRDVTMVVNLKKD  350
            G AYD+K V  D+++KRV+RTGDG+H  WGWGD DQ +++ +  ++ + K +
Sbjct  332  GWAYDLKTVSTDIIKKRVKRTGDGTHATWGWGDVDQPKEEIEDAVITHKKSE  383


>Q94541_DROME unnamed protein product
Length=383

 Score = 471 bits (1213),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 220/352 (63%), Positives = 274/352 (78%), Gaps = 5/352 (1%)

Query  4    NITSSPTGVLFEG--ETLDES-SRVIDAPKTKYKR--QIVWRNVIIFAYLHIGAVYGLYL  58
             +    TGVLFE   ET D    + I   K   KR  ++VWRN+I F YLH+ A+YG YL
Sbjct  32   KLQEDSTGVLFECDVETTDGGLVKDITVMKKAEKRLLKLVWRNIIAFGYLHLAALYGAYL  91

Query  59   ALTSAKWATLLFALCLHLFSALGITAGAHRLWAHRSYKAKWPLQLFLMIGNTIAFQDAAI  118
             +TSAKW T + A  L++ S LGITAGAHRLWAHRSYKAKWPL++ L+I NTIAFQDAA 
Sbjct  92   MVTSAKWQTCILAYFLYVISGLGITAGAHRLWAHRSYKAKWPLRVILVIFNTIAFQDAAY  151

Query  119  DWARDHRLHHKYSETNADPHNAKRGFFFAHVGWLLCRKHPDIRAKGKGIDLSDLKNNPIL  178
             WARDHR+HHKYSET+ADPHNA RGFFF+HVGWLLC+KHP+++AKGKG+DLSDL+ +PIL
Sbjct  152  HWARDHRVHHKYSETDADPHNATRGFFFSHVGWLLCKKHPEVKAKGKGVDLSDLRADPIL  211

Query  179  SFQKKYYAILMPLLCFIVPTLIPVYCWDESWGNAYFVPTVLRYVYTLNMTWLVNSAAHMF  238
             FQKKYY ILMP+ CFI+PT++P+Y W ES+ NA+FV T+ R+ + LN+TWLVNSAAH F
Sbjct  212  MFQKKYYMILMPIACFIIPTVVPMYAWGESFMNAWFVATMFRWCFILNVTWLVNSAAHKF  271

Query  239  GNKPYDKYINPVENKMVAITALGEGWHNYHHVFPWDYKTAELGNYKVNITTLFIDACSKL  298
            G +PYDK+INP EN  VAI A GEGWHNYHHVFPWDYKTAE G Y +N TT FID  +K+
Sbjct  272  GGRPYDKFINPSENISVAILAFGEGWHNYHHVFPWDYKTAEFGKYSLNFTTAFIDFFAKI  331

Query  299  GLAYDMKIVPQDLVRKRVERTGDGSHNVWGWGDKDQTQQDRDVTMVVNLKKD  350
            G AYD+K V  D+++KRV+RTGDG+H  WGWGD DQ +++ +  ++ + K +
Sbjct  332  GWAYDLKTVSTDIIKKRVKRTGDGTHATWGWGDVDQPKEEIEDAVITHKKSE  383


>Q7K4Y0_DROME unnamed protein product
Length=383

 Score = 471 bits (1213),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 220/352 (63%), Positives = 274/352 (78%), Gaps = 5/352 (1%)

Query  4    NITSSPTGVLFEG--ETLDES-SRVIDAPKTKYKR--QIVWRNVIIFAYLHIGAVYGLYL  58
             +    TGVLFE   ET D    + I   K   KR  ++VWRN+I F YLH+ A+YG YL
Sbjct  32   KLQEDSTGVLFECDVETTDGGLVKDITVMKKAEKRRLKLVWRNIIAFGYLHLAALYGAYL  91

Query  59   ALTSAKWATLLFALCLHLFSALGITAGAHRLWAHRSYKAKWPLQLFLMIGNTIAFQDAAI  118
             +TSAKW T + A  L++ S LGITAGAHRLWAHRSYKAKWPL++ L+I NTIAFQDAA 
Sbjct  92   MVTSAKWQTCILAYFLYVISGLGITAGAHRLWAHRSYKAKWPLRVILVIFNTIAFQDAAY  151

Query  119  DWARDHRLHHKYSETNADPHNAKRGFFFAHVGWLLCRKHPDIRAKGKGIDLSDLKNNPIL  178
             WARDHR+HHKYSET+ADPHNA RGFFF+HVGWLLC+KHP+++AKGKG+DLSDL+ +PIL
Sbjct  152  HWARDHRVHHKYSETDADPHNATRGFFFSHVGWLLCKKHPEVKAKGKGVDLSDLRADPIL  211

Query  179  SFQKKYYAILMPLLCFIVPTLIPVYCWDESWGNAYFVPTVLRYVYTLNMTWLVNSAAHMF  238
             FQKKYY ILMP+ CFI+PT++P+Y W ES+ NA+FV T+ R+ + LN+TWLVNSAAH F
Sbjct  212  MFQKKYYMILMPIACFIIPTVVPMYAWGESFMNAWFVATMFRWCFILNVTWLVNSAAHKF  271

Query  239  GNKPYDKYINPVENKMVAITALGEGWHNYHHVFPWDYKTAELGNYKVNITTLFIDACSKL  298
            G +PYDK+INP EN  VAI A GEGWHNYHHVFPWDYKTAE G Y +N TT FID  +K+
Sbjct  272  GGRPYDKFINPSENISVAILAFGEGWHNYHHVFPWDYKTAEFGKYSLNFTTAFIDFFAKI  331

Query  299  GLAYDMKIVPQDLVRKRVERTGDGSHNVWGWGDKDQTQQDRDVTMVVNLKKD  350
            G AYD+K V  D+++KRV+RTGDG+H  WGWGD DQ +++ +  ++ + K +
Sbjct  332  GWAYDLKTVSTDIIKKRVKRTGDGTHATWGWGDVDQPKEEIEDAVITHKKSE  383


>Q9VTD4_DROME unnamed protein product
Length=355

 Score = 395 bits (1014),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 184/353 (52%), Positives = 257/353 (73%), Gaps = 5/353 (1%)

Query  3    PNITSSPTGVLFEG--ETLDES-SRVIDAPKTK--YKRQIVWRNVIIFAYLHIGAVYGLY  57
            P  T   TGVL+E   ET+D   S  +   KT    K ++VW N+++F  LHI ++YG++
Sbjct  2    PRNTKDTTGVLYESDVETVDGGLSTELSNRKTTDGSKLELVWVNIVLFVILHISSLYGVW  61

Query  58   LALTSAKWATLLFALCLHLFSALGITAGAHRLWAHRSYKAKWPLQLFLMIGNTIAFQDAA  117
            L  TSA W T++      + + LG++ GAHRLWAHR++KA  PL+L  +  NT+AFQDA 
Sbjct  62   LLFTSATWTTVVLFWPTVVVTILGVSGGAHRLWAHRTFKANTPLKLIFLFLNTLAFQDAV  121

Query  118  IDWARDHRLHHKYSETNADPHNAKRGFFFAHVGWLLCRKHPDIRAKGKGIDLSDLKNNPI  177
              WARDHR+HHKY+ET+ADP+N++RG+FFAH+GWL CRKHP++  KGK IDLSDL+ +P+
Sbjct  122  YYWARDHRVHHKYTETDADPYNSQRGWFFAHIGWLCCRKHPEVVEKGKQIDLSDLEADPL  181

Query  178  LSFQKKYYAILMPLLCFIVPTLIPVYCWDESWGNAYFVPTVLRYVYTLNMTWLVNSAAHM  237
            + FQKKYY +LMP++CF++PT++P+Y W ES   ++ V  +LR+  +LN+ W VNS+AHM
Sbjct  182  IMFQKKYYLLLMPIICFVLPTVLPMYLWGESLNVSWHVMALLRWCLSLNLIWTVNSSAHM  241

Query  238  FGNKPYDKYINPVENKMVAITALGEGWHNYHHVFPWDYKTAELGNYKVNITTLFIDACSK  297
             G +PYDK I PV+   +    +GEG+HNYHHVFPWDYK+AELG Y  ++TT FI+  + 
Sbjct  242  HGMRPYDKNICPVDQGFLIFFRVGEGYHNYHHVFPWDYKSAELGKYSQDVTTKFIEFMAY  301

Query  298  LGLAYDMKIVPQDLVRKRVERTGDGSHNVWGWGDKDQTQQDRDVTMVVNLKKD  350
            LG AYD+K V  DLV++RV+R+GDGSH VWGWGDKDQ ++D  VT + + + +
Sbjct  302  LGWAYDLKSVSLDLVKQRVQRSGDGSHPVWGWGDKDQLKEDVGVTTITHQRNE  354


>Q9NFT2_DROME unnamed protein product
Length=355

 Score = 392 bits (1007),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 183/353 (52%), Positives = 256/353 (73%), Gaps = 5/353 (1%)

Query  3    PNITSSPTGVLFEG--ETLDES-SRVIDAPKTK--YKRQIVWRNVIIFAYLHIGAVYGLY  57
            P  T   TGVL+E   ET+D   S  +   KT    K ++VW N+++F  LHI ++YG++
Sbjct  2    PRNTKDTTGVLYESDVETVDGGLSTELSNRKTTDGSKLELVWFNIVLFVILHISSLYGVW  61

Query  58   LALTSAKWATLLFALCLHLFSALGITAGAHRLWAHRSYKAKWPLQLFLMIGNTIAFQDAA  117
            L  TSA W T++      + + LG++ GAHRLWAHR++KA  PL+L  +  NT+AFQDA 
Sbjct  62   LLFTSATWTTVVLFWPTVVVTILGVSGGAHRLWAHRTFKANTPLKLIFLFLNTLAFQDAV  121

Query  118  IDWARDHRLHHKYSETNADPHNAKRGFFFAHVGWLLCRKHPDIRAKGKGIDLSDLKNNPI  177
              WARDHR+HHKY+ET+ADP+N++RG+FFAH+GWL CRKHP++  KGK IDLSDL+ +P+
Sbjct  122  YYWARDHRVHHKYTETDADPYNSQRGWFFAHIGWLCCRKHPEVVEKGKQIDLSDLEADPL  181

Query  178  LSFQKKYYAILMPLLCFIVPTLIPVYCWDESWGNAYFVPTVLRYVYTLNMTWLVNSAAHM  237
            + FQKKYY +LMP++CF++PT++P+Y W ES   ++ V  +LR+  +LN+ W VNS+AHM
Sbjct  182  IMFQKKYYLLLMPIICFVLPTVLPMYLWGESLNVSWHVMALLRWCLSLNLIWTVNSSAHM  241

Query  238  FGNKPYDKYINPVENKMVAITALGEGWHNYHHVFPWDYKTAELGNYKVNITTLFIDACSK  297
             G +PYDK I  V+   +    +GEG+HNYHHVFPWDYK+AELG Y  ++TT FI+  + 
Sbjct  242  HGMRPYDKNICSVDQGFLIFFRVGEGYHNYHHVFPWDYKSAELGKYSQDVTTKFIEFMAY  301

Query  298  LGLAYDMKIVPQDLVRKRVERTGDGSHNVWGWGDKDQTQQDRDVTMVVNLKKD  350
            LG AYD+K V  DLV++RV+R+GDGSH VWGWGDKDQ ++D  VT + + + +
Sbjct  302  LGWAYDLKSVSLDLVKQRVQRSGDGSHPVWGWGDKDQLKEDVGVTTITHQRNE  354



Lambda      K        H
   0.324    0.138    0.456 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3617638992


Query= NP_001267823.1 venom serine protease precursor [Bombus terrestris]

Length=358
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CFB_TACTR  unnamed protein product                                    182     5e-54
Q9VW19_DROME  unnamed protein product                                 182     9e-54
PPAF1_HOLDI  unnamed protein product                                  178     2e-52
PPAF3_HOLDI  unnamed protein product                                  170     1e-49
GRASS_DROME  unnamed protein product                                  170     2e-49


>CFB_TACTR unnamed protein product
Length=400

 Score = 182 bits (463),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 127/370 (34%), Positives = 181/370 (49%), Gaps = 65/370 (18%)

Query  27   QECTTPDNKAGKCLGIRGCKPLLEMLQTQGHAAADFLRQSVCKYENN-NPIVCCPNE---  82
             ECT      G C  +  C  +L  L+             VC +     PIVCCP+    
Sbjct  35   NECTARGGLKGSCKSLIDCPSVLATLKDSFPV--------VCSWNGRFQPIVCCPDAIAP  86

Query  83   -----------ESRE------------DRGILVEY-------EPLRPPHCGFSNVSHTR-  111
                        ++E             R + ++         P+ PP     N +  R 
Sbjct  87   PPVTTTAVTVISTKEPKLPRLHISGCGKRKVKIDITTVGRSGSPILPPISTPQNSTGGRG  146

Query  112  -VVGGNPAVLGAWPWIAALGFRYPRNPALEPLWKCGGSLISSRHVLTAAHCAEIN-----  165
             + GG  A +GAWPW+AA+   + +N  +   + C GS+IS++++L+AAH   I      
Sbjct  147  IIAGGVEAKIGAWPWMAAV---FVKNFGIG-RFHCAGSIISNKYILSAAHAFLIGGRKLT  202

Query  166  -ELYVVRIGDLNLVRNDDGAHPVQIEIESKIIHPDYISGVTKHDIAILKLVEEVPFSEYV  224
                 VR+G   + R  +  +PV+      IIHP Y+     +DIAI++L EE+ F++ V
Sbjct  203  PTRLAVRVGGHYIKRGQE--YPVK----DVIIHPHYVEKENYNDIAIIELKEELNFTDLV  256

Query  225  YPICLPVEDNLRNNNFERYYPFVAGWGSLAHHGPGSDDLMEVQVPVISNTECKNSYARFA  284
             PICLP  + + +   +R     AGWG L   GP S  L EV +PV+   +C  +Y +  
Sbjct  257  NPICLPDPETVTDPLKDRIVT-AAGWGDLDFSGPRSQVLREVSIPVVPVDKCDQAYEKLN  315

Query  285  AAH----VTDTVLCAGYTQGGKDACQGDSGGPLMLPKKFTFYQIGVVSYGHKCAAAGYPG  340
                   +T+  LCAG  +GGKDACQGDSGGPLML     +  +GVVS+GHKCA  GYPG
Sbjct  316  TPSLKNGITNNFLCAGLEEGGKDACQGDSGGPLMLVNNTRWIVVGVVSFGHKCAEEGYPG  375

Query  341  VYTRVTSYLD  350
            VY+RV SYLD
Sbjct  376  VYSRVASYLD  385


>Q9VW19_DROME unnamed protein product
Length=408

 Score = 182 bits (462),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 118/337 (35%), Positives = 178/337 (53%), Gaps = 38/337 (11%)

Query  29   CTTPDNKAGKCLGIRGCKPLLEMLQTQGHAAADFLRQSVCKYENNNPIVCCPNEESREDR  88
            C+TP  ++G+C  I  C+    M + +       L   +C  E ++  +CC ++ +    
Sbjct  87   CSTPLGESGRCRHIIYCR----MPELKNDVWR--LVSQLCIIEKSSIGICCTDQSTSNRF  140

Query  89   GILV-------EYEPLRPPH---CGFSNVSHTRVVGGNPAVLGAWPWIAALGFRYPRNPA  138
               V       E   +  P    CG ++    R+ GG PA    WPW+AAL         
Sbjct  141  SPQVVTSADGDEPRIVNKPEQRGCGITSRQFPRLTGGRPAEPDEWPWMAAL-----LQEG  195

Query  139  LEPLWKCGGSLISSRHVLTAAHC--AEINELYVVRIGDLNL-VRNDDGAHPVQIEIESKI  195
            L  +W CGG LI+ RHVLTAAHC   +  E   VR+G+ N  + N+  A      I + +
Sbjct  196  LPFVW-CGGVLITDRHVLTAAHCIYKKNKEDIFVRLGEYNTHMLNETRAR--DFRIANMV  252

Query  196  IHPDYISGVTKHDIAILKLVEEVPFSEYVYPICLPVEDNLRNNNFERYYPFVAGWGSLAH  255
            +H DY      +DIAI+++     F+ Y++P+C+P      N ++      V GWG+   
Sbjct  253  LHIDYNPQNYDNDIAIVRIDRATIFNTYIWPVCMPPV----NEDWSDRNAIVTGWGTQKF  308

Query  256  HGPGSDDLMEVQVPVISNTECKNSYARFAAAHVTDTVLCAGYTQGGKDACQGDSGGPLM-  314
             GP S+ LMEV +PV   ++C++S+ +    HV DT +CAG+ +GG+D+CQGDSGGPL+ 
Sbjct  309  GGPHSNILMEVNLPVWKQSDCRSSFVQ----HVPDTAMCAGFPEGGQDSCQGDSGGPLLV  364

Query  315  -LPKKFTFYQIGVVSYGHKCAAAGYPGVYTRVTSYLD  350
             LP +  +  IG+VS+G  C   G PG+YTRV  YLD
Sbjct  365  QLPNQ-RWVTIGIVSWGVGCGQRGRPGIYTRVDRYLD  400


>PPAF1_HOLDI unnamed protein product
Length=365

 Score = 178 bits (451),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 120/360 (33%), Positives = 181/360 (50%), Gaps = 33/360 (9%)

Query  13   LIAFLHPLVHVASAQECTTPDNKAGKCLGIRGCKPLLEMLQTQGHAAADFLRQSVCKYEN  72
            L  F+  L  + +   C TP+ +  +C+ I  CK L + + T       FLR S C Y N
Sbjct  9    LWFFVLNLYSIKAQAGCRTPNGENARCVPINNCKILYDSVLTSDPEVIRFLRASQCGY-N  67

Query  73   NNPIVCCPNEESRE----DRGILVEYEPLRPPHCGFSNVSHTRVVGGNPAVLGAWPWIAA  128
              P+VCC +  S +       I      L P  CG+  V   +++ G+  V   +PW A 
Sbjct  68   GQPLVCCGSSASYQPPPTSASIRNRRPELLPNDCGYQ-VEADKILNGDDTVPEEFPWTAM  126

Query  129  LGFRYPRNPALEPLWKCGGSLISSRHVLTAAHCAE------INELYVVRIGDLNLVRNDD  182
            +G+   +N +    + CGGSLI++R+++TAAHC        +  L  VR+G+ N   + D
Sbjct  127  IGY---KNSSNFEQFACGGSLINNRYIVTAAHCVAGRVLRVVGALNKVRLGEWNTATDPD  183

Query  183  --GA-------HPVQIEIESKIIHPDYISGVTK--HDIAILKLVEEVPFSEYVYPICLPV  231
              GA        P+ + IE  I HPDY+ G     HDIA+++L  +V F+ Y+ P+CLP 
Sbjct  184  CYGAVRVCVPDKPIDLGIEETIQHPDYVDGSKDRYHDIALIRLNRQVEFTNYIRPVCLP-  242

Query  232  EDNLRNNNFERYYPFVAGWGSLAHHGPGSDDLMEVQVPVISNTECKNSYARFAAAHVTDT  291
            + N      +R    V GWG     G  S    ++ VPV+   +C  ++   A   V  +
Sbjct  243  QPNEEVQVGQRLT--VVGWGR-TETGQYSTIKQKLAVPVVHAEQCAKTFGA-AGVRVRSS  298

Query  292  VLCAGYTQGGKDACQGDSGGPLMLPK-KFTFYQIGVVSYGHKCAAAGYPGVYTRVTSYLD  350
             LCAG  +  KD+C GDSGGPL+  +    F+  G+VS+G  C   G+PG+YT+V  Y D
Sbjct  299  QLCAG-GEKAKDSCGGDSGGPLLAERANQQFFLEGLVSFGATCGTEGWPGIYTKVGKYRD  357


>PPAF3_HOLDI unnamed protein product
Length=351

 Score = 170 bits (430),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 125/367 (34%), Positives = 183/367 (50%), Gaps = 47/367 (13%)

Query  7    LFACLALIAFLHPLVHVASAQECTTPDNKAGKCLGIRGCKPLLEMLQTQGH--AAADFLR  64
            ++  L ++     +V+V++ + CTTP+ +   CL I  CK   + + T G       FLR
Sbjct  1    MWLSLVILGVASAIVNVSTQESCTTPNGETATCLPIESCKIFWDYVVTSGADPEINSFLR  60

Query  65   QSVCKYENNNPIVCCPNEESREDRGILVEYEPLRP--PHCGFSNVSHTRVVGGNPAVLGA  122
             S+C+    N +VCC         G  +++    P    CG  +    +V+GG    LG 
Sbjct  61   ASLCR--QGNYVVCC---------GSTLKFNSALPDRTECGLQD--DFKVLGGEDTDLGE  107

Query  123  WPWIAALGFRYPRNPALEPLWKCGGSLISSRHVLTAAHCAEINELYV--VRIGDLNLVRN  180
            +PW+A L        +    + CGGSLIS R+VLTAAHC   +   V  VR+G+ +L   
Sbjct  108  YPWMALL---QQTKTSGAKSFGCGGSLISDRYVLTAAHCVVSSSYTVTMVRLGEWDLRAT  164

Query  181  DD----GAH------PVQIEIESKIIHPDY--ISGVTKHDIAILKLVEEVPFSEYVYPIC  228
             D    G++      P  I IES   HP+Y   S    +DIA+++L   V  ++YV PIC
Sbjct  165  QDCVGSGSYQYCSPPPQDIGIESITSHPNYEKSSRGVFNDIALIRLARPVNRNKYVQPIC  224

Query  229  LPV--EDNLRNNNFERYYPFVAGWGSLAHHGPGSDDLMEVQVPVISNTECKNSYARFAAA  286
            LP+  E      N       VAGWG+       SD   ++++PV     CK  YA+    
Sbjct  225  LPLPTERTPVGENL-----LVAGWGATETKAQ-SDKKQKLKLPVTDLPACKTLYAKHNKI  278

Query  287  HVTDTVLCAGYTQGGKDACQGDSGGPLMLPK---KFTFYQIGVVSYGHKCAAAGYPGVYT  343
             + D ++CAG  +G KD+C+GDSGGPL          FY  G+VSYG  C   G+P +YT
Sbjct  279  -INDKMICAGGLKG-KDSCKGDSGGPLFGQTGAGNAQFYIEGIVSYGAICGTEGFPAIYT  336

Query  344  RVTSYLD  350
            RV+ +LD
Sbjct  337  RVSDHLD  343


>GRASS_DROME unnamed protein product
Length=377

 Score = 170 bits (430),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 115/352 (33%), Positives = 173/352 (49%), Gaps = 43/352 (12%)

Query  26   AQECTTPDNKAGKCLGIRGCKPLLEMLQTQGHAA-------ADFLRQSVCKYENNNPIVC  78
            A +CTTPD   G+C+    C+ + E L     A        A +L++++C   N     C
Sbjct  29   ADDCTTPDGDQGQCMPFSSCRTIEERLTEAQKAGQKVPADYASYLQKALCGEFNGVRHFC  88

Query  79   CPNEESREDRGILVEYEPLRPPHCGFSNVSHTRVVGGNPAVLGAWPWIAALGFRYPRNPA  138
            CP+   + +  ++  ++      CG  N    RV  G    L + PW+A L  RY +   
Sbjct  89   CPSANIQHNSKVMSLFKD-ENFDCG--NFLSQRVSNGYEVKLSSRPWMALL--RYQQFG-  142

Query  139  LEPLWKCGGSLISSRHVLTAAHCAE--INELYVVRIGDLNLVRNDDGAHP----------  186
             E  + CGG++IS R++LTAAHC     N+LY +R+G+  +   +D              
Sbjct  143  -ESRFLCGGAMISERYILTAAHCVHGLQNDLYEIRLGEHRISTEEDCRQQGRKKKCAPPV  201

Query  187  VQIEIESKIIHPDYISGVTKHDIAILKLVEEVPFSEYVYPICLPVEDNLRNNNFERYYPF  246
            V + IE  +IH  Y +    HDIA+LKL   VPF +++ PICLP+ D L+    +    F
Sbjct  202  VNVGIEKHLIHEKYDARHIMHDIALLKLNRSVPFQKHIKPICLPITDELKEKAEQISTYF  261

Query  247  VAGWGSLAHHGPGSDDLMEVQVPVISNTECKNSYARFAAAHVTDTVLCAGYTQGG--KDA  304
            V GWG+   +G  SD L++  VP+   + C  +Y R     V  + LC G   GG  +D+
Sbjct  262  VTGWGT-TENGSSSDVLLQANVPLQPRSACSQAYRR----AVPLSQLCVG---GGDLQDS  313

Query  305  CQGDSGGPLMLPKKF------TFYQIGVVSYG-HKCAAAGYPGVYTRVTSYL  349
            C+GDSGGPL  P ++         + G+VS G   C     PG+YT V  Y+
Sbjct  314  CKGDSGGPLQAPAQYLGEYAPKMVEFGIVSQGVVTCGQISLPGLYTNVGEYV  365



Lambda      K        H
   0.324    0.138    0.456 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3617638992


Query= NP_001267828.1 silk fibroin 3 precursor [Bombus terrestris]

Length=332


***** No hits found *****



Lambda      K        H
   0.324    0.138    0.456 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3617638992


Query= NP_001267830.1 silk fibroin 2 precursor [Bombus terrestris]

Length=313


***** No hits found *****



Lambda      K        H
   0.324    0.138    0.456 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3617638992


Query= NP_001267833.1 silk fibroin 1 precursor [Bombus terrestris]

Length=327


***** No hits found *****



Lambda      K        H
   0.324    0.138    0.456 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3617638992


Query= NP_001267835.1 farnesyl pyrophosphate synthase-like [Bombus
terrestris]

Length=370
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7KAK2_DROME  unnamed protein product                                 390     4e-135
Q7KN61_DROME  unnamed protein product                                 391     1e-134
FPS_DICDI  unnamed protein product                                    277     1e-90 
Q57WF1_TRYB2  unnamed protein product                                 171     1e-49 
Q9VS54_DROME  unnamed protein product                                 39.7    0.002 


>Q7KAK2_DROME unnamed protein product
Length=380

 Score = 390 bits (1002),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 180/347 (52%), Positives = 250/347 (72%), Gaps = 5/347 (1%)

Query  16   VPNTSFISV-KDESRELMAVWPDIVRDLTDAGRHLDIPDVTKWLVKVLQYNVPSGGRNRA  74
            VP  + ++V KDESR+ MAV+PD+VRD+T   +  +  D  KW  +VLQYNVP G +NR 
Sbjct  32   VPIAARVTVSKDESRDFMAVFPDLVRDITTVTKAYNCSDAAKWFAQVLQYNVPRGKKNRG  91

Query  75   LTVVEAYRSLNPPDQITEENLRLTRILGWCIELLQAFFLTIDDIQDHSEIRRNQPCWYLY  134
            +  V  Y++L P   +T EN++L + LGWC+E+LQ+FF+  DD+ D+S  RR QPCW+  
Sbjct  92   ILTVLTYKNLVPTQDLTPENIKLAQYLGWCVEMLQSFFIISDDVMDNSTTRRGQPCWHKV  151

Query  135  NDIGLTAINDALMLEMCIYQLLKKHFKTKECYLDLLEQFLSVSLKTEMGQCLDLLSTNFG  194
             ++GLTAINDALM+E  +Y +LKKHF   +CY+ L+E F  ++  T  GQ LD L++N  
Sbjct  152  ENVGLTAINDALMIENAMYAILKKHFSHLDCYVALMELFHEITYITTCGQSLDQLNSN--  209

Query  195  KKPNLHLFTMDRYNSIVKYKTGYYTFVLPATVAMSFTGIKDPEMYRQAKTILLEMGHLFQ  254
                +  FTM+ Y +IV+ KT YY+F LP  +A+   G KD E +RQ+KTILLEMG+ FQ
Sbjct  210  --RCVSEFTMENYKAIVENKTAYYSFYLPFALALHLAGYKDAEAFRQSKTILLEMGNFFQ  267

Query  255  VKDDYLDCYGSIEDIGKSGTDIAEGKCSWLIVVALQRATPEQKKIFEECYGQSDVEKINR  314
            V+DD+LDC+G+ E  GK GTDI + KCSWL VVA+QRA  EQK+I  +CYG+ +  K+ R
Sbjct  268  VQDDFLDCFGNPEVTGKIGTDIQDNKCSWLAVVAMQRANVEQKQIMVDCYGKEEPAKVER  327

Query  315  VKQLYQELGVSNTYAIYEEETYNLLHTHIQQISRGLPHDFFLKLLNR  361
            VK+LY+ELG+ +TYAI+EEE+YN++ THIQQ SRG+PH  FL++LN+
Sbjct  328  VKELYKELGLPSTYAIFEEESYNMIKTHIQQTSRGVPHQTFLQILNK  374


>Q7KN61_DROME unnamed protein product
Length=419

 Score = 391 bits (1004),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 180/347 (52%), Positives = 250/347 (72%), Gaps = 5/347 (1%)

Query  16   VPNTSFISV-KDESRELMAVWPDIVRDLTDAGRHLDIPDVTKWLVKVLQYNVPSGGRNRA  74
            VP  + ++V KDESR+ MAV+PD+VRD+T   +  +  D  KW  +VLQYNVP G +NR 
Sbjct  71   VPIAARVTVSKDESRDFMAVFPDLVRDITTVTKAYNCSDAAKWFAQVLQYNVPRGKKNRG  130

Query  75   LTVVEAYRSLNPPDQITEENLRLTRILGWCIELLQAFFLTIDDIQDHSEIRRNQPCWYLY  134
            +  V  Y++L P   +T EN++L + LGWC+E+LQ+FF+  DD+ D+S  RR QPCW+  
Sbjct  131  ILTVLTYKNLVPTQDLTPENIKLAQYLGWCVEMLQSFFIISDDVMDNSTTRRGQPCWHKV  190

Query  135  NDIGLTAINDALMLEMCIYQLLKKHFKTKECYLDLLEQFLSVSLKTEMGQCLDLLSTNFG  194
             ++GLTAINDALM+E  +Y +LKKHF   +CY+ L+E F  ++  T  GQ LD L++N  
Sbjct  191  ENVGLTAINDALMIENAMYAILKKHFSHLDCYVALMELFHEITYITTCGQSLDQLNSNRC  250

Query  195  KKPNLHLFTMDRYNSIVKYKTGYYTFVLPATVAMSFTGIKDPEMYRQAKTILLEMGHLFQ  254
                +  FTM+ Y +IV+ KT YY+F LP  +A+   G KD E +RQ+KTILLEMG+ FQ
Sbjct  251  ----VSEFTMENYKAIVENKTAYYSFYLPFALALHLAGYKDAEAFRQSKTILLEMGNFFQ  306

Query  255  VKDDYLDCYGSIEDIGKSGTDIAEGKCSWLIVVALQRATPEQKKIFEECYGQSDVEKINR  314
            V+DD+LDC+G+ E  GK GTDI + KCSWL VVA+QRA  EQK+I  +CYG+ +  K+ R
Sbjct  307  VQDDFLDCFGNPEVTGKIGTDIQDNKCSWLAVVAMQRANVEQKQIMVDCYGKEEPAKVER  366

Query  315  VKQLYQELGVSNTYAIYEEETYNLLHTHIQQISRGLPHDFFLKLLNR  361
            VK+LY+ELG+ +TYAI+EEE+YN++ THIQQ SRG+PH  FL++LN+
Sbjct  367  VKELYKELGLPSTYAIFEEESYNMIKTHIQQTSRGVPHQTFLQILNK  413


>FPS_DICDI unnamed protein product
Length=382

 Score = 277 bits (708),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 144/351 (41%), Positives = 211/351 (60%), Gaps = 11/351 (3%)

Query  23   SVKDESRELMAVWPDIVRDLTDAGRHLDIPDVT-KWLVKVLQYNVPSGGRNRALTVVEAY  81
            + K+E  + + ++P +  ++      +D+P  T  W+ K++  NV  G  NR LTV+ + 
Sbjct  33   TAKEELADFVEIFPILTNEILKELPGMDMPPQTIAWVEKMINVNVSGGKMNRGLTVLHSL  92

Query  82   RSLNPPDQITEENLRLTRILGWCIELLQAFFLTIDDIQDHSEIRRNQPCWY-----LYND  136
            + L    Q++   + L  +LGWC+E LQAFFL  DDI D S  RR QPCWY     + N+
Sbjct  93   QLLVEGRQLSRSEIFLANVLGWCVEWLQAFFLVADDIMDQSITRRGQPCWYRQANPISNN  152

Query  137  --IGLTAINDALMLEMCIYQLLKKHFKTKECYLDLLEQFLSVSLKTEMGQCLDLLSTNFG  194
              IG  AIND+ +LE CIY L+KK+F+ +  Y D+L+ F   S +TE+GQ LDL  T   
Sbjct  153  GTIGSIAINDSFILESCIYILIKKYFRNEPYYADILDIFHETSYQTELGQLLDL--TTQP  210

Query  195  KKPNLHLFTMDRYNSIVKYKTGYYTFVLPATVAMSFTGIKDPEMYRQAKTILLEMGHLFQ  254
             + +  LFT++ Y  IVKYKT YY+F LP  +AM   GI     +  AK ILL MG  FQ
Sbjct  211  NRGDFSLFTLNTYRRIVKYKTAYYSFYLPVALAMLMAGITSTPAFSTAKDILLPMGEFFQ  270

Query  255  VKDDYLDCYGSIEDIGKSGTDIAEGKCSWLIVVALQRATPEQKKIFEECYGQSDVEKINR  314
            V+DD+LDCYGS   IGK G DI E KCSW+I  A+   TPEQ  + ++ YG  +   +  
Sbjct  271  VQDDFLDCYGSPAVIGKIGRDIEENKCSWMICQAILNGTPEQINLLKKHYGLDNPTDVEL  330

Query  315  VKQLYQELGVSNTYAIYEEETYNLLHTHIQQISRGLPHDFFLKLLNRTCRK  365
            VK++Y E+G+   +  YE+E+Y  L + I+ + R +P + F+KLL++  ++
Sbjct  331  VKKIYGEIGLKKIFKDYEDESYAFLISKIKSV-RIMPQEVFIKLLSKIYKR  380


>Q57WF1_TRYB2 unnamed protein product
Length=367

 Score = 171 bits (432),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 107/321 (33%), Positives = 161/321 (50%), Gaps = 21/321 (7%)

Query  52   PDVTKWLVKVLQYNVPSGGRNRALTVV---EAYRSLNPPDQITEEN-LRLTRIL------  101
            P+  ++L K++      G  NR LTV+   E+  SL+P +   +++  R  R+L      
Sbjct  29   PNRVRYLRKMMDTTCLGGKYNRGLTVIDVAESLLSLSPNNNGEKDDGARRKRVLHDACVC  88

Query  102  GWCIELLQAFFLTIDDIQDHSEIRRNQPCWYLYNDIGL-TAINDALMLEMCIYQLLKKHF  160
            GW IE LQA +L  DDI D+S  RR +PCWY +  + +  AIND L+L+   + +    F
Sbjct  89   GWMIEFLQAHYLVEDDIMDNSVTRRGKPCWYRHPGVTVQCAINDGLLLKSWTHMMAMHFF  148

Query  161  KTKECYLDLLEQFLSVSLKTEMGQCLDLLSTNFGKK----------PNLHLFTMDRYNSI  210
              +    DLL +F  V   T +GQ  D+ S     K           +   FT+  Y  I
Sbjct  149  ADRPFLQDLLCRFNRVDYTTAVGQLYDVTSMFDSNKLDPDVSQPTTTDFAEFTLSNYKRI  208

Query  211  VKYKTGYYTFVLPATVAMSFTGIKDPEMYRQAKTILLEMGHLFQVKDDYLDCYGSIEDIG  270
            VKYKT YYT++LP  + +  +           + + + MG  FQV+DD +DC+   E +G
Sbjct  209  VKYKTAYYTYLLPLVMGLIVSEALPTVDMGVTEELAMLMGEYFQVQDDVMDCFTPPERLG  268

Query  271  KSGTDIAEGKCSWLIVVALQRATPEQKKIFEECYGQSDVEKINRVKQLYQELGVSNTYAI  330
            K GTDI + KCSWL V  L +A+  Q   F+  YG  D EK+  V++LY+E  +   Y  
Sbjct  269  KVGTDIQDAKCSWLAVTFLAKASSAQIAEFKANYGSGDSEKVATVRRLYEEADLQEDYVA  328

Query  331  YEEETYNLLHTHIQQISRGLP  351
            YE      +   I+++    P
Sbjct  329  YEAAVAEQVKELIEKLRLCSP  349


>Q9VS54_DROME unnamed protein product
Length=338

 Score = 39.7 bits (91),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 94/205 (46%), Gaps = 27/205 (13%)

Query  101  LGWCIELLQAFFLTIDDIQDHSEIRRNQPCWYLYNDIGLT--AINDALMLEMCIYQLLKK  158
            +G  +++L    L IDDI+D+S +RR  P  +    +  T  A N AL L +   Q L  
Sbjct  61   IGDIVQMLHNSSLLIDDIEDNSILRRGVPVAHSIYGVASTINAANYALFLALEKVQQL-D  119

Query  159  HFKTKECYLDLLEQFLSVSLKTEMGQCLDLLSTNFGKKPNLHLFTMDRYNSIVKYKTGYY  218
            H +  + Y + L       L+   GQ +++   +    P     +   Y  +   KTG  
Sbjct  120  HPEATKVYTEQL-------LELHRGQGMEIYWRDSFTCP-----SESDYKLMTVRKTGGL  167

Query  219  TFVLPATVAMSFTGIKDPEMYRQAKTILLEMGHLFQVKDDYLDCYGSIEDIGKSGT---D  275
             F+L   +   F+  K  E Y +   IL   G  FQ++DDY  C  S+++  ++ +   D
Sbjct  168  -FMLAIRLMQLFSSNK--EDYSKLTAIL---GLYFQIRDDY--CNLSLKEYTENKSFAED  219

Query  276  IAEGKCSWLIVVALQRATPEQKKIF  300
            + EGK  + ++ A+ R   + K++ 
Sbjct  220  LTEGKFGFPVIHAV-RTQKQDKQVL  243



Lambda      K        H
   0.324    0.138    0.456 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3617638992


Query= NP_001267838.1 defensin precursor [Bombus terrestris]

Length=96
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DEFI_DROME  unnamed protein product                                   58.5    1e-12
LUCFE_LUCSE  unnamed protein product                                  55.8    1e-11
DEFI_PHLDU  unnamed protein product                                   52.0    5e-10
DEFA_AEDAE  unnamed protein product                                   45.4    2e-07
DEFI_PALPR  unnamed protein product                                   42.4    9e-07


>DEFI_DROME unnamed protein product
Length=92

 Score = 58.5 bits (140),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 54/93 (58%), Gaps = 11/93 (12%)

Query  2   VKVYFLVALLFVAVAAIMAA-------PVEEEYELLEQAGIEE--RADRQRRVTCDLLSI  52
           +K + LVA+ F  +A +  A       P+ E++ L+ +   +E  +  RQ+R TCDLLS 
Sbjct  1   MKFFVLVAIAFALLACVAQAQPVSDVDPIPEDHVLVHEDAHQEVLQHSRQKRATCDLLS-  59

Query  53  KGVAEHSACAANCLSMGKAGGRCEN-AVCLCRK  84
           K    H+ACA +C++ G  GG C + AVC+CR 
Sbjct  60  KWNWNHTACAGHCIAKGFKGGYCNDKAVCVCRN  92


>LUCFE_LUCSE unnamed protein product
Length=92

 Score = 55.8 bits (133),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 52/89 (58%), Gaps = 13/89 (15%)

Query  4   VYFLVALLFVAVAAIMAAPVEEEYELLEQAGIE-------ERADRQRRVTCDLLSIKGVA  56
           V F +AL FV+ +  +A P ++E   ++  G+E       E   R +R TCDLLS  GV 
Sbjct  9   VTFCLALSFVSQS--LALPADDEAHFVD--GLEALKTIEPELHGRYKRATCDLLSGTGV-  63

Query  57  EHSACAANCLSMGKAGGRCEN-AVCLCRK  84
           +HSACAA+CL  G  GG C   A+C+CR 
Sbjct  64  KHSACAAHCLLRGNRGGYCNGRAICVCRN  92


>DEFI_PHLDU unnamed protein product
Length=98

 Score = 52.0 bits (123),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 44/83 (53%), Gaps = 14/83 (17%)

Query  15  VAAIMAAPVEEEYELLEQAG------------IEERADRQRRVTCDLLSIKGVAEHSACA  62
           ++A  + PVE E E  +               + +   RQ+R TCDLLS  GV  H+ACA
Sbjct  17  ISAYPSNPVEVEAEDFDAQDPDLQTFQDTFYEVPQVHSRQKRATCDLLSAFGVG-HAACA  75

Query  63  ANCLSMGKAGGRCEN-AVCLCRK  84
           A+C+  G  GG C + AVC CR+
Sbjct  76  AHCIGHGYRGGYCNSKAVCTCRR  98


>DEFA_AEDAE unnamed protein product
Length=98

 Score = 45.4 bits (106),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 38/62 (61%), Gaps = 8/62 (13%)

Query  24  EEEYELLEQAGIEERADRQRRVTCDLLSIKGVAEHSACAANCLSMGKAGGRCEN-AVCLC  82
           EE Y    QA +E    R +R TCDLLS  GV + SACAA+C++ G  GG C +  VC+C
Sbjct  44  EETY----QAAVENF--RLKRATCDLLSGFGVGD-SACAAHCIARGNRGGYCNSKKVCVC  96

Query  83  RK  84
           R 
Sbjct  97  RN  98


>DEFI_PALPR unnamed protein product
Length=43

 Score = 42.4 bits (98),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 24/42 (57%), Gaps = 3/42 (7%)

Query  46  TCDLLSIKG---VAEHSACAANCLSMGKAGGRCENAVCLCRK  84
           TCD LS         HSACA +CL+ G  GGRC N +C CR 
Sbjct  2   TCDALSFSSKWLTVNHSACAIHCLTKGYKGGRCVNTICNCRN  43



Lambda      K        H
   0.324    0.138    0.456 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3617638992


Query= NP_001267840.1 fatty acid synthase-like [Bombus terrestris]

Length=2392
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VQL7_DROME  unnamed protein product                                 2592    0.0  
B7Z001_DROME  unnamed protein product                                 2587    0.0  
Q9VQL6_DROME  unnamed protein product                                 2272    0.0  
M9PB21_DROME  unnamed protein product                                 2270    0.0  
Q8MR70_DROME  unnamed protein product                                 1296    0.0  


>Q9VQL7_DROME unnamed protein product
Length=2438

 Score = 2592 bits (6718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1319/2448 (54%), Positives = 1726/2448 (71%), Gaps = 73/2448 (3%)

Query  1     MPAQFES---ANTPIVREPTMLNSNTNAY-----DVNNEIVISGFSGRFPESSDIEEFKK  52
             MPA+F        P  R    L+     Y      +N+EI I+GFSGR PESS IEEFK+
Sbjct  1     MPARFAEEVITAEPAQRAAPQLDLGGGHYVPRQQHLNDEIAITGFSGRLPESSTIEEFKQ  60

Query  53    NLFEGIDMITDDERRWPAGLFGLPKRTGKLKD--LKSFDATFFGVHAKQAHVMDPQLRLL  110
             NLF+G+DM+ DD RRW  GL+GLP R GKLKD  L++FD  FFGVH KQA  MDP LR+L
Sbjct  61    NLFDGVDMVNDDPRRWERGLYGLPDRIGKLKDSDLENFDQQFFGVHQKQAECMDPLLRML  120

Query  111   LEVVYEAIVDAGINPNDIRGSKTGVFIGVSSSESDEFWSKDPEQINGYGLTGCCRAMFPN  170
             LE+ +EAI+DAG+NP+D+RGS+TGV+IGVS+SE+++ W  D +++NGYGLTGC RAMF N
Sbjct  121   LELTHEAIIDAGLNPSDLRGSRTGVYIGVSNSETEQHWCSDADRVNGYGLTGCARAMFAN  180

Query  171   RISYTFDFNGPSYAIDTACSSSLYAMHQAIVSIRSGECDAAIVGGCNLLLKPTSSLQFHR  230
             RIS+TFDF GPSY+IDTACSSSLYA+ QA   +R G+ D A+V G  L+LKPT SLQF R
Sbjct  181   RISFTFDFKGPSYSIDTACSSSLYALEQAFSDMREGKVDNALVAGAGLILKPTMSLQFKR  240

Query  231   LGMLSPDGACKAFDTDGKGYVRSEAVSVLLLQKARDARRVYATVLHAKTNTDGNKAQGIT  290
             L MLSPDG+CKAFD  G GYVRS+   VLLLQ+   ARRVYA++L+ +TNTDG K QGIT
Sbjct  241   LNMLSPDGSCKAFDESGNGYVRSDGCVVLLLQRTSAARRVYASILNVRTNTDGFKEQGIT  300

Query  291   FPSGDMQNKLMREVYAEVGVNPADVVYVEAHGTGTKVGDPQEINSIANLFCKGRKGPLLL  350
             +P G MQN+L+RE Y E+G+NPADVVYVEAHGTGTKVGDPQE+NSI + FCK R  PLL+
Sbjct  301   YPIGKMQNRLIRETYEEIGLNPADVVYVEAHGTGTKVGDPQEVNSITDFFCKDRTTPLLI  360

Query  351   GSVKSNMGHSEPASGVCSMAKLLIAMEAGVIPGNLHFKNPNTDIPALSDGSIQVVDKNMP  410
             GSVKSNMGHSEPASGVCS+AK+LIAME GVIPGNLH+  PN D+  L DG ++VVD+N+P
Sbjct  361   GSVKSNMGHSEPASGVCSVAKILIAMEEGVIPGNLHYNKPNPDLYGLVDGRLKVVDRNLP  420

Query  411   WKGGLIAVNSFGFGGANAHILLRSNPKPK-LSPVLDNKVPKLVTVSGRTSEAVNVLLDKA  469
             W GG+I +NSFGFGGANAH++L+SNPKPK L+P   +   K+V  SGRT EAV  LL+ A
Sbjct  421   WNGGIIGLNSFGFGGANAHVILKSNPKPKALTP--KDGALKVVLASGRTFEAVEQLLESA  478

Query  470   KEYEKDDEFIALLHDIHTNNVAGHLYRGYSIMGN--VNIREVDSYVNEKRPVWFVFSGMG  527
                  DDE++ L+++IH+  +  H +RGY ++ +   + REV    ++KRP+W+++SGMG
Sbjct  479   STNADDDEYLQLINEIHSKAIPNHFFRGYGVVSSKGTHQREVIESNDDKRPIWYIYSGMG  538

Query  528   SQWPGMGKDLLSIDIFQRSLRRCAEALKPEGIDLMNLIQNGTAETFDENVLYSFVSIAAI  587
             SQW  M KDL+ I+ F ++++RCA+ LKPEG+DL++++   T ++F EN+L SF+SIAA+
Sbjct  539   SQWASMAKDLMKIEAFAKTIQRCADVLKPEGVDLIDVLTRSTDKSF-ENILNSFISIAAM  597

Query  588   QVALVDVLTYLGIQPDGIVGHSVGELGCAYADGTFTPEQTVLAAYWRGKTIKDSNLQPGG  647
             QVAL D+L+ LGI PDGIVGHSVGELGCAYADG FTPEQTVLAAYWRGK+I D+ L  G 
Sbjct  598   QVALTDLLSSLGIHPDGIVGHSVGELGCAYADGCFTPEQTVLAAYWRGKSILDTQLAKGK  657

Query  648   MAAVGLSWEEAAARCPPDVTPACNNSADSVTVSGPIESLKKLADDLQKDNIFIKLVNSSG  707
             MAAVGLSWE+A +R P D  P C+NS D+ T+SGP  S++ L   L  + +F K VNSSG
Sbjct  658   MAAVGLSWEDAHSRVPSDCFPVCHNSEDNCTISGPEASIEALVAKLNAEGVFAKAVNSSG  717

Query  708   VAFHSKYVAPVGQKLRAMLEKIITNPKQRTSRWISTSIPESAWGTPLAQLSSAAYHVNNL  767
              AFHSKY+A  G KLR  LEKII N K RT+RWISTSIPESAW TP+A+ SSAAYHVNNL
Sbjct  718   YAFHSKYIAEAGPKLRKSLEKIIPNAKNRTARWISTSIPESAWNTPVAKQSSAAYHVNNL  777

Query  768   LSPVLFYQALGHIPENAIVIEIAPHCLLQAILRRSLPSTVTNIGLHKRGHANNLNFFLEN  827
             LSPVLF++AL H+P+NAI +EIAPH LLQAIL+R+L    TN+ L KRGH NN+ FFL N
Sbjct  778   LSPVLFHEALQHVPKNAISVEIAPHGLLQAILKRALGPDATNLSLVKRGHENNVEFFLTN  837

Query  828   IGKLYLAGGQPRVSKLYPPVNYPVGRGTPMINSLVKWDHSVEWNLADYAATNASFGENVV  887
             +GKL+ AG QP+V  L  P++YPVGRGTPM+NS V WDH+ +W +A +    +S GE +V
Sbjct  838   VGKLFAAGAQPQVLTLVRPISYPVGRGTPMLNSKVGWDHTQKWLVAKFGKETSS-GETIV  896

Query  888   EVNLSKETDAYLVGHCIDERILFPATGYLVIVWKTYAKMRGTDFEKLPITFENVKFQRAT  947
             EV+LSKE DA+L GH ID RILFPATGY+ + W+T+AKM+G++F K P+  EN+ F RAT
Sbjct  897   EVDLSKEDDAFLAGHTIDGRILFPATGYMTLAWQTFAKMQGSEFHKTPVVMENLVFHRAT  956

Query  948   IMPMDGTVKFSINIFLGTGDFEICESGSVVVTGTVSVPENVDKMLLNMPAPIVKNESTVV  1007
             I+  +  VKF IN F GTG FEICESGS+ V+G +++PE++D    N   P+ +   + V
Sbjct  957   ILNKNAVVKFGINFFDGTGAFEICESGSLAVSGKITIPESID----NEELPLEEQTPSAV  1012

Query  1008  --ELNTTDVYKELRLRGYNYTGIFQGIKVVHNGGVSGRLLWND-WISFMDTMLQFSILEK  1064
               EL T DVYKELRLRGY+Y GIF+GI        +G+L W D WISFMDTMLQFSIL K
Sbjct  1013  AKELGTNDVYKELRLRGYDYGGIFRGIVRSDTVASTGKLQWVDNWISFMDTMLQFSILSK  1072

Query  1065  DCRGLYVPVRVQYVAINPIAHLEFVENYKEGE----GVPIYSYPNIGVIKSGGVEIRKMK  1120
             + R LY+P R++   INP  H E +    + E    G+P+  Y +I VIKS GVE+R +K
Sbjct  1073  NLRELYLPTRIERAVINPAKHFELLSALTKEEQVETGLPVQWYSDINVIKSAGVELRGLK  1132

Query  1121  ASLIAKKQQIR-PPKLERCLFIPYENSQPLVQDPEKAKVHALTILLLTAYENIKG-IKLK  1178
             A+L  ++   + PP LER  F+P  N+  L ++ EKA++HAL + +    EN  G +KLK
Sbjct  1133  ANLAQRRPGTQAPPTLERYQFVPNINTTDLNENSEKARLHALDVAIQVIIENSSGAVKLK  1192

Query  1179  ITEVSGDRPVDSLMLPYIKTWCSREPVINGDLQLATVLRKRYISL----KQNIKIIKCNV  1234
               E++  R  D L+   +      EPV+ GD+ + T                ++++  +V
Sbjct  1193  GVELANGRNPDVLVANRLLQIIEGEPVLTGDVAVVTSNNNEETITAALGDSGVRVVSKDV  1252

Query  1235  EKELIGQDLHIAVASNVLTDNSLNVLKNLKDSVINRGFILLEETAQTDFN-----VVDPD  1289
              KE + Q+ H     +VL+      L+N   S+   GF++LEET  T        +    
Sbjct  1253  LKEPVEQNCHFVFGIDVLSRPDTKTLENSIASIRENGFLILEETLPTYTKTGRALLTKFG  1312

Query  1290  LVCVAKQVIPGKSYILLKKKEV---RPDPIVIQLTEKNFSWVEGVKAALKNVVAQNQRPL  1346
              V V +Q +     ++L +K V       +V+  TE+NF+WV+ +KAAL     + Q   
Sbjct  1313  FVAVQEQSLGATRVLVLARKAVDLKTRKSVVVVATEQNFNWVDDLKAALATAATEEQYVY  1372

Query  1347  FVCQGEELFGMVGFMNCILNEDGGAKASYVFIQDKNMPKFNLNDKFYAKQLDKQMFANIL  1406
              VCQGEELFG VG M CI NE+GG  A  VF+QD    KF+L    Y +QL+K + +N+L
Sbjct  1373  VVCQGEELFGAVGLMTCIKNENGGKLARLVFVQDAKAEKFSLTSTLYRQQLEKDLISNVL  1432

Query  1407  RGGQWGSYKHIELDQENESSLQVEHAYINALNRGDLSSLRWIESPLSYYQLEKSPNTELC  1466
             + G WG+++H++L+ + +++LQVEHAY+NAL +GDL+SL+WIE+  +        N E C
Sbjct  1433  KNGAWGTFRHLKLETQ-QATLQVEHAYVNALVKGDLASLKWIEAAQADTAATVDKNLETC  1491

Query  1467  SVYYAPLNFRDIMLATGKLPPDALPGNLATQDCILGLEFSGRDSKGQRVMAMVPARGLAT  1526
             +VYYAP+NFRD+ML +GKL  DALPG+LA QDC+LGLEF+GRD++G+RVMAMVPA+ LAT
Sbjct  1492  TVYYAPINFRDVMLTSGKLAADALPGDLAEQDCVLGLEFAGRDTQGRRVMAMVPAKSLAT  1551

Query  1527  TVIADPGFMWKVPDKWSLEEAATVPVAYATSYYALCVRGHMKPGDSVLIHAGSGGVGQAS  1586
             T +A    MW++P+KW++EEA+TVP  Y+T YYAL VRG MK G+ +LIHAGSGGVGQA+
Sbjct  1552  TCVASKRMMWQIPEKWTMEEASTVPCVYSTVYYALVVRGQMKKGEKILIHAGSGGVGQAA  1611

Query  1587  ISIALHAGCKVFTTVGTQDKRDFLKKMFPVLTDRNIGNSRDTSFEQLILNETNGRGVDIV  1646
             IS+AL  G  VFTTVG+++KR+FL K FP L +RNIGNSRDTSFEQL+L ET GRGVD+V
Sbjct  1612  ISVALAHGLTVFTTVGSKEKREFLLKRFPKLQERNIGNSRDTSFEQLVLRETKGRGVDLV  1671

Query  1647  LNSLAEEKLQASIRCLAQGGRFLEIGKFDLSNDSPLGMSVFLKNVSFHGILLDAICEDDG  1706
             LNSL+EEKLQASIRCL   GRFLEIGKFDLSN+SPLGMSVFLKN SFHGILLD++ E + 
Sbjct  1672  LNSLSEEKLQASIRCLGLNGRFLEIGKFDLSNNSPLGMSVFLKNTSFHGILLDSVMEGEE  1731

Query  1707  PERQEVVRLVSEGIKSGAVRPLPSTVFSEQQIEQSFRYMATGKHIGKVLLKIRDEEK-QK  1765
               + +VV LV+EGIK+GAV PLP++VF++QQ+EQ+FR+MA+GKHIGKV++K+RDEE  +K
Sbjct  1732  EMQNQVVSLVAEGIKTGAVVPLPTSVFNDQQVEQAFRFMASGKHIGKVVIKVRDEEAGKK  1791

Query  1766  VVQSPQKVVSAIPRTYLNPEKSYILVGGLGGFGLELAYWMILRGAKYIILTSRSGVTTGF  1825
              +Q   ++++AIPRTY++PEKSYILVGGLGGFGLEL  W++ RGA+YI+LTSRSGV TG+
Sbjct  1792  ALQPKPRLINAIPRTYMHPEKSYILVGGLGGFGLELTNWLVTRGARYIVLTSRSGVKTGY  1851

Query  1826  QALCIRRWRNMGAHIKISTADVTTLDGAKQLIKESKALAPVGGIFNLAAVLRDGLIENLT  1885
             Q L IRRW+  G  + I T+DVTT  GAK+L++ S  LA VGGIFNLAAVLRD LIE+ T
Sbjct  1852  QGLMIRRWQERGVKVVIDTSDVTTAAGAKKLLENSNKLALVGGIFNLAAVLRDALIEDQT  1911

Query  1886  ESDFVISASPKVNGTKNLDIVSRE-CSSLDYFVVFSSVTSGRGNVGQTNYGLANSAMERL  1944
               DF   A PKV  TK LD  SR+ C+ LDYF+ FSSV+ GRGN+GQTNYGLANSAMER+
Sbjct  1912  AKDFKTVADPKVTATKYLDQFSRDICTELDYFICFSSVSCGRGNIGQTNYGLANSAMERI  1971

Query  1945  MEQRQANGLPGLAIQWGAIGDVGLILEKLGGFNDTEIGGTLPQRIQNCLDTMDIFLQQPH  2004
              EQRQ +G PG AIQWGAIGD GL+LE LG  NDT IGGTLPQR+ +CL T+D+FLQQPH
Sbjct  1972  CEQRQVSGFPGTAIQWGAIGDTGLVLENLGD-NDTVIGGTLPQRMPSCLQTIDLFLQQPH  2030

Query  2005  PILASLVTANKDNTVESANKVSVVQAIANILGIKALESVNGSTSLADLGMDSLMGTEIKQ  2064
             P++AS+V A K  + +SA  VS++  IANILG++  +++    SLADLGMDSLM  EIKQ
Sbjct  2031  PVVASMVVAEKRKSDQSAG-VSLIATIANILGLRDTKNIQDGASLADLGMDSLMSAEIKQ  2089

Query  2065  TMERNYDIVLSALEIRNLTFDKLGKLDNTS-------------GAEAGN--AGADSDDEE  2109
             T+ERN+DIVLSA EIR LTF  L  +D  +             G    N  +G  S    
Sbjct  2090  TLERNFDIVLSAQEIRQLTFGALKAMDGGADVKPAAAAPAAAAGVPEANITSGGSSRTAS  2149

Query  2110  TIQDAAGLLSFEGTEIVPVKIIVPLST---ANSAGQPLFFVPAIEGVAAPFKTVASELNR  2166
              + D   ++    T ++P + IV L T   ANS   P+FF+  IEG A+  + +A  L  
Sbjct  2150  PMGDGTQVVF--TTSLIPTEAIVQLDTKAPANSKQSPIFFISPIEGFASALEPLAKRLEV  2207

Query  2167  PAWSFQCTESCPLESVSALANFYLKKMRAIQTEGPYNIIGYSFGSCIGLEMAVQLQKAGH  2226
             PA+  Q TE+ P +S+ + A F++K++R +Q +GPY + GYSFG  +   MA  L++   
Sbjct  2208  PAYGLQYTEAVPSDSLESAAKFFIKQLRTVQPKGPYKLAGYSFGCLLTYVMAGILEETNE  2267

Query  2227  KTNLTVIDGSPDFVKLHSVELGKRATEESSEVITDGLRKCLAYFVRQFRSNITFLKLYDM  2286
               N+ ++DG+P +V  ++    +R T + +    D     LAYF     +NI +  L  +
Sbjct  2268  VANVIMLDGAPSYVNWYTSSFKQRYT-DGTNADNDNQSYGLAYFGIVL-ANIDYKALVRL  2325

Query  2287  LKNINTTEVVLNKVVELIDDK-NLDSEDLKSAALLFYKKLKAAFFYKPE-KYDGDIVLLK  2344
             L  I T E  L +  EL+ ++     E +K +A LFYKKL+ A  Y+P  K   ++ L+K
Sbjct  2326  LIVIPTWEEKLERFAELMSNEITQPVETIKKSATLFYKKLELADGYQPTLKLKTNVTLVK  2385

Query  2345  AKDSFVPLNNDYGLSKISNK-VTVIELPGNHRSILL-GKSASQIANIL  2390
               D+   L+ DY L ++  K V V  + GNHR+ L+  +S   I +IL
Sbjct  2386  PTDNSAKLDEDYRLKEVCTKPVEVHTVEGNHRTFLIEDQSLKTIQSIL  2433


>B7Z001_DROME unnamed protein product
Length=2540

 Score = 2587 bits (6705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1319/2448 (54%), Positives = 1726/2448 (71%), Gaps = 73/2448 (3%)

Query  1     MPAQFES---ANTPIVREPTMLNSNTNAY-----DVNNEIVISGFSGRFPESSDIEEFKK  52
             MPA+F        P  R    L+     Y      +N+EI I+GFSGR PESS IEEFK+
Sbjct  103   MPARFAEEVITAEPAQRAAPQLDLGGGHYVPRQQHLNDEIAITGFSGRLPESSTIEEFKQ  162

Query  53    NLFEGIDMITDDERRWPAGLFGLPKRTGKLKD--LKSFDATFFGVHAKQAHVMDPQLRLL  110
             NLF+G+DM+ DD RRW  GL+GLP R GKLKD  L++FD  FFGVH KQA  MDP LR+L
Sbjct  163   NLFDGVDMVNDDPRRWERGLYGLPDRIGKLKDSDLENFDQQFFGVHQKQAECMDPLLRML  222

Query  111   LEVVYEAIVDAGINPNDIRGSKTGVFIGVSSSESDEFWSKDPEQINGYGLTGCCRAMFPN  170
             LE+ +EAI+DAG+NP+D+RGS+TGV+IGVS+SE+++ W  D +++NGYGLTGC RAMF N
Sbjct  223   LELTHEAIIDAGLNPSDLRGSRTGVYIGVSNSETEQHWCSDADRVNGYGLTGCARAMFAN  282

Query  171   RISYTFDFNGPSYAIDTACSSSLYAMHQAIVSIRSGECDAAIVGGCNLLLKPTSSLQFHR  230
             RIS+TFDF GPSY+IDTACSSSLYA+ QA   +R G+ D A+V G  L+LKPT SLQF R
Sbjct  283   RISFTFDFKGPSYSIDTACSSSLYALEQAFSDMREGKVDNALVAGAGLILKPTMSLQFKR  342

Query  231   LGMLSPDGACKAFDTDGKGYVRSEAVSVLLLQKARDARRVYATVLHAKTNTDGNKAQGIT  290
             L MLSPDG+CKAFD  G GYVRS+   VLLLQ+   ARRVYA++L+ +TNTDG K QGIT
Sbjct  343   LNMLSPDGSCKAFDESGNGYVRSDGCVVLLLQRTSAARRVYASILNVRTNTDGFKEQGIT  402

Query  291   FPSGDMQNKLMREVYAEVGVNPADVVYVEAHGTGTKVGDPQEINSIANLFCKGRKGPLLL  350
             +P G MQN+L+RE Y E+G+NPADVVYVEAHGTGTKVGDPQE+NSI + FCK R  PLL+
Sbjct  403   YPIGKMQNRLIRETYEEIGLNPADVVYVEAHGTGTKVGDPQEVNSITDFFCKDRTTPLLI  462

Query  351   GSVKSNMGHSEPASGVCSMAKLLIAMEAGVIPGNLHFKNPNTDIPALSDGSIQVVDKNMP  410
             GSVKSNMGHSEPASGVCS+AK+LIAME GVIPGNLH+  PN D+  L DG ++VVD+N+P
Sbjct  463   GSVKSNMGHSEPASGVCSVAKILIAMEEGVIPGNLHYNKPNPDLYGLVDGRLKVVDRNLP  522

Query  411   WKGGLIAVNSFGFGGANAHILLRSNPKPK-LSPVLDNKVPKLVTVSGRTSEAVNVLLDKA  469
             W GG+I +NSFGFGGANAH++L+SNPKPK L+P   +   K+V  SGRT EAV  LL+ A
Sbjct  523   WNGGIIGLNSFGFGGANAHVILKSNPKPKALTP--KDGALKVVLASGRTFEAVEQLLESA  580

Query  470   KEYEKDDEFIALLHDIHTNNVAGHLYRGYSIMGN--VNIREVDSYVNEKRPVWFVFSGMG  527
                  DDE++ L+++IH+  +  H +RGY ++ +   + REV    ++KRP+W+++SGMG
Sbjct  581   STNADDDEYLQLINEIHSKAIPNHFFRGYGVVSSKGTHQREVIESNDDKRPIWYIYSGMG  640

Query  528   SQWPGMGKDLLSIDIFQRSLRRCAEALKPEGIDLMNLIQNGTAETFDENVLYSFVSIAAI  587
             SQW  M KDL+ I+ F ++++RCA+ LKPEG+DL++++   T ++F EN+L SF+SIAA+
Sbjct  641   SQWASMAKDLMKIEAFAKTIQRCADVLKPEGVDLIDVLTRSTDKSF-ENILNSFISIAAM  699

Query  588   QVALVDVLTYLGIQPDGIVGHSVGELGCAYADGTFTPEQTVLAAYWRGKTIKDSNLQPGG  647
             QVAL D+L+ LGI PDGIVGHSVGELGCAYADG FTPEQTVLAAYWRGK+I D+ L  G 
Sbjct  700   QVALTDLLSSLGIHPDGIVGHSVGELGCAYADGCFTPEQTVLAAYWRGKSILDTQLAKGK  759

Query  648   MAAVGLSWEEAAARCPPDVTPACNNSADSVTVSGPIESLKKLADDLQKDNIFIKLVNSSG  707
             MAAVGLSWE+A +R P D  P C+NS D+ T+SGP  S++ L   L  + +F K VNSSG
Sbjct  760   MAAVGLSWEDAHSRVPSDCFPVCHNSEDNCTISGPEASIEALVAKLNAEGVFAKAVNSSG  819

Query  708   VAFHSKYVAPVGQKLRAMLEKIITNPKQRTSRWISTSIPESAWGTPLAQLSSAAYHVNNL  767
              AFHSKY+A  G KLR  LEKII N K RT+RWISTSIPESAW TP+A+ SSAAYHVNNL
Sbjct  820   YAFHSKYIAEAGPKLRKSLEKIIPNAKNRTARWISTSIPESAWNTPVAKQSSAAYHVNNL  879

Query  768   LSPVLFYQALGHIPENAIVIEIAPHCLLQAILRRSLPSTVTNIGLHKRGHANNLNFFLEN  827
             LSPVLF++AL H+P+NAI +EIAPH LLQAIL+R+L    TN+ L KRGH NN+ FFL N
Sbjct  880   LSPVLFHEALQHVPKNAISVEIAPHGLLQAILKRALGPDATNLSLVKRGHENNVEFFLTN  939

Query  828   IGKLYLAGGQPRVSKLYPPVNYPVGRGTPMINSLVKWDHSVEWNLADYAATNASFGENVV  887
             +GKL+ AG QP+V  L  P++YPVGRGTPM+NS V WDH+ +W +A +    +S GE +V
Sbjct  940   VGKLFAAGAQPQVLTLVRPISYPVGRGTPMLNSKVGWDHTQKWLVAKFGKETSS-GETIV  998

Query  888   EVNLSKETDAYLVGHCIDERILFPATGYLVIVWKTYAKMRGTDFEKLPITFENVKFQRAT  947
             EV+LSKE DA+L GH ID RILFPATGY+ + W+T+AKM+G++F K P+  EN+ F RAT
Sbjct  999   EVDLSKEDDAFLAGHTIDGRILFPATGYMTLAWQTFAKMQGSEFHKTPVVMENLVFHRAT  1058

Query  948   IMPMDGTVKFSINIFLGTGDFEICESGSVVVTGTVSVPENVDKMLLNMPAPIVKNESTVV  1007
             I+  +  VKF IN F GTG FEICESGS+ V+G +++PE++D    N   P+ +   + V
Sbjct  1059  ILNKNAVVKFGINFFDGTGAFEICESGSLAVSGKITIPESID----NEELPLEEQTPSAV  1114

Query  1008  --ELNTTDVYKELRLRGYNYTGIFQGIKVVHNGGVSGRLLWND-WISFMDTMLQFSILEK  1064
               EL T DVYKELRLRGY+Y GIF+GI        +G+L W D WISFMDTMLQFSIL K
Sbjct  1115  AKELGTNDVYKELRLRGYDYGGIFRGIVRSDTVASTGKLQWVDNWISFMDTMLQFSILSK  1174

Query  1065  DCRGLYVPVRVQYVAINPIAHLEFVENYKEGE----GVPIYSYPNIGVIKSGGVEIRKMK  1120
             + R LY+P R++   INP  H E +    + E    G+P+  Y +I VIKS GVE+R +K
Sbjct  1175  NLRELYLPTRIERAVINPAKHFELLSALTKEEQVETGLPVQWYSDINVIKSAGVELRGLK  1234

Query  1121  ASLIAKKQQIR-PPKLERCLFIPYENSQPLVQDPEKAKVHALTILLLTAYENIKG-IKLK  1178
             A+L  ++   + PP LER  F+P  N+  L ++ EKA++HAL + +    EN  G +KLK
Sbjct  1235  ANLAQRRPGTQAPPTLERYQFVPNINTTDLNENSEKARLHALDVAIQVIIENSSGAVKLK  1294

Query  1179  ITEVSGDRPVDSLMLPYIKTWCSREPVINGDLQLATVLRKRYISL----KQNIKIIKCNV  1234
               E++  R  D L+   +      EPV+ GD+ + T                ++++  +V
Sbjct  1295  GVELANGRNPDVLVANRLLQIIEGEPVLTGDVAVVTSNNNEETITAALGDSGVRVVSKDV  1354

Query  1235  EKELIGQDLHIAVASNVLTDNSLNVLKNLKDSVINRGFILLEETAQTDFN-----VVDPD  1289
              KE + Q+ H     +VL+      L+N   S+   GF++LEET  T        +    
Sbjct  1355  LKEPVEQNCHFVFGIDVLSRPDTKTLENSIASIRENGFLILEETLPTYTKTGRALLTKFG  1414

Query  1290  LVCVAKQVIPGKSYILLKKKEV---RPDPIVIQLTEKNFSWVEGVKAALKNVVAQNQRPL  1346
              V V +Q +     ++L +K V       +V+  TE+NF+WV+ +KAAL     + Q   
Sbjct  1415  FVAVQEQSLGATRVLVLARKAVDLKTRKSVVVVATEQNFNWVDDLKAALATAATEEQYVY  1474

Query  1347  FVCQGEELFGMVGFMNCILNEDGGAKASYVFIQDKNMPKFNLNDKFYAKQLDKQMFANIL  1406
              VCQGEELFG VG M CI NE+GG  A  VF+QD    KF+L    Y +QL+K + +N+L
Sbjct  1475  VVCQGEELFGAVGLMTCIKNENGGKLARLVFVQDAKAEKFSLTSTLYRQQLEKDLISNVL  1534

Query  1407  RGGQWGSYKHIELDQENESSLQVEHAYINALNRGDLSSLRWIESPLSYYQLEKSPNTELC  1466
             + G WG+++H++L+ + +++LQVEHAY+NAL +GDL+SL+WIE+  +        N E C
Sbjct  1535  KNGAWGTFRHLKLETQ-QATLQVEHAYVNALVKGDLASLKWIEAAQADTAATVDKNLETC  1593

Query  1467  SVYYAPLNFRDIMLATGKLPPDALPGNLATQDCILGLEFSGRDSKGQRVMAMVPARGLAT  1526
             +VYYAP+NFRD+ML +GKL  DALPG+LA QDC+LGLEF+GRD++G+RVMAMVPA+ LAT
Sbjct  1594  TVYYAPINFRDVMLTSGKLAADALPGDLAEQDCVLGLEFAGRDTQGRRVMAMVPAKSLAT  1653

Query  1527  TVIADPGFMWKVPDKWSLEEAATVPVAYATSYYALCVRGHMKPGDSVLIHAGSGGVGQAS  1586
             T +A    MW++P+KW++EEA+TVP  Y+T YYAL VRG MK G+ +LIHAGSGGVGQA+
Sbjct  1654  TCVASKRMMWQIPEKWTMEEASTVPCVYSTVYYALVVRGQMKKGEKILIHAGSGGVGQAA  1713

Query  1587  ISIALHAGCKVFTTVGTQDKRDFLKKMFPVLTDRNIGNSRDTSFEQLILNETNGRGVDIV  1646
             IS+AL  G  VFTTVG+++KR+FL K FP L +RNIGNSRDTSFEQL+L ET GRGVD+V
Sbjct  1714  ISVALAHGLTVFTTVGSKEKREFLLKRFPKLQERNIGNSRDTSFEQLVLRETKGRGVDLV  1773

Query  1647  LNSLAEEKLQASIRCLAQGGRFLEIGKFDLSNDSPLGMSVFLKNVSFHGILLDAICEDDG  1706
             LNSL+EEKLQASIRCL   GRFLEIGKFDLSN+SPLGMSVFLKN SFHGILLD++ E + 
Sbjct  1774  LNSLSEEKLQASIRCLGLNGRFLEIGKFDLSNNSPLGMSVFLKNTSFHGILLDSVMEGEE  1833

Query  1707  PERQEVVRLVSEGIKSGAVRPLPSTVFSEQQIEQSFRYMATGKHIGKVLLKIRDEEK-QK  1765
               + +VV LV+EGIK+GAV PLP++VF++QQ+EQ+FR+MA+GKHIGKV++K+RDEE  +K
Sbjct  1834  EMQNQVVSLVAEGIKTGAVVPLPTSVFNDQQVEQAFRFMASGKHIGKVVIKVRDEEAGKK  1893

Query  1766  VVQSPQKVVSAIPRTYLNPEKSYILVGGLGGFGLELAYWMILRGAKYIILTSRSGVTTGF  1825
              +Q   ++++AIPRTY++PEKSYILVGGLGGFGLEL  W++ RGA+YI+LTSRSGV TG+
Sbjct  1894  ALQPKPRLINAIPRTYMHPEKSYILVGGLGGFGLELTNWLVTRGARYIVLTSRSGVKTGY  1953

Query  1826  QALCIRRWRNMGAHIKISTADVTTLDGAKQLIKESKALAPVGGIFNLAAVLRDGLIENLT  1885
             Q L IRRW+  G  + I T+DVTT  GAK+L++ S  LA VGGIFNLAAVLRD LIE+ T
Sbjct  1954  QGLMIRRWQERGVKVVIDTSDVTTAAGAKKLLENSNKLALVGGIFNLAAVLRDALIEDQT  2013

Query  1886  ESDFVISASPKVNGTKNLDIVSRE-CSSLDYFVVFSSVTSGRGNVGQTNYGLANSAMERL  1944
               DF   A PKV  TK LD  SR+ C+ LDYF+ FSSV+ GRGN+GQTNYGLANSAMER+
Sbjct  2014  AKDFKTVADPKVTATKYLDQFSRDICTELDYFICFSSVSCGRGNIGQTNYGLANSAMERI  2073

Query  1945  MEQRQANGLPGLAIQWGAIGDVGLILEKLGGFNDTEIGGTLPQRIQNCLDTMDIFLQQPH  2004
              EQRQ +G PG AIQWGAIGD GL+LE LG  NDT IGGTLPQR+ +CL T+D+FLQQPH
Sbjct  2074  CEQRQVSGFPGTAIQWGAIGDTGLVLENLGD-NDTVIGGTLPQRMPSCLQTIDLFLQQPH  2132

Query  2005  PILASLVTANKDNTVESANKVSVVQAIANILGIKALESVNGSTSLADLGMDSLMGTEIKQ  2064
             P++AS+V A K  + +SA  VS++  IANILG++  +++    SLADLGMDSLM  EIKQ
Sbjct  2133  PVVASMVVAEKRKSDQSAG-VSLIATIANILGLRDTKNIQDGASLADLGMDSLMSAEIKQ  2191

Query  2065  TMERNYDIVLSALEIRNLTFDKLGKLDNTS-------------GAEAGN--AGADSDDEE  2109
             T+ERN+DIVLSA EIR LTF  L  +D  +             G    N  +G  S    
Sbjct  2192  TLERNFDIVLSAQEIRQLTFGALKAMDGGADVKPAAAAPAAAAGVPEANITSGGSSRTAS  2251

Query  2110  TIQDAAGLLSFEGTEIVPVKIIVPLST---ANSAGQPLFFVPAIEGVAAPFKTVASELNR  2166
              + D   ++    T ++P + IV L T   ANS   P+FF+  IEG A+  + +A  L  
Sbjct  2252  PMGDGTQVVF--TTSLIPTEAIVQLDTKAPANSKQSPIFFISPIEGFASALEPLAKRLEV  2309

Query  2167  PAWSFQCTESCPLESVSALANFYLKKMRAIQTEGPYNIIGYSFGSCIGLEMAVQLQKAGH  2226
             PA+  Q TE+ P +S+ + A F++K++R +Q +GPY + GYSFG  +   MA  L++   
Sbjct  2310  PAYGLQYTEAVPSDSLESAAKFFIKQLRTVQPKGPYKLAGYSFGCLLTYVMAGILEETNE  2369

Query  2227  KTNLTVIDGSPDFVKLHSVELGKRATEESSEVITDGLRKCLAYFVRQFRSNITFLKLYDM  2286
               N+ ++DG+P +V  ++    +R T + +    D     LAYF     +NI +  L  +
Sbjct  2370  VANVIMLDGAPSYVNWYTSSFKQRYT-DGTNADNDNQSYGLAYFGIVL-ANIDYKALVRL  2427

Query  2287  LKNINTTEVVLNKVVELIDDK-NLDSEDLKSAALLFYKKLKAAFFYKPE-KYDGDIVLLK  2344
             L  I T E  L +  EL+ ++     E +K +A LFYKKL+ A  Y+P  K   ++ L+K
Sbjct  2428  LIVIPTWEEKLERFAELMSNEITQPVETIKKSATLFYKKLELADGYQPTLKLKTNVTLVK  2487

Query  2345  AKDSFVPLNNDYGLSKISNK-VTVIELPGNHRSILL-GKSASQIANIL  2390
               D+   L+ DY L ++  K V V  + GNHR+ L+  +S   I +IL
Sbjct  2488  PTDNSAKLDEDYRLKEVCTKPVEVHTVEGNHRTFLIEDQSLKTIQSIL  2535


>Q9VQL6_DROME unnamed protein product
Length=2409

 Score = 2272 bits (5887),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1175/2412 (49%), Positives = 1637/2412 (68%), Gaps = 97/2412 (4%)

Query  29    NNEIVISGFSGRFPESSDIEEFKKNLFEGIDMITDDERRWPAGLFGLPKRTGKLKD--LK  86
             + +IVISG SG+ PESS+IEEFK NL  GIDM+TD+ RRW AG++GLP+R  K+KD  L+
Sbjct  16    DADIVISGLSGKLPESSNIEEFKYNLLNGIDMVTDEPRRWEAGIYGLPERMAKMKDSDLE  75

Query  87    SFDATFFGVHAKQAHVMDPQLRLLLEVVYEAIVDAGINPNDIRGSKTGVFIGVSSSESD-  145
              FD  FF VH KQA +MDP +R+LLE+ +EAI+DAGINP  +RGS+TGV+IG+S  E++ 
Sbjct  76    KFDDKFFSVHQKQAELMDPCMRMLLELTHEAIIDAGINPVQLRGSRTGVYIGLSFVETEH  135

Query  146   EFWSKDPEQINGYGLTGCCRAMFPNRISYTFDFNGPSYAIDTACSSSLYAMHQAIVSIRS  205
             E  + +P  INGY LTGC RAMF NRISYTFDF GPS+ +DTACSSSL A++ A   +R+
Sbjct  136   EIPNMEPSSINGYCLTGCARAMFANRISYTFDFKGPSFIVDTACSSSLVALNHAFADMRA  195

Query  206   GECDAAIVGGCNLLLKPTSSLQFHRLGMLSPDGACKAFDTDGKGYVRSEAVSVLLLQKAR  265
             G CD A+V G NL+LKP  +LQF RLG++S DG+CK FD    GY R++  +V+LLQ+ +
Sbjct  196   GRCDYALVAGVNLILKPIFALQFLRLGIVSHDGSCKTFDAAANGYARADTCAVVLLQRRK  255

Query  266   DARRVYATVLHAKTNTDGNKAQGITFPSGDMQNKLMREVYAEVGVNPADVVYVEAHGTGT  325
             +A+RVYA++L+ +TNTDG K QG+TFP G MQ  L+ E Y+E+G+NP +VVYVEAHG+GT
Sbjct  256   EAKRVYASILNVRTNTDGFKEQGVTFPDGRMQQALLEETYSEIGLNPDEVVYVEAHGSGT  315

Query  326   KVGDPQEINSIANLFCK-GRKGPLLLGSVKSNMGHSEPASGVCSMAKLLIAMEAGVIPGN  384
              VGD QE N ++N FC+  R  PLL+GSVKSNMGH+EPASGV ++AK++IAME G+IP N
Sbjct  316   PVGDDQEANMLSNFFCRPSRSTPLLIGSVKSNMGHAEPASGVSALAKMIIAMEEGIIPKN  375

Query  385   LHFKNPNTDIPALSDGSIQVVDKNMPWKGGLIAVNSFGFGGANAHILLRSNPK---PKLS  441
             LH++ PN  +PAL +G ++VVD+N+PW+GG++ +NSFGFGGANAH++L+S+ K   PK  
Sbjct  376   LHYRTPNPSVPALVEGKLKVVDRNLPWQGGIVGLNSFGFGGANAHVVLKSHTKAKEPKAC  435

Query  442   PVLDN--KVPKLVTVSGRTSEAVNVLLDKAKEYEKDDEFIALLHDIHTNNVAGHLYRGYS  499
             P      +   LVT SGRT +AVN LL  A E   D E + L++DIH++ +  H +RGY+
Sbjct  436   PKAGEAEQSLSLVTCSGRTEDAVNQLLKVATEQRHDQELLTLINDIHSHPIPLHPFRGYA  495

Query  500   IMGNVNI--REVDSYVNEKRPVWFVFSGMGSQWPGMGKDLLSIDIFQRSLRRCAEALKPE  557
             ++G       EV  Y  E+RP+WFV++GMGSQW  M KDL+ +++F+ S++ CAE L   
Sbjct  496   VLGTSGCVKEEVLPYEEEERPIWFVYAGMGSQWARMAKDLMQLEVFRNSIQHCAEVLAQV  555

Query  558   GIDLMNLIQNGTAETFDENVLYSFVSIAAIQVALVDVLTYLGIQPDGIVGHSVGELGCAY  617
               DL++++   T  TFD N+LYSFVS++A+QVAL D+L  L I+PDGI+GHS GELG AY
Sbjct  556   DFDLIDVLTRSTERTFD-NMLYSFVSVSAVQVALTDLLRVLDIRPDGIIGHSAGELGAAY  614

Query  618   ADGTFTPEQTVLAAYWRGKTIKDS-NLQPGGMAAVGLSWEEAAARCPPDVTPACNNSADS  676
              DG  T EQTVLAAYWRG+++ D+ +L  G MAAVGLSWE+  ++ P D  P C+NS D+
Sbjct  615   MDGCLTAEQTVLAAYWRGRSVLDTPDLPRGKMAAVGLSWEQIGSQIPKDCYPVCHNSDDN  674

Query  677   VTVSGPIESLKKLADDLQKDNIFIKLVNSSGVAFHSKYVAPVGQKLRAMLEKIITNPKQR  736
              TVSGP  S+  + +DL    IF++ V S G AFHS Y+      LR  LE++IT PK++
Sbjct  675   CTVSGPPSSMDAMIEDLTAKGIFVREVGSGGYAFHSPYIEGAAPMLRRSLERLITEPKKK  734

Query  737   TSRWISTSIPESAWGTPLAQLSSAAYHVNNLLSPVLFYQALGHIPENAIVIEIAPHCLLQ  796
             + RW+STS+ E+ W +    L+SA Y +NNL+SPVLF+QA+  IP+NA+++EIAPH L +
Sbjct  735   SIRWLSTSVKEAEWDSEKNHLASAGYFINNLISPVLFHQAVKRIPQNALIVEIAPHGLFR  794

Query  797   AILRRSLPSTVTNIGLHKRGHANNLNFFLENIGKLYLAGGQPRVSKLYPPVNYPVGRGTP  856
             AILR SL   ++ + L +RGHANN  F L  +G+LY AGGQP++ K+ P + YPV RGTP
Sbjct  795   AILR-SLSPQISYVSLMQRGHANNFEFLLSQLGRLYAAGGQPQILKISPSIPYPVSRGTP  853

Query  857   MINSLVKWDHSVEWNLADYAATNASFGENVVEVNLSKETDAYLVGHCIDERILFPATGYL  916
             M+ SLV WDH+ +WN   +     + G+  VE++L KE + YL GH ID R+LFPATGY+
Sbjct  854   MLGSLVGWDHTQKWNYPKFKGGRQA-GQLSVELDLGKEENVYLAGHTIDGRVLFPATGYM  912

Query  917   VIVWKTYAKMRGTDFEKLPITFENVKFQRATIMPMDGTVKFSINIFLGTGDFEICESGSV  976
              + W + A+ +G D+ + P+ FE+V F RATI+ +   VK ++N F G+  FEICE  S+
Sbjct  913   TLAWMSLAQQQGLDYLRTPVLFEDVVFHRATILSVGTVVKLTLNFFPGSSSFEICEGTSL  972

Query  977   VVTGTVSVPENVDKMLLNMPA-PIVKNESTVVELNTTDVYKELRLRGYNYTGIFQGIKVV  1035
             V +G + +  NV +  L + + P +   +   +L+T D+YKELRLRGY+YTG+FQGI   
Sbjct  973   VTSGKIRLVSNVQQEQLQLSSLPGIAGSN---KLSTKDIYKELRLRGYDYTGVFQGILES  1029

Query  1036  HNGGVSGRLLWND-WISFMDTMLQFSILEKDCRGLYVPVRVQYVAINPIAHLEFVENYKE  1094
                 V+G+L W D WISFMDTMLQF IL  D R LYVP  ++   I+P+ HLE  + +++
Sbjct  1030  DISAVTGQLQWADNWISFMDTMLQFRILSNDIRELYVPTGIERALIDPLKHLELAKKHQQ  1089

Query  1095  GEGVPIYSYPNIGVIKSGGVEIRKMKASLIAKKQQIR-PPKLERCLFIPYENSQPLVQDP  1153
                + +  + NI V+K GGVEI KMK +   ++   + PP LER  F P+       ++ 
Sbjct  1090  K--LTVNWHRNISVVKCGGVEIHKMKTAQTQRRSGGQSPPSLERYRFWPHSQHLGQREEQ  1147

Query  1154  EKAKVHALTILLLTAYENIKG-IKLKITEVSGDRP-VDSLMLPYIKTWCSREPVINGDLQ  1211
             EK++  AL + +    EN  G +KLK  E++G R  +D+L    +     REP++ GD+ 
Sbjct  1148  EKSRSTALAVAIQLIIENSGGAVKLKGVELAGSRSTLDALSAVQLLELIEREPILVGDMA  1207

Query  1212  LATVLRKRYI---SLKQN-IKIIKCNVEKELIGQDLHIAVASNVLTDNSLNVLKNLKDSV  1267
             + T           LK++ I++I  +++   + Q  H   + N+L  NS+  L++  DS+
Sbjct  1208  VVTSSSNESELGEQLKEHGIRVIVKDIKAGAVEQQCHFVYSVNMLAQNSVKDLQHCLDSL  1267

Query  1268  -INRGFILLEETAQTDFNVVDPD------LVCVAKQVIPGKSYILLKKKEVR---PDPIV  1317
               + GF+LLEE A + +N++  +      LV V +Q       ++L +K  +      + 
Sbjct  1268  KSDSGFLLLEEAA-SRYNIIGKEKLNKLKLVSVLEQFFGTDRVLVLVRKLSKVQSSQALT  1326

Query  1318  IQLTEKNFSWVEGVKAALKNVVAQNQRPLFVCQGEELFGMVGFMNCILNEDGGAKASYVF  1377
             + LT K F WV  +K ++    A+ +    V QGE   G +G MNC+  E GG       
Sbjct  1327  LHLTNKQFKWVNELKNSIAKAQAEEKNLYLVAQGEPNSGALGLMNCLKREAGGHFLRLYL  1386

Query  1378  IQDKNMPKFNLNDKFYAKQLDKQMFANILRGGQWGSYKHIELDQENESSLQVEHAYINAL  1437
             I D+ +P+F+L+D FYA QL K +  N+ R G WGSY+H++++      L VE AY+N L
Sbjct  1387  ILDEGVPQFSLDDPFYAAQLAKDLVVNVYRNGSWGSYRHLKME-SRPPMLPVEQAYVNTL  1445

Query  1438  NRGDLSSLRWIESPLSYYQLEKSP---NTELCSVYYAPLNFRDIMLATGKLPPDALPGNL  1494
              +GDLSSLRWIESP S      SP     E C+VYYAPLNFRD+MLA+GKL  DALPG+L
Sbjct  1446  VKGDLSSLRWIESPRS------SPIQSQLEPCTVYYAPLNFRDVMLASGKLGVDALPGDL  1499

Query  1495  ATQDCILGLEFSGRDSKGQRVMAMVPARGLATTVIADPGFMWKVPDKWSLEEAATVPVAY  1554
             A QDC+LGLEF+GRDS G+RVMAMV A+ LAT  +A+   +W+VP KW++E+A+TVP  Y
Sbjct  1500  AYQDCVLGLEFAGRDSCGRRVMAMVTAKSLATNCLANRNLLWEVPSKWTMEQASTVPCVY  1559

Query  1555  ATSYYALCVRGHMKPGDSVLIHAGSGGVGQASISIALHAGCKVFTTVGTQDKRDFLKKMF  1614
             AT YYAL VRG MK G+ +LIHAGSGGVGQA+IS+AL  G  VFTTVG+++KR+FL K F
Sbjct  1560  ATVYYALVVRGQMKEGERILIHAGSGGVGQAAISVALAHGLTVFTTVGSKEKREFLLKRF  1619

Query  1615  PVLTDRNIGNSRDTSFEQLILNETNGRGVDIVLNSLAEEKLQASIRCLAQGGRFLEIGKF  1674
             P L  +NIGNSRDTSFEQLI++ET+G GV++VLNSL+EEKLQASIRCLA  GRFLEIGKF
Sbjct  1620  PKLKAKNIGNSRDTSFEQLIMSETHGNGVELVLNSLSEEKLQASIRCLALNGRFLEIGKF  1679

Query  1675  DLSNDSPLGMSVFLKNVSFHGILLDAICEDDGPERQEVVRLVSEGIKSGAVRPLPSTVFS  1734
             DLSN++PLGMSVFLKN SFHGILLD++ E +   +  V +LV+EGIKSGAV+PLP+TVF+
Sbjct  1680  DLSNNTPLGMSVFLKNTSFHGILLDSVMEGEEEMQLMVAKLVAEGIKSGAVQPLPTTVFA  1739

Query  1735  EQQIEQSFRYMATGKHIGKVLLKIRDEEKQKVVQSPQKVVSAIPRTYLNPEKSYILVGGL  1794
             EQ+IE++FR+MA+GKHIGKV++K+R EE+Q+      + + AIPR+Y++PEKSYILVGGL
Sbjct  1740  EQEIEKAFRFMASGKHIGKVVIKVRLEEEQQAALPRLRQIQAIPRSYMHPEKSYILVGGL  1799

Query  1795  GGFGLELAYWMILRGAKYIILTSRSGVTTGFQALCIRRWRNMGAHIKISTADVTTLDGAK  1854
             GGFGLELA W++ RGA++++L+SRSGV +G+QAL IRRW + G  ++I T DVTT  G +
Sbjct  1800  GGFGLELANWLVSRGARFLVLSSRSGVKSGYQALMIRRWHDRGVQVQIDTNDVTTAVGCQ  1859

Query  1855  QLIKESKALAPVGGIFNLAAVLRDGLIENLTESDFVISASPKVNGTKNLDIVSRE-CSSL  1913
             +L++ S  LA VGGIFNLAAVLRDGLIE+ +  +F   ++PK+  T +LD +SRE C +L
Sbjct  1860  RLLEVSNKLALVGGIFNLAAVLRDGLIEDQSPKNFEKVSAPKLLATIHLDKISREICPAL  1919

Query  1914  DYFVVFSSVTSGRGNVGQTNYGLANSAMERLMEQRQANGLPGLAIQWGAIGDVGLILEKL  1973
             +YFV FSS++ GRGN+GQTNYGLANS MER+ EQRQ  G PG AIQWGAIGD GLI+E +
Sbjct  1920  EYFVCFSSLSCGRGNMGQTNYGLANSTMERICEQRQEYGYPGTAIQWGAIGDTGLIIEHM  1979

Query  1974  GGFNDTEIGGTLPQRIQNCLDTMDIFLQQPHPILASLVTANKDNTVESANKVSVVQAIAN  2033
             G  N+T +GGTLPQR+ +CL+T+D+FLQQPHP++AS+V A K  T E AN++S++  IAN
Sbjct  1980  GN-NETVVGGTLPQRMISCLETLDLFLQQPHPVMASMVVAEKRKT-EQANRLSLIATIAN  2037

Query  2034  ILGIKALESVNGSTSLADLGMDSLMGTEIKQTMERNYDIVLSALEIRNLTFDKLGKLDNT  2093
             I+G++ ++SV+  T+L DLGMDSLM TEIKQT+ER++D+VLSA EIR LTF  L ++D  
Sbjct  2038  IMGLRDVKSVSDKTTLFDLGMDSLMSTEIKQTLERHFDLVLSAQEIRQLTFSALRQIDAQ  2097

Query  2094  SGA-----------------EAGNAGADSDDEETIQDAAGLLSFEGTEIVPVKIIVPLST  2136
                                 E          +ET +  A        E++P +++V L +
Sbjct  2098  EPPSASVSSPSASSTLSRIKEEACVEVQPQSDETRKVFA-------KEVLPQEVMVRLRS  2150

Query  2137  ---ANSAGQPLFFVPAIEGVAAPFKTVASELNRPAWSFQCTESCPLESVSALANFYLKKM  2193
                  S    +FF+  IEG     + +A+ L  PA+  QCTE  PL+S+ A A +YL+++
Sbjct  2151  KAPVASEDPAVFFLAPIEGFTIAVEALAASLTCPAYGLQCTEQVPLDSIEACAAYYLRQI  2210

Query  2194  RAIQTEGPYNIIGYSFGSCIGLEMAVQLQKAGHKTNLTVIDGSPDFVKLHSVELGKRATE  2253
             + +Q  GPY+I+GYS+G  +   +AV L++      + ++DG+P     +  E  K+   
Sbjct  2211  QKLQPLGPYHIVGYSYGCLLAHAIAVALEQRRFGVKVIMLDGAPTMASGYVQEAKKQ---  2267

Query  2254  ESSEVITDGLRK----CLAYFVRQFRSNITFLKLYDMLKNINTTEVVLNKVVELIDDKNL  2309
                   TD L +     LAYF     +++ + +L  +L  + T    L+K+ + +     
Sbjct  2268  ------TDDLNRQQSMTLAYF-GALLADVDYNQLLQLLDGVQTWPSKLDKLADTLAGYTQ  2320

Query  2310  DS-EDLKSAALLFYKKLKAAFFYKPEK-YDGDIVLLKAKDSFVPLNNDYGLSKI-SNKVT  2366
              + E +K AA +F +KL  +  YK  K    D+VL+K+ +    +  DYGL +I S ++ 
Sbjct  2321  QTREVIKKAACMFKQKLLLSESYKGAKQLHSDVVLIKSAEHNAIMAQDYGLKEICSAQID  2380

Query  2367  VIELPGNHRSIL  2378
             +  + G HR+ L
Sbjct  2381  MHVVEGTHRTFL  2392


>M9PB21_DROME unnamed protein product
Length=2410

 Score = 2270 bits (5883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1177/2415 (49%), Positives = 1635/2415 (68%), Gaps = 102/2415 (4%)

Query  29    NNEIVISGFSGRFPESSDIEEFKKNLFEGIDMITDDERRWPAGLFGLPKRTGKLKD--LK  86
             + +IVISG SG+ PESS+IEEFK NL  GIDM+TD+ RRW AG++GLP+R  K+KD  L+
Sbjct  16    DADIVISGLSGKLPESSNIEEFKYNLLNGIDMVTDEPRRWEAGIYGLPERMAKMKDSDLE  75

Query  87    SFDATFFGVHAKQAHVMDPQLRLLLEVVYEAIVDAGINPNDIRGSKTGVFIGVSSSESD-  145
              FD  FF VH KQA +MDP +R+LLE+ +EAI+DAGINP  +RGS+TGV+IG+S  E++ 
Sbjct  76    KFDDKFFSVHQKQAELMDPCMRMLLELTHEAIIDAGINPVQLRGSRTGVYIGLSFVETEH  135

Query  146   EFWSKDPEQINGYGLTGCCRAMFPNRISYTFDFNGPSYAIDTACSSSLYAMHQAIVSIRS  205
             E  + +P  INGY LTGC RAMF NRISYTFDF GPS+ +DTACSSSL A++ A   +R+
Sbjct  136   EIPNMEPSSINGYCLTGCARAMFANRISYTFDFKGPSFIVDTACSSSLVALNHAFADMRA  195

Query  206   GECDAAIVGGCNLLLKPTSSLQFHRLGMLSPDGACKAFDTDGKGYVRSEAVSVLLLQKAR  265
             G CD A+V G NL+LKP  +LQF RLG++S DG+CK FD    GY R++  +V+LLQ+ +
Sbjct  196   GRCDYALVAGVNLILKPIFALQFLRLGIVSHDGSCKTFDAAANGYARADTCAVVLLQRRK  255

Query  266   DARRVYATVLHAKTNTDGNKAQGITFPSGDMQNKLMREVYAEVGVNPADVVYVEAHGTGT  325
             +A+RVYA++L+ +TNTDG K QG+TFP G MQ  L+ E Y+E+G+NP +VVYVEAHG+GT
Sbjct  256   EAKRVYASILNVRTNTDGFKEQGVTFPDGRMQQALLEETYSEIGLNPDEVVYVEAHGSGT  315

Query  326   KVGDPQEINSIANLFCK-GRKGPLLLGSVKSNMGHSEPASGVCSMAKLLIAMEAGVIPGN  384
              VGD QE N ++N FC+  R  PLL+GSVKSNMGH+EPASGV ++AK++IAME G+IP N
Sbjct  316   PVGDDQEANMLSNFFCRPSRSTPLLIGSVKSNMGHAEPASGVSALAKMIIAMEEGIIPKN  375

Query  385   LHFKNPNTDIPALSDGSIQVVDKNMPWKGGLIAVNSFGFGGANAHILLRSNPK---PKLS  441
             LH++ PN  +PAL +G ++VVD+N+PW+GG++ +NSFGFGGANAH++L+S+ K   PK  
Sbjct  376   LHYRTPNPSVPALVEGKLKVVDRNLPWQGGIVGLNSFGFGGANAHVVLKSHTKAKEPKAC  435

Query  442   PVLDN--KVPKLVTVSGRTSEAVNVLLDKAKEYEKDDEFIALLHDIHTNNVAGHLYRGYS  499
             P      +   LVT SGRT +AVN LL  A E   D E + L++DIH++ +  H +RGY+
Sbjct  436   PKAGEAEQSLSLVTCSGRTEDAVNQLLKVATEQRHDQELLTLINDIHSHPIPLHPFRGYA  495

Query  500   IMGNVNI--REVDSYVNEKRPVWFVFSGMGSQWPGMGKDLLSIDIFQRSLRRCAEALKPE  557
             ++G       EV  Y  E+RP+WFV++GMGSQW  M KDL+ +++F+ S++ CAE L   
Sbjct  496   VLGTSGCVKEEVLPYEEEERPIWFVYAGMGSQWARMAKDLMQLEVFRNSIQHCAEVLAQV  555

Query  558   GIDLMNLIQNGTAETFDENVLYSFVSIAAIQVALVDVLTYLGIQPDGIVGHSVGELGCAY  617
               DL++++   T  TFD N+LYSFVS++A+QVAL D+L  L I+PDGI+GHS GELG AY
Sbjct  556   DFDLIDVLTRSTERTFD-NMLYSFVSVSAVQVALTDLLRVLDIRPDGIIGHSAGELGAAY  614

Query  618   ADGTFTPEQTVLAAYWRGKTIKDS-NLQPGGMAAVGLSWEEAAARCPPDVTPACNNSADS  676
              DG  T EQTVLAAYWRG+++ D+ +L  G MAAVGLSWE+  ++ P D  P C+NS D+
Sbjct  615   MDGCLTAEQTVLAAYWRGRSVLDTPDLPRGKMAAVGLSWEQIGSQIPKDCYPVCHNSDDN  674

Query  677   VTVSGPIESLKKLADDLQKDNIFIKLVNSSGVAFHSKYVAPVGQKLRAMLEKIITNPKQR  736
              TVSGP  S+  + +DL    IF++ V S G AFHS Y+      LR  LE++IT PK++
Sbjct  675   CTVSGPPSSMDAMIEDLTAKGIFVREVGSGGYAFHSPYIEGAAPMLRRSLERLITEPKKK  734

Query  737   TSRWISTSIPESAWGTPLAQLSSAAYHVNNLLSPVLFYQALGHIPENAIVIEIAPHCLLQ  796
             + RW+STS+ E+ W +    L+SA Y +NNL+SPVLF+QA+  IP+NA+++EIAPH L +
Sbjct  735   SIRWLSTSVKEAEWDSEKNHLASAGYFINNLISPVLFHQAVKRIPQNALIVEIAPHGLFR  794

Query  797   AILRRSLPSTVTNIGLHKRGHANNLNFFLENIGKLYLAGGQPRVSKLYPPVNYPVGRGTP  856
             AILR SL   ++ + L +RGHANN  F L  +G+LY AGGQP++ K+ P + YPV RGTP
Sbjct  795   AILR-SLSPQISYVSLMQRGHANNFEFLLSQLGRLYAAGGQPQILKISPSIPYPVSRGTP  853

Query  857   MINSLVKWDHSVEWNLADYAATNASFGENVVEVNLSKETDAYLVGHCIDERILFPATGYL  916
             M+ SLV WDH+ +WN   +     + G+  VE++L KE + YL GH ID R+LFPATGY+
Sbjct  854   MLGSLVGWDHTQKWNYPKFKGGRQA-GQLSVELDLGKEENVYLAGHTIDGRVLFPATGYM  912

Query  917   VIVWKTYAKMRGTDFEKLPITFENVKFQRATIMPMDGTVKFSINIFLGTGDFEICESGSV  976
              + W + A+ +G D+ + P+ FE+V F RATI+ +   VK ++N F G+  FEICE  S+
Sbjct  913   TLAWMSLAQQQGLDYLRTPVLFEDVVFHRATILSVGTVVKLTLNFFPGSSSFEICEGTSL  972

Query  977   VVTGTVSVPENVDKMLLNMPA-PIVKNESTVVELNTTDVYKELRLRGYNYTGIFQGIKVV  1035
             V +G + +  NV +  L + + P +   +   +L+T D+YKELRLRGY+YTG+FQGI   
Sbjct  973   VTSGKIRLVSNVQQEQLQLSSLPGIAGSN---KLSTKDIYKELRLRGYDYTGVFQGILES  1029

Query  1036  HNGGVSGRLLWND-WISFMDTMLQFSILEKDCRGLYVPVRVQYVAINPIAHLEFVENYKE  1094
                 V+G+L W D WISFMDTMLQF IL  D R LYVP  ++   I+P+ HLE  + +++
Sbjct  1030  DISAVTGQLQWADNWISFMDTMLQFRILSNDIRELYVPTGIERALIDPLKHLELAKKHQQ  1089

Query  1095  GEGVPIYSYPNIGVIKSGGVEIRKMKASLIAKKQQIR-PPKLERCLFIPYENSQPLVQDP  1153
                + +  + NI V+K GGVEI KMK +   ++   + PP LER  F P+       ++ 
Sbjct  1090  K--LTVNWHRNISVVKCGGVEIHKMKTAQTQRRSGGQSPPSLERYRFWPHSQHLGQREEQ  1147

Query  1154  EKAKVHALTILLLTAYENIKG-IKLKITEVSGDRP-VDSLMLPYIKTWCSREPVINGDLQ  1211
             EK++  AL + +    EN  G +KLK  E++G R  +D+L    +     REP++ GD+ 
Sbjct  1148  EKSRSTALAVAIQLIIENSGGAVKLKGVELAGSRSTLDALSAVQLLELIEREPILVGDMA  1207

Query  1212  LATVLRKRYI---SLKQN-IKIIKCNVEKELIGQDLHIAVASNVLTDNSLNVLKNLKDSV  1267
             + T           LK++ I++I  +++   + Q  H   + N+L  NS+  L++  DS+
Sbjct  1208  VVTSSSNESELGEQLKEHGIRVIVKDIKAGAVEQQCHFVYSVNMLAQNSVKDLQHCLDSL  1267

Query  1268  -INRGFILLEETAQTDFNVVDPD------LVCVAKQVIPGKSYILLKKKEVR---PDPIV  1317
               + GF+LLEE A + +N++  +      LV V +Q       ++L +K  +      + 
Sbjct  1268  KSDSGFLLLEEAA-SRYNIIGKEKLNKLKLVSVLEQFFGTDRVLVLVRKLSKVQSSQALT  1326

Query  1318  IQLTEKNFSWVEGVKAALKNVVAQNQRPLFVCQGEELFGMVGFMNCILNEDGGAKASYVF  1377
             + LT K F WV  +K ++    A+ +    V QGE   G +G MNC+  E GG       
Sbjct  1327  LHLTNKQFKWVNELKNSIAKAQAEEKNLYLVAQGEPNSGALGLMNCLKREAGGHFLRLYL  1386

Query  1378  IQDKNMPKFNLNDKFYAKQLDKQMFANILRGGQWGSYKHIELDQENESSLQVEHAYINAL  1437
             I D+ +P+F+L+D FYA QL K +  N+ R G WGSY+H++++      L VE AY+N L
Sbjct  1387  ILDEGVPQFSLDDPFYAAQLAKDLVVNVYRNGSWGSYRHLKME-SRPPMLPVEQAYVNTL  1445

Query  1438  NRGDLSSLRWIESPLSYYQLEKSP---NTELCSVYYAPLNFRDIMLATGKLPPDALPGNL  1494
              +GDLSSLRWIESP S      SP     E C+VYYAPLNFRD+MLA+GKL  DALPG+L
Sbjct  1446  VKGDLSSLRWIESPRS------SPIQSQLEPCTVYYAPLNFRDVMLASGKLGVDALPGDL  1499

Query  1495  ATQDCILGLEFSGRDSKGQRVMAMVPARGLATTVIADPGFMWKVPDKWSLEEAATVPVAY  1554
             A QDC+LGLEF+GRDS G+RVMAMV A+ LAT  +A+   +W+VP KW++E+A+TVP  Y
Sbjct  1500  AYQDCVLGLEFAGRDSCGRRVMAMVTAKSLATNCLANRNLLWEVPSKWTMEQASTVPCVY  1559

Query  1555  ATSYYALCVRGHMKPGDSVLIHAGSGGVGQASISIALHAGCKVFTTVGTQDKRDFLKKMF  1614
             AT YYAL VRG MK G+ +LIHAGSGGVGQA+IS+AL  G  VFTTVG+++KR+FL K F
Sbjct  1560  ATVYYALVVRGQMKEGERILIHAGSGGVGQAAISVALAHGLTVFTTVGSKEKREFLLKRF  1619

Query  1615  PVLTDRNIGNSRDTSFEQLILNETNGRGVDIVLNSLAEEKLQASIRCLAQGGRFLEIGKF  1674
             P L  +NIGNSRDTSFEQLI++ET+G GV++VLNSL+EEKLQASIRCLA  GRFLEIGKF
Sbjct  1620  PKLKAKNIGNSRDTSFEQLIMSETHGNGVELVLNSLSEEKLQASIRCLALNGRFLEIGKF  1679

Query  1675  DLSNDSPLGMSVFLKNVSFHGILLDAICEDDGPERQEVVRLVSEGIKSGAVRPLPSTVFS  1734
             DLSN++PLGMSVFLKN SFHGILLD++ E +   +  V +LV+EGIKSGAV+PLP+TVF+
Sbjct  1680  DLSNNTPLGMSVFLKNTSFHGILLDSVMEGEEEMQLMVAKLVAEGIKSGAVQPLPTTVFA  1739

Query  1735  EQQIEQSFRYMATGKHIGKVLLKIRDEEKQKVVQSPQKVVSAIPRTYLNPEKSYILVGGL  1794
             EQ+IE++FR+MA+GKHIGKV++K+R EE+Q+      + + AIPR+Y++PEKSYILVGGL
Sbjct  1740  EQEIEKAFRFMASGKHIGKVVIKVRLEEEQQAALPRLRQIQAIPRSYMHPEKSYILVGGL  1799

Query  1795  GGFGLELAYWMILRGAKYIILTSRSGVTTGFQALCIRRWRNMGAHIKISTADVTTLDGAK  1854
             GGFGLELA W++ RGA++++L+SRSGV +G+QAL IRRW + G  ++I T DVTT  G +
Sbjct  1800  GGFGLELANWLVSRGARFLVLSSRSGVKSGYQALMIRRWHDRGVQVQIDTNDVTTAVGCQ  1859

Query  1855  QLIKESKALAPVGGIFNLAAVLRDGLIENLTESDFVISASPKVNGTKNLDIVSRE-CSSL  1913
             +L++ S  LA VGGIFNLAAVLRDGLIE+ +  +F   ++PK+  T +LD +SRE C +L
Sbjct  1860  RLLEVSNKLALVGGIFNLAAVLRDGLIEDQSPKNFEKVSAPKLLATIHLDKISREICPAL  1919

Query  1914  DYFVVFSSVTSGRGNVGQTNYGLANSAMERLMEQRQANGLPGLAIQWGAIGDVGLILEKL  1973
             +YFV FSS++ GRGN+GQTNYGLANS MER+ EQRQ  G PG AIQWGAIGD GLI+E +
Sbjct  1920  EYFVCFSSLSCGRGNMGQTNYGLANSTMERICEQRQEYGYPGTAIQWGAIGDTGLIIEHM  1979

Query  1974  GGFNDTEIGGTLPQRIQNCLDTMDIFLQQPHPILASLVTANKDNTVESANKVSVVQAIAN  2033
             G  N+T +GGTLPQR+ +CL+T+D+FLQQPHP++AS+V A K  T E AN++S++  IAN
Sbjct  1980  GN-NETVVGGTLPQRMISCLETLDLFLQQPHPVMASMVVAEKRKT-EQANRLSLIATIAN  2037

Query  2034  ILGIKALESVNGSTSLADLGMDSLMGTEIKQTMERNYDIVLSALEIRNLTFDKLGKLDNT  2093
             I+G++ ++SV+  T+L DLGMDSLM TEIKQT+ER++D+VLSA EIR LTF  L ++D  
Sbjct  2038  IMGLRDVKSVSDKTTLFDLGMDSLMSTEIKQTLERHFDLVLSAQEIRQLTFSALRQIDAQ  2097

Query  2094  SGA-----------------EAGNAGADSDDEETIQDAAGLLSFEGTEIVPVKIIVPLST  2136
                                 E          +ET +  A        E++P +++V L +
Sbjct  2098  EPPSASVSSPSASSTLSRIKEEACVEVQPQSDETRKVFA-------KEVLPQEVMVRLRS  2150

Query  2137  ---ANSAGQPLFFVPAIEGVAAPFKTVASELNRPAWSFQCTESCPLESVSALANFYLKKM  2193
                  S    +FF+  IEG     + +A+ L  PA+  QCTE  PL+S+ A A +YL+++
Sbjct  2151  KAPVASEDPAVFFLAPIEGFTIAVEALAASLTCPAYGLQCTEQVPLDSIEACAAYYLRQI  2210

Query  2194  RAIQTEGPYNIIGYSFGSCIGLEMAVQLQKAGHKTNLTVIDGSPDFVKLHSVELGKRATE  2253
             + +Q  GPY+I+GYS+G  +   +AV L++      + ++DG+P     +  E  K+   
Sbjct  2211  QKLQPLGPYHIVGYSYGCLLAHAIAVALEQRRFGVKVIMLDGAPTMASGYVQEAKKQ---  2267

Query  2254  ESSEVITDGLRK----CLAYF---VRQFRSNITFLKLYDMLKNINTTEVVLNKVVELIDD  2306
                   TD L +     LAYF   +     N   L+L D    + T    L+K+ + +  
Sbjct  2268  ------TDDLNRQQSMTLAYFGALLADVDYNQVLLQLLD---GVQTWPSKLDKLADTLAG  2318

Query  2307  KNLDS-EDLKSAALLFYKKLKAAFFYKPEK-YDGDIVLLKAKDSFVPLNNDYGLSKI-SN  2363
                 + E +K AA +F +KL  +  YK  K    D+VL+K+ +    +  DYGL +I S 
Sbjct  2319  YTQQTREVIKKAACMFKQKLLLSESYKGAKQLHSDVVLIKSAEHNAIMAQDYGLKEICSA  2378

Query  2364  KVTVIELPGNHRSIL  2378
             ++ +  + G HR+ L
Sbjct  2379  QIDMHVVEGTHRTFL  2393


>Q8MR70_DROME unnamed protein product
Length=1529

 Score = 1296 bits (3354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 709/1542 (46%), Positives = 1006/1542 (65%), Gaps = 82/1542 (5%)

Query  887   VEVNLSKETDAYLVGHCIDERILFPATGYLVIVWKTYAKMRGTDFEKLPITFENVKFQRA  946
             VE++L KE + YL GH ID R+LFPATGY+ + W + A+ +G D+ + P+ FE+V F RA
Sbjct  3     VELDLGKEENVYLAGHTIDGRVLFPATGYMTLAWMSLAQQQGLDYLRTPVLFEDVVFHRA  62

Query  947   TIMPMDGTVKFSINIFLGTGDFEICESGSVVVTGTVSVPENVDKMLLNMPA-PIVKNEST  1005
             TI+ +   VK ++N F G+  FEICE  S+V +G + +  NV +  L + + P +   + 
Sbjct  63    TILSVGTVVKLTLNFFPGSSSFEICEGTSLVTSGKIRLVSNVQQEQLQLSSLPGIAGSN-  121

Query  1006  VVELNTTDVYKELRLRGYNYTGIFQGIKVVHNGGVSGRLLWND-WISFMDTMLQFSILEK  1064
               +L+T D+YKELRLRGY+YTG+FQGI       V+G+L W D WISFMDTMLQF IL  
Sbjct  122   --KLSTKDIYKELRLRGYDYTGVFQGILESDISAVTGQLQWADNWISFMDTMLQFRILSN  179

Query  1065  DCRGLYVPVRVQYVAINPIAHLEFVENYKEGEGVPIYSYPNIGVIKSGGVEIRKMKASLI  1124
             D R LYVP  ++   I+P+ HLE  + +++   + +  + NI V+K GGVEI KMK +  
Sbjct  180   DIRELYVPTGIERALIDPLKHLELAKKHQQK--LTVNWHRNISVVKCGGVEIHKMKTAQT  237

Query  1125  AKKQQIR-PPKLERCLFIPYENSQPLVQDPEKAKVHALTILLLTAYENIKG-IKLKITEV  1182
              ++   + PP LER  F P+       ++ EK++  AL + +    EN  G +KLK  E+
Sbjct  238   QRRSGGQSPPSLERYRFWPHSQHLGQREEQEKSRSTALAVAIQLIIENSGGAVKLKGVEL  297

Query  1183  SGDRP-VDSLMLPYIKTWCSREPVINGDLQLATVLRKRYI---SLKQN-IKIIKCNVEKE  1237
             +G R  +D+L    +     REP++ GD+ + T           LK++ I++I  +++  
Sbjct  298   AGSRSTLDALSAVQLLELIEREPILVGDMAVVTSSSNESELGEQLKEHGIRVIVKDIKAG  357

Query  1238  LIGQDLHIAVASNVLTDNSLNVLKNLKDSV-INRGFILLEETAQTDFNVVDPD------L  1290
              + Q  H   + N+L  NS+  L++  DS+  + GF+LLEE A + +N++  +      L
Sbjct  358   AVEQQCHFVYSVNMLAQNSVKDLQHCLDSLKSDSGFLLLEEAA-SRYNIIGKEKLNKLKL  416

Query  1291  VCVAKQVIPGKSYILLKKKEVR---PDPIVIQLTEKNFSWVEGVKAALKNVVAQNQRPLF  1347
             V V +Q       ++L +K  +      + + LT K F WV  +K ++    A+ +    
Sbjct  417   VSVLEQFFGTDRVLVLVRKLSKVQSSQALTLHLTNKQFKWVNELKNSIAKAQAEEKNLYL  476

Query  1348  VCQGEELFGMVGFMNCILNEDGGAKASYVFIQDKNMPKFNLNDKFYAKQLDKQMFANILR  1407
             V QGE   G +G MNC+  E GG       I D+ +P+F+L+D FYA QL K +  N+ R
Sbjct  477   VAQGEPNSGALGLMNCLKREAGGHFLRLYLILDEGVPQFSLDDPFYAAQLAKDLVVNVYR  536

Query  1408  GGQWGSYKHIELDQENESSLQVEHAYINALNRGDLSSLRWIESPLSYYQLEKSP---NTE  1464
              G WGSY+H++++      L VE AY+N L +GDLSSLRWIESP S      SP     E
Sbjct  537   NGSWGSYRHLKME-SRPPMLPVEQAYVNTLVKGDLSSLRWIESPRS------SPIQSQLE  589

Query  1465  LCSVYYAPLNFRDIMLATGKLPPDALPGNLATQDCILGLEFSGRDSKGQRVMAMVPARGL  1524
              C+VYYAPLNFRD+MLA+GKL  DALPG+LA QDC+LGLEF+GRDS G+RVMAMV A+ L
Sbjct  590   PCTVYYAPLNFRDVMLASGKLGVDALPGDLAYQDCVLGLEFAGRDSCGRRVMAMVTAKSL  649

Query  1525  ATTVIADPGFMWKVPDKWSLEEAATVPVAYATSYYALCVRGHMKPGDSVLIHAGSGGVGQ  1584
             AT  +A+   +W+VP KW++E+A+TVP  YAT YYAL VRG MK G+ +LIHAGSGGVGQ
Sbjct  650   ATNCLANRNLLWEVPSKWTMEQASTVPCVYATVYYALVVRGQMKEGERILIHAGSGGVGQ  709

Query  1585  ASISIALHAGCKVFTTVGTQDKRDFLKKMFPVLTDRNIGNSRDTSFEQLILNETNGRGVD  1644
             A+IS+AL  G  VFTTVG+++KR+FL K FP L  +NIGNSRDTSFEQLI++ET+G GV+
Sbjct  710   AAISVALAHGLTVFTTVGSKEKREFLLKRFPKLKAKNIGNSRDTSFEQLIMSETHGNGVE  769

Query  1645  IVLNSLAEEKLQASIRCLAQGGRFLEIGKFDLSNDSPLGMSVFLKNVSFHGILLDAICED  1704
             +VLNSL+EEKLQASIRCLA  GRFLEIGKFDLSN++PLGMSVFLKN SFHGILLD++ E 
Sbjct  770   LVLNSLSEEKLQASIRCLALNGRFLEIGKFDLSNNTPLGMSVFLKNTSFHGILLDSVMEG  829

Query  1705  DGPERQEVVRLVSEGIKSGAVRPLPSTVFSEQQIEQSFRYMATGKHIGKVLLKIRDEEKQ  1764
             +   +  V +LV+EGIKSGAV+PLP+TVF+EQ+IE++FR+MA+GKHIGKV++K+R EE+Q
Sbjct  830   EEEMQLMVAKLVAEGIKSGAVQPLPTTVFAEQEIEKAFRFMASGKHIGKVVIKVRLEEEQ  889

Query  1765  KVVQSPQKVVSAIPRTYLNPEKSYILVGGLGGFGLELAYWMILRGAKYIILTSRSGVTTG  1824
             +      + + AIPR+Y++PEKSYILVGGLGGFGLELA W++ RGA++++L+SRSGV +G
Sbjct  890   QAALPRLRQIQAIPRSYMHPEKSYILVGGLGGFGLELANWLVSRGARFLVLSSRSGVKSG  949

Query  1825  FQALCIRRWRNMGAHIKISTADVTTLDGAKQLIKESKALAPVGGIFNLAAVLRDGLIENL  1884
             +QAL IRRW + G  ++I T DVTT  G ++L++ S  LA VGGIFNLAAVLRDGLIE+ 
Sbjct  950   YQALMIRRWHDRGVQVQIDTNDVTTAVGCQRLLEVSNKLALVGGIFNLAAVLRDGLIEDQ  1009

Query  1885  TESDFVISASPKVNGTKNLDIVSRE-CSSLDYFVVFSSVTSGRGNVGQTNYGLANSAMER  1943
             +  +F   ++PK+  T +LD +SRE C +L+YFV FSS++ GRGN+GQTNYGLANS MER
Sbjct  1010  SPKNFEKVSAPKLLATIHLDKISREICPALEYFVCFSSLSCGRGNMGQTNYGLANSTMER  1069

Query  1944  LMEQRQANGLPGLAIQWGAIGDVGLILEKLGGFNDTEIGGTLPQRIQNCLDTMDIFLQQP  2003
             + EQRQ  G PG AIQWGAIGD GLI+E +G  N+T +GGTLPQR+ +CL+T+D+FLQQP
Sbjct  1070  ICEQRQEYGYPGTAIQWGAIGDTGLIIEHMGN-NETVVGGTLPQRMISCLETLDLFLQQP  1128

Query  2004  HPILASLVTANKDNTVESANKVSVVQAIANILGIKALESVNGSTSLADLGMDSLMGTEIK  2063
             HP++AS+V A K  T E AN++S++  IANI+G++ ++SV+  T+L DLGMDSLM TEIK
Sbjct  1129  HPVMASMVVAEKRKT-EQANRLSLIATIANIMGLRDVKSVSDKTTLFDLGMDSLMSTEIK  1187

Query  2064  QTMERNYDIVLSALEIRNLTFDKLGKLDNTSGA-----------------EAGNAGADSD  2106
             QT+ER++D+VLSA EIR LTF  L ++D                      E         
Sbjct  1188  QTLERHFDLVLSAQEIRQLTFSALRQIDAQEPPSASVSSPSASSTLSRIKEEACVEVQPQ  1247

Query  2107  DEETIQDAAGLLSFEGTEIVPVKIIVPLST---ANSAGQPLFFVPAIEGVAAPFKTVASE  2163
              +ET +  A        E++P +++V L +     S    +FF+  IEG     + +A+ 
Sbjct  1248  SDETRKVFA-------KEVLPQEVMVRLRSKAPVASEDPAVFFLAPIEGFTIAVEALAAS  1300

Query  2164  LNRPAWSFQCTESCPLESVSALANFYLKKMRAIQTEGPYNIIGYSFGSCIGLEMAVQLQK  2223
             L  PA+  QCTE  PL+S+ A A +YL++++ +Q  GPY+I+GYS+G  +   +AV L++
Sbjct  1301  LTCPAYGLQCTEQVPLDSIEACAAYYLRQIQKLQPLGPYHIVGYSYGCLLAHAIAVALEQ  1360

Query  2224  AGHKTNLTVIDGSPDFVKLHSVELGKRATEESSEVITDGLRK----CLAYFVRQFRSNIT  2279
                   + ++DG+P     +  E  K+         TD L +     LAYF     +++ 
Sbjct  1361  RRFGVKVIMLDGAPTMASGYVQEAKKQ---------TDDLNRQQSMTLAYF-GALLADVD  1410

Query  2280  FLKLYDMLKNINTTEVVLNKVVELIDDKNLDS-EDLKSAALLFYKKLKAAFFYK-PEKYD  2337
             + +L  +L  + T    L+K+ + +      + E +K AA +F +KL  +  YK  ++  
Sbjct  1411  YNQLLQLLDGVQTWPSKLDKLADTLAGYTQQTREVIKKAACMFKQKLLLSESYKGAKQLH  1470

Query  2338  GDIVLLKAKDSFVPLNNDYGLSKI-SNKVTVIELPGNHRSIL  2378
              D+VL+K+ +    +  DYGL +I S ++ +  + G HR+ L
Sbjct  1471  SDVVLIKSAEHNAIMAQDYGLKEICSAQIDMHVVEGTHRTFL  1512



Lambda      K        H
   0.324    0.138    0.456 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3617638992


Query= NP_001267845.1 phosphomevalonate kinase [Bombus terrestris]

Length=202
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q583U0_TRYB2  unnamed protein product                                 27.7    8.9  
Q8IGN3_DROME  unnamed protein product                                 27.7    9.5  
Q9VWZ7_DROME  unnamed protein product                                 27.3    9.8  


>Q583U0_TRYB2 unnamed protein product
Length=730

 Score = 27.7 bits (60),  Expect = 8.9, Method: Composition-based stats.
 Identities = 15/46 (33%), Positives = 21/46 (46%), Gaps = 9/46 (20%)

Query  52   IIRLSGPIKFHWAKSLDLDIDQLLGDGKYKENYRLEMAKWGENIRN  97
            ++   GP + H+ KS         GDG YK N R E   +G  + N
Sbjct  557  LLEWGGPTRSHFNKS---------GDGNYKSNARREAKLFGAALLN  593


>Q8IGN3_DROME unnamed protein product
Length=949

 Score = 27.7 bits (60),  Expect = 9.5, Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 24/55 (44%), Gaps = 3/55 (5%)

Query  62   HWAKSLD---LDIDQLLGDGKYKENYRLEMAKWGENIRNKDYGYFCRAALEMYNA  113
            +W ++ D   LD     G   Y E ++  M     N+R  D+GY+   A    NA
Sbjct  561  YWERAYDGKILDPSDKYGIESYPEGFKTTMRLTISNLRKDDFGYYHCVARNELNA  615


>Q9VWZ7_DROME unnamed protein product
Length=949

 Score = 27.3 bits (59),  Expect = 9.8, Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 24/55 (44%), Gaps = 3/55 (5%)

Query  62   HWAKSLD---LDIDQLLGDGKYKENYRLEMAKWGENIRNKDYGYFCRAALEMYNA  113
            +W ++ D   LD     G   Y E ++  M     N+R  D+GY+   A    NA
Sbjct  561  YWERAYDGKILDPSDKYGIESYPEGFKTTMRLTISNLRKDDFGYYHCVARNELNA  615



Lambda      K        H
   0.324    0.138    0.456 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3617638992


Query= NP_001267847.1 geranylgeranyl pyrophosphate synthase-like [Bombus
terrestris]

Length=308
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O61539_DROME  unnamed protein product                                 440     3e-156
Q9VS54_DROME  unnamed protein product                                 439     4e-156
O61538_DROME  unnamed protein product                                 416     6e-147
M9PEL3_DROME  unnamed protein product                                 409     2e-144
Q5G1W2_DROME  unnamed protein product                                 81.3    2e-19 


>O61539_DROME unnamed protein product
Length=338

 Score = 440 bits (1131),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 199/297 (67%), Positives = 246/297 (83%), Gaps = 0/297 (0%)

Query  12   SGDKEEDEILLLPLTYILQIPGKQIRAKLIQAFNYWLKIPQDKFHAVGDIIQLLHTSSLL  71
            S  KE+DEILL P TYI QIPGKQ R++L  AFN+WL IP +K   +GDI+Q+LH SSLL
Sbjct  15   STQKEQDEILLQPFTYIQQIPGKQFRSELALAFNHWLLIPGEKLAQIGDIVQMLHNSSLL  74

Query  72   IDDIQDNSVLRRGIPVAHNIYGVASTINASNYGLFIALEKVMALNHPEGTQVYLQQLLEL  131
            IDDI+DNS+LRRG+PVAH+IYGVASTINA+NY LF+ALEKV  L+HPE T+VY +QLLEL
Sbjct  75   IDDIEDNSILRRGVPVAHSIYGVASTINAANYALFLALEKVQQLDHPEATKVYTEQLLEL  134

Query  132  HRGQGMELYWRDNYMCPSETAYKQMIMRKTGGLFNMAVRLMQLFSDSKEDYVSLVSMLGL  191
            HRGQGME+YWRD++ CPSE+ YK M +RKTGGLF +A+RLMQLFS +KEDY  L ++LGL
Sbjct  135  HRGQGMEIYWRDSFTCPSESDYKLMTVRKTGGLFMLAIRLMQLFSSNKEDYSKLTAILGL  194

Query  192  YFQIRDDYCNLCVKEYALNKSYCEDLSEGKFSFPIIHALRTHPEDRQILNILRQRTKDNE  251
            YFQIRDDYCNL +KEY  NKS+ EDL+EGKF FP+IHA+RT  +D+Q+L+ILRQRT D E
Sbjct  195  YFQIRDDYCNLSLKEYTENKSFAEDLTEGKFGFPVIHAVRTQKQDKQVLHILRQRTHDIE  254

Query  252  VKRYCVSLLEKFGSFAYTRTVLEDMDKEVRKKIQCLGGNPLLVRVLDELMSWKHHDS  308
            VK+YC++LLEK GSF YTR VLE +D E R ++  LG NP + R+L++L+SWK  DS
Sbjct  255  VKKYCITLLEKLGSFQYTRKVLESLDAEARSEVARLGSNPYMDRLLNKLLSWKTSDS  311


>Q9VS54_DROME unnamed protein product
Length=338

 Score = 439 bits (1130),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 199/297 (67%), Positives = 246/297 (83%), Gaps = 0/297 (0%)

Query  12   SGDKEEDEILLLPLTYILQIPGKQIRAKLIQAFNYWLKIPQDKFHAVGDIIQLLHTSSLL  71
            S  KE+DEILL P TYI QIPGKQ R++L  AFN+WL IP +K   +GDI+Q+LH SSLL
Sbjct  15   STQKEQDEILLQPFTYIQQIPGKQFRSELALAFNHWLLIPGEKLAQIGDIVQMLHNSSLL  74

Query  72   IDDIQDNSVLRRGIPVAHNIYGVASTINASNYGLFIALEKVMALNHPEGTQVYLQQLLEL  131
            IDDI+DNS+LRRG+PVAH+IYGVASTINA+NY LF+ALEKV  L+HPE T+VY +QLLEL
Sbjct  75   IDDIEDNSILRRGVPVAHSIYGVASTINAANYALFLALEKVQQLDHPEATKVYTEQLLEL  134

Query  132  HRGQGMELYWRDNYMCPSETAYKQMIMRKTGGLFNMAVRLMQLFSDSKEDYVSLVSMLGL  191
            HRGQGME+YWRD++ CPSE+ YK M +RKTGGLF +A+RLMQLFS +KEDY  L ++LGL
Sbjct  135  HRGQGMEIYWRDSFTCPSESDYKLMTVRKTGGLFMLAIRLMQLFSSNKEDYSKLTAILGL  194

Query  192  YFQIRDDYCNLCVKEYALNKSYCEDLSEGKFSFPIIHALRTHPEDRQILNILRQRTKDNE  251
            YFQIRDDYCNL +KEY  NKS+ EDL+EGKF FP+IHA+RT  +D+Q+L+ILRQRT D E
Sbjct  195  YFQIRDDYCNLSLKEYTENKSFAEDLTEGKFGFPVIHAVRTQKQDKQVLHILRQRTHDIE  254

Query  252  VKRYCVSLLEKFGSFAYTRTVLEDMDKEVRKKIQCLGGNPLLVRVLDELMSWKHHDS  308
            VK+YC++LLEK GSF YTR VLE +D E R ++  LG NP + R+L++L+SWK  DS
Sbjct  255  VKKYCITLLEKLGSFQYTRKVLESLDAEARSEVARLGSNPYMDRLLNKLLSWKTSDS  311


>O61538_DROME unnamed protein product
Length=335

 Score = 416 bits (1069),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 190/297 (64%), Positives = 239/297 (80%), Gaps = 3/297 (1%)

Query  12   SGDKEEDEILLLPLTYILQIPGKQIRAKLIQAFNYWLKIPQDKFHAVGDIIQLLHTSSLL  71
            S  KE+DEILL P TYI QIPGKQ R++L  AFN+WL IP +K   +G+I+Q+LH SSLL
Sbjct  15   STQKEQDEILLQPFTYIQQIPGKQFRSELALAFNHWLLIPGEKLAQIGNIVQMLHNSSLL  74

Query  72   IDDIQDNSVLRRGIPVAHNIYGVASTINASNYGLFIALEKVMALNHPEGTQVYLQQLLEL  131
            I+D   NS+LRRG+PVAH+IYGVASTINA+NY LF+ALEKV  L+HPE  +VY +QLLEL
Sbjct  75   IED---NSILRRGVPVAHSIYGVASTINAANYALFLALEKVQQLDHPEVRKVYTEQLLEL  131

Query  132  HRGQGMELYWRDNYMCPSETAYKQMIMRKTGGLFNMAVRLMQLFSDSKEDYVSLVSMLGL  191
            HRGQGME+YWRD++ CPSE+ YK M +RKTGGLF +A+RLMQLFS +KEDY  L ++LGL
Sbjct  132  HRGQGMEIYWRDSFTCPSESDYKLMTVRKTGGLFMLAIRLMQLFSSNKEDYSKLTAILGL  191

Query  192  YFQIRDDYCNLCVKEYALNKSYCEDLSEGKFSFPIIHALRTHPEDRQILNILRQRTKDNE  251
            YFQIRDDYCNL +KE ++NKS+ EDL+EGKF FP+IHA+RT  +D+Q+L    QRT D E
Sbjct  192  YFQIRDDYCNLSLKEVSVNKSFAEDLTEGKFGFPVIHAVRTQKQDKQVLRKSSQRTHDIE  251

Query  252  VKRYCVSLLEKFGSFAYTRTVLEDMDKEVRKKIQCLGGNPLLVRVLDELMSWKHHDS  308
            VK+YC++LLEK GSF YTR VLE +D E R ++  LG NP + R+L++L+SWK  DS
Sbjct  252  VKKYCITLLEKLGSFQYTRKVLESLDAEARSEVSTLGSNPYMDRLLNKLLSWKTSDS  308


>M9PEL3_DROME unnamed protein product
Length=326

 Score = 409 bits (1052),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 189/297 (64%), Positives = 234/297 (79%), Gaps = 12/297 (4%)

Query  12   SGDKEEDEILLLPLTYILQIPGKQIRAKLIQAFNYWLKIPQDKFHAVGDIIQLLHTSSLL  71
            S  KE+DEILL P TYI QIPGKQ R++L  AFN+WL IP +K   +GDI+Q+LH SSLL
Sbjct  15   STQKEQDEILLQPFTYIQQIPGKQFRSELALAFNHWLLIPGEKLAQIGDIVQMLHNSSLL  74

Query  72   IDDIQDNSVLRRGIPVAHNIYGVASTINASNYGLFIALEKVMALNHPEGTQVYLQQLLEL  131
                        G+PVAH+IYGVASTINA+NY LF+ALEKV  L+HPE T+VY +QLLEL
Sbjct  75   ------------GVPVAHSIYGVASTINAANYALFLALEKVQQLDHPEATKVYTEQLLEL  122

Query  132  HRGQGMELYWRDNYMCPSETAYKQMIMRKTGGLFNMAVRLMQLFSDSKEDYVSLVSMLGL  191
            HRGQGME+YWRD++ CPSE+ YK M +RKTGGLF +A+RLMQLFS +KEDY  L ++LGL
Sbjct  123  HRGQGMEIYWRDSFTCPSESDYKLMTVRKTGGLFMLAIRLMQLFSSNKEDYSKLTAILGL  182

Query  192  YFQIRDDYCNLCVKEYALNKSYCEDLSEGKFSFPIIHALRTHPEDRQILNILRQRTKDNE  251
            YFQIRDDYCNL +KEY  NKS+ EDL+EGKF FP+IHA+RT  +D+Q+L+ILRQRT D E
Sbjct  183  YFQIRDDYCNLSLKEYTENKSFAEDLTEGKFGFPVIHAVRTQKQDKQVLHILRQRTHDIE  242

Query  252  VKRYCVSLLEKFGSFAYTRTVLEDMDKEVRKKIQCLGGNPLLVRVLDELMSWKHHDS  308
            VK+YC++LLEK GSF YTR VLE +D E R ++  LG NP + R+L++L+SWK  DS
Sbjct  243  VKKYCITLLEKLGSFQYTRKVLESLDAEARSEVARLGSNPYMDRLLNKLLSWKTSDS  299


>Q5G1W2_DROME unnamed protein product
Length=74

 Score = 81.3 bits (199),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 46/60 (77%), Gaps = 0/60 (0%)

Query  12  SGDKEEDEILLLPLTYILQIPGKQIRAKLIQAFNYWLKIPQDKFHAVGDIIQLLHTSSLL  71
           S  KE+DEILL P TYI QIPGKQ R++L  AFN+WL IP +K   +GDI+Q+LH SSLL
Sbjct  15  STQKEQDEILLQPFTYIQQIPGKQFRSELALAFNHWLLIPGEKLAQIGDIVQMLHNSSLL  74



Lambda      K        H
   0.324    0.138    0.456 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3617638992


Query= NP_001267850.1 kruppel homolog 1 [Bombus terrestris]

Length=491
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

KRH1_DROME  unnamed protein product                                   361     6e-116
O96395_DROME  unnamed protein product                                 186     2e-52 
M9PF60_DROME  unnamed protein product                                 186     2e-52 
Q8MRK4_DROME  unnamed protein product                                 189     8e-52 
M9PCY3_DROME  unnamed protein product                                 188     8e-52 


>KRH1_DROME unnamed protein product
Length=845

 Score = 361 bits (926),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 161/199 (81%), Positives = 175/199 (88%), Gaps = 2/199 (1%)

Query  78   GEDPYRCNICGKTFAVPARLTRHYRTHTGEKPYQCEYCSKSFSVKENLSVHRRIHTKERP  137
            G DPY+CN+C KTFAVPARL RHYRTHTGE+P++CE+C K FSVKENL VHRRIHTKERP
Sbjct  267  GADPYQCNVCQKTFAVPARLIRHYRTHTGERPFECEFCHKLFSVKENLQVHRRIHTKERP  326

Query  138  YKCDVCERAFEHSGKLHRHMRIHTGERPHKCTVCSKTFIQSGQLVIHMRTHTGEKPYVC-  196
            YKCDVC RAFEHSGKLHRHMRIHTGERPHKC+VC KTFIQSGQLVIHMRTHTGEKPY C 
Sbjct  327  YKCDVCGRAFEHSGKLHRHMRIHTGERPHKCSVCEKTFIQSGQLVIHMRTHTGEKPYKCP  386

Query  197  -KSCGKGFTCSKQLKVHTRTHTGEKPYTCDICGKSFGYNHVLKLHQVAHYGEKVYKCTLC  255
               CGKGFTCSKQLKVH+RTHTGEKPY CDIC + FGYNHVLKLH+V HYG K YKCT+C
Sbjct  387  EPGCGKGFTCSKQLKVHSRTHTGEKPYHCDICFRDFGYNHVLKLHRVQHYGSKCYKCTIC  446

Query  256  HETFGSKKTMELHIKTHSD  274
             ETF +KK ME HIK H++
Sbjct  447  DETFKNKKEMEAHIKGHAN  465


 Score = 140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/205 (37%), Positives = 107/205 (52%), Gaps = 6/205 (3%)

Query  19   VNPVKSLVCSPDLSVFTPACSGETLSANVEEKTYQCLLCQKVFDQKSLYQSHLRSHGKEG  78
             +P +  VC    +V  PA        +  E+ ++C  C K+F  K   Q H R H K  
Sbjct  268  ADPYQCNVCQKTFAV--PARLIRHYRTHTGERPFECEFCHKLFSVKENLQVHRRIHTK--  323

Query  79   EDPYRCNICGKTFAVPARLTRHYRTHTGEKPYQCEYCSKSFSVKENLSVHRRIHTKERPY  138
            E PY+C++CG+ F    +L RH R HTGE+P++C  C K+F     L +H R HT E+PY
Sbjct  324  ERPYKCDVCGRAFEHSGKLHRHMRIHTGERPHKCSVCEKTFIQSGQLVIHMRTHTGEKPY  383

Query  139  KC--DVCERAFEHSGKLHRHMRIHTGERPHKCTVCSKTFIQSGQLVIHMRTHTGEKPYVC  196
            KC    C + F  S +L  H R HTGE+P+ C +C + F  +  L +H   H G K Y C
Sbjct  384  KCPEPGCGKGFTCSKQLKVHSRTHTGEKPYHCDICFRDFGYNHVLKLHRVQHYGSKCYKC  443

Query  197  KSCGKGFTCSKQLKVHTRTHTGEKP  221
              C + F   K+++ H + H  E P
Sbjct  444  TICDETFKNKKEMEAHIKGHANEVP  468


 Score = 119 bits (298),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 64/205 (31%), Positives = 103/205 (50%), Gaps = 22/205 (11%)

Query  91   FAVPARLTRHYRTHTGEKP-YQCEYCSKSFSVKENLSVHRRIHTKERPYKCD--------  141
            F   A +    R  +  KP ++C+ C  +F  K   + H + H+K +    +        
Sbjct  174  FPASAAVVSQVRKPSASKPQFKCDQCGMTFGSKSAHTSHTKSHSKNQDLSLNGASGAGVA  233

Query  142  --VCERAFE-----------HSGKLHRHMRIHTGERPHKCTVCSKTFIQSGQLVIHMRTH  188
              V   A E            S  +     +  G  P++C VC KTF    +L+ H RTH
Sbjct  234  APVSTAAIELNDAGLPVGIPKSPTIKPLANVAAGADPYQCNVCQKTFAVPARLIRHYRTH  293

Query  189  TGEKPYVCKSCGKGFTCSKQLKVHTRTHTGEKPYTCDICGKSFGYNHVLKLHQVAHYGEK  248
            TGE+P+ C+ C K F+  + L+VH R HT E+PY CD+CG++F ++  L  H   H GE+
Sbjct  294  TGERPFECEFCHKLFSVKENLQVHRRIHTKERPYKCDVCGRAFEHSGKLHRHMRIHTGER  353

Query  249  VYKCTLCHETFGSKKTMELHIKTHS  273
             +KC++C +TF     + +H++TH+
Sbjct  354  PHKCSVCEKTFIQSGQLVIHMRTHT  378


>O96395_DROME unnamed protein product
Length=583

 Score = 186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/228 (38%), Positives = 136/228 (60%), Gaps = 4/228 (2%)

Query  49   EKTYQCLLCQKVFDQKSLYQSHLRSHGKEGEDPYRCNICGKTFAVPARLTRHYRTHTGEK  108
            E+ ++C LC K +      +SH+ +H  + E  ++C  C KTF     L  H + HTGE+
Sbjct  297  ERPFKCPLCPKAYTHGPTLKSHMHTH--DEEKGHKCPQCDKTFYTRGNLRAHIQRHTGER  354

Query  109  PYQCEYCSKSFSVKENLSVHRRIHTKERPYKCDVCERAFEHSGKLHRHMRIHTGERPHKC  168
            PY+C  C ++F+    L +H R+H +ERP+KC++C + F  +  L  H+R+H G+R  KC
Sbjct  355  PYKCPDCPQTFAKNSGLKLHSRLHKEERPFKCELCGKGFVQNQHLITHLRVHNGDRQFKC  414

Query  169  TVCSKTFIQSGQLVIHMRTHTGEKPYVCKSCGKGFTCSKQLKVHTRTHTGEKPYTCDICG  228
              C K+F +   ++ H RTH+G KP+ C+ CG+ F+ +  LK H R HTGEKPY CD CG
Sbjct  415  PDCDKSFFEKSNMMKHQRTHSGIKPFKCEECGQAFSHNHHLKSHLRIHTGEKPYKCDQCG  474

Query  229  KSFGYNHVLKLHQVAHY--GEKVYKCTLCHETFGSKKTMELHIKTHSD  274
            K F  N  L  H + H    ++ +KC+ C + + +++++  H KTH +
Sbjct  475  KGFSANQSLMKHTLWHVDNNDRPFKCSQCPKAYDTQQSLRGHEKTHKN  522


 Score = 175 bits (443),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 86/228 (38%), Positives = 125/228 (55%), Gaps = 2/228 (1%)

Query  49   EKTYQCLLCQKVFDQKSLYQSHLRSHGKEGEDPYRCNICGKTFAVPARLTRHYRTHTGEK  108
            +K + C  C + F   +   +H R H   GE P++C +C K +     L  H  TH  EK
Sbjct  269  QKPHLCDFCGRGFRTNAQLTTHRRRH--TGERPFKCPLCPKAYTHGPTLKSHMHTHDEEK  326

Query  109  PYQCEYCSKSFSVKENLSVHRRIHTKERPYKCDVCERAFEHSGKLHRHMRIHTGERPHKC  168
             ++C  C K+F  + NL  H + HT ERPYKC  C + F  +  L  H R+H  ERP KC
Sbjct  327  GHKCPQCDKTFYTRGNLRAHIQRHTGERPYKCPDCPQTFAKNSGLKLHSRLHKEERPFKC  386

Query  169  TVCSKTFIQSGQLVIHMRTHTGEKPYVCKSCGKGFTCSKQLKVHTRTHTGEKPYTCDICG  228
             +C K F+Q+  L+ H+R H G++ + C  C K F     +  H RTH+G KP+ C+ CG
Sbjct  387  ELCGKGFVQNQHLITHLRVHNGDRQFKCPDCDKSFFEKSNMMKHQRTHSGIKPFKCEECG  446

Query  229  KSFGYNHVLKLHQVAHYGEKVYKCTLCHETFGSKKTMELHIKTHSDSS  276
            ++F +NH LK H   H GEK YKC  C + F + +++  H   H D++
Sbjct  447  QAFSHNHHLKSHLRIHTGEKPYKCDQCGKGFSANQSLMKHTLWHVDNN  494


 Score = 161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 77/194 (40%), Positives = 108/194 (56%), Gaps = 4/194 (2%)

Query  84   CNICGKTFAVPARLTRHYRTH----TGEKPYQCEYCSKSFSVKENLSVHRRIHTKERPYK  139
            C  CG +++    L RH   H      +KP+ C++C + F     L+ HRR HT ERP+K
Sbjct  242  CTECGVSYSTQKALARHVAKHKEQGDTQKPHLCDFCGRGFRTNAQLTTHRRRHTGERPFK  301

Query  140  CDVCERAFEHSGKLHRHMRIHTGERPHKCTVCSKTFIQSGQLVIHMRTHTGEKPYVCKSC  199
            C +C +A+ H   L  HM  H  E+ HKC  C KTF   G L  H++ HTGE+PY C  C
Sbjct  302  CPLCPKAYTHGPTLKSHMHTHDEEKGHKCPQCDKTFYTRGNLRAHIQRHTGERPYKCPDC  361

Query  200  GKGFTCSKQLKVHTRTHTGEKPYTCDICGKSFGYNHVLKLHQVAHYGEKVYKCTLCHETF  259
             + F  +  LK+H+R H  E+P+ C++CGK F  N  L  H   H G++ +KC  C ++F
Sbjct  362  PQTFAKNSGLKLHSRLHKEERPFKCELCGKGFVQNQHLITHLRVHNGDRQFKCPDCDKSF  421

Query  260  GSKKTMELHIKTHS  273
              K  M  H +THS
Sbjct  422  FEKSNMMKHQRTHS  435


 Score = 119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 73/207 (35%), Positives = 106/207 (51%), Gaps = 9/207 (4%)

Query  48   EEKTYQCLLCQKVFDQKSLYQSHLRSHGKEGEDPYRCNICGKTFAVPARLTRHYRTHTGE  107
            EE+ ++C LC K F Q     +HLR H   G+  ++C  C K+F   + + +H RTH+G 
Sbjct  380  EERPFKCELCGKGFVQNQHLITHLRVHN--GDRQFKCPDCDKSFFEKSNMMKHQRTHSGI  437

Query  108  KPYQCEYCSKSFSVKENLSVHRRIHTKERPYKCDVCERAFEHSGKLHRHMRIH--TGERP  165
            KP++CE C ++FS   +L  H RIHT E+PYKCD C + F  +  L +H   H    +RP
Sbjct  438  KPFKCEECGQAFSHNHHLKSHLRIHTGEKPYKCDQCGKGFSANQSLMKHTLWHVDNNDRP  497

Query  166  HKCTVCSKTFIQSGQLVIHMRTHTG-EKP---YVCKSCGKGFTCSKQLKVHTRTHTGEKP  221
             KC+ C K +     L  H +TH   ++P   + C  C   F   K L  H  +H   +P
Sbjct  498  FKCSQCPKAYDTQQSLRGHEKTHKNPDEPKTLHQCPHCDVRFALKKTLDKHITSHKI-RP  556

Query  222  YTCDICGKSFGYNHVLKLHQVAHYGEK  248
            + C  C + F     LK H   H  +K
Sbjct  557  HPCPQCPEGFFSQKSLKKHLRLHNLKK  583


 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 68/139 (49%), Gaps = 4/139 (3%)

Query  140  CDVCERAFEHSGKLHRHMRIH----TGERPHKCTVCSKTFIQSGQLVIHMRTHTGEKPYV  195
            C  C  ++     L RH+  H      ++PH C  C + F  + QL  H R HTGE+P+ 
Sbjct  242  CTECGVSYSTQKALARHVAKHKEQGDTQKPHLCDFCGRGFRTNAQLTTHRRRHTGERPFK  301

Query  196  CKSCGKGFTCSKQLKVHTRTHTGEKPYTCDICGKSFGYNHVLKLHQVAHYGEKVYKCTLC  255
            C  C K +T    LK H  TH  EK + C  C K+F     L+ H   H GE+ YKC  C
Sbjct  302  CPLCPKAYTHGPTLKSHMHTHDEEKGHKCPQCDKTFYTRGNLRAHIQRHTGERPYKCPDC  361

Query  256  HETFGSKKTMELHIKTHSD  274
             +TF     ++LH + H +
Sbjct  362  PQTFAKNSGLKLHSRLHKE  380


 Score = 59.3 bits (142),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 56/123 (46%), Gaps = 5/123 (4%)

Query  43   LSANVEEKTYQCLLCQKVFDQKSLYQSHLRSHGKEGEDPYRCNICGKTFAVPARLTRHYR  102
            L  +  EK Y+C  C K F        H   H    + P++C+ C K +     L  H +
Sbjct  459  LRIHTGEKPYKCDQCGKGFSANQSLMKHTLWHVDNNDRPFKCSQCPKAYDTQQSLRGHEK  518

Query  103  THTG-EKP---YQCEYCSKSFSVKENLSVHRRIHTKERPYKCDVCERAFEHSGKLHRHMR  158
            TH   ++P   +QC +C   F++K+ L  H   H K RP+ C  C   F     L +H+R
Sbjct  519  THKNPDEPKTLHQCPHCDVRFALKKTLDKHITSH-KIRPHPCPQCPEGFFSQKSLKKHLR  577

Query  159  IHT  161
            +H 
Sbjct  578  LHN  580


>M9PF60_DROME unnamed protein product
Length=571

 Score = 186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/228 (38%), Positives = 136/228 (60%), Gaps = 4/228 (2%)

Query  49   EKTYQCLLCQKVFDQKSLYQSHLRSHGKEGEDPYRCNICGKTFAVPARLTRHYRTHTGEK  108
            E+ ++C LC K +      +SH+ +H  + E  ++C  C KTF     L  H + HTGE+
Sbjct  285  ERPFKCPLCPKAYTHGPTLKSHMHTH--DEEKGHKCPQCDKTFYTRGNLRAHIQRHTGER  342

Query  109  PYQCEYCSKSFSVKENLSVHRRIHTKERPYKCDVCERAFEHSGKLHRHMRIHTGERPHKC  168
            PY+C  C ++F+    L +H R+H +ERP+KC++C + F  +  L  H+R+H G+R  KC
Sbjct  343  PYKCPDCPQTFAKNSGLKLHSRLHKEERPFKCELCGKGFVQNQHLITHLRVHNGDRQFKC  402

Query  169  TVCSKTFIQSGQLVIHMRTHTGEKPYVCKSCGKGFTCSKQLKVHTRTHTGEKPYTCDICG  228
              C K+F +   ++ H RTH+G KP+ C+ CG+ F+ +  LK H R HTGEKPY CD CG
Sbjct  403  PDCDKSFFEKSNMMKHQRTHSGIKPFKCEECGQAFSHNHHLKSHLRIHTGEKPYKCDQCG  462

Query  229  KSFGYNHVLKLHQVAHY--GEKVYKCTLCHETFGSKKTMELHIKTHSD  274
            K F  N  L  H + H    ++ +KC+ C + + +++++  H KTH +
Sbjct  463  KGFSANQSLMKHTLWHVDNNDRPFKCSQCPKAYDTQQSLRGHEKTHKN  510


 Score = 175 bits (443),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 86/228 (38%), Positives = 125/228 (55%), Gaps = 2/228 (1%)

Query  49   EKTYQCLLCQKVFDQKSLYQSHLRSHGKEGEDPYRCNICGKTFAVPARLTRHYRTHTGEK  108
            +K + C  C + F   +   +H R H   GE P++C +C K +     L  H  TH  EK
Sbjct  257  QKPHLCDFCGRGFRTNAQLTTHRRRH--TGERPFKCPLCPKAYTHGPTLKSHMHTHDEEK  314

Query  109  PYQCEYCSKSFSVKENLSVHRRIHTKERPYKCDVCERAFEHSGKLHRHMRIHTGERPHKC  168
             ++C  C K+F  + NL  H + HT ERPYKC  C + F  +  L  H R+H  ERP KC
Sbjct  315  GHKCPQCDKTFYTRGNLRAHIQRHTGERPYKCPDCPQTFAKNSGLKLHSRLHKEERPFKC  374

Query  169  TVCSKTFIQSGQLVIHMRTHTGEKPYVCKSCGKGFTCSKQLKVHTRTHTGEKPYTCDICG  228
             +C K F+Q+  L+ H+R H G++ + C  C K F     +  H RTH+G KP+ C+ CG
Sbjct  375  ELCGKGFVQNQHLITHLRVHNGDRQFKCPDCDKSFFEKSNMMKHQRTHSGIKPFKCEECG  434

Query  229  KSFGYNHVLKLHQVAHYGEKVYKCTLCHETFGSKKTMELHIKTHSDSS  276
            ++F +NH LK H   H GEK YKC  C + F + +++  H   H D++
Sbjct  435  QAFSHNHHLKSHLRIHTGEKPYKCDQCGKGFSANQSLMKHTLWHVDNN  482


 Score = 160 bits (406),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 77/194 (40%), Positives = 108/194 (56%), Gaps = 4/194 (2%)

Query  84   CNICGKTFAVPARLTRHYRTH----TGEKPYQCEYCSKSFSVKENLSVHRRIHTKERPYK  139
            C  CG +++    L RH   H      +KP+ C++C + F     L+ HRR HT ERP+K
Sbjct  230  CTECGVSYSTQKALARHVAKHKEQGDTQKPHLCDFCGRGFRTNAQLTTHRRRHTGERPFK  289

Query  140  CDVCERAFEHSGKLHRHMRIHTGERPHKCTVCSKTFIQSGQLVIHMRTHTGEKPYVCKSC  199
            C +C +A+ H   L  HM  H  E+ HKC  C KTF   G L  H++ HTGE+PY C  C
Sbjct  290  CPLCPKAYTHGPTLKSHMHTHDEEKGHKCPQCDKTFYTRGNLRAHIQRHTGERPYKCPDC  349

Query  200  GKGFTCSKQLKVHTRTHTGEKPYTCDICGKSFGYNHVLKLHQVAHYGEKVYKCTLCHETF  259
             + F  +  LK+H+R H  E+P+ C++CGK F  N  L  H   H G++ +KC  C ++F
Sbjct  350  PQTFAKNSGLKLHSRLHKEERPFKCELCGKGFVQNQHLITHLRVHNGDRQFKCPDCDKSF  409

Query  260  GSKKTMELHIKTHS  273
              K  M  H +THS
Sbjct  410  FEKSNMMKHQRTHS  423


 Score = 119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 73/207 (35%), Positives = 106/207 (51%), Gaps = 9/207 (4%)

Query  48   EEKTYQCLLCQKVFDQKSLYQSHLRSHGKEGEDPYRCNICGKTFAVPARLTRHYRTHTGE  107
            EE+ ++C LC K F Q     +HLR H   G+  ++C  C K+F   + + +H RTH+G 
Sbjct  368  EERPFKCELCGKGFVQNQHLITHLRVHN--GDRQFKCPDCDKSFFEKSNMMKHQRTHSGI  425

Query  108  KPYQCEYCSKSFSVKENLSVHRRIHTKERPYKCDVCERAFEHSGKLHRHMRIH--TGERP  165
            KP++CE C ++FS   +L  H RIHT E+PYKCD C + F  +  L +H   H    +RP
Sbjct  426  KPFKCEECGQAFSHNHHLKSHLRIHTGEKPYKCDQCGKGFSANQSLMKHTLWHVDNNDRP  485

Query  166  HKCTVCSKTFIQSGQLVIHMRTHTG-EKP---YVCKSCGKGFTCSKQLKVHTRTHTGEKP  221
             KC+ C K +     L  H +TH   ++P   + C  C   F   K L  H  +H   +P
Sbjct  486  FKCSQCPKAYDTQQSLRGHEKTHKNPDEPKTLHQCPHCDVRFALKKTLDKHITSHKI-RP  544

Query  222  YTCDICGKSFGYNHVLKLHQVAHYGEK  248
            + C  C + F     LK H   H  +K
Sbjct  545  HPCPQCPEGFFSQKSLKKHLRLHNLKK  571


 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 68/139 (49%), Gaps = 4/139 (3%)

Query  140  CDVCERAFEHSGKLHRHMRIH----TGERPHKCTVCSKTFIQSGQLVIHMRTHTGEKPYV  195
            C  C  ++     L RH+  H      ++PH C  C + F  + QL  H R HTGE+P+ 
Sbjct  230  CTECGVSYSTQKALARHVAKHKEQGDTQKPHLCDFCGRGFRTNAQLTTHRRRHTGERPFK  289

Query  196  CKSCGKGFTCSKQLKVHTRTHTGEKPYTCDICGKSFGYNHVLKLHQVAHYGEKVYKCTLC  255
            C  C K +T    LK H  TH  EK + C  C K+F     L+ H   H GE+ YKC  C
Sbjct  290  CPLCPKAYTHGPTLKSHMHTHDEEKGHKCPQCDKTFYTRGNLRAHIQRHTGERPYKCPDC  349

Query  256  HETFGSKKTMELHIKTHSD  274
             +TF     ++LH + H +
Sbjct  350  PQTFAKNSGLKLHSRLHKE  368


 Score = 59.3 bits (142),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 56/123 (46%), Gaps = 5/123 (4%)

Query  43   LSANVEEKTYQCLLCQKVFDQKSLYQSHLRSHGKEGEDPYRCNICGKTFAVPARLTRHYR  102
            L  +  EK Y+C  C K F        H   H    + P++C+ C K +     L  H +
Sbjct  447  LRIHTGEKPYKCDQCGKGFSANQSLMKHTLWHVDNNDRPFKCSQCPKAYDTQQSLRGHEK  506

Query  103  THTG-EKP---YQCEYCSKSFSVKENLSVHRRIHTKERPYKCDVCERAFEHSGKLHRHMR  158
            TH   ++P   +QC +C   F++K+ L  H   H K RP+ C  C   F     L +H+R
Sbjct  507  THKNPDEPKTLHQCPHCDVRFALKKTLDKHITSH-KIRPHPCPQCPEGFFSQKSLKKHLR  565

Query  159  IHT  161
            +H 
Sbjct  566  LHN  568


>Q8MRK4_DROME unnamed protein product
Length=878

 Score = 189 bits (479),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 100/253 (40%), Positives = 136/253 (54%), Gaps = 3/253 (1%)

Query  25   LVCSPDLSVFTPACSGET-LSANVEEKTYQCLLCQKVFDQKSLYQSHLRSHGKEGEDPYR  83
              C    +VF    S E  +  +  +K + C +CQK F +K    +H RSH   GE P+R
Sbjct  277  FTCIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRSH--TGETPFR  334

Query  84   CNICGKTFAVPARLTRHYRTHTGEKPYQCEYCSKSFSVKENLSVHRRIHTKERPYKCDVC  143
            C  C KTF     +  H R HTGE P++C+ C KSF+ KE+   H   HT E P++CD C
Sbjct  335  CQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHYMWHTGETPHRCDFC  394

Query  144  ERAFEHSGKLHRHMRIHTGERPHKCTVCSKTFIQSGQLVIHMRTHTGEKPYVCKSCGKGF  203
             + F     L  H+R HTGE PH+C+ C KTF +   LV H+R HTGE P+ C  C K F
Sbjct  395  SKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGESPHKCTYCTKTF  454

Query  204  TCSKQLKVHTRTHTGEKPYTCDICGKSFGYNHVLKLHQVAHYGEKVYKCTLCHETFGSKK  263
            T  + L  H R HTG+ P+ C  C K+F     L  H   H G+  +KC  C +TF  K+
Sbjct  455  TRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKE  514

Query  264  TMELHIKTHSDSS  276
             +  H++ HS  +
Sbjct  515  HLNNHMRQHSSDN  527


 Score = 179 bits (455),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 93/235 (40%), Positives = 138/235 (59%), Gaps = 8/235 (3%)

Query  49   EKTYQCLLCQKVFDQKSLYQSHLRSHGKEGEDPYRCNICGKTFAVPARLTRHYRTHTGEK  108
            E  ++C  C K F +K    +H+R H   GE P++C  C KTF     LT H R HTG+ 
Sbjct  414  ESPHRCSYCMKTFTRKEHLVNHIRQH--TGESPHKCTYCTKTFTRKEHLTNHVRQHTGDS  471

Query  109  PYQCEYCSKSFSVKENLSVHRRIHTKERPYKCDVCERAFEHSGKLHRHMRIHTGERPHKC  168
            P++C YC K+F+ KE+L+ H R+HT + P+KC+ C++ F     L+ HMR H+ + PH C
Sbjct  472  PHRCSYCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCC  531

Query  169  TVCSKTFIQSGQLVIHM-RTHTGEKPYVCKSCGKGFTCSKQLKVHTRTHTG----EKPYT  223
             VC+K F +   L+ HM R HTG++P+ C++CGK F     L  H R+HT     E+P+ 
Sbjct  532  NVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFA  591

Query  224  CDICGKSFGYNHVLKLHQVAHYGEKVYKCTLCHETFGSKKTMELHIK-THSDSSV  277
            C+ C K+F     L  H  +H GEK + CTLC + F  +  ++ H+K  H D+ +
Sbjct  592  CEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSKAFVERGNLKRHMKMNHPDAMM  646


 Score = 174 bits (441),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 89/227 (39%), Positives = 128/227 (56%), Gaps = 2/227 (1%)

Query  43   LSANVEEKTYQCLLCQKVFDQKSLYQSHLRSHGKEGEDPYRCNICGKTFAVPARLTRHYR  102
              ++  E  ++C  C K F +K    +H+R H   GE P+RC+IC K+F        HY 
Sbjct  324  FRSHTGETPFRCQYCAKTFTRKEHMVNHVRKH--TGETPHRCDICKKSFTRKEHYVNHYM  381

Query  103  THTGEKPYQCEYCSKSFSVKENLSVHRRIHTKERPYKCDVCERAFEHSGKLHRHMRIHTG  162
             HTGE P++C++CSK+F+ KE+L  H R HT E P++C  C + F     L  H+R HTG
Sbjct  382  WHTGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTG  441

Query  163  ERPHKCTVCSKTFIQSGQLVIHMRTHTGEKPYVCKSCGKGFTCSKQLKVHTRTHTGEKPY  222
            E PHKCT C+KTF +   L  H+R HTG+ P+ C  C K FT  + L  H R HTG+ P+
Sbjct  442  ESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRLHTGDSPH  501

Query  223  TCDICGKSFGYNHVLKLHQVAHYGEKVYKCTLCHETFGSKKTMELHI  269
             C+ C K+F     L  H   H  +  + C +C++ F  K+ +  H+
Sbjct  502  KCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHM  548


 Score = 157 bits (396),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 85/229 (37%), Positives = 118/229 (52%), Gaps = 2/229 (1%)

Query  48   EEKTYQCLLCQKVFDQKSLYQSHLRSHGKEGEDPYRCNICGKTFAVPARLTRHYRTHTGE  107
            E K + C +C + F        H + H   G   + C +C   FA    L RH + H+ +
Sbjct  245  ERKPFMCQVCGQGFTTSQDLTRHGKIH--IGGPMFTCIVCFNVFANNTSLERHMKRHSTD  302

Query  108  KPYQCEYCSKSFSVKENLSVHRRIHTKERPYKCDVCERAFEHSGKLHRHMRIHTGERPHK  167
            KP+ C  C K+F+ KE+L  H R HT E P++C  C + F     +  H+R HTGE PH+
Sbjct  303  KPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEHMVNHVRKHTGETPHR  362

Query  168  CTVCSKTFIQSGQLVIHMRTHTGEKPYVCKSCGKGFTCSKQLKVHTRTHTGEKPYTCDIC  227
            C +C K+F +    V H   HTGE P+ C  C K FT  + L  H R HTGE P+ C  C
Sbjct  363  CDICKKSFTRKEHYVNHYMWHTGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYC  422

Query  228  GKSFGYNHVLKLHQVAHYGEKVYKCTLCHETFGSKKTMELHIKTHSDSS  276
             K+F     L  H   H GE  +KCT C +TF  K+ +  H++ H+  S
Sbjct  423  MKTFTRKEHLVNHIRQHTGESPHKCTYCTKTFTRKEHLTNHVRQHTGDS  471


 Score = 151 bits (382),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 74/193 (38%), Positives = 109/193 (56%), Gaps = 0/193 (0%)

Query  84   CNICGKTFAVPARLTRHYRTHTGEKPYQCEYCSKSFSVKENLSVHRRIHTKERPYKCDVC  143
            C+ICGK F    +L  H R H+  KP+ C+ C + F+  ++L+ H +IH     + C VC
Sbjct  223  CDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTCIVC  282

Query  144  ERAFEHSGKLHRHMRIHTGERPHKCTVCSKTFIQSGQLVIHMRTHTGEKPYVCKSCGKGF  203
               F ++  L RHM+ H+ ++P  CT+C KTF +   L  H R+HTGE P+ C+ C K F
Sbjct  283  FNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYCAKTF  342

Query  204  TCSKQLKVHTRTHTGEKPYTCDICGKSFGYNHVLKLHQVAHYGEKVYKCTLCHETFGSKK  263
            T  + +  H R HTGE P+ CDIC KSF        H + H GE  ++C  C +TF  K+
Sbjct  343  TRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHYMWHTGETPHRCDFCSKTFTRKE  402

Query  264  TMELHIKTHSDSS  276
             +  H++ H+  S
Sbjct  403  HLLNHVRQHTGES  415


 Score = 88.6 bits (218),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 64/111 (58%), Gaps = 0/111 (0%)

Query  166  HKCTVCSKTFIQSGQLVIHMRTHTGEKPYVCKSCGKGFTCSKQLKVHTRTHTGEKPYTCD  225
            H C +C K F    QL++H R H+  KP++C+ CG+GFT S+ L  H + H G   +TC 
Sbjct  221  HVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTCI  280

Query  226  ICGKSFGYNHVLKLHQVAHYGEKVYKCTLCHETFGSKKTMELHIKTHSDSS  276
            +C   F  N  L+ H   H  +K + CT+C +TF  K+ ++ H ++H+  +
Sbjct  281  VCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRSHTGET  331


>M9PCY3_DROME unnamed protein product
Length=878

 Score = 188 bits (478),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 100/253 (40%), Positives = 138/253 (55%), Gaps = 3/253 (1%)

Query  25   LVCSPDLSVFTPACSGET-LSANVEEKTYQCLLCQKVFDQKSLYQSHLRSHGKEGEDPYR  83
              C    +VF    S E  +  +  +K + C +CQK F +K    +H RSH   GE P+R
Sbjct  277  FTCIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRSH--TGETPFR  334

Query  84   CNICGKTFAVPARLTRHYRTHTGEKPYQCEYCSKSFSVKENLSVHRRIHTKERPYKCDVC  143
            C  C KTF     +  H R HTGE P++C++CSK+F+ KE+L  H R HT E P++C  C
Sbjct  335  CQYCAKTFTRKEHMVNHVRKHTGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYC  394

Query  144  ERAFEHSGKLHRHMRIHTGERPHKCTVCSKTFIQSGQLVIHMRTHTGEKPYVCKSCGKGF  203
             + F     L  H+R HTGE P KCT C+K F +   +V H+R HTGE P+ C  C K F
Sbjct  395  MKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTF  454

Query  204  TCSKQLKVHTRTHTGEKPYTCDICGKSFGYNHVLKLHQVAHYGEKVYKCTLCHETFGSKK  263
            T  + L  H R HTG+ P+ C  C K+F     L  H   H G+  +KC  C +TF  K+
Sbjct  455  TRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKE  514

Query  264  TMELHIKTHSDSS  276
             +  H++ HS  +
Sbjct  515  HLNNHMRQHSSDN  527


 Score = 180 bits (457),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 93/235 (40%), Positives = 138/235 (59%), Gaps = 8/235 (3%)

Query  49   EKTYQCLLCQKVFDQKSLYQSHLRSHGKEGEDPYRCNICGKTFAVPARLTRHYRTHTGEK  108
            E  ++C  C K F +K    +H+R H   GE P++C  C KTF     LT H R HTG+ 
Sbjct  414  ETPFKCTYCTKAFTRKDHMVNHVRQH--TGESPHKCTYCTKTFTRKEHLTNHVRQHTGDS  471

Query  109  PYQCEYCSKSFSVKENLSVHRRIHTKERPYKCDVCERAFEHSGKLHRHMRIHTGERPHKC  168
            P++C YC K+F+ KE+L+ H R+HT + P+KC+ C++ F     L+ HMR H+ + PH C
Sbjct  472  PHRCSYCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCC  531

Query  169  TVCSKTFIQSGQLVIHM-RTHTGEKPYVCKSCGKGFTCSKQLKVHTRTHTG----EKPYT  223
             VC+K F +   L+ HM R HTG++P+ C++CGK F     L  H R+HT     E+P+ 
Sbjct  532  NVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFA  591

Query  224  CDICGKSFGYNHVLKLHQVAHYGEKVYKCTLCHETFGSKKTMELHIK-THSDSSV  277
            C+ C K+F     L  H  +H GEK + CTLC + F  +  ++ H+K  H D+ +
Sbjct  592  CEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSKAFVERGNLKRHMKMNHPDAMM  646


 Score = 177 bits (449),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 91/227 (40%), Positives = 127/227 (56%), Gaps = 2/227 (1%)

Query  43   LSANVEEKTYQCLLCQKVFDQKSLYQSHLRSHGKEGEDPYRCNICGKTFAVPARLTRHYR  102
              ++  E  ++C  C K F +K    +H+R H   GE P+RC+ C KTF     L  H R
Sbjct  324  FRSHTGETPFRCQYCAKTFTRKEHMVNHVRKH--TGETPHRCDFCSKTFTRKEHLLNHVR  381

Query  103  THTGEKPYQCEYCSKSFSVKENLSVHRRIHTKERPYKCDVCERAFEHSGKLHRHMRIHTG  162
             HTGE P++C YC K+F+ KE+L  H R HT E P+KC  C +AF     +  H+R HTG
Sbjct  382  QHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTRKDHMVNHVRQHTG  441

Query  163  ERPHKCTVCSKTFIQSGQLVIHMRTHTGEKPYVCKSCGKGFTCSKQLKVHTRTHTGEKPY  222
            E PHKCT C+KTF +   L  H+R HTG+ P+ C  C K FT  + L  H R HTG+ P+
Sbjct  442  ESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRLHTGDSPH  501

Query  223  TCDICGKSFGYNHVLKLHQVAHYGEKVYKCTLCHETFGSKKTMELHI  269
             C+ C K+F     L  H   H  +  + C +C++ F  K+ +  H+
Sbjct  502  KCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHM  548


 Score = 162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 87/229 (38%), Positives = 121/229 (53%), Gaps = 2/229 (1%)

Query  48   EEKTYQCLLCQKVFDQKSLYQSHLRSHGKEGEDPYRCNICGKTFAVPARLTRHYRTHTGE  107
            E K + C +C + F        H + H   G   + C +C   FA    L RH + H+ +
Sbjct  245  ERKPFMCQVCGQGFTTSQDLTRHGKIH--IGGPMFTCIVCFNVFANNTSLERHMKRHSTD  302

Query  108  KPYQCEYCSKSFSVKENLSVHRRIHTKERPYKCDVCERAFEHSGKLHRHMRIHTGERPHK  167
            KP+ C  C K+F+ KE+L  H R HT E P++C  C + F     +  H+R HTGE PH+
Sbjct  303  KPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEHMVNHVRKHTGETPHR  362

Query  168  CTVCSKTFIQSGQLVIHMRTHTGEKPYVCKSCGKGFTCSKQLKVHTRTHTGEKPYTCDIC  227
            C  CSKTF +   L+ H+R HTGE P+ C  C K FT  + L  H R HTGE P+ C  C
Sbjct  363  CDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGETPFKCTYC  422

Query  228  GKSFGYNHVLKLHQVAHYGEKVYKCTLCHETFGSKKTMELHIKTHSDSS  276
             K+F     +  H   H GE  +KCT C +TF  K+ +  H++ H+  S
Sbjct  423  TKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQHTGDS  471


 Score = 149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/193 (38%), Positives = 109/193 (56%), Gaps = 0/193 (0%)

Query  84   CNICGKTFAVPARLTRHYRTHTGEKPYQCEYCSKSFSVKENLSVHRRIHTKERPYKCDVC  143
            C+ICGK F    +L  H R H+  KP+ C+ C + F+  ++L+ H +IH     + C VC
Sbjct  223  CDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTCIVC  282

Query  144  ERAFEHSGKLHRHMRIHTGERPHKCTVCSKTFIQSGQLVIHMRTHTGEKPYVCKSCGKGF  203
               F ++  L RHM+ H+ ++P  CT+C KTF +   L  H R+HTGE P+ C+ C K F
Sbjct  283  FNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYCAKTF  342

Query  204  TCSKQLKVHTRTHTGEKPYTCDICGKSFGYNHVLKLHQVAHYGEKVYKCTLCHETFGSKK  263
            T  + +  H R HTGE P+ CD C K+F     L  H   H GE  ++C+ C +TF  K+
Sbjct  343  TRKEHMVNHVRKHTGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKE  402

Query  264  TMELHIKTHSDSS  276
             +  HI+ H+  +
Sbjct  403  HLVNHIRQHTGET  415


 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 64/111 (58%), Gaps = 0/111 (0%)

Query  166  HKCTVCSKTFIQSGQLVIHMRTHTGEKPYVCKSCGKGFTCSKQLKVHTRTHTGEKPYTCD  225
            H C +C K F    QL++H R H+  KP++C+ CG+GFT S+ L  H + H G   +TC 
Sbjct  221  HVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTCI  280

Query  226  ICGKSFGYNHVLKLHQVAHYGEKVYKCTLCHETFGSKKTMELHIKTHSDSS  276
            +C   F  N  L+ H   H  +K + CT+C +TF  K+ ++ H ++H+  +
Sbjct  281  VCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRSHTGET  331



Lambda      K        H
   0.324    0.138    0.456 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3617638992


Query= NP_001267853.1 feminizer [Bombus terrestris]

Length=416
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TRSF_MUSDO  unnamed protein product                                   38.9    0.007


>TRSF_MUSDO unnamed protein product
Length=367

 Score = 38.9 bits (89),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 30/105 (29%), Positives = 50/105 (48%), Gaps = 22/105 (21%)

Query  159  DIINPEDVLVKRGEGEGSKPIFEREEIKGTTVKADEIVERRTV-------------VVLN  205
            D+I  E++ +KR  GEG+KP+FER+++K  TV   E +  + +              ++ 
Sbjct  53   DLI--EEIQIKRRFGEGTKPLFERDDVKVNTVADGESISSKKIKSHKASSPSKGVNGLVK  110

Query  206  NENLESKSKVNKKYTTSSRNRSPSPRHRSSRHARYEDSKYDNRDS  250
              + +   K  KKY +S      +P  R  RH+ YE   Y   +S
Sbjct  111  QNSPDVTQKFTKKYGSSE-----NPDFR--RHSSYEKDNYHKSNS  148



Lambda      K        H
   0.324    0.138    0.456 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3617638992


Query= NP_001267855.1 isopentenyl-diphosphate Delta-isomerase 1-like
[Bombus terrestris]

Length=241
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9NGX3_DROME  unnamed protein product                                 28.5    4.8  
Q8T8Y5_DROME  unnamed protein product                                 28.5    5.1  


>Q9NGX3_DROME unnamed protein product
Length=313

 Score = 28.5 bits (62),  Expect = 4.8, Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 36/82 (44%), Gaps = 10/82 (12%)

Query  78   KGELLLQKRSPNKITFPNRYTNTCCSHPLFEI---PEETEEHEALGIRKAARRRLNFELG  134
            + E LLQ ++  K +FP     T  S  L E+   P+ET       +  A  R+L++ +G
Sbjct  37   QSERLLQAQNRRKFSFPA----TLHSASLLEVGGGPKETTRRRLSNVSDAVTRKLSYTIG  92

Query  135  IPLSQILLSDFFYLTRI---HY  153
               +QI   D     R    HY
Sbjct  93   WKAAQIPAQDIISQGRCLCGHY  114


>Q8T8Y5_DROME unnamed protein product
Length=299

 Score = 28.5 bits (62),  Expect = 5.1, Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 36/82 (44%), Gaps = 10/82 (12%)

Query  78   KGELLLQKRSPNKITFPNRYTNTCCSHPLFEI---PEETEEHEALGIRKAARRRLNFELG  134
            + E LLQ ++  K +FP     T  S  L E+   P+ET       +  A  R+L++ +G
Sbjct  23   QSERLLQAQNRRKFSFPA----TLHSASLLEVGGGPKETTRRRLSNVSDAVTRKLSYTIG  78

Query  135  IPLSQILLSDFFYLTRI---HY  153
               +QI   D     R    HY
Sbjct  79   WKAAQIPAQDIISQGRCLCGHY  100



Lambda      K        H
   0.324    0.138    0.456 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3617638992


Query= NP_001267859.1 mevalonate kinase [Bombus terrestris]

Length=380
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q65XX8_CAEEL  unnamed protein product                                 132     2e-34
Q65XY0_CAEEL  unnamed protein product                                 133     2e-34
Q65XX9_CAEEL  unnamed protein product                                 132     1e-33
Q9N4Z7_CAEEL  unnamed protein product                                 89.7    3e-19
Q57Y11_TRYB2  unnamed protein product                                 83.2    1e-17


>Q65XX8_CAEEL unnamed protein product
Length=484

 Score = 132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 84/294 (29%), Positives = 153/294 (52%), Gaps = 36/294 (12%)

Query  6    VSAPGKVILFGEHAVVYGKTAVAASVDLRTVLNFAELPETEQIVKICFPKVNLFINIPLQ  65
            VSAPGK+ILFGEHAVVYG+TA+A S+DLRT ++     +             +++++P  
Sbjct  14   VSAPGKIILFGEHAVVYGRTAIAGSIDLRTYVSLYTSADGR-----------IYLSLPDL  62

Query  66   QIQNFFFINKDMVHVENYEAFYNKVKE--------FVSIISYANLQ-------QRLSLEA  110
             ++  + + KD++   +  A    ++E         V I    +         Q L++ A
Sbjct  63   GVEKTWML-KDLLKAADRLAAEYPIEEDQPPSLEILVPIARKLSGSCEDQCGVQHLAILA  121

Query  111  FFYLFIYITQKEEIEVKPFQVHLNTELGIGSGLGSSSSFAVCLAACFLHWSRLQKDIYKI  170
            F+YL + +  ++  ++   +  +  +L    GLGSS ++ VC+A   L  + L      +
Sbjct  122  FWYLLLGVAHRKR-DLLAVKATVRFKLPSCVGLGSSGAYCVCIATSLLQTAGLIPPPSIV  180

Query  171  LDF--------SILDTISKYALNCEKIMHGNPSGIDNSVCTYGSIIEFKKDDYVKPISNV  222
             D           LD I K+A   E ++HG  SG+D +VCT+G +  FK    ++ + N+
Sbjct  181  ADEQGNLTWEEDHLDIIRKWATAAESLIHGRASGLDAAVCTFGGVASFKPGHRIEHLKNL  240

Query  223  HALKILLVDTRVNRSTKALVERLLELKHRYPVIIDLIMSSIDNIAKEVIKIIEK  276
              L+++LV+++V R+T  +V+ + E   ++P ++D +  SID I+ +  KI+ +
Sbjct  241  PDLRVILVNSKVERNTARMVQTVKERLKKFPEVVDAMFGSIDAISLDAAKILHR  294


 Score = 63.5 bits (153),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 45/87 (52%), Gaps = 0/87 (0%)

Query  291  YRQLMILINMNQGLLATCQVSHPSLDRICAEAQNYALAAKLTGAGGGGHAYILLLPDTQP  350
            + +L  L  +N  LL    V HP +D IC     Y +  K+TGAGGGG  +  L P+T  
Sbjct  371  FSKLNDLCRINNQLLIALGVGHPKVDLICTTLARYGIHPKMTGAGGGGSVFAFLKPNTPQ  430

Query  351  ETIASISRKLIADGFTVKLTTLGGPGV  377
              +  I  +L + GF V    LGGPGV
Sbjct  431  TLLDMIDGELRSHGFEVWQPPLGGPGV  457


>Q65XY0_CAEEL unnamed protein product
Length=514

 Score = 133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 84/294 (29%), Positives = 153/294 (52%), Gaps = 36/294 (12%)

Query  6    VSAPGKVILFGEHAVVYGKTAVAASVDLRTVLNFAELPETEQIVKICFPKVNLFINIPLQ  65
            VSAPGK+ILFGEHAVVYG+TA+A S+DLRT ++     +             +++++P  
Sbjct  44   VSAPGKIILFGEHAVVYGRTAIAGSIDLRTYVSLYTSADGR-----------IYLSLPDL  92

Query  66   QIQNFFFINKDMVHVENYEAFYNKVKE--------FVSIISYANLQ-------QRLSLEA  110
             ++  + + KD++   +  A    ++E         V I    +         Q L++ A
Sbjct  93   GVEKTWML-KDLLKAADRLAAEYPIEEDQPPSLEILVPIARKLSGSCEDQCGVQHLAILA  151

Query  111  FFYLFIYITQKEEIEVKPFQVHLNTELGIGSGLGSSSSFAVCLAACFLHWSRLQKDIYKI  170
            F+YL + +  ++  ++   +  +  +L    GLGSS ++ VC+A   L  + L      +
Sbjct  152  FWYLLLGVAHRKR-DLLAVKATVRFKLPSCVGLGSSGAYCVCIATSLLQTAGLIPPPSIV  210

Query  171  LDFSI--------LDTISKYALNCEKIMHGNPSGIDNSVCTYGSIIEFKKDDYVKPISNV  222
             D           LD I K+A   E ++HG  SG+D +VCT+G +  FK    ++ + N+
Sbjct  211  ADEQGNLTWEEDHLDIIRKWATAAESLIHGRASGLDAAVCTFGGVASFKPGHRIEHLKNL  270

Query  223  HALKILLVDTRVNRSTKALVERLLELKHRYPVIIDLIMSSIDNIAKEVIKIIEK  276
              L+++LV+++V R+T  +V+ + E   ++P ++D +  SID I+ +  KI+ +
Sbjct  271  PDLRVILVNSKVERNTARMVQTVKERLKKFPEVVDAMFGSIDAISLDAAKILHR  324


 Score = 63.2 bits (152),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 45/87 (52%), Gaps = 0/87 (0%)

Query  291  YRQLMILINMNQGLLATCQVSHPSLDRICAEAQNYALAAKLTGAGGGGHAYILLLPDTQP  350
            + +L  L  +N  LL    V HP +D IC     Y +  K+TGAGGGG  +  L P+T  
Sbjct  401  FSKLNDLCRINNQLLIALGVGHPKVDLICTTLARYGIHPKMTGAGGGGSVFAFLKPNTPQ  460

Query  351  ETIASISRKLIADGFTVKLTTLGGPGV  377
              +  I  +L + GF V    LGGPGV
Sbjct  461  TLLDMIDGELRSHGFEVWQPPLGGPGV  487


>Q65XX9_CAEEL unnamed protein product
Length=614

 Score = 132 bits (332),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 84/294 (29%), Positives = 153/294 (52%), Gaps = 36/294 (12%)

Query  6    VSAPGKVILFGEHAVVYGKTAVAASVDLRTVLNFAELPETEQIVKICFPKVNLFINIPLQ  65
            VSAPGK+ILFGEHAVVYG+TA+A S+DLRT ++     +             +++++P  
Sbjct  144  VSAPGKIILFGEHAVVYGRTAIAGSIDLRTYVSLYTSADG-----------RIYLSLPDL  192

Query  66   QIQNFFFINKDMVHVENYEAFYNKVKE--------FVSIISYANLQ-------QRLSLEA  110
             ++  + + KD++   +  A    ++E         V I    +         Q L++ A
Sbjct  193  GVEKTWML-KDLLKAADRLAAEYPIEEDQPPSLEILVPIARKLSGSCEDQCGVQHLAILA  251

Query  111  FFYLFIYITQKEEIEVKPFQVHLNTELGIGSGLGSSSSFAVCLAACFLHWSRLQKDIYKI  170
            F+YL + +  ++  ++   +  +  +L    GLGSS ++ VC+A   L  + L      +
Sbjct  252  FWYLLLGVAHRKR-DLLAVKATVRFKLPSCVGLGSSGAYCVCIATSLLQTAGLIPPPSIV  310

Query  171  LDF--------SILDTISKYALNCEKIMHGNPSGIDNSVCTYGSIIEFKKDDYVKPISNV  222
             D           LD I K+A   E ++HG  SG+D +VCT+G +  FK    ++ + N+
Sbjct  311  ADEQGNLTWEEDHLDIIRKWATAAESLIHGRASGLDAAVCTFGGVASFKPGHRIEHLKNL  370

Query  223  HALKILLVDTRVNRSTKALVERLLELKHRYPVIIDLIMSSIDNIAKEVIKIIEK  276
              L+++LV+++V R+T  +V+ + E   ++P ++D +  SID I+ +  KI+ +
Sbjct  371  PDLRVILVNSKVERNTARMVQTVKERLKKFPEVVDAMFGSIDAISLDAAKILHR  424


 Score = 63.9 bits (154),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 45/87 (52%), Gaps = 0/87 (0%)

Query  291  YRQLMILINMNQGLLATCQVSHPSLDRICAEAQNYALAAKLTGAGGGGHAYILLLPDTQP  350
            + +L  L  +N  LL    V HP +D IC     Y +  K+TGAGGGG  +  L P+T  
Sbjct  501  FSKLNDLCRINNQLLIALGVGHPKVDLICTTLARYGIHPKMTGAGGGGSVFAFLKPNTPQ  560

Query  351  ETIASISRKLIADGFTVKLTTLGGPGV  377
              +  I  +L + GF V    LGGPGV
Sbjct  561  TLLDMIDGELRSHGFEVWQPPLGGPGV  587


>Q9N4Z7_CAEEL unnamed protein product
Length=607

 Score = 89.7 bits (221),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 80/143 (56%), Gaps = 8/143 (6%)

Query  142  GLGSSSSFAVCLAACFLHWSRLQKDIYKILDFSI--------LDTISKYALNCEKIMHGN  193
            GLGSS ++ VC+A   L  + L      + D           LD I K+A   E ++HG 
Sbjct  275  GLGSSGAYCVCIATSLLQTAGLIPPPSIVADEQGNLTWEEDHLDIIRKWATAAESLIHGR  334

Query  194  PSGIDNSVCTYGSIIEFKKDDYVKPISNVHALKILLVDTRVNRSTKALVERLLELKHRYP  253
             SG+D +VCT+G +  FK    ++ + N+  L+++LV+++V R+T  +V+ + E   ++P
Sbjct  335  ASGLDAAVCTFGGVASFKPGHRIEHLKNLPDLRVILVNSKVERNTARMVQTVKERLKKFP  394

Query  254  VIIDLIMSSIDNIAKEVIKIIEK  276
             ++D +  SID I+ +  KI+ +
Sbjct  395  EVVDAMFGSIDAISLDAAKILHR  417


 Score = 62.8 bits (151),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 45/87 (52%), Gaps = 0/87 (0%)

Query  291  YRQLMILINMNQGLLATCQVSHPSLDRICAEAQNYALAAKLTGAGGGGHAYILLLPDTQP  350
            + +L  L  +N  LL    V HP +D IC     Y +  K+TGAGGGG  +  L P+T  
Sbjct  494  FSKLNDLCRINNQLLIALGVGHPKVDLICTTLARYGIHPKMTGAGGGGSVFAFLKPNTPQ  553

Query  351  ETIASISRKLIADGFTVKLTTLGGPGV  377
              +  I  +L + GF V    LGGPGV
Sbjct  554  TLLDMIDGELRSHGFEVWQPPLGGPGV  580


 Score = 58.9 bits (141),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 31/34 (91%), Gaps = 0/34 (0%)

Query  6   VSAPGKVILFGEHAVVYGKTAVAASVDLRTVLNF  39
           VSAPGK+ILFGEHAVVYG+TA+A S+DLRT ++ 
Sbjct  44  VSAPGKIILFGEHAVVYGRTAIAGSIDLRTYVSL  77


>Q57Y11_TRYB2 unnamed protein product
Length=329

 Score = 83.2 bits (204),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 91/354 (26%), Positives = 143/354 (40%), Gaps = 65/354 (18%)

Query  10   GKVILFGEHAVVYGKTAVAASVDLRTVLNFAELPETEQIVKICFPKVNLFINIPLQQIQN  69
            GKVILFGEH VVYG  ++ A ++  T    + L     +V++                  
Sbjct  17   GKVILFGEHFVVYGAESIVAGINEYTTCEISRLKHKPNVVEV------------------  58

Query  70   FFFINKDMVHVENYEAFYNKVKEFVSIISYANLQQRLSLEAFFYLFIYITQKEEIEVKPF  129
                      ++   A    +KE          +QR++           T K+ + VK  
Sbjct  59   ----------IDERPAVPGYIKE-------KREEQRVAHGLVLRHLNIDTSKDGLLVK--  99

Query  130  QVHLNTELGIGSGLGSSSSFAVCLAACFLHWSRLQKDIYKILDFSILDTISKYALNCEKI  189
               L   L   SG+G+S+S  V L       SR   ++Y  L+ S  + +++ A   E  
Sbjct  100  ---LGGPLVPSSGIGASASDVVSL-------SRALNELYS-LNLS-EEAVNRSAYAGECG  147

Query  190  MHGNPSGIDNSVCTYGSIIEFK---KDDYVKPISNVHALKILLVDTRVNRSTKALVERLL  246
             HG PSG+DN+  TYG II F+   K      ++    L I++  T +  ST  +V  + 
Sbjct  148  YHGTPSGVDNTAATYGGIILFRRALKKSVFSRLALGKTLSIIVCSTGITASTTKVVADVA  207

Query  247  ELKHRYPVIIDLIMSSIDNIAKEVIKIIEKLKTVSTDDEYFLEGYRQLMILINMNQGLLA  306
             LK   P   D +    +   +E  K ++                R++  L+N+N  L  
Sbjct  208  RLKAAQPSWFDDLFEQYNACVREAKKALQS------------GNLRRVGELMNINHTLCQ  255

Query  307  TCQVSHPSLDRICAEAQNY-ALAAKLTGAGGGGHAYILLLPDTQPETIASISRK  359
               VS P LD I    + + AL AK++G G GG    L     + + IA   R+
Sbjct  256  KLTVSCPELDAIATCCRTFGALGAKMSGTGRGGLVVALAANTQERDRIAKAVRE  309



Lambda      K        H
   0.324    0.138    0.456 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3617638992


Query= NP_001267862.1 acetyl-CoA acetyltransferase [Bombus terrestris]

Length=394
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9W3N9_DROME  unnamed protein product                                 310     7e-103
THIL1_DICDI  unnamed protein product                                  305     8e-101
THILH_CAEEL  unnamed protein product                                  296     3e-97 
Q9W1H8_DROME  unnamed protein product                                 186     3e-54 
O77466_DROME  unnamed protein product                                 184     1e-53 


>Q9W3N9_DROME unnamed protein product
Length=410

 Score = 310 bits (795),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 169/391 (43%), Positives = 249/391 (64%), Gaps = 7/391 (2%)

Query  5    DVVIISAVRTPIGSFCGSLSSLKASDLGSIVIKESLERAHIKPVDVSEVILGQVLTAGQG  64
            +VV++SA RTPIGSF   L+ L A+ LG+  I+ ++E+A I   DV EVI+G V++AG G
Sbjct  24   EVVVVSAARTPIGSFQSQLAPLTATQLGARAIEAAIEKAGIAKTDVQEVIMGNVVSAGLG  83

Query  65   QNPARQAAMKAGLPISVPAYLINMLCGSGLKAVLNGYLSIKAGENQIVVAGGQESMSQSC  124
            Q PARQAA+ AGLP +V    +N +C SG+KAV+ G  S+  G   +VVAGG ESMS   
Sbjct  84   QAPARQAAIFAGLPTNVCCTTVNKVCSSGMKAVMLGAQSLMLGYADVVVAGGMESMSNVP  143

Query  125  HVLHLRKGVKIGDCNLMDTLLIDGLIDAFHGIHMGVTAENISKDYTVSRKEQDEYAAKSQ  184
            + L  R     G  NL D ++ DGL D ++  HMG  AEN +K   ++R++QD++A +S 
Sbjct  144  YYLK-RGATPYGGVNLTDGIVFDGLWDVYNKFHMGNCAENTAKKLEITRQQQDDFAIESY  202

Query  185  QKVEAAMTAGYFSKEIIPVTVPTGKEP--IIVDKDEYPKFGTTVESLQKLKPAFLEAKGT  242
            ++  AA     F  EI PV +   ++P  +I + +EY +     +   +L   F    GT
Sbjct  203  KRSAAAWANKVFQDEIAPVKIQQKRKPEIVISEDEEYKR--VNFDKFGQLATVFQRENGT  260

Query  243  VTAGNASGVNDGAAAVVLMSADTAMQKGLSPLAKIVAVAEAGVEPRIMGIGPVPAVELVL  302
            VTAGNAS +NDG AAVVLMSA+ A + G+ PLA+IVA  +A  +P    I P  A+  +L
Sbjct  261  VTAGNASTLNDGGAAVVLMSAEAAQKAGIKPLARIVAFQDAETDPIDFPIAPALAIPKLL  320

Query  303  QKAKWTKEEVDLYELNEAFAAQAIACVKSLGLNPNKVNINGGAIALGHPIGASGTRVLVT  362
            ++A   KE+V ++E+NEAF+   +A +K L ++P KVN++GGA+++GHPIG SG R++  
Sbjct  321  KRAGVRKEDVAMWEVNEAFSLVVLANIKKLDVDPAKVNVHGGAVSIGHPIGMSGARLVAH  380

Query  363  LLHSLERIGGNKGVAALCIGGGMGIAIAVQR  393
            L HSL++  G  G A++C GGG   +I +++
Sbjct  381  LSHSLKK--GELGCASICNGGGGASSILIEK  409


>THIL1_DICDI unnamed protein product
Length=414

 Score = 305 bits (781),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 175/391 (45%), Positives = 246/391 (63%), Gaps = 6/391 (2%)

Query  6    VVIISAVRTPIGSFCGSLSSLKASDLGSIVIKESLERAHIKPVDVSEVILGQVLTAGQGQ  65
            VVI+SAVRTPIGS  GSLS++  + L SI I+E+++RA IKP DV E I+G V++A  GQ
Sbjct  26   VVIVSAVRTPIGSIGGSLSTIPGTKLSSITIEEAVKRAGIKPSDVDEAIIGNVISANLGQ  85

Query  66   NPARQAAMKAGLPISVPAYLINMLCGSGLKAVLNGYLSIKAGENQIVVAGGQESMSQ-SC  124
             PARQ A+ AGL        IN +C SG+KA++ G  SI  G ++ VVAGG ESMSQ   
Sbjct  86   APARQCALGAGLEQKTITTTINKVCSSGMKAIVFGAQSIALGHSKTVVAGGFESMSQVPY  145

Query  125  HVLHLRKGVKIGDCNLMDTLLIDGLIDAFHGIHMGVTAENISKDYTVSRKEQDEYAAKSQ  184
            +   +R G K G+   +D L+ DGL DA++G  MGV  ++ +  Y ++R++QD++A  S 
Sbjct  146  YADKMRFGAKYGNQTFIDGLVRDGLADAYNGSAMGVCGDDCADKYKITREQQDKFAVDSY  205

Query  185  QKVEAAMTAGYFSKEII--PVTVPTGKEPIIVDKDEYPKFGTTVESLQKLKPAFLEAKGT  242
             +   A   G+F+ EI+  P+    GK   +V+ DE PK     + +  LKPAF    GT
Sbjct  206  LRALEAQKNGFFNDEIVQVPIVGRGGKVTYVVE-DEEPK-KVLFDKIPNLKPAF-TPNGT  262

Query  243  VTAGNASGVNDGAAAVVLMSADTAMQKGLSPLAKIVAVAEAGVEPRIMGIGPVPAVELVL  302
            VT  NAS +NDGA++V+LMS   A + GL PLA+I+  A+A   P      P  A+   L
Sbjct  263  VTPANASKLNDGASSVILMSESHAKELGLKPLARIIGYADAEQAPIEFPTAPALAIPKAL  322

Query  303  QKAKWTKEEVDLYELNEAFAAQAIACVKSLGLNPNKVNINGGAIALGHPIGASGTRVLVT  362
            + A     +VDL+E+NEAFA   +A  K L ++ NK+N+NGGA+ALGHPIG+SG R++VT
Sbjct  323  KNAGINMSQVDLFEINEAFAVVGLANAKILDIDHNKLNVNGGAVALGHPIGSSGCRIVVT  382

Query  363  LLHSLERIGGNKGVAALCIGGGMGIAIAVQR  393
            L H L+      GVAA+C GGG   A+ +++
Sbjct  383  LTHLLQNKNLKYGVAAICNGGGGSTALVLEK  413


>THILH_CAEEL unnamed protein product
Length=407

 Score = 296 bits (757),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 163/394 (41%), Positives = 236/394 (60%), Gaps = 7/394 (2%)

Query  1    MSNNDVVIISAVRTPIGSFCGSLSSLKASDLGSIVIKESLERAHIKPVDVSEVILGQVLT  60
            +SN    I+ A RTPIGSF  SLSS+ A +L S+ IK +LER  +KP  + EV LGQV  
Sbjct  19   LSNKHAFIVGAARTPIGSFRSSLSSVTAPELASVAIKAALERGAVKPSSIQEVFLGQVCQ  78

Query  61   AGQGQNPARQAAMKAGLPISVPAYLINMLCGSGLKAVLNGYLSIKAGENQIVVAGGQESM  120
            A  GQ PARQAA+ AGL +SV    +N +C SGLKA++     I+ G     + GG ESM
Sbjct  79   ANAGQAPARQAALGAGLDLSVAVTTVNKVCSSGLKAIILAAQQIQTGHQDFAIGGGMESM  138

Query  121  SQSCHVLHLRKGVKIGDCNLMDTLLIDGLIDAFHGIHMGVTAENISKDYTVSRKEQDEYA  180
            SQ    +  R  +  G   ++D ++ DGL DA+  +HMG   E  SK+  ++RK+QDEYA
Sbjct  139  SQVPFYVQ-RGEIPYGGFQVIDGIVKDGLTDAYDKVHMGNCGEKTSKEMGITRKDQDEYA  197

Query  181  AKSQQKVEAAMTAGYFSKEIIPVTVPTGKEPIIVDKD-EYPKFGTTVESLQKLKPAFLEA  239
              S +K   A   G    E++PV V + K   IVDKD E+ K     +    L+  F + 
Sbjct  198  INSYKKSAKAWENGNIGPEVVPVNVKSKKGVTIVDKDEEFTK--VNFDKFTSLRTVF-QK  254

Query  240  KGTVTAGNASGVNDGAAAVVLMSADTAMQKGLSPLAKIVAVAEAGVEPRIMGIGPVPAVE  299
             GT+TA NAS +NDGAAAV++ S +   ++ L PLA+I+A  +A   P    + P     
Sbjct  255  DGTITAANASTLNDGAAAVIVASQEAVSEQSLKPLARILAYGDAATHPLDFAVAPTLMFP  314

Query  300  LVLQKAKWTKEEVDLYELNEAFAAQAIACVKSLGLNPNKVNINGGAIALGHPIGASGTRV  359
             +L++A   + +V  +E+NEAF+   +A +K LG++P+ VN +GGA+++GHPIG SG R+
Sbjct  315  KILERAGVKQSDVAQWEVNEAFSCVPLAFIKKLGVDPSLVNPHGGAVSIGHPIGMSGARL  374

Query  360  LVTLLHSLERIGGNKGVAALCIGGGMGIAIAVQR  393
            +  L+H+L+   G  GVAA+C GGG    + +Q+
Sbjct  375  ITHLVHTLKS--GQIGVAAICNGGGGSSGMVIQK  406


>Q9W1H8_DROME unnamed protein product
Length=469

 Score = 186 bits (472),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 135/431 (31%), Positives = 215/431 (50%), Gaps = 47/431 (11%)

Query  2    SNNDVVIISAVRTPIGSFCGSLSSLKASDLGSIVIKESLERAHIKPVDVSEVILGQVLTA  61
            ++ ++V++  VRTP  +   + S L   +L    +   L++  +    +  ++ G V+  
Sbjct  40   NSQNIVLVDGVRTPFLTSGTTYSKLMPHELARHSLLSLLQKNRLDKELIDYIVYGSVIQE  99

Query  62   GQGQNPARQAAMKAGLPISVPAYLINMLCGSGLKAVLNGYLSIKAGENQIVVAGGQESMS  121
             +  N AR+AA+ AG     PA+ + M C S   A+  G   I      ++VAGG E MS
Sbjct  100  VKTSNIAREAALAAGFSNKTPAHTVTMACISSNAAITTGMGLIATNTYDVIVAGGVEFMS  159

Query  122  QSCHVLHLRK--------------GVKIGDCNLMDTLLIDGLIDAF-------HGIHMGV  160
                + H RK              G ++    L+ T   D L            G  MG 
Sbjct  160  D-VPIRHSRKMRSLLLKANKAKTLGQRLA---LLSTFRPDFLAPELPAVAEFSSGETMGH  215

Query  161  TAENISKDYTVSRKEQDEYAAKSQQKVEAAMTAGYFSKEIIPVTVPTGKEPIIVDKDEYP  220
            +A+ ++  + VSR EQDEYA +S    + A   GYF+ +++P  V    +  IVDKD   
Sbjct  216  SADRLASAFNVSRSEQDEYALRSHTLAKEAQEKGYFT-DLVPFKVSGVDQ--IVDKDNGI  272

Query  221  KFGTTVESLQKLKPAFLEAKGTVTAGNASGVNDGAAAVVLMSADTAMQKGLSPLAKIVAV  280
            +  ++ ESL KL+PAF++  GTVTA NAS + DGA+A ++M+ + A Q GL P A +   
Sbjct  273  RV-SSPESLAKLRPAFVKPYGTVTAANASFLTDGASACIIMTEEKAKQLGLKPKAYLRDF  331

Query  281  AEAGVEP-RIMGIGPVPAVELVLQKAKWTKEEVDLYELNEAFAAQAIA----------CV  329
                 +P   + +GP   +  +L+KA  T +++D +E++EAFA Q +A          C 
Sbjct  332  LFVSQDPVNQLLLGPAYGIPKLLKKAGLTLKDIDSWEIHEAFAGQIVANLKALDSDWFCK  391

Query  330  KSLGLNP-------NKVNINGGAIALGHPIGASGTRVLVTLLHSLERIGGNKGVAALCIG  382
              LGLN        +K N  GG++++GHP  A+G R+ +   + L R  G  GV A C  
Sbjct  392  TYLGLNEKVGTPDLSKWNNWGGSLSIGHPFAATGVRLCMHTANRLVREDGKLGVVAACAA  451

Query  383  GGMGIAIAVQR  393
            GG G+A+ ++R
Sbjct  452  GGQGVAMLIER  462


>O77466_DROME unnamed protein product
Length=469

 Score = 184 bits (468),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 134/431 (31%), Positives = 214/431 (50%), Gaps = 47/431 (11%)

Query  2    SNNDVVIISAVRTPIGSFCGSLSSLKASDLGSIVIKESLERAHIKPVDVSEVILGQVLTA  61
            ++ ++V++  VRTP  +   + S L   +L    +   L++  +    +  ++ G V+  
Sbjct  40   NSQNIVLVDGVRTPFLTSGTTYSKLMPHELARHSLLSLLQKKRLDKELIDYIVYGSVIQE  99

Query  62   GQGQNPARQAAMKAGLPISVPAYLINMLCGSGLKAVLNGYLSIKAGENQIVVAGGQESMS  121
             +  N AR+AA+ AG     PA+ + M C S   A+  G   I      ++VAGG E MS
Sbjct  100  VKTSNIAREAALAAGFSNKTPAHTVTMACISSNAAITTGMGLIATNTYDVIVAGGVEFMS  159

Query  122  QSCHVLHLRK--------------GVKIGDCNLMDTLLIDGLIDAF-------HGIHMGV  160
                + H RK              G ++    L+ T   D L            G  MG 
Sbjct  160  D-VPIRHSRKMRSLLLKANKAKTLGQRLA---LLSTFRPDFLAPELPAVAEFSSGETMGH  215

Query  161  TAENISKDYTVSRKEQDEYAAKSQQKVEAAMTAGYFSKEIIPVTVPTGKEPIIVDKDEYP  220
            +A+ ++  + VSR EQDEYA +S    + A   GYF+ +++P  V    +  IVDKD   
Sbjct  216  SADRLASAFNVSRSEQDEYALRSHTLAKEAQEKGYFT-DLVPFKVSGVDQ--IVDKDNGI  272

Query  221  KFGTTVESLQKLKPAFLEAKGTVTAGNASGVNDGAAAVVLMSADTAMQKGLSPLAKIVAV  280
            +  ++ ESL KL+PAF++  G VTA NAS + DGA+A ++M+ + A Q GL P A +   
Sbjct  273  RV-SSPESLAKLRPAFVKPDGIVTAANASFLTDGASACIIMTEEKAKQLGLKPKAYLRDF  331

Query  281  AEAGVEP-RIMGIGPVPAVELVLQKAKWTKEEVDLYELNEAFAAQAIA----------CV  329
                 +P   + +GP   +  +L+KA  T +++D +E++EAFA Q +A          C 
Sbjct  332  LFVSQDPVNQLLLGPAYGIPKLLKKAGLTLKDIDSWEIHEAFAGQIVANLKALDSDWFCK  391

Query  330  KSLGLNP-------NKVNINGGAIALGHPIGASGTRVLVTLLHSLERIGGNKGVAALCIG  382
              LGLN        +K N  GG++++GHP  A+G R+ +   + L R  G  GV A C  
Sbjct  392  TYLGLNEKVGTPDLSKWNNWGGSLSIGHPFAATGVRLCMHTANRLVREDGKLGVVAACAA  451

Query  383  GGMGIAIAVQR  393
            GG G+A+ ++R
Sbjct  452  GGQGVAMLIER  462



Lambda      K        H
   0.324    0.138    0.456 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3617638992


Query= NP_001267865.1 diphosphomevalonate decarboxylase [Bombus terrestris]

Length=384
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q388P2_TRYB2  unnamed protein product                                 291     4e-96
Q388J2_TRYB2  unnamed protein product                                 290     2e-95


>Q388P2_TRYB2 unnamed protein product
Length=382

 Score = 291 bits (746),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 160/381 (42%), Positives = 232/381 (61%), Gaps = 16/381 (4%)

Query  4    VTCIASVNIAVIKYWGKRD--ETLILPVNDSISATLDTDHLHTKTTVMISPTFKEDQIWL  61
            VT  A +NIA IKYWGKR+  ETLILP NDS S TL      +KT+V +    + D + L
Sbjct  6    VTVEAPINIAFIKYWGKREGGETLILPTNDSFSITLSASPFRSKTSVELRDDIETDTLRL  65

Query  62   NGQEEDI-KNPRLQNCLTQIRKRARNSNHIDQWKVHICSENNFPTAAGLASSAAGYACLV  120
            NG E D+ K PR+Q+ L  +R        +   KV+I SENNFPTAAG+ASSA+GY  + 
Sbjct  66   NGTEVDVGKTPRVQSMLLHLRSTC--PEDLKNKKVNIVSENNFPTAAGMASSASGYCAMS  123

Query  121  AALAKLYQVEGDISSIARIGSGSACRSVMGGFVRWYMGSEPNGADSIAKQIVPASHWPEM  180
            AAL + ++   ++S +AR+GSGSACRS  GGFV W  G +P+G+D +A Q V  +HWPE+
Sbjct  124  AALIRAFKSTTNVSMLARLGSGSACRSAFGGFVIWNKGEKPDGSDCVATQFVDETHWPEI  183

Query  181  RILILVVNDAKKKVSSSVGMKRTMETSDLVQYRIKHVIPERMKRMEQAIVEKDFKIFAEH  240
            +++  V+  A+K VSS+ GM+++++TS L++ RI   +PERMK   +AI  +DF  FAE 
Sbjct  184  QVMCAVLKGAQKDVSSTKGMQQSLKTSPLMKKRISETVPERMKIASRAIKARDFATFAEI  243

Query  241  TMKDSNQLHAVCLDAYPPFVYMNDISHAIVDLVHAYNEAVNEVKVAYTFDAGPNATLYLL  300
             M +S+ L  +C    P   Y  + S+A++ LV AYN       +AYTFDAG N  L++L
Sbjct  244  AMLESDDLQEICATTEPKITYATEDSYAMIRLVKAYNAKKGRTALAYTFDAGANCFLFVL  303

Query  301  EESVPEFVGVL-DHFYPPGINLEKY----RRGLPLNEVMDSPELFNNINAKKQAPESLKY  355
            +E +PE V +L +HF  P    EK+    R  L   +V+  P+ +  +    + P   + 
Sbjct  304  KEDLPEAVAMLMEHFPTP---FEKFFFGDRELLEKVKVVSLPDEYKKLIDHPKKP--FEM  358

Query  356  IIYTKVGDGPKYLKDPKDHLL  376
            ++ + VG G KYL  P + L+
Sbjct  359  LLQSPVGCGVKYL-GPSESLI  378


>Q388J2_TRYB2 unnamed protein product
Length=382

 Score = 290 bits (742),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 159/380 (42%), Positives = 231/380 (61%), Gaps = 16/380 (4%)

Query  5    TCIASVNIAVIKYWGKRD--ETLILPVNDSISATLDTDHLHTKTTVMISPTFKEDQIWLN  62
            T  A +NIA IKYWGKR+  ETLILP NDS S TL      +KT+V +    + D + LN
Sbjct  7    TVEAPINIAFIKYWGKREGGETLILPTNDSFSITLSASPFRSKTSVELRDDIETDTLRLN  66

Query  63   GQEEDI-KNPRLQNCLTQIRKRARNSNHIDQWKVHICSENNFPTAAGLASSAAGYACLVA  121
            G E D+ K PR+Q+ L  +R        +   KV+I SENNFPTAAG+ASSA+GY  + A
Sbjct  67   GTEVDVGKTPRVQSMLLHLRSTC--PEDLKNKKVNIVSENNFPTAAGMASSASGYCAMSA  124

Query  122  ALAKLYQVEGDISSIARIGSGSACRSVMGGFVRWYMGSEPNGADSIAKQIVPASHWPEMR  181
            AL + ++   ++S +AR+GSGSACRS  GGFV W  G +P+G+D +A Q V  +HWPE++
Sbjct  125  ALIRAFKSTTNVSMLARLGSGSACRSAFGGFVIWNKGEKPDGSDCVATQFVDETHWPEIQ  184

Query  182  ILILVVNDAKKKVSSSVGMKRTMETSDLVQYRIKHVIPERMKRMEQAIVEKDFKIFAEHT  241
            ++  V+  A+K VSS+ GM+++++TS L++ RI   +PERMK   +AI  +DF  FAE  
Sbjct  185  VMCAVLKGAQKDVSSTKGMQQSLKTSPLMKKRISETVPERMKIASRAIKARDFATFAEIA  244

Query  242  MKDSNQLHAVCLDAYPPFVYMNDISHAIVDLVHAYNEAVNEVKVAYTFDAGPNATLYLLE  301
            M +S+ L  +C    P   Y  + S+A++ LV AYN       +AYTFDAG N  L++L+
Sbjct  245  MLESDDLQEICATTEPKITYATEDSYAMIRLVKAYNAKKGRTALAYTFDAGANCFLFVLK  304

Query  302  ESVPEFVGVL-DHFYPPGINLEKY----RRGLPLNEVMDSPELFNNINAKKQAPESLKYI  356
            E +PE V +L +HF  P    EK+    R  L   +V+  P+ +  +    + P   + +
Sbjct  305  EDLPEAVAMLMEHFPTP---FEKFFFGDRELLEKVKVVSLPDEYKKLIDHPKKP--FEML  359

Query  357  IYTKVGDGPKYLKDPKDHLL  376
            + + VG G KYL  P + L+
Sbjct  360  LQSPVGCGVKYL-GPSESLI  378



Lambda      K        H
   0.324    0.138    0.456 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3617638992


Query= NP_001272327.1 acyl-CoA Delta(11) desaturase-like [Bombus
terrestris]

Length=377
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q94541_DROME  unnamed protein product                                 410     1e-142
Q7K4Y0_DROME  unnamed protein product                                 410     1e-142
Q9U972_DROME  unnamed protein product                                 407     1e-141
ACO11_SPOLI  unnamed protein product                                  373     7e-129
DESAT_BOMMO  unnamed protein product                                  371     5e-128


>Q94541_DROME unnamed protein product
Length=383

 Score = 410 bits (1054),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 192/328 (59%), Positives = 242/328 (74%), Gaps = 15/328 (5%)

Query  51   KIVWRNVIAFIYLHIGAIYGVYLTFTSTKFQTNIWLVSLILFGGVGVTAGAHRLWAHRTY  110
            K+VWRN+IAF YLH+ A+YG YL  TS K+QT I    L +  G+G+TAGAHRLWAHR+Y
Sbjct  69   KLVWRNIIAFGYLHLAALYGAYLMVTSAKWQTCILAYFLYVISGLGITAGAHRLWAHRSY  128

Query  111  KAKWPMRLLLMILQTIAFQNHIYEWVRDHRVHHKFTDTNADPHNAKRGFFFSHIGWLLVR  170
            KAKWP+R++L+I  TIAFQ+  Y W RDHRVHHK+++T+ADPHNA RGFFFSH+GWLL +
Sbjct  129  KAKWPLRVILVIFNTIAFQDAAYHWARDHRVHHKYSETDADPHNATRGFFFSHVGWLLCK  188

Query  171  KHPDVLKKGATIDMSDLENDPIVVWQRRLYLLLVPTICFLFPVWVPCYFWKETLFNSWY-  229
            KHP+V  KG  +D+SDL  DPI+++Q++ Y++L+P  CF+ P  VP Y W E+  N+W+ 
Sbjct  189  KHPEVKAKGKGVDLSDLRADPILMFQKKYYMILMPIACFIIPTVVPMYAWGESFMNAWFV  248

Query  230  STLTRYALTLNGTWLVNSAAHIWGVKPYDKNIGPTENKGVAILAFGEGWHNYHHVFPWDY  289
            +T+ R+   LN TWLVNSAAH +G +PYDK I P+EN  VAILAFGEGWHNYHHVFPWDY
Sbjct  249  ATMFRWCFILNVTWLVNSAAHKFGGRPYDKFINPSENISVAILAFGEGWHNYHHVFPWDY  308

Query  290  KAAELGNYKFNFTTAFIDFCAWLGLAYDLKTVPVEAIKRRAIRTGDGTKYSKHDDSHHHM  349
            K AE G Y  NFTTAFIDF A +G AYDLKTV  + IK+R  RTGDGT  +         
Sbjct  309  KTAEFGKYSLNFTTAFIDFFAKIGWAYDLKTVSTDIIKKRVKRTGDGTHAT---------  359

Query  350  HVDMKWGWGDVDMKPEEIQEVDIINKRN  377
                 WGWGDVD   EEI++  I +K++
Sbjct  360  -----WGWGDVDQPKEEIEDAVITHKKS  382


>Q7K4Y0_DROME unnamed protein product
Length=383

 Score = 410 bits (1053),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 192/328 (59%), Positives = 242/328 (74%), Gaps = 15/328 (5%)

Query  51   KIVWRNVIAFIYLHIGAIYGVYLTFTSTKFQTNIWLVSLILFGGVGVTAGAHRLWAHRTY  110
            K+VWRN+IAF YLH+ A+YG YL  TS K+QT I    L +  G+G+TAGAHRLWAHR+Y
Sbjct  69   KLVWRNIIAFGYLHLAALYGAYLMVTSAKWQTCILAYFLYVISGLGITAGAHRLWAHRSY  128

Query  111  KAKWPMRLLLMILQTIAFQNHIYEWVRDHRVHHKFTDTNADPHNAKRGFFFSHIGWLLVR  170
            KAKWP+R++L+I  TIAFQ+  Y W RDHRVHHK+++T+ADPHNA RGFFFSH+GWLL +
Sbjct  129  KAKWPLRVILVIFNTIAFQDAAYHWARDHRVHHKYSETDADPHNATRGFFFSHVGWLLCK  188

Query  171  KHPDVLKKGATIDMSDLENDPIVVWQRRLYLLLVPTICFLFPVWVPCYFWKETLFNSWY-  229
            KHP+V  KG  +D+SDL  DPI+++Q++ Y++L+P  CF+ P  VP Y W E+  N+W+ 
Sbjct  189  KHPEVKAKGKGVDLSDLRADPILMFQKKYYMILMPIACFIIPTVVPMYAWGESFMNAWFV  248

Query  230  STLTRYALTLNGTWLVNSAAHIWGVKPYDKNIGPTENKGVAILAFGEGWHNYHHVFPWDY  289
            +T+ R+   LN TWLVNSAAH +G +PYDK I P+EN  VAILAFGEGWHNYHHVFPWDY
Sbjct  249  ATMFRWCFILNVTWLVNSAAHKFGGRPYDKFINPSENISVAILAFGEGWHNYHHVFPWDY  308

Query  290  KAAELGNYKFNFTTAFIDFCAWLGLAYDLKTVPVEAIKRRAIRTGDGTKYSKHDDSHHHM  349
            K AE G Y  NFTTAFIDF A +G AYDLKTV  + IK+R  RTGDGT  +         
Sbjct  309  KTAEFGKYSLNFTTAFIDFFAKIGWAYDLKTVSTDIIKKRVKRTGDGTHAT---------  359

Query  350  HVDMKWGWGDVDMKPEEIQEVDIINKRN  377
                 WGWGDVD   EEI++  I +K++
Sbjct  360  -----WGWGDVDQPKEEIEDAVITHKKS  382


>Q9U972_DROME unnamed protein product
Length=383

 Score = 407 bits (1047),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 190/328 (58%), Positives = 240/328 (73%), Gaps = 15/328 (5%)

Query  51   KIVWRNVIAFIYLHIGAIYGVYLTFTSTKFQTNIWLVSLILFGGVGVTAGAHRLWAHRTY  110
            K+VWRN+I F Y H+ A+YG YL  TS K+QT I    L +  G+G+TAGAHRLWAHR+Y
Sbjct  69   KLVWRNIIVFGYFHLAALYGAYLMVTSAKWQTCILAYFLYVISGLGITAGAHRLWAHRSY  128

Query  111  KAKWPMRLLLMILQTIAFQNHIYEWVRDHRVHHKFTDTNADPHNAKRGFFFSHIGWLLVR  170
            KAKWP+R++L+I  TIAFQ+  Y W RDHRVHHK+++T+ADPHNA RGFFFSH+GWLL +
Sbjct  129  KAKWPLRVILVIFNTIAFQDAAYHWARDHRVHHKYSETDADPHNATRGFFFSHVGWLLCK  188

Query  171  KHPDVLKKGATIDMSDLENDPIVVWQRRLYLLLVPTICFLFPVWVPCYFWKETLFNSWY-  229
            KHP+V  KG  +D+SDL  DPI+++Q++ Y++L+P  CF+ P  VP Y W E+  N+W+ 
Sbjct  189  KHPEVKAKGKGVDLSDLRADPILMFQKKYYMILMPIACFIIPTVVPMYAWGESFMNAWFV  248

Query  230  STLTRYALTLNGTWLVNSAAHIWGVKPYDKNIGPTENKGVAILAFGEGWHNYHHVFPWDY  289
            +T+ R+   LN TWLVNSAAH +G +PYDK I P+EN  VAILAFGEGWHNYHHVFPWDY
Sbjct  249  ATMFRWCFILNVTWLVNSAAHKFGGRPYDKFINPSENISVAILAFGEGWHNYHHVFPWDY  308

Query  290  KAAELGNYKFNFTTAFIDFCAWLGLAYDLKTVPVEAIKRRAIRTGDGTKYSKHDDSHHHM  349
            K AE G Y  NFTTAFIDF A +G AYDLKTV  + IK+R  RTGDGT  +         
Sbjct  309  KTAEFGKYSLNFTTAFIDFFAKIGWAYDLKTVSTDIIKKRVKRTGDGTHAT---------  359

Query  350  HVDMKWGWGDVDMKPEEIQEVDIINKRN  377
                 WGWGDVD   EEI++  I +K++
Sbjct  360  -----WGWGDVDQPKEEIEDAVITHKKS  382


>ACO11_SPOLI unnamed protein product
Length=338

 Score = 373 bits (958),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 174/320 (54%), Positives = 235/320 (73%), Gaps = 16/320 (5%)

Query  49   EWKIVWRNVIAFIYLHIGAIYGVYLTFTSTKFQTNIWLVSLILFGGVGVTAGAHRLWAHR  108
            +++IV+ N+I F Y HI  +YG+YL FTSTK+ T ++   L +   VGVTAG+HRLW+H+
Sbjct  30   KFEIVYFNIITFAYWHIAGLYGLYLCFTSTKWATVLFSFFLFVVAEVGVTAGSHRLWSHK  89

Query  109  TYKAKWPMRLLLMILQTIAFQNHIYEWVRDHRVHHKFTDTNADPHNAKRGFFFSHIGWLL  168
            TYKAK P+++LLM++ ++AFQN + +WVRDHR+HHK++DT+ADPHNA RGFF+SH+GWLL
Sbjct  90   TYKAKLPLQILLMVMNSLAFQNTVIDWVRDHRLHHKYSDTDADPHNASRGFFYSHVGWLL  149

Query  169  VRKHPDVLKKGATIDMSDLENDPIVVWQRRLYLLLVPTICFLFPVWVPCYFWKETLFNSW  228
            VRKHPDV K+G  ID+SD+ N+P++ +Q++  +  +  +CF+ P  +P Y W ET  N+W
Sbjct  150  VRKHPDVKKRGKEIDISDIYNNPVLRFQKKYAIPFIGAVCFVLPTLIPVYGWGETWTNAW  209

Query  229  YSTLTRYALTLNGTWLVNSAAHIWGVKPYDKNIGPTENKGVAILAFGEGWHNYHHVFPWD  288
            +  + RY + LN T+LVNSAAHI+G +PYDK I P++N  V+I  FGEG+HNYHHVFPWD
Sbjct  210  HVAMLRYIMNLNVTFLVNSAAHIYGKRPYDKKILPSQNIAVSIATFGEGFHNYHHVFPWD  269

Query  289  YKAAELGNYKFNFTTAFIDFCAWLGLAYDLKTVPVEAIKRRAIRTGDGTKYSKHDDSHHH  348
            Y+AAELGN   NF T FIDF AW+G AYDLKTV  E IK+R+ RTGDGT           
Sbjct  270  YRAAELGNNSLNFPTKFIDFFAWIGWAYDLKTVSKEMIKQRSKRTGDGTNL---------  320

Query  349  MHVDMKWGWGDVDMKPEEIQ  368
                  WG  DVD  PE+++
Sbjct  321  ------WGLEDVDT-PEDLK  333


>DESAT_BOMMO unnamed protein product
Length=330

 Score = 371 bits (952),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 174/319 (55%), Positives = 226/319 (71%), Gaps = 7/319 (2%)

Query  26   STAEKTNNQELLVEKSSNTE-------SSYEWKIVWRNVIAFIYLHIGAIYGVYLTFTST  78
            ++ +KTN  E L +   + E       S  + KIV  NVI F YLHI  +YG+YL FTS 
Sbjct  4    NSVDKTNETEYLKDNHVDYEKLIAPQASPIKHKIVVMNVIRFSYLHIAGLYGLYLCFTSA  63

Query  79   KFQTNIWLVSLILFGGVGVTAGAHRLWAHRTYKAKWPMRLLLMILQTIAFQNHIYEWVRD  138
            K  T+++ + L   G  G+TAGAHRLW+H  YK K P+ +LLM+  +IAFQN I+ WVRD
Sbjct  64   KLATSVFAIVLFFLGNFGITAGAHRLWSHNGYKVKLPLEILLMVFNSIAFQNTIFTWVRD  123

Query  139  HRVHHKFTDTNADPHNAKRGFFFSHIGWLLVRKHPDVLKKGATIDMSDLENDPIVVWQRR  198
            HR+HHK+TDT+ADPHNA RGFFFSHIGWLLVRKHP V   G ++DMSD+  +P++ +Q++
Sbjct  124  HRLHHKYTDTDADPHNATRGFFFSHIGWLLVRKHPMVKIAGKSLDMSDIYCNPLLRFQKK  183

Query  199  LYLLLVPTICFLFPVWVPCYFWKETLFNSWYSTLTRYALTLNGTWLVNSAAHIWGVKPYD  258
              +  + TICF+ P   P YFW E+L N+W+ T+ RY  +LNGT+LVNSAAH+WG KPYD
Sbjct  184  YAIPFIGTICFIIPTLAPMYFWGESLNNAWHITVLRYIFSLNGTFLVNSAAHLWGYKPYD  243

Query  259  KNIGPTENKGVAILAFGEGWHNYHHVFPWDYKAAELGNYKFNFTTAFIDFCAWLGLAYDL  318
            K++  T++       FGEG+HNYHHVFPWDY+A ELG+   N TT FIDF AW+G AYDL
Sbjct  244  KSLKATQSGMANAFTFGEGFHNYHHVFPWDYRADELGDRYINLTTRFIDFFAWMGWAYDL  303

Query  319  KTVPVEAIKRRAIRTGDGT  337
            KT     I++RA+RTGDGT
Sbjct  304  KTASTNIIEKRALRTGDGT  322



Lambda      K        H
   0.324    0.138    0.456 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3617638992


Query= NP_001273373.1 acyl-CoA Delta(11) desaturase-like [Bombus
terrestris]

Length=322
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7K4Y0_DROME  unnamed protein product                                 202     3e-62
Q9U972_DROME  unnamed protein product                                 201     7e-62
Q94541_DROME  unnamed protein product                                 200     2e-61
ACO11_SPOLI  unnamed protein product                                  193     4e-59
ACO11_CHORO  unnamed protein product                                  192     7e-59


>Q7K4Y0_DROME unnamed protein product
Length=383

 Score = 202 bits (515),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 103/289 (36%), Positives = 167/289 (58%), Gaps = 4/289 (1%)

Query  4    EKQPARKQEIIWAAILWYIYIHVLGIYAIWFLFTSAKWMTVIFTLFITILGCLGVTAGAH  63
            +K   R+ +++W  I+ + Y+H+  +Y  + + TSAKW T I   F+ ++  LG+TAGAH
Sbjct  61   KKAEKRRLKLVWRNIIAFGYLHLAALYGAYLMVTSAKWQTCILAYFLYVISGLGITAGAH  120

Query  64   RLWAHRTYEATGSLRLLLVLFHTIAGVGSIYDWVLYHRLHHKYYGTDKDPYNHKKGFFYS  123
            RLWAHR+Y+A   LR++LV+F+TIA   + Y W   HR+HHKY  TD DP+N  +GFF+S
Sbjct  121  RLWAHRSYKAKWPLRVILVIFNTIAFQDAAYHWARDHRVHHKYSETDADPHNATRGFFFS  180

Query  124  HYVANILSPSMDLEEIKREIDMRDIEQDGYVWFQKKFYWPLFIIFGLILPLNAPLEYWDE  183
            H    +     +++   + +D+ D+  D  + FQKK+Y  L  I   I+P   P+  W E
Sbjct  181  HVGWLLCKKHPEVKAKGKGVDLSDLRADPILMFQKKYYMILMPIACFIIPTVVPMYAWGE  240

Query  184  SMTESILITGVLRFAITVNVSWLVNSARLVWSMETQKL---PQDNISIYFLT-KSFWPMY  239
            S   +  +  + R+   +NV+WLVNSA   +          P +NIS+  L     W  Y
Sbjct  241  SFMNAWFVATMFRWCFILNVTWLVNSAAHKFGGRPYDKFINPSENISVAILAFGEGWHNY  300

Query  240  HYMVPWDWKCGEFGSYADGWATFFIKIWHELGYVTLLQTTDSEDVREML  288
            H++ PWD+K  EFG Y+  + T FI  + ++G+   L+T  ++ +++ +
Sbjct  301  HHVFPWDYKTAEFGKYSLNFTTAFIDFFAKIGWAYDLKTVSTDIIKKRV  349


>Q9U972_DROME unnamed protein product
Length=383

 Score = 201 bits (512),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 103/289 (36%), Positives = 166/289 (57%), Gaps = 4/289 (1%)

Query  4    EKQPARKQEIIWAAILWYIYIHVLGIYAIWFLFTSAKWMTVIFTLFITILGCLGVTAGAH  63
            +K   R+ +++W  I+ + Y H+  +Y  + + TSAKW T I   F+ ++  LG+TAGAH
Sbjct  61   KKAEKRRLKLVWRNIIVFGYFHLAALYGAYLMVTSAKWQTCILAYFLYVISGLGITAGAH  120

Query  64   RLWAHRTYEATGSLRLLLVLFHTIAGVGSIYDWVLYHRLHHKYYGTDKDPYNHKKGFFYS  123
            RLWAHR+Y+A   LR++LV+F+TIA   + Y W   HR+HHKY  TD DP+N  +GFF+S
Sbjct  121  RLWAHRSYKAKWPLRVILVIFNTIAFQDAAYHWARDHRVHHKYSETDADPHNATRGFFFS  180

Query  124  HYVANILSPSMDLEEIKREIDMRDIEQDGYVWFQKKFYWPLFIIFGLILPLNAPLEYWDE  183
            H    +     +++   + +D+ D+  D  + FQKK+Y  L  I   I+P   P+  W E
Sbjct  181  HVGWLLCKKHPEVKAKGKGVDLSDLRADPILMFQKKYYMILMPIACFIIPTVVPMYAWGE  240

Query  184  SMTESILITGVLRFAITVNVSWLVNSARLVWSMETQKL---PQDNISIYFLT-KSFWPMY  239
            S   +  +  + R+   +NV+WLVNSA   +          P +NIS+  L     W  Y
Sbjct  241  SFMNAWFVATMFRWCFILNVTWLVNSAAHKFGGRPYDKFINPSENISVAILAFGEGWHNY  300

Query  240  HYMVPWDWKCGEFGSYADGWATFFIKIWHELGYVTLLQTTDSEDVREML  288
            H++ PWD+K  EFG Y+  + T FI  + ++G+   L+T  ++ +++ +
Sbjct  301  HHVFPWDYKTAEFGKYSLNFTTAFIDFFAKIGWAYDLKTVSTDIIKKRV  349


>Q94541_DROME unnamed protein product
Length=383

 Score = 200 bits (509),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/289 (36%), Positives = 166/289 (57%), Gaps = 4/289 (1%)

Query  4    EKQPARKQEIIWAAILWYIYIHVLGIYAIWFLFTSAKWMTVIFTLFITILGCLGVTAGAH  63
            +K   R  +++W  I+ + Y+H+  +Y  + + TSAKW T I   F+ ++  LG+TAGAH
Sbjct  61   KKAEKRLLKLVWRNIIAFGYLHLAALYGAYLMVTSAKWQTCILAYFLYVISGLGITAGAH  120

Query  64   RLWAHRTYEATGSLRLLLVLFHTIAGVGSIYDWVLYHRLHHKYYGTDKDPYNHKKGFFYS  123
            RLWAHR+Y+A   LR++LV+F+TIA   + Y W   HR+HHKY  TD DP+N  +GFF+S
Sbjct  121  RLWAHRSYKAKWPLRVILVIFNTIAFQDAAYHWARDHRVHHKYSETDADPHNATRGFFFS  180

Query  124  HYVANILSPSMDLEEIKREIDMRDIEQDGYVWFQKKFYWPLFIIFGLILPLNAPLEYWDE  183
            H    +     +++   + +D+ D+  D  + FQKK+Y  L  I   I+P   P+  W E
Sbjct  181  HVGWLLCKKHPEVKAKGKGVDLSDLRADPILMFQKKYYMILMPIACFIIPTVVPMYAWGE  240

Query  184  SMTESILITGVLRFAITVNVSWLVNSARLVWSMETQKL---PQDNISIYFLT-KSFWPMY  239
            S   +  +  + R+   +NV+WLVNSA   +          P +NIS+  L     W  Y
Sbjct  241  SFMNAWFVATMFRWCFILNVTWLVNSAAHKFGGRPYDKFINPSENISVAILAFGEGWHNY  300

Query  240  HYMVPWDWKCGEFGSYADGWATFFIKIWHELGYVTLLQTTDSEDVREML  288
            H++ PWD+K  EFG Y+  + T FI  + ++G+   L+T  ++ +++ +
Sbjct  301  HHVFPWDYKTAEFGKYSLNFTTAFIDFFAKIGWAYDLKTVSTDIIKKRV  349


>ACO11_SPOLI unnamed protein product
Length=338

 Score = 193 bits (490),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 105/298 (35%), Positives = 179/298 (60%), Gaps = 9/298 (3%)

Query  1    MLDEKQPARKQEIIWAAILWYIYIHVLGIYAIWFLFTSAKWMTVIFTLFITILGCLGVTA  60
            +L  +   RK EI++  I+ + Y H+ G+Y ++  FTS KW TV+F+ F+ ++  +GVTA
Sbjct  21   LLVPQAGKRKFEIVYFNIITFAYWHIAGLYGLYLCFTSTKWATVLFSFFLFVVAEVGVTA  80

Query  61   GAHRLWAHRTYEATGSLRLLLVLFHTIAGVGSIYDWVLYHRLHHKYYGTDKDPYNHKKGF  120
            G+HRLW+H+TY+A   L++LL++ +++A   ++ DWV  HRLHHKY  TD DP+N  +GF
Sbjct  81   GSHRLWSHKTYKAKLPLQILLMVMNSLAFQNTVIDWVRDHRLHHKYSDTDADPHNASRGF  140

Query  121  FYSHYVANILSPSMDLEEIKREIDMRDIEQDGYVWFQKKFYWPLFIIFGLILPLNAPLEY  180
            FYSH    ++    D+++  +EID+ DI  +  + FQKK+  P       +LP   P+  
Sbjct  141  FYSHVGWLLVRKHPDVKKRGKEIDISDIYNNPVLRFQKKYAIPFIGAVCFVLPTLIPVYG  200

Query  181  WDESMTESILITGVLRFAITVNVSWLVNSARLVWSM---ETQKLPQDNISIYFLT-KSFW  236
            W E+ T +  +  +LR+ + +NV++LVNSA  ++     + + LP  NI++   T    +
Sbjct  201  WGETWTNAWHV-AMLRYIMNLNVTFLVNSAAHIYGKRPYDKKILPSQNIAVSIATFGEGF  259

Query  237  PMYHYMVPWDWKCGEFGSYADGWATFFIKIWHELGYVTLLQTTDSEDVREMLHEVSKK  294
              YH++ PWD++  E G+ +  + T FI  +  +G+   L+T      +EM+ + SK+
Sbjct  260  HNYHHVFPWDYRAAELGNNSLNFPTKFIDFFAWIGWAYDLKTVS----KEMIKQRSKR  313


>ACO11_CHORO unnamed protein product
Length=335

 Score = 192 bits (488),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 101/293 (34%), Positives = 173/293 (59%), Gaps = 7/293 (2%)

Query  1    MLDEKQPARKQEIIWAAILWYIYIHVLGIYAIWFLFTSAKWMTVIFTLFITILGCLGVTA  60
            ++  +   RK +II+  +L + Y H+ G+Y ++  FTSAKW T+I  L +  +  LG+TA
Sbjct  22   LVAPQAAPRKYQIIYTNLLTFGYWHIAGLYGLYLCFTSAKWQTIILALILNEMAILGITA  81

Query  61   GAHRLWAHRTYEATGSLRLLLVLFHTIAGVGSIYDWVLYHRLHHKYYGTDKDPYNHKKGF  120
            GAHRLWAHR+Y+AT  L+++L++F++++   S   W+  HR+HHKY  TD DP+N  +GF
Sbjct  82   GAHRLWAHRSYKATVPLQIILIIFNSLSFQNSAIHWIRDHRMHHKYSDTDGDPHNASRGF  141

Query  121  FYSHYVANILSPSMDLEEIKREIDMRDIEQDGYVWFQKKFYWPLFIIFGLILPLNAPLEY  180
            FYSH    ++    ++++  + IDM DI  +  + FQKK+  P   +   +LP   P+ +
Sbjct  142  FYSHVGWLLVKKHPEVKKRAKTIDMSDIYSNPILRFQKKYAIPFIGMICFVLPTIIPMYF  201

Query  181  WDESMTESILITGVLRFAITVNVSWLVNSARLVWS---METQKLPQDN--ISIYFLTKSF  235
            W E+++ +  IT +LR+  ++N  +LVNSA  ++     +   LP +N    I  L ++F
Sbjct  202  WGETLSNAWHIT-MLRYVFSLNSIFLVNSAAHLYGYRPYDKNILPAENKMTFIACLGENF  260

Query  236  WPMYHYMVPWDWKCGEFGSYADGWATFFIKIWHELGYVTLLQTTDSEDVREML  288
               YH++ PWD++  E G+    W   FI  +  +G+   L+T   E+++  +
Sbjct  261  H-NYHHVFPWDYRASELGNIGMNWTAKFIDFFAWIGWAYDLKTASDENIKSRM  312



Lambda      K        H
   0.324    0.138    0.456 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3617638992


Query= NP_001274492.1 acyl-CoA Delta(11) desaturase-like [Bombus
terrestris]

Length=368
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q94541_DROME  unnamed protein product                                 374     2e-128
Q7K4Y0_DROME  unnamed protein product                                 372     8e-128
Q9U972_DROME  unnamed protein product                                 370     7e-127
ACO11_SPOLI  unnamed protein product                                  327     6e-111
Q9VTD4_DROME  unnamed protein product                                 322     2e-108


>Q94541_DROME unnamed protein product
Length=383

 Score = 374 bits (959),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 176/335 (53%), Positives = 230/335 (69%), Gaps = 1/335 (0%)

Query  35   TDDYLAVDETYRSSKVEYVPRITWPDLIALIFVHVGCIYGLYLIFTEAKLLTTLWAFVVI  94
            TD  L  D T      + + ++ W ++IA  ++H+  +YG YL+ T AK  T + A+ + 
Sbjct  49   TDGGLVKDITVMKKAEKRLLKLVWRNIIAFGYLHLAALYGAYLMVTSAKWQTCILAYFLY  108

Query  95   YTSGFGITAGAHRLWSHRAYKAKWPLRFLLILLFTITGQKHVYAWALDHRVHHKYSETDA  154
              SG GITAGAHRLW+HR+YKAKWPLR +L++  TI  Q   Y WA DHRVHHKYSETDA
Sbjct  109  VISGLGITAGAHRLWAHRSYKAKWPLRVILVIFNTIAFQDAAYHWARDHRVHHKYSETDA  168

Query  155  DPHNAKRGFFFAHVGWLFTTPHPDVVAKRKAVDMSDLEADPLVMWQKRYYIPLFALLTIG  214
            DPHNA RGFFF+HVGWL    HP+V AK K VD+SDL ADP++M+QK+YY+ L  +    
Sbjct  169  DPHNATRGFFFSHVGWLLCKKHPEVKAKGKGVDLSDLRADPILMFQKKYYMILMPIACFI  228

Query  215  FPVGVPCYFWSESVWTSFWVNFNFRFCVTLNIAFFVNSVAHMWGQRPYDKYISPVENVVV  274
             P  VP Y W ES   +++V   FR+C  LN+ + VNS AH +G RPYDK+I+P EN+ V
Sbjct  229  IPTVVPMYAWGESFMNAWFVATMFRWCFILNVTWLVNSAAHKFGGRPYDKFINPSENISV  288

Query  275  SIAALGEGWHNFHHVFPWDYKTGELGNYTFNLTTGFIDAFAHIGWAYNRKYVSPAMVRRR  334
            +I A GEGWHN+HHVFPWDYKT E G Y+ N TT FID FA IGWAY+ K VS  ++++R
Sbjct  289  AILAFGEGWHNYHHVFPWDYKTAEFGKYSLNFTTAFIDFFAKIGWAYDLKTVSTDIIKKR  348

Query  335  AIRSGDGSH-VWGYGDADIPIEDLQELKQMDRKKE  368
              R+GDG+H  WG+GD D P E++++     +K E
Sbjct  349  VKRTGDGTHATWGWGDVDQPKEEIEDAVITHKKSE  383


>Q7K4Y0_DROME unnamed protein product
Length=383

 Score = 372 bits (955),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 176/335 (53%), Positives = 229/335 (68%), Gaps = 1/335 (0%)

Query  35   TDDYLAVDETYRSSKVEYVPRITWPDLIALIFVHVGCIYGLYLIFTEAKLLTTLWAFVVI  94
            TD  L  D T      +   ++ W ++IA  ++H+  +YG YL+ T AK  T + A+ + 
Sbjct  49   TDGGLVKDITVMKKAEKRRLKLVWRNIIAFGYLHLAALYGAYLMVTSAKWQTCILAYFLY  108

Query  95   YTSGFGITAGAHRLWSHRAYKAKWPLRFLLILLFTITGQKHVYAWALDHRVHHKYSETDA  154
              SG GITAGAHRLW+HR+YKAKWPLR +L++  TI  Q   Y WA DHRVHHKYSETDA
Sbjct  109  VISGLGITAGAHRLWAHRSYKAKWPLRVILVIFNTIAFQDAAYHWARDHRVHHKYSETDA  168

Query  155  DPHNAKRGFFFAHVGWLFTTPHPDVVAKRKAVDMSDLEADPLVMWQKRYYIPLFALLTIG  214
            DPHNA RGFFF+HVGWL    HP+V AK K VD+SDL ADP++M+QK+YY+ L  +    
Sbjct  169  DPHNATRGFFFSHVGWLLCKKHPEVKAKGKGVDLSDLRADPILMFQKKYYMILMPIACFI  228

Query  215  FPVGVPCYFWSESVWTSFWVNFNFRFCVTLNIAFFVNSVAHMWGQRPYDKYISPVENVVV  274
             P  VP Y W ES   +++V   FR+C  LN+ + VNS AH +G RPYDK+I+P EN+ V
Sbjct  229  IPTVVPMYAWGESFMNAWFVATMFRWCFILNVTWLVNSAAHKFGGRPYDKFINPSENISV  288

Query  275  SIAALGEGWHNFHHVFPWDYKTGELGNYTFNLTTGFIDAFAHIGWAYNRKYVSPAMVRRR  334
            +I A GEGWHN+HHVFPWDYKT E G Y+ N TT FID FA IGWAY+ K VS  ++++R
Sbjct  289  AILAFGEGWHNYHHVFPWDYKTAEFGKYSLNFTTAFIDFFAKIGWAYDLKTVSTDIIKKR  348

Query  335  AIRSGDGSH-VWGYGDADIPIEDLQELKQMDRKKE  368
              R+GDG+H  WG+GD D P E++++     +K E
Sbjct  349  VKRTGDGTHATWGWGDVDQPKEEIEDAVITHKKSE  383


>Q9U972_DROME unnamed protein product
Length=383

 Score = 370 bits (949),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 175/335 (52%), Positives = 227/335 (68%), Gaps = 1/335 (0%)

Query  35   TDDYLAVDETYRSSKVEYVPRITWPDLIALIFVHVGCIYGLYLIFTEAKLLTTLWAFVVI  94
            TD  L  D T      +   ++ W ++I   + H+  +YG YL+ T AK  T + A+ + 
Sbjct  49   TDGGLVKDITVMKKAEKRRLKLVWRNIIVFGYFHLAALYGAYLMVTSAKWQTCILAYFLY  108

Query  95   YTSGFGITAGAHRLWSHRAYKAKWPLRFLLILLFTITGQKHVYAWALDHRVHHKYSETDA  154
              SG GITAGAHRLW+HR+YKAKWPLR +L++  TI  Q   Y WA DHRVHHKYSETDA
Sbjct  109  VISGLGITAGAHRLWAHRSYKAKWPLRVILVIFNTIAFQDAAYHWARDHRVHHKYSETDA  168

Query  155  DPHNAKRGFFFAHVGWLFTTPHPDVVAKRKAVDMSDLEADPLVMWQKRYYIPLFALLTIG  214
            DPHNA RGFFF+HVGWL    HP+V AK K VD+SDL ADP++M+QK+YY+ L  +    
Sbjct  169  DPHNATRGFFFSHVGWLLCKKHPEVKAKGKGVDLSDLRADPILMFQKKYYMILMPIACFI  228

Query  215  FPVGVPCYFWSESVWTSFWVNFNFRFCVTLNIAFFVNSVAHMWGQRPYDKYISPVENVVV  274
             P  VP Y W ES   +++V   FR+C  LN+ + VNS AH +G RPYDK+I+P EN+ V
Sbjct  229  IPTVVPMYAWGESFMNAWFVATMFRWCFILNVTWLVNSAAHKFGGRPYDKFINPSENISV  288

Query  275  SIAALGEGWHNFHHVFPWDYKTGELGNYTFNLTTGFIDAFAHIGWAYNRKYVSPAMVRRR  334
            +I A GEGWHN+HHVFPWDYKT E G Y+ N TT FID FA IGWAY+ K VS  ++++R
Sbjct  289  AILAFGEGWHNYHHVFPWDYKTAEFGKYSLNFTTAFIDFFAKIGWAYDLKTVSTDIIKKR  348

Query  335  AIRSGDGSH-VWGYGDADIPIEDLQELKQMDRKKE  368
              R+GDG+H  WG+GD D P E++++     +K E
Sbjct  349  VKRTGDGTHATWGWGDVDQPKEEIEDAVITHKKSE  383


>ACO11_SPOLI unnamed protein product
Length=338

 Score = 327 bits (839),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 151/307 (49%), Positives = 209/307 (68%), Gaps = 2/307 (1%)

Query  55   RITWPDLIALIFVHVGCIYGLYLIFTEAKLLTTLWAFVVIYTSGFGITAGAHRLWSHRAY  114
             I + ++I   + H+  +YGLYL FT  K  T L++F +   +  G+TAG+HRLWSH+ Y
Sbjct  32   EIVYFNIITFAYWHIAGLYGLYLCFTSTKWATVLFSFFLFVVAEVGVTAGSHRLWSHKTY  91

Query  115  KAKWPLRFLLILLFTITGQKHVYAWALDHRVHHKYSETDADPHNAKRGFFFAHVGWLFTT  174
            KAK PL+ LL+++ ++  Q  V  W  DHR+HHKYS+TDADPHNA RGFF++HVGWL   
Sbjct  92   KAKLPLQILLMVMNSLAFQNTVIDWVRDHRLHHKYSDTDADPHNASRGFFYSHVGWLLVR  151

Query  175  PHPDVVAKRKAVDMSDLEADPLVMWQKRYYIPLFALLTIGFPVGVPCYFWSESVWTSFWV  234
             HPDV  + K +D+SD+  +P++ +QK+Y IP    +    P  +P Y W E+ WT+ W 
Sbjct  152  KHPDVKKRGKEIDISDIYNNPVLRFQKKYAIPFIGAVCFVLPTLIPVYGWGET-WTNAWH  210

Query  235  NFNFRFCVTLNIAFFVNSVAHMWGQRPYDKYISPVENVVVSIAALGEGWHNFHHVFPWDY  294
                R+ + LN+ F VNS AH++G+RPYDK I P +N+ VSIA  GEG+HN+HHVFPWDY
Sbjct  211  VAMLRYIMNLNVTFLVNSAAHIYGKRPYDKKILPSQNIAVSIATFGEGFHNYHHVFPWDY  270

Query  295  KTGELGNYTFNLTTGFIDAFAHIGWAYNRKYVSPAMVRRRAIRSGDGSHVWGYGDADIPI  354
            +  ELGN + N  T FID FA IGWAY+ K VS  M+++R+ R+GDG+++WG  D D P 
Sbjct  271  RAAELGNNSLNFPTKFIDFFAWIGWAYDLKTVSKEMIKQRSKRTGDGTNLWGLEDVDTP-  329

Query  355  EDLQELK  361
            EDL+  K
Sbjct  330  EDLKNTK  336


>Q9VTD4_DROME unnamed protein product
Length=355

 Score = 322 bits (824),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 154/320 (48%), Positives = 220/320 (69%), Gaps = 5/320 (2%)

Query  39   LAVDETYRSSKVEYVPRITWPDLIALIFVHVGCIYGLYLIFTEAKLLTTLWAFVVIYTSG  98
            L+  +T   SK+E V    W +++  + +H+  +YG++L+FT A   T +  +  +  + 
Sbjct  28   LSNRKTTDGSKLELV----WVNIVLFVILHISSLYGVWLLFTSATWTTVVLFWPTVVVTI  83

Query  99   FGITAGAHRLWSHRAYKAKWPLRFLLILLFTITGQKHVYAWALDHRVHHKYSETDADPHN  158
             G++ GAHRLW+HR +KA  PL+ + + L T+  Q  VY WA DHRVHHKY+ETDADP+N
Sbjct  84   LGVSGGAHRLWAHRTFKANTPLKLIFLFLNTLAFQDAVYYWARDHRVHHKYTETDADPYN  143

Query  159  AKRGFFFAHVGWLFTTPHPDVVAKRKAVDMSDLEADPLVMWQKRYYIPLFALLTIGFPVG  218
            ++RG+FFAH+GWL    HP+VV K K +D+SDLEADPL+M+QK+YY+ L  ++    P  
Sbjct  144  SQRGWFFAHIGWLCCRKHPEVVEKGKQIDLSDLEADPLIMFQKKYYLLLMPIICFVLPTV  203

Query  219  VPCYFWSESVWTSFWVNFNFRFCVTLNIAFFVNSVAHMWGQRPYDKYISPVENVVVSIAA  278
            +P Y W ES+  S+ V    R+C++LN+ + VNS AHM G RPYDK I PV+   +    
Sbjct  204  LPMYLWGESLNVSWHVMALLRWCLSLNLIWTVNSSAHMHGMRPYDKNICPVDQGFLIFFR  263

Query  279  LGEGWHNFHHVFPWDYKTGELGNYTFNLTTGFIDAFAHIGWAYNRKYVSPAMVRRRAIRS  338
            +GEG+HN+HHVFPWDYK+ ELG Y+ ++TT FI+  A++GWAY+ K VS  +V++R  RS
Sbjct  264  VGEGYHNYHHVFPWDYKSAELGKYSQDVTTKFIEFMAYLGWAYDLKSVSLDLVKQRVQRS  323

Query  339  GDGSH-VWGYGDADIPIEDL  357
            GDGSH VWG+GD D   ED+
Sbjct  324  GDGSHPVWGWGDKDQLKEDV  343



Lambda      K        H
   0.324    0.138    0.456 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3617638992


Query= NP_001274494.1 lipase member H-A-like precursor [Bombus terrestris]

Length=304
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7K3Z8_DROME  unnamed protein product                                 171     5e-51
Q9VX69_DROME  unnamed protein product                                 117     7e-30
Q8SXG0_DROME  unnamed protein product                                 117     7e-30
Q0E8T1_DROME  unnamed protein product                                 107     6e-27
VIT3_DROME  unnamed protein product                                   70.9    2e-13


>Q7K3Z8_DROME unnamed protein product
Length=340

 Score = 171 bits (434),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 96/254 (38%), Positives = 149/254 (59%), Gaps = 25/254 (10%)

Query  72   RDSILYIHGFLENTEAENVRVIIRAYLDKGDVNVIVLDWGEIAFNINYVYVS-SQVVTIA  130
            ++++LY+HG+LE+ + E++ VI  AYL++ D N+IVLDWGE+A + NY++ +   +  + 
Sbjct  59   KNTVLYLHGYLEDPDVESIHVIAEAYLERKDTNLIVLDWGELA-DGNYMFDAFPNLKQLG  117

Query  131  KAVAESLKKLVDL-IDLDTLHVIGHSLGAHIAGNIGRYANI------NLSRITGLDPALP  183
              +A+ L K+ D  +D++  H++GHS+G  +AG +GR           + RI+ LDPA P
Sbjct  118  PELAKVLLKMFDHGLDIEKFHIVGHSMGGQLAGLLGREITKRTKGVRKIKRISALDPAFP  177

Query  184  LFYPSTCHVRSTDAEAVVILHTDGGFYGTATNTGTIDFYVNGGSSVQPGCP-----IIFG  238
            LFYP T H+ + DAE V ++HTD   YG  T+TGT DF+ NGG S+QPGCP     ++  
Sbjct  178  LFYPGT-HLSANDAEFVDVIHTDAWLYGAPTSTGTADFWPNGGYSLQPGCPKRNYKMLSD  236

Query  239  GEFCSHQRSTRIYAESLLNP-----KAFPAHKC----LNEIADT-EEVYFGDSTPKDIYG  288
             +  SH+RS   +AES+ +       A PA K      N+I +    V  G   P  I+G
Sbjct  237  NDLSSHRRSWWFWAESVSDRYPIGFDAVPAKKWSDFKQNKIVENCPPVVMGHHCPTTIHG  296

Query  289  TYCFNTNAKPPYGK  302
             +   TN   P+ +
Sbjct  297  DFYLQTNGHTPFAR  310


>Q9VX69_DROME unnamed protein product
Length=411

 Score = 117 bits (293),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 75/229 (33%), Positives = 121/229 (53%), Gaps = 19/229 (8%)

Query  87   AENVRVIIRAYLDKGDVNVIVLDWGEIAFNINYVYVSSQVVTIAKAVAESLKKLVDLIDL  146
            ++ + V  +AY  +GDVN + +D       + Y + +     I + +A  L KL+DL+ +
Sbjct  147  SDTIEVFSKAYNCRGDVNFVAVDAARFVDTL-YTWSAFNTEEIGENIALGLVKLLDLVPV  205

Query  147  DTLHVIGHSLGAHIAGNIGRY----ANINLSRITGLDPALPLFY--PSTCHVRSTDAEAV  200
            + +H+IGHSLGAHI G+ GR+     N  + RITGLDPA P F    +   +   DA  V
Sbjct  206  ENIHLIGHSLGAHIVGSAGRHLQHLTNQTIPRITGLDPAKPCFNEGEALSGLMRGDAHFV  265

Query  201  VILHTDGGFYGTATNTGTIDFYVNGGSSVQPGCPIIFGGEFCSHQRSTRIYAESLL--NP  258
             ++H++ G  G     G +DFY  G S +  GC  +     C+H RS   +AE++   N 
Sbjct  266  DVIHSNPGVLGKRDPVGDVDFYPGGMSPLAAGCFSV----TCAHARSWEYFAETVFPGNE  321

Query  259  KAFPAHKC--LNEIAD----TEEVYFGDSTPKDIYGTYCFNTNAKPPYG  301
            + F A +C  ++++ D     +EV  G + P++I G Y    +A  P+G
Sbjct  322  RNFMATRCNSISKLRDFRCPGDEVPMGYAVPQNIKGNYFLEVSASAPFG  370


>Q8SXG0_DROME unnamed protein product
Length=411

 Score = 117 bits (293),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 75/229 (33%), Positives = 121/229 (53%), Gaps = 19/229 (8%)

Query  87   AENVRVIIRAYLDKGDVNVIVLDWGEIAFNINYVYVSSQVVTIAKAVAESLKKLVDLIDL  146
            ++ + V  +AY  +GDVN + +D       + Y + +     I + +A  L KL+DL+ +
Sbjct  147  SDTIEVFSKAYNCRGDVNFVAVDAARFVDTL-YTWSAFNTEEIGENIALGLVKLLDLVPV  205

Query  147  DTLHVIGHSLGAHIAGNIGRY----ANINLSRITGLDPALPLFY--PSTCHVRSTDAEAV  200
            + +H+IGHSLGAHI G+ GR+     N  + RITGLDPA P F    +   +   DA  V
Sbjct  206  ENIHLIGHSLGAHIVGSAGRHLQHLTNQTIPRITGLDPAKPCFNEGEALSGLMRGDAHFV  265

Query  201  VILHTDGGFYGTATNTGTIDFYVNGGSSVQPGCPIIFGGEFCSHQRSTRIYAESLL--NP  258
             ++H++ G  G     G +DFY  G S +  GC  +     C+H RS   +AE++   N 
Sbjct  266  DVIHSNPGVLGKRDPVGDVDFYPGGMSPLAAGCFSV----TCAHARSWEYFAETVFPGNE  321

Query  259  KAFPAHKC--LNEIAD----TEEVYFGDSTPKDIYGTYCFNTNAKPPYG  301
            + F A +C  ++++ D     +EV  G + P++I G Y    +A  P+G
Sbjct  322  RNFMATRCNSISKLRDFRCPGDEVPMGYAVPQNIKGNYFLEVSASAPFG  370


>Q0E8T1_DROME unnamed protein product
Length=338

 Score = 107 bits (268),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 81/241 (34%), Positives = 116/241 (48%), Gaps = 19/241 (8%)

Query  78   IHGFLENTE-AENVRVIIRAYLDKGDVNVIVLDWGEIAFNINYVYVSSQVVTIAKAVAES  136
            IHGF  + + + N +  +R      D N+I LD+ ++A+   Y         +A+  A+ 
Sbjct  73   IHGFNGHRDFSPNTQ--LRPLFLTQDYNLISLDYPKLAYEPCYTEAVHNAKYVARCTAQL  130

Query  137  LKKLVD--LIDLDTLHVIGHSLGAHIAGNIGRY-ANINLSRITGLDPALPLFYPSTCHVR  193
            L+ L++  L+ ++ LH+IG  LGAH+AG IG++     L  IT LDPA P +      ++
Sbjct  131  LRVLLESGLVKIEDLHLIGLGLGAHVAGFIGQFLPEHKLEHITALDPAKPFYMVKDPALK  190

Query  194  --STDAEAVVILHTDGGFYGTATNTGTIDFYVNGGSSVQPGCPIIFGGE--FCSHQRSTR  249
               TDA+ V ++HTD    G     G +DFY+N G S QP C  I   E  FC H R+  
Sbjct  191  LDPTDAKFVDVVHTDVTMLGLLDAVGHVDFYLNMGVS-QPNCGPINKMETHFCYHNRAAD  249

Query  250  IYAESLLNPKAFPAHKCLNE--------IADTEEVYFGDSTPKDIYGTYCFNTNAKPPYG  301
             YAES+ +P  F    C N         I D      G        G Y  +TN  PPY 
Sbjct  250  YYAESISSPSGFYGFYCPNFKSFAKGICIPDKNIELMGFHVDPKARGRYFLDTNNGPPYA  309

Query  302  K  302
            K
Sbjct  310  K  310


>VIT3_DROME unnamed protein product
Length=420

 Score = 70.9 bits (172),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 63/214 (29%), Positives = 96/214 (45%), Gaps = 20/214 (9%)

Query  104  NVIVLDWGEIAFNINYVYVSSQVVTIAKAVAESLKKLVDL-IDLDTLHVIGHSLGAHIAG  162
            ++I++D G    N    Y    V+     + ++L  L +  +  + +H+IG  + AH+AG
Sbjct  194  DLIIIDLGSTLTNFKR-YAMLDVLNTGAMIGQTLIDLTNKGVPQEIIHLIGQGISAHVAG  252

Query  163  NIGR----YANINLSRITGLDPALPLFYPSTC--HVRSTDAEAVVILHTDGGFYGTATNT  216
              G          L RITGLDPA  L         +   DA+ V  +HT     GT    
Sbjct  253  AAGNKYTAQTGHKLRRITGLDPAKVLSKRPQILGGLSRGDADFVDAIHTSTFAMGTPIRC  312

Query  217  GTIDFYVNGGSSVQPGCPIIFGGEFCSHQRSTRIYAESLL--NPKAFPA--HKCLNEIAD  272
            G +DFY NG S+  PG   +   E  +  R+TR +AES+   + + FPA     L +  +
Sbjct  313  GDVDFYPNGPSTGVPGSENVI--EAVA--RATRYFAESVRPGSERNFPAVPANSLKQYKE  368

Query  273  TE----EVYFGDSTPKDIYGTYCFNTNAKPPYGK  302
             +      Y G     D+ G Y    NAK P+G+
Sbjct  369  QDGFGKRAYMGLQIDYDLRGDYILEVNAKSPFGQ  402



Lambda      K        H
   0.324    0.138    0.456 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3617638992


Query= NP_001291369.1 allatotropin receptor precursor [Bombus terrestris]

Length=440
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

QRFPR_BRAFL  unnamed protein product                                  158     5e-44
SIFAR_DROME  unnamed protein product                                  164     7e-44
Q86RL0_DROME  unnamed protein product                                 158     4e-43
Q9VDC4_DROME  unnamed protein product                                 157     4e-43
RYAR_DROME  unnamed protein product                                   148     1e-39


>QRFPR_BRAFL unnamed protein product
Length=380

 Score = 158 bits (399),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 102/310 (33%), Positives = 163/310 (53%), Gaps = 19/310 (6%)

Query  74   VLIASHSVVFVVGLVGNALVCIAVYRNHSMRTVTNYFIVNLAVADFLVLLLCLPFTVLWD  133
            V +  + ++F+  L+GN LV + V++N  MRT  N FI +LA +D L+ ++C+P T++ +
Sbjct  49   VTLVFYVIIFLAALLGNTLVVVVVWKNKVMRTTMNIFICSLAASDLLITIVCIPVTLMQN  108

Query  134  ITETWFLGLTLCKAVPYLQTVSVTVSILTLTFISIDRWYAICFPLRFKSTTGRAKSAII-  192
            + + W +G  +CK VP++QT++V  SILTLT I+I+R+YAI  PL+ K    + ++ II 
Sbjct  109  MLQNWIMGDFMCKLVPFIQTIAVASSILTLTGIAIERYYAIIHPLKVKYLLSKTRAGIIL  168

Query  193  -GIWAAALLFDIPDLVVLHTVPPTHIKIKTVLFTQCDIS-WSQRSQVAFTIVKLIFLYTG  250
              +W  ++    P L V H     H  +    F  C    W Q  Q ++TI  L+ L+  
Sbjct  169  ALVWVVSVGVATPMLFV-HKAEEIHDFLYEQRFVTCQEKWWGQTQQTSYTIFNLVVLFII  227

Query  251  PLIFMSVAYWQIVKVLWRSNIPGHNLPSRASQMSQIPSTGGGNPEVQLRSRRKAAKMLVT  310
            PL+ M+  Y +I   LW     G               TG       +R +R+A KMLV 
Sbjct  228  PLLTMTSLYIRIAHRLWVQQPVG--------------VTGNFAHGNSVRRKRQAVKMLVV  273

Query  311  VVITFAICYFPVHLLSVLRYTTTLP-SNKWINAISLIAHGLCYFNSAVNPLIYNFMSGKF  369
            VV+ FA+C+ P H ++V+   T L    K    +  I   + + NS  NP++Y  ++  F
Sbjct  274  VVLLFAVCWLPYHTVTVMNELTGLRLEEKSAKLLIAIVQLIAFSNSFNNPVVYAILNENF  333

Query  370  RKAFRRTFRC  379
            +K F    RC
Sbjct  334  KKNFMTMLRC  343


>SIFAR_DROME unnamed protein product
Length=758

 Score = 164 bits (414),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 115/335 (34%), Positives = 187/335 (56%), Gaps = 34/335 (10%)

Query  57   EYVDRMINYIFPKFWDWVLIAS------HSVVFVVGLVGNALVCIAVYRNHSMRTVTNYF  110
            E +D  +++ F   +   L  S      + VVF+VGL+GN+ V   V R   MRTVTNYF
Sbjct  187  EQLDGSVDFGFDPLYRHSLAMSMVYCVAYIVVFLVGLIGNSFVIAVVLRAPRMRTVTNYF  246

Query  111  IVNLAVADFLVLLLCLPFTVLWDITETWFLGLTLCKAVPYLQTVSVTVSILTLTFISIDR  170
            IVNLA+AD LV++ CLP T++ +I   W LG  +CK VPY+Q VSV  S+ +L  +S+DR
Sbjct  247  IVNLAIADILVIVFCLPATLIGNIFVPWMLGWLMCKFVPYIQGVSVAASVYSLIAVSLDR  306

Query  171  WYAICFPLRFKSTTGRAKSAIIGIWAAALLFDIPDLVVLHTVPPTHIKIKTVL--FTQ--  226
            + AI +PL+ + T  RA+  IIGIW  AL+  IP L+    VP   +    ++  ++Q  
Sbjct  307  FIAIWWPLK-QMTKRRARIMIIGIWVIALVTTIPWLLFFDLVPAEEVFSDALVSAYSQPQ  365

Query  227  --CDISW--SQRSQVAFTIVKLIFLYTGPLIFMSVAYWQI-VKVLWRSNIPGHNLPSRAS  281
              C   W       + F +  L+  Y  P+  +++ Y  I +KV  RS IPG    S+ +
Sbjct  366  FLCQEVWPPGTDGNLYFLLANLVACYLLPMSLITLCYVLIWIKVSTRS-IPGE---SKDA  421

Query  282  QMSQIPSTGGGNPEVQLRSRRKAAKMLVTVVITFAICYFPVHLL-SVLRYTTTLPSNKW-  339
            QM ++          Q +S+ K  KMLV VVI F + + P++++ + +++ + +   ++ 
Sbjct  422  QMDRM----------QQKSKVKVIKMLVAVVILFVLSWLPLYVIFARIKFGSDISQEEFE  471

Query  340  -INAISLIAHGLCYFNSAVNPLIYNFMSGKFRKAF  373
             +  +  +A  L   NS +NP++Y+ ++ K+R+ F
Sbjct  472  ILKKVMPVAQWLGSSNSCINPILYS-VNKKYRRGF  505


>Q86RL0_DROME unnamed protein product
Length=471

 Score = 158 bits (399),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 112/338 (33%), Positives = 175/338 (52%), Gaps = 43/338 (13%)

Query  81   VVFVVGLVGNALVCIAVYRNHSMRTVTNYFIVNLAVADFLVLLLCLPFTVLWDIT---ET  137
            V+ ++G+VGN +V I + +   MR  TN F+ NL++AD LVLL+C P TVL ++    ET
Sbjct  19   VIMLLGVVGNVMVPIVIVKTKDMRNSTNIFLTNLSIADLLVLLVCTP-TVLVEVNTRPET  77

Query  138  WFLGLTLCKAVPYLQTVSVTVSILTLTFISIDRWYAICFPLR--FKSTTGRAKSAIIGIW  195
            W LG  +CKAVP+++      S+LT+  IS +R+YAIC PL+  +  T GRA    +  W
Sbjct  78   WVLGHEMCKAVPFVELTVAHASVLTILAISFERYYAICEPLKAGYVCTKGRAILICVLAW  137

Query  196  AAALLFDIPDLVVLHTVPPTHIKIKT--VLFTQCDISWSQRSQVAFTIVKLIFLYTGPLI  253
              A LF  P L V       +I   +  V  TQ    W+    +AF ++ +   +  P +
Sbjct  138  GIAALFTSPILWVAEYKLAEYIDGSSVAVCLTQAISDWT----LAFFLMTISVFFVVPFV  193

Query  254  FMSVAYWQIVKVLWRSNIPGHNLPSRASQMSQIPSTGGGNPEVQLRSRRKAAKMLVTVVI  313
             + V Y  I + L         + +RA+ +   P+     PE+ L++R++   ML  VV+
Sbjct  194  TLVVLYGIIARNL---------VSNRAAMLRARPT----KPELSLKARKQVVLMLGAVVL  240

Query  314  TFAICYFPVHLLS---VLRYTTTLPSNKWINAISLI--AHGLCYFNSAVNPLIYNFMSGK  368
            +F +C  P  +L+   +L    TL     +   SL+     + Y NSA+NP++YN MS K
Sbjct  241  SFFVCLLPFRVLTLWIILSTDQTLHDLGLVRYYSLLYFCRIMLYLNSAMNPILYNLMSTK  300

Query  369  FRKAFRR-------------TFRCARENGSRIQRGYLA  393
            FR+ F+R             T    +E+ SR +RG L+
Sbjct  301  FRRGFKRLCQDAGRLLLELVTLGRRKEDSSRGRRGTLS  338


>Q9VDC4_DROME unnamed protein product
Length=471

 Score = 157 bits (398),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 112/338 (33%), Positives = 176/338 (52%), Gaps = 43/338 (13%)

Query  81   VVFVVGLVGNALVCIAVYRNHSMRTVTNYFIVNLAVADFLVLLLCLPFTVLWDIT---ET  137
            V+ ++G+VGN +V I + +   MR  TN F+ NL++AD LVLL+C P TVL ++    ET
Sbjct  19   VIMLLGVVGNVMVPIVIVKTKDMRNSTNIFLTNLSIADLLVLLVCTP-TVLVEVNTRPET  77

Query  138  WFLGLTLCKAVPYLQTVSVTVSILTLTFISIDRWYAICFPLR--FKSTTGRAKSAIIGIW  195
            W LG  +CKAVP+++      S+LT+  IS +R+YAIC PL+  +  T GRA    +  W
Sbjct  78   WVLGHEMCKAVPFVELTVAHASVLTILAISFERYYAICEPLKAGYVCTKGRAILICVLAW  137

Query  196  AAALLFDIPDLVVLHTVPPTHIKIKT--VLFTQCDISWSQRSQVAFTIVKLIFLYTGPLI  253
              A LF  P L V       +I   +  V  TQ    W+    +AF ++ +   +  P +
Sbjct  138  GIAALFTSPILWVAEYKLAEYIDGSSVAVCLTQAISDWT----LAFFLMTISVFFVVPFV  193

Query  254  FMSVAYWQIVKVLWRSNIPGHNLPSRASQMSQIPSTGGGNPEVQLRSRRKAAKMLVTVVI  313
             + V Y  I + L         + +RA+ +   P+     PE+ L++R++   ML  VV+
Sbjct  194  TLVVLYGIIARNL---------VSNRAAMLRARPT----KPELSLKARKQVVLMLGAVVL  240

Query  314  TFAICYFPVHLLS---VLRYTTTLPSNKWINAISLI--AHGLCYFNSAVNPLIYNFMSGK  368
            +F +C  P  +L+   +L    TL     +   SL+     + Y NSA+NP++YN MS K
Sbjct  241  SFFVCLLPFRVLTLWIILSTDQTLHDLGLVRYYSLLYFCRIMLYLNSAMNPILYNLMSTK  300

Query  369  FRKAFRRTFRCA-------------RENGSRIQRGYLA  393
            FR+ F+R  + A             +E+ SR +RG L+
Sbjct  301  FRRGFKRLCQDAGRLLLELVTLGRRKEDSSRGRRGTLS  338


>RYAR_DROME unnamed protein product
Length=464

 Score = 148 bits (374),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 113/358 (32%), Positives = 163/358 (46%), Gaps = 37/358 (10%)

Query  82   VFVVGLVGNALVCIAVYRNHSMRTVTNYFIVNLAVADFLVLLLCLP--FTVLWDITETWF  139
            +F+  L+GN  VC  VY    MRTVTNYFI +LA+ D L+   C+P  F  L+ I   W 
Sbjct  115  IFIFALIGNGTVCYIVYSTPRMRTVTNYFIASLAIGDILMSFFCVPSSFISLF-ILNYWP  173

Query  140  LGLTLCKAVPYLQTVSVTVSILTLTFISIDRWYAICFPLRFKSTTGRAKSAIIGIWAAAL  199
             GL LC  V Y Q VSV VS  TL  ISIDR+ AI +PL+ + T   A   I G+W  AL
Sbjct  174  FGLALCHFVNYSQAVSVLVSAYTLVAISIDRYIAIMWPLKPRITKRYATFIIAGVWFIAL  233

Query  200  LFDIPDLVVLH---TVPPTHIKIKTVLFTQCDISWSQRSQVAFTIVKLIFL-YTGPLIFM  255
               +P  +V      + P H K +  +   C   W  R+Q  +  + L  L +  PL  +
Sbjct  234  ATALPIPIVSGLDIPMSPWHTKCEKYI---CREMWPSRTQEYYYTLSLFALQFVVPLGVL  290

Query  256  SVAYWQIVKVLWRSNIPGHNLPSRASQMSQIPSTGGGNPEVQLRSRRKAAKMLVTVVITF  315
               Y +I   +W    PG    +R  +M+              RS+RK  KM++TVVI F
Sbjct  291  IFTYARITIRVWAKRPPGEAETNRDQRMA--------------RSKRKMVKMMLTVVIVF  336

Query  316  AICYFPVHLLSVLRYTTTLPSNKWINAISLIAHGLCYFNSAVNPLIYNFMSGKFRKAF--  373
              C+ P ++L +L           +  +    H L   +   NP+IY +M+ +FR  F  
Sbjct  337  TCCWLPFNILQLLLNDEEFAHWDPLPYVWFAFHWLAMSHCCYNPIIYCYMNARFRSGFVQ  396

Query  374  -------RRTFRCARENGSRIQRGYLASTSNFPRIKSRTTTIRTTFKNNNNLQRNTEI  424
                    R + C R  G R+     A++   P +        TT+ +     R T +
Sbjct  397  LMHRMPGLRRWCCLRSVGDRMN----ATSGTGPALPLNRMNTSTTYISARRKPRATSL  450



Lambda      K        H
   0.324    0.138    0.456 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3617638992


Query= NP_001295235.1 3-hydroxy-3-methylglutaryl-coenzyme A reductase
[Bombus terrestris]

Length=910
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

HMDH_DROME  unnamed protein product                                   860     0.0   
Q9Y0F3_LEIMA  unnamed protein product                                 422     1e-139
Q587C0_TRYB2  unnamed protein product                                 393     3e-128
Q7YU59_DROME  unnamed protein product                                 49.3    1e-05 
X2J9B0_DROME  unnamed protein product                                 48.1    3e-05 


>HMDH_DROME unnamed protein product
Length=920

 Score = 860 bits (2221),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 472/935 (50%), Positives = 618/935 (66%), Gaps = 72/935 (8%)

Query  1    MLTHLFEIHGQFCAGHPLEVIVTTFTLTACILN------METGSG---------------  39
            M+  LF  HG+FCA HP EVIV   T+TAC+L       ++  SG               
Sbjct  1    MIGRLFRAHGEFCASHPWEVIVALLTITACMLTVDKNNTLDASSGLGTATASAAAAGGSG  60

Query  40   -----------HPRNSGTLPLALHCRP--GRCNSDD-----LNAADIIVMTIIRCLAILF  81
                        P + G    +   RP  G   S D      NAAD+I+MTI+RC A+L+
Sbjct  61   SGAGSGASGTIPPSSMGGSATSSRHRPCHGWSQSCDGLEAEYNAADVILMTIVRCTAVLY  120

Query  82   TYHQFRNLQKLGSKYILGIAGLFTVFSSVVFTSSVVNFGQSDISDLKDALFFFLLIIDLS  141
             Y+QF +L +LGSKY+LGIAGLFTVFSS +FT++++ F  SDIS+LKDALFF LL+IDLS
Sbjct  121  CYYQFCSLHRLGSKYVLGIAGLFTVFSSFIFTTAIIKFLGSDISELKDALFFLLLVIDLS  180

Query  142  KAAILAQLALSSRNKEEVRANIARGMSLLGPTITLDTLVETLLISIGSLSGVKRLEILSS  201
             +  LAQLALS  N+ EV  NIARG+ LLGP I+LDT+VE LL+ +G+LSGV+RLE+L  
Sbjct  181  NSGRLAQLALSGSNQAEVTQNIARGLELLGPAISLDTIVEVLLVGVGTLSGVQRLEVLCM  240

Query  202  FACLGVIVNYIVFMTFYPACLSLILELSRETNAMKPL--SADKIFIMHPLNEEDQKPNPV  259
            FA L V+VNY+VFMTFYPACLSLI +LSR    M  +   A    ++  L EE+QK NPV
Sbjct  241  FAVLSVLVNYVVFMTFYPACLSLIFDLSRSGVDMSVVREKAKGSLLLKSLTEEEQKANPV  300

Query  260  VERVKLIMIAGLFVVHANSRWPFKSDESDSAVEGEVSSVNSHVIVNSYNKTENSSEVKNY  319
            ++RVKLIM  GL  VH  SR  F   + D+  +    +++ +V   S N+TE S E+ + 
Sbjct  301  LQRVKLIMTTGLMAVHIYSRVAFSGSDYDAVDKTLTPTLSLNV---SNNRTE-SGEIADI  356

Query  320  LMNWLSVSADNIVILILLLALAVKFIFFEDKGDIAKQLRSKEEDDTEEKVENESVKGKEN  379
            ++ WL++SAD+IVI I+L+AL VKFI F+++  +  QLR         K    +   +E+
Sbjct  357  IIKWLTMSADHIVISIVLIALVVKFICFDNRDPLPDQLRQSGPVAIAAKASQTTPIDEEH  416

Query  380  ESEDVNVLSIKLPFKQNFSGMQSISFPSKIHNWSDDKEDQTIG--EKQCDIDKRDDKNLP  437
              ++ +         +N + ++++ F           EDQ+      Q D+     + + 
Sbjct  417  VEQEKDT--------ENSAAVRTLLF---------TIEDQSSANASTQTDLLPLRHRLVG  459

Query  438  PESKVPRSLKECLEIYKSD---LGASALTDEEIIQLVK--NKHIPAYQLEKAVGDMERGV  492
            P  K PR ++ECL+I  S     G +AL+DEEI+ +V     H P +++E  + D ERGV
Sbjct  460  P-IKPPRPVQECLDILNSTEEGSGPAALSDEEIVSIVHAGGTHCPLHKIESVLDDPERGV  518

Query  493  GIRRLIIGETGKFLDTLFD-LPYKNYDYSKVLGSCCENVIGYVPVPLGIAGPLLVDGELY  551
             IRR IIG   K      D LPY+++DY KVL +CCENV+GYVP+P+G AGPLL+DGE Y
Sbjct  519  RIRRQIIGSRAKMPVGRLDVLPYEHFDYRKVLNACCENVLGYVPIPVGYAGPLLLDGETY  578

Query  552  HIPMATTEGCLVASTNRGSRALLNCGVTSRVVADGMTRGPVVRFPNIVRASEAMAWMQDP  611
            ++PMATTEG LVASTNRG +AL   GV S V   GMTR P VRFP++ RA+EA +W+++ 
Sbjct  579  YVPMATTEGALVASTNRGCKALSVRGVRSVVEDVGMTRAPCVRFPSVARAAEAKSWIEND  638

Query  612  ENFKEMKENFDLTSRFARLTKIHIRIAGRHLFIRFVATTGDAMGMNMLSKGTEKSLNTVK  671
            EN++ +K  FD TSRF RL   HI + G  L+IRFVA TGDAMGMNM+SKG E +L  ++
Sbjct  639  ENYRVVKTEFDSTSRFGRLKDCHIAMDGPQLYIRFVAITGDAMGMNMVSKGAEMALRRIQ  698

Query  672  EHFPDMEILSLSGNFCTDKKPAAVNWIQGRGKSVVCEAVVPADIVTNVLKTSVHALVDVN  731
              FPDM+I+SLSGNFC DKKPAA+NWI+GRGK VV E  + A  + +VLKT    LV+ N
Sbjct  699  LQFPDMQIISLSGNFCCDKKPAAINWIKGRGKRVVTECTISAATLRSVLKTDAKTLVECN  758

Query  732  ISKNMIGSAIAGSVGGFNAHAANIVTAIFIATGQDPAQNVGSSNCMTLMEPWGADGSDLY  791
              KNM GSA+AGS+GG NAHAAN+VTA+F+ATGQDPAQNV SSNC T ME W  +  DLY
Sbjct  759  KLKNMGGSAMAGSIGGNNAHAANMVTAVFLATGQDPAQNVTSSNCSTAMECWAENSEDLY  818

Query  792  VSCTMPSIEIGTIGGGTGLPAQGACLAMLGVQGAHTDEPGENASRLARIICATVLAGELS  851
            ++CTMPS+E+GT+GGGTGLP Q ACL MLGV+GAH   PG+NA +LA+I+CATV+AGELS
Sbjct  819  MTCTMPSLEVGTVGGGTGLPGQSACLEMLGVRGAHATRPGDNAKKLAQIVCATVMAGELS  878

Query  852  LMAALTAGHLVKSHLRHNRSSTAVTNAISIPQNTT  886
            LMAAL    LVKSH+RHNRSS AV N+ + P N T
Sbjct  879  LMAALVNSDLVKSHMRHNRSSIAV-NSANNPLNVT  912


>Q9Y0F3_LEIMA unnamed protein product
Length=434

 Score = 422 bits (1086),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 205/417 (49%), Positives = 303/417 (73%), Gaps = 11/417 (3%)

Query  460  SALTDEEIIQLVKNKHIPAYQLEKAVG-DMERGVGIRRLIIGE----TGKFLDTLFDLPY  514
            ++++D EI++ V+NK I  + LE+A+  D +R + IRR I+ +    +      L  +PY
Sbjct  18   ASMSDTEIMKQVENKKIAFHGLEQALAPDYDRAIAIRREIVKKKICPSPAATHPLERVPY  77

Query  515  KNYDYSKVLGSCCENVIGYVPVPLGIAGPLLVDGELYHIPMATTEGCLVASTNRGSRAL-  573
            KNYD+S V+G  CEN++GYVPVP+G+AGPLL+DG+   +PMATTEG LVAS +RG+RA+ 
Sbjct  78   KNYDWSSVVGQSCENILGYVPVPVGLAGPLLLDGKEVALPMATTEGALVASAHRGARAIN  137

Query  574  LNCGVTSRVVADGMTRGPVVRFPNIVRASEAMAWMQDPENFKEMKENFDLTSRFARLTKI  633
            L+ G  + V+ +GMTR PVV   +   A   + + +  E F  ++E F+ T+RF +L  I
Sbjct  138  LSGGCRTAVLKEGMTRAPVVEVNSFDEAITVIKFCE--ERFDVLREAFESTTRFGKLLSI  195

Query  634  HIRIAGRHLFIRFVATTGDAMGMNMLSKGTEKSLNTVKEHFPDMEILSLSGNFCTDKKPA  693
               +AGR + +RF A TGDAMGMNM++KG +K+L  +++H P + +L+LSGNFCTDKKP+
Sbjct  196  KCAMAGRQVHLRFSAFTGDAMGMNMITKGCDKALQVLQQHIPSVRVLTLSGNFCTDKKPS  255

Query  694  AVNWIQGRGKSVVCEAVVPADIVTNVLKTSVHALVDVNISKNMIGSAIAGSVGGFNAHAA  753
            A+NW++GRGKSVV EAV+  D+V +VLK +V ++V +N++KN+ GSA+AGS+GGFNAHAA
Sbjct  256  ALNWVEGRGKSVVAEAVIKRDVVESVLKCTVDSVVSLNVTKNLRGSALAGSIGGFNAHAA  315

Query  754  NIVTAIFIATGQDPAQNVGSSNCMTLMEPWGADGSDLYVSCTMPSIEIGTIGGGTGLPAQ  813
            NIV A++IATGQDPAQ V S+ CMT ++     G DL +S  MPSIE+G +GGGTGL +Q
Sbjct  316  NIVAALYIATGQDPAQVVESATCMTTVDK---AGEDLVISLMMPSIEVGAVGGGTGLSSQ  372

Query  814  GACLAMLGVQGAHTDEPGENASRLARIICATVLAGELSLMAALTAGHLVKSHLRHNR  870
             A L ++G  G++ ++PG ++ ++AR++   V+ GELSL++ L AGHL+ +H++ NR
Sbjct  373  RAMLELMGCAGSNKEDPGAHSRQIARVVAGAVICGELSLLSGLAAGHLLSAHMKLNR  429


>Q587C0_TRYB2 unnamed protein product
Length=434

 Score = 393 bits (1009),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 210/422 (50%), Positives = 300/422 (71%), Gaps = 14/422 (3%)

Query  458  GASALTDEEIIQLVKNKHIPAYQLEKAVG-DMERGVGIRRLIIGE-------TGKFLDTL  509
            G  A+++ E+++ V ++ +  Y LE+A+  D +R + +RR ++ +             +L
Sbjct  16   GWGAMSNAELVKAVSSRQLTFYGLEQALEPDYQRAIAVRREVVSDYVASSQSAEVKRKSL  75

Query  510  FDLPYKNYDYSKVLGSCCENVIGYVPVPLGIAGPLLVDGELYHIPMATTEGCLVASTNRG  569
              +P++NY++ +V+G  CEN++GYVP+PLG+AGP+++DG  Y IPMATTEG LVAST+RG
Sbjct  76   ERIPFENYEWDRVVGQNCENIVGYVPIPLGMAGPIIMDGCEYPIPMATTEGALVASTHRG  135

Query  570  SRALLNCG-VTSRVVADGMTRGPVVRFPNIVRASEAMAWMQDPENFKEMKENFDLTSRFA  628
            +RA+   G   + ++ +GM+R PVV   ++  A     +    ENF E+K  F+ T+RF 
Sbjct  136  ARAISQSGGCKTLILGEGMSRAPVVEVESLEEAGRLHNFC--VENFTEIKAAFESTTRFG  193

Query  629  RLTKIHIRIAGRHLFIRFVATTGDAMGMNMLSKGTEKSLNTVKEHFPDMEILSLSGNFCT  688
            +L  +   I GR  +IRF ATTGDAMGMNM++KG +K+L  +K++FP M++++LSGN+CT
Sbjct  194  KLQSLKCVIIGRKAYIRFRATTGDAMGMNMITKGVDKALELIKQNFPSMKVIALSGNYCT  253

Query  689  DKKPAAVNWIQGRGKSVVCEAVVPADIVTNVLKTSVHALVDVNISKNMIGSAIAGSVGGF  748
            DKKP+AVNWI+GRGK+VV EA+V  ++V   LK +V  LV +NI KN++GSA+AGSVGGF
Sbjct  254  DKKPSAVNWIEGRGKTVVAEALVRGELVERTLKCTVEDLVSLNIDKNLVGSAVAGSVGGF  313

Query  749  NAHAANIVTAIFIATGQDPAQNVGSSNCMTLMEPWGADGSDLYVSCTMPSIEIGTIGGGT  808
            NA AAN+V AIFIATGQDPAQ V SS C+T M      G+DL +S  MPSIE+GT+GGGT
Sbjct  314  NAQAANVVAAIFIATGQDPAQVVESSTCITTMSKV---GNDLLISVAMPSIEVGTVGGGT  370

Query  809  GLPAQGACLAMLGVQGAHTDEPGENASRLARIICATVLAGELSLMAALTAGHLVKSHLRH  868
            GLPAQ  CL M+G  G++ + PG NA  L+R++ A VL+ ELSLM+ L AGHL+ +H+R 
Sbjct  371  GLPAQSGCLDMIGCAGSNKEAPGANAQLLSRLVAAGVLSAELSLMSGLAAGHLLSAHMRL  430

Query  869  NR  870
            NR
Sbjct  431  NR  432


>Q7YU59_DROME unnamed protein product
Length=1287

 Score = 49.3 bits (116),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 53/216 (25%), Positives = 104/216 (48%), Gaps = 18/216 (8%)

Query  34   METGSGHPRNSGTLPLALHCRPGRCNSDDLN-AADIIVMTIIRCLAILFTY--------H  84
            +E  + + +N+ +  + +     R   D+LN  +   V+TI+    I+F Y         
Sbjct  586  VEFMTNYTKNNMSQYMDIAFTSERSIEDELNRESQSDVLTILVSYLIMFMYIAISLGHVK  645

Query  85   QFRNLQKLGSKYILGIAGLFTVFSSVVFTSSVVNFGQSDISD---LKDALFFFLLIIDLS  141
            +F+ +  + SK  LGI G+  V +SVV  SSV  FG   +     + + + F +L + + 
Sbjct  646  EFKRV-FIDSKITLGIGGVIIVLASVV--SSVGVFGYIGLPATLIIVEVIPFLVLAVGVD  702

Query  142  KAAILAQLALSSRNK--EEVRANIARGMSLLGPTITLDTLVETLLISIGSLSGVKRLEIL  199
               IL Q     + K  E +   + R +  +GP+I L +L E+    +G LS +  +   
Sbjct  703  NIFILVQTHQRDQRKPNETLEQQVGRILGKVGPSILLTSLSESFCFFLGGLSDMPAVRAF  762

Query  200  SSFACLGVIVNYIVFMTFYPACLSLILELSRETNAM  235
            + +A + +I+++++ +T + +  +L  +  RE N M
Sbjct  763  ALYAGVALIIDFLLQITCFVSLFTLDTK-RREENRM  797


>X2J9B0_DROME unnamed protein product
Length=1283

 Score = 48.1 bits (113),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 52/216 (24%), Positives = 104/216 (48%), Gaps = 18/216 (8%)

Query  34   METGSGHPRNSGTLPLALHCRPGRCNSDDLN-AADIIVMTIIRCLAILFTY--------H  84
            +E  + + +N+ +  + +     R   D+LN  +   V+TI+    I+F Y         
Sbjct  582  VEFMTNYTKNNMSQYMDIAFTSERSIEDELNRESQSDVLTILVSYLIMFMYIAISLGHVK  641

Query  85   QFRNLQKLGSKYILGIAGLFTVFSSVVFTSSVVNFGQSDISD---LKDALFFFLLIIDLS  141
            +F+ +  + SK  LGI G+  V +SVV  SSV  FG   +     + + + F +L + + 
Sbjct  642  EFKRV-FIDSKITLGIGGVIIVLASVV--SSVGVFGYIGLPATLIIVEVIPFLVLAVGVD  698

Query  142  KAAILAQLALSSRNK--EEVRANIARGMSLLGPTITLDTLVETLLISIGSLSGVKRLEIL  199
               IL Q     + K  E +   + R +  +GP++ L +L E+    +G LS +  +   
Sbjct  699  NIFILVQTHQRDQRKPNETLEQQVGRILGKVGPSMLLTSLSESFCFFLGGLSDMPAVRAF  758

Query  200  SSFACLGVIVNYIVFMTFYPACLSLILELSRETNAM  235
            + +A + +I+++++ +T + +  +L  +  RE N M
Sbjct  759  ALYAGVALIIDFLLQITCFVSLFTLDTK-RREENRM  793



Lambda      K        H
   0.324    0.138    0.456 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3617638992


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Aug 1, 2023  12:07 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= NP_001295236.1 hydroxymethylglutaryl-CoA synthase 1 [Bombus
terrestris]

Length=453
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q57YL2_TRYB2  unnamed protein product                                 81.3    3e-16
O77289_DROME  unnamed protein product                                 30.0    5.5  
O01737_CAEEL  unnamed protein product                                 29.6    6.5  
DGK_DICDI  unnamed protein product                                    28.9    7.9  


>Q57YL2_TRYB2 unnamed protein product
Length=499

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 76/274 (28%), Positives = 115/274 (42%), Gaps = 34/274 (12%)

Query  6    VGIKAIEIYFPAQYVEQTELEQFDGVSAGKYTIGLGQCRMGFCNDREDINSLCLTVVHRL  65
             GI  + +Y P   V   E   + G    K +  +G       ++ E+  ++  + V RL
Sbjct  9    AGISGMSVYTPPCRVALKEWCNWTGNDWKKVSNVVGDS-FRVPSNNENAYTMAASAVLRL  67

Query  66   MDRYEIKPQDIGRLEVGTETILDKSKS-------VKSILMQLFEPYDCTDIEGADTTNAC  118
            +  YE+ P  +G L  GTE+  D S         V   L +L  P      E  +  +AC
Sbjct  68   ILNYEVDPSRVGFLGFGTESSSDNSAGAVIVRGMVDKALKELGMPALSRHCEVPEFKHAC  127

Query  119  YGGTAALLNAISWVESSAWDGRLALVVAGDNAVYSSGS-ARPTGGAGAVAMLIGPNAPLI  177
             GG  AL  A  + E    D +LA+VVA D A Y+ GS    T GAG+VAML+    P +
Sbjct  128  LGGVYALKGAARYAEVDGGDDKLAIVVASDIAEYALGSTGEQTQGAGSVAMLV-QKTPRL  186

Query  178  IDRGVRSSCMKHAY---DFYKPNLK---------------SEYPIVDGKLSVQCYLNALD  219
            ++   +++     Y   DF KP  +                ++P+  G  S   YL+ + 
Sbjct  187  LELNTKAAGSASDYRGPDFRKPYRRHFIKEYGSTAENGKIPDFPVFSGPYSTLVYLDEVT  246

Query  220  TCYQTYCKKMRSKHNHNVT--LDSFNAFLFHSPY  251
               +     M S+ N       DS +A  FH PY
Sbjct  247  AAVEN----MLSRLNQEPADYYDSVSALFFHRPY  276


>O77289_DROME unnamed protein product
Length=1021

 Score = 30.0 bits (66),  Expect = 5.5, Method: Compositional matrix adjust.
 Identities = 21/95 (22%), Positives = 42/95 (44%), Gaps = 11/95 (12%)

Query  188  KHAYDFYKPNLKSEYPIVDGKLSVQCYLNALDTCYQTYCKKMRS--KHNHNVTLDSFNAF  245
            +  +D  K N KS        L + C + ++ + + +     R   K   N+  DS+   
Sbjct  236  RREFDVSKVNPKS--------LPLHCVVESVHSLHASLTIDTRQPWKRRPNIETDSYVII  287

Query  246  LFHSPYCKLVQKSFARLAFI-DFLNTSKEEVSKKH  279
               +P+ ++VQ +  RL +  +  NT++  +  KH
Sbjct  288  AAXTPWSEIVQTALQRLGYSQEVANTARGSLIIKH  322


>O01737_CAEEL unnamed protein product
Length=1866

 Score = 29.6 bits (65),  Expect = 6.5, Method: Compositional matrix adjust.
 Identities = 39/173 (23%), Positives = 69/173 (40%), Gaps = 24/173 (14%)

Query  213   CYLNALDTCYQTYCKKMRSKHNHNVTLDSFNAFLFHSPYCKLVQKSFARLAFIDFLNTSK  272
             C    +DTC Q   + +++K    + L S       S   + +++    L   +F++T+K
Sbjct  982   CIAAKVDTCVQLSREAIKAKKCVVIGLQSTG----ESATLETLEEMGGELN--EFVSTAK  1035

Query  273   EE----VSKKHPELAQFHDVKLEDTYFNRDIEKSFMNLSKPNFQQKTQPSLMIANQVGNM  328
                   + K  P  A F       +  +RDI K F +  +P  ++KT+ +L     VG  
Sbjct  1036  TVLYGLIDKHFPTDASF-------SMGDRDIFKDFDDFERPAKRRKTRETLSFLGDVGFD  1088

Query  329   YTPSVYTGLASLLISKPIKELAGSKVGVFSYGSGLCSTMYSLTITNECNEKSN  381
                 V TG+   +     K +           SG+  +  S +  N  NE +N
Sbjct  1089  TWTGVTTGMGGRVGDGVTKNITRGL-------SGIGRSSMSSSTGNTNNEDAN  1134


>DGK_DICDI unnamed protein product
Length=285

 Score = 28.9 bits (63),  Expect = 7.9, Method: Compositional matrix adjust.
 Identities = 11/27 (41%), Positives = 19/27 (70%), Gaps = 0/27 (0%)

Query  214  YLNALDTCYQTYCKKMRSKHNHNVTLD  240
            YL+ LD CY+ +  +M+SK ++ + LD
Sbjct  187  YLSGLDNCYKKFLIEMKSKGSNVIILD  213



Lambda      K        H
   0.318    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5035546020


Query= NP_001318040.1 vitellogenin-like precursor [Bombus terrestris]

Length=1523
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VF24_DROME  unnamed protein product                                 203     2e-52
VIT6_CAEEL  unnamed protein product                                   86.7    1e-16
CLOT_PENMO  unnamed protein product                                   46.2    3e-04
G8JY38_CAEEL  unnamed protein product                                 43.5    0.002
VIT2_CAEEL  unnamed protein product                                   43.5    0.002


>Q9VF24_DROME unnamed protein product
Length=1470

 Score = 203 bits (517),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 209/901 (23%), Positives = 391/901 (43%), Gaps = 84/901 (9%)

Query  121  PFLVIYEENGHLEGVKFAEDEPGWSKNVKKGIVSMLQLDLDQMHVQSPIKAHSFISQEVT  180
            PF +   ++G +  V F E +P WS N K+ I S+LQ  +          + +F+  E+ 
Sbjct  104  PFKIALTKDGAISHVVFKEGDPIWSMNFKRAIASVLQFQMK--------SSGAFVVDELG  155

Query  181  IHGNCEVAYNVQPMDEMQATSGKELVVTKFYDSMNCSHFK---YHEFNHVECHKCQIHER  237
            IHG C   Y V       +     + + K  +   C  +    +   ++V  + C+   +
Sbjct  156  IHGTCRTEYFV-------SNRTNYISIRKTPEVKTCKPYSEAVHTTRSNVPPNTCEFDHQ  208

Query  238  NDMSTASRRVIVIDNHDNEILIKKLIGHA----VINYFPWLAASEAHYLLTNQTLFLEKV  293
              +   +  +  +  H NE      + HA    +I+ F   +  EA ++ +   L     
Sbjct  209  KSVIIGNEAIYGMSPH-NETGYYLSMAHAKGTTLIHTFE--STGEAQFINSELLLNFLNE  265

Query  294  VPVSDIQLMGFKHLIVSPIEKVIYDEPKTPYVPEADI-DVTGHRHVVKLDELVVKMKKML  352
             P+ +             IE  +  EP    +   D  D TG R   + + L+ +   +L
Sbjct  266  TPIDN----------PIDIETSMAAEPSNLELQRLDPNDPTGGRSPQQQETLIAQAGTLL  315

Query  353  DEVAGYLKETHVDKKQIDWKHDQTINRILHVMSYMNVASLNKVFSEIEDIKDAKVEAVRN  412
            D +A  L+ T     +    +D T++ ++ ++S M+  SL K++ E++     + E +RN
Sbjct  316  DSLAEALETTEF---KFSEPYDSTLSDVIKLLSEMDFDSLTKLYREVDIGTSYRQETIRN  372

Query  413  IFLTMVSHVGTPAACLFTRNVVRTKSVPNWVAVTMLANLPMHVKVSSKELLLQMEELLNL  472
            IF  ++  +GT A+   T ++V  K     +AV +L  +P H+   S EL+ + E+ LN+
Sbjct  373  IFHEIIPRIGTKASVFLTHHLVLNKLTKPQIAVQLLIPMPFHIFELSAELVQKCEDFLNI  432

Query  473  GEFVSPSVREAGIFCFATLIHKTFKKEQTEVVDPLIERYLRHFMDHVRNEPMFHMKMVYM  532
            G    P VR+A I  FATLIH  +  +  +      E Y++ + +   ++  F  KM+Y+
Sbjct  433  GP-DRPDVRQAAILSFATLIHNVYVAKGID--KEKFEEYVQKYFNAYLSDRDFDQKMLYL  489

Query  533  MAMKNVRSKHVLKHLEPIIKGEEIVSEKPHNIRVQAIW-ILKNINVHSNYIHDILWPVLS  591
              + N++  +V  +LEPI++       +  +++ QA W  L   +  +  I+++ WP+  
Sbjct  490  QGLNNLQLGNVANYLEPIVQD----PNEHEDLKFQAAWTTLALADRRAERIYEVYWPIFE  545

Query  592  DVSLPSAVRIAAFNVLIHQVNQEPNLGRVMNIYWLMVYEKDEHLYNYYVDTVKGLANSVD  651
              +    +R+AA  +L+      P   R+++I+ ++  E D H+ NYY  TV  ++ +  
Sbjct  546  SRNASLELRVAAVTLLLI---SNPTAARLISIHRIIQSETDPHMINYYRTTVTSISETTY  602

Query  652  PCLMKIREMAKKILKFIRIRNLNQPLSSKIHV------DYVDEKYGFGESVMASLVLDNL  705
            PC   +R    ++L ++  R+L Q   S+  V      DY D K+G G  +   LV D  
Sbjct  603  PCYQHLR----RLLSYMH-RHLPQKPESRYWVTGNYIFDYRDSKFGIGAMLQVFLVGDPK  657

Query  706  TGLPYVGSVEHVETVAHKPVTTLGVHWNIDGMSKILKHINHNVLHKIVETIKNDNVKNIL  765
            + +P V   +       K    L ++    G+   +  +N        +     ++K +L
Sbjct  658  SDMPVVAFFKFDTEALGKFTGQLALYIKARGLPDTI--LNKMQSRNGSDPFTFKSIKALL  715

Query  766  NRAVKDVPAI--KDINVNVILTMNDNVVFILHSDESNSLKL-LDKLKEWNKLITEYLNVI  822
              A+   P I  KD+++  IL M    V   + ++    +L  D + E  + I    + I
Sbjct  716  --AMLQAPIINSKDLHLEFILQMEGKTVLSYYLNQRMFRQLTYDNILERMQQIIRTDSHI  773

Query  823  NWQTVLYHSHFEMHMVTDLGVPAVLASKVPSLSSLRGSVEYSENKNHLILKSKL----KY  878
            N QTV +       + T LG  + +  +   L+SLRG++  +E +N  I K  L    +Y
Sbjct  774  NMQTVRWPFMNRYTVPTVLGTSSDVLLQTTVLTSLRGNI--TEQRNSPITKHTLEIDARY  831

Query  879  QQWMHGEYVMSIYNPVVDSWHSIRKTSSVDVTLPCDIAIGYNQE-TKSFKVSLARLPVSE  937
              +         YNP ++  H I +     + +P    +  N+  +K  + S +R    +
Sbjct  832  SSY--ASVRSRSYNPFLNLDHEINREQGFLIYIPFSSELHLNESGSKCRRYSFSR---PQ  886

Query  938  FSVVGVSFHGKNYVTLTGDQHDLLKKLCSTCRHHEVITTGASLKTYESNFDSKDTGTRFS  997
                G+SF  +      G    L+ K  +      ++  G +      ++   D G R S
Sbjct  887  NLTSGLSFKSRAVTKTRG----LITKTAAAPFEEIMVPEGRNDVVQLFSYPMTDLGVRLS  942

Query  998  M  998
            M
Sbjct  943  M  943


>VIT6_CAEEL unnamed protein product
Length=1651

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 182/933 (20%), Positives = 370/933 (40%), Gaps = 164/933 (18%)

Query  32   QAPFPHGKIVTYKYHADVKAGIIDPAPFASDFNIECLLQVHHDVTNPNS-----KNTFYV  86
            ++ F  G+   Y ++  + AG+  P P           QV    T+ N+     + T + 
Sbjct  31   ESSFRAGREYRYLFNGQLSAGL--PVPSTPQGISRLQSQVTLQWTDGNTVRMQLQKTRFA  88

Query  87   TLSDMKHGLYNGPMKHYESVSHMLPIDAAKALLNPFLVIYEENGHLEGVKFAEDEPGWSK  146
            T     + +   P + +E V  M   +  + L  P    YE +G +  ++FAE++  WS+
Sbjct  89   TSQQESNSMKMLPFERFEEVERM-NREHQELLSMPVEFDYE-HGLVREIRFAENDQPWSE  146

Query  147  NVKKGIVSMLQLDL---------DQMHVQSPIKAHSFISQEVTIHGNCEVAYNVQPMDEM  197
            N+K+ +++MLQ+++         ++   Q P    SF + E T+ G CEV Y V   +E+
Sbjct  147  NIKRAVINMLQVNILKKEKYEGAEKSDNQEP--TFSFTNVERTLEGECEVLYTV---EEI  201

Query  198  QATSGKELVVTKFYDSMNCSHFKYHEFNHVE---CHKCQIHERNDMSTASRRVIVIDNHD  254
            +    +    +  +D   C+   Y   +HV+   C  CQ     D  +++     I    
Sbjct  202  KKEDEQRWAKSINFDK--CTRRPY--IHHVQTPVCKDCQQTLEQDKMSSTVLNYNITGTS  257

Query  255  NEILIKKLIGHAVINYFPWLAASEAHYLLTNQTLFLEKVVPVSDIQLMGFKHLIVSPIEK  314
            +  LI  +   +   + P    SE H L++  TL   +++   + +    K +      +
Sbjct  258  SSFLINSVELRSQHLFAP---ISEKHQLVSAFTLNTMELIYAGE-KKTEIKQVRNEKTSE  313

Query  315  VIYDEPKTPYVPEADIDVTGH----RHVVKLDELVVKM-KKMLDEVAGYLKETHVDKKQI  369
            ++Y++       E     TG     R + +  E  V+M KKM   +A       +++ + 
Sbjct  314  LVYNQESE--WAEQQWAQTGEEKYLRQLPQWTENKVEMIKKMFSLMA-----KQIEQGEA  366

Query  370  DWKHDQTINRILHVMSYMNVASLNKVFSEIEDIKDAKV-EAVRNIFLTMVSHVGTPAAC-  427
            + +   T+ RI+ V+   N   L +++  + + KD K+ E +R+I+   ++  GT     
Sbjct  367  ELEAAHTVARIVKVLRECNEEQLEQIYRHVAEHKDEKIAEQLRSIYFNTLALAGTRVTIQ  426

Query  428  LFTRNVVRTKSVPNWVAVTMLANLPMHVKVSSKELLLQMEELLNLGEFVS----------  477
             F   V   K++            P+   V+ K L+      L + E ++          
Sbjct  427  QFVDKVQSRKNI-----------APLKASVAIKTLVDMRYPSLAIAEDIARLCESDVSSS  475

Query  478  -PSVREAGIFCFATLIH-------KTF----------KKEQTEVVDPLIERYLRHFMDHV  519
             P++R++    +  +++       + F          +  +  +VD L++++        
Sbjct  476  FPALRQSCWLTYGAIVNGVCGQTPRVFVQKNGVKMCPRDAKQRIVDKLVQQF--------  527

Query  520  RNEPMFHMKMVYMMAMKNVRSKHVLKHLEPIIKGEEIVSEKPHNIRVQAIWILKNINVH-  578
             +    + K++ +  + N      +  LE II  E+  +     IR QAI   + +    
Sbjct  528  ESASTRYEKVLALKTLANAGLDLSVYPLEKIILNEQHET----TIRTQAIESFRRLRTQM  583

Query  579  SNYIHDILWPVLSDVSLPSAVRIAAFNVLIHQVNQEPNLGRVMNIYWLMVYEKDEHLYNY  638
               I  +L PV  +   P  +R++A + +I+    +P    +  I   +  E+++ +  +
Sbjct  584  PTKIQRVLMPVYLNRQQPQHIRMSALHQIIY---TQPEWSVLSQIGNQLRQERNQQVRAF  640

Query  639  YVDTVKGLANSVDPCLMKIREMAKKILKFIRIRNLNQPLSSKIHVDYVDEKY--------  690
             +  ++  AN+  PC        + +L  I       P SS+  +D  +  Y        
Sbjct  641  TLSLLRSYANNESPCEQTFSSRVQSLLNNI-------PFSSQ-EIDRFESVYGKWSTYSR  692

Query  691  ----GFGESVMASLVLDNLTGLPYVGSVEHVETVAHKPVTTLGVHWN---------IDGM  737
                GF  +  +    +++     + S+E V          L   WN            M
Sbjct  693  RHQSGFEANFASLFTTESVLPTEMMASIEGV----------LSGEWNQYFAQIGFTQKNM  742

Query  738  SKILKHINHNVLHKIVETI------------KNDNVKNILN--RAVKDVPAIKDINVNVI  783
             KI+K +  NV  K +E I              + + N+L   R  +   + +D +  V 
Sbjct  743  EKIIKKLLSNVQEKGLEQIVVRGKRASGSFQPTEFLSNLLEKLRITRRQSSEQDPHAFVY  802

Query  784  LTMNDNVVFILHSDESNSLKLLDKLKEWNKLITEYLNVINWQTVLYHSH-----FEM--H  836
            +   D     L  D  +  +++  + +  +L    +  +  Q + + +      +E    
Sbjct  803  IRHRDMDYAFLPIDADSIPEVVRSMIQGGRLEIGDIERVLAQGIHFSASNAAFLYETVRR  862

Query  837  MVTDLGVPAVLASKVPSLSSLRGSVEYS-ENKN  868
            + T +G+P    SK+P++SS+RG V +  E KN
Sbjct  863  VPTPMGLPVQFTSKMPTISSIRGQVTFELEPKN  895


>CLOT_PENMO unnamed protein product
Length=1670

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 57/252 (23%), Positives = 106/252 (42%), Gaps = 39/252 (15%)

Query  377  INRILHVMSYMNVASLNKVFSEIEDIKDAKVEAVRNIFLTMVSHVGTPAACLFTRNVVRT  436
            I R++  ++ ++   +  +++      D K    + IF+ +V H GT  A  F       
Sbjct  407  IGRLVEAVANLDYPYIQTLYTHF----DGKGTMQKYIFVQLVIHAGTEPAVNF-------  455

Query  437  KSVPNWVAVTMLANLPMHVKVSSK---ELLLQMEELLNLGEFVSPSVREAGIFCFATLIH  493
             +V N   +         + VS +    +   M  L+N  E +  S+   G+  FATL H
Sbjct  456  -AVDNLSDILFYVTFYESIGVSLRTPAPIPKIMHSLINGEEGLHHSL---GLMNFATLAH  511

Query  494  KTFKKEQTE------------VVDP--LIERYLRHFMDHVRNEPM-FHMKMVYMMAMKNV  538
                 E  +              DP  +I  ++ + +  + N+      +++Y+ A+ N+
Sbjct  512  DACLSEDRKHFYFDYSCGPKTTCDPELIITNFIPYLVRELGNQGKDVWQRLIYLQALSNL  571

Query  539  RSKHVLKHLEPIIKGEEIVSEKPHNIRVQAIWILKNINVHS---NYIHDILWPVLSDVSL  595
             +   +  L+PII G   V+E    +R  AIW L   N+H    + I++IL P++ +   
Sbjct  572  GTPQTINVLKPIILG---VTETNIFMRTNAIWSLSAYNMHKTALSQIYEILMPIIENKGE  628

Query  596  PSAVRIAAFNVL  607
               +R  AF  L
Sbjct  629  QFEIRNIAFLTL  640


 Score = 33.5 bits (75),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 60/306 (20%), Positives = 114/306 (37%), Gaps = 82/306 (27%)

Query  1242  KTRECIEEALRHSTLRKYTVNMTIRKVPLY----------------LTSIVNMAQDILRA  1285
             + +E IE+   +ST   Y   + I   PLY                L +I     DI++A
Sbjct  1256  RVKEAIEKGCDYST---YAPGIDIITSPLYDHSHITATWTPDFPDNLKNITYYVDDIIKA  1312

Query  1286  TYFSHMKY--TWNH------------VDPGNAKIVLEFPHSTSLLNIAAATPMYSYELVH  1331
             +    +++  T  H            ++ G   +  E P++ S++N          EL  
Sbjct  1313  SLSKKIEFDHTSAHHASRVEIDATKCIETGLWTVRTEKPYAVSIIN----------ELEL  1362

Query  1332  LPFGDPLWSPWMDNAQFSFLMLHNYVKGGLKF-CTIRPRVLVTLDNGIIPYIVRDKWTLL  1390
               + +P+++P    A  +  +L+    G     CTI    + T D  +  Y   + W  +
Sbjct  1363  PAWANPIFTP----APLATTLLYGLTVGRTPVSCTIDETKVRTADGKVFAYEPSECWNAM  1418

Query  1391  SGDH-IDQMYSIFVKSVQDNVLALKVYIGEHELEIMPVDGGMTVT-------IDNEVIDK  1442
             + D   DQ  ++ V++            G+ E+ I+    G+ +        ++ E    
Sbjct  1419  TLDTTFDQRGAMLVRNT-----------GQWEVRIIWQKEGLVIDMSPTNFLVNGEPAKG  1467

Query  1443  TNIEKGVMIPKNSDSYVIRLTKGYEIMTIESQLLPFQIYYLPDSVTIFMGTSLQGQITGM  1502
             T+    V+   + DS+ I    G  +              + D V + +G   +G  TG+
Sbjct  1468  TDNRYTVL--HHDDSHTIVFESGTSVK-------------VSDKVEVLLGLDHRGHTTGI  1512

Query  1503  CGHMDS  1508
             CG+ D 
Sbjct  1513  CGNFDG  1518


 Score = 32.3 bits (72),  Expect = 4.6, Method: Compositional matrix adjust.
 Identities = 43/154 (28%), Positives = 65/154 (42%), Gaps = 24/154 (16%)

Query  15   MDTLIALLAILATAFAIQAPFPHGKIVTYKYHADVKAGI--IDPAPFASDFNIECLLQVH  72
            M  LI LL  L    A+Q     G    Y+Y A V +GI  I+    A+    +  +Q+ 
Sbjct  1    MKALILLL--LGACQALQP----GLEYQYRYSARVASGIPSINRQFAAAGIQADVTVQMA  54

Query  73   HDVTNPNSKNTFYVTLSDMKHGLYNGPMKHYESVSHMLPI------DAAKALLNPFLVIY  126
             D +         V  S+++ G  N  +     +   LPI      D    L  PF VI 
Sbjct  55   ADYS-------VVVQFSNIEVGDLNKVLDC--DLRAPLPIEYHPLEDYVDLLEKPFRVIM  105

Query  127  EENGHLEGVKFAEDEPGWSKNVKKGIVSMLQLDL  160
             E+ H+       +EP W  NV+KG V++ ++ L
Sbjct  106  NES-HVPSYMEGPEEPIWISNVRKGFVNIFRVPL  138


>G8JY38_CAEEL unnamed protein product
Length=1558

 Score = 43.5 bits (101),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 29/120 (24%), Positives = 57/120 (48%), Gaps = 22/120 (18%)

Query  129  NGHLEGVKFAEDEPGWSKNVKKGIVSMLQL-------DLDQMHV-----QSPIKAHSFIS  176
            NG +  ++F +++  WSKN+K+ +V+M+         +++++       +   +  SF +
Sbjct  117  NGLISELQFDKEDAEWSKNMKRAVVNMISFNPIAPRNEIEKIESSYDKEEQSEENTSFFT  176

Query  177  QEVTIHGNCEVAYNVQPMDEMQATSGKELVVTKFYDSMNC---SHFKYHEFNHVECHKCQ  233
             E T+ G+C+VAY V           K+ ++TK  +   C   S   Y      EC +C+
Sbjct  177  NEKTLEGDCQVAYTV-------IREQKKTIITKSINFDKCTERSEIAYGLRYSSECPECE  229


 Score = 40.4 bits (93),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 37/174 (21%), Positives = 78/174 (45%), Gaps = 8/174 (5%)

Query  507  LIERYLRHFMDHVRNEPMFHMKMVYMMAMKNVRSKHVLKHLEPIIKGEEIVSEKPHNIRV  566
            L E++LR FM   ++    + K++ +  + N      +  L  II    +   +P  +R 
Sbjct  487  LKEKFLRVFMQQYKDAETTYEKILALKTIGNAGLDISVNQLNEII----VDKRQPLPVRK  542

Query  567  QAIWILKNI-NVHSNYIHDILWPVLSDVSLPSAVRIAAFNVLIHQVNQEPNLGRVMNIYW  625
            +AI  L+ + +     I  +L P+  +      +R+ A   ++H   +E  L +V++   
Sbjct  543  EAIDALRLLKDTMPRKIQKVLLPIYKNRQYEPEIRMLALWRMMHTRPEESLLVQVVS---  599

Query  626  LMVYEKDEHLYNYYVDTVKGLANSVDPCLMKIREMAKKILKFIRIRNLNQPLSS  679
             M  E ++ +       ++  A S +PC  ++  +  K+L F R +   Q ++S
Sbjct  600  QMEKETNQQVAALTHQMIRHFAMSTNPCYQRVAIVCSKVLSFTRYQPQEQMIAS  653


>VIT2_CAEEL unnamed protein product
Length=1613

 Score = 43.5 bits (101),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 29/120 (24%), Positives = 57/120 (48%), Gaps = 22/120 (18%)

Query  129  NGHLEGVKFAEDEPGWSKNVKKGIVSMLQL-------DLDQMHV-----QSPIKAHSFIS  176
            NG +  ++F +++  WSKN+K+ +V+M+         +++++       +   +  SF +
Sbjct  117  NGLISELQFDKEDAEWSKNMKRAVVNMISFNPIAPRNEIEKIESSYDKEEQSEENTSFFT  176

Query  177  QEVTIHGNCEVAYNVQPMDEMQATSGKELVVTKFYDSMNC---SHFKYHEFNHVECHKCQ  233
             E T+ G+C+VAY V           K+ ++TK  +   C   S   Y      EC +C+
Sbjct  177  NEKTLEGDCQVAYTV-------IREQKKTIITKSINFDKCTERSEIAYGLRYSSECPECE  229


 Score = 40.4 bits (93),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 37/174 (21%), Positives = 78/174 (45%), Gaps = 8/174 (5%)

Query  507  LIERYLRHFMDHVRNEPMFHMKMVYMMAMKNVRSKHVLKHLEPIIKGEEIVSEKPHNIRV  566
            L E++LR FM   ++    + K++ +  + N      +  L  II    +   +P  +R 
Sbjct  487  LKEKFLRVFMQQYKDAETTYEKILALKTIGNAGLDISVNQLNEII----VDKRQPLPVRK  542

Query  567  QAIWILKNI-NVHSNYIHDILWPVLSDVSLPSAVRIAAFNVLIHQVNQEPNLGRVMNIYW  625
            +AI  L+ + +     I  +L P+  +      +R+ A   ++H   +E  L +V++   
Sbjct  543  EAIDALRLLKDTMPRKIQKVLLPIYKNRQYEPEIRMLALWRMMHTRPEESLLVQVVS---  599

Query  626  LMVYEKDEHLYNYYVDTVKGLANSVDPCLMKIREMAKKILKFIRIRNLNQPLSS  679
             M  E ++ +       ++  A S +PC  ++  +  K+L F R +   Q ++S
Sbjct  600  QMEKETNQQVAALTHQMIRHFAMSTNPCYQRVAIVCSKVLSFTRYQPQEQMIAS  653



Lambda      K        H
   0.318    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5035546020


Query= NP_001340321.1 DNA (cytosine-5)-methyltransferase 3B [Bombus
terrestris]

Length=1210
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A1Z8R2_DROME  unnamed protein product                                 56.2    1e-07
Q961B8_DROME  unnamed protein product                                 55.1    3e-07
A0A0B4LEU5_DROME  unnamed protein product                             54.7    5e-07
Q86PD1_DROME  unnamed protein product                                 52.0    3e-06
G5EGI1_CAEEL  unnamed protein product                                 41.2    0.007


>A1Z8R2_DROME unnamed protein product
Length=1199

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/98 (29%), Positives = 39/98 (40%), Gaps = 2/98 (2%)

Query  782  LCLKCLRVAEGKTEIHPFFEGSLCKSCSDHYKPCMFLFGNDAKCFHCTVCAASGMMIICD  841
            L L     AE   ++HP    + C  C D Y    F  G D    +C  C   G +  C 
Sbjct  71   LHLGTAPAAESNIKMHPILRVTHCVKCHDFYNSGEFSKGEDGSELYCRWCGQGGEVYCCS  130

Query  842  KEDCPRVYCTACMKHLLCPTTYEQVLQEDPWECFLCAT  879
               CP V+C +C+   L       + Q + W CF C +
Sbjct  131  T--CPYVFCKSCIVKNLSKGVIVDIEQNENWNCFSCTS  166


>Q961B8_DROME unnamed protein product
Length=1125

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/98 (29%), Positives = 39/98 (40%), Gaps = 2/98 (2%)

Query  782  LCLKCLRVAEGKTEIHPFFEGSLCKSCSDHYKPCMFLFGNDAKCFHCTVCAASGMMIICD  841
            L L     AE   ++HP    + C  C D Y    F  G D    +C  C   G +  C 
Sbjct  71   LHLGTAPAAESNIKMHPILRVTHCVKCHDFYNSGEFSKGEDGSELYCRWCGQGGEVYCCS  130

Query  842  KEDCPRVYCTACMKHLLCPTTYEQVLQEDPWECFLCAT  879
               CP V+C +C+   L       + Q + W CF C +
Sbjct  131  T--CPYVFCKSCIVKNLSKGVIVDIEQNENWNCFSCTS  166


>A0A0B4LEU5_DROME unnamed protein product
Length=979

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/98 (29%), Positives = 39/98 (40%), Gaps = 2/98 (2%)

Query  782  LCLKCLRVAEGKTEIHPFFEGSLCKSCSDHYKPCMFLFGNDAKCFHCTVCAASGMMIICD  841
            L L     AE   ++HP    + C  C D Y    F  G D    +C  C   G +  C 
Sbjct  71   LHLGTAPAAESNIKMHPILRVTHCVKCHDFYNSGEFSKGEDGSELYCRWCGQGGEVYCCS  130

Query  842  KEDCPRVYCTACMKHLLCPTTYEQVLQEDPWECFLCAT  879
               CP V+C +C+   L       + Q + W CF C +
Sbjct  131  T--CPYVFCKSCIVKNLSKGVIVDIEQNENWNCFSCTS  166


>Q86PD1_DROME unnamed protein product
Length=1199

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/98 (28%), Positives = 38/98 (39%), Gaps = 2/98 (2%)

Query  782  LCLKCLRVAEGKTEIHPFFEGSLCKSCSDHYKPCMFLFGNDAKCFHCTVCAASGMMIICD  841
            L L     AE   ++HP    + C  C D Y    F  G D    +C  C   G +  C 
Sbjct  71   LHLGTAPAAESNIKMHPILRVTHCVKCHDFYNSGEFSKGEDGSELYCRWCGQGGEVYCCS  130

Query  842  KEDCPRVYCTACMKHLLCPTTYEQVLQEDPWECFLCAT  879
               CP V+  +C+   L       + Q + W CF C +
Sbjct  131  T--CPYVFYKSCIVKNLSKGVIVDIEQNENWNCFSCTS  166


>G5EGI1_CAEEL unnamed protein product
Length=2475

 Score = 41.2 bits (95),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 47/114 (41%), Gaps = 32/114 (28%)

Query  782  LCLKCLRVAEGKTEIHPFFEGSL--CKSCSDHYKP-CMFL--------FGNDAKCFHCTV  830
            +CL C  + +G        EGS+  C +C+  Y   C+ L         G   +C  CTV
Sbjct  427  MCLVCGSIGKGP-------EGSMVACSNCAQTYHTYCVTLHDKLNSAVVGRGWRCLDCTV  479

Query  831  CAASGM------MIICDKEDCPRVYCTACMKHLLCPTTYEQVLQEDPWECFLCA  878
            C   G       +++CD  +C   Y   CMK LL        + + PW C  C+
Sbjct  480  CEGCGTGGDEANLLLCD--ECDVSYHIYCMKPLL------DKIPQGPWRCQWCS  525



Lambda      K        H
   0.318    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5035546020


Query= XP_003392860.1 ubiquitin-like-conjugating enzyme ATG3 [Bombus
terrestris]

Length=323
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VVS6_DROME  unnamed protein product                                 421     1e-148
C0H519_PLAF7  unnamed protein product                                 192     3e-59 
Q9N369_CAEEL  unnamed protein product                                 163     5e-48 
Q586I8_TRYB2  unnamed protein product                                 69.3    3e-13 
Q18991_CAEEL  unnamed protein product                                 48.9    6e-07 


>Q9VVS6_DROME unnamed protein product
Length=330

 Score = 421 bits (1082),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 213/331 (64%), Positives = 255/331 (77%), Gaps = 12/331 (4%)

Query  1    MQSVINSVKGTALGVAEYLTPVLKESKFRETGVLTPEEFVAAGDHLVHHCPTWQWATGDE  60
            MQSV+N+VKGTAL VAEYLTPVLKESKFRETGVLTPEEFVAAGDHLVHHCPTWQWA GDE
Sbjct  1    MQSVLNTVKGTALNVAEYLTPVLKESKFRETGVLTPEEFVAAGDHLVHHCPTWQWAAGDE  60

Query  61   DRVKSYLPKTKQFLLTRNVPCTRRCKQIEYSKEQECIIEEDDPEGGWVDTHHY-DSSLGG  119
             + K YLPK KQFL+TRNVPC RRCKQ+EY  E E ++EE+  +GGWV+TH   D     
Sbjct  61   TKTKPYLPKDKQFLITRNVPCYRRCKQMEYVGE-ETLVEEESGDGGWVETHQLNDDGTTQ  119

Query  120  IEERVTEMTLDETQLSQSIGTEENNGDNNEDDDDDDDDGDAADMEAFEVSGMLDEQDKYA  179
            +E+++ E+T++ET+        + +        +D+DD +A DM+ FE SGML+  D   
Sbjct  120  LEDKICELTMEETKEEMHTPDSDKSAPGAGGQAEDEDDDEAIDMDDFEESGMLELVDPAV  179

Query  180  AKITKKPANEKWES----------FSEGEIIHTRTYDLYITYDKYYQTPRLWLSGYDENR  229
            A  T+KP  E   S           S   ++HTRTYDL+I+YDKYYQTPRLW+ GYDE R
Sbjct  180  ATTTRKPEPEAKASPVAAASGDAEASGDSVLHTRTYDLHISYDKYYQTPRLWVVGYDEQR  239

Query  230  KPLTVEEMYEDVSQDHAKKTVTMEVHPHIPGPLMASVHPCRHAEVMKKIIETVMEGGREL  289
            KPLTVE+MYEDVSQDHAKKTVTME HPH+PGP MASVHPCRHA++MKKII+TV EGG +L
Sbjct  240  KPLTVEQMYEDVSQDHAKKTVTMESHPHLPGPNMASVHPCRHADIMKKIIQTVEEGGGQL  299

Query  290  GVHMYLIIFLKFVQSVIPTIEYDYTQNFMLN  320
            GVH+YLIIFLKFVQ+VIPTIEYD+TQNF ++
Sbjct  300  GVHLYLIIFLKFVQTVIPTIEYDFTQNFNMS  330


>C0H519_PLAF7 unnamed protein product
Length=313

 Score = 192 bits (489),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 116/313 (37%), Positives = 171/313 (55%), Gaps = 19/313 (6%)

Query  3    SVINSVKGTALGVAEYLTPVLKESKFRETGVLTPEEFVAAGDHLVHHCPTWQWATGDEDR  62
            +V + +  T   +  Y   V   S F + G LTP EFV +GD LV+   TW+W   D+DR
Sbjct  6    NVKHKIGDTCRKLYSYFKTVNNTSTFIQNGTLTPSEFVDSGDFLVYKFKTWEWQEADKDR  65

Query  63   VKSYLPKTKQFLLTRNVPCTRRCKQIEYSKEQECIIEEDDPEGGWVDTHHYDSSLGGIEE  122
            V  YLP+ KQFL+T+NVPC +R K +        I++ D     W+        L   EE
Sbjct  66   VVPYLPENKQFLITKNVPCKQRIKDLNNIVHDLKIVDND-----WL--------LPSYEE  112

Query  123  RVTEMTLDETQLSQSIGTEENNGDNNEDDDDDDDDGDAADMEAFEV-SGMLDEQDKYAAK  181
                  + E   +      + N  N E++++DD+  +A D+  F + + ++ E D   A 
Sbjct  113  DNNPTDIYEYLPNSEYTINDKNIYNYEEEEEDDNCDEAIDINNFYMENNLIKEHD--PAS  170

Query  182  ITKKPANEKWESFSEGEIIHTRTYDLYITYDKYYQTPRLWLSGYDENRKPLTVEEMYEDV  241
            I       K  +     ++  RTYD+ ITYDKYYQTPR+WL GY+EN  PL  EE++ED+
Sbjct  171  INSTSCYSK--NMLHDNLMKIRTYDVSITYDKYYQTPRIWLFGYNENGDPLKSEEIFEDI  228

Query  242  SQDHAKKTVTMEVHPHIPGPLMASVHPCRHAEVMKKIIETVMEGGRELGVHMYLIIFLKF  301
              D++ KTVT + HP   G + AS+HPC+HAE +  ++   +   +E    +YL+  LKF
Sbjct  229  LSDYSYKTVTYDPHP-CTGVMTASIHPCKHAEAILNVVNNWISEEKEPRHDLYLLFLLKF  287

Query  302  VQSVIPTIEYDYT  314
            +  VIPTIEYD+T
Sbjct  288  ISGVIPTIEYDFT  300


>Q9N369_CAEEL unnamed protein product
Length=305

 Score = 163 bits (413),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 94/120 (78%), Gaps = 7/120 (6%)

Query  1    MQSVINSVKGTALGVAEYLTPVLKESKFRETGVLTPEEFVAAGDHLVHHCPTWQWA-TGD  59
            MQ+++N++K  AL + E  TPVL+ESKFRETGVLTPEE+VAAGDHLVHHCPTW+WA   D
Sbjct  1    MQNLVNNLKSAALQIGETFTPVLRESKFRETGVLTPEEYVAAGDHLVHHCPTWKWAGASD  60

Query  60   EDRVKSYLPKTKQFLLTRNVPCTRRCKQIEYSKEQECIIEEDD------PEGGWVDTHHY  113
              +++++LP  KQFL+TRNVPC +RCKQ+EY ++ E II E+D       E GWVDTHHY
Sbjct  61   PSKIRTFLPIDKQFLITRNVPCHKRCKQMEYDEKLEKIINEEDGEYQTSDETGWVDTHHY  120


>Q586I8_TRYB2 unnamed protein product
Length=292

 Score = 69.3 bits (168),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 45/85 (53%), Gaps = 12/85 (14%)

Query  1   MQSVINSVKGTALGVAEYLTPVLKESKFRETGVLTPEEFVAAGDHLVHHCPTWQWATGDE  60
            + V NSV G           V   S F ETG LTP EF+ AGD L+H  P W WA G E
Sbjct  10  FKKVYNSVVG-----------VKTTSSFHETGTLTPMEFIQAGDELLHKMPVWSWAEGPE  58

Query  61  DRVKSYLPKTKQFLLTRNVPCTRRC  85
           + ++ +LP  K++L+ R  PC  R 
Sbjct  59  N-IQPFLPPNKKYLVYRGAPCYERA  82


>Q18991_CAEEL unnamed protein product
Length=157

 Score = 48.9 bits (115),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 59/138 (43%), Gaps = 19/138 (14%)

Query  149  EDDDDDDDDGDAADMEAFEVSGMLDEQDKYAAKITKKPANEKWESFSEGEIIHTRTYDLY  208
            E    D+  G    M        L E  KYA +   K       + S+G +I + T+   
Sbjct  4    EQQFRDEIRGFVDKMNENNFHWQLKEIGKYARETHLK-------TLSDGRVITSETH---  53

Query  209  ITYDKYYQTPRLWLSGYDENRKPLTVEEMYEDV--------SQDHAKKTVTMEVHPHIPG  260
            I Y+  YQ P +W + ++ N  PL    +  DV        S+   +  ++   HP + G
Sbjct  54   ILYNSTYQVPTIWFNFFENNGSPLPFRTVIRDVLNISETEESEASIRSRISHYEHPFM-G  112

Query  261  PLMASVHPCRHAEVMKKI  278
             L  ++HPC  + +MK++
Sbjct  113  VLYYNIHPCNTSNIMKEL  130



Lambda      K        H
   0.318    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5035546020


Query= XP_003392861.1 anaphase-promoting complex subunit 7 [Bombus
terrestris]

Length=571
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9W3Y6_DROME  unnamed protein product                                 232     2e-68
Q8T020_DROME  unnamed protein product                                 231     3e-68
Q8IRQ6_DROME  unnamed protein product                                 215     7e-63
Q7KJA9_DROME  unnamed protein product                                 42.7    8e-04
Q9Y148_DROME  unnamed protein product                                 42.7    8e-04


>Q9W3Y6_DROME unnamed protein product
Length=615

 Score = 232 bits (592),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 154/545 (28%), Positives = 277/545 (51%), Gaps = 15/545 (3%)

Query  4    LYDQIKLLYEQSLYSNVISLANLVLSLSEHNSDLLPIHGKFHIYVYYADAHFYLGKYKRA  63
            L+   K LY+  LY  VI  A+L+ ++ +++  +  +  ++ + +Y  +A++    Y+ A
Sbjct  15   LFANAKKLYDHKLYECVIPAADLLRTVLKNDRYVATLDVEYQVLLYLLNANYKERNYRAA  74

Query  64   EALYKKSLQFRKCLLKSKGAT-KPLEGQKDLPTDVDIKFQIHLCLIKLKNPQEALQVLQS  122
               + + +  R+ +++ K A    +E       D + + +   C  ++ N   A++ L  
Sbjct  75   LRHFDEIIHKRRLMMRHKNAVLVAIESSYPEFGDAEQRRRAAECYRQIGNTDMAIETLLQ  134

Query  123  IPGKQRTPKVNMALAKMFHEQGM-----ERSAITTYKEVLRECPLALEAAEGLLSLGVKG  177
            +P   R+P++N+ LA++ H         +  A+  YKEV+RECP+AL+  E LL LGV G
Sbjct  135  VPPTLRSPRINLMLARLQHHGSRHGTTKKSEAVLAYKEVIRECPMALQVIEALLELGVNG  194

Query  178  IEVNSLIVGCASSLSNLDWLNTWIKAHAHIHNREYTHAVTTLRSLDNVSLLRDNFNLLTT  237
             E+NSL++  A+   + DWL+ WIKA A + N +++ A  T   L + + LR N +L+  
Sbjct  195  NEINSLVMHAATVPDHFDWLSKWIKALAQMFNFKHSDASQTFLMLHDNTTLRCNEHLMMA  254

Query  238  MGECYYYAGDDKNALLCLRRARIIEPDIMKGVDVYAAVLYKTHSVKE----LERLIPIIT  293
            +G+C YY GD   A           PD ++ + + A +  +    ++    ++ L   ++
Sbjct  255  LGKCLYYNGDYFQAEDIFSSTLCANPDNVEAIGLMAVLCGQEGGCEQDSADMDYLFAKVS  314

Query  294  ASNECSGEVYVAMAYSLYATRKLGRANTFTAQALNLNPNDIEATILRGNILIEQKKYQDA  353
            +  + +   + A A  LY   K  R   F  + L+  P + EA ILRG +LI  +++  A
Sbjct  315  SEVKYTASHWFAHAQLLYDEGKFERGLNFVEKCLDSEPRNHEALILRGRLLIALERHTQA  374

Query  354  LFFFRHAVQLKPYRYEPHKGLVDCLVGMHRLREAINIASGSCKQLGHTTRVLTLYASV--  411
            +  FR A  + PYR+E ++GL    +   R +EA  + + + +   ++ R  T++     
Sbjct  375  VCAFRTAQMVAPYRFEIYRGLFHSYLAQKRFKEANALCNWTIRLFQNSPRSFTMFGRTLF  434

Query  412  LMKDPVSVGKAKNLLEKALLQDEVYLPAVYLLAEIYEQEMNLEAAIALLERQVEIQTACK  471
            L  DP     A+   EK+L  + +Y PAV L+A+I + E   +A I LLE+ V I     
Sbjct  435  LFPDPRMRRTARKFAEKSLKINHIYTPAVNLIADICQVEGPTKAIIKLLEKHVIIFPKVN  494

Query  472  LHQMLGDLWARVHNEEKALDHYAIALNLDPNNRRALEGMHRL---DNSSNKLDTAYYMTV  528
            L   LGD+  +     KA+++Y  AL  DP ++R L G+  L   D+ S  LD +  + +
Sbjct  495  LLNHLGDIMRKQKEPVKAMEYYYKALRQDPKSKRTLRGLRLLAKSDDESPVLDESDDIGM  554

Query  529  GEEQT  533
              +Q+
Sbjct  555  DNQQS  559


>Q8T020_DROME unnamed protein product
Length=595

 Score = 231 bits (590),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 154/545 (28%), Positives = 277/545 (51%), Gaps = 15/545 (3%)

Query  4    LYDQIKLLYEQSLYSNVISLANLVLSLSEHNSDLLPIHGKFHIYVYYADAHFYLGKYKRA  63
            L+   K LY+  LY  VI  A+L+ ++ +++  +  +  ++ + +Y  +A++    Y+ A
Sbjct  15   LFANAKKLYDHKLYECVIPAADLLRTVLKNDRYVATLDVEYQVLLYLLNANYKERNYRAA  74

Query  64   EALYKKSLQFRKCLLKSKGAT-KPLEGQKDLPTDVDIKFQIHLCLIKLKNPQEALQVLQS  122
               + + +  R+ +++ K A    +E       D + + +   C  ++ N   A++ L  
Sbjct  75   LRHFDEIIHKRRLMMRHKNAVLVAIESSYPEFGDAEQRRRAAECYRQIGNTDMAIETLLQ  134

Query  123  IPGKQRTPKVNMALAKMFHEQGM-----ERSAITTYKEVLRECPLALEAAEGLLSLGVKG  177
            +P   R+P++N+ LA++ H         +  A+  YKEV+RECP+AL+  E LL LGV G
Sbjct  135  VPPTLRSPRINLMLARLQHHGSRHGTTKKSEAVLAYKEVIRECPMALQVIEALLELGVNG  194

Query  178  IEVNSLIVGCASSLSNLDWLNTWIKAHAHIHNREYTHAVTTLRSLDNVSLLRDNFNLLTT  237
             E+NSL++  A+   + DWL+ WIKA A + N +++ A  T   L + + LR N +L+  
Sbjct  195  NEINSLVMHAATVPDHFDWLSKWIKALAQMFNFKHSDASQTFLMLHDNTTLRCNEHLMMA  254

Query  238  MGECYYYAGDDKNALLCLRRARIIEPDIMKGVDVYAAVLYKTHSVKE----LERLIPIIT  293
            +G+C YY GD   A           PD ++ + + A +  +    ++    ++ L   ++
Sbjct  255  LGKCLYYNGDYFQAEDIFSSTLCANPDNVEAIGLMAVLCGQEGGCEQDSADMDYLFAKVS  314

Query  294  ASNECSGEVYVAMAYSLYATRKLGRANTFTAQALNLNPNDIEATILRGNILIEQKKYQDA  353
            +  + +   + A A  LY   K  R   F  + L+  P + EA ILRG +LI  +++  A
Sbjct  315  SEVKYTASHWFAHAQLLYDEGKFERGLNFVEKCLDSEPRNHEALILRGRLLIALERHTQA  374

Query  354  LFFFRHAVQLKPYRYEPHKGLVDCLVGMHRLREAINIASGSCKQLGHTTRVLTLYASV--  411
            +  FR A  + PYR+E ++GL    +   R +EA  + + + +   ++ R  T++     
Sbjct  375  VCAFRTAQMVAPYRFEIYRGLFHSYLAQKRFKEANALCNWTIRLFQNSPRSFTMFGRTLF  434

Query  412  LMKDPVSVGKAKNLLEKALLQDEVYLPAVYLLAEIYEQEMNLEAAIALLERQVEIQTACK  471
            L  DP     A+   EK+L  + +Y PAV L+A+I + E   +A I LLE+ V I     
Sbjct  435  LFPDPRMRRTARKFAEKSLKINHIYTPAVNLIADICQVEGPTKAIIKLLEKHVIIFPKVN  494

Query  472  LHQMLGDLWARVHNEEKALDHYAIALNLDPNNRRALEGMHRL---DNSSNKLDTAYYMTV  528
            L   LGD+  +     KA+++Y  AL  DP ++R L G+  L   D+ S  LD +  + +
Sbjct  495  LLNHLGDIMRKQKEPVKAMEYYYKALRQDPKSKRTLRGLRLLAKSDDESPVLDESDDIGM  554

Query  529  GEEQT  533
              +Q+
Sbjct  555  DNQQS  559


>Q8IRQ6_DROME unnamed protein product
Length=528

 Score = 215 bits (548),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 135/442 (31%), Positives = 228/442 (52%), Gaps = 14/442 (3%)

Query  106  CLIKLKNPQEALQVLQSIPGKQRTPKVNMALAKMFHEQGM-----ERSAITTYKEVLREC  160
            C  ++ N   A++ L  +P   R+P++N+ LA++ H         +  A+  YKEV+REC
Sbjct  31   CYRQIGNTDMAIETLLQVPPTLRSPRINLMLARLQHHGSRHGTTKKSEAVLAYKEVIREC  90

Query  161  PLALEAAEGLLSLGVKGIEVNSLIVGCASSLSNLDWLNTWIKAHAHIHNREYTHAVTTLR  220
            P+AL+  E LL LGV G E+NSL++  A+   + DWL+ WIKA A + N +++ A  T  
Sbjct  91   PMALQVIEALLELGVNGNEINSLVMHAATVPDHFDWLSKWIKALAQMFNFKHSDASQTFL  150

Query  221  SLDNVSLLRDNFNLLTTMGECYYYAGDDKNALLCLRRARIIEPDIMKGVDVYAAVLYKTH  280
             L + + LR N +L+  +G+C YY GD   A           PD ++ + + A +  +  
Sbjct  151  MLHDNTTLRCNEHLMMALGKCLYYNGDYFQAEDIFSSTLCANPDNVEAIGLMAVLCGQEG  210

Query  281  SVKE----LERLIPIITASNECSGEVYVAMAYSLYATRKLGRANTFTAQALNLNPNDIEA  336
              ++    ++ L   +++  + +   + A A  LY   K  R   F  + L+  P + EA
Sbjct  211  GCEQDSADMDYLFAKVSSEVKYTASHWFAHAQLLYDEGKFERGLNFVEKCLDSEPRNHEA  270

Query  337  TILRGNILIEQKKYQDALFFFRHAVQLKPYRYEPHKGLVDCLVGMHRLREAINIASGSCK  396
             ILRG +LI  +++  A+  FR A  + PYR+E ++GL    +   R +EA  + + + +
Sbjct  271  LILRGRLLIALERHTQAVCAFRTAQMVAPYRFEIYRGLFHSYLAQKRFKEANALCNWTIR  330

Query  397  QLGHTTRVLTLYASV--LMKDPVSVGKAKNLLEKALLQDEVYLPAVYLLAEIYEQEMNLE  454
               ++ R  T++     L  DP     A+   EK+L  + +Y PAV L+A+I + E   +
Sbjct  331  LFQNSPRSFTMFGRTLFLFPDPRMRRTARKFAEKSLKINHIYTPAVNLIADICQVEGPTK  390

Query  455  AAIALLERQVEIQTACKLHQMLGDLWARVHNEEKALDHYAIALNLDPNNRRALEGMHRL-  513
            A I LLE+ V I     L   LGD+  +     KA+++Y  AL  DP ++R L G+  L 
Sbjct  391  AIIKLLEKHVIIFPKVNLLNHLGDIMRKQKEPVKAMEYYYKALRQDPKSKRTLRGLRLLA  450

Query  514  --DNSSNKLDTAYYMTVGEEQT  533
              D+ S  LD +  + +  +Q+
Sbjct  451  KSDDESPVLDESDDIGMDNQQS  472


>Q7KJA9_DROME unnamed protein product
Length=1059

 Score = 42.7 bits (99),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 49/194 (25%), Positives = 84/194 (43%), Gaps = 2/194 (1%)

Query  311  YATRKLGRANTFTAQALNLNPNDIEATILRGNILIEQKKYQDALFFFRHAVQLKPYRYEP  370
            +  R+L ++  F+  A+  NP   EA    GN+  E+ + Q+AL  +R AV+LKP   + 
Sbjct  95   FQCRRLDKSAQFSTLAIKQNPVLAEAYSNLGNVFKERGQLQEALDNYRRAVRLKPDFIDG  154

Query  371  HKGLVDCLVGMHRLREAINIASGSCKQLGHTTRVLTLYASVLMKDPVSVGKAKNLLEKAL  430
            +  L   LV    +  A+  A  +  Q       +      L+K    + +AK    KA+
Sbjct  155  YINLAAALVAARDMESAVQ-AYITALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAI  213

Query  431  LQDEVYLPAVYLLAEIYEQEMNLEAAIALLERQVEIQ-TACKLHQMLGDLWARVHNEEKA  489
                 +  A   L  ++  +  +  AI   E+ V +       +  LG++       ++A
Sbjct  214  ETCPGFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRA  273

Query  490  LDHYAIALNLDPNN  503
            +  Y  ALNL PNN
Sbjct  274  VAAYLRALNLSPNN  287


 Score = 38.9 bits (89),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 46/205 (22%), Positives = 93/205 (45%), Gaps = 8/205 (4%)

Query  301  EVYVAMAYSLYATRKLGRANTFTAQALNLNPNDIEATILRGN---ILIEQKKYQDALFFF  357
            + Y+ +   L   R   RA     +ALNL+PN+    ++ GN   +  EQ     A+  +
Sbjct  255  DAYINLGNVLKEARIFDRAVAAYLRALNLSPNN---AVVHGNLACVYYEQGLIDLAIDTY  311

Query  358  RHAVQLKPYRYEPHKGLVDCLVGMHRLREAINIASGSCKQLGHTTRVLTLYASVLMKDPV  417
            R A++L+P   + +  L + L    +++EA +  + + +   +    L   A++  ++  
Sbjct  312  RRAIELQPNFPDAYCNLANALKEKGQVKEAEDCYNTALRLCSNHADSLNNLANI-KREQG  370

Query  418  SVGKAKNLLEKALLQDEVYLPAVYLLAEIYEQEMNLEAAIALLERQVEIQ-TACKLHQML  476
             + +A  L  KAL     +  A   LA + +Q+  L+ A+   +  + IQ T    +  +
Sbjct  371  YIEEATRLYLKALEVFPDFAAAHSNLASVLQQQGKLKEALMHYKEAIRIQPTFADAYSNM  430

Query  477  GDLWARVHNEEKALDHYAIALNLDP  501
            G+    + +   AL  Y  A+ ++P
Sbjct  431  GNTLKELQDVSGALQCYTRAIQINP  455


>Q9Y148_DROME unnamed protein product
Length=1011

 Score = 42.7 bits (99),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 49/194 (25%), Positives = 84/194 (43%), Gaps = 2/194 (1%)

Query  311  YATRKLGRANTFTAQALNLNPNDIEATILRGNILIEQKKYQDALFFFRHAVQLKPYRYEP  370
            +  R+L ++  F+  A+  NP   EA    GN+  E+ + Q+AL  +R AV+LKP   + 
Sbjct  95   FQCRRLDKSAQFSTLAIKQNPVLAEAYSNLGNVFKERGQLQEALDNYRRAVRLKPDFIDG  154

Query  371  HKGLVDCLVGMHRLREAINIASGSCKQLGHTTRVLTLYASVLMKDPVSVGKAKNLLEKAL  430
            +  L   LV    +  A+  A  +  Q       +      L+K    + +AK    KA+
Sbjct  155  YINLAAALVAARDMESAVQ-AYITALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAI  213

Query  431  LQDEVYLPAVYLLAEIYEQEMNLEAAIALLERQVEIQ-TACKLHQMLGDLWARVHNEEKA  489
                 +  A   L  ++  +  +  AI   E+ V +       +  LG++       ++A
Sbjct  214  ETCPGFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRA  273

Query  490  LDHYAIALNLDPNN  503
            +  Y  ALNL PNN
Sbjct  274  VAAYLRALNLSPNN  287


 Score = 38.9 bits (89),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 46/205 (22%), Positives = 93/205 (45%), Gaps = 8/205 (4%)

Query  301  EVYVAMAYSLYATRKLGRANTFTAQALNLNPNDIEATILRGN---ILIEQKKYQDALFFF  357
            + Y+ +   L   R   RA     +ALNL+PN+    ++ GN   +  EQ     A+  +
Sbjct  255  DAYINLGNVLKEARIFDRAVAAYLRALNLSPNN---AVVHGNLACVYYEQGLIDLAIDTY  311

Query  358  RHAVQLKPYRYEPHKGLVDCLVGMHRLREAINIASGSCKQLGHTTRVLTLYASVLMKDPV  417
            R A++L+P   + +  L + L    +++EA +  + + +   +    L   A++  ++  
Sbjct  312  RRAIELQPNFPDAYCNLANALKEKGQVKEAEDCYNTALRLCSNHADSLNNLANI-KREQG  370

Query  418  SVGKAKNLLEKALLQDEVYLPAVYLLAEIYEQEMNLEAAIALLERQVEIQ-TACKLHQML  476
             + +A  L  KAL     +  A   LA + +Q+  L+ A+   +  + IQ T    +  +
Sbjct  371  YIEEATRLYLKALEVFPDFAAAHSNLASVLQQQGKLKEALMHYKEAIRIQPTFADAYSNM  430

Query  477  GDLWARVHNEEKALDHYAIALNLDP  501
            G+    + +   AL  Y  A+ ++P
Sbjct  431  GNTLKELQDVSGALQCYTRAIQINP  455



Lambda      K        H
   0.318    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5035546020


Query= XP_003392862.1 PPP2R1A-PPP2R2A-interacting phosphatase regulator 1
[Bombus terrestris]

Length=347


***** No hits found *****



Lambda      K        H
   0.318    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5035546020


Query= XP_003392863.1 thioredoxin reductase-like selenoprotein T homolog
CG3887 [Bombus terrestris]

Length=186
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SELT_DROME  unnamed protein product                                   171     3e-54
Q38C92_TRYB2  unnamed protein product                                 28.9    3.1  


>SELT_DROME unnamed protein product
Length=198

 Score = 171 bits (433),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 112/174 (64%), Gaps = 5/174 (3%)

Query  7    LILCFCVILCALDNKADDNQVSLTKLSTKTGPTLKFFYCYSCGYRKVFEEYVNILQQKYP  66
            L+LC C    AL     + ++ +TK      PT+ F YCYSCGYRK FE+YV +L +KYP
Sbjct  12   LVLCLCAGY-ALVFAEGEKEIPVTKFGQNIAPTMTFLYCYSCGYRKAFEDYVGLLGEKYP  70

Query  67   ELQIDGENYMPSHNKMFIAKLLSFAKILLIILIVSGLD----LGQPPTSLWQWCLDNRFY  122
            ++Q++G NY P     +++K++   KI++I+ +VS +     LG    S W     N+ Y
Sbjct  71   QIQVNGGNYDPPGLNYYLSKMIFALKIIIIVSVVSAVSPFTFLGLNTPSWWSHMQANKIY  130

Query  123  SCIMIFFIFNAIEGHFISSGAFEIHFNDVPVWSKLETGRIPQPLELFQIIDNHL  176
            +C+MIFF+ N +E   ISSGAFEI  NDVPVWSKL+TGR P P  LFQIIDNHL
Sbjct  131  ACMMIFFLGNMLEAQLISSGAFEITLNDVPVWSKLQTGRFPSPEVLFQIIDNHL  184


>Q38C92_TRYB2 unnamed protein product
Length=1220

 Score = 28.9 bits (63),  Expect = 3.1, Method: Composition-based stats.
 Identities = 12/24 (50%), Positives = 15/24 (63%), Gaps = 0/24 (0%)

Query  153  VWSKLETGRIPQPLELFQIIDNHL  176
            VWSKLE G IP  +E+ +  D  L
Sbjct  487  VWSKLEDGEIPDEVEIQEAFDQPL  510



Lambda      K        H
   0.318    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5035546020


Query= XP_003392864.2 ankyrin repeat domain-containing protein 13C isoform
X1 [Bombus terrestris]

Length=441
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A8DYI9_DROME  unnamed protein product                                 193     5e-55
Q7K4M9_DROME  unnamed protein product                                 193     6e-55
Q8IGB6_DROME  unnamed protein product                                 184     1e-51
A1ZBH1_DROME  unnamed protein product                                 172     1e-47
SECG_DICDI  unnamed protein product                                   59.3    4e-09


>A8DYI9_DROME unnamed protein product
Length=630

 Score = 193 bits (490),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 135/469 (29%), Positives = 227/469 (48%), Gaps = 66/469 (14%)

Query  11   KYPLHKCIFQGDIKALSSLIRIYNIAEKDTQGNTPLHLAVMLGRKESIQLLLAHGAPVKV  70
            +YPLH  I+  +++ L + I   +  + D +G TPL LAV L     ++ LLA       
Sbjct  10   EYPLHWHIWHNELEQLQAAIDQNDKEKIDPRGRTPLMLAVRLANLPCVKCLLAAKCNATY  69

Query  71   KNLAGWSPLAEAISYGDRQTISSLVRKLNQQAREQMEERRPNLLATLRQMGDFYMELKWD  130
            +   GWS + EA+  GD   +++++   + Q   Q     P LL  L    DFY+E+KW+
Sbjct  70   E-YEGWSIVQEAVCTGDVDILTAIIEVRDLQRHVQRVTHVPKLLQHLLDAPDFYIEMKWE  128

Query  131  FQSWVPLVSRVLPSDVCKIHKRGASIRMDTTLVDFNDMRWERGDISFIFNGDKKPSKSLA  190
            F SWVPL+SR+ PSD  K++KRGA++R+DTTL+ F++  W+RG+ S+IF G    +K  A
Sbjct  129  FTSWVPLMSRLCPSDTYKVYKRGANVRIDTTLLGFDNNTWQRGNRSYIFKG----AKETA  184

Query  191  VLDNLAKRYQTVRYEETELEIQDEVDI---------LMSSDIMAAQMSTKGITLSKAQTG  241
             +  +      V  EE   +I D V I          +++ ++   +    I+  + + G
Sbjct  185  TMIEIDHDTNEVMVEEMSSDIGDIVAIPPALGTVRARLNAPVITNNIEMDKISFERNKCG  244

Query  242  -WIFREDKREMVGPFHAECYQIDGMVLESKKRREHLSEEDLQKNKA--------------  286
             W +R +K EM+  ++ + Y    +   +K R +HLSEE ++   A              
Sbjct  245  IWGWRSEKSEMINGYNCKVYGASNVEFVTKTRMDHLSEEQIKNKTARTPLHSLLGIADED  304

Query  287  -------------------IMESLTKGSSQGFANEKPQVRR-------ASLNPPPESNIT  320
                               + E+   G   G  N      +       AS    P+S++T
Sbjct  305  YVSPADAAAALKDRTPSPRLEEASNAGVENGGRNSPAPGNQSNGSSAGASGTSTPKSSVT  364

Query  321  WEEYIMAPPGQSPLLGRNLV----YKESSKSFKATVAMSPDFPLTV-DMLLNVLEVIAPF  375
             EEY      +  L GR++          + F+A + ++ + P+ + + +L +L++++  
Sbjct  365  PEEYFTQ---EFDLHGRDVGGPKNLSTKVQRFRANLWLAEEHPIRLQEQVLPILDLMSTM  421

Query  376  K--HFSKLREFVLMKLPPGFPVKIDIPILPTVTAKITFQE-FAFRNDID  421
               H SKLR+F+ M+LP GFPVK++IP+   + A ITF   FA    +D
Sbjct  422  ASPHVSKLRDFITMQLPAGFPVKVEIPLFHVLNACITFGNVFALTTPVD  470


>Q7K4M9_DROME unnamed protein product
Length=637

 Score = 193 bits (490),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 138/471 (29%), Positives = 227/471 (48%), Gaps = 70/471 (15%)

Query  11   KYPLHKCIFQGDIKALSSLIRIYNIAEKDTQGNTPLHLAVMLGRKESIQLLLAHGAPVKV  70
            +YPLH  I+  +++ L + I   +  + D +G TPL LAV L     ++ LLA       
Sbjct  10   EYPLHWHIWHNELEQLQAAIDQNDKEKIDPRGRTPLMLAVRLANLPCVKCLLAAKCNATY  69

Query  71   KNLAGWSPLAEAISYGDRQTISSLVRKLNQQAREQMEERRPNLLATLRQMGDFYMELKWD  130
            +   GWS + EA+  GD   +++++   + Q   Q     P LL  L    DFY+E+KW+
Sbjct  70   E-YEGWSIVQEAVCTGDVDILTAIIEVRDLQRHVQRVTHVPKLLQHLLDAPDFYIEMKWE  128

Query  131  FQSWVPLVSRVLPSDVCKIHKRGASIRMDTTLVDFNDMRWERGDISFIFNGDKKPSKSLA  190
            F SWVPL+SR+ PSD  K++KRGA++R+DTTL+ F++  W+RG+ S+IF G    +K  A
Sbjct  129  FTSWVPLMSRLCPSDTYKVYKRGANVRIDTTLLGFDNNTWQRGNRSYIFKG----AKETA  184

Query  191  VLDNLAKRYQTVRYEETELEIQDEVDI---------LMSSDIMAAQMSTKGITLSKAQTG  241
             +  +      V  EE   +I D V I          +++ ++   +    I+  + + G
Sbjct  185  TMIEIDHDTNEVMVEEMSSDIGDIVAIPPALGTVRARLNAPVITNNIEMDKISFERNKCG  244

Query  242  -WIFREDKREMVGPFHAECYQIDGMVLESKKRREHLSEEDLQKNKA--------------  286
             W +R +K EM+  ++ + Y    +   +K R +HLSEE ++   A              
Sbjct  245  IWGWRSEKSEMINGYNCKVYGASNVEFVTKTRMDHLSEEQIKNKTARTPLHSLLGIADED  304

Query  287  -------------------IMESLTKGSSQGFAN-------EKPQVRRASLNPPPESNIT  320
                               + E+   G   G  N              AS    P+S++T
Sbjct  305  YVSPADAAAALKDRTPSPRLEEASNAGVENGGRNSPAPGNQSNGSSAGASGTSTPKSSVT  364

Query  321  WEEYIMAPPGQSPLLGR------NLVYKESSKSFKATVAMSPDFPLTV-DMLLNVLEVIA  373
             EEY      +  L GR      NL  K   + F+A + ++ + P+ + + +L +L++++
Sbjct  365  PEEYFTQ---EFDLHGRDVGGPKNLSTK--VQRFRANLWLAEEHPIRLQEQVLPILDLMS  419

Query  374  PFK--HFSKLREFVLMKLPPGFPVKIDIPILPTVTAKITFQE-FAFRNDID  421
                 H SKLR+F+ M+LP GFPVK++IP+   + A ITF   FA    +D
Sbjct  420  TMASPHVSKLRDFITMQLPAGFPVKVEIPLFHVLNACITFGNVFALTTPVD  470


>Q8IGB6_DROME unnamed protein product
Length=618

 Score = 184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 135/457 (30%), Positives = 219/457 (48%), Gaps = 71/457 (16%)

Query  26   LSSLIRIYNIAEK-DTQGNTPLHLAVMLGRKESIQLLLAHGAPVKVKNLAGWSPLAEAIS  84
            L+  + + N  EK D +G TPL LAV L     ++ LLA       +   GWS + EA+ 
Sbjct  5    LTDSVTLQNDKEKIDPRGRTPLMLAVRLANLPCVKCLLAAKCNATYE-YEGWSIVQEAVC  63

Query  85   YGDRQTISSLVRKLNQQAREQMEERRPNLLATLRQMGDFYMELKWDFQSWVPLVSRVLPS  144
             GD   +++++   + Q   Q     P LL  L    DFY+E+KW+F SWVPL+SR+ PS
Sbjct  64   TGDVDILTAIIEVRDLQRHVQRVTHVPKLLQHLLDAPDFYIEMKWEFTSWVPLMSRLCPS  123

Query  145  DVCKIHKRGASIRMDTTLVDFNDMRWERGDISFIFNGDKKPSKSLAVLDNLAKRYQTVRY  204
            D  K++KRGA++R+DTTL+ F++  W+RG+ S+IF G    +K  A +  +      V  
Sbjct  124  DTYKVYKRGANVRIDTTLLGFDNNTWQRGNRSYIFKG----AKETATMIEIDHDTNEVMV  179

Query  205  EETELEIQDEVDI---------LMSSDIMAAQMSTKGITLSKAQTG-WIFREDKREMVGP  254
            EE   +I D V I          +++ ++   +    I+  + + G W +R +K EM+  
Sbjct  180  EEMSSDIGDIVAIPPALGTVRARLNAPVITNNIEMDKISFERNKCGIWGWRSEKSEMING  239

Query  255  FHAECYQIDGMVLESKKRREHLSEEDLQKNKA----------------------------  286
            ++ + Y    +   +K R +HLSEE ++   A                            
Sbjct  240  YNCKVYGASNVEFVTKTRMDHLSEEQIKNKTARTPLHSLLGIADEDYVSPADAAAALKDR  299

Query  287  -----IMESLTKGSSQGFAN-------EKPQVRRASLNPPPESNITWEEYIMAPPGQSPL  334
                 + E+   G   G  N              AS    P+S++T EEY      +  L
Sbjct  300  TPSPRLEEASNAGVENGGRNSPAPGNQSNGSSAGASGTSTPKSSVTPEEYFTQ---EFDL  356

Query  335  LGR------NLVYKESSKSFKATVAMSPDFPLTV-DMLLNVLEVIAPFK--HFSKLREFV  385
             GR      NL  K   + F+A + ++ + P+ + + +L +L++++     H SKLR+F+
Sbjct  357  HGRDVGGPKNLSTK--VQRFRANLWLAEEHPIRLQEQVLPILDLMSTMASPHVSKLRDFI  414

Query  386  LMKLPPGFPVKIDIPILPTVTAKITFQE-FAFRNDID  421
             M+LP GFPVK++IP+   + A ITF   FA    +D
Sbjct  415  TMQLPAGFPVKVEIPLFHVLNACITFGNVFALTTPVD  451


>A1ZBH1_DROME unnamed protein product
Length=592

 Score = 172 bits (437),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 126/434 (29%), Positives = 206/434 (47%), Gaps = 70/434 (16%)

Query  48   LAVMLGRKESIQLLLAHGAPVKVKNLAGWSPLAEAISYGDRQTISSLVRKLNQQAREQME  107
            LAV L     ++ LLA       +   GWS + EA+  GD   +++++   + Q   Q  
Sbjct  2    LAVRLANLPCVKCLLAAKCNATYE-YEGWSIVQEAVCTGDVDILTAIIEVRDLQRHVQRV  60

Query  108  ERRPNLLATLRQMGDFYMELKWDFQSWVPLVSRVLPSDVCKIHKRGASIRMDTTLVDFND  167
               P LL  L    DFY+E+KW+F SWVPL+SR+ PSD  K++KRGA++R+DTTL+ F++
Sbjct  61   THVPKLLQHLLDAPDFYIEMKWEFTSWVPLMSRLCPSDTYKVYKRGANVRIDTTLLGFDN  120

Query  168  MRWERGDISFIFNGDKKPSKSLAVLDNLAKRYQTVRYEETELEIQDEVDI---------L  218
              W+RG+ S+IF G    +K  A +  +      V  EE   +I D V I          
Sbjct  121  NTWQRGNRSYIFKG----AKETATMIEIDHDTNEVMVEEMSSDIGDIVAIPPALGTVRAR  176

Query  219  MSSDIMAAQMSTKGITLSKAQTG-WIFREDKREMVGPFHAECYQIDGMVLESKKRREHLS  277
            +++ ++   +    I+  + + G W +R +K EM+  ++ + Y    +   +K R +HLS
Sbjct  177  LNAPVITNNIEMDKISFERNKCGIWGWRSEKSEMINGYNCKVYGASNVEFVTKTRMDHLS  236

Query  278  EEDLQKNKA---------------------------------IMESLTKGSSQGFAN---  301
            EE ++   A                                 + E+   G   G  N   
Sbjct  237  EEQIKNKTARTPLHSLLGIADEDYVSPADAAAALKDRTPSPRLEEASNAGVENGGRNSPA  296

Query  302  ----EKPQVRRASLNPPPESNITWEEYIMAPPGQSPLLGR------NLVYKESSKSFKAT  351
                       AS    P+S++T EEY      +  L GR      NL  K   + F+A 
Sbjct  297  PGNQSNGSSAGASGTSTPKSSVTPEEYFTQ---EFDLHGRDVGGPKNLSTK--VQRFRAN  351

Query  352  VAMSPDFPLTV-DMLLNVLEVIAPFK--HFSKLREFVLMKLPPGFPVKIDIPILPTVTAK  408
            + ++ + P+ + + +L +L++++     H SKLR+F+ M+LP GFPVK++IP+   + A 
Sbjct  352  LWLAEEHPIRLQEQVLPILDLMSTMASPHVSKLRDFITMQLPAGFPVKVEIPLFHVLNAC  411

Query  409  ITFQE-FAFRNDID  421
            ITF   FA    +D
Sbjct  412  ITFGNVFALTTPVD  425


>SECG_DICDI unnamed protein product
Length=986

 Score = 59.3 bits (142),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 46/85 (54%), Gaps = 1/85 (1%)

Query  13   PLHKCIFQGDIKALSSLIRIYNIAE-KDTQGNTPLHLAVMLGRKESIQLLLAHGAPVKVK  71
            PLHK  F G  K L++LIR     E KD+QG TPLH A   G  +  ++LL  GA V   
Sbjct  404  PLHKAAFNGRSKCLATLIRSGAELEVKDSQGGTPLHNAAYNGHSDCCRILLKKGANVNAV  463

Query  72   NLAGWSPLAEAISYGDRQTISSLVR  96
            +    +PL  A + G R T+  L++
Sbjct  464  DTHSSTPLHLASAAGARDTVDVLIQ  488


 Score = 50.1 bits (118),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 44/154 (29%), Positives = 64/154 (42%), Gaps = 11/154 (7%)

Query  13   PLHKCIFQGDIKALSSLI-RIYNIAEKDTQGNTPLHLAVMLGRKESIQLLLAHGAPVKVK  71
            PLHK  F G       L+ +   I   D+QG TPLH A   GR + +  L+  GA ++VK
Sbjct  371  PLHKASFNGHSSCAKLLVDKGAPICIVDSQGATPLHKAAFNGRSKCLATLIRSGAELEVK  430

Query  72   NLAGWSPLAEAISYGDRQTISSLVRKLNQQAREQMEERRPNLLAT---LRQMGDFYMELK  128
            +  G +PL  A   G       L++K             P  LA+    R   D  ++ K
Sbjct  431  DSQGGTPLHNAAYNGHSDCCRILLKKGANVNAVDTHSSTPLHLASAAGARDTVDVLIQFK  490

Query  129  W-----DFQSWVPLVSRVLP--SDVCKIHKRGAS  155
                  +F    PLV  +    SDV ++  R  +
Sbjct  491  ARIDAKNFAGKTPLVYAIKKNHSDVARVLIRAGA  524


 Score = 48.9 bits (115),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 44/84 (52%), Gaps = 1/84 (1%)

Query  14   LHKCIFQGDIKALSSLIRI-YNIAEKDTQGNTPLHLAVMLGRKESIQLLLAHGAPVKVKN  72
            LH   F G +  +  LIR    I  KD +G TPLH A   G     +LL+  GAP+ + +
Sbjct  339  LHLAAFNGLLDMVDLLIRYKAQINIKDEEGATPLHKASFNGHSSCAKLLVDKGAPICIVD  398

Query  73   LAGWSPLAEAISYGDRQTISSLVR  96
              G +PL +A   G  + +++L+R
Sbjct  399  SQGATPLHKAAFNGRSKCLATLIR  422


 Score = 47.8 bits (112),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 49/164 (30%), Positives = 78/164 (48%), Gaps = 18/164 (11%)

Query  13   PLHKCIFQGDIKALSSLIRI--YNIAEKDTQGNTPLHLAVMLGRKESIQLLLAHGAPVKV  70
            PLHK  F G  +    L+ +    I  +D++ +T LHLA   G  + + LL+ + A + +
Sbjct  304  PLHKAAFNGHKEVCEYLLYLDPTMIDCRDSRQSTSLHLAAFNGLLDMVDLLIRYKAQINI  363

Query  71   KNLAGWSPLAEAISYGDRQTISSLVRK------LNQQAREQMEER----RPNLLATLRQM  120
            K+  G +PL +A   G       LV K      ++ Q    + +     R   LATL + 
Sbjct  364  KDEEGATPLHKASFNGHSSCAKLLVDKGAPICIVDSQGATPLHKAAFNGRSKCLATLIRS  423

Query  121  GDFYMELKWDFQSWVPLVSRVL--PSDVCKI-HKRGASIR-MDT  160
            G   +E+K D Q   PL +      SD C+I  K+GA++  +DT
Sbjct  424  G-AELEVK-DSQGGTPLHNAAYNGHSDCCRILLKKGANVNAVDT  465


 Score = 46.6 bits (109),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/89 (34%), Positives = 41/89 (46%), Gaps = 1/89 (1%)

Query  9    NEKYPLHKCIFQGDIKALSSLIRI-YNIAEKDTQGNTPLHLAVMLGRKESIQLLLAHGAP  67
            N + PLH     G+ + +  LI+    +   D    TPLH A   G    + LLL  GA 
Sbjct  168  NGETPLHHASAGGNPQCVELLIKADSKVNAVDNDCITPLHQASFSGHSSCVSLLLKKGAK  227

Query  68   VKVKNLAGWSPLAEAISYGDRQTISSLVR  96
            V  +++ G SPL  A S G    +  LVR
Sbjct  228  VDPRDIHGISPLHNAASAGYVDCVEQLVR  256


 Score = 43.1 bits (100),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 40/81 (49%), Gaps = 6/81 (7%)

Query  21   GDIKALSSLIRIYNIAEK----DTQGNTPLHLAVMLGRKESIQLLLAHGAPVKVKNLAGW  76
            GDI+ LS+L+   N A      D++  TPLH A   G    +  LL   A   +K+ AG 
Sbjct  46   GDIEKLSNLLN--NSATSPDTPDSEKRTPLHHAAFCGSAACVNFLLDKKANANIKDSAGN  103

Query  77   SPLAEAISYGDRQTISSLVRK  97
            +PL  A S G  + I  LV K
Sbjct  104  TPLQWASSRGHLECIKLLVEK  124


 Score = 39.7 bits (91),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 26/84 (31%), Positives = 41/84 (49%), Gaps = 2/84 (2%)

Query  10   EKYPLHKCIFQGDIKALSSLI-RIYNIAEKDTQGNTPLHLAVMLGRKESIQLLLAHGA-P  67
            ++ PLH   F G    ++ L+ +  N   KD+ GNTPL  A   G  E I+LL+  G   
Sbjct  69   KRTPLHHAAFCGSAACVNFLLDKKANANIKDSAGNTPLQWASSRGHLECIKLLVEKGGVD  128

Query  68   VKVKNLAGWSPLAEAISYGDRQTI  91
            V  K+    +PL +A  +   + +
Sbjct  129  VNTKDDKNGTPLHKASLFASAECV  152


 Score = 39.7 bits (91),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 40/84 (48%), Gaps = 1/84 (1%)

Query  13   PLHKCIFQGDIKALSSLIRI-YNIAEKDTQGNTPLHLAVMLGRKESIQLLLAHGAPVKVK  71
            PLH+  F G    +S L++    +  +D  G +PLH A   G  + ++ L+ +G  +   
Sbjct  205  PLHQASFSGHSSCVSLLLKKGAKVDPRDIHGISPLHNAASAGYVDCVEQLVRNGENINCV  264

Query  72   NLAGWSPLAEAISYGDRQTISSLV  95
            ++ G +PL      G+ Q    L+
Sbjct  265  DIEGVTPLHHTCFNGNLQLTKRLI  288


 Score = 36.6 bits (83),  Expect = 0.044, Method: Compositional matrix adjust.
 Identities = 24/84 (29%), Positives = 39/84 (46%), Gaps = 1/84 (1%)

Query  13   PLHKCIFQGDIKALSSLIRIY-NIAEKDTQGNTPLHLAVMLGRKESIQLLLAHGAPVKVK  71
            PLH     G +  +  L+R   NI   D +G TPLH     G  +  + L+  GA + + 
Sbjct  238  PLHNAASAGYVDCVEQLVRNGENINCVDIEGVTPLHHTCFNGNLQLTKRLIELGAKINMV  297

Query  72   NLAGWSPLAEAISYGDRQTISSLV  95
            +  G +PL +A   G ++    L+
Sbjct  298  DEMGETPLHKAAFNGHKEVCEYLL  321


 Score = 33.9 bits (76),  Expect = 0.35, Method: Compositional matrix adjust.
 Identities = 18/63 (29%), Positives = 30/63 (48%), Gaps = 0/63 (0%)

Query  34   NIAEKDTQGNTPLHLAVMLGRKESIQLLLAHGAPVKVKNLAGWSPLAEAISYGDRQTISS  93
            ++  KD +  TPLH A +    E +  LL   A  +     G +PL  A + G+ Q +  
Sbjct  128  DVNTKDDKNGTPLHKASLFASAECVLYLLNGKADPRAVTTNGETPLHHASAGGNPQCVEL  187

Query  94   LVR  96
            L++
Sbjct  188  LIK  190


 Score = 32.7 bits (73),  Expect = 0.70, Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 0/58 (0%)

Query  40   TQGNTPLHLAVMLGRKESIQLLLAHGAPVKVKNLAGWSPLAEAISYGDRQTISSLVRK  97
            T G TPLH A   G  + ++LL+   + V   +    +PL +A   G    +S L++K
Sbjct  167  TNGETPLHHASAGGNPQCVELLIKADSKVNAVDNDCITPLHQASFSGHSSCVSLLLKK  224



Lambda      K        H
   0.318    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5035546020


Query= XP_003392865.1 BTB/POZ domain-containing protein 9 isoform X1
[Bombus terrestris]

Length=615
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

BTBD9_DROME  unnamed protein product                                  624     0.0  
A0A0B4KGU2_DROME  unnamed protein product                             98.2    4e-21
Q9VEL0_DROME  unnamed protein product                                 97.4    7e-21
Q9VEN5_DROME  unnamed protein product                                 84.7    8e-17
Q7KSF5_DROME  unnamed protein product                                 84.7    8e-17


>BTBD9_DROME unnamed protein product
Length=722

 Score = 624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/540 (55%), Positives = 396/540 (73%), Gaps = 4/540 (1%)

Query  23   NTLSEDIGALYLSDDYSDVTLIVGGQRFNSHKIILAARSQYFRALLFGGLKESTQHEIEL  82
            +  S D+  L +++ Y+DV  IV  +R  +H++ILAARS+YFRALL+GG+ E+TQ +I L
Sbjct  30   DRFSADMARLCMNEQYADVEFIVEEERIPAHRVILAARSEYFRALLYGGMAETTQRQIPL  89

Query  83   KDANLTGFKGLLEYIYTGRMSLTDRREEVVLDILGLAHLYGFSELEASISDYLREILNIK  142
             +  L  FK LL YIY+G + L+   E+  +D+LG+A+ YGF +LE +IS+YLR+ L + 
Sbjct  90   -EVPLEAFKVLLRYIYSGTLLLSTLDEDSTIDVLGMANQYGFQDLEMAISNYLRQYLALD  148

Query  143  NVCLIFGTALLYRLEFLTKVCHEYMDEHACEVIQHESFLQLSADALNELVSRDSFYAPEI  202
            NVC+I   A LY LE LT+VC  +MD +A +++ H SF  LS ++L E++ RD F+APE+
Sbjct  149  NVCMILDAARLYNLEELTEVCLMFMDRNAGDLLLHNSFNTLSKESLEEVLRRDCFFAPEV  208

Query  203  DIFLAVRAWVNANPDADGKTVLDKVRLNLVSITDLLNVVRPTGLISPEAILDAIAARTQT  262
             IFLAV  W   N + D K+V+  VRL L+++  LL VVRP+G++ P+ ILDAI  R+ +
Sbjct  209  QIFLAVWKWSRFNSNVDFKSVVSYVRLPLMNLEHLLQVVRPSGILDPDKILDAIDERSTS  268

Query  263  RDSDLNYRGRLLIDVNVAQPTYGAQVLQGEMRSYLLDGYTNNYDMERGYTRHTITESREH  322
            +   L YR  L  + NVA  T+ ++ +QGE R  LLDG    YDME GYTRH IT+S++ 
Sbjct  269  KA--LPYRAALWPEENVAAETFLSRCIQGECRDALLDGDVTTYDMENGYTRHCITDSKDA  326

Query  323  GILVKLGTQCIINHIKMLLWDKDMRSYSYYLEVSMDQKNWVRVIDYTEYFCRSWQYLYFE  382
            GI+V+LGT C+INHI+MLLWD+D R+YSYY+EVS DQ++W RV+DY++Y CRSWQYLYFE
Sbjct  327  GIVVELGTFCMINHIRMLLWDRDSRAYSYYVEVSGDQQHWDRVVDYSDYHCRSWQYLYFE  386

Query  383  PRIVLYIRIVGTNNTVNKVFHLVSFEAYYTNHTEKLYNGFVIPTRNVATMDQSATVTEGV  442
             R V +IR+VGT NTVN+VFH+V  EA +T    +L N FV P  NVAT++ SA VT+GV
Sbjct  387  ARPVRFIRLVGTQNTVNRVFHVVGLEAMHTAKVPRLVNHFVAPKTNVATVEMSAIVTDGV  446

Query  443  CRSRNALLNGDTSNYDWDSGYTCHQVGSGSILIQLGQPYIIDSMRLLLWDCDDRSYSYYI  502
             R+RNAL+NGD   YDWDSGYTCHQ+GSG I+++LGQPY + SMRLLLWDCDDR+YS+YI
Sbjct  447  SRTRNALINGDYVRYDWDSGYTCHQLGSGEIVVRLGQPYYLGSMRLLLWDCDDRTYSFYI  506

Query  503  EVSGNSWSWVLVGDKTREACRSWQTIHFEPARPVVFIRIVGTHNTANEVFHCVHFECPAQ  562
            E+S N   W +V D+  +  RSWQ  HF P RPVV+IRIVGT NTANE+FHCVH ECP Q
Sbjct  507  EISTNRKEWQMVVDRRNDRTRSWQNFHFTP-RPVVYIRIVGTRNTANEIFHCVHLECPTQ  565


>A0A0B4KGU2_DROME unnamed protein product
Length=735

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 75/268 (28%), Positives = 118/268 (44%), Gaps = 23/268 (9%)

Query  24   TLSEDIGALYLSDDYSDVTLIVGG-------QRFNSHKIILAARSQYFRALLFGGLKEST  76
            T+ E   A++ ++  SDV  IVGG       Q   +HK ILA  S  F A+ +GGL E+ 
Sbjct  197  TVLERNAAMFNNELMSDVKFIVGGEFDIDPIQTIPAHKYILATGSSVFYAMFYGGLAENK  256

Query  77   QHEIELKDANLTGFKGLLEYIYTGRMSLTDRREEVVLDILGLAHLYGFSELEASISDYLR  136
            Q EI++ D   T F  LL Y+Y   + L     E +L  L  A  Y    L  +  +YL 
Sbjct  257  Q-EIKVPDVEPTAFLTLLRYLYCDEIKL---EPEHILATLYAAKKYIVPHLARACVNYLE  312

Query  137  EILNIKNVCLIFGTALLYRLEFLTKVCHEYMDEHACEVIQHESFLQLSADALNELVSRDS  196
              L  KN CL+   + L+    L + C E +D  A   ++ E F+ +       ++SR++
Sbjct  313  VKLTAKNACLLLSQSRLFEEPELMQRCWEVIDAQAEMAVKSEDFVDIDLKTFESILSRET  372

Query  197  FYAPEIDIFLAVRAW---------VNANPDADGK---TVLDKVRLNLVSITDLLNVVRPT  244
                EI +F A   W         ++  P    +     L  +R+  +S+ +  N V  T
Sbjct  373  LNCKEIHLFEAALNWAMNACEKMSIDDTPQNKRRLLGQALHLIRIPTMSLEEFANGVAQT  432

Query  245  GLISPEAILDAIAARTQTRDSDLNYRGR  272
            G++S +  +D     T      L +  R
Sbjct  433  GILSSQETIDMFLHFTAKMKPSLGFPTR  460


>Q9VEL0_DROME unnamed protein product
Length=677

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 75/268 (28%), Positives = 118/268 (44%), Gaps = 23/268 (9%)

Query  24   TLSEDIGALYLSDDYSDVTLIVGG-------QRFNSHKIILAARSQYFRALLFGGLKEST  76
            T+ E   A++ ++  SDV  IVGG       Q   +HK ILA  S  F A+ +GGL E+ 
Sbjct  197  TVLERNAAMFNNELMSDVKFIVGGEFDIDPIQTIPAHKYILATGSSVFYAMFYGGLAENK  256

Query  77   QHEIELKDANLTGFKGLLEYIYTGRMSLTDRREEVVLDILGLAHLYGFSELEASISDYLR  136
            Q EI++ D   T F  LL Y+Y   + L     E +L  L  A  Y    L  +  +YL 
Sbjct  257  Q-EIKVPDVEPTAFLTLLRYLYCDEIKL---EPEHILATLYAAKKYIVPHLARACVNYLE  312

Query  137  EILNIKNVCLIFGTALLYRLEFLTKVCHEYMDEHACEVIQHESFLQLSADALNELVSRDS  196
              L  KN CL+   + L+    L + C E +D  A   ++ E F+ +       ++SR++
Sbjct  313  VKLTAKNACLLLSQSRLFEEPELMQRCWEVIDAQAEMAVKSEDFVDIDLKTFESILSRET  372

Query  197  FYAPEIDIFLAVRAW---------VNANPDADGK---TVLDKVRLNLVSITDLLNVVRPT  244
                EI +F A   W         ++  P    +     L  +R+  +S+ +  N V  T
Sbjct  373  LNCKEIHLFEAALNWAMNACEKMSIDDTPQNKRRLLGQALHLIRIPTMSLEEFANGVAQT  432

Query  245  GLISPEAILDAIAARTQTRDSDLNYRGR  272
            G++S +  +D     T      L +  R
Sbjct  433  GILSSQETIDMFLHFTAKMKPSLGFPTR  460


>Q9VEN5_DROME unnamed protein product
Length=744

 Score = 84.7 bits (208),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 59/199 (30%), Positives = 99/199 (50%), Gaps = 7/199 (4%)

Query  23   NTLSEDIGALYLSDDY---SDVTLIVGGQRFNSHKIILAARSQYFRALLFGGLKESTQHE  79
            N   E +  +Y+   +   +DV L V  + F +HK++L+A S YF+A+  GGLKES    
Sbjct  39   NYAKEALKMMYMMRSHGMLTDVVLEVKKELFPAHKVVLSAASPYFKAMFTGGLKESEMSR  98

Query  80   IELKDANLTGFKGLLEYIYTGRMSLTDRREEVVLDILGLAHLYGFSELEASISDYLREIL  139
            ++L+    T    +L ++YTG++ +T   E  V  +L  A ++    +  +   +L   L
Sbjct  99   VQLQGVCPTAMSRILYFMYTGQIRVT---EVTVCQLLPAATMFQVPNVIDACCAFLERQL  155

Query  140  NIKNVCLIFGTALLYRLEFLTKVCHEYMDEHACEVIQHESFLQLSADALNELVSRDSF-Y  198
            +  N   I   A  +    L K  + +++ +  +V Q E FLQLSA  L  L+ RD    
Sbjct  156  DPTNAIGIAHFAEQHGCVELQKKANVFIERNFTQVCQEEEFLQLSAYQLIALIRRDELNV  215

Query  199  APEIDIFLAVRAWVNANPD  217
              E +++ AV  WV  + D
Sbjct  216  QEEREVYNAVLKWVKYDED  234


>Q7KSF5_DROME unnamed protein product
Length=776

 Score = 84.7 bits (208),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 59/199 (30%), Positives = 99/199 (50%), Gaps = 7/199 (4%)

Query  23   NTLSEDIGALYLSDDY---SDVTLIVGGQRFNSHKIILAARSQYFRALLFGGLKESTQHE  79
            N   E +  +Y+   +   +DV L V  + F +HK++L+A S YF+A+  GGLKES    
Sbjct  71   NYAKEALKMMYMMRSHGMLTDVVLEVKKELFPAHKVVLSAASPYFKAMFTGGLKESEMSR  130

Query  80   IELKDANLTGFKGLLEYIYTGRMSLTDRREEVVLDILGLAHLYGFSELEASISDYLREIL  139
            ++L+    T    +L ++YTG++ +T   E  V  +L  A ++    +  +   +L   L
Sbjct  131  VQLQGVCPTAMSRILYFMYTGQIRVT---EVTVCQLLPAATMFQVPNVIDACCAFLERQL  187

Query  140  NIKNVCLIFGTALLYRLEFLTKVCHEYMDEHACEVIQHESFLQLSADALNELVSRDSF-Y  198
            +  N   I   A  +    L K  + +++ +  +V Q E FLQLSA  L  L+ RD    
Sbjct  188  DPTNAIGIAHFAEQHGCVELQKKANVFIERNFTQVCQEEEFLQLSAYQLIALIRRDELNV  247

Query  199  APEIDIFLAVRAWVNANPD  217
              E +++ AV  WV  + D
Sbjct  248  QEEREVYNAVLKWVKYDED  266



Lambda      K        H
   0.318    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5035546020


Query= XP_003392868.1 ejaculatory bulb-specific protein 3 isoform X1
[Bombus terrestris]

Length=125
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9W0X2_DROME  unnamed protein product                                 123     2e-37
PEB3_DROME  unnamed protein product                                   121     2e-36
Q9VBX5_DROME  unnamed protein product                                 27.7    2.8  
Q8IN05_DROME  unnamed protein product                                 26.6    6.9  
BNK_DROME  unnamed protein product                                    26.2    8.9  


>Q9W0X2_DROME unnamed protein product
Length=121

 Score = 123 bits (308),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 80/120 (67%), Gaps = 3/120 (3%)

Query  1    MKIYLLLFTLVAVVCVTA---EDYTTKYDNVDVDRILQNGRILTNYIKCMLDEGPCTNEG  57
            MK  L L   V V    A   + YT KYD+V+VD +L N R+L NY+KC++D+GPCT EG
Sbjct  1    MKASLALVFCVCVGLAAAAPEKTYTNKYDSVNVDEVLGNNRVLGNYLKCLMDKGPCTAEG  60

Query  58   RELKKILPDALSTGCSKCNEKQKHTANKVVNYLRTKRPKDWERLSAKYDSSGEYKKRYEN  117
            RELK++LPDAL + CSKC E Q+  + KV+NYLR  +  +W+ L  KYD  G Y+ ++E 
Sbjct  61   RELKRLLPDALHSDCSKCTEVQRKNSQKVINYLRANKAGEWKLLLNKYDPQGIYRAKHEG  120


>PEB3_DROME unnamed protein product
Length=126

 Score = 121 bits (303),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 71/95 (75%), Gaps = 0/95 (0%)

Query  21   YTTKYDNVDVDRILQNGRILTNYIKCMLDEGPCTNEGRELKKILPDALSTGCSKCNEKQK  80
            YTTKYDN+DVD IL++ R+  NY KC++D G CT EGRELKK LPDAL T CSKC+EKQ+
Sbjct  21   YTTKYDNIDVDEILKSDRLFGNYFKCLVDNGKCTPEGRELKKSLPDALKTECSKCSEKQR  80

Query  81   HTANKVVNYLRTKRPKDWERLSAKYDSSGEYKKRY  115
               +KV+ Y+   +P++W++L AKYD    Y KRY
Sbjct  81   QNTDKVIRYIIENKPEEWKQLQAKYDPDEIYIKRY  115


>Q9VBX5_DROME unnamed protein product
Length=917

 Score = 27.7 bits (60),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 25/79 (32%), Positives = 37/79 (47%), Gaps = 7/79 (9%)

Query  26   DNVDVDRILQNGRILTNYIKCMLDEGP----CTNEGRELKKILPDALSTGCSKCNEKQKH  81
            DN + DRI Q  R L    +    + P    C  EGR L+KI+   +S G      + + 
Sbjct  682  DNNEADRIWQYERALETDSEIPFVKKPTVEKCEVEGRRLRKIMLKKISNGSELTPFQARQ  741

Query  82   TANKVV-NYLR--TKRPKD  97
            T +  + + LR  T+ PKD
Sbjct  742  TFSMYLESVLRRLTEDPKD  760


>Q8IN05_DROME unnamed protein product
Length=1415

 Score = 26.6 bits (57),  Expect = 6.9, Method: Composition-based stats.
 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 4/40 (10%)

Query  45    KCMLDEGPCTNEGRELKKILPDALSTGCSKCNEKQKHTAN  84
             K  LDE PC ++ ++L+  L D +ST      +K+ H  N
Sbjct  987   KTKLDEKPCEDQLKQLELHLSDFMST----TEQKEPHKPN  1022


>BNK_DROME unnamed protein product
Length=303

 Score = 26.2 bits (56),  Expect = 8.9, Method: Compositional matrix adjust.
 Identities = 12/48 (25%), Positives = 23/48 (48%), Gaps = 0/48 (0%)

Query  64   LPDALSTGCSKCNEKQKHTANKVVNYLRTKRPKDWERLSAKYDSSGEY  111
            L +   +G SK   +   T N+ +  LRT RP++    +A   ++  +
Sbjct  151  LTNTFESGFSKLMPQASSTNNRFIAMLRTARPQNVATTTANSSTANSF  198



Lambda      K        H
   0.318    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5035546020


Query= XP_003392871.1 exosome complex component RRP42 isoform X1 [Bombus
terrestris]

Length=291
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q29QQ9_DROME  unnamed protein product                                 291     2e-98
Q8T4A9_DROME  unnamed protein product                                 93.2    3e-21
Q583T6_TRYB2  unnamed protein product                                 55.8    1e-08
Q95Z11_9TRYP  unnamed protein product                                 53.9    4e-08
Q4GYW4_TRYB2  unnamed protein product                                 43.1    1e-04


>Q29QQ9_DROME unnamed protein product
Length=296

 Score = 291 bits (745),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 153/296 (52%), Positives = 209/296 (71%), Gaps = 5/296 (2%)

Query  1    MAETVLSSGEKTFILHGIDADFRNDGRRRCEYRSMEIETKLMPQTHGSARLRIGNTDILV  60
            MA   LS  EKT+ILHG++ DFR DGR R +YR M++ET L+    GSARLR+ NTDILV
Sbjct  1    MAYVALSEAEKTYILHGVEDDFRCDGRSRRDYRPMDLETGLVSNASGSARLRLANTDILV  60

Query  61   GIKIELDVPHADRSNEGKLEFFVDCSATATPAFEGKGGDDLATEISNILTAAYQTPNAFD  120
            G+K E+DVP+      GKLEFFVDCSA ATP FEG+GG DLA E+   L  AY++P AF+
Sbjct  61   GVKTEIDVPNPLTPEFGKLEFFVDCSANATPEFEGRGGSDLAQELILSLQNAYESPLAFN  120

Query  121  LRTLCILPHKKCWKIYVDILILQCGGNLFDAVGIAVKAALNSTEIPKITTATLDGGEPDI  180
             RTLC++P ++CWK+Y+DILIL+CGGNL DAV +A KAAL +T++P++T   LD G  D+
Sbjct  121  YRTLCLIPGQQCWKLYIDILILECGGNLHDAVSLAAKAALFNTKLPRVTATMLDAGITDL  180

Query  181  ELSDDAYDCIQLDTSNYPIIVTLCKIGDNYIVDPTSEEEVCSASSIVMSVLP-NGK--VS  237
             +SD+ YDC ++     P++VT+CKIGD  +VDP++EEEVCS  S+V+SV   NG+  +S
Sbjct  181  IISDNPYDCTRIGIETVPLLVTVCKIGDYVLVDPSAEEEVCSTVSMVVSVSMRNGQAFLS  240

Query  238  SVIKLGYGSIQPNTFIKMLQIGKNIGLQLNESLMKALK-EESQLGQQR-QILGFLR  291
                 G G++  +T    L++G  IG  L+  L K L  E+ ++G +R QI+GFL+
Sbjct  241  GTHLTGGGAMHRDTMRNCLELGLAIGEHLDRLLTKMLNLEQQRVGLKRPQIVGFLK  296


>Q8T4A9_DROME unnamed protein product
Length=412

 Score = 93.2 bits (230),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 73/261 (28%), Positives = 117/261 (45%), Gaps = 12/261 (5%)

Query  7    SSGEKTFILHGIDADFRNDGRRRCEYRSMEIETKLMPQTHGSARLRIGNTDILVGIKIEL  66
            S  E++F+   +  + R DGRR  E R +E+      +  GS  + +G+T +L  +  E+
Sbjct  13   SKPERSFVQLAVKQNQRLDGRRSNESRDVEL---TFGKDWGSVAVSMGDTKVLAQVTCEM  69

Query  67   DVPHADRSNEGKLEFFVDCSATATPAFEGKGGDDLATEISNILTAAYQTPNAFDLRTLCI  126
              P   R NEGK+   V     A         D  + +++++L   +++  + DL +LC+
Sbjct  70   GPPALSRPNEGKIHLNVYLGGVAFLDEAHTTHDQRSLKLNSLLERTFRSSRSIDLESLCV  129

Query  127  LPHKKCWKIYVDILILQCGGNLFDAVGIAVKAALNSTEIPKITTATLDGGEPDIELSDDA  186
               K  W I V++ +L   GNL+DA  IA  AAL     P +       GE  I      
Sbjct  130  AVEKHVWCIRVNVNVLNHDGNLYDASTIATLAALMHFRRPDV---WYKDGELRI-FKKKE  185

Query  187  YDCIQLDTSNYPIIVTLC--KIGDNYIVDPTSEEEVCSASSIVMSVLPNGKVSSVIKLGY  244
             + I L   +YP+ VT C  K     I+DPT  EE  + S IV+S         +  L  
Sbjct  186  REFIPLLFHHYPVSVTYCVYKSSVQPILDPTLLEENAADSVIVLSF---NSFQELCSLTA  242

Query  245  GSIQPNTFIKMLQIGKNIGLQ  265
            G   P     ++Q  +N  ++
Sbjct  243  GGTAPTNARIIMQCARNAAVR  263


>Q583T6_TRYB2 unnamed protein product
Length=363

 Score = 55.8 bits (133),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 71/171 (42%), Gaps = 8/171 (5%)

Query  1    MAETVLSSGEKTFILHGIDADFRNDGRRRCEYRSMEIETKLMPQTHGSARLRIGNTDILV  60
            +A   L+  E  F      A  R D R   + R + +E  L+  +     +R G + +  
Sbjct  10   IASPALTQREVEFTKSAWLAGLRPDQRTAQQMREVSVEFPLL--SRDVVVVRCGGSVVTA  67

Query  61   GIKIELDVPHADRSNEGKLEFFVDCSATA--TPAFEGKGGDDLATEISNILTAAYQTPNA  118
             I   L  P   R   G L F V    T   +PA +G    +L   +  ++    +T   
Sbjct  68   AIATALVEPTPQRPKHGLLHFSVRRLHTERDSPAADGSTQKNLVAFLERLV----RTGGV  123

Query  119  FDLRTLCILPHKKCWKIYVDILILQCGGNLFDAVGIAVKAALNSTEIPKIT  169
             D   LC+LP +K W + VD+ I+   GN  DA   AV A L     P++T
Sbjct  124  IDTAGLCVLPGQKVWSLTVDVTIMNDEGNCNDAAVWAVIALLMHHRRPELT  174


 Score = 33.1 bits (74),  Expect = 0.22, Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 26/38 (68%), Gaps = 0/38 (0%)

Query  211  IVDPTSEEEVCSASSIVMSVLPNGKVSSVIKLGYGSIQ  248
            +VDPT+ E + +ASSIV+++   G+V +V+K    SI 
Sbjct  261  VVDPTTAESLAAASSIVVAINAEGQVCTVVKAEGCSIH  298


>Q95Z11_9TRYP unnamed protein product
Length=363

 Score = 53.9 bits (128),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 46/171 (27%), Positives = 71/171 (42%), Gaps = 8/171 (5%)

Query  1    MAETVLSSGEKTFILHGIDADFRNDGRRRCEYRSMEIETKLMPQTHGSARLRIGNTDILV  60
            +A   L+  E  F      A  R D R   + R + +E  L+  +     +R G + +  
Sbjct  10   IASPALTQREVEFTKSAWLAGLRPDQRTAQQMREVSVEFPLL--SRDVVVVRCGGSVVTA  67

Query  61   GIKIELDVPHADRSNEGKLEFFVDCSATA--TPAFEGKGGDDLATEISNILTAAYQTPNA  118
             I   L  P   R   G L F V    T   +PA +G    +L   +  ++    +T   
Sbjct  68   AIATALVEPTPQRPKHGLLHFSVRRLHTEKDSPAADGSTQKNLVAFLERLV----RTGGV  123

Query  119  FDLRTLCILPHKKCWKIYVDILILQCGGNLFDAVGIAVKAALNSTEIPKIT  169
             D   LC+LP +K W + V++ I+   GN  DA   AV A L     P++T
Sbjct  124  IDTAGLCVLPGQKVWSLTVNVTIMNDEGNCNDAAVWAVIALLMHHRRPELT  174


 Score = 33.1 bits (74),  Expect = 0.23, Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 26/38 (68%), Gaps = 0/38 (0%)

Query  211  IVDPTSEEEVCSASSIVMSVLPNGKVSSVIKLGYGSIQ  248
            +VDPT+ E + +ASSIV+++   G+V +V+K    SI 
Sbjct  261  VVDPTTAESLAAASSIVVAINAEGQVCTVVKAEGCSIH  298


>Q4GYW4_TRYB2 unnamed protein product
Length=397

 Score = 43.1 bits (100),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/107 (29%), Positives = 53/107 (50%), Gaps = 3/107 (3%)

Query  132  CWKIYVDILILQC-GGNLFDAVGIAVKAALNSTEIPKITTATLDGGEPDIELSDDAYDCI  190
             ++I VD  +LQ  GG+L   V +AV AAL +  +P +T      G   +E++       
Sbjct  197  AFRIDVDAHVLQAHGGSLASIVALAVHAALKTVRLPSVTLHEASAGF-SLEVNYSKPYAT  255

Query  191  QLDTSNYPII-VTLCKIGDNYIVDPTSEEEVCSASSIVMSVLPNGKV  236
             ++ S  P++ V       +Y+VDPT  EE+     + ++V   G+V
Sbjct  256  AVNWSRLPVLSVVHVSPTRHYVVDPTRLEELALPQQLRVAVNSFGQV  302



Lambda      K        H
   0.318    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5035546020


Query= XP_003392873.1 GTP-binding protein Rheb homolog [Bombus terrestris]

Length=182
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RHEB_DROME  unnamed protein product                                   296     6e-104
RHEB_DICDI  unnamed protein product                                   192     5e-63 
RASC_DICDI  unnamed protein product                                   140     2e-42 
RAP1_CAEEL  unnamed protein product                                   139     7e-42 
RAP1_DROME  unnamed protein product                                   136     6e-41 


>RHEB_DROME unnamed protein product
Length=182

 Score = 296 bits (758),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 141/182 (77%), Positives = 159/182 (87%), Gaps = 0/182 (0%)

Query  1    MPPKQRKIAIMGYRSVGKSSLSIQFVEGQFVDSYDPTIENTFTKSTRVNSQDYEVKLVDT  60
            MP K+R IA+MGYRSVGKSSL IQFVEGQFVDSYDPTIENTFTK  RV SQDY VKL+DT
Sbjct  1    MPTKERHIAMMGYRSVGKSSLCIQFVEGQFVDSYDPTIENTFTKIERVKSQDYIVKLIDT  60

Query  61   AGQDEYSIFPTQYSMDIHGYVLVYSITSAKSFEVVQIIYDKLLDITGKVHVPIVLVGNKT  120
            AGQDEYSIFP QYSMD HGYVLVYSITS KSFEVV+IIY+KLLD+ GK +VP+VLVGNK 
Sbjct  61   AGQDEYSIFPVQYSMDYHGYVLVYSITSQKSFEVVKIIYEKLLDVMGKKYVPVVLVGNKI  120

Query  121  DLYVDRMITTEQGKRLADSWHAAFLETSAKQNESVADIFHTLLIEIEKADGNVQEKSNCI  180
            DL+ +R ++TE+GK+LA+SW AAFLETSAKQNESV DIFH LLI IE  +GN QEKS C+
Sbjct  121  DLHQERTVSTEEGKKLAESWRAAFLETSAKQNESVGDIFHQLLILIENENGNPQEKSGCL  180

Query  181  IS  182
            +S
Sbjct  181  VS  182


>RHEB_DICDI unnamed protein product
Length=185

 Score = 192 bits (489),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 126/182 (69%), Gaps = 2/182 (1%)

Query  2    PPKQRKIAIMGYRSVGKSSLSIQFVEGQFVDSYDPTIENTFTKSTRVNSQDYEVKLVDTA  61
            P K RKI +MG R+VGKS++++QFVE    DSY PTIENT+ K  R   Q+Y V+++DTA
Sbjct  3    PQKHRKICVMGSRAVGKSTITMQFVESHCPDSYHPTIENTYQKIIRHQGQEYSVEIIDTA  62

Query  62   GQDEYSIFPTQYSMDIHGYVLVYSITSAKSFEVVQIIYDKLLDITGKVHVPIVLVGNKTD  121
            GQDEYSI   QYS+ IHGY+LVYS+TS  S EV++++ DK+L   G   +P VLVGNK+D
Sbjct  63   GQDEYSILQKQYSIGIHGYILVYSVTSVSSLEVIKVLNDKILSSLGAEKIPRVLVGNKSD  122

Query  122  LYVDRMITTEQGKRLADSWHAAFLETSAKQNESVADIFHTLLIEIEKADGNVQ--EKSNC  179
            L  +R I+ +QG +LA+ W  AF+E S K NE+V ++F  +L E+ K     +  +K  C
Sbjct  123  LDNERNISRDQGIQLANEWECAFVECSGKNNENVEEVFKQILNEVNKGSTGPEPPQKEGC  182

Query  180  II  181
            I+
Sbjct  183  IL  184


>RASC_DICDI unnamed protein product
Length=189

 Score = 140 bits (353),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 111/183 (61%), Gaps = 8/183 (4%)

Query  7    KIAIMGYRSVGKSSLSIQFVEGQFVDSYDPTIENTFTKSTRVNSQDYEVKLVDTAGQDEY  66
            K+ I+G   VGKS+L+IQ  + QF+  YDPTIEN++ K   ++ + Y + ++DTAGQ+EY
Sbjct  6    KLVIVGDGGVGKSALTIQLTQNQFIAEYDPTIENSYRKQVNIDEEVYMLDILDTAGQEEY  65

Query  67   SIFPTQYSMDIHGYVLVYSITSAKSFEVVQIIYDKLLDITGKVHVPIVLVGNKTDLY-VD  125
            S    QY     G+++VYSI S  SFE V    +++L +      PIV++GNK DL   D
Sbjct  66   SAMRDQYIRSGRGFLIVYSIISRASFEAVTTFREQILRVKDLSTYPIVIIGNKADLPDKD  125

Query  126  RMITTEQGKRLADSWHAAFLETSAKQNESVADIFHTLLIEIEKADGNVQ-------EKSN  178
            R +   +GK LA S+ A FLETSAK   +V + F TL+ EI++ + N Q       +K  
Sbjct  126  RKVPPMEGKELAKSFGAPFLETSAKSRVNVEEAFFTLVREIKRWNQNPQNEEMLPPKKRG  185

Query  179  CII  181
            CII
Sbjct  186  CII  188


>RAP1_CAEEL unnamed protein product
Length=188

 Score = 139 bits (350),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 71/186 (38%), Positives = 120/186 (65%), Gaps = 8/186 (4%)

Query  4    KQRKIAIMGYRSVGKSSLSIQFVEGQFVDSYDPTIENTFTKSTRVNSQDYEVKLVDTAGQ  63
            ++ KI ++G   VGKS+L++QFV+G FV+ YDPTIE+++ K   V+ Q   ++++DTAG 
Sbjct  2    REYKIVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGT  61

Query  64   DEYSIFPTQYSMDIHGYVLVYSITSAKSFEVVQIIYDKLLDITGKVHVPIVLVGNKTDLY  123
            ++++     Y  +  G+VLVYSIT+  +F  +  + D++L +     VP++LVGNK DL 
Sbjct  62   EQFTAMRDLYMKNGQGFVLVYSITAQSTFNDLMDLRDQILRVKDTDEVPMILVGNKCDLE  121

Query  124  VDRMITTEQGKRLADSWHAAFLETSAKQNESVADIFHTLLIEIEK---ADGNVQEKSN--  178
             +R++  +QG+ LA  + +AFLETSAK   +V+++F+ L+ +I +     G  Q +SN  
Sbjct  122  DERVVGKDQGQNLARQFGSAFLETSAKAKINVSEVFYDLVRQINRRYPESGRRQGQSNKQ  181

Query  179  ---CII  181
               C+I
Sbjct  182  CCSCVI  187


>RAP1_DROME unnamed protein product
Length=184

 Score = 136 bits (343),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 109/163 (67%), Gaps = 0/163 (0%)

Query  4    KQRKIAIMGYRSVGKSSLSIQFVEGQFVDSYDPTIENTFTKSTRVNSQDYEVKLVDTAGQ  63
            ++ KI ++G   VGKS+L++QFV+  FV+ YDPTIE+++ K   V+ Q   ++++DTAG 
Sbjct  2    REYKIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGT  61

Query  64   DEYSIFPTQYSMDIHGYVLVYSITSAKSFEVVQIIYDKLLDITGKVHVPIVLVGNKTDLY  123
            ++++     Y  +  G+VLVYSIT+  +F  +Q + +++L +     VP+VLVGNK DL 
Sbjct  62   EQFTAMRDLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCDLE  121

Query  124  VDRMITTEQGKRLADSWHAAFLETSAKQNESVADIFHTLLIEI  166
             +R++  E GK LA  ++ AF+ETSAK   +V DIF+ L+ +I
Sbjct  122  EERVVGKELGKNLATQFNCAFMETSAKAKVNVNDIFYDLVRQI  164



Lambda      K        H
   0.318    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5035546020


Query= XP_003392875.1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex
subunit 12 [Bombus terrestris]

Length=142
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

NDUAC_CAEEL  unnamed protein product                                  117     2e-34
G5ECX2_CAEEL  unnamed protein product                                 28.5    2.4  
C1716_DROME  unnamed protein product                                  27.3    5.9  
O77375_PLAF7  unnamed protein product                                 26.9    8.9  
TRH_DROME  unnamed protein product                                    26.6    9.2  


>NDUAC_CAEEL unnamed protein product
Length=146

 Score = 117 bits (293),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 87/139 (63%), Gaps = 2/139 (1%)

Query  3    NIAKFVGLDRACNYWRTIKANGGILNSLFTLYRVDELKAGTLVGVDKYGNKYYENNSNFV  62
            ++  ++G+D+   + + +K  GG+   L   Y +D  + GTLVG D +GN+YYENN+ FV
Sbjct  2    SLKAWLGIDKIQKFGQMVKEIGGVKAVLKKRYLMDATRVGTLVGSDNFGNRYYENNAYFV  61

Query  63   GSNRWVIYSEEVNMDYDGSQVPAEWFGWLHYKTDLIPTKDPNRPKYSWMADHKPNLSG-T  121
              NRWV + ++V +DYD +QVP EW  WLH+ TD  P+  P  P   W+ +HK N S   
Sbjct  62   PRNRWVEFPDKVWLDYDATQVPPEWHSWLHHITDDAPSVKPP-PTQDWVLEHKENTSIYA  120

Query  122  SEAYIPYTTTKPKIIPWKP  140
             + Y+PY+TT+ KI  W+P
Sbjct  121  DKKYVPYSTTRTKIQGWQP  139


>G5ECX2_CAEEL unnamed protein product
Length=1187

 Score = 28.5 bits (62),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 38/87 (44%), Gaps = 11/87 (13%)

Query  65   NRWVIYSEEVNMDYDGSQVPAEWFGWLHYKTDLIPTKDPNR--------PKYSWM-ADHK  115
            N W + +EEVN++ +  +V      W++Y   ++      R        PK  W+    +
Sbjct  655  NEWEVINEEVNVNKETFEVDITLTPWVNYTFRVVAVNSHGRSDMKIDGQPKEDWLTCQTR  714

Query  116  PNLSGTSEAYIPYTTTKPK--IIPWKP  140
            P+   T+   +    T+P   +I WKP
Sbjct  715  PSFPYTNPTGVKGEGTEPDNLVISWKP  741


>C1716_DROME unnamed protein product
Length=2313

 Score = 27.3 bits (59),  Expect = 5.9, Method: Composition-based stats.
 Identities = 14/45 (31%), Positives = 20/45 (44%), Gaps = 8/45 (18%)

Query  97    LIPTKDPNRPKYSWMADHKPNLSGTSEAYIPYTTTKPKIIPWKPP  141
             L P  DP  P ++W          TS+  I Y   + +I  W+PP
Sbjct  1958  LPPGVDPLPPAWNWQV--------TSDGDIYYYNLRERISQWEPP  1994


>O77375_PLAF7 unnamed protein product
Length=2457

 Score = 26.9 bits (58),  Expect = 8.9, Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 20/42 (48%), Gaps = 2/42 (5%)

Query  99    PTKDPNRPKYSWMADHKPNLSGTSEAYIPYTTTKPKIIPWKP  140
             P   P  PKYS  +    N++  S  Y PY+ T PK  P  P
Sbjct  2342  PKYSPTSPKYSPTSPVAQNIA--SPNYSPYSITSPKFSPTSP  2381


>TRH_DROME unnamed protein product
Length=1022

 Score = 26.6 bits (57),  Expect = 9.2, Method: Composition-based stats.
 Identities = 11/34 (32%), Positives = 20/34 (59%), Gaps = 0/34 (0%)

Query  96   DLIPTKDPNRPKYSWMADHKPNLSGTSEAYIPYT  129
            D++P   P +P+ S+ A   P+ S T+E  + Y+
Sbjct  894  DVVPATLPLKPQASYTATMHPSGSTTTEGGVTYS  927



Lambda      K        H
   0.318    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5035546020


Query= XP_003392876.2 uncharacterized protein LOC100644354 [Bombus
terrestris]

Length=160
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9PDI0_DROME  unnamed protein product                                 28.9    1.7  
M9PE21_DROME  unnamed protein product                                 28.9    1.8  
Q9W0S4_DROME  unnamed protein product                                 28.9    2.0  
Q9U3W4_DROME  unnamed protein product                                 28.9    2.0  
Q8SZ83_DROME  unnamed protein product                                 28.5    2.1  


>M9PDI0_DROME unnamed protein product
Length=282

 Score = 28.9 bits (63),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 20/63 (32%), Positives = 30/63 (48%), Gaps = 9/63 (14%)

Query  73   NALERVLTPLMGNKNAIITRYVIAKCLMGLVILYGARYYYKYNTGDWTRQSGWMVRPTRE  132
            N   RVL+   G +N + TR +  KC  G     G RY      G+W++  G  +  TRE
Sbjct  174  NMRSRVLSLRKGEQNCLPTRTIQKKCKKG---ARGCRYEK----GEWSQCVGGQI--TRE  224

Query  133  ARI  135
             ++
Sbjct  225  DKL  227


>M9PE21_DROME unnamed protein product
Length=281

 Score = 28.9 bits (63),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 18/63 (29%), Positives = 29/63 (46%), Gaps = 12/63 (19%)

Query  73   NALERVLTPLMGNKNAIITRYVIAKCLMGLVILYGARYYYKYNTGDWTRQSGWMVRPTRE  132
            N   RVL+   G +N + TR +  KC  G           +Y  G+W++  G  +  TRE
Sbjct  174  NMRSRVLSLRKGEQNCLPTRTIQKKCKKGC----------RYEKGEWSQCVGGQI--TRE  221

Query  133  ARI  135
             ++
Sbjct  222  DKL  224


>Q9W0S4_DROME unnamed protein product
Length=279

 Score = 28.9 bits (63),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 18/63 (29%), Positives = 29/63 (46%), Gaps = 12/63 (19%)

Query  73   NALERVLTPLMGNKNAIITRYVIAKCLMGLVILYGARYYYKYNTGDWTRQSGWMVRPTRE  132
            N   RVL+   G +N + TR +  KC  G           +Y  G+W++  G  +  TRE
Sbjct  174  NMRSRVLSLRKGEQNCLPTRTIQKKCKKGC----------RYEKGEWSQCVGGQI--TRE  221

Query  133  ARI  135
             ++
Sbjct  222  DKL  224


>Q9U3W4_DROME unnamed protein product
Length=279

 Score = 28.9 bits (63),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 18/63 (29%), Positives = 29/63 (46%), Gaps = 12/63 (19%)

Query  73   NALERVLTPLMGNKNAIITRYVIAKCLMGLVILYGARYYYKYNTGDWTRQSGWMVRPTRE  132
            N   RVL+   G +N + TR +  KC  G           +Y  G+W++  G  +  TRE
Sbjct  174  NMRSRVLSLRKGEQNCLPTRTIQKKCKKGC----------RYEKGEWSQCVGGQI--TRE  221

Query  133  ARI  135
             ++
Sbjct  222  DKL  224


>Q8SZ83_DROME unnamed protein product
Length=279

 Score = 28.5 bits (62),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 18/63 (29%), Positives = 29/63 (46%), Gaps = 12/63 (19%)

Query  73   NALERVLTPLMGNKNAIITRYVIAKCLMGLVILYGARYYYKYNTGDWTRQSGWMVRPTRE  132
            N   RVL+   G +N + TR +  KC  G           +Y  G+W++  G  +  TRE
Sbjct  174  NMRSRVLSLRKGEQNCLPTRTIQKKCEKGC----------RYEKGEWSQCVGGQI--TRE  221

Query  133  ARI  135
             ++
Sbjct  222  DKL  224



Lambda      K        H
   0.318    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5035546020


Query= XP_003392877.2 uncharacterized protein LOC100644354 [Bombus
terrestris]

Length=160
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9PDI0_DROME  unnamed protein product                                 28.9    1.7  
M9PE21_DROME  unnamed protein product                                 28.9    1.8  
Q9W0S4_DROME  unnamed protein product                                 28.9    2.0  
Q9U3W4_DROME  unnamed protein product                                 28.9    2.0  
Q8SZ83_DROME  unnamed protein product                                 28.5    2.1  


>M9PDI0_DROME unnamed protein product
Length=282

 Score = 28.9 bits (63),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 20/63 (32%), Positives = 30/63 (48%), Gaps = 9/63 (14%)

Query  73   NALERVLTPLMGNKNAIITRYVIAKCLMGLVILYGARYYYKYNTGDWTRQSGWMVRPTRE  132
            N   RVL+   G +N + TR +  KC  G     G RY      G+W++  G  +  TRE
Sbjct  174  NMRSRVLSLRKGEQNCLPTRTIQKKCKKG---ARGCRYEK----GEWSQCVGGQI--TRE  224

Query  133  ARI  135
             ++
Sbjct  225  DKL  227


>M9PE21_DROME unnamed protein product
Length=281

 Score = 28.9 bits (63),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 18/63 (29%), Positives = 29/63 (46%), Gaps = 12/63 (19%)

Query  73   NALERVLTPLMGNKNAIITRYVIAKCLMGLVILYGARYYYKYNTGDWTRQSGWMVRPTRE  132
            N   RVL+   G +N + TR +  KC  G           +Y  G+W++  G  +  TRE
Sbjct  174  NMRSRVLSLRKGEQNCLPTRTIQKKCKKGC----------RYEKGEWSQCVGGQI--TRE  221

Query  133  ARI  135
             ++
Sbjct  222  DKL  224


>Q9W0S4_DROME unnamed protein product
Length=279

 Score = 28.9 bits (63),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 18/63 (29%), Positives = 29/63 (46%), Gaps = 12/63 (19%)

Query  73   NALERVLTPLMGNKNAIITRYVIAKCLMGLVILYGARYYYKYNTGDWTRQSGWMVRPTRE  132
            N   RVL+   G +N + TR +  KC  G           +Y  G+W++  G  +  TRE
Sbjct  174  NMRSRVLSLRKGEQNCLPTRTIQKKCKKGC----------RYEKGEWSQCVGGQI--TRE  221

Query  133  ARI  135
             ++
Sbjct  222  DKL  224


>Q9U3W4_DROME unnamed protein product
Length=279

 Score = 28.9 bits (63),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 18/63 (29%), Positives = 29/63 (46%), Gaps = 12/63 (19%)

Query  73   NALERVLTPLMGNKNAIITRYVIAKCLMGLVILYGARYYYKYNTGDWTRQSGWMVRPTRE  132
            N   RVL+   G +N + TR +  KC  G           +Y  G+W++  G  +  TRE
Sbjct  174  NMRSRVLSLRKGEQNCLPTRTIQKKCKKGC----------RYEKGEWSQCVGGQI--TRE  221

Query  133  ARI  135
             ++
Sbjct  222  DKL  224


>Q8SZ83_DROME unnamed protein product
Length=279

 Score = 28.5 bits (62),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 18/63 (29%), Positives = 29/63 (46%), Gaps = 12/63 (19%)

Query  73   NALERVLTPLMGNKNAIITRYVIAKCLMGLVILYGARYYYKYNTGDWTRQSGWMVRPTRE  132
            N   RVL+   G +N + TR +  KC  G           +Y  G+W++  G  +  TRE
Sbjct  174  NMRSRVLSLRKGEQNCLPTRTIQKKCEKGC----------RYEKGEWSQCVGGQI--TRE  221

Query  133  ARI  135
             ++
Sbjct  222  DKL  224



Lambda      K        H
   0.318    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5035546020


Query= XP_003392881.1 uncharacterized protein LOC100644871 [Bombus
terrestris]

Length=93
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9TZN2_CAEEL  unnamed protein product                                 28.9    0.43 
Q9Y1A7_DROME  unnamed protein product                                 27.3    2.2  
Q38BP4_TRYB2  unnamed protein product                                 25.4    9.5  


>Q9TZN2_CAEEL unnamed protein product
Length=245

 Score = 28.9 bits (63),  Expect = 0.43, Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 26/55 (47%), Gaps = 1/55 (2%)

Query  17   VRSYHVPNEVRPPSMDEVIVPQGSWQQSYFKAQQKHNLQLAAGIIILGATIAYGR  71
            VR YHV  E     +DE IVP G  Q   FK+Q + +     G I   A I Y +
Sbjct  155  VRDYHVRREELWGIIDEAIVP-GDCQIYSFKSQFEDDPFTEDGCIWALAFIFYNK  208


>Q9Y1A7_DROME unnamed protein product
Length=499

 Score = 27.3 bits (59),  Expect = 2.2, Method: Composition-based stats.
 Identities = 11/18 (61%), Positives = 14/18 (78%), Gaps = 1/18 (6%)

Query  72   VSGLLWLNFRPPKPEDRP  89
            VSGLLW+ ++ PK E RP
Sbjct  403  VSGLLWMRYKQPKTE-RP  419


>Q38BP4_TRYB2 unnamed protein product
Length=1056

 Score = 25.4 bits (54),  Expect = 9.5, Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 27/53 (51%), Gaps = 4/53 (8%)

Query  1    MLRHILQPIVRNTRNGV-RSYHVPNEVRPPSMDEVIVPQGSWQQSYFKAQQKH  52
            +L H+ +P+V +  +G+  S+ V  E RP    EV    G    S F+  +KH
Sbjct  54   VLSHMFEPVVTSVEHGIAESHEVTGESRPTG--EVCADSGDGCPS-FEEHRKH  103



Lambda      K        H
   0.318    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5035546020


Query= XP_003392882.1 exocyst complex component 1 [Bombus terrestris]

Length=859
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

EXOC1_DROME  unnamed protein product                                  798     0.0   
EXOC1_CAEEL  unnamed protein product                                  415     9e-132
Q9VXU2_DROME  unnamed protein product                                 33.1    1.2   
Q57Y34_TRYB2  unnamed protein product                                 30.8    5.2   
Q38C47_TRYB2  unnamed protein product                                 30.8    6.3   


>EXOC1_DROME unnamed protein product
Length=889

 Score = 798 bits (2060),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/890 (48%), Positives = 598/890 (67%), Gaps = 38/890 (4%)

Query  1    MAAIRHTLQREVFTPSDEKLLSVCYVSKAYRKKKMSFLCLTTTTDSPSSLLLYQVKKNDK  60
            MA I+HTLQ+E+F  S E+LLSV  V K   KK   +LC+ TT      + L  +K++++
Sbjct  7    MANIKHTLQKELFLASGERLLSVVTVVKKKDKKP-CYLCVVTTAPPVPVVTLCLIKQSEQ  65

Query  61   --NVFKKKQSWPLSDIQIVDGVKN--DSMDIELHIDKVYKWSVTTAQERRTFIS--NLYT  114
                +K+K+SW L +I+ VDG     ++ + +L ++K+YKW      ER+ F++  N   
Sbjct  66   REGEYKRKRSWQLDEIKWVDGRNEQFETHEFDLQLEKLYKWYALNPHERQNFLAVLNRQI  125

Query  115  YSCNLAQRPQFKNIPKELLID--PSSLKESDSITFTPELLTSPI----SSDYQPITEKEA  168
                  QR +F+N+P   L +  P  +    ++  T  +         + ++  +T+KEA
Sbjct  126  QKSVRGQRAEFRNVPAAWLSEKSPEKVALGRAVQKTQHMDDEEDEEEEAQEFTALTDKEA  185

Query  169  ADLKQLMEDCEYAVSNAELFMETLSKDLSILDGENVQSVLASEACVTQLMNSIEAAITEA  228
             +L +L  +C++A+ +AE F+E LS++L  LDG N+QSVLASE  V ++M  I+ AI+EA
Sbjct  186  NELGKLFSECDFAIKDAEQFIEQLSRELHDLDGANMQSVLASEQKVLKMMEHIDNAISEA  245

Query  229  SIVESRLAAYDEALGRIREVMARVGQKNQAIHTANNNARLLLDQLNTVISQLDISPTHQR  288
               E+RL +Y++ LG ++E M ++G KN  I  ANNN   L+ +LN VISQLD+  + Q+
Sbjct  246  DKFENRLDSYEDILGHVKETMEKIGGKNAMIEIANNNNIKLMKELNKVISQLDLPHSQQQ  305

Query  289  VLSEAELP---GEKEELSQAGAALLKATTAPLPPGLDKLSAVTEQKRRLDKLRVKFSVIV  345
             L E +L    G K  ++ A   L +A  + + P L +L AV +Q++R +K + KFS  V
Sbjct  306  ALDEPDLKTANGRKAAIA-AAQCLQQAMNSDIDPALLRLEAVQDQRKRFEKWKQKFSATV  364

Query  346  ARHLNNLFIHLGNDVGDMSTSMTDLILPTHQAVHHELEPYTELMQLLRALDNKAFVQLTK  405
            +R +NNLFIHLGN++GDM  + T+L LP H  VH EL PYTELM   +A+D K +  L +
Sbjct  365  SRFMNNLFIHLGNEIGDMQVTSTELTLPNHSNVHRELTPYTELMHWTKAMDRKTYDGLMR  424

Query  406  VYTDTMSKLYKRDLKRFFEEAK----NKLICKRLQANTSKSSGQKVEDLLNPAPICLLSG  461
            VYT ++SK+Y RD++ FF  AK     KL   R   + S SS +     + P     ++ 
Sbjct  425  VYTASLSKIYDRDVRNFFNLAKIQVTEKLRNSREDLDMSTSSRKSAVSTI-PYGTLGINR  483

Query  462  ETWAP---VGEGNLLDSVLDCLLSQMQPVCLAEQAFCISFLQLDSVLSPSKSS-----EM  513
            + W P     +    D++L+ +L++++P+ L EQ FCI+F Q+D V+SP+  +     EM
Sbjct  484  DQWGPGVETADRMRFDALLEKVLAELEPIALQEQLFCINFFQMD-VISPTTKNTQTTLEM  542

Query  514  EE----TDNVSNGAASPGSVTSTASKKLERQVNEEVRATMAAIFPSLETELNNFIAFLDK  569
            E+    T ++ +GA SP S      K+++RQ+NE+VR  M  +F  LE EL +FI   ++
Sbjct  543  EKAVDMTQSIISGAVSP-SGDGVPQKRIDRQINEDVRKLMMGLFGCLEPELVSFIQSFER  601

Query  570  IDSFWCMYVLVRLSQHVMSAQDTGSFLSMTFASALIQVKRAFDKFMQTQLQSILCDTKVN  629
            +DSF+ +YV VRL+QHVMSAQDT SFLSMTFASAL+QVKR+FD+FMQ QL SI  + K++
Sbjct  602  VDSFYSLYVFVRLTQHVMSAQDTHSFLSMTFASALVQVKRSFDRFMQNQLLSIR-EAKLH  660

Query  630  RRNKCGILPYVENFGPFARTAEKIFKNSDRKVDLEKWYTKLVSTMFEAIVIHSREHHKTP  689
            +R+K  ILPYVENF  FA+TAE IF+ SDR+ D+EKWY +LV+ +FE I +HS+EH KTP
Sbjct  661  KRSK-AILPYVENFENFAQTAEGIFRKSDRRTDMEKWYLQLVNAIFEGIQLHSQEHPKTP  719

Query  690  QEVIKMENFHHLYDLLSQLKIPIFDHERKEAKQKYQDALRAYVTQYFGRPLEKLNLFFEG  749
             +V++MEN+HH+Y LL+QLK+P  D  +KEAK+ Y DAL+AYVTQYFGRPLEKLN FFEG
Sbjct  720  VQVVRMENYHHMYALLAQLKVPGLDALKKEAKKCYNDALKAYVTQYFGRPLEKLNQFFEG  779

Query  750  VQAKVGAGVKESEVSYQMAFSKQELRRVVKEYPAREVKKGLENLYRKVEKHLCEEENLLQ  809
            VQ KV  GVKE+E+SYQMAFSKQELR+V+ +YPAREVKKGLENLY+KVEKHL EEENLLQ
Sbjct  780  VQLKVAQGVKETEISYQMAFSKQELRKVIAQYPAREVKKGLENLYKKVEKHLSEEENLLQ  839

Query  810  VVWREMQGEFIAQYIYIEELIQRCYPDSMVTLEFTIQDILEFFSEIARSH  859
            VVW  MQ EFIAQY Y+EE IQ+CY  +M+ LEF IQDIL FFS+IARSH
Sbjct  840  VVWHAMQEEFIAQYNYLEERIQKCYAGAMINLEFNIQDILAFFSDIARSH  889


>EXOC1_CAEEL unnamed protein product
Length=848

 Score = 415 bits (1066),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 282/880 (32%), Positives = 466/880 (53%), Gaps = 53/880 (6%)

Query  1    MAAIRHTLQREVFTPSDEKLLSVCYVSK--AYRKKKMSFLCLTTTTDSPSSLLLYQVKKN  58
            M+AIR  +QR++F   DE++ ++  VSK    +KK  + LCL  T + P ++ LY VK  
Sbjct  1    MSAIRKIIQRQLFQKDDERIQAIVNVSKLDGKKKKNQTLLCLAVTIEHPIAVRLYFVKGE  60

Query  59   DKNVFKKKQSWPLSDIQIVDGVKNDSMDIELHI---DKVYKWSVTTAQERRTFISNLYTY  115
              + FKKK  + L +++ +DG+       E HI   D  Y     +A+E+  FI  LY  
Sbjct  61   KDDTFKKKDRFNLREVREIDGINPKKASPEFHITIGDHQYVILAGSAEEKDEFIRELYKL  120

Query  116  SCNL--AQRPQFKN--IPK---ELLIDPSSLKESDSITFTPELLTSPISSDYQPITEKEA  168
            SC     Q P F N  +P+   E  I P  L E D            + SDYQPI+ KE 
Sbjct  121  SCQYLPVQMPDFCNFSLPQLESETSIIPIELPEHDM----------AMQSDYQPISNKED  170

Query  169  ADLKQLMEDCEYAVSNAELFMETLSKDLSILDGENVQSVLASEACVTQLMNSIEAAITEA  228
            AD ++L+      +  A +F E L++ L  LDG N+ S++ SE  V QL++SI+AA+T  
Sbjct  171  ADFRKLIARANLTIGEAHIFAEMLTEQLQSLDGANINSMMDSENSVNQLLSSIDAALTGV  230

Query  229  SIVESRLAAYDEALGRIREVMARVGQKNQAIHTANNNARLLLDQLNTVISQLD-ISPTHQ  287
              VE  L   D+ L  +R  +  + +K+        N + L +++ + ++ L  ++ +H 
Sbjct  231  ESVEKELDRCDDILAFVRNSIELIEEKDSLSVVERKNKQRLNEEIVSFVNSLQAVTDSHI  290

Query  288  RVLSEAEL--PGEKEELSQAGAALLKATTAPLPPGLDKLSAVTEQKRRLDKLRVKFSVIV  345
              L +A    P   +  + A  A+ +     +   + ++ A  ++   L  + V F   +
Sbjct  291  ETLKQANFSNPESVQRCTDAARAVAQFWHGRISKPMLQMKAYQDRNDELTAVDV-FVDRL  349

Query  346  ARHLNNLFIHLGNDVGDMSTSMTDLILPTHQAVHHELEPYTELMQLLRALDNKAFVQLTK  405
              HL+ LF +L ND+  +     +L +P        L P ++L+  L+    KA   + +
Sbjct  350  MSHLSALFSNL-NDLS-LDHEWHELCIPKQSQRFRALSPLSDLINWLKTNRPKACNLVLQ  407

Query  406  VYTDTMSKLYKRDLKRFFEEAKNKLICKRLQANTSKSSGQKVEDLLNPAPICLLSGE---  462
             Y D+ + LYKR    FFE     LI K  +AN+S+   +  E     A I L S     
Sbjct  408  KYIDSTNLLYKRLFDNFFE----TLINKVPKANSSEKKSKANE----SANISLRSDNQSF  459

Query  463  -TWAPVGEGNLLDSVLDCLLSQMQPVCLAEQAFCISFLQLDSVLSPSKSSEMEETDNVSN  521
             + +   +  +L  +++ +L+++  V  AEQ F + F  ++S L       + + D  S 
Sbjct  460  LSTSSEIDTEVLPQLIETVLAELSAVIDAEQKFVVRFFHINSEL-------LAQFDTTST  512

Query  522  GAASPGSVTSTASKKLERQVNEEVRATMAAIFPSLETELNNFIAFLDKIDSFWCMYVLVR  581
            G+      +S   + +E+ +NE+VR  M  +F SL   L++F   + + +    + + V 
Sbjct  513  GSGD---SSSLGGRSMEKHMNEQVRHVMGNLFDSLNIHLDSFCRAVCRHNPSNVLLLFVI  569

Query  582  LSQHVMSAQDTGSFLSMTFASALIQVKRAFDKFMQTQLQSILCDTKVNRRNKCGILPYVE  641
            +S+ V+  QD  S+ S+TF S ++ +KR FD F+Q +  S   + ++ ++ + GILP + 
Sbjct  570  MSKKVLLPQDPSSYFSITFGSLVVLIKRQFDAFIQMEC-SQYSEVRIAKKTRIGILPSIF  628

Query  642  NFGPFARTAEKIFKNSDRKVDLEKWYTKLVSTMFEAI-VIHSREHHKTPQEVIKMENFHH  700
             F  F R AE IF+N++R+ DLEK Y  L   + + I    + ++ K+P  V+K EN+H 
Sbjct  629  RFANFVRRAEIIFENAERRTDLEKAYFNLCRAVCDGIQKAAANQYSKSPSSVVKFENYHE  688

Query  701  LYDLLSQLKIPIFDHERKEAKQKYQDALRAYVTQYFGRPLEKLNLFFEGVQAKVGA-GVK  759
            LY  LS+LKI   D +RK+AK   ++ + AYV ++ GRPL+++  FF+ V   +   G++
Sbjct  689  LYLTLSELKISCLDQQRKDAKALKEEHIDAYVKEFMGRPLKEIQTFFDNVNNFIETRGIR  748

Query  760  ESEVSYQMAFSKQELRRVVKEYPAREVKKGLENLYRKVEKHLCEEENLLQVVWREMQGEF  819
              E+SYQ  FS+ EL++V+ ++P +EVKKGLE LY+K+EK+L    +LLQVVWR+MQ +F
Sbjct  749  PDEISYQQQFSRIELKKVISQHPGKEVKKGLEQLYKKIEKNLVANSSLLQVVWRDMQEQF  808

Query  820  IAQYIYIEELIQRCYPDSMVTLEFTIQDILEFFSEIARSH  859
            + Q     +LI  CYP S + LE +   +L+FFSEIA+ H
Sbjct  809  VKQIAEYNKLILTCYPGSKIELEVSTDTVLQFFSEIAQQH  848


>Q9VXU2_DROME unnamed protein product
Length=1398

 Score = 33.1 bits (74),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 36/67 (54%), Gaps = 3/67 (4%)

Query  273  LNTVISQLDISPTH--QRVLSEAELPGEKE-ELSQAGAALLKATTAPLPPGLDKLSAVTE  329
            LN+ +SQL    T+  Q VL+E   PG+ E E  QAG A ++         L+ L+   E
Sbjct  4    LNSSLSQLKGQLTNLAQEVLAETAGPGDLEYEGHQAGGASVQDAEQQAKTALELLAETQE  63

Query  330  QKRRLDK  336
            QK +LDK
Sbjct  64   QKEQLDK  70


>Q57Y34_TRYB2 unnamed protein product
Length=563

 Score = 30.8 bits (68),  Expect = 5.2, Method: Compositional matrix adjust.
 Identities = 30/133 (23%), Positives = 55/133 (41%), Gaps = 16/133 (12%)

Query  9    QREVFTPSDEKLLSVCYVSK------AYRKKKMSFLCLTTTTDSPSSLLLYQVKKNDKNV  62
            ++E+F P    L +V  +++       YRK K SFL   +    P +L +Y+V  N    
Sbjct  31   KKEMFAPRIATLAAVAPLAEEELPPAVYRKPKFSFLSDPSERHPPDALSVYEVPNNSPKA  90

Query  63   FKKKQSWPLSD-------IQIVDGVKNDSMDI--ELHIDKVYKW-SVTTAQERRTFISNL  112
                 +  L+        I++ + +  DSM    E H+     W      +  +T + N+
Sbjct  91   PLPMWASSLTSPQLGRQRIRVENWISTDSMGTVPEDHVQDFLAWFREELIKSSQTVLWNM  150

Query  113  YTYSCNLAQRPQF  125
             T + +   R Q+
Sbjct  151  LTDNVDFHLRSQY  163


>Q38C47_TRYB2 unnamed protein product
Length=748

 Score = 30.8 bits (68),  Expect = 6.3, Method: Compositional matrix adjust.
 Identities = 48/173 (28%), Positives = 72/173 (42%), Gaps = 21/173 (12%)

Query  250  ARVGQKNQAIHTANNN--ARLLLDQLNTVISQLDIS-PTHQRVL------SEAELPGEKE  300
            A V Q+ + IH   +    +LL+D L   + Q  +  P    VL      S  +  G   
Sbjct  290  ASVRQRLEVIHNDGSQLLRQLLMDPLGCHLFQAYLRVPVPASVLKDYDSFSSYQCSGTAP  349

Query  301  ELSQAGA---ALLKATTAPLPPGLDKLSAVTEQKRRLDKLRVKFSVIVARHLNNLFIHLG  357
              S +G     +L+   A  PP  D+L+    +K   DK       IV   L++L    G
Sbjct  350  TSSGSGKRFIKMLRDVAAEEPPNPDELA---HEKTCWDKALA----IVVEALDDLLDPAG  402

Query  358  NDVGDMSTSMTDLILPTHQAVHHE--LEPYTELMQLLRALDNKAFVQLTKVYT  408
            + VG    ++ DL+L    AVH E   E   E + L   L +   VQ+  V+T
Sbjct  403  SSVGHAVFALQDLVLFAPTAVHLERVWEQLLERIGLRTLLASPKLVQVLIVFT  455



Lambda      K        H
   0.318    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5035546020


Query= XP_003392883.1 microfibrillar-associated protein 1 [Bombus
terrestris]

Length=459
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MFAP1_DROME  unnamed protein product                                  395     5e-134
MFAP1_CAEEL  unnamed protein product                                  270     9e-86 


>MFAP1_DROME unnamed protein product
Length=478

 Score = 395 bits (1014),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 208/320 (65%), Positives = 268/320 (84%), Gaps = 3/320 (1%)

Query  137  ERTRERIKLESSDSSEDEELSDSEIERRREALKQRVLSKKENEEELIHGEEDERSGDTSE  196
            +R   +I L +S+S  D ELSD+E+E RR  L+ R+L +++ EEE++  E++++S  +  
Sbjct  159  QRGTNKITL-ASESDTDAELSDTELENRRTKLRSRML-QQQREEEVLQKEDEKQSESSES  216

Query  197  ESSEYEEYTDSEEETGPRLKPVFVRKKDRITVMEKEKEAMKQKQAEIEAKKLAEERKRQT  256
            ESSEYEE T+SEE+  PRLKP+FVRK+DR T+ EKE+EA KQKQ E EAK+ A+ER+R T
Sbjct  217  ESSEYEEETESEEDNEPRLKPLFVRKRDRATIQEKEREAQKQKQLEAEAKRAAKERRRAT  276

Query  257  LRMVEEAIRKEAQVGKTTSEHEGKLEDVCTDDENDEVEYEAWKLRELKRIKRDREEREQL  316
            LRMVEE+++K+ +  K  + +E  +EDVCTDDENDEVEYEAWKLRELKR+KRDREER+ +
Sbjct  277  LRMVEESVKKDLEKTKPET-NEACIEDVCTDDENDEVEYEAWKLRELKRMKRDREERDNV  335

Query  317  EKERLEVERIRNMTEEERRQEVRLNPKVITNKAAKGKYKFLQKYYHRGAFYLDKEDNIFK  376
            E+E+L+++R+RNMTEEERRQE+R NPKV+TNKA KGKYKFLQKYYHRGAFYLD+E+++ K
Sbjct  336  EREKLDIDRMRNMTEEERRQELRQNPKVVTNKATKGKYKFLQKYYHRGAFYLDEENDVLK  395

Query  377  RDFSGATLEDHFDKTILPKVMQVKNFGRSGRTKYTHLVDQDTTQFDSPWISETAQNLKFH  436
            RDF+ ATLEDHFDKTILPKVMQVKNFGR GRTKYTHLVDQDTT+FDSPW +E++ N+KFH
Sbjct  396  RDFAQATLEDHFDKTILPKVMQVKNFGRCGRTKYTHLVDQDTTKFDSPWYAESSSNIKFH  455

Query  437  NNQAAGMKQVFERPSLKKRK  456
            N  A GM+Q F++P+  KRK
Sbjct  456  NEHAGGMRQQFDKPTGSKRK  475


>MFAP1_CAEEL unnamed protein product
Length=466

 Score = 270 bits (691),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 139/245 (57%), Positives = 183/245 (75%), Gaps = 0/245 (0%)

Query  213  PRLKPVFVRKKDRITVMEKEKEAMKQKQAEIEAKKLAEERKRQTLRMVEEAIRKEAQVGK  272
            PRLKP+F RKKDRIT+ E EKE  K+   +IE +K AEERKR++ ++VE+ +++E    K
Sbjct  222  PRLKPIFTRKKDRITLQEAEKEKEKEILKKIEDEKRAEERKRESAKLVEKVLQEEEAAEK  281

Query  273  TTSEHEGKLEDVCTDDENDEVEYEAWKLRELKRIKRDREEREQLEKERLEVERIRNMTEE  332
              +E    L  V TDDE + + YEAWKLRE+KR+KR+R+ERE+  +E+ E+++I  M+EE
Sbjct  282  RKTEDRVDLSSVLTDDETENMAYEAWKLREMKRLKRNRDEREEAAREKAELDKIHAMSEE  341

Query  333  ERRQEVRLNPKVITNKAAKGKYKFLQKYYHRGAFYLDKEDNIFKRDFSGATLEDHFDKTI  392
            ER + +RLNPKVITNK  KGKYKFLQKY+HRGAF+LD+ED + KR+F+ AT +D FDKTI
Sbjct  342  ERLKYLRLNPKVITNKQDKGKYKFLQKYFHRGAFFLDEEDEVLKRNFAEATNDDQFDKTI  401

Query  393  LPKVMQVKNFGRSGRTKYTHLVDQDTTQFDSPWISETAQNLKFHNNQAAGMKQVFERPSL  452
            LPKVMQVKNFG++ RTKYTHL ++DTT     W S    N +F   +A G + VFERP+ 
Sbjct  402  LPKVMQVKNFGKASRTKYTHLTEEDTTDHQGVWASTNQLNSQFSTKRAGGSRPVFERPAT  461

Query  453  KKRKN  457
            KKRKN
Sbjct  462  KKRKN  466



Lambda      K        H
   0.318    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5035546020


Query= XP_003392884.1 FAS-associated factor 1 isoform X1 [Bombus
terrestris]

Length=647
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A0A0B4LFH2_DROME  unnamed protein product                             447     6e-149
Q7JUP3_DROME  unnamed protein product                                 447     6e-149
UBXN3_CAEEL  unnamed protein product                                  125     7e-30 
UBXN5_CAEEL  unnamed protein product                                  38.9    0.004 
Q9Y114_DROME  unnamed protein product                                 39.3    0.010 


>A0A0B4LFH2_DROME unnamed protein product
Length=690

 Score = 447 bits (1150),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 264/702 (38%), Positives = 404/702 (58%), Gaps = 67/702 (10%)

Query  1    MAGIRDEILANFQACTGIDDVGDAIKYLEESNWDLLAAVNQAMLHGTQQLPSEVSPDIEM  60
            M+  +DE L +FQ+ TGIDDVG+A  +LE ++W+L+ A+++ + H    L    SP   +
Sbjct  1    MSENKDEALTSFQSITGIDDVGEAFSHLEAADWNLVEALSRVIPHEDAPL---TSPHPIL  57

Query  61   IEEIERMPQAHSLSSQTNCDPKSNSKVEVTENSK------------------PGTSK---  99
            + E    P  +++ S     P    ++  T N+                   P   +   
Sbjct  58   VPE---PPARNAVESTNGFRPPGFDEMPGTSNASGFFAAALQNQNQNLNLNQPHIQQRFP  114

Query  100  ----------PKSCEK--ERTLTFHINHLNNE-YKINLSEFSSLKDLKQLIWVQTNVPPC  146
                      P S +   +  +TF+I H N + Y++ L   ++++ LK+ I+ +T+VP C
Sbjct  115  TQLTSSINLDPASSQNNNQNVITFNI-HFNQQLYQLRLPSEATVEQLKRKIFAETSVPVC  173

Query  147  QQRLYGWKKEPKSDYRSLQS----LDLPKENTLYMSPATEDVDLTTDIVSLSNRMTQTYT  202
            +Q + GW     SD + L +    LDL  EN L +   TED  + T+   ++ R+ + +T
Sbjct  174  RQAIRGWPPSKASDAQQLGTRLCNLDLSPENELILVDLTEDGFMDTEQDEVTQRVDKDFT  233

Query  203  LNIKNEINKETYNLKFPGTNTILDVKSGIYSLTAVPVRNQQWKGWPSLVKNDNVMLAQSG  262
            + I+ E +     L  PG  T+ +VK  ++ + ++PVR+Q+W GWP+   ND   LAQSG
Sbjct  234  IFIQFE-SDPPLTLSLPGRMTVQEVKMNVFDIKSIPVRHQEWTGWPNGCDNDTT-LAQSG  291

Query  263  ISYPEHDLSVNEI----PIKKERKEVIDLVESDSSIDEDDIEDD--------VFVDNVRS  310
            I    H  +V       P    +    D+V  DS    D+ ED         +F D+  +
Sbjct  292  IGL-SHRFAVRSTERSAPTNSNQHNAFDVVTVDSESSTDEFEDATDFNNAEYIFTDSPPA  350

Query  311  TKTQR-LMPENVTDETIGTMHFAEEFEKRYGPAHPEFFTGTFKDAVKESCLKPAKERKLL  369
                R L+P +  DE  G+  F E ++ RYG   PEFF G+ ++A + +CL+ AKERKLL
Sbjct  351  QPPNRHLIPNDTDDEISGSTQFVENYKARYGEPCPEFFVGSLENAKQLACLRSAKERKLL  410

Query  370  AVYLHHDNSVLANVFCTQLLSCEAVLQVLSANFIVWGWDITFESNKQKFLSSVKQTLGSF  429
            A+YLHH  S+L+NVFC QL+  E+++Q     F+++GWD+T+ESNK  FLSS+   + S 
Sbjct  411  AIYLHHGKSILSNVFCDQLMKHESIIQTFKEKFVLYGWDMTYESNKDMFLSSLTACISSN  470

Query  430  ATLAMENIDVDTLPALVIIMRARSI---TEMFTVIHANVGVNELLTNLIHVVEVFQEQRR  486
            A+L   NI +D LPA++++ ++R +    E+ +VIH N+G+++LLT LI   E+F+EQ +
Sbjct  471  ASLTARNIKLDKLPAIMLVGKSRQLGSNCEVLSVIHGNIGLDDLLTRLIETCEMFEEQLQ  530

Query  487  TDIGVEEERQARERVKQEQDRAYQESLAADRAKEEAKQMQEELEKQRKEQAENERLAEEA  546
             +I  E+ER AR++VK EQD AYQE+L AD AK+ AK+ +E  +   +++ E+ER  E+A
Sbjct  531  VEIRQEDERAARDQVKAEQDMAYQETLQADMAKDAAKRQKEAAQLAERKRMESERAEEDA  590

Query  547  RKEAHRQAVESSLPPEP-QQSTGDGVLKVRVRLPAGKFLERRFQSDTPLQTLLNFLIVEG  605
            R+E+ R   + SLP EP +Q TG    K+RVR P G FLERRF  +  LQ LLNF+   G
Sbjct  591  RRESIRLVAQQSLPQEPSEQETGTS--KIRVRKPTGDFLERRFFINNNLQDLLNFVTANG  648

Query  606  YPTEEYKVLCSWPRRDLTSMDSKLTLMDLKFCPQETVILEER  647
            +  EEYK++ SWPRRDLT+++S  TL  LK  PQETVILEER
Sbjct  649  FLIEEYKLISSWPRRDLTAIESSQTLESLKLYPQETVILEER  690


>Q7JUP3_DROME unnamed protein product
Length=695

 Score = 447 bits (1151),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 265/704 (38%), Positives = 405/704 (58%), Gaps = 66/704 (9%)

Query  1    MAGIRDEILANFQACTGIDDVGDAIKYLEESNWDLLAAVNQAMLHGTQQLPSE---VSPD  57
            M+  +DE L +FQ+ TGIDDVG+A  +LE ++W+L+ A+++ + H    L S    + P+
Sbjct  1    MSENKDEALTSFQSITGIDDVGEAFSHLEAADWNLVEALSRVIPHEDAPLTSPHPILVPE  60

Query  58   IEMIEEIE-----RMPQAHSLSSQTNCD-------------------------PKSNSKV  87
                  +E     R P    +   +N                           P S    
Sbjct  61   PPARNAVESTNGFRPPGFDEMPGTSNASGFFAAALQNQNQNLNLNQPHIQQRFPTSQLLA  120

Query  88   EVTE--NSKPGTSKPKSCEKERTLTFHINHLNNE-YKINLSEFSSLKDLKQLIWVQTNVP  144
            ++T   N  P +S+  +   +  +TF+I H N + Y++ L   ++++ LK+ I+ +T+VP
Sbjct  121  QLTSSINLDPASSQNNN---QNVITFNI-HFNQQLYQLRLPSEATVEQLKRKIFAETSVP  176

Query  145  PCQQRLYGWKKEPKSDYRSLQS----LDLPKENTLYMSPATEDVDLTTDIVSLSNRMTQT  200
             C+Q + GW     SD + L +    LDL  EN L +   TED  + T+   ++ R+ + 
Sbjct  177  VCRQAIRGWPPSKASDAQQLGTRLCNLDLSPENELILVDLTEDGFMDTEQDEVTQRVDKD  236

Query  201  YTLNIKNEINKETYNLKFPGTNTILDVKSGIYSLTAVPVRNQQWKGWPSLVKNDNVMLAQ  260
            +T+ I+ E +     L  PG  T+ +VK  ++ + ++PVR+Q+W GWP+   ND   LAQ
Sbjct  237  FTIFIQFE-SDPPLTLSLPGRMTVQEVKMNVFDIKSIPVRHQEWTGWPNGCDNDTT-LAQ  294

Query  261  SGISYPEHDLSVNEI----PIKKERKEVIDLVESDSSIDEDDIEDD--------VFVDNV  308
            SGI    H  +V       P    +    D+V  DS    D+ ED         +F D+ 
Sbjct  295  SGIGL-SHRFAVRSTERSAPTNSNQHNAFDVVTVDSESSTDEFEDATDFNNAEYIFTDSP  353

Query  309  RSTKTQR-LMPENVTDETIGTMHFAEEFEKRYGPAHPEFFTGTFKDAVKESCLKPAKERK  367
             +    R L+P +  DE  G+  F E ++ RYG   PEFF G+ ++A + +CL+ AKERK
Sbjct  354  PAQPPNRHLIPNDTDDEISGSTQFVENYKARYGEPCPEFFVGSLENAKQLACLRSAKERK  413

Query  368  LLAVYLHHDNSVLANVFCTQLLSCEAVLQVLSANFIVWGWDITFESNKQKFLSSVKQTLG  427
            LLA+YLHH  S+L+NVFC QL+  E+++Q     F+++GWD+T+ESNK  FLSS+   + 
Sbjct  414  LLAIYLHHGKSILSNVFCDQLMKHESIIQTFKEKFVLYGWDMTYESNKDMFLSSLTACIS  473

Query  428  SFATLAMENIDVDTLPALVIIMRARSI---TEMFTVIHANVGVNELLTNLIHVVEVFQEQ  484
            S A+L   NI +D LPA++++ ++R +    E+ +VIH N+G+++LLT LI   E+F+EQ
Sbjct  474  SNASLTARNIKLDKLPAIMLVGKSRQLGSNCEVLSVIHGNIGLDDLLTRLIETCEMFEEQ  533

Query  485  RRTDIGVEEERQARERVKQEQDRAYQESLAADRAKEEAKQMQEELEKQRKEQAENERLAE  544
             + +I  E+ER AR++VK EQD AYQE+L AD AK+ AK+ +E  +   +++ E+ER  E
Sbjct  534  LQVEIRQEDERAARDQVKAEQDMAYQETLQADMAKDAAKRQKEAAQLAERKRMESERAEE  593

Query  545  EARKEAHRQAVESSLPPEP-QQSTGDGVLKVRVRLPAGKFLERRFQSDTPLQTLLNFLIV  603
            +AR+E+ R   + SLP EP +Q TG    K+RVR P G FLERRF  +  LQ LLNF+  
Sbjct  594  DARRESIRLVAQQSLPQEPSEQETGTS--KIRVRKPTGDFLERRFFINNNLQDLLNFVTA  651

Query  604  EGYPTEEYKVLCSWPRRDLTSMDSKLTLMDLKFCPQETVILEER  647
             G+  EEYK++ SWPRRDLT+++S  TL  LK  PQETVILEER
Sbjct  652  NGFLIEEYKLISSWPRRDLTAIESSQTLESLKLYPQETVILEER  695


>UBXN3_CAEEL unnamed protein product
Length=613

 Score = 125 bits (313),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 114/400 (29%), Positives = 198/400 (50%), Gaps = 34/400 (9%)

Query  275  IPIKKERKEV--IDLVESDSSI-----DEDDIEDDVFVDNVRSTKTQR------LMPENV  321
            IPI   R +V  +D  E D S+     D+DD   +V    V +  +        ++P+  
Sbjct  219  IPINPRRVDVFNVDSDEDDDSMAIAYEDDDDGVHEVHHSEVVARGSGPPNGRIPMIPDGF  278

Query  322  TDETIGTMHFAEEFEKRYGPA------HPEFFTGTFKDAVKESCLKPAKE-RKLLAVYLH  374
            +  +    +F   F  R+          P F+T     AVKE+   P  E R+ L  Y++
Sbjct  279  SSVSDALRNFVAIFSDRFCSTPQTQAFMPPFYTEPLPAAVKEAFDHPNSEHRRPLLFYIN  338

Query  375  HDNSVLANVFCTQLLSCEAVLQVLSANFIVWGWDITFESNKQKFLSSVKQT-LGSFAT--  431
            HD S+ AN+F +Q+L  E V  ++   ++++ WDIT +SN   FL  ++   +G   T  
Sbjct  339  HDRSIAANIFASQVLCSETVSTLIRHQYVLFPWDITSDSNLMLFLEYLQAANMGDVRTII  398

Query  432  --LAMENIDVDTLPALVIIMRARSITEMFTVIHANVGVNELLTNLIHVVEVFQEQRRTDI  489
              LAM  I+  + P + I+++ R+   +          ++++  L+  V  + + R  + 
Sbjct  399  QRLAMSKIE--SFPLMAIVVKERNSYRLVDYCRGTDTSDQVMEKLLSGVSEYSDIRMNEQ  456

Query  490  GVEEERQARERVKQEQDRAYQESLAADRAKEEAKQMQEELEKQRKEQAENERLAEEARKE  549
                ER+ RE ++ +Q+  Y+ SLAAD+A+ EAKQ + E ++  +E+   E   E  R  
Sbjct  457  SERREREEREAIRNQQEAEYKASLAADKARMEAKQQEIEEQRLEEERKLREEEEECVR--  514

Query  550  AHRQAVESSLPPEPQQSTGDG-VLKVRVRLPAGKFLERRFQSDTPLQTLLNFLIVEGYPT  608
              RQ V S++P EP  S     ++ V+ RLP G    RRF+    +QTL+N+L  +GY  
Sbjct  515  --RQTVASTVPEEPPASAPLAEIINVKFRLPEGGQDMRRFRRLESIQTLINYLSSKGYSP  572

Query  609  EEYKVLCS-WPRRDLT-SMDSKLTLMDLKFCPQETVILEE  646
            +++K   S +P++++T   D      D K+  +E + +EE
Sbjct  573  DKFKYFNSDFPKKEITRHFDLSHNFADTKWPAREQIFVEE  612


>UBXN5_CAEEL unnamed protein product
Length=174

 Score = 38.9 bits (89),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 64/137 (47%), Gaps = 17/137 (12%)

Query  487  TDIGVEEERQARER-VKQEQDRAYQESLAADRAKEEAKQMQEELEKQRKEQAENERLAEE  545
            T+  V++E+ A +R +  +Q++ Y ESLA D AK+E                E +++  E
Sbjct  3    TNNHVQKEKFAEDRALLSQQNKEYAESLAKDIAKKE----------------EKDKIRFE  46

Query  546  ARKEAHRQAVESSLPPEPQQSTGDGVLKVRVRLPAGKFLERRFQSDTPLQTLLNFLIVEG  605
            A ++  R+        + + +   G L++ VR P G  L   F    P+ +L + +I+  
Sbjct  47   AEQKELRKKTIQDYREKLKGTVSQGPLRLLVRYPNGSRLILSFSPSQPMTSLFDAIILNP  106

Query  606  YPTEEYKVLCSWPRRDL  622
               + + V   +PR ++
Sbjct  107  ACPDYFSVRSVYPRAEI  123


>Q9Y114_DROME unnamed protein product
Length=656

 Score = 39.3 bits (90),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 43/187 (23%), Positives = 86/187 (46%), Gaps = 27/187 (14%)

Query  483  EQRRTDIGVEEERQARER-VKQEQDRAYQESLAADRAKEEAKQMQEELEKQRKEQ-AENE  540
            EQ+R +   EE+R  +E  +++ +D    +S  A   ++E K MQE+++++R+E+ A  E
Sbjct  292  EQKRKERVEEEKRMEKENELRRRRDGREAQSQQARAKEQELKNMQEQIKRERQEELAARE  351

Query  541  RLAEEARKEAHRQAVESSLPPEPQQSTGDGVL--------------------KVRVRLPA  580
            R+  +   +   QA   + P     ST + V                     ++++RLP 
Sbjct  352  RIRAQIAADRAEQAQRFNTP--DISSTTNSVAATAASNVITTDASVSSVDETRLQIRLPG  409

Query  581  GKFLERRFQSDTPLQTLLNFL---IVEGYPTEEYKVLCSWPRRDLTSMDSKLTLMDLKFC  637
            G    + F +   L T+  ++   ++      ++ +  S+PRR+  + D   TL +L   
Sbjct  410  GIQRTKSFPAGEVLATVRVYVRNEMLAASDVRDFTLATSYPRREFQTEDEVKTLNELNLV  469

Query  638  PQETVIL  644
            P   V++
Sbjct  470  PNAVVLV  476



Lambda      K        H
   0.318    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5035546020


Query= XP_003392885.1 importin-7 [Bombus terrestris]

Length=1057
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VSD6_DROME  unnamed protein product                                 1356    0.0  
Q86NK4_DROME  unnamed protein product                                 1353    0.0  
Q7KIF8_DROME  unnamed protein product                                 1351    0.0  
Q95RH0_DROME  unnamed protein product                                 860     0.0  
Q385Z4_TRYB2  unnamed protein product                                 131     8e-31


>Q9VSD6_DROME unnamed protein product
Length=1049

 Score = 1356 bits (3509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 665/1060 (63%), Positives = 836/1060 (79%), Gaps = 19/1060 (2%)

Query  1     MDVRKVTELLRATIDP--EQQKQAEEQLNQIHKIIGFAPTLLQVLM-TAEEMSVRQAGVI  57
             M+ +K+TELLRATIDP  EQ+K AE+QL QIHKIIGF PT+LQ++M T  E  VRQAG +
Sbjct  1     MEAQKLTELLRATIDPNPEQRKAAEDQLAQIHKIIGFVPTILQIVMQTTVEQPVRQAGAV  60

Query  58    YLKNLIATNWADREDENGS-VKFTIHEQDRAMIRDAIVDALVHAPELIRVQLGVCVSNII  116
             YLKNLI ++W+D E + G  + F+IHEQDRAMIR AIVDA+VHAPELIRVQL VCV++II
Sbjct  61    YLKNLINSSWSDHEAKPGEPIPFSIHEQDRAMIRGAIVDAIVHAPELIRVQLSVCVNHII  120

Query  117   KHDFPGRWTQIVDKITIYLQNSDASCWPGVLLALHQLVKNFEYKKAEERGPLNEAMNLLF  176
             K DFPGRW Q+VD I+IYLQN D + W G L+ ++QLVK +EYK+ EER PLNEAMNLL 
Sbjct  121   KSDFPGRWPQVVDSISIYLQNQDVNGWNGALVTMYQLVKTYEYKRHEERTPLNEAMNLLL  180

Query  177   PMIYQLILRLLPDPSEQSVLLQKQILKIFFTLTQYTLPLDLISKEVFSQWMDVVRQVADR  236
             PMIYQL++RLL + SEQSVLLQKQILKI++ LTQYTLPLDLI+KE+FSQWM++ RQVADR
Sbjct  181   PMIYQLMVRLLAEQSEQSVLLQKQILKIYYALTQYTLPLDLITKEIFSQWMEICRQVADR  240

Query  237   PVPPETNNPDLDDDERAELPWWKCKKWALHILRRMFERYGSPGNVTHE-YKEFSGWYLRT  295
              VP   ++  LDDDER E P+WK KKWALHI+ RMFERYGSP NV  E Y++F+ WYL T
Sbjct  241   AVP---DSSHLDDDERTEFPYWKTKKWALHIMVRMFERYGSPSNVVSEKYQKFAEWYLPT  297

Query  296   FSGGILEVLLKILDQYRRKIYVSPRVIQQSINYINQGVSHAYSWKFLKPHMFEIIRDVLF  355
             FS G+LEVLLKILDQYR ++YVSPRV+   +NY+   VSHAY+WK +KPHM  +I+DV+F
Sbjct  298   FSQGVLEVLLKILDQYRNRVYVSPRVLTDVLNYLKNAVSHAYTWKLIKPHMVAVIQDVIF  357

Query  356   PILSYSAADEELWNNNPYEYIRVKFDIFEDFVSPVTAAQTLLYSACKKRKDMLQETIQFC  415
             PI+S++ +D+ELW ++PYEYIR+KFDIFED+ +PV AAQ+LL+S CKKRK +L + +   
Sbjct  358   PIMSFTDSDQELWESDPYEYIRLKFDIFEDYATPVPAAQSLLHSMCKKRKGILPKAMATI  417

Query  416   VEVLTSPNADPRQKDGALHMIGSLADVLLKKKVYKEQMDKMLLQYVLPEFSSPHGHMRAR  475
             ++++TSPNAD +QKDGALHMIG+LADVLLKK  Y++Q++ ML  YV PEF +P GHMRAR
Sbjct  418   MQIITSPNADNKQKDGALHMIGTLADVLLKKASYRDQVESMLTTYVFPEFQNPAGHMRAR  477

Query  476   ACWVLHYFSEIKFKQEQILVEAVRLTTNVLLTDQDLPVKVEAAIALQMLLSAQEKAKKYV  535
             ACWVLHYF +++ K  Q+L E +RLTTN LLTD++LPVKVEAAI LQM +S+Q++A +YV
Sbjct  478   ACWVLHYFCDVQIKNPQVLAEIMRLTTNALLTDKELPVKVEAAIGLQMFISSQDEAPQYV  537

Query  536   KPLIKPITLELLAIVRETENDDLTTVIQKIVYIYPDQLMPIAVEICQHLAATFSQVLETD  595
             +  IK IT ELL I+RETEN+DLT V+QKIV  + +QL+P+A EICQHLA TFSQVLE++
Sbjct  538   EAQIKEITKELLTIIRETENEDLTNVMQKIVCTFTEQLLPVATEICQHLATTFSQVLESE  597

Query  596   EGSDEKAITAMGLLNTIESLLSVMENQPEIIARLQPTVLQVVAHIFGESVMEFYEESLSL  655
             EGSDEKAITAM LLNTIE+LLSVME  P+++  L P V+ VV HIF  ++ +FYEE+ SL
Sbjct  598   EGSDEKAITAMSLLNTIETLLSVMEEHPDVLLNLHPIVINVVGHIFQHNITDFYEETFSL  657

Query  656   VYDLTIKTISGDMWKVLEMIYQLFQKDGFEYFTDMMPALHNYITVDTPAFLSNENHILAM  715
             VYDLT K IS +MW++LE+IYQ+F+KDG +YF D+MPALHNY+TVDTPAFLSN N +LA+
Sbjct  658   VYDLTAKAISPEMWQMLELIYQVFKKDGIDYFIDIMPALHNYVTVDTPAFLSNPNRLLAI  717

Query  716   FNMCKAVLTGDAGEDPECHAAKLLEVIILQCKDHIDQCIPSFVQLVLERLMREVKTSELR  775
              +MCK +LT   GEDPECHAAKL+EVIILQCK  ID  I  FV+L L RL REV++SELR
Sbjct  718   LDMCKTMLTSSPGEDPECHAAKLMEVIILQCKGQIDSVIHMFVELALSRLTREVQSSELR  777

Query  776   TMCLQVVIAALYYNPALCLETMDRLQGNFRQSTEPIASHFIKQWIHDTDCFLGLHDRKLC  835
             TMCLQVVIAALYYNP L L  +D++    +Q+ + I++HFIKQW+HDTDCFLG+HDRKLC
Sbjct  778   TMCLQVVIAALYYNPQLLLSILDKMS---QQNNDSISAHFIKQWLHDTDCFLGIHDRKLC  834

Query  836   VLGLCTLISMGPAKPPAVNECAQQIIPSLILLFDGLKRAYAAKASDAGDEENEEDDSDID  895
             VLGLCTLIS+G AKP  ++E A +I+P+LILLFDGLKRAY ++A +  ++E EED  D +
Sbjct  835   VLGLCTLISLGEAKPQVLSEVAGKIVPALILLFDGLKRAYESRAQEEEEDEEEEDGDDCE  894

Query  896   EEILSSDEDEIDDASQEYLEKLQEKVTRSSTQHGFNVSASIQDGHGDHRSDDDGDDSEYD  955
             E  LSSDED++D+ + +YL+KL E       + GF V A I+D   D     D ++S  D
Sbjct  895   EA-LSSDEDDMDEMAPDYLDKLAEFAKTKGNESGFEVKAEIKDDDADSDG--DAEESVGD  951

Query  956   ANEETPLEYYATPLDSDDMNQ---DEYIVFKEVMQNIERTDTVWYRALTGHLTAEQQKAL  1012
              N ET LE + TP+D D+ N+   DEY  FKEV+  +   D  WY  LT +LT EQ KAL
Sbjct  952   LN-ETGLESFTTPID-DEENESAIDEYWTFKEVITALSAQDQAWYALLTSNLTPEQAKAL  1009

Query  1013  QEIILLADQRKAALESKRIEQSGGYAFHSQTVPTSFNFGG  1052
             QE+++ ADQRKAA ESK IE+ GG+AF    VPTSF FG 
Sbjct  1010  QEVVVTADQRKAAKESKLIEKQGGFAFPQTAVPTSFKFGS  1049


>Q86NK4_DROME unnamed protein product
Length=1049

 Score = 1353 bits (3501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 664/1060 (63%), Positives = 835/1060 (79%), Gaps = 19/1060 (2%)

Query  1     MDVRKVTELLRATIDP--EQQKQAEEQLNQIHKIIGFAPTLLQVLM-TAEEMSVRQAGVI  57
             M+ +K+TELLRATIDP  EQ+K AE+QL QIHKIIGF PT+LQ++M T  E  VRQAG +
Sbjct  1     MEAQKLTELLRATIDPNPEQRKAAEDQLAQIHKIIGFVPTILQIVMQTTVEQPVRQAGAV  60

Query  58    YLKNLIATNWADREDENGS-VKFTIHEQDRAMIRDAIVDALVHAPELIRVQLGVCVSNII  116
             YLKNLI ++W+D E + G  + F+IHEQDRAMIR AIVDA+VHAPELIRVQL VCV++II
Sbjct  61    YLKNLINSSWSDHEAKPGEPIPFSIHEQDRAMIRGAIVDAIVHAPELIRVQLSVCVNHII  120

Query  117   KHDFPGRWTQIVDKITIYLQNSDASCWPGVLLALHQLVKNFEYKKAEERGPLNEAMNLLF  176
             K DFPGRW Q+VD I+IYLQN D + W G L+ ++QLVK +EYK+ EER PLNEAMNLL 
Sbjct  121   KSDFPGRWPQVVDSISIYLQNQDVNGWNGALVTMYQLVKTYEYKRHEERTPLNEAMNLLL  180

Query  177   PMIYQLILRLLPDPSEQSVLLQKQILKIFFTLTQYTLPLDLISKEVFSQWMDVVRQVADR  236
             PMIYQL++RLL + SEQSVLLQKQILKI++ LTQYTLPLDLI+KE+FSQWM++ RQVADR
Sbjct  181   PMIYQLMVRLLAEQSEQSVLLQKQILKIYYALTQYTLPLDLITKEIFSQWMEICRQVADR  240

Query  237   PVPPETNNPDLDDDERAELPWWKCKKWALHILRRMFERYGSPGNVTHE-YKEFSGWYLRT  295
              VP   ++  LDDDER E P+WK KKWALHI+ RMFERYGSP NV  E Y++F+ WYL T
Sbjct  241   AVP---DSSHLDDDERTEFPYWKTKKWALHIMVRMFERYGSPSNVVSEKYQKFAEWYLPT  297

Query  296   FSGGILEVLLKILDQYRRKIYVSPRVIQQSINYINQGVSHAYSWKFLKPHMFEIIRDVLF  355
             FS G+LEVLLKILDQYR ++YVSPRV+   +NY+   VSHAY+WK +KPHM  +I+DV+F
Sbjct  298   FSQGVLEVLLKILDQYRNRVYVSPRVLTDVLNYLKNAVSHAYTWKLIKPHMVAVIQDVIF  357

Query  356   PILSYSAADEELWNNNPYEYIRVKFDIFEDFVSPVTAAQTLLYSACKKRKDMLQETIQFC  415
             PI+S++ +D+ELW ++PYEYIR+KFDIFED+ +PV AAQ+LL+S CKKRK +L + +   
Sbjct  358   PIMSFTDSDQELWESDPYEYIRLKFDIFEDYATPVPAAQSLLHSMCKKRKGILPKAMATI  417

Query  416   VEVLTSPNADPRQKDGALHMIGSLADVLLKKKVYKEQMDKMLLQYVLPEFSSPHGHMRAR  475
             ++++TSPNAD +QKDGALHMIG+LADVLLKK  Y++Q++ ML  YV PEF +P GHMRAR
Sbjct  418   MQIITSPNADNKQKDGALHMIGTLADVLLKKASYRDQVESMLTTYVFPEFQNPAGHMRAR  477

Query  476   ACWVLHYFSEIKFKQEQILVEAVRLTTNVLLTDQDLPVKVEAAIALQMLLSAQEKAKKYV  535
             ACWVLHYF +++ K  Q+L E +RLTTN LLTD++LPVKVEAAI LQM +S+Q++A +YV
Sbjct  478   ACWVLHYFCDVQIKNPQVLAEIMRLTTNALLTDKELPVKVEAAIGLQMFISSQDEAPQYV  537

Query  536   KPLIKPITLELLAIVRETENDDLTTVIQKIVYIYPDQLMPIAVEICQHLAATFSQVLETD  595
             +  IK IT ELL I+RETEN+DLT V+QKIV  + +QL+P+A EICQHLA TFSQVLE++
Sbjct  538   EAQIKEITKELLTIIRETENEDLTNVMQKIVCTFTEQLLPVATEICQHLATTFSQVLESE  597

Query  596   EGSDEKAITAMGLLNTIESLLSVMENQPEIIARLQPTVLQVVAHIFGESVMEFYEESLSL  655
             EGSDEKAITAM LLNTIE+LLSVME  P+++  L P V+ VV HIF  ++ + YEE+ SL
Sbjct  598   EGSDEKAITAMSLLNTIETLLSVMEEHPDVLLNLHPIVINVVGHIFQHNITDLYEETFSL  657

Query  656   VYDLTIKTISGDMWKVLEMIYQLFQKDGFEYFTDMMPALHNYITVDTPAFLSNENHILAM  715
             VYDLT K IS +MW++LE+IYQ+F+KDG +YF D+MPALHNY+TVDTPAFLSN N +LA+
Sbjct  658   VYDLTAKAISPEMWQMLELIYQVFKKDGIDYFIDIMPALHNYVTVDTPAFLSNPNRLLAI  717

Query  716   FNMCKAVLTGDAGEDPECHAAKLLEVIILQCKDHIDQCIPSFVQLVLERLMREVKTSELR  775
              +MCK +LT   GEDPECHAAKL+EVIILQCK  ID  I  FV+L L RL REV++SELR
Sbjct  718   LDMCKTMLTSSPGEDPECHAAKLMEVIILQCKGQIDSVIHMFVELALSRLTREVQSSELR  777

Query  776   TMCLQVVIAALYYNPALCLETMDRLQGNFRQSTEPIASHFIKQWIHDTDCFLGLHDRKLC  835
             TMCLQVVIAALYYNP L L  +D++    +Q+ + I++HFIKQW+HDTDCFLG+HDRKLC
Sbjct  778   TMCLQVVIAALYYNPQLLLSILDKMS---QQNNDSISAHFIKQWLHDTDCFLGIHDRKLC  834

Query  836   VLGLCTLISMGPAKPPAVNECAQQIIPSLILLFDGLKRAYAAKASDAGDEENEEDDSDID  895
             VLGLCTLIS+G AKP  ++E A +I+P+LILLFDGLKRAY ++A +  ++E EED  D +
Sbjct  835   VLGLCTLISLGEAKPQVLSEVAGKIVPALILLFDGLKRAYESRAQEEEEDEEEEDGDDCE  894

Query  896   EEILSSDEDEIDDASQEYLEKLQEKVTRSSTQHGFNVSASIQDGHGDHRSDDDGDDSEYD  955
             E  LSSDED++D+ + +YL+KL E       + GF V A I+D   D     D ++S  D
Sbjct  895   EA-LSSDEDDMDEMAPDYLDKLAEFAKTKGNESGFEVKAEIKDDDADSDG--DAEESVGD  951

Query  956   ANEETPLEYYATPLDSDDMNQ---DEYIVFKEVMQNIERTDTVWYRALTGHLTAEQQKAL  1012
              N ET LE + TP+D D+ N+   DEY  FKEV+  +   D  WY  LT +LT EQ KAL
Sbjct  952   LN-ETGLESFTTPID-DEENESAIDEYWTFKEVITALSAQDQAWYALLTSNLTPEQAKAL  1009

Query  1013  QEIILLADQRKAALESKRIEQSGGYAFHSQTVPTSFNFGG  1052
             QE+++ ADQRKAA ESK IE+ GG+AF    VPTSF FG 
Sbjct  1010  QEVVVTADQRKAAKESKLIEKQGGFAFPQTAVPTSFKFGS  1049


>Q7KIF8_DROME unnamed protein product
Length=1049

 Score = 1351 bits (3496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 664/1060 (63%), Positives = 835/1060 (79%), Gaps = 19/1060 (2%)

Query  1     MDVRKVTELLRATIDP--EQQKQAEEQLNQIHKIIGFAPTLLQVLM-TAEEMSVRQAGVI  57
             M+ +K+TELLRATIDP  EQ+K AE+QL QIHKIIGF PT+LQ++M T  E  VRQAG +
Sbjct  1     MEAQKLTELLRATIDPNPEQRKAAEDQLAQIHKIIGFVPTILQIVMQTTVEQPVRQAGAV  60

Query  58    YLKNLIATNWADREDENGS-VKFTIHEQDRAMIRDAIVDALVHAPELIRVQLGVCVSNII  116
             YLKNLI ++W+D E + G  + F+IHEQDRAMIR AIVDA+VHAPELIRVQL VCV++II
Sbjct  61    YLKNLINSSWSDHEAKPGEPIPFSIHEQDRAMIRGAIVDAIVHAPELIRVQLSVCVNHII  120

Query  117   KHDFPGRWTQIVDKITIYLQNSDASCWPGVLLALHQLVKNFEYKKAEERGPLNEAMNLLF  176
             K DFPGRW Q+VD I+IYLQN D + W G L+ ++QLVK +EYK+ EER PLNEAMNLL 
Sbjct  121   KSDFPGRWPQVVDSISIYLQNQDVNGWNGALVTMYQLVKTYEYKRHEERTPLNEAMNLLL  180

Query  177   PMIYQLILRLLPDPSEQSVLLQKQILKIFFTLTQYTLPLDLISKEVFSQWMDVVRQVADR  236
             PMIYQL++RLL + SEQSVLLQKQILKI++ LTQYTLPLDLI+KE+FSQWM++ RQVADR
Sbjct  181   PMIYQLMVRLLAEQSEQSVLLQKQILKIYYALTQYTLPLDLITKEIFSQWMEICRQVADR  240

Query  237   PVPPETNNPDLDDDERAELPWWKCKKWALHILRRMFERYGSPGNVTHE-YKEFSGWYLRT  295
              VP   ++  LDDDER E P+WK KKWALHI+ RMFERYGSP NV  E Y++F+ WYL T
Sbjct  241   AVP---DSSHLDDDERTEFPYWKTKKWALHIMVRMFERYGSPSNVVSEKYQKFAEWYLPT  297

Query  296   FSGGILEVLLKILDQYRRKIYVSPRVIQQSINYINQGVSHAYSWKFLKPHMFEIIRDVLF  355
             FS G+LEVLLKILDQYR ++YVSPRV+   +NY+   VSHAY+WK +KPHM  +I+DV+F
Sbjct  298   FSQGVLEVLLKILDQYRNRVYVSPRVLTDVLNYLKNAVSHAYTWKLIKPHMVAVIQDVIF  357

Query  356   PILSYSAADEELWNNNPYEYIRVKFDIFEDFVSPVTAAQTLLYSACKKRKDMLQETIQFC  415
             PI+S++ +D+ELW ++PYEYIR+KFDIFED+ +PV AAQ+LL+S CKKRK +L + +   
Sbjct  358   PIMSFTDSDQELWESDPYEYIRLKFDIFEDYATPVPAAQSLLHSMCKKRKGILPKAMATI  417

Query  416   VEVLTSPNADPRQKDGALHMIGSLADVLLKKKVYKEQMDKMLLQYVLPEFSSPHGHMRAR  475
             ++++TSPNAD +QKDGALHMIG+LADVLLKK  Y++Q++ ML  YV PEF +P GHMRAR
Sbjct  418   MQIITSPNADNKQKDGALHMIGTLADVLLKKASYRDQVESMLTTYVFPEFQNPAGHMRAR  477

Query  476   ACWVLHYFSEIKFKQEQILVEAVRLTTNVLLTDQDLPVKVEAAIALQMLLSAQEKAKKYV  535
             ACWVLHYF +++ K  Q+L E +RLTTN LLTD++LPVKVEAAI LQM +S+Q++A +YV
Sbjct  478   ACWVLHYFCDVQIKNPQVLAEIMRLTTNALLTDKELPVKVEAAIGLQMFISSQDEAPQYV  537

Query  536   KPLIKPITLELLAIVRETENDDLTTVIQKIVYIYPDQLMPIAVEICQHLAATFSQVLETD  595
             +  IK IT ELL I+RETEN+DLT V+QKIV  + +QL+P+A EICQHLA TFSQVLE++
Sbjct  538   EAQIKEITKELLTIIRETENEDLTNVMQKIVCTFTEQLLPVATEICQHLATTFSQVLESE  597

Query  596   EGSDEKAITAMGLLNTIESLLSVMENQPEIIARLQPTVLQVVAHIFGESVMEFYEESLSL  655
             EGSDEKAITAM LLNTIE+LLSVME  P+++  L P V+ VV HIF  ++ +FYEE+ SL
Sbjct  598   EGSDEKAITAMSLLNTIETLLSVMEEHPDVLLNLHPIVINVVGHIFQHNITDFYEETFSL  657

Query  656   VYDLTIKTISGDMWKVLEMIYQLFQKDGFEYFTDMMPALHNYITVDTPAFLSNENHILAM  715
             VYDLT K IS +MW++LE+IYQ+F+KDG +YF D+MPALHNY+TVDTPAFLSN N +LA+
Sbjct  658   VYDLTAKAISPEMWQMLELIYQVFKKDGIDYFIDIMPALHNYVTVDTPAFLSNPNRLLAI  717

Query  716   FNMCKAVLTGDAGEDPECHAAKLLEVIILQCKDHIDQCIPSFVQLVLERLMREVKTSELR  775
              +MCK +LT   GEDPECHAAKL+EVIILQCK  ID  I  FV+L L RL REV++SELR
Sbjct  718   LDMCKTMLTSSPGEDPECHAAKLMEVIILQCKGQIDSVIHMFVELALSRLTREVQSSELR  777

Query  776   TMCLQVVIAALYYNPALCLETMDRLQGNFRQSTEPIASHFIKQWIHDTDCFLGLHDRKLC  835
             TMCLQVVIAALYYNP L L  +D++    +Q+ + I++HFIKQW+HDTDCFLG+HD KLC
Sbjct  778   TMCLQVVIAALYYNPQLLLSILDKMS---QQNNDSISAHFIKQWLHDTDCFLGIHDCKLC  834

Query  836   VLGLCTLISMGPAKPPAVNECAQQIIPSLILLFDGLKRAYAAKASDAGDEENEEDDSDID  895
             VLGLCTLIS+G AKP  ++E A +I+P+LILLFDGLKRAY ++A +  ++E EED  D +
Sbjct  835   VLGLCTLISLGEAKPQVLSEVAGKIVPALILLFDGLKRAYESRAQEEEEDEEEEDGDDCE  894

Query  896   EEILSSDEDEIDDASQEYLEKLQEKVTRSSTQHGFNVSASIQDGHGDHRSDDDGDDSEYD  955
             E  LSSDED++D+ + +YL+KL E       + GF V A I+D   D     D ++S  D
Sbjct  895   EA-LSSDEDDMDEMAPDYLDKLAEFAKTKGNESGFEVKAEIKDDDADSDG--DAEESVGD  951

Query  956   ANEETPLEYYATPLDSDDMNQ---DEYIVFKEVMQNIERTDTVWYRALTGHLTAEQQKAL  1012
              N ET LE + TP+D D+ N+   DEY  FKEV+  +   D  WY  LT +LT EQ KAL
Sbjct  952   LN-ETGLESFTTPID-DEENESAIDEYWTFKEVITALSAQDQAWYALLTSNLTPEQAKAL  1009

Query  1013  QEIILLADQRKAALESKRIEQSGGYAFHSQTVPTSFNFGG  1052
             QE+++ ADQRKAA ESK IE+ GG+AF    VPTSF FG 
Sbjct  1010  QEVVVTADQRKAAKESKLIEKQGGFAFPQTAVPTSFKFGS  1049


>Q95RH0_DROME unnamed protein product
Length=702

 Score = 860 bits (2223),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/710 (60%), Positives = 549/710 (77%), Gaps = 11/710 (2%)

Query  346   MFEIIRDVLFPILSYSAADEELWNNNPYEYIRVKFDIFEDFVSPVTAAQTLLYSACKKRK  405
             M  +I+DV+FPI+S++ +D+ELW ++PYEYIR+KFDIFED+ +PV AAQ+LL+S CKKRK
Sbjct  1     MVAVIQDVIFPIMSFTDSDQELWESDPYEYIRLKFDIFEDYATPVPAAQSLLHSMCKKRK  60

Query  406   DMLQETIQFCVEVLTSPNADPRQKDGALHMIGSLADVLLKKKVYKEQMDKMLLQYVLPEF  465
              +L + +   ++++TSPNAD +QKDGALHMIG+LADVLLKK  Y++Q++ ML  YV PEF
Sbjct  61    GILPKAMATIMQIITSPNADNKQKDGALHMIGTLADVLLKKASYRDQVESMLTTYVFPEF  120

Query  466   SSPHGHMRARACWVLHYFSEIKFKQEQILVEAVRLTTNVLLTDQDLPVKVEAAIALQMLL  525
              +P GHMRARACWVLHYF +++ K  Q+L E +RLTTN LLTD++LPVKVEAAI LQM +
Sbjct  121   QNPAGHMRARACWVLHYFCDVQIKNPQVLAEIMRLTTNALLTDKELPVKVEAAIGLQMFI  180

Query  526   SAQEKAKKYVKPLIKPITLELLAIVRETENDDLTTVIQKIVYIYPDQLMPIAVEICQHLA  585
             S+Q++A +YV+  IK IT ELL I+RETEN+DLT V+QKIV  + +QL+P+A EICQHLA
Sbjct  181   SSQDEAPQYVEAQIKEITKELLTIIRETENEDLTNVMQKIVCTFTEQLLPVATEICQHLA  240

Query  586   ATFSQVLETDEGSDEKAITAMGLLNTIESLLSVMENQPEIIARLQPTVLQVVAHIFGESV  645
              TFSQVLE++EGSDEKAITAM LLNTIE+LLSVME  P+++  L P V+ VV HIF  ++
Sbjct  241   TTFSQVLESEEGSDEKAITAMSLLNTIETLLSVMEEHPDVLLNLHPIVINVVGHIFQHNI  300

Query  646   MEFYEESLSLVYDLTIKTISGDMWKVLEMIYQLFQKDGFEYFTDMMPALHNYITVDTPAF  705
              +FYEE+ SLVYDLT K IS +MW++LE+IYQ+F+KDG +YF D+MPALHNY+TVDTPAF
Sbjct  301   TDFYEETFSLVYDLTAKAISPEMWQMLELIYQVFKKDGIDYFIDIMPALHNYVTVDTPAF  360

Query  706   LSNENHILAMFNMCKAVLTGDAGEDPECHAAKLLEVIILQCKDHIDQCIPSFVQLVLERL  765
             LSN N +LA+ +MCK +LT   GEDPECHAAKL+EVIILQCK  ID  I  FV+L L RL
Sbjct  361   LSNPNRLLAILDMCKTMLTSSPGEDPECHAAKLMEVIILQCKGQIDSVIHMFVELALSRL  420

Query  766   MREVKTSELRTMCLQVVIAALYYNPALCLETMDRLQGNFRQSTEPIASHFIKQWIHDTDC  825
              REV++SELRTMCLQVVIAALYYNP L L  +D++    +Q+ + I++HFIKQW+HDTDC
Sbjct  421   TREVQSSELRTMCLQVVIAALYYNPQLLLSILDKMS---QQNNDSISAHFIKQWLHDTDC  477

Query  826   FLGLHDRKLCVLGLCTLISMGPAKPPAVNECAQQIIPSLILLFDGLKRAYAAKASDAGDE  885
             FLG+HDRKLCVLGLCTLIS+G AKP  ++E A +I+P+LILLFDGLKRAY ++A    +E
Sbjct  478   FLGIHDRKLCVLGLCTLISLGEAKPQVLSEVAGKIVPALILLFDGLKRAYESRAQ-EEEE  536

Query  886   ENEEDDSDIDEEILSSDEDEIDDASQEYLEKLQEKVTRSSTQHGFNVSASIQDGHGDHRS  945
             + EE+D D  EE LSSDED++D+ + +YL+KL E       + GF V A I+D   D   
Sbjct  537   DEEEEDGDDCEEALSSDEDDMDEMAPDYLDKLAEFAKTKGNESGFEVKAEIKDDDADSDG  596

Query  946   DDDGDDSEYDANEETPLEYYATPLDSDDMNQ---DEYIVFKEVMQNIERTDTVWYRALTG  1002
               D ++S  D N ET LE + TP+D D+ N+   DEY  FKEV+  +   D  WY  LT 
Sbjct  597   --DAEESVGDLN-ETGLESFTTPID-DEENESAIDEYWTFKEVITALSAQDQAWYALLTS  652

Query  1003  HLTAEQQKALQEIILLADQRKAALESKRIEQSGGYAFHSQTVPTSFNFGG  1052
             +LT EQ KALQE+++ ADQRKAA ESK IE+ GG+AF    VPTSF FG 
Sbjct  653   NLTPEQAKALQEVVVTADQRKAAKESKLIEKQGGFAFPQTAVPTSFKFGS  702


>Q385Z4_TRYB2 unnamed protein product
Length=1201

 Score = 131 bits (330),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 199/842 (24%), Positives = 342/842 (41%), Gaps = 154/842 (18%)

Query  1    MDVRKVTELLRATI--DPEQQKQAEEQL-------NQIHKIIGFAPTLLQVLMTAEEMSV  51
            +D   + ++  AT+  D   +K+AE  L       N I ++I FA   L+    A +++ 
Sbjct  2    VDEETLVQIFTATLSADKATRKEAETALANLSNDPNIIPQLIRFACNDLRQAGAAAQVAQ  61

Query  52   RQAGVIYLKNLIATNWADREDENGSVKFTIHEQDRAMIRDAIV--DALVHAPELIRVQLG  109
              A  I ++N++      R D N    FT  E  +A +RD IV      H P  +R QL 
Sbjct  62   HAAS-IRVRNVVG-----RSDWNRQSYFT--ENVKANVRDCIVPLQCSSHVPPAVRRQLL  113

Query  110  VCVSNIIKHDFPGRWTQIVDKITIYLQ------NSD--ASCWP-------------GVLL  148
                 +I +D+P  W  ++ ++T  L       NSD  A   P             GVLL
Sbjct  114  DTTQELITYDYPASWPTLMPQLTSILDECVNVLNSDVGAVATPPYETAAARLRAALGVLL  173

Query  149  ALHQLVKNFEYKKAE-------ERGP-LNEAMNLLFPMIYQLILRLLPDPSEQSVLLQKQ  200
            A  +   N     AE         GP L     LL     Q +L+      +  V L  +
Sbjct  174  ACCRYYNNPINVDAEAVDDFVDRIGPSLVSLAELLGSAWGQELLQHSHAVCQTGVPLTFE  233

Query  201  I--------------LKIFFTLTQYTLPLDLISKEVFSQWMDV----VRQVADRPVPPET  242
            I              LK F  LT    P  L  +     +  V    + + A   + P  
Sbjct  234  ISPLHTVLTDCLRIVLKCFHELTASRWPRFLCERPEMEHFCRVCVVQLSEAAYSTLLPLY  293

Query  243  NN--PDLDDDERAEL--------PWWKCKKWALHILRRMFERYGSPGNVTHEYKEFSGWY  292
             +     +DDE  E+          WK  KW   +  ++ +    P       +  + ++
Sbjct  294  RHRISSCEDDENGEVDLATTDESAVWKLLKWVTRLSYQLVQELMFPKKCESRARGSAKYF  353

Query  293  LRTFSGGILEVLLKILDQYRRKI--YVSPRVIQQ-----SINYINQGVSHAYSWK-FLKP  344
                      +LL ++ Q    I  + SPR++       ++  I   V H+  ++  L P
Sbjct  354  CEN-------ILLPLVQQALEFIRWHASPRIVTSKAYILALEIITLAVEHSAVYRQILFP  406

Query  345  HMFEIIRDVLFPILSYSAADEELWNNNPYEYIRVKFDIFEDFVSPVTAAQTL---LYSAC  401
            +  E++  +LFP L++S+ D ELW+ NP EY+R + D  ED  S    + +L   L +  
Sbjct  407  NAGELLTQLLFPRLAFSSVDAELWSTNPVEYVRRQTDPQEDMYSARVVSGSLILALTTPS  466

Query  402  KKRKDMLQET--IQFCVEVLTSPNA--------DPRQKDGALHMIGSLADVLLKKKVYKE  451
            +   D L  T  + F +E L++ +A        + R  D     +     +L       E
Sbjct  467  RPFHDALALTNFMHFVLEKLSTHSAAAACGAVEESRVVDACFFAVYQFGGMLDVAGFPNE  526

Query  452  QMDKMLLQYVLPEFSSPHGHMRARACWVLHYFS-EIKFKQEQILVEAVRLTTNVLLTDQD  510
            +++ ++ +Y++P  + P G +RAR   VL   + +IK+   Q     V +    LL D +
Sbjct  527  RVEWLITEYIIPAAAYPAGILRARCALVLSVLAPKIKWSSSQAYQRVVHVVLR-LLQDAE  585

Query  511  LPVKVEAAIALQMLLSAQEKAKKYVKPLIKPITLELLAIVRETENDDLTTVIQKIVYIYP  570
             PV+++A  +   L+     A + + P+I  +     + +R  +N+ +   ++K +  Y 
Sbjct  586  PPVRIQACSSFAPLI-CHPFAHEVITPVIGEVIQNYFSAMRMMDNEGVVRTLRKTIRHYR  644

Query  571  DQLMPIAVEICQHLAATFSQ-------------VLET-DEGSDEKAITAMG---------  607
              L   A+++   LA  F Q             VLE+ D  + EK+   +G         
Sbjct  645  RTLSQWALQLTDVLAQHFEQMLGRALSEGHTDSVLESLDACNSEKSSKTLGGAGESTVSD  704

Query  608  -------LLNTIESLL--------SVMENQP------EIIARLQPTVLQVVAHIFGESVM  646
                   +L+T+ +L+        S   +QP      +I  R  P +  V+A   G S  
Sbjct  705  SIMAADEVLDTLVTLVRSLPQPNVSTPGSQPVDDLLLQIQERTAPMLFAVLAQ-EGGSCF  763

Query  647  EFYEESLSLVYDLTIKT--ISGDMWKVLEMIYQLFQKDGFEYFTDMMPALHNYITVDTPA  704
             F + +L L+  +  K+  +S   WK+L  +YQL  +   +YF+ M+P L N++ V    
Sbjct  764  GFMDATLMLLTTVLSKSTAVSTGTWKLLLCLYQLVSQGSVDYFSQMLPPLDNFVCVAPRE  823

Query  705  FL  706
            FL
Sbjct  824  FL  825



Lambda      K        H
   0.318    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5035546020


Query= XP_003392886.1 NEDD8-conjugating enzyme Ubc12 isoform X1 [Bombus
terrestris]

Length=181
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

UBC12_DROME  unnamed protein product                                  304     4e-107
Q8I607_PLAF7  unnamed protein product                                 101     1e-27 
UBC2_CAEEL  unnamed protein product                                   99.8    6e-27 
UBC12_CAEEL  unnamed protein product                                  99.4    2e-26 
UBCD1_DROME  unnamed protein product                                  97.1    6e-26 


>UBC12_DROME unnamed protein product
Length=181

 Score = 304 bits (779),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 157/180 (87%), Gaps = 1/180 (1%)

Query  1    MIKLFSLKQAKKDGESPKAGTQKKASAAQLRITKDINELNLPKTCGTEFPDPDDLLSFKL  60
            MIKLF+LKQ KKDGE  K   QKKASAAQLRI KDINELNLP TC T+FPDP+DLL+FKL
Sbjct  1    MIKLFTLKQQKKDGEQ-KGSQQKKASAAQLRIQKDINELNLPNTCATDFPDPNDLLNFKL  59

Query  61   IICPDEGFYRGGRFVFSFKVGPNYPHEPPKVKCETQVYHPNIDLDGNVCLNILREDWKPV  120
            II PDEGFYR GRFVF+F+VG NYPHEPPKVKC TQVYHPNIDLDGNVCLNILREDW PV
Sbjct  60   IISPDEGFYRDGRFVFNFRVGSNYPHEPPKVKCATQVYHPNIDLDGNVCLNILREDWNPV  119

Query  121  LTINSIVYGLQYLFLEPNPEDPLNKDAAEVLQNNRRAFEQNVAKAMRGGYVGAFYFERCL  180
            L INSIVYGLQ+LFLEPNPEDPLNK+AA+VLQ NRR FE NV KAMRGG VG  YFE CL
Sbjct  120  LNINSIVYGLQFLFLEPNPEDPLNKEAADVLQTNRRQFENNVKKAMRGGCVGETYFECCL  179


>Q8I607_PLAF7 unnamed protein product
Length=147

 Score = 101 bits (252),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 83/143 (58%), Gaps = 3/143 (2%)

Query  31   RITKDINELNL-PKTCGTEFPDPDDLLSFK-LIICPDEGFYRGGRFVFSFKVGPNYPHEP  88
            RITK++ +LN  P T  +  P  DDL  ++  I+ P +  Y  G +  + K  P+YP +P
Sbjct  5    RITKELQDLNKDPPTNCSAGPIGDDLFFWQATIMGPGDSPYENGVYFLNIKFPPDYPFKP  64

Query  89   PKVKCETQVYHPNIDLDGNVCLNILREDWKPVLTINSIVYGLQYLFLEPNPEDPLNKDAA  148
            PK+   T++YHPNI+  G +CL+IL++ W P LTI+ ++  +  L  +PN +DPL  + A
Sbjct  65   PKIIFTTKIYHPNINTAGAICLDILKDQWSPALTISKVLLSISSLLTDPNADDPLVPEIA  124

Query  149  EVLQNNRRAFEQNVAKAMRGGYV  171
             V + +R  + Q  AKA    Y 
Sbjct  125  HVYKTDRTKYHQ-TAKAWTQKYA  146


>UBC2_CAEEL unnamed protein product
Length=147

 Score = 99.8 bits (247),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 79/133 (59%), Gaps = 4/133 (3%)

Query  31   RITKDINEL--NLPKTCGTEFPDPDDLLSFK-LIICPDEGFYRGGRFVFSFKVGPNYPHE  87
            RI K++ +L  + P  C    P  DDL  ++  I+ P E  Y+GG F  +     +YP +
Sbjct  5    RIQKELQDLGRDPPAQCSAG-PVGDDLFHWQATIMGPPESPYQGGVFFLTIHFPTDYPFK  63

Query  88   PPKVKCETQVYHPNIDLDGNVCLNILREDWKPVLTINSIVYGLQYLFLEPNPEDPLNKDA  147
            PPKV   T++YHPNI+ +G++CL+ILR  W P LTI+ ++  +  L  +PNP+DPL  + 
Sbjct  64   PPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEI  123

Query  148  AEVLQNNRRAFEQ  160
            A + + +R  + Q
Sbjct  124  ARIYKTDRERYNQ  136


>UBC12_CAEEL unnamed protein product
Length=180

 Score = 99.4 bits (246),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 72/127 (57%), Gaps = 7/127 (6%)

Query  43   KTCGTEFPDPDDLLSFKLIICPDEGFYRGGRFVFSFKVGPNYPHEPPKVKCETQVYHPNI  102
            K    E P    L   +L + P EG YRGG+F F   V P Y + PP VKC T+V+HPNI
Sbjct  46   KLWHLEVPSTSCLHELELTVTPQEGIYRGGKFRFKITVPPEYNNVPPVVKCLTKVWHPNI  105

Query  103  DLDGNVCLNILRED------WKPVLTINSIVYGLQYLFLE-PNPEDPLNKDAAEVLQNNR  155
            + DG++CL+ILR++      W+P   +  +V+GL  LF +  +  D LN  AA++   NR
Sbjct  106  NEDGSICLSILRQNSLDQYGWRPTRNLTDVVHGLVSLFNDLMDFNDALNIQAAQMWSQNR  165

Query  156  RAFEQNV  162
             +F   V
Sbjct  166  ESFNHRV  172


>UBCD1_DROME unnamed protein product
Length=147

 Score = 97.1 bits (240),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 81/140 (58%), Gaps = 4/140 (3%)

Query  31   RITKDINEL--NLPKTCGTEFPDPDDLLSFK-LIICPDEGFYRGGRFVFSFKVGPNYPHE  87
            RI K++ +L  + P  C    P  DDL  ++  I+ P +  Y+GG F  +     +YP +
Sbjct  5    RINKELQDLGRDPPAQCSAG-PVGDDLFHWQATIMGPPDSPYQGGVFFLTIHFPTDYPFK  63

Query  88   PPKVKCETQVYHPNIDLDGNVCLNILREDWKPVLTINSIVYGLQYLFLEPNPEDPLNKDA  147
            PPKV   T++YHPNI+ +G++CL+ILR  W P LTI+ ++  +  L  +PNP+DPL  + 
Sbjct  64   PPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEI  123

Query  148  AEVLQNNRRAFEQNVAKAMR  167
            A + + +R  + +   +  R
Sbjct  124  ARIYKTDREKYNELAREWTR  143



Lambda      K        H
   0.318    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5035546020


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Aug 1, 2023  12:07 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_003392887.2 NEDD8-conjugating enzyme Ubc12 isoform X2 [Bombus
terrestris]

Length=150
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

UBC12_DROME  unnamed protein product                                  255     3e-88
UBC12_CAEEL  unnamed protein product                                  97.8    2e-26
UBC2_CAEEL  unnamed protein product                                   95.1    1e-25
UBC1_CAEEL  unnamed protein product                                   95.1    5e-25
Q8I607_PLAF7  unnamed protein product                                 93.6    6e-25


>UBC12_DROME unnamed protein product
Length=181

 Score = 255 bits (651),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 129/145 (89%), Gaps = 0/145 (0%)

Query  5    INELNLPKTCGTEFPDPDDLLSFKLIICPDEGFYRGGRFVFSFKVGPNYPHEPPKVKCET  64
            INELNLP TC T+FPDP+DLL+FKLII PDEGFYR GRFVF+F+VG NYPHEPPKVKC T
Sbjct  35   INELNLPNTCATDFPDPNDLLNFKLIISPDEGFYRDGRFVFNFRVGSNYPHEPPKVKCAT  94

Query  65   QVYHPNIDLDGNVCLNILREDWKPVLTINSIVYGLQYLFLEPNPEDPLNKDAAEVLQNNR  124
            QVYHPNIDLDGNVCLNILREDW PVL INSIVYGLQ+LFLEPNPEDPLNK+AA+VLQ NR
Sbjct  95   QVYHPNIDLDGNVCLNILREDWNPVLNINSIVYGLQFLFLEPNPEDPLNKEAADVLQTNR  154

Query  125  RAFEQNVAKAMRGGYVGAFYFERCL  149
            R FE NV KAMRGG VG  YFE CL
Sbjct  155  RQFENNVKKAMRGGCVGETYFECCL  179


>UBC12_CAEEL unnamed protein product
Length=180

 Score = 97.8 bits (242),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 72/127 (57%), Gaps = 7/127 (6%)

Query  12   KTCGTEFPDPDDLLSFKLIICPDEGFYRGGRFVFSFKVGPNYPHEPPKVKCETQVYHPNI  71
            K    E P    L   +L + P EG YRGG+F F   V P Y + PP VKC T+V+HPNI
Sbjct  46   KLWHLEVPSTSCLHELELTVTPQEGIYRGGKFRFKITVPPEYNNVPPVVKCLTKVWHPNI  105

Query  72   DLDGNVCLNILRED------WKPVLTINSIVYGLQYLFLE-PNPEDPLNKDAAEVLQNNR  124
            + DG++CL+ILR++      W+P   +  +V+GL  LF +  +  D LN  AA++   NR
Sbjct  106  NEDGSICLSILRQNSLDQYGWRPTRNLTDVVHGLVSLFNDLMDFNDALNIQAAQMWSQNR  165

Query  125  RAFEQNV  131
             +F   V
Sbjct  166  ESFNHRV  172


>UBC2_CAEEL unnamed protein product
Length=147

 Score = 95.1 bits (235),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 71/120 (59%), Gaps = 2/120 (2%)

Query  11   PKTCGTEFPDPDDLLSFK-LIICPDEGFYRGGRFVFSFKVGPNYPHEPPKVKCETQVYHP  69
            P  C    P  DDL  ++  I+ P E  Y+GG F  +     +YP +PPKV   T++YHP
Sbjct  18   PAQCSAG-PVGDDLFHWQATIMGPPESPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHP  76

Query  70   NIDLDGNVCLNILREDWKPVLTINSIVYGLQYLFLEPNPEDPLNKDAAEVLQNNRRAFEQ  129
            NI+ +G++CL+ILR  W P LTI+ ++  +  L  +PNP+DPL  + A + + +R  + Q
Sbjct  77   NINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRERYNQ  136


>UBC1_CAEEL unnamed protein product
Length=192

 Score = 95.1 bits (235),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 74/123 (60%), Gaps = 1/123 (1%)

Query  19   PDPDDLLSFKLII-CPDEGFYRGGRFVFSFKVGPNYPHEPPKVKCETQVYHPNIDLDGNV  77
            P  D++L+++ II  P E  +  G F  S +    YP++PP VK  ++++HPN+  DG++
Sbjct  28   PTEDNILTWEAIIFGPQETPFEDGTFKLSLEFTEEYPNKPPTVKFISKMFHPNVYADGSI  87

Query  78   CLNILREDWKPVLTINSIVYGLQYLFLEPNPEDPLNKDAAEVLQNNRRAFEQNVAKAMRG  137
            CL+IL+  W P   + +I+  +Q L  EPNP  P N  AA++ Q NRR +E+ V + +  
Sbjct  88   CLDILQNRWSPTYDVAAILTSIQSLLDEPNPNSPANSLAAQLYQENRREYEKRVQQIVEQ  147

Query  138  GYV  140
             ++
Sbjct  148  SWL  150


>Q8I607_PLAF7 unnamed protein product
Length=147

 Score = 93.6 bits (231),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 74/131 (56%), Gaps = 2/131 (2%)

Query  11   PKTCGTEFPDPDDLLSFK-LIICPDEGFYRGGRFVFSFKVGPNYPHEPPKVKCETQVYHP  69
            P T  +  P  DDL  ++  I+ P +  Y  G +  + K  P+YP +PPK+   T++YHP
Sbjct  17   PPTNCSAGPIGDDLFFWQATIMGPGDSPYENGVYFLNIKFPPDYPFKPPKIIFTTKIYHP  76

Query  70   NIDLDGNVCLNILREDWKPVLTINSIVYGLQYLFLEPNPEDPLNKDAAEVLQNNRRAFEQ  129
            NI+  G +CL+IL++ W P LTI+ ++  +  L  +PN +DPL  + A V + +R  + Q
Sbjct  77   NINTAGAICLDILKDQWSPALTISKVLLSISSLLTDPNADDPLVPEIAHVYKTDRTKYHQ  136

Query  130  NVAKAMRGGYV  140
              AKA    Y 
Sbjct  137  -TAKAWTQKYA  146



Lambda      K        H
   0.323    0.145    0.461 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 845836338


Query= XP_003392888.1 F-box only protein 28 [Bombus terrestris]

Length=365
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VT01_DROME  unnamed protein product                                 189     3e-57
Q95RF4_DROME  unnamed protein product                                 152     1e-43
Q7K2J4_DROME  unnamed protein product                                 139     2e-36
O62217_CAEEL  unnamed protein product                                 33.1    0.42 
MYS2_DICDI  unnamed protein product                                   30.4    2.7  


>Q9VT01_DROME unnamed protein product
Length=314

 Score = 189 bits (479),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 123/159 (77%), Gaps = 0/159 (0%)

Query  2    LQLINLPDIVLETILSNLSYDDISRYRIVCKQFDRICKKLLNRGFNLMEKYHAQCLRAVK  61
            + L++LP  +++ IL  L YD++++ R VC  F+ + +++LN+GFN +   HA+  + +K
Sbjct  1    MNLLDLPQTLIQDILELLPYDEVAKKREVCTLFNYLGQQILNKGFNKIIMAHAKNFKRIK  60

Query  62   SQLPRRESERRSHPLARHCDILTAIETRISMLSMTFIKYVDLNLCCFIPGKVIDEIFRVL  121
            S LPRRESERR+H L+RH DILT+IETRISML+MT+ K++DLN+CCFIPG+V+DEI  +L
Sbjct  61   SMLPRRESERRNHILSRHSDILTSIETRISMLTMTYSKFIDLNICCFIPGRVLDEINSIL  120

Query  122  RLIRDSKTPPRAHEILQELRDISSMAMEHFDEKILPDLK  160
            R++  S    R HE+LQELRDISSMA+EHFDEKI  + K
Sbjct  121  RILSTSTKQLRPHEVLQELRDISSMAIEHFDEKIAVNFK  159


>Q95RF4_DROME unnamed protein product
Length=265

 Score = 152 bits (384),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 89/108 (82%), Gaps = 0/108 (0%)

Query  53   HAQCLRAVKSQLPRRESERRSHPLARHCDILTAIETRISMLSMTFIKYVDLNLCCFIPGK  112
            HA+  + +KS LPRRESERR+H L+RH DILT+IETRISML+MT+ K++DLN+CCFIPG+
Sbjct  3    HAKNFKRIKSMLPRRESERRNHILSRHSDILTSIETRISMLTMTYSKFIDLNICCFIPGR  62

Query  113  VIDEIFRVLRLIRDSKTPPRAHEILQELRDISSMAMEHFDEKILPDLK  160
            V+DEI  +LR++  S    R HE+LQELRDISSMA+EHFDEKI  + K
Sbjct  63   VLDEINSILRILSTSTKQLRPHEVLQELRDISSMAIEHFDEKIAVNFK  110


>Q7K2J4_DROME unnamed protein product
Length=603

 Score = 139 bits (351),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 100/299 (33%), Positives = 154/299 (52%), Gaps = 20/299 (7%)

Query  4    LINLPDIVLETILSNLSYDDISRYRIVCKQFDRICKKLLNRGFNLMEKYHAQCLRAVKSQ  63
            L +LP+ ++E ILS + Y  +S  R+V  + + IC  +LN  F    K      +A+K+ 
Sbjct  122  LYDLPNELIEKILSYVDYKKVSNLRLVSHRMNDICMAMLNTAFTKQIKTTLSRFQAIKAS  181

Query  64   LPRRESERRSHPLARHCDILTAIETRISMLSMTFIKYVDLNLCCFIPGKVIDEIFRVLRL  123
            +PRRES RR+HPLA  CDI+     R+S+L M+  K+++   CCF PG ++DE+  +L  
Sbjct  182  MPRRESHRRNHPLACECDIIETCYMRLSLLQMSMGKHIERGHCCFFPGAILDEVQAILNY  241

Query  124  IRDSKTPPRAHEILQELRDISSMAMEHFDEKI---LPDLKHSICTSVVSNVGSYELPS--  178
            I  +    R + +  EL D+S+MAME+F ++I   LP L +        N   Y LP+  
Sbjct  242  ISITPRLQRPYRVTDELFDLSTMAMEYFKDRIEATLPGLAY-------FNKDFYTLPTTT  294

Query  179  --GSLMISHHTTSSNSVTLPHNFNSEKLNQTFKKIYSRTK--KNKLSVLSIKGQIGKMKL  234
               +L IS     S S + P N     L +  +KI    K   N+LSVL  + ++   K 
Sbjct  295  KRPTLAISSDLEDSASNSPPQNHMV--LRKGIRKIKQGMKMYNNQLSVL--RTELRTCKR  350

Query  235  RMKRQGFQMRLQSLKLQEQAKKIHDQDTQLAEMRKHLEEWEQKMVDLTAELSRAREETQ  293
            +   Q  Q+  QS  + EQ K+  +   +L E  K  EE  +K   L  EL++ + E Q
Sbjct  351  KAAEQSKQLAEQSNLISEQQKQTLEYANRLDENDKKNEEMSRKFSTLLQELNKCKTELQ  409


>O62217_CAEEL unnamed protein product
Length=983

 Score = 33.1 bits (74),  Expect = 0.42, Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 36/75 (48%), Gaps = 5/75 (7%)

Query  232  MKLRMKRQGFQMRLQSLKLQEQAKKIHDQDTQLAEMRKHLEEWEQKMVDLTAELSRAREE  291
            + LR+KR+     L    ++E+   I D++  L E R HL   E  ++++   + +   E
Sbjct  420  LSLRIKRKAVDTELDKTGIEEKLLHIPDREVHLKEFRGHLLYLEHLILEMLRWIRQVSTE  479

Query  292  TQKP-----DSIETC  301
             + P     D ++TC
Sbjct  480  AKTPARGGQDGVKTC  494


>MYS2_DICDI unnamed protein product
Length=2116

 Score = 30.4 bits (67),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 30/117 (26%), Positives = 51/117 (44%), Gaps = 27/117 (23%)

Query  228   QIGKMKLRMKRQGFQMRLQSLKLQEQAKKIHDQDTQLAEMRKHLEEWEQKMVDLTAELSR  287
             Q  K  L  KR G +  L+ +            + QL E +K  E  E++ VDL  E+S 
Sbjct  1275  QKAKQALEKKRLGLESELKHV------------NEQLEEEKKQKESNEKRKVDLEKEVSE  1322

Query  288   AREE---------------TQKPDSIETCKRKHIDMINQRETDSLQTKELQAKKRKL  329
              +++                +K   ++  KR++ D+++ R+    Q K LQAK  +L
Sbjct  1323  LKDQIEEEVASKKAVTEAKNKKESELDEIKRQYADVVSSRDKSVEQLKTLQAKNEEL  1379



Lambda      K        H
   0.323    0.145    0.461 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 845836338


Query= XP_003392889.1 cilia- and flagella-associated protein 91 isoform X2
[Bombus terrestris]

Length=640
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q386N1_TRYB2  unnamed protein product                                 63.5    3e-10


>Q386N1_TRYB2 unnamed protein product
Length=709

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 79/279 (28%), Positives = 129/279 (46%), Gaps = 28/279 (10%)

Query  313  ATRWTKEKLSQLHSDLKASRSNTKTIEAPLLLKRKYKLPALPSTPYRKSTEDITNKRLHQ  372
            ATR   E L  +H+ +  S +  +TI   L L R    P  P TP  +   D+ N+ + +
Sbjct  417  ATRVV-EALEYVHAKIHKSDTPAETIRV-LELYRATPRPQRPDTPTLELEGDV-NEAVEE  473

Query  373  LSILIQKIIKGRAIQCMMFEGRNRCRELIEELQSSYGLEEHSKKQHQEEKAHTLELQHLQ  432
               L+Q++++GRA+Q   F+G+ RCR LIEELQ++      S  ++ E    + E +  +
Sbjct  474  SCTLLQRLLRGRAVQNDFFDGKERCRGLIEELQAA------SNAKYAE---RSAEEKQAE  524

Query  433  SEKSMQEDSLYEILNSLEGMTISGMLDFLSKELIRLEDERRIHAFALLAERERATREAAE  492
            +E+ M+E     I N  +G  I   LD+L  E+ R +D   + A   L     A R   E
Sbjct  525  AEEKMREAIADSIGNEAQGDIICDTLDYLFHEMTRQQD---LLALEALRHEAEAVRAERE  581

Query  493  AGRRQLEYNRRREFDE---MFRQTMKVNQESVESYLEDIIKEGIEWISDEATKAYISELC  549
            A   +L    R   D+    +   ++  ++ VE Y  D+     E  + E     I   C
Sbjct  582  AREAELRAQERILHDKEAVQYAAYVRAIEDIVECYSHDLYATVAEECAMEEA---IEAEC  638

Query  550  DKIDSISKAAQNNATKLSEEEMVANMIY----NFVLPEV  584
             +++ +     N    LS+ E+  N++     NFVLP V
Sbjct  639  QRLEQLPPPTSN---ILSDPEVAENLVCDVLDNFVLPAV  674


 Score = 59.7 bits (143),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 42/69 (61%), Gaps = 2/69 (3%)

Query  68   NIGTQTDYRDSDSQTAPWDPPYKIKSGH--YPEALSIAHLSWNHGLEIGIHDLEIINRMR  125
            +   QT +R++++QT P+ P Y I  G    P+ L +  L WN GL  G  ++E+I R+R
Sbjct  132  DAAMQTVFRENEAQTLPYTPNYYIPEGGDPNPQVLGLMELHWNEGLPAGKEEVELIQRLR  191

Query  126  RKRAWEAVL  134
            R+RA EA L
Sbjct  192  RRRAVEASL  200



Lambda      K        H
   0.323    0.145    0.461 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 845836338


Query= XP_003392892.1 serine/threonine-protein kinase 32A [Bombus
terrestris]

Length=462
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PK2_DICDI  unnamed protein product                                    187     1e-53
KRAC_DICDI  unnamed protein product                                   182     4e-52
KS6A1_CAEEL  unnamed protein product                                  180     2e-49
KAPC_DICDI  unnamed protein product                                   177     1e-48
Q9VR61_DROME  unnamed protein product                                 176     8e-48


>PK2_DICDI unnamed protein product
Length=479

 Score = 187 bits (474),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 120/343 (35%), Positives = 180/343 (52%), Gaps = 28/343 (8%)

Query  2    GANQSTRNEPTPGEEVNF---------DHFQILRAIGKGSFGKVCIVQKRDRTGNMYAMK  52
            G+     +E    EEV F         D F++L  IGKGSFGKV  V+K+     ++AMK
Sbjct  124  GSGNGNDDEDEGPEEVIFSKNKQSATKDDFELLNVIGKGSFGKVMQVKKKGED-KIFAMK  182

Query  53   YVHKGECAMRGALKNVAREVEILSQLEHPCLVNLWFSFQDEEDLFMVSDLLLGGDLRYHI  112
             + K     R  + +   E  IL  + HP +VNL ++FQ ++ L+MV D + GG+L +H+
Sbjct  183  VLRKDAIIARKQVNHTKSEKTILQCISHPFIVNLHYAFQTKDKLYMVLDFVNGGELFFHL  242

Query  113  QQEVVFSEQSIVLFVAEIALALDYLQSHKIVHRDIKPDNILLDEEGHAHVTDFNIATVLE  172
            ++E  FSE  + ++ AEI  ALD+L    IV+RD+KP+NILLD EGH  +TDF ++  +E
Sbjct  243  KREGRFSEPRVKIYAAEIVSALDHLHKQDIVYRDLKPENILLDSEGHICITDFGLSKKIE  302

Query  173  DGELATSMSGTKPYIAPEIYMCSCEEYGVLGYGFAVDWWSLGILAWETLAGERPYPLCST  232
              +   +  GT  Y+APE+           G+G AVDWWSLG L +E L G  P+   + 
Sbjct  303  TTDGTFTFCGTPEYLAPEVLNGH-------GHGCAVDWWSLGTLLYEMLTGLPPFYSQNV  355

Query  233  TTHREALQILQKERPTPVDWSSAICELMNRLLVVAPGARVSTL--KELKQVNAMRELDFD  290
            +T  +  +IL  E   P   S     L+  LL      R+ T    E+KQ    + +D++
Sbjct  356  STMYQ--KILNGELKIPTYISPEAKSLLEGLLTREVDKRLGTKGGGEVKQHPWFKNIDWE  413

Query  291  KVLNKQIKPSFTPP----KDHLNCDPTFELE---EMIIETKPL  326
            K+  K+++  F P      D    DP F  E   + ++ET  L
Sbjct  414  KLDRKEVEVHFKPKVKSGTDISQIDPVFTQERPMDSLVETSAL  456


>KRAC_DICDI unnamed protein product
Length=444

 Score = 182 bits (461),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 107/311 (34%), Positives = 167/311 (54%), Gaps = 16/311 (5%)

Query  10   EPTPGEEVNFDHFQILRAIGKGSFGKVCIVQKRDRTGNMYAMKYVHKGECAMRGALKNVA  69
            +P   E+V    F++L  +GKGSFGKV  V+K+D TG +YAMK + K        +++  
Sbjct  108  QPKKSEKVGVADFELLNLVGKGSFGKVIQVRKKD-TGEVYAMKVLSKKHIVEHNEVEHTL  166

Query  70   REVEILSQLEHPCLVNLWFSFQDEEDLFMVSDLLLGGDLRYHIQQEVVFSEQSIVLFVAE  129
             E  IL ++ HP LVNL +SFQ E+ L+ + D + GG+L YH+Q++  F+E  +  + AE
Sbjct  167  SERNILQKINHPFLVNLNYSFQTEDKLYFILDYVNGGELFYHLQKDKKFTEDRVRYYGAE  226

Query  130  IALALDYLQSHKIVHRDIKPDNILLDEEGHAHVTDFNIAT--VLEDGELATSMSGTKPYI  187
            I LAL++L    +++RD+KP+N+LL  EGH  +TDF +    +L   +   +  GT  Y+
Sbjct  227  IVLALEHLHLSGVIYRDLKPENLLLTNEGHICMTDFGLCKEGLLTPTDKTGTFCGTPEYL  286

Query  188  APEIYMCSCEEYGVLGYGFAVDWWSLGILAWETLAGERPYPLCSTTTHREALQILQKERP  247
            APE+   +       GYG  VDWWS G L +E L G  P+   +        +I+ ++  
Sbjct  287  APEVLQGN-------GYGKQVDWWSFGSLLYEMLTGLPPF--YNQDVQEMYRKIMMEKLS  337

Query  248  TPVDWSSAICELMNRLLVVAPGARVSTLKELKQVNAMRELDFDKVLNKQIKPSFTP----  303
             P   S     L+ +LL   P  R++    +K+    R +D++++  K I P F P    
Sbjct  338  FPHFISPDARSLLEQLLERDPEKRLADPNLIKRHPFFRSIDWEQLFQKNIPPPFIPNVKG  397

Query  304  PKDHLNCDPTF  314
              D    DP F
Sbjct  398  SADTSQIDPVF  408


>KS6A1_CAEEL unnamed protein product
Length=784

 Score = 180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 112/311 (36%), Positives = 174/311 (56%), Gaps = 17/311 (5%)

Query  14   GEEVNFDHFQILRAIGKGSFGKVCIVQK-RDR-TGNMYAMKYVHKGECAMRGALKNVARE  71
            GE+ +   F++L+ +G+GSFGKV +V+K R R +G++YAMK + K    +R   +    E
Sbjct  96   GEKADPRQFELLKVLGQGSFGKVFLVRKVRGRDSGHVYAMKVLKKATLKVRDR-QRTKLE  154

Query  72   VEILSQLEHPCLVNLWFSFQDEEDLFMVSDLLLGGDLRYHIQQEVVFSEQSIVLFVAEIA  131
              IL+ + HP +V L ++FQ E  L+++ D L GGDL   + +EV+F+E  +  ++AE+ 
Sbjct  155  RNILAHISHPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEDDVKFYLAELT  214

Query  132  LALDYLQSHKIVHRDIKPDNILLDEEGHAHVTDFNIATVLEDGELAT-SMSGTKPYIAPE  190
            LAL++L S  IV+RD+KP+NILLD +GH  VTDF ++    D E  T S  GT  Y+APE
Sbjct  215  LALEHLHSLGIVYRDLKPENILLDADGHIKVTDFGLSKEAIDSEKKTYSFCGTVEYMAPE  274

Query  191  IYMCSCEEYGVLGYGFAVDWWSLGILAWETLAGERPYPLCSTTTHREALQILQKERPTP-  249
            +           G+  A D+WSLG+L +E L G  P+       +    QIL+ +   P 
Sbjct  275  V-------INRRGHSMAADFWSLGVLMFEMLTGHLPFQ--GRDRNDTMTQILKAKLSMPH  325

Query  250  ---VDWSSAICELMNRLLVVAPGARVSTLKELKQVNAMRELDFDKVLNKQIKPSFTPPKD  306
                +  S +  L  R      GA    ++E+K+     ++DF K+LNK+I P F P   
Sbjct  326  FLTQEAQSLLRALFKRNSQNRLGAGPDGVEEIKRHAFFAKIDFVKLLNKEIDPPFKPALS  385

Query  307  HLNCDPTFELE  317
             ++    F+ E
Sbjct  386  TVDSTSYFDPE  396


 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 82/290 (28%), Positives = 135/290 (47%), Gaps = 31/290 (11%)

Query  5    QSTRNEPTPGEEVNFDHFQILRAIGKGSFGKVCIVQKRDRTGNMYAMKYVHKGECAMRGA  64
            +S R+ PT       D ++IL  IG G+   V   Q +  T   YA+K V K       A
Sbjct  437  KSVRSVPTAKTNPFTDDYEILEKIGNGAHSVVHKCQMK-ATRRKYAVKIVKK-------A  488

Query  65   LKNVAREVEIL-SQLEHPCLVNLWFSFQDEEDLFMVSDLLLGGDLRYH-IQQEVVFSEQS  122
            + +   EV+IL     H  +V L+  ++DE  ++M+ +L  GG+L    + ++ + SE+ 
Sbjct  489  VFDATEEVDILLRHSHHQFVVKLFDVYEDETAIYMIEELCEGGELLDKLVNKKSLGSEKE  548

Query  123  IVLFVAEIALALDYLQSHKIVHRDIKPDNILL----DEEGHAHVTDFNIA--TVLEDGEL  176
            +   +A +  A+ YL S ++ HRD+   NIL      +     + DF  A  +  E+G L
Sbjct  549  VAAIMANLLNAVQYLHSQQVAHRDLTAANILFALKDGDPSSLRIVDFGFAKQSRAENGML  608

Query  177  ATSMSGTKPYIAPEIYMCSCEEYGVLGYGFAVDWWSLGILAWETLAGERPYPLCSTTTHR  236
             T    T  ++APE+           GY  + D WSLG+L    L G  P+ +    T  
Sbjct  609  MTPCY-TAQFVAPEVLRKQ-------GYDRSCDVWSLGVLLHTMLTGCTPFAMGPNDTPD  660

Query  237  EALQILQKERPT---PVDW---SSAICELMNRLLVVAPGARVSTLKELKQ  280
            + LQ +   + +   PV W   S    +L+ ++L V P  RV+  + L+ 
Sbjct  661  QILQRVGDGKISMTHPV-WDTISDEAKDLVRKMLDVDPNRRVTAKQALQH  709


>KAPC_DICDI unnamed protein product
Length=648

 Score = 177 bits (448),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 103/310 (33%), Positives = 170/310 (55%), Gaps = 18/310 (6%)

Query  22   FQILRAIGKGSFGKVCIVQKRDRTGNMYAMKYVHKGECAMRGALKNVAREVEILSQLEHP  81
            F+ +R IG G+FGKV ++Q   + G  YAMK ++K        ++++  E  ILS + HP
Sbjct  336  FKQIRVIGTGTFGKVYLIQNT-KDGCYYAMKCLNKAYVVQLKQVEHLNSEKSILSSIHHP  394

Query  82   CLVNLWFSFQDEEDLFMVSDLLLGGDLRYHIQQEVVFSEQSIVLFVAEIALALDYLQSHK  141
             +VNL+ +FQDE+ L+++ + + GG++  H+++ + FS  +   + AEI LAL++L    
Sbjct  395  FIVNLYQAFQDEKKLYLLFEYVAGGEVFTHLRKSMKFSNSTAKFYAAEIVLALEFLHKQN  454

Query  142  IVHRDIKPDNILLDEEGHAHVTDFNIATVLEDGELATSMSGTKPYIAPEIYMCSCEEYGV  201
            IV+RD+KP+N+L+D +GH  +TDF  A  +ED     ++ GT  Y+APEI          
Sbjct  455  IVYRDLKPENLLIDNQGHIKITDFGFAKRVEDRTF--TLCGTPEYLAPEIIQSK------  506

Query  202  LGYGFAVDWWSLGILAWETLAGERPYPLCSTTTHREALQILQKERPTPVDWSSAICELMN  261
             G+G AVDWW+LGIL +E LAG  P+      T     +IL      P+ +     +L+ 
Sbjct  507  -GHGKAVDWWALGILIFEMLAGYPPF--YDDDTFAIYNKILAGRITFPLGFDVDAKDLIK  563

Query  262  RLLVVAPGARVSTLK----ELKQVNAMRELDFDKVLNKQIKPSFTPPKDHLNCDPTFEL-  316
            RLL      R+  LK    ++K      +++++++  ++    F P   H      FE+ 
Sbjct  564  RLLTADRTRRLGALKDGALDVKNHRWFSDINWERLYQRRDNGPFIPKIQHQGDSSNFEMY  623

Query  317  -EEMIIETKP  325
             EE ++E  P
Sbjct  624  DEEEMVEEPP  633


>Q9VR61_DROME unnamed protein product
Length=911

 Score = 176 bits (447),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 101/289 (35%), Positives = 163/289 (56%), Gaps = 18/289 (6%)

Query  22   FQILRAIGKGSFGKVCIVQK--RDRTGNMYAMKYVHKGECAMRGALKNVAREVEILSQLE  79
            F++LR +G+GSFGKV +V+K      G +YAMK + K    ++  +++   E +IL+ + 
Sbjct  199  FELLRVLGEGSFGKVFLVRKIIGKDAGTLYAMKVLKKATLKVKDRVRST-NERKILADVG  257

Query  80   HPCLVNLWFSFQDEEDLFMVSDLLLGGDLRYHIQQEVVFSEQSIVLFVAEIALALDYLQS  139
            H  +V L ++FQ    L+++ D L GGDL   + +EV+F+E+ +  ++AE+ALA+++L +
Sbjct  258  HAFIVRLHYAFQTPGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALAMNHLHT  317

Query  140  HKIVHRDIKPDNILLDEEGHAHVTDFNIATVLEDGELATSMSGTKPYIAPEIYMCSCEEY  199
              I++RD+KP+NILLDE GH  +TDF ++    DG    S  GT  Y+APEI        
Sbjct  318  LGIIYRDLKPENILLDEHGHIALTDFGLSKQPLDGSKTYSFCGTVEYMAPEI-------V  370

Query  200  GVLGYGFAVDWWSLGILAWETLAGERPYPLCSTTTHREAL-QILQKERPTPVDWSSAICE  258
               G+ FA DWWS G+L +E L G  P+      T +E + QIL+ +   P + S     
Sbjct  371  NRKGHDFAADWWSFGVLMYEMLTGNLPF---HGQTRQETMNQILRSKLGMPENLSPEAQS  427

Query  259  LMNRLLVVAP----GARVSTLKELKQVNAMRELDFDKVLNKQIKPSFTP  303
            L+  L    P    GA    + ++K       +D+ ++  KQ++P F P
Sbjct  428  LLRALFKRNPQNRLGAGAQGILDIKAHCFFATIDWVRLERKQVRPPFIP  476


 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 77/277 (28%), Positives = 131/277 (47%), Gaps = 31/277 (11%)

Query  22   FQILRAIGKGSFGKVCIVQKRDRTGNMYAMKYVHKGECAMRGALK--NVAREVEILSQL-  78
            + +L+ +G+G+F  VC + +   +   YA+K + K   A        +   EVEI+ +  
Sbjct  568  YNLLQELGRGTF-SVCRLCEHRASKKHYAVKVIEKAAVAAASTSTSADCWEEVEIMLRYG  626

Query  79   EHPCLVNLWFSFQDEEDLFMVSDLLLGGDL--RYHIQQEVVFSEQSIVLFVAEIALALDY  136
             HP +V L+  ++D    ++V +LL GG+L  R     ++  SE S VL    IA A+ Y
Sbjct  627  NHPNIVTLYSVYEDAGSAYLVMELLKGGELLDRILAVGQMCESEASAVL--RTIASAVAY  684

Query  137  LQSHKIVHRDIKPDNILLDEEGHA----HVTDFNIATVLE-DGELATSMSGTKPYIAPEI  191
            L  H +VHRD+KP N++            + D   A  L  D  L  +   T  ++APE+
Sbjct  685  LHEHGVVHRDLKPSNMIYASMRQTPETLKLCDLGFAKQLRADNGLLMTPCYTANFVAPEV  744

Query  192  YMCSCEEYGVLGYGFAVDWWSLGILAWETLAGERPYPLCSTTTHREALQILQKERPTPVD  251
                       GY  A D WSLG+L +  L+G  P+   ++T +     IL++     +D
Sbjct  745  LKRQ-------GYDLACDIWSLGVLLYIMLSGRTPF---ASTPNDSPDVILKRIGSGQID  794

Query  252  WSSA--------ICELMNRLLVVAPGARVSTLKELKQ  280
            ++S+          EL+ ++L + P  R +  + L+ 
Sbjct  795  FTSSRWALISVPAKELLRQMLHIVPENRPTAARILEH  831



Lambda      K        H
   0.323    0.145    0.461 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 845836338


Query= XP_003392893.1 isocitrate dehydrogenase [NAD] subunit beta,
mitochondrial [Bombus terrestris]

Length=374
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VD58_DROME  unnamed protein product                                 534     0.0   
IDHB_DICDI  unnamed protein product                                   332     3e-112
IDH3A_DROME  unnamed protein product                                  292     1e-96 
IDH3A_CAEEL  unnamed protein product                                  273     2e-89 
PYR1_CAEEL  unnamed protein product                                   30.8    2.6   


>Q9VD58_DROME unnamed protein product
Length=370

 Score = 534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/372 (72%), Positives = 310/372 (83%), Gaps = 8/372 (2%)

Query  1    MALLARNICKVFSQTAQKGAVRCLHVGTVHRQESAVEQEG--KVKCTLIPGDGVGPELVV  58
            M++LAR + + F Q A   A R LH  +  R   A +  G  +  CTLIPGDGVGPELV 
Sbjct  1    MSMLARTVGRTFMQAA---AARSLHTTSTLR---ATDNYGANRTTCTLIPGDGVGPELVY  54

Query  59   SVQSVFKAANVPVEFEPYFLSEVNPTLSAPLEQVSNSIARNRVCLKGILATPDHSMTGEL  118
            S+Q VFKAA+VPV+FE YFLSE+NP LSA LE V  SI +N+VC+KG+LATPD+S  G+L
Sbjct  55   SLQEVFKAASVPVDFECYFLSEINPVLSAKLEDVVASIQKNKVCIKGVLATPDYSNVGDL  114

Query  119  QTLNMKLRKSLDLYSNVVHVKSLPGVTCRHKNVDCIIIREQTEGEYSALEHESVKGVVEC  178
            QTLNMKLR  LDLY+NVVHV+SLPGV  RH N+D +IIREQTEGEYSALEHESV G+VEC
Sbjct  115  QTLNMKLRNDLDLYANVVHVRSLPGVKTRHTNIDTVIIREQTEGEYSALEHESVPGIVEC  174

Query  179  LKIVTAVKSQRIAKFAFDYAVKHNRKKVTCVHKANIMKLGDGLFLKSCQEIAKMYPRITF  238
            LKI+TA KS RIAKFAFDYA K+ RKKVT VHKANIMKLGDGLFL+SC+E++++YPRI F
Sbjct  175  LKIITAKKSMRIAKFAFDYATKNQRKKVTAVHKANIMKLGDGLFLRSCEEVSRLYPRIQF  234

Query  239  ETMIVDNCTMQMVSNPHQFDVMVLPNLYGNILDNVASGLVGGAGVVAGASYSPECVVFEP  298
            E MIVDN TMQMVSNP+QFDVMV PNLYG I+DN+ASGLVGGAGVVAGASYS E VVFEP
Sbjct  235  EKMIVDNTTMQMVSNPNQFDVMVTPNLYGAIVDNLASGLVGGAGVVAGASYSSESVVFEP  294

Query  299  GARHTYSEAVGKNVANPTAMLLCAVKLLRHVNLKRYSEQIKDALNRVLNDGKVLTKDLGG  358
            GARHT++EAVGKNVANPTAMLLC VKLLRH+NL  Y E I++A+N+VLNDGKV TKDLGG
Sbjct  295  GARHTFAEAVGKNVANPTAMLLCGVKLLRHINLPTYGEIIQNAINKVLNDGKVRTKDLGG  354

Query  359  QSSTTDFTTAVI  370
            QS+T DFT A+I
Sbjct  355  QSTTQDFTRAII  366


>IDHB_DICDI unnamed protein product
Length=360

 Score = 332 bits (850),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 165/336 (49%), Positives = 230/336 (68%), Gaps = 10/336 (3%)

Query  41   KVKCTLIPGDGVGPELVVSVQSVFKAANVPVEFEPYFLSEVNPTLSAPLEQVSNSIARNR  100
            K   T+IPGDG+GPE+  SV  VF+AA VP+E+E + +S   P      +++  SI RN+
Sbjct  29   KKTVTVIPGDGIGPEITSSVMGVFQAAKVPIEWEIFDISGGQPIS----QELIASITRNK  84

Query  101  VCLKGILATPDHSMTGELQTLNMKLRKSLDLYSNVVHVKSLPGVTCRHKNV--DCIIIRE  158
            V LKG L T   S +   Q+ NM+LRK+LDLY++VV  K +PG+T RH +V  D ++IRE
Sbjct  85   VALKGPLYTEILSGS---QSRNMELRKALDLYAHVVPCKQIPGITARHDDVLVDFVVIRE  141

Query  159  QTEGEYSALEHESVKGVVECLKIVTAVKSQRIAKFAFDYAVKHNRKKVTCVHKANIMKLG  218
             T+GEYS LE     GVV+ LKI+T   S+RIA++AF+YA  + RKKVT VHKANI K  
Sbjct  142  NTQGEYSGLEQVLTPGVVQSLKIITKEASERIARYAFEYAKANGRKKVTAVHKANIQKQT  201

Query  219  DGLFLKSCQEIAKMYPRITFETMIVDNCTMQMVSNPHQFDVMVLPNLYGNILDNVASGLV  278
            DGLFL +C +IAK YP I FE  I+DNC MQ+V +P Q+DVMV PNLYGNI+ N+ + LV
Sbjct  202  DGLFLATCTQIAKEYPEIKFENTIIDNCCMQLVKSPEQYDVMVTPNLYGNIVSNIGAALV  261

Query  279  GGAGVVAGASYSPECVVFEPGARHTYSEAVGKNVANPTAMLLCAVKLLRHVNLKRYSEQI  338
            GG G+  GA+     ++FE GA H  ++  GK+ ANPT +LL +V +L+H+ L  ++ ++
Sbjct  262  GGPGLAGGANVGEGSIIFEMGAHHVAADIAGKDKANPTGLLLASVMMLKHLGLNEHATKV  321

Query  339  KDALNRVLNDGKVLTKDLGGQSSTTDFTTAVINCLR  374
            ++A+  V+ +G  LT D+GG+SST  FT AVI+ + 
Sbjct  322  ENAVKAVIKEG-TLTSDIGGKSSTKQFTGAVIDYIE  356


>IDH3A_DROME unnamed protein product
Length=377

 Score = 292 bits (748),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 147/332 (44%), Positives = 219/332 (66%), Gaps = 6/332 (2%)

Query  40   GKVKCTLIPGDGVGPELVVSVQSVFKAANVPVEFEPYFLSEV-NPTLSAPLEQVS-NSIA  97
            G  K TLIPGDG+GPE+  +VQ +F AANVP+E+E   ++ V  P     + Q + +S+ 
Sbjct  46   GTKKVTLIPGDGIGPEISAAVQKIFTAANVPIEWEAVDVTPVRGPDGKFGIPQAAIDSVN  105

Query  98   RNRVCLKGILATPDHSMTGELQTLNMKLRKSLDLYSNVVHVKSLPGVTCRHKNVDCIIIR  157
             N++ LKG L TP   +    ++LN+ LRK  +LY+NV   +SL G    + +VD + IR
Sbjct  106  TNKIGLKGPLMTP---VGKGHRSLNLALRKEFNLYANVRPCRSLEGYKTLYDDVDVVTIR  162

Query  158  EQTEGEYSALEHESVKGVVECLKIVTAVKSQRIAKFAFDYAVKHNRKKVTCVHKANIMKL  217
            E TEGEYS +EHE V GVV+ +K++T   S+R+A++AF YA  +NRKKVT VHKANIM++
Sbjct  163  ENTEGEYSGIEHEIVDGVVQSIKLITEEASKRVAEYAFQYAKNNNRKKVTVVHKANIMRM  222

Query  218  GDGLFLKSCQEIAKMYPRITFETMIVDNCTMQMVSNPHQFDVMVLPNLYGNILDNVASGL  277
             DGLFL+  +++A+ +P I FE   +D   + MV NP ++DV+V+PNLYG+IL ++ +GL
Sbjct  223  SDGLFLRCVRDMAQKFPEIQFEEKYLDTVCLNMVQNPGKYDVLVMPNLYGDILSDMCAGL  282

Query  278  VGGAGVVAGASYSPECVVFEPGARHTYSEAVGKNVANPTAMLLCAVKLLRHVNLKRYSEQ  337
            VGG G+    +      +FE     T  +  GK++ANPTA+LL AV +LRH+ L  Y+++
Sbjct  283  VGGLGLTPSGNMGLNGALFE-SVHGTAPDIAGKDLANPTALLLSAVMMLRHMELNTYADK  341

Query  338  IKDALNRVLNDGKVLTKDLGGQSSTTDFTTAV  369
            I+ A    + +GK LT DLGG++  ++FT  +
Sbjct  342  IERAAFETIKEGKYLTGDLGGRAKCSEFTNEI  373


>IDH3A_CAEEL unnamed protein product
Length=358

 Score = 273 bits (699),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 145/335 (43%), Positives = 210/335 (63%), Gaps = 10/335 (3%)

Query  43   KCTLIPGDGVGPELVVSVQSVFKAANVPVEFEPYFLSEV---NPTLSAPLEQVSNSIARN  99
            + TLIPGDG+GPE+  SVQ +F+AA+ P+ ++P  ++ V   +     P   +    A N
Sbjct  26   RVTLIPGDGIGPEISASVQKIFEAADAPIAWDPVDVTPVKGRDGVFRIPSRCIELMHA-N  84

Query  100  RVCLKGILATPDHSMTGELQTLNMKLRKSLDLYSNVVHVKSLPGVTCRHKNVDCIIIREQ  159
            +V LKG L TP   +    ++LN+ +RK   LY+NV   +SL G    + NVD + IRE 
Sbjct  85   KVGLKGPLETP---IGKGHRSLNLAVRKEFSLYANVRPCRSLEGHKTLYDNVDVVTIREN  141

Query  160  TEGEYSALEHESVKGVVECLKIVTAVKSQRIAKFAFDYAVKHNRKKVTCVHKANIMKLGD  219
            TEGEYS +EHE V GVV+ +K++T   S+ +A FAF+YA ++ RK VT VHKANIM+  D
Sbjct  142  TEGEYSGIEHEIVPGVVQSIKLITETASRNVASFAFEYARQNGRKVVTAVHKANIMRQSD  201

Query  220  GLFLKSCQEIAKMYPRITFETMIVDNCTMQMVSNPHQFDVMVLPNLYGNILDNVASGLVG  279
            GLFL  C+E A +YP I F+   +D   + MV +P Q+DV+V+PNLYG+IL ++ +GLVG
Sbjct  202  GLFLSICREQAALYPDIKFKEAYLDTVCLNMVQDPSQYDVLVMPNLYGDILSDLCAGLVG  261

Query  280  GAGVVAGASYSPECVVFEPGARHTYSEAVGKNVANPTAMLLCAVKLLRHVNLKRYSEQIK  339
            G GV    +      VFE     T  +  G++ ANPTA+LL AV +LR++NL +++ +I+
Sbjct  262  GLGVTPSGNIGKGAAVFE-SVHGTAPDIAGQDKANPTALLLSAVMMLRYMNLPQHAARIE  320

Query  340  DALNRVLNDGKVLTKDLGGQSSTTDFTTAVINCLR  374
             A+   + DG+  T DLGG  + + FT  V  C R
Sbjct  321  KAVFDAIADGRAKTGDLGGTGTCSSFTADV--CAR  353


>PYR1_CAEEL unnamed protein product
Length=2198

 Score = 30.8 bits (68),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 27/114 (24%), Positives = 47/114 (41%), Gaps = 10/114 (9%)

Query  152  DCIIIREQTEGEYSALEHESVKGVVECLKIVTAVKSQRIAKFAFDYA--------VKHNR  203
            D  I ++    EY+  E   VKG+  C+K +  V  +  A+  + Y         V  N 
Sbjct  874  DRQIAKKIGSNEYTVREARFVKGITPCVKQIDTVAGEWPAQTNYLYTTFNGIENDVSFNM  933

Query  204  KKVTCVHKANIMKLGDGL-FLKSCQEIAKMYPRITFETMIVDNCTMQMVSNPHQ  256
            K    V  + + ++G  + F  SC    +    + + T+ V NC  + VS  + 
Sbjct  934  KNAVMVLGSGVYRIGSSVEFDSSCVGCIRELKALGYSTITV-NCNPETVSTDYD  986



Lambda      K        H
   0.323    0.145    0.461 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 845836338


Query= XP_003392894.1 methenyltetrahydrofolate synthase domain-containing
protein [Bombus terrestris]

Length=457
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VN21_DROME  unnamed protein product                                 251     2e-77
Q8IGE9_DROME  unnamed protein product                                 250     3e-77
Q384C0_TRYB2  unnamed protein product                                 29.6    6.5  
Q9VPS2_DROME  unnamed protein product                                 28.9    9.2  


>Q9VN21_DROME unnamed protein product
Length=545

 Score = 251 bits (640),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 150/432 (35%), Positives = 254/432 (59%), Gaps = 21/432 (5%)

Query  7    PPEVTKHSFRQKVWDYLMKNDLVNFPLTVYDRIPNFKGAAEAAQRLADLEIFKEAKIIKI  66
            P E TK S R + W  + +  +      +++RIP+F GA +AA   A+ E FK+A+ IK+
Sbjct  29   PIEPTKRSLRVQTWKKIQEGKVGIGFNNIFNRIPSFVGADKAAALFANEEEFKKAQHIKV  88

Query  67   NPDKPQEPVRFLALEANKEILVPIPRLRTGLFLHVTPIAGSSKSELRTLSKIHGLTEAGK  126
            N D+     + LAL A+K + +P  R  + L L V  +A +++ + +   ++  + +   
Sbjct  89   NIDRVLHEFKELALLADKSVYLPSTRESSALCLKVDVLADATEEQKKEALRVQDIQKFRS  148

Query  127  PLGVDSKIKIDLVILGSVCVSHDGYRLGKGKGFADLEFAMMMRMGAVTQDTIVITTVHDC  186
             +G+DS +K+D+V++GSV VS +GYR+G+G GFADL+  +++ +GA+T  TI++T VHD 
Sbjct  149  EIGLDSGLKLDIVVIGSVVVSREGYRIGRGNGFADLDIGLLIELGAITPKTIIVTIVHDM  208

Query  187  QVFDSLPPEIFKEYDVPVDIIVTPTQTIIVNPKLKKPSCIMWHMLSERRIKSMPVLQQLK  246
            QV DSLPP +F++YD PVDII TPT+ I V  +L  P+ + W +LSERR+K +PVLQQLK
Sbjct  209  QVVDSLPPNLFQKYDTPVDIIATPTEIIRVPKRLSFPNGVYWELLSERRLKILPVLQQLK  268

Query  247  EMDEKEGKIVTLKEEDSDIEIQKSYRSHYIKNKRRSKTKKAASSGKDVNEERGEQVKPRS  306
            E +EK GK ++LKEED+D+E    ++++  +     +  +  + G+  ++   EQ +  +
Sbjct  269  EREEKAGKSISLKEEDTDVE---QHQNNRRRRGPVRRRIQRGNPGRTTSQTDNEQPQGET  325

Query  307  SKKRAFNK-----------IKSGDDNVFSDVAEAKVERNDKNMQQRRKNLRLKSKSQ-VE  354
            ++KR   +            KS  D       EA  + +D+ + +   + R   K++  +
Sbjct  326  AQKRTPRRKGRFVNRRRRTTKSEGDQ---SGVEAGAKTDDRKLPEAGTDERRSKKNKNSD  382

Query  355  FSLKLSNISSGARIRDLKNALSERGIKPNEITWLGYRGICYLHFNKLRKNNSLSEQPIQV  414
            F +KL+N+S   R++DLK+ L +R   P  I+W G+ G C+LHF   +   S  +    +
Sbjct  383  FCIKLTNLSRDIRVKDLKSELRKRECTPMSISWKGHFGKCFLHFGNRKGVPSTQD---DM  439

Query  415  DSIMANLQQLCI  426
            D ++ +L  L +
Sbjct  440  DKVLKSLNDLSL  451


>Q8IGE9_DROME unnamed protein product
Length=534

 Score = 250 bits (639),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 150/432 (35%), Positives = 254/432 (59%), Gaps = 21/432 (5%)

Query  7    PPEVTKHSFRQKVWDYLMKNDLVNFPLTVYDRIPNFKGAAEAAQRLADLEIFKEAKIIKI  66
            P E TK S R + W  + +  +      +++RIP+F GA +AA   A+ E FK+A+ IK+
Sbjct  18   PIEPTKRSLRVQTWKKIQEGKVGIGFNNIFNRIPSFVGADKAAALFANEEEFKKAQHIKV  77

Query  67   NPDKPQEPVRFLALEANKEILVPIPRLRTGLFLHVTPIAGSSKSELRTLSKIHGLTEAGK  126
            N D+     + LAL A+K + +P  R  + L L V  +A +++ + +   ++  + +   
Sbjct  78   NIDRVLHEFKELALLADKSVYLPSTRESSALCLKVDVLADATEEQKKEALRVQDIQKFRS  137

Query  127  PLGVDSKIKIDLVILGSVCVSHDGYRLGKGKGFADLEFAMMMRMGAVTQDTIVITTVHDC  186
             +G+DS +K+D+V++GSV VS +GYR+G+G GFADL+  +++ +GA+T  TI++T VHD 
Sbjct  138  EIGLDSGLKLDIVVIGSVVVSREGYRIGRGNGFADLDIGLLIELGAITPKTIIVTIVHDM  197

Query  187  QVFDSLPPEIFKEYDVPVDIIVTPTQTIIVNPKLKKPSCIMWHMLSERRIKSMPVLQQLK  246
            QV DSLPP +F++YD PVDII TPT+ I V  +L  P+ + W +LSERR+K +PVLQQLK
Sbjct  198  QVVDSLPPNLFQKYDTPVDIIATPTEIIRVPKRLSFPNGVYWELLSERRLKILPVLQQLK  257

Query  247  EMDEKEGKIVTLKEEDSDIEIQKSYRSHYIKNKRRSKTKKAASSGKDVNEERGEQVKPRS  306
            E +EK GK ++LKEED+D+E    ++++  +     +  +  + G+  ++   EQ +  +
Sbjct  258  EREEKAGKSISLKEEDTDVE---QHQNNRRRRGPVRRRIQRGNPGRTTSQTDNEQPQGET  314

Query  307  SKKRAFNK-----------IKSGDDNVFSDVAEAKVERNDKNMQQRRKNLRLKSKSQ-VE  354
            ++KR   +            KS  D       EA  + +D+ + +   + R   K++  +
Sbjct  315  AQKRTPRRKGRFVNRRRRTTKSEGDQ---SGVEAGAKTDDRKLPEAGTDERRSKKNKNSD  371

Query  355  FSLKLSNISSGARIRDLKNALSERGIKPNEITWLGYRGICYLHFNKLRKNNSLSEQPIQV  414
            F +KL+N+S   R++DLK+ L +R   P  I+W G+ G C+LHF   +   S  +    +
Sbjct  372  FCIKLTNLSRDIRVKDLKSELRKRECTPMSISWKGHFGKCFLHFGNRKGVPSTQD---DM  428

Query  415  DSIMANLQQLCI  426
            D ++ +L  L +
Sbjct  429  DKVLKSLNDLSL  440


>Q384C0_TRYB2 unnamed protein product
Length=1216

 Score = 29.6 bits (65),  Expect = 6.5, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 39/78 (50%), Gaps = 8/78 (10%)

Query  287  AASSGKDVNEERGEQVKPRSSKKRAFNKIK--SGDDNVFSDV------AEAKVERNDKNM  338
            A   GK + EE+   ++ R +KK+AFN++    G +N +S         EAK ER D  +
Sbjct  741  AIVGGKPLTEEQERLLQKRMAKKKAFNELYDMGGKNNTYSHYHEMTREVEAKKERLDTAL  800

Query  339  QQRRKNLRLKSKSQVEFS  356
            Q+   ++  K K    FS
Sbjct  801  QEVGHDITNKIKLVGHFS  818


>Q9VPS2_DROME unnamed protein product
Length=269

 Score = 28.9 bits (63),  Expect = 9.2, Method: Compositional matrix adjust.
 Identities = 32/129 (25%), Positives = 55/129 (43%), Gaps = 11/129 (9%)

Query  275  YIKNKRRSKTKKAASSGKDVNEERGEQVKPRSSKKRAFNKIKSGDDNVFSD--VAEAKVE  332
            YI N  +S    A      VNE R +  K    +K   +KIK   DNV ++     AK+ 
Sbjct  46   YISNNHKSHWNSANEV--QVNETRKQLAKIEGQEKETNDKIKVIHDNVDNEFNALSAKI-  102

Query  333  RNDKNMQQRRKNLRLK---SKSQVEFSLKLSNISSGARIRDLKNALSERGI---KPNEIT  386
            +N KN+Q+   +L L+   +K  +  S++   +     I      +  R     K +++ 
Sbjct  103  KNVKNIQRHLASLELQLQETKKALNLSVEAKKVMPKTEIPSQFQKIGWRHFFIEKKHKVD  162

Query  387  WLGYRGICY  395
            W     +C+
Sbjct  163  WFKATSMCH  171



Lambda      K        H
   0.323    0.145    0.461 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 845836338


Query= XP_003392897.3 protein Star isoform X1 [Bombus terrestris]

Length=340
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

STAR_DROME  unnamed protein product                                   121     3e-30


>STAR_DROME unnamed protein product
Length=597

 Score = 121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 82/278 (29%), Positives = 136/278 (49%), Gaps = 48/278 (17%)

Query  62   VASCL-AFLAAFSTAMSLLLVWSEAAALRRQAFDANMTRDYVLNSVSMDNPELVAYIREV  120
            +A CL +F A F+T    L+V+ +   +R Q F  NM+RDY LN V+ D+P L+ ++R++
Sbjct  283  IALCLLSFAAVFAT----LIVYMDTTEIRHQQFRLNMSRDYELNGVAQDDPALIDFLRQI  338

Query  121  QL-KPTTQQDPSNATQTTE-------------------------------ERYVAGLTEG  148
             + K   +  P  A   +                                  YVA L  G
Sbjct  339  HMGKYLGKASPKVAAAASVGVGPPPNSPRLAAAGSTFGSGNSSGSGADQLAHYVADLVGG  398

Query  149  KREGVYVEYISR-IGAISSTGWLERNLSWRGVLILTDPRSFFEAHR-GTRNPKTRVLHAC  206
            K  G  ++ +S  +  + +  WL   L+W GVL+  +PR +F   +   +  + +V+HAC
Sbjct  399  KMNGAVIQSLSGPLAHLITAPWLSEQLNWMGVLVEPEPRWYFTLRKQNAQRARMQVVHAC  458

Query  207  LSTDKDTKEITYHQESEVQVTKLGEGPNSLVSSDEGFPTTRLKCFPLYSVLLAYSATTLD  266
            +S +   KEIT H E +V++       NSL   +  +  +R+KCFPLY+++LA   T  D
Sbjct  459  VSPNTYPKEITIHNE-DVRI-------NSLHDEETSWFNSRVKCFPLYTIMLACERTEYD  510

Query  267  YLSLDSPDAQDSQVLDTIPWETTRISVVSIRWSPHHSE  304
             LSL      + ++L T+P++  +I V+SI     H +
Sbjct  511  LLSLGV-QGHELEILQTLPFDKVKIDVISIHLLEDHED  547



Lambda      K        H
   0.323    0.145    0.461 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 845836338


Query= XP_003392898.1 facilitated trehalose transporter Tret1 [Bombus
terrestris]

Length=477
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8IQH6_DROME  unnamed protein product                                 356     1e-118
Q9VU17_DROME  unnamed protein product                                 356     1e-117
TRE12_DROME  unnamed protein product                                  312     2e-101
TRET1_ANOGA  unnamed protein product                                  314     8e-99 
TRET1_BOMMO  unnamed protein product                                  299     3e-96 


>Q8IQH6_DROME unnamed protein product
Length=471

 Score = 356 bits (913),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 186/469 (40%), Positives = 288/469 (61%), Gaps = 3/469 (1%)

Query  9    DAAVRQESRKLWQYLASISACILVVGVGTALAWTSPVLPQLYAADSW--LVITKEQGSWI  66
              +    S+K  QY+A+++A       GT L WTSP   ++          + K+Q SW+
Sbjct  3    HTSTSNNSQKWPQYVAALAAAGGAFAAGTVLGWTSPAETEIVDRGEGYDFPVDKDQFSWV  62

Query  67   SSLLALGAIAGALGSGSMADKMGRKKSLLLLSVPFLLSWGIILVATEVKLLYIARFLVGI  126
             S + LGA    +  G + + +GRK ++L L +PF+L W +++ A  V +LY +RF++GI
Sbjct  63   GSAMTLGAACVCIPIGFLINMIGRKWTMLFLVLPFILGWTMLIWAVNVSMLYASRFILGI  122

Query  127  GVGAGCVLGPTYISEISEVSTRGTLGALFQLFLTVGIFVAFILGSVLNYTMLALVCALIV  186
              GA CV  P Y  EI++   RGTLG+ FQL +T+GI   + +G+ +    L+++C ++ 
Sbjct  123  AGGAFCVTAPMYTGEIAQKEIRGTLGSFFQLMITIGILFVYAVGAGVKIFWLSIICGILP  182

Query  187  VFFLTTFYWMPESPVWLVNQNRKQEAMSAMSVLRGEDYDPKQELNEMQKEAEASAGKKPS  246
            + F   F++MPESP +LV+++R + A+ ++  LRG++YD + EL E+++    +   K +
Sbjct  183  LIFGAIFFFMPESPTYLVSKDRSENAIKSIQWLRGKEYDYEPELAELRETDRETKANKVN  242

Query  247  LSDMAKDPVNKKAMIASFGMMFFQQASGVNAVIFYTVMIFEASGSSMAPELASILVALVQ  306
            +      PV +KA+  S G+MFFQQ  G+NAVIFY   IF  + + +  E A+IL+ ++Q
Sbjct  243  VWAALNRPVTRKALAISMGLMFFQQVCGINAVIFYASRIFLEANTGIEAEWATILIGIMQ  302

Query  307  LVMSGVAALIVDRAGRKPLLMISTSIMSVSLIALG-YYFQQKDDGNDVSSLGWLPLASLI  365
            +V + V+ L+VD+ GR+ LL+ S   M++S  A+G Y+F QK D   V SLGWLP+ASL 
Sbjct  303  VVATFVSTLVVDKLGRRILLLASGISMAISTTAIGVYFFLQKQDAAQVVSLGWLPVASLC  362

Query  366  VFMVAFSIGLGPVPWMLMGELFAAETKAVASSVAVMLNWLLVFIVTKTFPMMNKELGTDM  425
            +F++ FSIG GPVPW++MGELFA + K  A S+A   NWLL F+VTKTF  +N  LG   
Sbjct  363  LFIIMFSIGYGPVPWLMMGELFATDIKGFAGSLAGTSNWLLAFVVTKTFVNLNDGLGIGG  422

Query  426  TFWIFAVVMACATAFTHVLVPETKGKTYQQIHDELQGGPTVDKSVQQMK  474
            TFW+FA +      F +  VPETKGK+  +I  EL G  +  +++   K
Sbjct  423  TFWLFAGLTVVGVIFVYFAVPETKGKSLNEIQQELAGNRSTPQAIPAEK  471


>Q9VU17_DROME unnamed protein product
Length=539

 Score = 356 bits (913),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 187/473 (40%), Positives = 290/473 (61%), Gaps = 3/473 (1%)

Query  5    GMINDAAVRQESRKLWQYLASISACILVVGVGTALAWTSPVLPQLYAADSW--LVITKEQ  62
            G +   +    S+K  QY+A+++A       GT L WTSP   ++          + K+Q
Sbjct  67   GNMVHTSTSNNSQKWPQYVAALAAAGGAFAAGTVLGWTSPAETEIVDRGEGYDFPVDKDQ  126

Query  63   GSWISSLLALGAIAGALGSGSMADKMGRKKSLLLLSVPFLLSWGIILVATEVKLLYIARF  122
             SW+ S + LGA    +  G + + +GRK ++L L +PF+L W +++ A  V +LY +RF
Sbjct  127  FSWVGSAMTLGAACVCIPIGFLINMIGRKWTMLFLVLPFILGWTMLIWAVNVSMLYASRF  186

Query  123  LVGIGVGAGCVLGPTYISEISEVSTRGTLGALFQLFLTVGIFVAFILGSVLNYTMLALVC  182
            ++GI  GA CV  P Y  EI++   RGTLG+ FQL +T+GI   + +G+ +    L+++C
Sbjct  187  ILGIAGGAFCVTAPMYTGEIAQKEIRGTLGSFFQLMITIGILFVYAVGAGVKIFWLSIIC  246

Query  183  ALIVVFFLTTFYWMPESPVWLVNQNRKQEAMSAMSVLRGEDYDPKQELNEMQKEAEASAG  242
             ++ + F   F++MPESP +LV+++R + A+ ++  LRG++YD + EL E+++    +  
Sbjct  247  GILPLIFGAIFFFMPESPTYLVSKDRSENAIKSIQWLRGKEYDYEPELAELRETDRETKA  306

Query  243  KKPSLSDMAKDPVNKKAMIASFGMMFFQQASGVNAVIFYTVMIFEASGSSMAPELASILV  302
             K ++      PV +KA+  S G+MFFQQ  G+NAVIFY   IF  + + +  E A+IL+
Sbjct  307  NKVNVWAALNRPVTRKALAISMGLMFFQQVCGINAVIFYASRIFLEANTGIEAEWATILI  366

Query  303  ALVQLVMSGVAALIVDRAGRKPLLMISTSIMSVSLIALG-YYFQQKDDGNDVSSLGWLPL  361
             ++Q+V + V+ L+VD+ GR+ LL+ S   M++S  A+G Y+F QK D   V SLGWLP+
Sbjct  367  GIMQVVATFVSTLVVDKLGRRILLLASGISMAISTTAIGVYFFLQKQDAAQVVSLGWLPV  426

Query  362  ASLIVFMVAFSIGLGPVPWMLMGELFAAETKAVASSVAVMLNWLLVFIVTKTFPMMNKEL  421
            ASL +F++ FSIG GPVPW++MGELFA + K  A S+A   NWLL F+VTKTF  +N  L
Sbjct  427  ASLCLFIIMFSIGYGPVPWLMMGELFATDIKGFAGSLAGTSNWLLAFVVTKTFVNLNDGL  486

Query  422  GTDMTFWIFAVVMACATAFTHVLVPETKGKTYQQIHDELQGGPTVDKSVQQMK  474
            G   TFW+FA +      F +  VPETKGK+  +I  EL G  +  +++   K
Sbjct  487  GIGGTFWLFAGLTVVGVIFVYFAVPETKGKSLNEIQQELAGNRSTPQAIPAEK  539


>TRE12_DROME unnamed protein product
Length=488

 Score = 312 bits (800),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 166/442 (38%), Positives = 261/442 (59%), Gaps = 8/442 (2%)

Query  25   SISACILVVGVGTALAWTSPVLPQLYAAD-SWLVITKEQGSWISSLLALGAIAGALGSGS  83
            S+S C LVVG  +A  +TSP L  +     +   +TK+ GSW+  ++ L A+AG +  G 
Sbjct  34   SVSLCSLVVGFVSA--YTSPALVSMTDRTITSFEVTKDAGSWVGGIMPLAALAGGITGGP  91

Query  84   MADKMGRKKSLLLLSVPFLLSWGIILVATEVKLLYIARFLVGIGVGAGCVLGPTYISEIS  143
            + + +GR+ ++L  +VPF++S  +I  A  V ++   RFL G  VG   +  P Y+ E  
Sbjct  92   LIEYLGRRSTILATAVPFIVSSLLIACAVNVIMILCGRFLTGFCVGIASLSLPVYLGETL  151

Query  144  EVSTRGTLGALFQLFLTVGIFVAFILGSVLNYTMLALVCALIVVFFLTTFYWMPESPVWL  203
            +   RGTLG L      +GI V ++ GS +N++MLA + A + V FL     +PE+P W 
Sbjct  152  QPEVRGTLGLLPTALGNIGILVCYVAGSFMNWSMLAFLGAALPVPFLILMIIIPETPRWF  211

Query  204  VNQNRKQEAMSAMSVLRGEDYDPKQELNEM---QKEAEASAGKKPSLSDMAKDPVNKKAM  260
            VN+ +++ A  A+  LRG++ D + EL E+   Q +A+  A +   L    ++  N K +
Sbjct  212  VNRGQEERARKALKWLRGKEADVEPELKELMQSQADADRQATQNTCLELFKRN--NLKPL  269

Query  261  IASFGMMFFQQASGVNAVIFYTVMIFEASGSSMAPELASILVALVQLVMSGVAALIVDRA  320
              S G+MFFQQ SG+NAVIFYTV IF+ +GS++   L++I+V +V    + +  +++DR 
Sbjct  270  SISLGLMFFQQFSGINAVIFYTVQIFKDAGSTIDSNLSTIIVGVVNFFATFMGIILIDRL  329

Query  321  GRKPLLMISTSIMSVSLIALGYYFQQKDDGNDVSSLGWLPLASLIVFMVAFSIGLGPVPW  380
            GRK LL +S   M V+L  LG +F  K  G DVS LGWLPL   +++++ FS+G GP+PW
Sbjct  330  GRKILLYVSDIAMIVTLSILGGFFYCKAHGPDVSHLGWLPLTCFVIYILGFSLGFGPIPW  389

Query  381  MLMGELFAAETKAVASSVAVMLNWLLVFIVTKTFPMMNKELGTDMTFWIFAVVMACATAF  440
            ++MGE+  A+ +  A+SV    NW   F+VTKTF  +   +G    FW+F  +      F
Sbjct  390  LMMGEILPAKIRGPAASVVTAFNWFCTFVVTKTFQDLTVAMGAHGAFWLFGAICIVGLFF  449

Query  441  THVLVPETKGKTYQQIHDELQG  462
              + VPET+GK+ ++I  ++ G
Sbjct  450  VIIFVPETRGKSLEEIERKMMG  471


>TRET1_ANOGA unnamed protein product
Length=793

 Score = 314 bits (805),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 174/464 (38%), Positives = 278/464 (60%), Gaps = 13/464 (3%)

Query  19   LW-QYLASISACILVVGVGTALAWTSPVLPQLYAAD-SWLVITKEQGSWISSLLALGAIA  76
            +W Q LA++S  +  + VG + A+TSP L  +   + +   +T + GSW+  ++ L  +A
Sbjct  329  IWTQVLAALSVSLGSMVVGFSSAYTSPALVSMKDRNITSFEVTDQSGSWVGGIMPLAGLA  388

Query  77   GALGSGSMADKMGRKKSLLLLSVPFLLSWGIILVATEVKLLYIARFLVGIGVGAGCVLGP  136
            G +  G M + +GRK ++L  + PF++SW +I  AT V ++ + R L G+ VG   +  P
Sbjct  389  GGILGGPMIEYLGRKNTILATATPFIISWLLIGCATHVAMVLVGRALSGLCVGIASLSLP  448

Query  137  TYISEISEVSTRGTLGALFQLFLTVGIFVAFILGSVLNYTMLALVCALIVVFFLTTFYWM  196
             Y+ E  +   RGTLG L   F  +GI + F+ G  L+++ LA + A + + FL   + +
Sbjct  449  VYLGETVQPEVRGTLGLLPTAFGNIGILLCFVAGKYLDWSGLAFLGAALPIPFLLLMFLI  508

Query  197  PESPVWLVNQNRKQEAMSAMSVLRGEDYDPKQELNEMQK---EAEASAGKKPSLSDMAKD  253
            PE+P W V++NR+  A  A+  LRG   D + EL  + K   +AE  A     L  + K 
Sbjct  509  PETPRWYVSRNREDRARKALQWLRGRKADVEPELKGISKSHQDAERHASSSAMLDLLNK-  567

Query  254  PVNKKAMIASFGMMFFQQASGVNAVIFYTVMIFEASGSSMAPELASILVALVQLVMSGVA  313
              N K ++ S G+MFFQQ SG+NAVIFYTV IF+++GS++  +L +I+V +V  + + +A
Sbjct  568  -ANLKPLLISLGLMFFQQLSGINAVIFYTVQIFQSAGSTIDEKLCTIIVGVVNFIATFIA  626

Query  314  ALIVDRAGRKPLLMISTSIMSVSLIALGYYFQQKDDGNDVSSLGWLPLASLIVFMVAFSI  373
             +++DR GRK LL IS   M ++L+ LG +F  K++G+DVS +GWLPLA+ +VF+V FS+
Sbjct  627  TVLIDRLGRKILLYISDVAMIITLMTLGTFFYMKNNGDDVSEIGWLPLAAFVVFVVGFSL  686

Query  374  GLGPVPWMLMGELFAAETKAVASSVAVMLNWLLVFIVTKTFPMMNKELGTDMTFWIFAVV  433
            G GP+PW++MGE+   + +  A+SVA   NW   F+VTKTF  +   +G    FW+F  +
Sbjct  687  GFGPIPWLMMGEILPGKIRGSAASVATAFNWSCTFVVTKTFADITASIGNHGAFWMFGSI  746

Query  434  MACATAFTHVLVPETKGKTYQQIHDELQGGPTVDKSVQQMKAIA  477
                  F  V VPET+GK+ + I  ++ G       V++M ++A
Sbjct  747  CIVGLLFVIVYVPETQGKSLEDIERKMMG------RVRRMSSVA  784


>TRET1_BOMMO unnamed protein product
Length=505

 Score = 299 bits (766),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 167/461 (36%), Positives = 272/461 (59%), Gaps = 16/461 (3%)

Query  19   LW-QYLASISACILVVGVGTALAWTSPVLPQLYAADSWLVITKEQGSWISSLLALGAIAG  77
            LW Q LA+ +  +  + VG +  +TSP +  +   +  L ITKE+ +W+  L+ L A+ G
Sbjct  48   LWTQLLAAFAVSVGSMNVGFSSGYTSPAVLTM---NITLDITKEEITWVGGLMPLAALVG  104

Query  78   ALGSGSMADKMGRKKSLLLLSVPFLLSWGIILVATEVKLLYIARFLVGIGVGAGCVLGPT  137
             +  G + + +GRKK+++  +VPF + W +I  A  V +++  R + G+ VG   +  P 
Sbjct  105  GIVGGPLIEYLGRKKTIMGTAVPFTIGWMLIANAINVVMVFAGRVICGVCVGIVSLAFPV  164

Query  138  YISEISEVSTRGTLGALFQLFLTVGIFVAFILGSVLNYTMLALVCALIVVFFLTTFYWMP  197
            YI E  +   RG LG L   F   GI +AF++GS L+++ LA   A I V F       P
Sbjct  165  YIGETIQPEVRGALGLLPTAFGNTGILLAFLVGSYLDWSNLAFFGAAIPVPFFLLMILTP  224

Query  198  ESPVWLVNQNRKQEAMSAMSVLRGEDYDPKQELNEM---QKEAEASAGKKPSLSDMAKDP  254
            E+P W V++ R QEA  ++  LRG++ + ++E+ ++   Q E++ + G      +  K  
Sbjct  225  ETPRWYVSKARVQEARKSLRWLRGKNVNIEKEMRDLTISQTESDRTGG------NAFKQL  278

Query  255  VNKK---AMIASFGMMFFQQASGVNAVIFYTVMIFEASGSSMAPELASILVALVQLVMSG  311
             +K+   A++ S G+M FQQ +G+NAVIFY   IF+ SGSS+   LASI++ +V  + + 
Sbjct  279  FSKRYLPAVMISLGLMLFQQLTGINAVIFYAASIFQMSGSSVDENLASIIIGVVNFISTF  338

Query  312  VAALIVDRAGRKPLLMISTSIMSVSLIALGYYFQQKDDGNDVSSLGWLPLASLIVFMVAF  371
            +A +++DR GRK LL IS+  M  +L+ALG YF  K +  DV++ GWLPLA L+++++ F
Sbjct  339  IATMLIDRLGRKVLLYISSVAMITTLLALGAYFYLKQNHIDVTAYGWLPLACLVIYVLGF  398

Query  372  SIGLGPVPWMLMGELFAAETKAVASSVAVMLNWLLVFIVTKTFPMMNKELGTDMTFWIFA  431
            SIG GP+PW+++GE+  ++ +  A+S+A   NW   FIVTKTF  +   +    T W+FA
Sbjct  399  SIGFGPIPWLMLGEILPSKIRGTAASLATGFNWTCTFIVTKTFQNIIDAIYMHGTLWLFA  458

Query  432  VVMACATAFTHVLVPETKGKTYQQIHDELQGGPTVDKSVQQ  472
            V+      F    VPETKGK+ ++I  +L  G    +++ +
Sbjct  459  VICIGGLLFVIFFVPETKGKSLEEIEMKLTSGSRRVRNISK  499



Lambda      K        H
   0.323    0.145    0.461 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 845836338


Query= XP_003392902.2 lateral signaling target protein 2 homolog [Bombus
terrestris]

Length=499
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7KS77_DROME  unnamed protein product                                 204     1e-59
Q9VDA1_DROME  unnamed protein product                                 202     6e-59
Q9VDA2_DROME  unnamed protein product                                 188     7e-55
P91626_DROME  unnamed protein product                                 188     9e-55
Q7JMT6_DROME  unnamed protein product                                 165     5e-49


>Q7KS77_DROME unnamed protein product
Length=479

 Score = 204 bits (518),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 124/164 (76%), Gaps = 15/164 (9%)

Query  336  KTSQQHGSQSGHHGK---RTTGQG-----SPLDALFQMTSKTFDAGEHSQEQANHLNLFN  387
            K + Q GS+     K   + TG G     +PLDALFQMT+K FD    SQ+++ HL++F+
Sbjct  290  KLTTQEGSEEAQKKKSEEQPTGSGKSNGDTPLDALFQMTTKDFD---ESQDKS-HLDIFS  345

Query  388  NRQQPKKKRKSRTAFTNQQIFELEKRFLYQKYLSPADRDEIATQLGLSNAQVITWFQNRR  447
            NR QPKKKRKSRTAFTN QIFELEKRFLYQKYLSPADRDEIA  LGLSNAQVITWFQNRR
Sbjct  346  NRPQPKKKRKSRTAFTNHQIFELEKRFLYQKYLSPADRDEIAASLGLSNAQVITWFQNRR  405

Query  448  AKLKRDMEELKKDVQTVNPLLVAQHHKTFLENVQDLGILKKRPL  491
            AK KRD+EELKKD  +V    V   HK+FLENV DL ILKK+P+
Sbjct  406  AKQKRDIEELKKDFDSVK---VFSAHKSFLENVNDLSILKKKPM  446


 Score = 35.4 bits (80),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 32/68 (47%), Gaps = 22/68 (32%)

Query  157  SAAG-AADDYFKPLKRLKMVQMQHSDEEDDRD-----------RDTNE------RGVKSF  198
            SA G   +DYF PLKRL+M     S   + RD             TN+       GVKSF
Sbjct  79   SAVGNLPEDYFHPLKRLRM----SSSSSEPRDHTPSPPSAVPEPQTNQTTKSAIEGVKSF  134

Query  199  SILDILSH  206
            SI DIL H
Sbjct  135  SIADILGH  142


>Q9VDA1_DROME unnamed protein product
Length=479

 Score = 202 bits (513),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 107/164 (65%), Positives = 124/164 (76%), Gaps = 15/164 (9%)

Query  336  KTSQQHGSQSGHHGK---RTTGQG-----SPLDALFQMTSKTFDAGEHSQEQANHLNLFN  387
            K + Q GS+     K   + TG G     +PLDALFQMT+K FD    SQ+++ HL++F+
Sbjct  290  KLTTQEGSEEAQKKKSEEQPTGSGKSNGDTPLDALFQMTTKDFD---ESQDKS-HLDIFS  345

Query  388  NRQQPKKKRKSRTAFTNQQIFELEKRFLYQKYLSPADRDEIATQLGLSNAQVITWFQNRR  447
            +R QPKKKRKSRTAFTN QIFELEKRFLYQKYLSPADRDEIA  LGLSNAQVITWFQNRR
Sbjct  346  DRPQPKKKRKSRTAFTNHQIFELEKRFLYQKYLSPADRDEIAASLGLSNAQVITWFQNRR  405

Query  448  AKLKRDMEELKKDVQTVNPLLVAQHHKTFLENVQDLGILKKRPL  491
            AK KRD+EELKKD  +V    V   HK+FLENV DL ILKK+P+
Sbjct  406  AKQKRDIEELKKDFDSVK---VFSAHKSFLENVNDLSILKKKPM  446


 Score = 36.2 bits (82),  Expect = 0.053, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 30/64 (47%), Gaps = 14/64 (22%)

Query  157  SAAG-AADDYFKPLKRLKMVQMQHSDEE-------------DDRDRDTNERGVKSFSILD  202
            SA G  A+DYF PLKRL+M        E              ++   +   GVKSFSI D
Sbjct  79   SAVGNLAEDYFHPLKRLRMSSSSSEPREHTASPPSAVPEPQTNQTTKSAIEGVKSFSIAD  138

Query  203  ILSH  206
            IL H
Sbjct  139  ILGH  142


>Q9VDA2_DROME unnamed protein product
Length=372

 Score = 188 bits (477),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 109/143 (76%), Gaps = 8/143 (6%)

Query  349  GKRTTGQGSPLDALFQMTSKTFDAGEHSQEQANHLNLFNNRQQPKKKRKSRTAFTNQQIF  408
            G   +   +PLDALFQ+++K FD     Q+ A  LN+F  R  PKKKRKSRTAFTNQQIF
Sbjct  209  GASKSSGDTPLDALFQLSTKNFD---EEQDPAT-LNIFATRSNPKKKRKSRTAFTNQQIF  264

Query  409  ELEKRFLYQKYLSPADRDEIATQLGLSNAQVITWFQNRRAKLKRDMEELKKDVQTVNPLL  468
            ELEKRFLYQKYLSPADRDEIA  LGLSNAQVITWFQNRRAKLKRDMEELKKDVQ      
Sbjct  265  ELEKRFLYQKYLSPADRDEIAGGLGLSNAQVITWFQNRRAKLKRDMEELKKDVQCEK---  321

Query  469  VAQHHKTFLENVQDLGILKKRPL  491
                +++FL+NV DL ILK RP+
Sbjct  322  -MSANQSFLKNVNDLTILKTRPV  343


>P91626_DROME unnamed protein product
Length=372

 Score = 188 bits (477),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 109/143 (76%), Gaps = 8/143 (6%)

Query  349  GKRTTGQGSPLDALFQMTSKTFDAGEHSQEQANHLNLFNNRQQPKKKRKSRTAFTNQQIF  408
            G   +   +PLDALFQ+++K FD     Q+ A  LN+F  R  PKKKRKSRTAFTNQQIF
Sbjct  209  GASKSSGDTPLDALFQLSTKNFD---EEQDPAT-LNIFATRSNPKKKRKSRTAFTNQQIF  264

Query  409  ELEKRFLYQKYLSPADRDEIATQLGLSNAQVITWFQNRRAKLKRDMEELKKDVQTVNPLL  468
            ELEKRFLYQKYLSPADRDEIA  LGLSNAQVITWFQNRRAKLKRDMEELKKDVQ      
Sbjct  265  ELEKRFLYQKYLSPADRDEIAGGLGLSNAQVITWFQNRRAKLKRDMEELKKDVQCEK---  321

Query  469  VAQHHKTFLENVQDLGILKKRPL  491
                +++FL+NV DL ILK RP+
Sbjct  322  -MSANQSFLKNVNDLTILKTRPV  343


>Q7JMT6_DROME unnamed protein product
Length=132

 Score = 165 bits (417),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 86/101 (85%), Gaps = 3/101 (3%)

Query  391  QPKKKRKSRTAFTNQQIFELEKRFLYQKYLSPADRDEIATQLGLSNAQVITWFQNRRAKL  450
            QPKKKRKSRTAFTN QIFELEKRFLYQKYLSPADRDEIA  LGLSNAQVITWFQNRRAK 
Sbjct  2    QPKKKRKSRTAFTNHQIFELEKRFLYQKYLSPADRDEIAASLGLSNAQVITWFQNRRAKQ  61

Query  451  KRDMEELKKDVQTVNPLLVAQHHKTFLENVQDLGILKKRPL  491
            KRD+EELKKD  +V    V   HK+FLENV DL ILKK+P+
Sbjct  62   KRDIEELKKDFDSVK---VFSAHKSFLENVNDLSILKKKPM  99



Lambda      K        H
   0.323    0.145    0.461 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 845836338


Query= XP_003392903.1 homeobox protein mls-2 [Bombus terrestris]

Length=340
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

BAGP_DROME  unnamed protein product                                   127     3e-33
A8Y527_DROME  unnamed protein product                                 90.5    2e-20
Q7PL95_DROME  unnamed protein product                                 91.7    3e-20
Q9NCG1_DROME  unnamed protein product                                 90.5    4e-20
VND_DROME  unnamed protein product                                    88.6    5e-19


>BAGP_DROME unnamed protein product
Length=382

 Score = 127 bits (318),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 76/88 (86%), Gaps = 3/88 (3%)

Query  179  SRKKRSRAAFSHAQVYELERRFAAQKYLSGPERADLARGLKLTETQVKIWFQNRRYKTKR  238
            SRKKRSRAAFSHAQV+ELERRFA Q+YLSGPER+++A+ L+LTETQVKIWFQNRRYKTKR
Sbjct  173  SRKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNRRYKTKR  232

Query  239  RQ-QQELGALVNSGNARRVAVRVLVHPD  265
            +Q QQ   AL+  G ++RV V+VLV  D
Sbjct  233  KQIQQHEAALL--GASKRVPVQVLVRED  258


>A8Y527_DROME unnamed protein product
Length=307

 Score = 90.5 bits (223),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 60/91 (66%), Gaps = 6/91 (7%)

Query  177  LQSRKKRSRAAFSHAQVYELERRFAAQKYLSGPERADLARGLKLTETQVKIWFQNRRYKT  236
            L  R+KR R  F+ AQVYELERRF  Q+YLS PER  LA  + LT TQVKIWFQN RYK 
Sbjct  89   LAQRRKR-RVLFTQAQVYELERRFKQQRYLSAPEREHLASLIHLTPTQVKIWFQNHRYKC  147

Query  237  KRRQQQELGALVNSGN-----ARRVAVRVLV  262
            KR+ +++  A  N  N      RRVAV VLV
Sbjct  148  KRQAKEKAMAEQNQHNQPASSPRRVAVPVLV  178


>Q7PL95_DROME unnamed protein product
Length=468

 Score = 91.7 bits (226),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 60/91 (66%), Gaps = 6/91 (7%)

Query  177  LQSRKKRSRAAFSHAQVYELERRFAAQKYLSGPERADLARGLKLTETQVKIWFQNRRYKT  236
            L  R+KR R  F+ AQVYELERRF  Q+YLS PER  LA  + LT TQVKIWFQN RYK 
Sbjct  250  LAQRRKR-RVLFTQAQVYELERRFKQQRYLSAPEREHLASLIHLTPTQVKIWFQNHRYKC  308

Query  237  KRRQQQELGALVNSGNA-----RRVAVRVLV  262
            KR+ +++  A  N  N      RRVAV VLV
Sbjct  309  KRQAKEKAMAEQNQHNQPASSPRRVAVPVLV  339


>Q9NCG1_DROME unnamed protein product
Length=380

 Score = 90.5 bits (223),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 60/91 (66%), Gaps = 6/91 (7%)

Query  177  LQSRKKRSRAAFSHAQVYELERRFAAQKYLSGPERADLARGLKLTETQVKIWFQNRRYKT  236
            L  R+KR R  F+ AQVYELERRF  Q+YLS PER  LA  + LT TQVKIWFQN RYK 
Sbjct  162  LAQRRKR-RVLFTQAQVYELERRFKQQRYLSAPEREHLASLIHLTPTQVKIWFQNHRYKC  220

Query  237  KRRQQQELGALVNSGNA-----RRVAVRVLV  262
            KR+ +++  A  N  N      RRVAV VLV
Sbjct  221  KRQAKRKAMAEQNQHNQPASSPRRVAVPVLV  251


>VND_DROME unnamed protein product
Length=723

 Score = 88.6 bits (218),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 62/107 (58%), Gaps = 17/107 (16%)

Query  172  NHGQNLQSRKKRSRAAFSHAQVYELERRFAAQKYLSGPERADLARGLKLTETQVKIWFQN  231
            N    L ++K++ R  F+ AQ YELERRF  Q+YLS PER  LA  ++LT TQVKIWFQN
Sbjct  536  NGSDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQN  595

Query  232  RRYKTKRRQQQELGALVNSG----------------NARRVAVRVLV  262
             RYKTK R Q E G   + G                + RRVAV VLV
Sbjct  596  HRYKTK-RAQNEKGYEGHPGLLHGHATHPHHPSALPSPRRVAVPVLV  641



Lambda      K        H
   0.323    0.145    0.461 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 845836338


Query= XP_003392904.1 homeobox protein Nkx-2.5-like [Bombus terrestris]

Length=384
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A8Y527_DROME  unnamed protein product                                 115     2e-29
Q7PL95_DROME  unnamed protein product                                 116     2e-28
Q9NCG1_DROME  unnamed protein product                                 113     5e-28
VND_DROME  unnamed protein product                                    108     2e-25
TIN_DROME  unnamed protein product                                    103     3e-24


>A8Y527_DROME unnamed protein product
Length=307

 Score = 115 bits (289),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 70/94 (74%), Gaps = 5/94 (5%)

Query  119  KRKPRVLFSQNQVYELEQRFKQQRYLSAPERELLAQTLKLTSTQVKIWFQNRRYKNKRAR  178
            +RK RVLF+Q QVYELE+RFKQQRYLSAPERE LA  + LT TQVKIWFQN RYK KR  
Sbjct  92   RRKRRVLFTQAQVYELERRFKQQRYLSAPEREHLASLIHLTPTQVKIWFQNHRYKCKRQA  151

Query  179  LEDAEKLQAQNAKNQ---SLKKIHVPVLIRDGKP  209
             E A  +  QN  NQ   S +++ VPVL++DGKP
Sbjct  152  KEKA--MAEQNQHNQPASSPRRVAVPVLVKDGKP  183


>Q7PL95_DROME unnamed protein product
Length=468

 Score = 116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 70/94 (74%), Gaps = 5/94 (5%)

Query  119  KRKPRVLFSQNQVYELEQRFKQQRYLSAPERELLAQTLKLTSTQVKIWFQNRRYKNKRAR  178
            +RK RVLF+Q QVYELE+RFKQQRYLSAPERE LA  + LT TQVKIWFQN RYK KR  
Sbjct  253  RRKRRVLFTQAQVYELERRFKQQRYLSAPEREHLASLIHLTPTQVKIWFQNHRYKCKRQA  312

Query  179  LEDAEKLQAQNAKNQ---SLKKIHVPVLIRDGKP  209
             E A  +  QN  NQ   S +++ VPVL++DGKP
Sbjct  313  KEKA--MAEQNQHNQPASSPRRVAVPVLVKDGKP  344


>Q9NCG1_DROME unnamed protein product
Length=380

 Score = 113 bits (283),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 69/94 (73%), Gaps = 5/94 (5%)

Query  119  KRKPRVLFSQNQVYELEQRFKQQRYLSAPERELLAQTLKLTSTQVKIWFQNRRYKNKRAR  178
            +RK RVLF+Q QVYELE+RFKQQRYLSAPERE LA  + LT TQVKIWFQN RYK KR  
Sbjct  165  RRKRRVLFTQAQVYELERRFKQQRYLSAPEREHLASLIHLTPTQVKIWFQNHRYKCKRQA  224

Query  179  LEDAEKLQAQNAKNQ---SLKKIHVPVLIRDGKP  209
               A  +  QN  NQ   S +++ VPVL++DGKP
Sbjct  225  KRKA--MAEQNQHNQPASSPRRVAVPVLVKDGKP  256


>VND_DROME unnamed protein product
Length=723

 Score = 108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 73/107 (68%), Gaps = 11/107 (10%)

Query  119  KRKPRVLFSQNQVYELEQRFKQQRYLSAPERELLAQTLKLTSTQVKIWFQNRRYKNKRAR  178
            KRK RVLF++ Q YELE+RF+QQRYLSAPERE LA  ++LT TQVKIWFQN RYK KRA+
Sbjct  545  KRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQ  604

Query  179  ----LEDAEKLQAQNAKN-------QSLKKIHVPVLIRDGKPNIQES  214
                 E    L   +A +        S +++ VPVL+R+GKP + +S
Sbjct  605  NEKGYEGHPGLLHGHATHPHHPSALPSPRRVAVPVLVRNGKPCLGDS  651


>TIN_DROME unnamed protein product
Length=416

 Score = 103 bits (257),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 76/113 (67%), Gaps = 18/113 (16%)

Query  97   EDGNVVTSSKTELRK----------SQSGK---RTKRKPRVLFSQNQVYELEQRFKQQRY  143
            +D + VTSS++ELRK          S SG    R KRKPRVLFSQ QV ELE RF+ ++Y
Sbjct  266  KDNSQVTSSRSELRKNSISGNSNPGSNSGSTKPRMKRKPRVLFSQAQVLELECRFRLKKY  325

Query  144  LSAPERELLAQTLKLTSTQVKIWFQNRRYKNKRARLEDAEKLQAQNAKNQSLK  196
            L+  ERE++AQ L L++TQVKIWFQNRRYK+KR  + D E +    AK+  LK
Sbjct  326  LTGAEREIIAQKLNLSATQVKIWFQNRRYKSKRGDI-DCEGI----AKHLKLK  373



Lambda      K        H
   0.323    0.145    0.461 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 845836338


Query= XP_003392925.1 WD repeat-containing protein 7 isoform X11 [Bombus
terrestris]

Length=1505
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9W543_DROME  unnamed protein product                                 1899    0.0   
Q2XXU2_DROME  unnamed protein product                                 1866    0.0   
O46092_DROME  unnamed protein product                                 1805    0.0   
Q960M9_DROME  unnamed protein product                                 505     5e-167
EBI_DROME  unnamed protein product                                    52.0    4e-06 


>Q9W543_DROME unnamed protein product
Length=1525

 Score = 1899 bits (4918),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 954/1557 (61%), Positives = 1160/1557 (75%), Gaps = 89/1557 (6%)

Query  4     GTSLVVPIVLWGRIAPTHCVSCIYLSRDQKTLVTGCYDGQICLWQVDPETLKMSPRCLLV  63
              T+LVVP+VLWG  APTHC+S ++LS DQ TLVTGCYDGQICLWQV+P TLKMSPRCLLV
Sbjct  3     STNLVVPVVLWGPTAPTHCISSVFLSDDQFTLVTGCYDGQICLWQVEPTTLKMSPRCLLV  62

Query  64    GHTAPIMCLSRASVIMEQNYIVSSSESGEMCTWDLVDGKCREAVKLTSVHTQMLPYVSAG  123
             GH+AP++CL RAS++ E N++VSSSE+GEMCTWDL DGKC EAVKL  VHTQ+  Y +A 
Sbjct  63    GHSAPVLCLVRASLLPENNFLVSSSENGEMCTWDLTDGKCMEAVKLPQVHTQIQSYHTAN  122

Query  124   GEDVRLFCSGYYPEVLVMDPFSLEVLFTLSSRVNPDWISALHVLRPAKRKGRFYVHTNDV  183
              EDVRLFC GYY E++VMDPFSLEV++ LSS+V PDWISA+HVLRP +RK       +DV
Sbjct  123   SEDVRLFCIGYYAEIMVMDPFSLEVIYVLSSKVKPDWISAIHVLRPMRRK-------DDV  175

Query  184   VLALTTTGTVKVWTLLGHENRNSEPLYEHESKQIRCLNALAMTCCPYNQRTVLIVCSKHW  243
             VLA+TTTGTVKVWTL G+EN+++EP+YE+ESK+IRCLNA+ M CC  NQRTVL+VC+K+W
Sbjct  176   VLAITTTGTVKVWTLTGNENKHAEPIYENESKEIRCLNAITMNCCAQNQRTVLLVCTKYW  235

Query  244   QIYDAGDFSLLCSITAPCGERWMAGDFLSADRVILWSDEGCGYLYKLPANSVADNKNFHT  303
             QIYDAGDF++LCS+ AP  ERW  GDF+++DRV+LW+DEG GYLYKLPAN + DNK FH+
Sbjct  236   QIYDAGDFTVLCSVIAPARERWQGGDFITSDRVMLWTDEGKGYLYKLPANCIPDNKEFHS  295

Query  304   AGVEYDQPYLYCTLTQPGVKPLSCPPAMRLVTVQKQSKTLKYLLRGDSGGVV-LWTVPEV  362
               V  D PYLY  L   G K LSCPPAM+L+   + +     LLRGDS G + +W VPEV
Sbjct  296   KSVVRDAPYLYYVLQHAGDKVLSCPPAMKLL---QGAGGQHNLLRGDSEGYISVWNVPEV  352

Query  363   TTQQLAQICQNDRSTPLSLPPAVKTSITTAWEEMKPSPVGILDQLDSGDGHGIKLTASIY  422
                 ++ I Q  +  P  L P V TS+  AW  M P PVGILDQL       +KLT+SIY
Sbjct  353   PLDNIS-ILQAKQMPPRPLKPHVCTSLVEAWSIMDPPPVGILDQLSRITESPVKLTSSIY  411

Query  423   LPQQSRLVVGREDGSIIIVPATQTVMLQLLHGNHQQYDDWPPHQVLLGHSGRVNCLLYPH  482
             LPQQSRLV+GREDGSI+IVPATQTVM+QLL G  Q + DWP HQ+L GH GRVNCLL P 
Sbjct  412   LPQQSRLVIGREDGSIVIVPATQTVMMQLLVGIKQNFSDWPSHQILYGHRGRVNCLLCPS  471

Query  483   GAAPRYDRTHLVSGSVDFAVCLWDLYAGTLIHRFCVHAGEITQLMVPPDNCSPRIQKCVC  542
                 RY+++HL+SG +DFAVCLWDLY+G+L+HRFCVHAGEITQL+VPP++CSPRI KC+C
Sbjct  472   MIHSRYEKSHLLSGGIDFAVCLWDLYSGSLLHRFCVHAGEITQLLVPPESCSPRILKCIC  531

Query  543   SVASDHSVTLLSLAERKCVVLASRHLFPVVTIKWRPLDDFMIVGCSDGAVYVWQMETGHL  602
             SVASDHSVTL+SL ERKCV LASRHLFPVVTIKWRPLDDF+IVGCSDG+VYVWQMETGHL
Sbjct  532   SVASDHSVTLVSLQERKCVTLASRHLFPVVTIKWRPLDDFLIVGCSDGSVYVWQMETGHL  591

Query  603   DRVLHGIIAEEVLYACDENT------IAASGGSATGGELGLANPAVHFFRGLRHRNLSAI  656
             DRVLHG++AEEVL ACDE               A+  E+G+ANPAVHFFRGL+ RN++AI
Sbjct  592   DRVLHGMLAEEVLSACDEQAEDGGSGGGGGSNGASASEMGMANPAVHFFRGLKSRNMNAI  651

Query  657   RHATQRGLHQLQQLHGGQGVDHGNQIKTKGTPLMIQGFRSNPKDPESHILFFDIEALIVQ  716
             RHATQRG+ QLQQL G    +    +K +  PL+IQG R+NPKD ESHILFFDIE LI +
Sbjct  652   RHATQRGITQLQQLQGHNQGNFDFLMKHRSNPLVIQGLRTNPKDAESHILFFDIEGLIFE  711

Query  717   LLNDEYGAMSPGSLEAQGLISASEYQKVAALTQSASPDAHKKIADFFGRVKDKAGDVERI  776
             L ++EY  M+P +LE+ G+     + +     +S   DA KKI DFF +VK+KA DVE+I
Sbjct  712   LHSEEYAQMTPATLESLGV-----HLQNPKDGKSMHLDASKKIGDFFNKVKNKAVDVEKI  766

Query  777   LKEKDRHGILAKMKEGAENVHTKIQAKVESV--GLKPSTLDGKGDNWNNNEIAKNNLKRN  834
             LK+KD+HG++ K KE  E V  K+QAKVES+   ++P            +E  ++   + 
Sbjct  767   LKDKDKHGLVQKFKEKTEIVEKKVQAKVESLQKAVEP------------HEEQQDLKSKI  814

Query  835   GAFSEPNATMEVAQLILSLLHAWGIDPDLDRVCEGKLGLLRPMVPVSFGVLSKGGYMSLL  894
              +  E    MEVAQL+LSLLH+WG+DP LD++CE +LGLLRP+VP+S+GVLSK GYMSLL
Sbjct  815   ASKMEVTHVMEVAQLLLSLLHSWGLDPHLDKMCETRLGLLRPIVPISYGVLSKAGYMSLL  874

Query  895   LPTWQ--MQLEP-IGEPTTQLEQRLPAELVRQERLTRAFTARAHWELSTTLTSNHLLAVV  951
             LPTWQ    + P I  P++  ++ LP EL R E LT  FT+R HWELSTTLT+NH+LA+V
Sbjct  875   LPTWQNNYAIPPGIQLPSSSKKRPLPEELQRLEHLTAVFTSRLHWELSTTLTTNHILALV  934

Query  952   ALANTLMSMNNATFVPEQERNRKMHRPGNRSTVNWNKAEEENEEIYTAQQAQIKQGWSLL  1011
             A++NTL+SM+ A+F+P+ E+++K+ R   R+    +  EEE EE+     +QIK  WSLL
Sbjct  935   AMSNTLLSMSAASFLPDSEKHKKLQRLAQRTDSTLSN-EEEREELMAHHISQIKHAWSLL  993

Query  1012  ATLHCVLLPDKIVSQGGVKTFKRPQVEMMARRWQHQCLEIREAAQALLLAELGRMGPKGR  1071
             AT HC LLPDKI +    K FKRPQVEMM +RWQH C+EIREAAQ +LL EL RMG KGR
Sbjct  994   ATHHCFLLPDKIEALEP-KKFKRPQVEMMVKRWQHHCIEIREAAQQILLGELTRMGKKGR  1052

Query  1072  KTLVDSWSQYLPMYSTQEPIAPQSQN---------------------------QSPPAPG  1104
             K LV+SW+QYLP+Y+  EPI    Q                                A  
Sbjct  1053  KQLVESWAQYLPLYTHTEPIVGAQQQLALISQPASGGAGSGSGGNGGVGVGVSGGGGAGS  1112

Query  1105  SPIPSSESHTEEEDEEEELAEAEINVARKPSSVAELKRKQTTAVVLLGVIGAEFGQDVTT  1164
                P       +  ++E+  E E  + RKPSS++ELKRKQTTAV+LLGVIGAEFGQD++ 
Sbjct  1113  GSGPGGSVPGGDAHQDEDYEEEEEEIIRKPSSLSELKRKQTTAVILLGVIGAEFGQDISQ  1172

Query  1165  TNQKRDNE----------------QRRKSSIVEGFGIGNNNLARHTSMALTHLLHAPHSP  1208
              +                      +RRKSS+VEGFGI NN LAR TSMAL HLL+AP SP
Sbjct  1173  ESPNHRGSISMATGANLTSGVAGGERRKSSVVEGFGIANN-LARLTSMALAHLLYAPPSP  1231

Query  1209  KLPLHTALRRAAIDLIGRGFTVWEPYLDVSKVLLGLLEMCCDADKLVPNMTYGLPLTPQA  1268
             KLP +T LRRAAIDL+GRGFTVWEPYLDVSKVLLGLLE+ C+  K VPN+ Y LPLTPQA
Sbjct  1232  KLPQYTPLRRAAIDLLGRGFTVWEPYLDVSKVLLGLLEISCEG-KAVPNLNYKLPLTPQA  1290

Query  1269  DTCRTARHALTLIATARPAAFITTMAREVARYNTLQQNAQTLNVNMGASVLVRAKPEILR  1328
             D CRTARHAL LIATARPAAFITTMAREVARYNT+QQNAQ++N  +  SVL +AK EIL+
Sbjct  1291  DACRTARHALRLIATARPAAFITTMAREVARYNTMQQNAQSINTPLTQSVLHKAKGEILQ  1350

Query  1329  IVEQLIDKMQSEMSDLLVEVMDIILHCLDPGHLKTKPLNDVFPAVCRFNQVSHCPATRRI  1388
              VE LIDKMQSE++ LLVEVMDI LHC+D   LK + L ++ PA+C+FNQ+SHC  TRRI
Sbjct  1351  CVEMLIDKMQSEIAGLLVEVMDIALHCVDGNELKNRGLAELCPAICKFNQISHCAQTRRI  1410

Query  1389  AVGSRNGQLALYELRGNVKCQTVPAHVASVTALAFSPEGKFLVSYSCTENKLCFWQQTSS  1448
             AVG+ +G LA+YELR N KCQ +PAH   +T+LAFSP+GK+LVSYSC EN+L FW QTS+
Sbjct  1411  AVGANSGNLAIYELRQN-KCQMIPAHTHPITSLAFSPDGKYLVSYSCAENRLSFW-QTST  1468

Query  1449  GMFGLGNSQTRCVKSYSTAPINDVARLNPMRLARLIWINNRTVTLMLADGSETRFNV  1505
             GMFGLG SQTRC K YSTAPI DV+RLNPMRLA+L+WINNRTVTLMLADGSETRFNV
Sbjct  1469  GMFGLGQSQTRCTKGYSTAPIPDVSRLNPMRLAKLVWINNRTVTLMLADGSETRFNV  1525


>Q2XXU2_DROME unnamed protein product
Length=1505

 Score = 1866 bits (4834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 938/1539 (61%), Positives = 1143/1539 (74%), Gaps = 89/1539 (6%)

Query  11    IVLWGRIAPTHCVSCIYLSRDQKTLVTGCYDGQICLWQVDPETLKMSPRCLLVGHTAPIM  70
             +VLWG  APTHC+S ++LS DQ TLVTGCYDGQICLWQV+P TLKMSPRCLLVGH+AP++
Sbjct  1     VVLWGPTAPTHCISSVFLSDDQFTLVTGCYDGQICLWQVEPTTLKMSPRCLLVGHSAPVL  60

Query  71    CLSRASVIMEQNYIVSSSESGEMCTWDLVDGKCREAVKLTSVHTQMLPYVSAGGEDVRLF  130
             CL RAS++ E N++VSSSE+GEMCTWDL DGKC EAVKL  VHTQ+  Y +A  EDVRLF
Sbjct  61    CLVRASLLPENNFLVSSSENGEMCTWDLTDGKCMEAVKLPQVHTQIQSYHTANSEDVRLF  120

Query  131   CSGYYPEVLVMDPFSLEVLFTLSSRVNPDWISALHVLRPAKRKGRFYVHTNDVVLALTTT  190
             C GYY E++VMDPFSLEV++ LSS+V PDWISA+HVLRP +RK       +DVVLA+TTT
Sbjct  121   CIGYYAEIMVMDPFSLEVIYVLSSKVKPDWISAIHVLRPMRRK-------DDVVLAITTT  173

Query  191   GTVKVWTLLGHENRNSEPLYEHESKQIRCLNALAMTCCPYNQRTVLIVCSKHWQIYDAGD  250
             GTVKVWTL G+EN+++EP+YE+ESK+IRCLNA+ M CC  NQRTVL+VC+K+WQIYDAGD
Sbjct  174   GTVKVWTLTGNENKHAEPIYENESKEIRCLNAITMNCCAQNQRTVLLVCTKYWQIYDAGD  233

Query  251   FSLLCSITAPCGERWMAGDFLSADRVILWSDEGCGYLYKLPANSVADNKNFHTAGVEYDQ  310
             F++LCS+ AP  ERW  GDF+++DRV+LW+DEG GYLYKLPAN + DNK FH+  V  D 
Sbjct  234   FTVLCSVIAPARERWQGGDFITSDRVMLWTDEGKGYLYKLPANCIPDNKEFHSKSVVRDA  293

Query  311   PYLYCTLTQPGVKPLSCPPAMRLVTVQKQSKTLKYLLRGDSGGVV-LWTVPEVTTQQLAQ  369
             PYLY  L   G K LSCPPAM+L+   + +     LLRGDS G + +W VPEV    ++ 
Sbjct  294   PYLYYVLQHAGDKVLSCPPAMKLL---QGAGGQHNLLRGDSEGYISVWNVPEVPLDNIS-  349

Query  370   ICQNDRSTPLSLPPAVKTSITTAWEEMKPSPVGILDQLDSGDGHGIKLTASIYLPQQSRL  429
             I Q  +  P  L P V TS+  AW  M P PVGILDQL       +KLT+SIYLPQQSRL
Sbjct  350   ILQAKQMPPRPLKPHVCTSLVEAWSIMDPPPVGILDQLSRITESPVKLTSSIYLPQQSRL  409

Query  430   VVGREDGSIIIVPATQTVMLQLLHGNHQQYDDWPPHQVLLGHSGRVNCLLYPHGAAPRYD  489
             V+GREDGSI+IVPATQTVM+QLL G  Q + DWP HQ+L GH GRVNCLL P     RY+
Sbjct  410   VIGREDGSIVIVPATQTVMMQLLVGIKQNFSDWPSHQILYGHRGRVNCLLCPSMIHSRYE  469

Query  490   RTHLVSGSVDFAVCLWDLYAGTLIHRFCVHAGEITQLMVPPDNCSPRIQKCVCSVASDHS  549
             ++HL+SG +DFAVCLWDLY+G+L+HRFCVHAGEITQL+VPP++CSPRI KC+CSVASDHS
Sbjct  470   KSHLLSGGIDFAVCLWDLYSGSLLHRFCVHAGEITQLLVPPESCSPRILKCICSVASDHS  529

Query  550   VTLLSLAERKCVVLASRHLFPVVTIKWRPLDDFMIVGCSDGAVYVWQMETGHLDRVLHGI  609
             VTL+SL ERKCV LASRHLFPVVTIKWRPLDDF+IVGCSDG+VYVWQMETGHLDRVLHG+
Sbjct  530   VTLVSLQERKCVTLASRHLFPVVTIKWRPLDDFLIVGCSDGSVYVWQMETGHLDRVLHGM  589

Query  610   IAEEVLYACDENT------IAASGGSATGGELGLANPAVHFFRGLRHRNLSAIRHATQRG  663
             +AEEVL ACDE               A+  E+G+ANPAVHFFRGL+ RN++AIRHATQRG
Sbjct  590   LAEEVLSACDEQAEDGGSGGGGGSNGASASEMGMANPAVHFFRGLKSRNMNAIRHATQRG  649

Query  664   LHQLQQLHGGQGVDHGNQIKTKGTPLMIQGFRSNPKDPESHILFFDIEALIVQLLNDEYG  723
             + QLQQL G    +    +K +  PL+IQG R+NPKD ESHILFFDIE LI +L ++EY 
Sbjct  650   ITQLQQLQGHNQGNFDFLMKHRSNPLVIQGLRTNPKDAESHILFFDIEGLIFELHSEEYA  709

Query  724   AMSPGSLEAQGLISASEYQKVAALTQSASPDAHKKIADFFGRVKDKAGDVERILKEKDRH  783
              M+P +LE+ G+     + +     +S   DA KKI DFF +VK+KA DVE+ILK+KD+H
Sbjct  710   QMTPATLESLGV-----HLQNPKDGKSMHLDASKKIGDFFNKVKNKAVDVEKILKDKDKH  764

Query  784   GILAKMKEGAENVHTKIQAKVESV--GLKPSTLDGKGDNWNNNEIAKNNLKRNGAFSEPN  841
             G++ K KE  E V  K+QAKVES+   ++P            +E  ++   +  +  E  
Sbjct  765   GLVQKFKEKTEIVEKKVQAKVESLQKAVEP------------HEEQQDLKSKIASKMEVT  812

Query  842   ATMEVAQLILSLLHAWGIDPDLDRVCEGKLGLLRPMVPVSFGVLSKGGYMSLLLPTWQ--  899
               MEVAQL+LSLLH+WG+DP LD++CE +LGLLRP+VP+S+GVLSK GYMSLLLPTWQ  
Sbjct  813   HVMEVAQLLLSLLHSWGLDPHLDKMCETRLGLLRPIVPISYGVLSKAGYMSLLLPTWQNN  872

Query  900   MQLEP-IGEPTTQLEQRLPAELVRQERLTRAFTARAHWELSTTLTSNHLLAVVALANTLM  958
               + P I  P++  ++ LP EL R E LT  FT+R HWELSTTLT+NH+LA+VA++NTL+
Sbjct  873   YAIPPGIQLPSSSKKRPLPEELQRLEHLTAVFTSRLHWELSTTLTTNHILALVAMSNTLL  932

Query  959   SMNNATFVPEQERNRKMHRPGNRSTVNWNKAEEENEEIYTAQQAQIKQGWSLLATLHCVL  1018
             SM+ A+F+P+ E+++K+ R   R+    +  EEE EE+     +QIK  WSLLAT HC L
Sbjct  933   SMSAASFLPDSEKHKKLQRLAQRTDSTLSN-EEEREELMAHHISQIKHAWSLLATHHCFL  991

Query  1019  LPDKIVSQGGVKTFKRPQVEMMARRWQHQCLEIREAAQALLLAELGRMGPKGRKTLVDSW  1078
             LPDKI +    K FKRPQVEMM +RWQH C+EIREAAQ +LL EL RMG KGRK LV+SW
Sbjct  992   LPDKIEALEP-KKFKRPQVEMMVKRWQHHCIEIREAAQQILLGELTRMGKKGRKQLVESW  1050

Query  1079  SQYLPMYSTQEPIAPQSQN---------------------------QSPPAPGSPIPSSE  1111
             +QYLP+Y+  EPI    Q                                A     P   
Sbjct  1051  AQYLPLYTHTEPIVGAQQQLALISQPASGGAGSGSGGNGGVGVGVSGGGGAGSGSGPGGS  1110

Query  1112  SHTEEEDEEEELAEAEINVARKPSSVAELKRKQTTAVVLLGVIGAEFGQDVTTTNQKRDN  1171
                 +  ++E+  E E  + RKPSS++ELKRKQTTAV+LLGVIGAEFGQD++  +     
Sbjct  1111  VPGGDAHQDEDYEEEEEEIIRKPSSLSELKRKQTTAVILLGVIGAEFGQDISQESPNHRG  1170

Query  1172  E----------------QRRKSSIVEGFGIGNNNLARHTSMALTHLLHAPHSPKLPLHTA  1215
                              +RRKSS+VEGFGI NN LAR TSMAL HLL+AP SPKLP +T 
Sbjct  1171  SISMATGANLTSGVAGGERRKSSVVEGFGIANN-LARLTSMALAHLLYAPPSPKLPQYTP  1229

Query  1216  LRRAAIDLIGRGFTVWEPYLDVSKVLLGLLEMCCDADKLVPNMTYGLPLTPQADTCRTAR  1275
             LRRAAIDL+GRGFTVWEPYLDVSKVLLGLLE+ C+  K VPN+ Y LPLTPQAD CRTAR
Sbjct  1230  LRRAAIDLLGRGFTVWEPYLDVSKVLLGLLEISCEG-KAVPNLNYKLPLTPQADACRTAR  1288

Query  1276  HALTLIATARPAAFITTMAREVARYNTLQQNAQTLNVNMGASVLVRAKPEILRIVEQLID  1335
             HAL LIATARPAAFITTMAREVARYNT+QQNAQ++N  +  SVL +AK EIL+ VE LID
Sbjct  1289  HALRLIATARPAAFITTMAREVARYNTMQQNAQSINTPLTQSVLHKAKGEILQCVEMLID  1348

Query  1336  KMQSEMSDLLVEVMDIILHCLDPGHLKTKPLNDVFPAVCRFNQVSHCPATRRIAVGSRNG  1395
             KMQSE++ LLVEVMDI LHC+D   LK + L ++ PA+C+FNQ+SHC  TRRIAVG+ +G
Sbjct  1349  KMQSEIAGLLVEVMDIALHCVDGNELKNRGLAELCPAICKFNQISHCAQTRRIAVGANSG  1408

Query  1396  QLALYELRGNVKCQTVPAHVASVTALAFSPEGKFLVSYSCTENKLCFWQQTSSGMFGLGN  1455
              LA+YELR N KCQ +PAH   +T+LAFSP+GK+LVSYSC EN+L FW QTS+GMFGLG 
Sbjct  1409  NLAIYELRQN-KCQMIPAHTHPITSLAFSPDGKYLVSYSCAENRLSFW-QTSTGMFGLGQ  1466

Query  1456  SQTRCVKSYSTAPINDVARLNPMRLARLIWINNRTVTLM  1494
             SQTRC K YSTAPI DV+RLNPMRLA+L+WINNRTVTLM
Sbjct  1467  SQTRCTKGYSTAPIPDVSRLNPMRLAKLVWINNRTVTLM  1505


>O46092_DROME unnamed protein product
Length=1471

 Score = 1805 bits (4675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 914/1505 (61%), Positives = 1117/1505 (74%), Gaps = 89/1505 (6%)

Query  56    MSPRCLLVGHTAPIMCLSRASVIMEQNYIVSSSESGEMCTWDLVDGKCREAVKLTSVHTQ  115
             MSPRCLLVGH+AP++CL RAS++ E N++VSSSE+GEMCTWDL DGKC EAVKL  VHTQ
Sbjct  1     MSPRCLLVGHSAPVLCLVRASLLPENNFLVSSSENGEMCTWDLTDGKCMEAVKLPQVHTQ  60

Query  116   MLPYVSAGGEDVRLFCSGYYPEVLVMDPFSLEVLFTLSSRVNPDWISALHVLRPAKRKGR  175
             +  Y +A  EDVRLFC GYY E++VMDPFSLEV++ LSS+V PDWISA+HVLRP +RK  
Sbjct  61    IQSYHTANSEDVRLFCIGYYAEIMVMDPFSLEVIYVLSSKVKPDWISAIHVLRPMRRK--  118

Query  176   FYVHTNDVVLALTTTGTVKVWTLLGHENRNSEPLYEHESKQIRCLNALAMTCCPYNQRTV  235
                  +DVVLA+TTTGTVKVWTL G+EN+++EP+YE+ESK+IRCLNA+ M CC  NQRTV
Sbjct  119   -----DDVVLAITTTGTVKVWTLTGNENKHAEPIYENESKEIRCLNAITMNCCAQNQRTV  173

Query  236   LIVCSKHWQIYDAGDFSLLCSITAPCGERWMAGDFLSADRVILWSDEGCGYLYKLPANSV  295
             L+VC+K+WQIYDAGDF++LCS+ AP  ERW  GDF+++DRV+LW+DEG GYLYKLPAN +
Sbjct  174   LLVCTKYWQIYDAGDFTVLCSVIAPARERWQGGDFITSDRVMLWTDEGKGYLYKLPANCI  233

Query  296   ADNKNFHTAGVEYDQPYLYCTLTQPGVKPLSCPPAMRLVTVQKQSKTLKYLLRGDSGGVV  355
              DNK FH+  V  D PYLY  L   G K LSCPPAM+L+   + +     LLRGDS G +
Sbjct  234   PDNKEFHSKSVVRDAPYLYYVLQHAGDKVLSCPPAMKLL---QGAGGQHNLLRGDSEGYI  290

Query  356   -LWTVPEVTTQQLAQICQNDRSTPLSLPPAVKTSITTAWEEMKPSPVGILDQLDSGDGHG  414
              +W VPEV    ++ I Q  +  P  L P V TS+  AW  M P PVGILDQL       
Sbjct  291   SVWNVPEVPLDNIS-ILQAKQMPPRPLKPHVCTSLVEAWSIMDPPPVGILDQLSRITESP  349

Query  415   IKLTASIYLPQQSRLVVGREDGSIIIVPATQTVMLQLLHGNHQQYDDWPPHQVLLGHSGR  474
             +KLT+SIYLPQQSRLV+GREDGSI+IVPATQTVM+QLL G  Q + DWP HQ+L GH GR
Sbjct  350   VKLTSSIYLPQQSRLVIGREDGSIVIVPATQTVMMQLLVGIKQNFSDWPSHQILYGHRGR  409

Query  475   VNCLLYPHGAAPRYDRTHLVSGSVDFAVCLWDLYAGTLIHRFCVHAGEITQLMVPPDNCS  534
             VNCLL P     RY+++HL+SG +DFAVCLWDLY+G+L+HRFCVHAGEITQL+VPP++CS
Sbjct  410   VNCLLCPSMIHSRYEKSHLLSGGIDFAVCLWDLYSGSLLHRFCVHAGEITQLLVPPESCS  469

Query  535   PRIQKCVCSVASDHSVTLLSLAERKCVVLASRHLFPVVTIKWRPLDDFMIVGCSDGAVYV  594
             PRI KC+CSVASDHSVTL+SL ERKCV LASRHLFPVVTIKW PLDDF+IVGCSDG+VYV
Sbjct  470   PRILKCICSVASDHSVTLVSLQERKCVTLASRHLFPVVTIKWAPLDDFLIVGCSDGSVYV  529

Query  595   WQMETGHLDRVLHGIIAEEVLYACDENT------IAASGGSATGGELGLANPAVHFFRGL  648
             WQMETGHLDRVLHG++AEEVL ACDE               A+  E+G+ANPAVHFFRGL
Sbjct  530   WQMETGHLDRVLHGMLAEEVLSACDEQAEDGGSGGGGGSNGASASEMGMANPAVHFFRGL  589

Query  649   RHRNLSAIRHATQRGLHQLQQLHGGQGVDHGNQIKTKGTPLMIQGFRSNPKDPESHILFF  708
             + RN++AIRHATQRG+ QLQQL G    +    +K +  PL+IQG R+NPKD ESHILFF
Sbjct  590   KSRNMNAIRHATQRGITQLQQLQGHNQGNFDFLMKHRSNPLVIQGLRTNPKDAESHILFF  649

Query  709   DIEALIVQLLNDEYGAMSPGSLEAQGLISASEYQKVAALTQSASPDAHKKIADFFGRVKD  768
             DIE LI +L ++EY  M+P +LE+ G+     + +     +S   DA KKI DFF +VK+
Sbjct  650   DIEGLIFELHSEEYAQMTPATLESLGV-----HLQNPKDGKSMHLDASKKIGDFFNKVKN  704

Query  769   KAGDVERILKEKDRHGILAKMKEGAENVHTKIQAKVESV--GLKPSTLDGKGDNWNNNEI  826
             KA DVE+ILK+KD+HG++ K KE  E V  K+QAKVES+   ++P            +E 
Sbjct  705   KAVDVEKILKDKDKHGLVQKFKEKTEIVEKKVQAKVESLQKAVEP------------HEE  752

Query  827   AKNNLKRNGAFSEPNATMEVAQLILSLLHAWGIDPDLDRVCEGKLGLLRPMVPVSFGVLS  886
              ++   +  +  E    MEVAQL+LSLLH+WG+DP LD++CE +LGLLRP+VP+S+GVLS
Sbjct  753   QQDLKSKIASKMEVTHVMEVAQLLLSLLHSWGLDPHLDKMCETRLGLLRPIVPISYGVLS  812

Query  887   KGGYMSLLLPTWQ--MQLEP-IGEPTTQLEQRLPAELVRQERLTRAFTARAHWELSTTLT  943
             K GYMSLLLPTWQ    + P I  P++  ++ LP EL R E LT  FT+R HWELSTTLT
Sbjct  813   KAGYMSLLLPTWQNNYAIPPGIQLPSSSKKRPLPEELQRLEHLTAVFTSRLHWELSTTLT  872

Query  944   SNHLLAVVALANTLMSMNNATFVPEQERNRKMHRPGNRSTVNWNKAEEENEEIYTAQQAQ  1003
             +NH+LA+VA++NTL+SM+ A+F+P+ E+++K+ R   R+    +  EEE EE+     +Q
Sbjct  873   TNHILALVAMSNTLLSMSAASFLPDSEKHKKLQRLAQRTDSTLSN-EEEREELMAHHISQ  931

Query  1004  IKQGWSLLATLHCVLLPDKIVSQGGVKTFKRPQVEMMARRWQHQCLEIREAAQALLLAEL  1063
             IK  WSLLAT HC LLPDKI +    K FKRPQVEMM +RWQH C+EIREAAQ +LL EL
Sbjct  932   IKHAWSLLATHHCFLLPDKIEALEP-KKFKRPQVEMMVKRWQHHCIEIREAAQQILLGEL  990

Query  1064  GRMGPKGRKTLVDSWSQYLPMYS-------TQEPIAPQSQNQSPPAPGSPIPSSESHTE-  1115
              RMG KGRK LV+SW+QYLP+Y+        Q+ +A  SQ  S  A      +       
Sbjct  991   TRMGKKGRKQLVESWAQYLPLYTHTEPIVGAQQQLALISQPASGGAGSGSGGNGGVGVGV  1050

Query  1116  -------------------EEDEEEELAEAEINVARKPSSVAELKRKQTTAVVLLGVIGA  1156
                                +  ++E+  E E  + RKPSS++ELKRKQTTAV+LLGVIGA
Sbjct  1051  SGGGGAGSGSGPGGSVPGGDAHQDEDYEEEEEEIIRKPSSLSELKRKQTTAVILLGVIGA  1110

Query  1157  EFGQDVTTTNQKRDNE----------------QRRKSSIVEGFGIGNNNLARHTSMALTH  1200
             EFGQD++  +                      +RRKSS+VEGFGI NN LAR TSMAL H
Sbjct  1111  EFGQDISQESPNHRGSISMATGANLTSGVAGGERRKSSVVEGFGIANN-LARLTSMALAH  1169

Query  1201  LLHAPHSPKLPLHTALRRAAIDLIGRGFTVWEPYLDVSKVLLGLLEMCCDADKLVPNMTY  1260
             LL+AP SPKLP +T LRRAAIDL+GRGFTVWEPYLDVSKVLLGLLE+ C+  K VPN+ Y
Sbjct  1170  LLYAPPSPKLPQYTPLRRAAIDLLGRGFTVWEPYLDVSKVLLGLLEISCEG-KAVPNLNY  1228

Query  1261  GLPLTPQADTCRTARHALTLIATARPAAFITTMAREVARYNTLQQNAQTLNVNMGASVLV  1320
              LPLTPQAD CRTARHAL LIATARPAAFITTMAREVARYNT+QQNAQ++N  +  SVL 
Sbjct  1229  KLPLTPQADACRTARHALRLIATARPAAFITTMAREVARYNTMQQNAQSINTPLTQSVLH  1288

Query  1321  RAKPEILRIVEQLIDKMQSEMSDLLVEVMDIILHCLDPGHLKTKPLNDVFPAVCRFNQVS  1380
             +AK EIL+ VE LIDKMQSE++ LLVEVMDI LHC+D   LK + L ++ PA+C+FNQ+S
Sbjct  1289  KAKGEILQCVEMLIDKMQSEIAGLLVEVMDIALHCVDGNELKNRGLAELCPAICKFNQIS  1348

Query  1381  HCPATRRIAVGSRNGQLALYELRGNVKCQTVPAHVASVTALAFSPEGKFLVSYSCTENKL  1440
             HC  TRRIAVG+ +G LA+YELR N KCQ +PAH   +T+LAFSP+GK+LVSYSC EN+L
Sbjct  1349  HCAQTRRIAVGANSGNLAIYELRQN-KCQMIPAHTHPITSLAFSPDGKYLVSYSCAENRL  1407

Query  1441  CFWQQTSSGMFGLGNSQTRCVKSYSTAPINDVARLNPMRLARLIWINNRTVTLMLADGSE  1500
              FW QTS+GMFGLG SQTRC K YSTAPI DV+RLNPMRLA+L+WINNRTVTLMLADGSE
Sbjct  1408  SFW-QTSTGMFGLGQSQTRCTKGYSTAPIPDVSRLNPMRLAKLVWINNRTVTLMLADGSE  1466

Query  1501  TRFNV  1505
             TRFNV
Sbjct  1467  TRFNV  1471


>Q960M9_DROME unnamed protein product
Length=343

 Score = 505 bits (1301),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 248/333 (74%), Positives = 284/333 (85%), Gaps = 4/333 (1%)

Query  1173  QRRKSSIVEGFGIGNNNLARHTSMALTHLLHAPHSPKLPLHTALRRAAIDLIGRGFTVWE  1232
             +RRKSS+VEGFGI NN LAR TSMAL HLL+AP SPKLP +T LRRAAIDL+GRGFTVWE
Sbjct  15    ERRKSSVVEGFGIANN-LARLTSMALAHLLYAPPSPKLPQYTPLRRAAIDLLGRGFTVWE  73

Query  1233  PYLDVSKVLLGLLEMCCDADKLVPNMTYGLPLTPQADTCRTARHALTLIATARPAAFITT  1292
             PYLDVSKVLLGLLE+ C+  K VPN+ Y LPLTPQAD CRTARHAL LIATARPAAFITT
Sbjct  74    PYLDVSKVLLGLLEISCEG-KAVPNLNYKLPLTPQADACRTARHALRLIATARPAAFITT  132

Query  1293  MAREVARYNTLQQNAQTLNVNMGASVLVRAKPEILRIVEQLIDKMQSEMSDLLVEVMDII  1352
             MAREVARYNT+QQNAQ++N  +  SVL +AK EIL+ VE LIDKMQSE++ LLVEVMDI 
Sbjct  133   MAREVARYNTMQQNAQSINTPLTQSVLHKAKGEILQCVEMLIDKMQSEIAGLLVEVMDIA  192

Query  1353  LHCLDPGHLKTKPLNDVFPAVCRFNQVSHCPATRRIAVGSRNGQLALYELRGNVKCQTVP  1412
             LHC+D   LK + L ++ PA+C+FNQ+SHC  TRRIAVG+ +G LA+YELR N KCQ +P
Sbjct  193   LHCVDGNELKNRGLAELCPAICKFNQISHCAQTRRIAVGANSGNLAIYELRQN-KCQMIP  251

Query  1413  AHVASVTALAFSPEGKFLVSYSCTENKLCFWQQTSSGMFGLGNSQTRCVKSYSTAPINDV  1472
             AH   +T+LAFSP+GK+LVSYSC EN+L FW QTS+GMFGLG SQTRC K YSTAPI DV
Sbjct  252   AHTHPITSLAFSPDGKYLVSYSCAENRLSFW-QTSTGMFGLGQSQTRCTKGYSTAPIPDV  310

Query  1473  ARLNPMRLARLIWINNRTVTLMLADGSETRFNV  1505
             +RLNPMRLA+L+WINNRTVTLMLADGSETRFNV
Sbjct  311   SRLNPMRLAKLVWINNRTVTLMLADGSETRFNV  343


>EBI_DROME unnamed protein product
Length=700

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 40/176 (23%), Positives = 68/176 (39%), Gaps = 13/176 (7%)

Query  464  PHQVLLGHSGRVNCLLY-PHGAAPRYDRTHLVSGSVDFAVCLWDLYAGTLIHRFCVHAGE  522
            P +   GH+  VN + + P G         L S S D  + +W +      H    H+ E
Sbjct  526  PIKTFKGHTNEVNAIKWCPQGQL-------LASCSDDMTLKIWSMNRDRCCHDLQAHSKE  578

Query  523  ITQLM---VPPDNCSPRIQKCVCSVASDHSVTLLSLAERKCVVLASRHLFPVVTIKWRPL  579
            I  +      P   +P     + S + D +V L  +    C+   ++H  PV ++ + P 
Sbjct  579  IYTIKWSPTGPGTNNPNTNLILASASFDSTVRLWDVERGSCIHTLTKHTEPVYSVAFSPD  638

Query  580  DDFMIVGCSDGAVYVWQMETGHLDRVLHGIIAEEVLYACDENTIAASGGSATGGEL  635
               +  G  D  V++W  +TG L     G     +   C  +     G SA+ G +
Sbjct  639  GKHLASGSFDKCVHIWSTQTGQLVHSYKGTGG--IFEVCWNSKGTKVGASASDGSV  692


 Score = 37.7 bits (86),  Expect = 0.092, Method: Compositional matrix adjust.
 Identities = 25/120 (21%), Positives = 45/120 (38%), Gaps = 10/120 (8%)

Query  492  HLVSGSVDFAVCLWDLYAGTLIHRFCVHAGEITQLMVPPDNCSPRIQKCVCSVASDHSVT  551
            +++S  VD    +WD   G    +F  H+        P  +   +  +   S ++D  + 
Sbjct  465  YILSAGVDKTTIIWDASTGQCTQQFAFHS-------APALDVDWQTNQAFASCSTDQRIH  517

Query  552  LLSLAERKCVVLASRHLFPVVTIKWRPLDDFMIVGCSDGAVYVWQMETGHLDRVLHGIIA  611
            +  L   + +     H   V  IKW P    +     D  + +W M   + DR  H + A
Sbjct  518  VCRLGVNEPIKTFKGHTNEVNAIKWCPQGQLLASCSDDMTLKIWSM---NRDRCCHDLQA  574


 Score = 33.9 bits (76),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 29/82 (35%), Gaps = 8/82 (10%)

Query  31   DQKTLVTGCYDGQICLWQVDPETLKMSPRCLLVGHTAPIMCLSRASVIMEQNYIVSSSES  90
            D   L TG YDG   +W+ D           L  H  PI  L         NYI+S+   
Sbjct  421  DGSLLATGSYDGYARIWKTDGRLAST-----LGQHKGPIFALKWNKC---GNYILSAGVD  472

Query  91   GEMCTWDLVDGKCREAVKLTSV  112
                 WD   G+C +     S 
Sbjct  473  KTTIIWDASTGQCTQQFAFHSA  494


 Score = 33.9 bits (76),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 34/150 (23%), Positives = 55/150 (37%), Gaps = 28/150 (19%)

Query  466  QVLLGHSGRVN-CLLYPHGAAPRYDRTHLVSGSVDFAVCLWDLY-----AGTLIHRFCVH  519
            +VL GH   V  C   P        R  L SGS D    +WD+      +  L+ R C+ 
Sbjct  349  RVLRGHESEVFICAWNP-------SRDLLASGSGDSTARIWDMSDANTNSNQLVLRHCIQ  401

Query  520  AG--------EITQLMVPPDNCSPRIQKCVCSVASDHSVTLLSLAERKCVVLASRHLFPV  571
             G        ++T L     NC   +   + + + D    +     R    L  +H  P+
Sbjct  402  KGGAEVPSNKDVTSLDW---NCDGSL---LATGSYDGYARIWKTDGRLASTLG-QHKGPI  454

Query  572  VTIKWRPLDDFMIVGCSDGAVYVWQMETGH  601
              +KW    ++++    D    +W   TG 
Sbjct  455  FALKWNKCGNYILSAGVDKTTIIWDASTGQ  484



Lambda      K        H
   0.323    0.145    0.461 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 845836338


Query= XP_003392928.1 growth hormone-inducible transmembrane protein
[Bombus terrestris]

Length=339
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

BI1_DROME  unnamed protein product                                    42.0    4e-04
ACH8_CAEEL  unnamed protein product                                   33.5    0.25 
ABCGO_DICDI  unnamed protein product                                  29.6    4.9  


>BI1_DROME unnamed protein product
Length=245

 Score = 42.0 bits (97),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 54/247 (22%), Positives = 102/247 (41%), Gaps = 46/247 (19%)

Query  107  WPQYVKDRIKTTYMYLGASIVSSTVAAAVCLRSPTMMNLVMRQGWVAMLVTLASVWGSGI  166
            +  YV++ +   YM LG++  ++ + A + +R        +  G +A + TL  V G   
Sbjct  23   YEPYVREHLSKVYMVLGSTAAATAMGAMLQMRD------FLDLGVLAAVATLVLVLGLHF  76

Query  167  LLQT---------IPYKEGFGAKQIAWLIHTGTVGAFLAPLYLLGGPLVLRAAWYTAGVV  217
                         + Y  GF + Q        T+G  L  +  +   ++L A   T    
Sbjct  77   YKDDGKNYYTRLGMLYAFGFCSGQ--------TLGPLLGYICSINPAIILSALTGTFVTF  128

Query  218  GGLSVVAVCAPNEKFLNMGGPL-----AVGLGFVFASSVGSMFLPPTTALGSGLYSISLY  272
              LS+ A+ A   K+L +GG L      + L  +F     S F+  T           LY
Sbjct  129  ISLSLSALLAEQGKYLYLGGMLVSVINTMALLSLFNMVFKSYFVQVT----------QLY  178

Query  273  GGLVLFSMLLLYDTQRIIKQAETYPIHEYLARPYDPINNAISVYMDAVNIFVRILTMLAS  332
             G+ + +  ++YDTQ I+++              D + +A+ ++ D +++F R+L +L  
Sbjct  179  VGVFVMAAFIVYDTQNIVEKCRN--------GNRDVVQHALDLFFDVLSMFRRLLIILTQ  230

Query  333  GGSKRQK  339
               ++Q 
Sbjct  231  KEERKQN  237


>ACH8_CAEEL unnamed protein product
Length=474

 Score = 33.5 bits (75),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 32/65 (49%), Gaps = 1/65 (2%)

Query  275  LVLFSMLLLYDTQRIIKQAETYPIHEYLARPYDPINNAISVYMDAVNIFVR-ILTMLASG  333
            +  F+++LL   +R+    E Y + + L   YDP+   ++ +   VN+ +R IL  L   
Sbjct  5    IAFFTLILLVSIERVYSSDEEYRLLKDLREGYDPVERPVADHRKPVNVKLRLILQQLVDV  64

Query  334  GSKRQ  338
              + Q
Sbjct  65   DERNQ  69


>ABCGO_DICDI unnamed protein product
Length=1159

 Score = 29.6 bits (65),  Expect = 4.9, Method: Composition-based stats.
 Identities = 17/61 (28%), Positives = 31/61 (51%), Gaps = 17/61 (28%)

Query  82    IGIGSLCYYGLGLSPSMGAIDYAKLWPQYVKDRIKTTYMYLGASIVSSTVAAAVCLRSPT  141
             I +GS+CYY +GL P +    Y                 +L + +++STVA+++C+   T
Sbjct  997   IILGSICYYMIGLRPGILHFIY-----------------FLISLVLTSTVASSMCMAIST  1039

Query  142   M  142
             +
Sbjct  1040  I  1040



Lambda      K        H
   0.323    0.145    0.461 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 845836338


Query= XP_003392931.1 ATP-dependent RNA helicase DHX33 [Bombus terrestris]

Length=693
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MOG5_CAEEL  unnamed protein product                                   544     1e-179
DHX8_DROME  unnamed protein product                                   536     2e-176
DHX16_CAEEL  unnamed protein product                                  521     5e-173
Q9VIZ3_DROME  unnamed protein product                                 509     8e-170
Q7K3M5_DROME  unnamed protein product                                 498     1e-167


>MOG5_CAEEL unnamed protein product
Length=1200

 Score = 544 bits (1401),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 279/630 (44%), Positives = 409/630 (65%), Gaps = 12/630 (2%)

Query  58    NISLQQQRKSLPVYKLRKRLLEEIRRNSTLIVIGETGSGKTTQIPQLLLSSGIAGTIGCI  117
             N+S+ +QR+SLP++ L+K L+E +  N  L+V+GETGSGKTTQ+ Q  + +G+ G  G I
Sbjct  530   NLSMVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGL-GRRGKI  588

Query  118   GITQPRRVAAVSVARRVAQEQGVEPGKLVGYCVRFEDVTSSQTRIKYLTDGMMVREAMTD  177
             G TQPRRVAA+SVA+RVA+E G + G  VGY +RFED TS  T IKY+TDGM++RE + D
Sbjct  589   GCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLID  648

Query  178   EILSDYSVVILDEAHERSVQTDVLLGVARRAQNLRKLKNLPPLKLLVMSATMDVDKFSKY  237
               LS YS+++LDEAHER++ TDVL G+ + A   R     P LKL++ SAT+D  KFS+Y
Sbjct  649   PDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKR-----PELKLIITSATLDSVKFSEY  703

Query  238   F-QAPAVYLEGRQHPVKIYHAVKSQEDYAFSALVTAFQIHRDNPANEDILVFLTGQEEIE  296
             F +AP   + GR  PV+I +  + + DY  +A +T  QIH   P   D+LVFLTGQEEI+
Sbjct  704   FLEAPIFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPG-DVLVFLTGQEEID  762

Query  297   AAATSARQVAKQLDGQGYPSLKVFPLYSALPTHQQLEAFKPSSPGMRKLILSTNVAETSV  356
              +     +  K + G   P L + P+Y ALP+  Q   F P+  G RK++++TN+AETS+
Sbjct  763   TSCEVLYERMKSM-GPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSL  821

Query  357   TIGGIRHVIDTGVVKARTHHPTTGLDVLRVEKVSKAQAWQRTGRAGREAAGKCYRNYTKE  416
             TI GI +V+D G VK + ++P +G+D L V  +S+A A QR+GRAGR   GKCYR YT+ 
Sbjct  822   TIDGIFYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTER  881

Query  417   EF-ERMKEMPVPEIQRCSLAGVALQLLAIGVD-ITTFDFMDKPPKEAVDVAVTCLEKLGA  474
              F + M   PVPEIQR +LA   LQL A+G++ +  FDFMD PP +++  A+  L  L A
Sbjct  882   AFRDEMLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSA  941

Query  475   VKGSPPQLTTLGRTMSLFPLDPRFTKVILASAEHQCLEEALTVVALLSGESVFTDPPAKR  534
             + G    LT LGR M+ FPL+P  +K+++ S +  C EE LT+VA+L+ +++F  P  K+
Sbjct  942   LDGDG-LLTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQ  1000

Query  535   QQAYVARSRFASPEGDHVTLLNVFRAYANTKQKKVWCHENFLHHRNLEYATEVRQQLATL  594
               A   +++F  PEGDH+TLL V+ ++ N    + WC ENF+  R+++ A ++R+QL  +
Sbjct  1001  DHADQKKAKFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGI  1060

Query  595   AERANLEKASCGTNTEQLRKALLEGLYDNLAELQRDQTYITVSSKQPVAIHPSSTLHASK  654
              +R  L   SCG +  +++KA+  G + N A+    + Y T++  Q V IHPSS     +
Sbjct  1061  MDRHKLLMVSCGRDVSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQQ  1120

Query  655   PPLILFTEVVATGRCYLRGLSVIDCSWLTE  684
             P  +++ E+V T + Y+R ++ ID  WL E
Sbjct  1121  PEWVVYHELVMTTKEYMREVTAIDPKWLVE  1150


>DHX8_DROME unnamed protein product
Length=1242

 Score = 536 bits (1382),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 286/632 (45%), Positives = 405/632 (64%), Gaps = 12/632 (2%)

Query  56    KGNISLQQQRKSLPVYKLRKRLLEEIRRNSTLIVIGETGSGKTTQIPQLLLSSGIAGTIG  115
             K +++L +QR+SLP+YKLR  L++ +  N  LIVIGETGSGKTTQI Q L   G     G
Sbjct  574   KTDLTLVEQRQSLPIYKLRDDLIKAVTDNQILIVIGETGSGKTTQITQYLGECGFTAR-G  632

Query  116   CIGITQPRRVAAVSVARRVAQEQGVEPGKLVGYCVRFEDVTSSQTRIKYLTDGMMVREAM  175
              IG TQPRRVAA+SVA+RVA+E G   G+ VGY +RFED TS +T IKY+TDGM++RE +
Sbjct  633   KIGCTQPRRVAAMSVAKRVAEEYGCRLGQEVGYTIRFEDCTSPETIIKYMTDGMLLRECL  692

Query  176   TDEILSDYSVVILDEAHERSVQTDVLLGVARRAQNLRKLKNLPPLKLLVMSATMDVDKFS  235
              +  L  YSV++LDEAHER++ TDVL G+ + A   R     P LKL+V SAT+D  KFS
Sbjct  693   MEAELKSYSVIMLDEAHERTIHTDVLFGLLKTAVQKR-----PELKLIVTSATLDAVKFS  747

Query  236   KYF-QAPAVYLEGRQHPVKIYHAVKSQEDYAFSALVTAFQIHRDNPANEDILVFLTGQEE  294
             +YF +AP   + GR  PV++ +  + + DY  ++L+T  QIH   P   DIL+FLTGQEE
Sbjct  748   QYFFKAPIFTIPGRTFPVEVLYTKEPETDYLDASLITVMQIHLREPPG-DILLFLTGQEE  806

Query  295   IEAAATSARQVAKQLDGQGYPSLKVFPLYSALPTHQQLEAFKPSSPGMRKLILSTNVAET  354
             I+ A     +  K L G   P L + P+YSALP+  Q   F P+  G RK++++TN+AET
Sbjct  807   IDTACEILYERMKSL-GPDVPELIILPVYSALPSEMQTRIFDPAPAGSRKVVIATNIAET  865

Query  355   SVTIGGIRHVIDTGVVKARTHHPTTGLDVLRVEKVSKAQAWQRTGRAGREAAGKCYRNYT  414
             S+TI GI +V+D G VK + ++  TG+D L V  +S+A A QR GRAGR   GK YR YT
Sbjct  866   SLTIDGIFYVVDPGFVKQKVYNSKTGMDSLVVTPISQAAAKQRAGRAGRTGPGKTYRLYT  925

Query  415   KEEF-ERMKEMPVPEIQRCSLAGVALQLLAIGV-DITTFDFMDKPPKEAVDVAVTCLEKL  472
             +  + + M   PVPEIQR +LA   LQL  +G+ D+  FDFMD PP E++ +A+  L  L
Sbjct  926   ERAYRDEMLPTPVPEIQRTNLATTVLQLKTMGINDLLHFDFMDAPPVESLVMALEQLHSL  985

Query  473   GAVKGSPPQLTTLGRTMSLFPLDPRFTKVILASAEHQCLEEALTVVALLSGESVFTDPPA  532
              A+      LT LGR M+ FPL+P  +K+++ S   QC +E LT+V++LS ++VF  P  
Sbjct  986   SALDDEG-LLTRLGRRMAEFPLEPNLSKMLIMSVALQCSDEILTIVSMLSVQNVFYRPKD  1044

Query  533   KRQQAYVARSRFASPEGDHVTLLNVFRAYANTKQKKVWCHENFLHHRNLEYATEVRQQLA  592
             K+  A   +++F   EGDH+TLL V+ ++ N K    WC+ENF+  R L+ + +VR+QL 
Sbjct  1045  KQALADQKKAKFNQAEGDHLTLLAVYNSWKNNKFSNAWCYENFVQIRTLKRSQDVRKQLL  1104

Query  593   TLAERANLEKASCGTNTEQLRKALLEGLYDNLAELQRDQTYITVSSKQPVAIHPSSTLHA  652
              + +R  L+  S G N+ +++KA+  G + N A+    + Y T+   Q V IHPSS L  
Sbjct  1105  GIMDRHKLDVVSAGKNSVRIQKAICSGFFRNAAKKDPQEGYRTLVDSQVVYIHPSSALFN  1164

Query  653   SKPPLILFTEVVATGRCYLRGLSVIDCSWLTE  684
              +P  +++ E+V T + Y+R ++ ID  WL E
Sbjct  1165  RQPEWVIYHELVQTTKEYMREVTTIDPKWLVE  1196


>DHX16_CAEEL unnamed protein product
Length=1008

 Score = 521 bits (1342),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 280/644 (43%), Positives = 403/644 (63%), Gaps = 13/644 (2%)

Query  45   NQQNVQAENVDKGNISLQQQRKSLPVYKLRKRLLEEIRRNSTLIVIGETGSGKTTQIPQL  104
            N++ V+ E  +K  +S+++ RKSLPVY  R   +E ++ +  LI+ GETGSGKTTQ+PQ 
Sbjct  342  NEEVVETE-AEKKKMSIEETRKSLPVYAFRDAFIEAVKEHQVLIIEGETGSGKTTQLPQY  400

Query  105  LLSSGIAGTIGCIGITQPRRVAAVSVARRVAQEQGVEPGKLVGYCVRFEDVTSSQTRIKY  164
            L  +G       IG TQPRRVAA+SVA RVA E G + G  VGY +RFED TS +T +KY
Sbjct  401  LYEAGFCEGGKRIGCTQPRRVAAMSVAARVADEVGCKLGTQVGYSIRFEDCTSEKTVLKY  460

Query  165  LTDGMMVREAMTDEILSDYSVVILDEAHERSVQTDVLLGVARRAQNLRKLKNLPPLKLLV  224
            +TDGM++RE + +  L+ YSV+++DEAHER++ TD+L G+ +     RK      LKLL+
Sbjct  461  MTDGMLLREFLNEPDLASYSVMMIDEAHERTLHTDILFGLVKDIARFRK-----DLKLLI  515

Query  225  MSATMDVDKFSKYF-QAPAVYLEGRQHPVKIYHAVKSQEDYAFSALVTAFQIHRDNPANE  283
             SAT+D +KFS +F  AP   + GR+ PV IY+    + DY  +A+VT  QIH   P   
Sbjct  516  SSATLDAEKFSSFFDDAPIFRIPGRRFPVDIYYTQAPEADYVDAAIVTIMQIHLTQPLPG  575

Query  284  DILVFLTGQEEIEAAATSARQVAKQLDGQGYPSLKVFPLYSALPTHQQLEAFKPSSPGMR  343
            DILVFLTGQEEIE    +  + +K L G     L   P+Y+ LP+  Q + F+P+    R
Sbjct  576  DILVFLTGQEEIETVQEALMERSKAL-GSKIKELIPLPVYANLPSDLQAKIFEPTPKDAR  634

Query  344  KLILSTNVAETSVTIGGIRHVIDTGVVKARTHHPTTGLDVLRVEKVSKAQAWQRTGRAGR  403
            K++L+TN+AETSVTI GI +VID G  K  +    +G++ L V  +SKA A QR GRAGR
Sbjct  635  KVVLATNIAETSVTIDGINYVIDPGFSKQNSFDARSGVEHLHVVTISKAAANQRAGRAGR  694

Query  404  EAAGKCYRNYTKEEFE-RMKEMPVPEIQRCSLAGVALQLLAIGV-DITTFDFMDKPPKEA  461
               GKC+R YT   ++  ++E P+PEIQR +L  V L L ++G+ D+  FDF+D PP+E 
Sbjct  695  TGPGKCFRLYTAWAYKHELEEQPIPEIQRTNLGNVVLMLKSLGIHDLVHFDFLDPPPQET  754

Query  462  VDVAVTCLEKLGAVKGSPPQLTTLGRTMSLFPLDPRFTKVILASAEHQCLEEALTVVALL  521
            + +A+  L  LGA+     +LT LGR M+ FP DP  +K+I+AS +++C EE +T+ A+L
Sbjct  755  LVIALEQLYALGALNHR-GELTKLGRRMAEFPCDPCMSKMIIASEKYECSEEIVTIAAML  813

Query  522  S-GESVFTDPPAKRQQAYVARSRFASPEGDHVTLLNVFRAYANTKQKKVWCHENFLHHRN  580
            S   +VF  P A+   A  AR  F SP GDH+TL+NV+  +  +   + WC EN++ HR 
Sbjct  814  SCNAAVFYRPKAQVIHADSARKGFWSPAGDHITLMNVYNKWQESSFSQRWCVENYVQHRT  873

Query  581  LEYATEVRQQLATLAERANLEKASCGTNTEQLRKALLEGLYDNLAELQRDQTYITVSSKQ  640
            ++ A +VR QL  L ER  +E  S  T+T ++RKA+  G + N+++L     Y TV  K 
Sbjct  874  MKRARDVRDQLVGLLERVEIETKS-STDTIKIRKAITAGYFYNVSKLDNTGHYKTVKHKH  932

Query  641  PVAIHPSSTLHASKPPLILFTEVVATGRCYLRGLSVIDCSWLTE  684
                HP+S L    P  +++ E+V T + ++R +S I+  WL E
Sbjct  933  TTHPHPNSCLFEETPRWVVYFELVFTSKEFMREMSEIESGWLLE  976


>Q9VIZ3_DROME unnamed protein product
Length=894

 Score = 509 bits (1311),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 272/634 (43%), Positives = 393/634 (62%), Gaps = 12/634 (2%)

Query  55   DKGNISLQQQRKSLPVYKLRKRLLEEIRRNSTLIVIGETGSGKTTQIPQLLLSSGIAGTI  114
            ++  ++L + R+SLPVY  ++ L+  ++ +  LI+ GETGSGKTTQ+PQ L+ +G     
Sbjct  239  ERKRLTLDETRRSLPVYPFKEDLIAAVKEHQVLIIEGETGSGKTTQVPQYLVEAGFTKDK  298

Query  115  GCIGITQPRRVAAVSVARRVAQEQGVEPGKLVGYCVRFEDVTSSQTRIKYLTDGMMVREA  174
              IG TQPRRVAA+SVA RVA+E GV+ G  VGY +RFED TS +T +KY+TDG + RE 
Sbjct  299  KMIGCTQPRRVAAMSVAARVAEEMGVKLGNEVGYSIRFEDCTSDRTILKYMTDGTLHREF  358

Query  175  MTDEILSDYSVVILDEAHERSVQTDVLLGVARRAQNLRKLKNLPPLKLLVMSATMDVDKF  234
            +++  L+ YSV+I+DEAHER++ TD+L G+ +     R     P LKLL+ SAT+D +KF
Sbjct  359  LSEPDLASYSVMIIDEAHERTLHTDILFGLVKDIARFR-----PELKLLISSATLDAEKF  413

Query  235  SKYF-QAPAVYLEGRQHPVKIYHAVKSQEDYAFSALVTAFQIHRDNPANEDILVFLTGQE  293
            S +F  AP   + GR++PV I++    + DY  +  V+  QIH   P   DILVFLTGQ+
Sbjct  414  SAFFDDAPIFRIPGRRYPVDIFYTKAPEADYIDACCVSVLQIHATQPLG-DILVFLTGQD  472

Query  294  EIEAAATSARQVAKQLDGQGYPSLKVFPLYSALPTHQQLEAFKPSSPGMRKLILSTNVAE  353
            EIE          K+L G     L V P+Y+ LP+  Q + F+P+ P  RK+IL+TN+AE
Sbjct  473  EIETCQEVLHDRVKRL-GSKIRELIVIPVYANLPSDMQAKIFEPTPPNARKVILATNIAE  531

Query  354  TSVTIGGIRHVIDTGVVKARTHHPTTGLDVLRVEKVSKAQAWQRTGRAGREAAGKCYRNY  413
            TS+TI  I +VID G  K    +  TG++ L V  +SKA A QR GRAGR A GKC+R Y
Sbjct  532  TSLTIDNIIYVIDPGFAKQNNFNSRTGMESLMVVPISKASANQRAGRAGRTAPGKCFRLY  591

Query  414  TKEEFER-MKEMPVPEIQRCSLAGVALQLLAIGV-DITTFDFMDKPPKEAVDVAVTCLEK  471
            T   ++  +++  VPEIQR +L    L L A+G+ D+  FDF+D PP E + +A+  L  
Sbjct  592  TAWAYKHELEDNTVPEIQRINLGNAVLMLKALGINDLIHFDFLDPPPHETLVLALEQLYA  651

Query  472  LGAVKGSPPQLTTLGRTMSLFPLDPRFTKVILASAEHQCLEEALTVVALLSGES-VFTDP  530
            LGA+     +LT LGR M+ FP+DP   K++LAS +++C EE +T+ A+LS  S +F  P
Sbjct  652  LGAL-NHHGELTKLGRRMAEFPVDPMMGKMLLASEKYKCSEEMVTIAAMLSVNSAIFYRP  710

Query  531  PAKRQQAYVARSRFASPEGDHVTLLNVFRAYANTKQKKVWCHENFLHHRNLEYATEVRQQ  590
              K   A  AR  F    GDH++LL V+  +A T     WC+ENF+ +R+++ A +VR+Q
Sbjct  711  KDKIIHADTARKNFNHMHGDHLSLLQVYNQWAETDYSTQWCYENFIQYRSMKRARDVREQ  770

Query  591  LATLAERANLEKASCGTNTEQLRKALLEGLYDNLAELQRDQTYITVSSKQPVAIHPSSTL  650
            L  L +R  ++  SC   T  +RKA   G + ++A L +   Y T+   Q V IHP+S+L
Sbjct  771  LVGLMQRVEIDMVSCLPETVNVRKAATAGYFYHVARLSKGGHYKTIKHNQTVMIHPNSSL  830

Query  651  HASKPPLILFTEVVATGRCYLRGLSVIDCSWLTE  684
                P  +L+ E+V T + Y+R +  I+  WL E
Sbjct  831  FEELPRWVLYHELVFTSKEYMRQVIEIESKWLLE  864


>Q7K3M5_DROME unnamed protein product
Length=729

 Score = 498 bits (1282),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 264/638 (41%), Positives = 401/638 (63%), Gaps = 25/638 (4%)

Query  60   SLQQQRKSLPVYKLRKRLLEEIRRNSTLIVIGETGSGKTTQIPQLLLSSGIAGTIGCIGI  119
            +L ++R +LPV++ +   +  +  +  ++++GETGSGKTTQIPQ  +   ++     +  
Sbjct  64   NLYKKRIALPVFEYQADFMRLLSLHQCIVLVGETGSGKTTQIPQWCVDFAVSKGRKGVSC  123

Query  120  TQPRRVAAVSVARRVAQEQGVEPGKLVGYCVRFEDVTSSQTRIKYLTDGMMVREAMTDEI  179
            TQPRRVAA+SVA+RV++E  V+ G+ VGY +RFED ++++T +KY+TDGM++REAM+D +
Sbjct  124  TQPRRVAAMSVAQRVSEEMDVKLGEEVGYSIRFEDCSTAKTLLKYMTDGMLLREAMSDPM  183

Query  180  LSDYSVVILDEAHERSVQTDVLLGVARRAQNLRKLKNLPPLKLLVMSATMDVDKFSKYF-  238
            L  Y V++LDEAHER++ TD+L+GV +       ++    LKL+VMSAT+D  KF +YF 
Sbjct  184  LDQYQVILLDEAHERTLATDILMGVLKEV-----IRQRSDLKLVVMSATLDAGKFQQYFD  238

Query  239  QAPAVYLEGRQHPVKIYHAVKSQEDYAFSALVTAFQIHRDNPANEDILVFLTGQEEIEAA  298
             AP + + GR HPV+I++  + + DY  +A+ T  QIH       DIL+FLTGQEEIE A
Sbjct  239  NAPLMKVPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMCEEIEGDILMFLTGQEEIEEA  298

Query  299  ATSARQVAKQLDGQGYP--SLKVFPLYSALPTHQQLEAFKPSSPGM------RKLILSTN  350
                +++ +++D  G     LK  PLYS LP + Q   F+P+ P        RK+++STN
Sbjct  299  ---CKRIKREIDNLGSEIGELKCIPLYSTLPPNLQQRIFEPAPPPNANGAIGRKVVVSTN  355

Query  351  VAETSVTIGGIRHVIDTGVVKARTHHPTTGLDVLRVEKVSKAQAWQRTGRAGREAAGKCY  410
            +AETS+TI G+  VID G  K + ++P   ++ L V  +SKA A QR+GRAGR   GKC+
Sbjct  356  IAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVSPISKASAQQRSGRAGRTRPGKCF  415

Query  411  RNYTKEEFER-MKEMPVPEIQRCSLAGVALQLLAIGV-DITTFDFMDKPPKEAVDVAVTC  468
            R YT++ F+  M++   PEI R +L  V LQL  +G+ D+  FDFMD P  E +  A+  
Sbjct  416  RLYTEKAFKNEMQDNTYPEILRSNLGTVVLQLKKLGIDDLVHFDFMDPPAPETLMRALEL  475

Query  469  LEKLGAVKGSPPQLTTLGRTMSLFPLDPRFTKVILASAEHQCLEEALTVVALLSGESVFT  528
            L  L A+      LT LG  MS FPLDP+  K+++AS +H C  E L++ A+LS    F 
Sbjct  476  LNYLAALDDD-GNLTDLGAVMSEFPLDPQLAKMLIASCQHNCSNEILSITAMLSVPQCFV  534

Query  529  DPPAKRQQAYVARSRFASPEGDHVTLLNVFRAYANTKQKKVWCHENFLHHRNLEYATEVR  588
             P   ++ A  A+ RFA  +GDH+TLLNV+ A+  + +   WC+ENF++ R+L+ A  VR
Sbjct  535  RPNEAKKAADEAKMRFAHIDGDHLTLLNVYHAFKQSSEDPNWCYENFINFRSLKSADNVR  594

Query  589  QQLATLAERANLEKASCGTNTE----QLRKALLEGLYDNLAELQRDQTYITVSSKQPVAI  644
            QQLA + +R NL + S    ++     +RKAL++G +  +A L+R   Y+T+   Q V +
Sbjct  595  QQLARIMDRFNLRRTSTEFTSKDYYVNIRKALVQGFFMQVAHLERTGYYLTIKDNQNVQL  654

Query  645  HPSSTLHASKPPLILFTEVVATGRCYLRGLSVIDCSWL  682
            HPS+ L   KP  +++ E V T + Y+R ++ +   WL
Sbjct  655  HPSTCLD-HKPDWVIYNEFVLTTKNYIRTVTDVKPEWL  691



Lambda      K        H
   0.323    0.145    0.461 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 845836338


Query= XP_003392932.1 major facilitator superfamily domain-containing
protein 1 [Bombus terrestris]

Length=513
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TH2A_TRYBB  unnamed protein product                                   30.8    3.0  
Q86NN1_DROME  unnamed protein product                                 30.8    3.8  
Q9VWC0_DROME  unnamed protein product                                 30.8    3.8  
Q9VCJ5_DROME  unnamed protein product                                 29.6    7.3  


>TH2A_TRYBB unnamed protein product
Length=529

 Score = 30.8 bits (68),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 13/45 (29%), Positives = 25/45 (56%), Gaps = 0/45 (0%)

Query  97   SVFGIRLGTIIYMGLTLIGQIIFATGAMVNEFWVMMVGRFVFGVG  141
            ++FG++   II   ++++   +       NEFWV+  GR + G+G
Sbjct  145  TMFGLKKSFIIVGVMSVVASALNHISVATNEFWVLCAGRVLMGIG  189


>Q86NN1_DROME unnamed protein product
Length=2201

 Score = 30.8 bits (68),  Expect = 3.8, Method: Composition-based stats.
 Identities = 25/85 (29%), Positives = 41/85 (48%), Gaps = 15/85 (18%)

Query  424  TVVAIWVSDVTTTGGYLNMTPG-QREKYEEIR-RTPESLEREKLLAPESTSDLSTDDLLQ  481
            +VV +  +DVT TG Y+N + G  +E Y +++ R   S+  E++L P S           
Sbjct  658  SVVIVQDTDVTITGVYVNASNGAAQEAYCKMQYRVQSSVTEERVLRPGSVE--------P  709

Query  482  PQSDISIRNRYLSRIGGMVPPNVKT  506
            P+S        LS +  M+PP   +
Sbjct  710  PKSYTP-----LSALSSMLPPGASS  729


>Q9VWC0_DROME unnamed protein product
Length=2529

 Score = 30.8 bits (68),  Expect = 3.8, Method: Composition-based stats.
 Identities = 25/85 (29%), Positives = 41/85 (48%), Gaps = 15/85 (18%)

Query  424   TVVAIWVSDVTTTGGYLNMTPG-QREKYEEIR-RTPESLEREKLLAPESTSDLSTDDLLQ  481
             +VV +  +DVT TG Y+N + G  +E Y +++ R   S+  E++L P S           
Sbjct  986   SVVIVQDTDVTITGVYVNASNGAAQEAYCKMQYRVQSSVTEERVLRPGSVE--------P  1037

Query  482   PQSDISIRNRYLSRIGGMVPPNVKT  506
             P+S        LS +  M+PP   +
Sbjct  1038  PKSYTP-----LSALSSMLPPGASS  1057


>Q9VCJ5_DROME unnamed protein product
Length=602

 Score = 29.6 bits (65),  Expect = 7.3, Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 43/104 (41%), Gaps = 4/104 (4%)

Query  44   LGFGSYFCFDNPGALQDDFKVDLQMSTSKFVLLYSIYSWPNVILCFIGGFLLDSVFGIRL  103
            L  G     DN      + ++ L        LL ++ +   +I   I G    S FG RL
Sbjct  185  LASGHPPTHDNSSNDNSNKELTLTQENGSIGLLLAMKALVQLIFNPIVGNA-SSKFGYRL  243

Query  104  GTIIYMGLTLIGQIIFATGAMVNEFWVMMVGRFVFGVGAESLAV  147
              ++     L+  ++F  G     +W ++V R V GVG+  + +
Sbjct  244  PIVVGTFFLLLSSLVFTVG---ESYWALLVARAVQGVGSACINI  284



Lambda      K        H
   0.323    0.145    0.461 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 845836338


Query= XP_003392933.1 chromatin complexes subunit BAP18 isoform X2 [Bombus
terrestris]

Length=160
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

H8ESF4_CAEEL  unnamed protein product                                 35.8    0.011
H8ESF3_CAEEL  unnamed protein product                                 35.4    0.012
G5EF87_CAEEL  unnamed protein product                                 35.4    0.013
MYO1_CAEEL  unnamed protein product                                   28.9    2.2  
MDHC_TAESO  unnamed protein product                                   28.5    2.6  


>H8ESF4_CAEEL unnamed protein product
Length=685

 Score = 35.8 bits (81),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 26/40 (65%), Gaps = 1/40 (3%)

Query  31   TTDSPAGK-WTDEEIEMLRHSVKTFSEDLNKISEHIKGRT  69
            T  +P G+ WT++E  +L  +++ F +D NK+ +H+  RT
Sbjct  144  TKGAPPGRDWTEQETCLLLEALEMFKDDWNKVCDHVGTRT  183


>H8ESF3_CAEEL unnamed protein product
Length=792

 Score = 35.4 bits (80),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 26/40 (65%), Gaps = 1/40 (3%)

Query  31   TTDSPAGK-WTDEEIEMLRHSVKTFSEDLNKISEHIKGRT  69
            T  +P G+ WT++E  +L  +++ F +D NK+ +H+  RT
Sbjct  248  TKGAPPGRDWTEQETCLLLEALEMFKDDWNKVCDHVGTRT  287


>G5EF87_CAEEL unnamed protein product
Length=789

 Score = 35.4 bits (80),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 26/40 (65%), Gaps = 1/40 (3%)

Query  31   TTDSPAGK-WTDEEIEMLRHSVKTFSEDLNKISEHIKGRT  69
            T  +P G+ WT++E  +L  +++ F +D NK+ +H+  RT
Sbjct  248  TKGAPPGRDWTEQETCLLLEALEMFKDDWNKVCDHVGTRT  287


>MYO1_CAEEL unnamed protein product
Length=1938

 Score = 28.9 bits (63),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 25/40 (63%), Gaps = 2/40 (5%)

Query  42    EEIEMLRHSVKTFSEDLNKISEHIK--GRTVSQIRTTLKK  79
             E+IE LR   K FS+++  I+E I   GRT  ++  ++++
Sbjct  1500  EQIETLRRENKIFSQEIRDINEQITQGGRTYQEVHKSVRR  1539


>MDHC_TAESO unnamed protein product
Length=332

 Score = 28.5 bits (62),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 21/35 (60%), Gaps = 0/35 (0%)

Query  112  TGNQGLMGKSSEVTLNMLNAPESEVDVEGLPEECQ  146
              N  L GK  ++ L++L+ PE++  +EG+  E Q
Sbjct  24   VANGNLFGKDQKIILHLLDIPEAKTVLEGVVMELQ  58



Lambda      K        H
   0.323    0.145    0.461 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 845836338


Query= XP_003392935.1 tribbles homolog 2 [Bombus terrestris]

Length=347
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TRIB_DROME  unnamed protein product                                   193     2e-57
Q38B72_TRYB2  unnamed protein product                                 125     1e-31
O18645_DROME  unnamed protein product                                 121     3e-30
Q5U118_DROME  unnamed protein product                                 121     3e-30
SAD1_CAEEL  unnamed protein product                                   120     1e-29


>TRIB_DROME unnamed protein product
Length=484

 Score = 193 bits (491),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 102/260 (39%), Positives = 150/260 (58%), Gaps = 28/260 (11%)

Query  84   RCVDVHTGQQLVAKALTVGDKGCEALLQAHLRLE------------GTGAASGVAGVVEA  131
            RCVD+ TG+Q + +   + ++    + +A+ +L+            G      V  ++  
Sbjct  141  RCVDIFTGEQFLCR---IVNEPLHKVQRAYFQLQQHDEELRRSTIYGHPLIRPVHDIIPL  197

Query  132  PGGRRYLLL-------------EGHHGDLHAYVRARRRLREPEARRLFRQAARAVATCHE  178
               R Y+L+              G + +LH Y+R  +RL E EAR +F Q  + V  CH 
Sbjct  198  TKDRTYILIAPVPQERDSTGGVTGVYENLHTYIRHAKRLCETEARAIFHQICQTVQVCHR  257

Query  179  YGVVLRDLKLRKFVFADEARTRLRLESLEDAVIVEGDDDKLTDRRGCPAYVAPEVLRSGR  238
             G++LRDLKL++F F DEART+L+ ESLE ++I++G+DD L+D+ GCP Y APE+L   +
Sbjct  258  NGIILRDLKLKRFYFIDEARTKLQYESLEGSMILDGEDDTLSDKIGCPLYTAPELLCPQQ  317

Query  239  AYSGKAADIWSLGVLLYTMLVGRYPFNDAEHASLFAKISRGQFAVPEGLSPRARCLIRSL  298
             Y GK AD+WSLGV+LYTMLVG+YPF +  + +L   I  G   +P  LS   R L+ SL
Sbjct  318  TYKGKPADMWSLGVILYTMLVGQYPFYEKANCNLITVIRHGNVQIPLTLSKSVRWLLLSL  377

Query  299  LRKEPSERPYAEDVPRHPWL  318
            LRK+ +ER  A  +   PWL
Sbjct  378  LRKDYTERMTASHIFLTPWL  397


>Q38B72_TRYB2 unnamed protein product
Length=729

 Score = 125 bits (315),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 95/174 (55%), Gaps = 3/174 (2%)

Query  145  GDLHAYVRARRRLREPEARRLFRQAARAVATCHEYGVVLRDLKLRKFVFADEARTRLRLE  204
            G+L  Y+  R  L E   R +F+Q A  VA CH Y V+ RDLK    +      T +++ 
Sbjct  91   GELFDYICQRGPLAEDVVRHIFQQIAAGVAYCHRYRVIHRDLKPENILLEKNTNT-VKIA  149

Query  205  SLEDAVIVEGDDDKLTDRRGCPAYVAPEVLRSGRAYSGKAADIWSLGVLLYTMLVGRYPF  264
                +     D   L    G P Y +P+V+ SG  Y+G   D+WS GV+LYTMLVG  PF
Sbjct  150  DFGLSSYTH-DGRFLETSCGTPNYASPQVV-SGEMYAGPDTDVWSCGVILYTMLVGALPF  207

Query  265  NDAEHASLFAKISRGQFAVPEGLSPRARCLIRSLLRKEPSERPYAEDVPRHPWL  318
             D   A+LF KI R ++ VPE +SP+A  L+R +L   P ER   E V +HPW+
Sbjct  208  EDTNVAALFQKIKRAEYLVPESVSPQAHDLLRRMLVVNPLERATMEQVIQHPWV  261


>O18645_DROME unnamed protein product
Length=582

 Score = 121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 67/203 (33%), Positives = 105/203 (52%), Gaps = 6/203 (3%)

Query  128  VVEAPGGRRYLLLEGHHGDLHAYVRARRRLREPEARRLFRQAARAVATCHEYGVVLRDLK  187
            V+  P     ++     G+L  Y+    +L+E +ARR F+Q    V  CH + +V RDLK
Sbjct  94   VISTPSDIFMIMEYVSGGELFDYIVKHGKLQEHQARRFFQQIISGVDYCHRHMIVHRDLK  153

Query  188  LRKFVFADEARTRLRLESLEDAVIVEGDDDKLTDRRGCPAYVAPEVLRSGRAYSGKAADI  247
                +       ++    L + ++   D + L    G P Y APEV+ SG+ Y+G   DI
Sbjct  154  PENLLLDHNMHVKIADFGLSNMML---DGEFLRTSCGSPNYAAPEVI-SGKLYAGPEVDI  209

Query  248  WSLGVLLYTMLVGRYPFNDAEHASLFAKISRGQFAVPEGLSPRARCLIRSLLRKEPSERP  307
            WS GV+LY +L G  PF+D    +LF KI  G F +PE L+ +   L+  +L+ +P +R 
Sbjct  210  WSCGVILYALLCGTLPFDDEHVPTLFRKIKSGIFPIPEYLNKQVVNLVCQMLQVDPLKRA  269

Query  308  YAEDVPRHPWLAK--PLRVCPTS  328
              E++ +H W  K  P  + P+S
Sbjct  270  NIEEIKKHEWFQKDLPAYLFPSS  292


>Q5U118_DROME unnamed protein product
Length=582

 Score = 121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 67/203 (33%), Positives = 105/203 (52%), Gaps = 6/203 (3%)

Query  128  VVEAPGGRRYLLLEGHHGDLHAYVRARRRLREPEARRLFRQAARAVATCHEYGVVLRDLK  187
            V+  P     ++     G+L  Y+    +L+E +ARR F+Q    V  CH + +V RDLK
Sbjct  94   VISTPSDIFMIMEYVSGGELFDYIVKHGKLQEHQARRFFQQIISGVDYCHRHMIVHRDLK  153

Query  188  LRKFVFADEARTRLRLESLEDAVIVEGDDDKLTDRRGCPAYVAPEVLRSGRAYSGKAADI  247
                +       ++    L + ++   D + L    G P Y APEV+ SG+ Y+G   DI
Sbjct  154  PENLLLDHNMHVKIADFGLSNMML---DGEFLRTSCGSPNYAAPEVI-SGKLYAGPEVDI  209

Query  248  WSLGVLLYTMLVGRYPFNDAEHASLFAKISRGQFAVPEGLSPRARCLIRSLLRKEPSERP  307
            WS GV+LY +L G  PF+D    +LF KI  G F +PE L+ +   L+  +L+ +P +R 
Sbjct  210  WSCGVILYALLCGTLPFDDEHVPTLFRKIKSGIFPIPEYLNKQVVNLVCQMLQVDPLKRA  269

Query  308  YAEDVPRHPWLAK--PLRVCPTS  328
              E++ +H W  K  P  + P+S
Sbjct  270  NIEEIKKHEWFQKDLPAYLFPSS  292


>SAD1_CAEEL unnamed protein product
Length=914

 Score = 120 bits (300),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/192 (36%), Positives = 103/192 (54%), Gaps = 7/192 (4%)

Query  137  YLLLEG-HHGDLHAYVRARRRLREPEARRLFRQAARAVATCHEYGVVLRDLKLRKFVFAD  195
            YLLLE    G+L  Y+  + RL   EAR+ FRQ   A+  CH + +  RDLK    +   
Sbjct  120  YLLLEHVSGGELFDYLVRKGRLMSKEARKFFRQIISALDFCHAHNICHRDLKPENLLL--  177

Query  196  EARTRLRLESLEDAVI-VEGDDDKLTDRRGCPAYVAPEVLRSGRAYSGKAADIWSLGVLL  254
            + R  +++     A + VEG    L    G P Y  PEV+R G  Y G+ AD+WS GV+L
Sbjct  178  DERNNIKVADFGMASLQVEGS--MLETSCGSPHYACPEVIR-GEKYDGRKADVWSCGVIL  234

Query  255  YTMLVGRYPFNDAEHASLFAKISRGQFAVPEGLSPRARCLIRSLLRKEPSERPYAEDVPR  314
            Y +LVG  PF+D    +L  K+ RG F +P  +    + L+R+++  +P +R    DV +
Sbjct  235  YALLVGALPFDDDNLRNLLEKVKRGVFHIPHFVPADVQSLLRAMIEVDPGKRYSLADVFK  294

Query  315  HPWLAKPLRVCP  326
            HPW++   +  P
Sbjct  295  HPWVSGTTKADP  306



Lambda      K        H
   0.323    0.145    0.461 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 845836338


Query= XP_003392936.1 sterol regulatory element-binding protein 1 [Bombus
terrestris]

Length=1021
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q24146_DROME  unnamed protein product                                 441     3e-137
Q9VW37_DROME  unnamed protein product                                 440     5e-137
Q9XX00_CAEEL  unnamed protein product                                 132     5e-31 
Q86MJ3_CAEEL  unnamed protein product                                 53.9    4e-07 
Q86MJ4_CAEEL  unnamed protein product                                 53.9    5e-07 


>Q24146_DROME unnamed protein product
Length=1113

 Score = 441 bits (1134),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 318/864 (37%), Positives = 453/864 (52%), Gaps = 105/864 (12%)

Query  239   KVQINRLSTNTHIGVPRVKEVKRSAHNAIERRYRTSINDKIIELKNIIVGVDAKLNKSAI  298
             KV INR+        P+VKEVKRSAHNAIERRYRTSINDKI ELKN++VG  AKLNKSA+
Sbjct  270   KVPINRVQ-------PKVKEVKRSAHNAIERRYRTSINDKINELKNLVVGEQAKLNKSAV  322

Query  299   LRKTIDYIRFLQNSNARLKAENMSLK---LAAQRQNLRDLLVCGE---------------  340
             LRK+ID IR LQ  N  LKAE   L+   +A     ++DLL  G                
Sbjct  323   LRKSIDKIRDLQRQNHDLKAELQRLQRELMARDGSKVKDLLQLGTRPGRASKKRRESSQT  382

Query  341   ------LTPPRSDSSESSLSPAPAPLS-PQSP----SSIKDDPDLLQNVDSTSVLTN-QG  388
                   LTPPRSD S+ SLSP  + +S P SP    ++         N +   V ++ +G
Sbjct  383   FTTDAGLTPPRSDESDPSLSPMHSDISLPPSPYGGSTASCSSGSSSSNEEPLVVPSSMRG  442

Query  389   MRDHTRLTICGFMLLFLAFNPLGFLINNVGRFNSDYINTKLDG-RTILNYQDQSDLEN--  445
             M  H+RL +C FM   LA NP    +   G ++S+     + G R IL+Y    D+E   
Sbjct  443   MATHSRLGLCMFMFAILAVNPFKTFLQR-GHYDSNDDLGDMSGQRRILSY----DVEGEG  497

Query  446   -PVW-SNVFLWLTNAILLIGGLCRLLLYGDPILPSDSKIFLELHRWRRQAEFNISKNEYS  503
               VW  + ++WL N  L++G L +LL+YGDP L + +  + + HR R  A+F  S+ + S
Sbjct  498   FAVWQQSSWIWLLNFTLMLGCLVKLLVYGDPQLDAQTDAYCQ-HRQR--ADFYFSQGQSS  554

Query  504   QACRDLHQCLQYLGRPYPSSRAEIWLATMWQIIRQLLHKLWIGKWI-LYTHKWFSEKTTR  562
             QA      CL   G   P+SR E +L T WQ +R L H+LW+G+ +   +   FS   +R
Sbjct  555   QAYAGYLNCLHMFGLSLPASRLECYLQTTWQFLRFLFHRLWLGRVLSRRSGGLFSNAASR  614

Query  563   QQAEISAMEMAIIYQHMLCLHLSEGSKSGTL---YLALSAVNYAEATGETIPKSLLAEIY  619
             +QA  SA E+A+++  +  L L+     G +    +AL A N AE     +       I+
Sbjct  615   KQALASARELALLFNRLNQLQLTGNGSRGDMNGIMMALFASNMAEVAHNLLTPRETICIH  674

Query  620   INVALCFKHS----LFPFIHKYYLGKARTLLSSCAVPPK---LKWIMSDEGTKFLAFQKW  672
             +  AL  K S    L  F  +YY+ +AR          +   L+W  +  G ++ A   +
Sbjct  675   VMTALRMKRSAPKWLQQFFARYYMSRARQECGRTRATEQTQELRWAFTAYGYRYCATHVF  734

Query  673   QY-----GEQPDNEFTSQTSKADPLSYASRAYRDYLIGHCLRILTG------------TV  715
              Y     GEQ D  FT   +  DP ++  + YR++L+   ++ L G              
Sbjct  735   TYDLSDSGEQ-DGFFTRLRNPCDPAAHVIKQYREHLLFKSIQCLVGAGHKSGGLPTSSVS  793

Query  716   GDAHLSSILEYGQTIMASAGIDAGFLCTDKVTVTHCEDEIG---LWWGAVIYVAACWRLK  772
             G+A      ++  TI+++       L   K T+   EDE     +WW  V+  A  W L 
Sbjct  794   GEAEQLQQQQHSGTIVSNVLKYTSLL---KDTLWADEDERDTNVVWWADVLETAVHWLLG  850

Query  773   EDD--SQAWSIVESKFPYEKCYQLCNNNNSISPLPYIVLNAL--------QAAKATTKSV  822
             ED    Q +  ++ + P +   Q C  N+ +    + VL A          A   + K +
Sbjct  851   EDTLAEQLYGRIK-QMPTQ--LQQCGENDHLPKALHAVLRAKMILLKNNGNALDKSLKQL  907

Query  823   SMRFIDQAGILLEQCLVYYNCKQQSSQNVLLTQLWICDWLLEMRTTLWQ----ELDNDLE  878
                  D++ + L++CL   N    +    LL QL  CDWLLE RT LW+     +++D  
Sbjct  908   VNILCDESSVELQECLT-VNRITDAKGIKLLFQLLTCDWLLETRTALWELEHMNMEDDGF  966

Query  879   KLTTNISLGGFQRDLACLRQLCQHIPSTLARVFVYEATTRIMAGATPVKTQILLDRSLHH  938
                    L  FQ DL  LR + ++IP+  +R+++YEA  R+MAGA+P  TQ LLDRSL  
Sbjct  967   YQVPGEVLEKFQTDLNSLRNIVENIPNAQSRIYLYEAVCRLMAGASPCPTQQLLDRSLRS  1026

Query  939   RNSRSSIICG-KDRSQDQYT-GEREHAVALCLACRHLPPLLLASPGERAGMLAEAAKTLE  996
             RN+ SSI CG KDR Q  +  GERE A A+ +AC++LPP LL+SPGERAGMLAEAAKTLE
Sbjct  1027  RNAHSSIFCGSKDRRQQNFVGGERERASAMYVACKYLPPALLSSPGERAGMLAEAAKTLE  1086

Query  997   RVGDRKRLQECYKLMRQLGPAISA  1020
             +VGD+++L+ECY+LM+ LG  I +
Sbjct  1087  KVGDKRKLKECYQLMKSLGNGIGS  1110


>Q9VW37_DROME unnamed protein product
Length=1113

 Score = 440 bits (1132),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 318/864 (37%), Positives = 454/864 (53%), Gaps = 105/864 (12%)

Query  239   KVQINRLSTNTHIGVPRVKEVKRSAHNAIERRYRTSINDKIIELKNIIVGVDAKLNKSAI  298
             KV INR+        P+VKEVKRSAHNAIERRYRTSINDKI ELKN++VG  AKLNKSA+
Sbjct  270   KVPINRVQ-------PKVKEVKRSAHNAIERRYRTSINDKINELKNLVVGEQAKLNKSAV  322

Query  299   LRKTIDYIRFLQNSNARLKAENMSLK---LAAQRQNLRDLLVCGE---------------  340
             LRK+ID IR LQ  N  LKAE   L+   +A     ++DLL  G                
Sbjct  323   LRKSIDKIRDLQRQNHDLKAELQRLQRELMARDGSKVKDLLQLGTRPGRASKKRRESSQT  382

Query  341   ------LTPPRSDSSESSLSPAPAPLS-PQSP----SSIKDDPDLLQNVDSTSVLTN-QG  388
                   LTPPRSD S+ SLSP  + +S P SP    ++         N +   V ++ +G
Sbjct  383   FTTDAGLTPPRSDESDPSLSPMHSDISLPPSPYGGSTASCSSGSSSSNEEPLVVPSSMRG  442

Query  389   MRDHTRLTICGFMLLFLAFNPLGFLINNVGRFNSDYINTKLDG-RTILNYQDQSDLEN--  445
             M  H+RL +C FM   LA NP    +   G ++S+     + G R IL+Y    D+E   
Sbjct  443   MATHSRLGLCMFMFAILAVNPFKTFLQR-GHYDSNDDLGDMSGQRRILSY----DVEGEG  497

Query  446   -PVW-SNVFLWLTNAILLIGGLCRLLLYGDPILPSDSKIFLELHRWRRQAEFNISKNEYS  503
               VW  + ++WL N  L++G L +LL+YGDP L + +  + + HR R  A+F  S+ + S
Sbjct  498   FAVWQQSSWIWLLNFTLMLGCLVKLLVYGDPQLDAQTDAYCQ-HRQR--ADFYFSQGQSS  554

Query  504   QACRDLHQCLQYLGRPYPSSRAEIWLATMWQIIRQLLHKLWIGKWI-LYTHKWFSEKTTR  562
             QA      CL   G   P+SR E +L T WQ +R L H+LW+G+ +   +   FS   +R
Sbjct  555   QAYAGYLNCLHMFGLSLPASRLECYLQTTWQFLRFLFHRLWLGRVLSRRSGGLFSNAASR  614

Query  563   QQAEISAMEMAIIYQHMLCLHLSEGSKSGTL---YLALSAVNYAEATGETIPKSLLAEIY  619
             +QA  SA E+A+++  +  L L+     G +    +AL A N AE     +       I+
Sbjct  615   KQALASARELALLFNRLNQLQLTGNGSRGDMNGIMMALFASNMAEVAHNLLTPRETICIH  674

Query  620   INVALCFKHS----LFPFIHKYYLGKART---LLSSCAVPPKLKWIMSDEGTKFLAFQKW  672
             +  AL  K S    L     +YY+ +AR    L  +     +L+W  +  G ++ A   +
Sbjct  675   VMTALRMKRSAPKWLQQLFARYYMSRARQECGLTRATEQTQELRWAFTAYGYRYCATHVF  734

Query  673   QY-----GEQPDNEFTSQTSKADPLSYASRAYRDYLIGHCLRILTG------------TV  715
              Y     GEQ D  FT   +  DP ++  + YR++L+   ++ L G              
Sbjct  735   TYDLSDSGEQ-DGFFTRLRNPCDPAAHVIKQYREHLLFKAIQCLVGAGHKSGGLPTSSVS  793

Query  716   GDAHLSSILEYGQTIMASAGIDAGFLCTDKVTVTHCEDEIG---LWWGAVIYVAACWRLK  772
             G+A      ++  TI+++       L   K T+   EDE     +WW  V+  A  W L 
Sbjct  794   GEAEQLQQQQHSGTIVSNVLKYTSLL---KDTLWADEDERDTNVVWWADVLETAVHWLLG  850

Query  773   EDD--SQAWSIVESKFPYEKCYQLCNNNNSISPLPYIVLNAL--------QAAKATTKSV  822
             ED    Q +  ++ + P +   Q C  N+ +    + VL A          A   + K +
Sbjct  851   EDTLAEQLYGRIK-QMPTQ--LQQCGENDHLPKALHAVLRAKMILLKNNGNALDKSLKQL  907

Query  823   SMRFIDQAGILLEQCLVYYNCKQQSSQNVLLTQLWICDWLLEMRTTLWQ----ELDNDLE  878
                  D++ + L++CL   N    +    LL QL  CDWLLE RT LW+     +++D  
Sbjct  908   VNILCDESSVELQECLT-VNRITDAKGIKLLFQLLTCDWLLETRTALWELEHMNMEDDGF  966

Query  879   KLTTNISLGGFQRDLACLRQLCQHIPSTLARVFVYEATTRIMAGATPVKTQILLDRSLHH  938
                    L  FQ DL  LR + ++IP+  +R+++YEA  R+MAGA+P  TQ LLDRSL  
Sbjct  967   YQVPGEVLEKFQTDLNSLRNIVENIPNAQSRIYLYEAVCRLMAGASPCPTQQLLDRSLRS  1026

Query  939   RNSRSSIICG-KDRSQDQYT-GEREHAVALCLACRHLPPLLLASPGERAGMLAEAAKTLE  996
             RN+ SSI CG KDR Q  +  GERE A A+ +AC++LPP LL+SPGERAGMLAEAAKTLE
Sbjct  1027  RNAHSSIFCGSKDRRQQNFVGGERERASAMYVACKYLPPALLSSPGERAGMLAEAAKTLE  1086

Query  997   RVGDRKRLQECYKLMRQLGPAISA  1020
             +VGD+++L+ECY+LM+ LG  I +
Sbjct  1087  KVGDKRKLKECYQLMKSLGNGIGS  1110


>Q9XX00_CAEEL unnamed protein product
Length=1113

 Score = 132 bits (332),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 115/431 (27%), Positives = 198/431 (46%), Gaps = 62/431 (14%)

Query  245  LSTNTHIGVPRVKEVKRSAHNAIERRYRTSINDKIIELKNIIVGVDAKLNKSAILRKTID  304
            +S  T I V R K  +R+AHN IE++YR SIND+I +LK ++ G +AKL+KSA LR+ I+
Sbjct  341  MSQGTTIIVRRPKTERRTAHNLIEKKYRCSINDRIQQLKVLLCGDEAKLSKSATLRRAIE  400

Query  305  YIRFLQNSNARLKAENMSLKLAAQRQNLRDLLVCGELTPPRSDSSESSLSPAPAPLSPQS  364
            +I  +++ N  LK     ++   Q   L                      P P P+    
Sbjct  401  HIEEVEHENQVLKHHVEQMRKTLQNNRL----------------------PYPEPIQYTE  438

Query  365  PSS--------IKDDPDLLQNVDSTSVLTNQGMRD-HTRLTICGFMLLFLAFNPLGFLIN  415
             S+             +  ++  ST+     G RD  +++T+   +L  L FNP+G L  
Sbjct  439  YSARSPVESSPSPPRNERKRSRMSTTTPMKNGTRDGSSKVTLFAMLLAVLIFNPIGLLAG  498

Query  416  NV---GRFNSDYINTKLDGRTILNYQDQSDLENPVWSN-----VFLWLTNAILLIGGLCR  467
            +           I +  +   +++  D +      W        ++W+ N +++I  + +
Sbjct  499  SAIFSKAAAEAPIASPFEHGRVIDDPDGTSTRTLFWEGSIINMSYVWVFNILMIIYVVVK  558

Query  468  LLLYGDPILPSDSKIFLELHRWRRQAEFNISKNEYSQACRDLHQCLQYLGRPYPSSRAEI  527
            LL++GDP+    S  +      R +A   ++      A R   +CL  L R  PS   + 
Sbjct  559  LLIHGDPVQDFMSVSWQTFVTTREKARAELNSGNLKDAQRKFCECLATLDRSLPSPGVDS  618

Query  528  WLATMWQIIRQLLHKLWIGKWILYTHKWFSEKTTRQQAEI--SAMEMAIIYQHMLCLHLS  585
              +  W+ +R LL+ LWIG++I    +     TT+  + +  S  + A++Y  +  LHL 
Sbjct  619  VFSVGWECVRHLLNWLWIGRYIARRRR----STTKPVSVVCRSHAQTAVLYHEIHQLHLM  674

Query  586  ----------EGSKSGTLYLALSAVNYAEATG---ETIPKSLLAEIYINVA----LCFKH  628
                      E S    L+++L AVN AEA G   + +P++++A+IYI+ +    L   +
Sbjct  675  GITGNFEDTYEPSALTGLFMSLCAVNLAEAAGASNDGLPRAVMAQIYISASIQCRLALPN  734

Query  629  SLFPFIHKYYL  639
             L PF   Y+L
Sbjct  735  LLAPFFSGYFL  745


>Q86MJ3_CAEEL unnamed protein product
Length=439

 Score = 53.9 bits (128),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 43/76 (57%), Gaps = 9/76 (12%)

Query  260  KRSAHNAIERRYRTSINDKIIELKNII---VGVDAKLNKSAILRKTIDYIRFLQNSNARL  316
            K+  HN IERR R +IND+I EL  ++      D KLNK  IL+ + DYIR LQ      
Sbjct  179  KKDIHNMIERRRRYNINDRIKELGQMLPKNTSEDMKLNKGTILKASCDYIRVLQ------  232

Query  317  KAENMSLKLAAQRQNL  332
            K    ++K   Q+++L
Sbjct  233  KDREQAMKTQQQQKSL  248


>Q86MJ4_CAEEL unnamed protein product
Length=464

 Score = 53.9 bits (128),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 43/76 (57%), Gaps = 9/76 (12%)

Query  260  KRSAHNAIERRYRTSINDKIIELKNII---VGVDAKLNKSAILRKTIDYIRFLQNSNARL  316
            K+  HN IERR R +IND+I EL  ++      D KLNK  IL+ + DYIR LQ      
Sbjct  204  KKDIHNMIERRRRYNINDRIKELGQMLPKNTSEDMKLNKGTILKASCDYIRVLQ------  257

Query  317  KAENMSLKLAAQRQNL  332
            K    ++K   Q+++L
Sbjct  258  KDREQAMKTQQQQKSL  273



Lambda      K        H
   0.323    0.145    0.461 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 845836338


Query= XP_003392938.1 uncharacterized protein LOC100642190 isoform X1
[Bombus terrestris]

Length=467
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VE96_DROME  unnamed protein product                                 125     8e-31
YKA7_CAEEL  unnamed protein product                                   90.5    3e-19
Q7K4D1_DROME  unnamed protein product                                 86.3    1e-17
Q9NHP2_DROME  unnamed protein product                                 85.9    1e-17
Q966V0_DROME  unnamed protein product                                 77.8    7e-15


>Q9VE96_DROME unnamed protein product
Length=600

 Score = 125 bits (315),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 115/380 (30%), Positives = 170/380 (45%), Gaps = 69/380 (18%)

Query  122  LIDF-SPPGSPTFTTRSSSDGVSIDSFGSDGNSNPSAFTSSGNTSQTESAFEDDFDFFVI  180
            LI F SPP SPTFT +S+SD     S  S  + +  +  ++G+ SQ ES FEDD+     
Sbjct  249  LISFDSPPSSPTFTQKSNSD---CVSVDSFSSDSNFSSPNNGSVSQPESGFEDDYH----  301

Query  181  SNKKASQN--DPWK-MNSI----TDPFGPLEITNRNTLQSVKHVGDASFFAFNTNNHTNN  233
             ++ ++Q+  DPW+ ++S+     D FG   +     +QS                 ++N
Sbjct  302  RSRPSTQSPLDPWEAVDSVGLGGVDSFGSAPVRQTYQVQS---------------RGSDN  346

Query  234  QASFNQTSLKSTQS--MPTIIRAKPPKPPAPKVLQTKIQQKINNIEIDSRCSNKIVPSAK  291
                 ++ L  TQS  MPTII+        PK+ Q     K              +PS  
Sbjct  347  PLCNGKSLLPPTQSLTMPTIIK--------PKISQKPKAPKPPPFIGGHLPPGYSIPSGY  398

Query  292  SMT-----LDLSNSWQNDSKDNPSPPMPTIPPPAPPLEYLAEINNDLPVSNEE--PYGIA  344
            + +       +            S  +  +      ++ LA  N       EE  PY +A
Sbjct  399  AGSETPPSPPMPKGPPPPPPPASSGGISLLDVINGKVDALALSNGCQGYMEEEVVPYAVA  458

Query  345  LYDFPLIHADDLPFKQGDIIYLIRKINEDWMEGRV-GNQQGIFPINFIDIKIPLPGVPDN  403
            LYDF  I   DL F++G+ IYL+     +W+ GR     +GIFPIN++DIK+PL      
Sbjct  459  LYDFDGIEPGDLSFREGEKIYLLDHPTPEWLRGRTRSGCEGIFPINYVDIKVPLGATGGA  518

Query  404  ---------------------IVTAIYPFKGETPEDLVFDEGEKITVLSRISQDWLYGEC  442
                                     +Y F GE   DL   E E +TVL RI++DWLYGE 
Sbjct  519  AAAPTASAAAPSPSPSQQQLPTALCLYHFPGEVEGDLALQENELVTVLYRINEDWLYGEV  578

Query  443  KDRKGQFPVNYVNRIPCNLP  462
              R+GQFP N+++++P NLP
Sbjct  579  AGRQGQFPANFLDQVPANLP  598


>YKA7_CAEEL unnamed protein product
Length=493

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 71/133 (53%), Gaps = 17/133 (13%)

Query  340  PYGIALYDFPLIHADDLPFKQGDIIYLIRKINEDWMEGRVGNQQ--GIFPINFIDIKIPL  397
            PYGIA +D+    +D++  + GD + + +K++ +W  G   NQ+  GI P +++DIKIPL
Sbjct  194  PYGIAKFDYAPTQSDEMGLRIGDTVLISKKVDAEWFYGENQNQRTFGIVPSSYLDIKIPL  253

Query  398  ----------PGVPDN-----IVTAIYPFKGETPEDLVFDEGEKITVLSRISQDWLYGEC  442
                      P  P         TAIY +      DL F  G +I V +R++++WL GEC
Sbjct  254  KEAFTALPPRPAAPSGSSSGTYATAIYDYNSNEAGDLNFAVGSQIMVTARVNEEWLEGEC  313

Query  443  KDRKGQFPVNYVN  455
              R G FP  +V+
Sbjct  314  FGRSGIFPSQFVD  326


 Score = 75.9 bits (185),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 61/141 (43%), Gaps = 21/141 (15%)

Query  336  SNEEPYGIALYDFPLIHADDLPFKQGDIIYLIRKINEDWMEGRVGNQQGIFPINFIDI--  393
            S+   Y  A+YD+    A DL F  G  I +  ++NE+W+EG    + GIFP  F+D   
Sbjct  270  SSSGTYATAIYDYNSNEAGDLNFAVGSQIMVTARVNEEWLEGECFGRSGIFPSQFVDCPN  329

Query  394  --KIPLP-----------------GVPDNIVTAIYPFKGETPEDLVFDEGEKITVLSRIS  434
              ++P+                    P   VT  Y +      DL   EG+ IT L  I 
Sbjct  330  LYQVPMKQSAPSSAPSYSHPITNNSGPKQTVTVSYDYDSGVASDLRLFEGDVITALEDID  389

Query  435  QDWLYGECKDRKGQFPVNYVN  455
              WL  EC+ ++G  P  ++ 
Sbjct  390  AQWLLAECRGQQGMVPKTFLG  410


>Q7K4D1_DROME unnamed protein product
Length=838

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 67/118 (57%), Gaps = 6/118 (5%)

Query  340  PYGIALYDFPLIHADDLPFKQGDIIYLIRKINEDWMEGRVGNQQGIFPINFIDIKIPLPG  399
            P+  AL+DF    A DL FK+GD+I +  +I+ +W  G+   Q+G FPIN++ + +PLP 
Sbjct  138  PHAYALFDFASGEATDLKFKKGDLILIKHRIDNNWFVGQANGQEGTFPINYVKVSVPLP-  196

Query  400  VPDNIVTAIYPFK-GETPED--LVFDEGEKITVLSRISQDWLYGECKDRKGQFPVNYV  454
            +P  I  A+Y FK G   E+  L F +   I V+ R+  +W  G      G FP+ +V
Sbjct  197  MPQCI--AMYDFKMGPNDEEGCLEFKKSTVIQVMRRVDHNWAEGRIGQTIGIFPIAFV  252


 Score = 57.0 bits (136),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 48/75 (64%), Gaps = 8/75 (11%)

Query  322  PLEYLAEINNDLPVSNEEPYGIALYDFPLIHADD---LPFKQGDIIYLIRKINEDWMEGR  378
            P+ Y+ +++  LP+    P  IA+YDF +   D+   L FK+  +I ++R+++ +W EGR
Sbjct  185  PINYV-KVSVPLPM----PQCIAMYDFKMGPNDEEGCLEFKKSTVIQVMRRVDHNWAEGR  239

Query  379  VGNQQGIFPINFIDI  393
            +G   GIFPI F+++
Sbjct  240  IGQTIGIFPIAFVEL  254


 Score = 33.9 bits (76),  Expect = 0.34, Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 23/40 (58%), Gaps = 2/40 (5%)

Query  355  DLPFKQGDIIYLIRKINEDWMEGRVG--NQQGIFPINFID  392
            +L    GDIIY+ RK    W +G     ++ G+FP +F++
Sbjct  796  ELELHLGDIIYVQRKQKNGWYKGTHARTHKTGLFPASFVE  835


 Score = 30.8 bits (68),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 14/54 (26%), Positives = 30/54 (56%), Gaps = 2/54 (4%)

Query  340  PYG-IALYDFPLIHADDLPFKQGDIIYLIRKINEDWMEGR-VGNQQGIFPINFI  391
            P+G +AL+ +     D+L  K+G +  +  +  + W +G+   +  G+FP N++
Sbjct  422  PWGYLALFPYKPRQTDELELKKGCVYIVTERCVDGWFKGKNWLDITGVFPGNYL  475


>Q9NHP2_DROME unnamed protein product
Length=838

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 67/118 (57%), Gaps = 6/118 (5%)

Query  340  PYGIALYDFPLIHADDLPFKQGDIIYLIRKINEDWMEGRVGNQQGIFPINFIDIKIPLPG  399
            P+  AL+DF    A DL FK+GD+I +  +I+ +W  G+   Q+G FPIN++ + +PLP 
Sbjct  138  PHAYALFDFASGEATDLKFKKGDLILIKHRIDNNWFVGQANGQEGTFPINYVKVSVPLP-  196

Query  400  VPDNIVTAIYPFK-GETPED--LVFDEGEKITVLSRISQDWLYGECKDRKGQFPVNYV  454
            +P  I  A+Y FK G   E+  L F +   I V+ R+  +W  G      G FP+ +V
Sbjct  197  MPQCI--AMYDFKMGPNDEEGCLEFKKSTVIQVMRRVDHNWAEGRIGQTIGIFPIAFV  252


 Score = 57.0 bits (136),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 38/57 (67%), Gaps = 3/57 (5%)

Query  340  PYGIALYDFPLIHADD---LPFKQGDIIYLIRKINEDWMEGRVGNQQGIFPINFIDI  393
            P  IA+YDF +   D+   L FK+  +I ++R+++ +W EGR+G   GIFPI F+++
Sbjct  198  PQCIAMYDFKMGPNDEEGCLEFKKSTVIQVMRRVDHNWAEGRIGQTIGIFPIAFVEL  254


 Score = 33.9 bits (76),  Expect = 0.36, Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 23/40 (58%), Gaps = 2/40 (5%)

Query  355  DLPFKQGDIIYLIRKINEDWMEGRVG--NQQGIFPINFID  392
            +L    GDIIY+ RK    W +G     ++ G+FP +F++
Sbjct  796  ELELHLGDIIYVQRKQKNGWYKGTHARTHKTGLFPASFVE  835


 Score = 30.8 bits (68),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 14/54 (26%), Positives = 30/54 (56%), Gaps = 2/54 (4%)

Query  340  PYG-IALYDFPLIHADDLPFKQGDIIYLIRKINEDWMEGR-VGNQQGIFPINFI  391
            P+G +AL+ +     D+L  K+G +  +  +  + W +G+   +  G+FP N++
Sbjct  422  PWGYLALFPYKPRQTDELELKKGCVYIVTERCVDGWFKGKNWLDITGVFPGNYL  475


>Q966V0_DROME unnamed protein product
Length=1743

 Score = 77.8 bits (190),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 35/117 (30%), Positives = 65/117 (56%), Gaps = 6/117 (5%)

Query  344   ALYDFPLIHADDLPFKQGDIIYLIRKINEDWMEGRVGNQQGIFPINFIDI------KIPL  397
             AL++F    + +L F++GD IY+ R+I+ +W EG      G+ P ++++I      + P 
Sbjct  1493  ALFNFQGQTSKELSFRKGDTIYIRRQIDANWYEGEHNAMIGLLPASYVEIVSRDGARTPS  1552

Query  398   PGVPDNIVTAIYPFKGETPEDLVFDEGEKITVLSRISQDWLYGECKDRKGQFPVNYV  454
                 +    A Y F+ ++  +L  ++GE +T+  R+  +W  G+  +RKG FP +YV
Sbjct  1553  KRPSEGQARAKYNFQAQSGIELSLNKGELVTLTRRVDGNWFEGKIANRKGIFPCSYV  1609


 Score = 51.2 bits (121),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 35/55 (64%), Gaps = 0/55 (0%)

Query  339   EPYGIALYDFPLIHADDLPFKQGDIIYLIRKINEDWMEGRVGNQQGIFPINFIDI  393
             E    A Y+F      +L   +G+++ L R+++ +W EG++ N++GIFP +++++
Sbjct  1557  EGQARAKYNFQAQSGIELSLNKGELVTLTRRVDGNWFEGKIANRKGIFPCSYVEV  1611


 Score = 42.0 bits (97),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 30/54 (56%), Gaps = 0/54 (0%)

Query  401   PDNIVTAIYPFKGETPEDLVFDEGEKITVLSRISQDWLYGECKDRKGQFPVNYV  454
             P  +  A++ F+G+T ++L F +G+ I +  +I  +W  GE     G  P +YV
Sbjct  1487  PKTVARALFNFQGQTSKELSFRKGDTIYIRRQIDANWYEGEHNAMIGLLPASYV  1540


 Score = 38.1 bits (87),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 16/54 (30%), Positives = 31/54 (57%), Gaps = 8/54 (15%)

Query  344   ALYDFPLIHADDLPFKQGDIIYLIRKINEDWMEGRVGNQQ-----GIFPINFID  392
             ALY +   ++D+L   +GD+++++ K ++ W    VG  Q     G FP N+++
Sbjct  1691  ALYKYRPQNSDELELLEGDVVHVLEKCDDGWF---VGTSQRTGCFGTFPGNYVE  1741


 Score = 34.3 bits (77),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 16/52 (31%), Positives = 26/52 (50%), Gaps = 2/52 (4%)

Query  407   AIYPFKGETPEDLVFDEGEKITVLSRISQDWLYGECKDRK--GQFPVNYVNR  456
             A+Y ++ +  ++L   EG+ + VL +    W  G  +     G FP NYV R
Sbjct  1691  ALYKYRPQNSDELELLEGDVVHVLEKCDDGWFVGTSQRTGCFGTFPGNYVER  1742



Lambda      K        H
   0.323    0.145    0.461 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 845836338


Query= XP_003392942.1 proteasome subunit alpha type-1 [Bombus terrestris]

Length=277
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PSA1_DROME  unnamed protein product                                   335     3e-116
PSA1_DICDI  unnamed protein product                                   311     2e-107
Q9VK14_DROME  unnamed protein product                                 306     7e-105
PSA1_CAEEL  unnamed protein product                                   283     3e-96 
Q38B02_TRYB2  unnamed protein product                                 275     7e-93 


>PSA1_DROME unnamed protein product
Length=279

 Score = 335 bits (859),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 166/278 (60%), Positives = 215/278 (77%), Gaps = 5/278 (2%)

Query  1    MFRNQYDSDVTVWSPQGRLHQVEYAMEAVKLGSATVGLKNKSHAVLIALKRASSELSAHQ  60
            MFRNQYDSDVTVWSPQGRLHQVEYAMEAVKLG+ATVGLKNK +AVL+AL + +SELS  Q
Sbjct  1    MFRNQYDSDVTVWSPQGRLHQVEYAMEAVKLGTATVGLKNKDYAVLVALCKPTSELSDTQ  60

Query  61   KKIFPIDKHMGISISGLTADARMLSRYMRTECLNYKYSHDDLLPVSRLLASLGNKLQTCT  120
            +KI PID H+GISI+GLTADAR+LSRY+R+ECLNYK+S+D   PVSRL+ +LGNK+QT T
Sbjct  61   RKIIPIDDHLGISIAGLTADARVLSRYLRSECLNYKHSYDTTYPVSRLITNLGNKMQTTT  120

Query  121  QRYDRRPYGVGLLIAGYDDQGPHIYQTCPSSNYFDCKAMAIGARSQSARTYLEKHLNELL  180
            QRYDRRPYGVGLL+AGYD++GPHIYQ  PS+ +F+CKA +IG+RSQSARTYLEK+LN+ L
Sbjct  121  QRYDRRPYGVGLLVAGYDERGPHIYQVTPSATFFNCKANSIGSRSQSARTYLEKNLNKFL  180

Query  181  SCDLDELIKHGLRALRDTLPNE---VDLSVKNVSIAVVGKGTDFKIYDEDAISVYLSQIE  237
                DE+I+HG+RA+  TLP +    D    ++++A+VGK   F I      + +++  +
Sbjct  181  DSSKDEIIRHGIRAILGTLPTDEQGKDAGQYDITVAIVGKDQPFTILSNKDSAKHVAIAK  240

Query  238  DDKRSKPTEPDVEQDSKPPQPPPSDEGPQDPQVTVAMD  275
            ++    P   D +    PP+ P +  GP+DP+V VA +
Sbjct  241  ENDNDTPRNDDDDDRPSPPEEPAA--GPRDPEVLVATE  276


>PSA1_DICDI unnamed protein product
Length=248

 Score = 311 bits (797),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 145/241 (60%), Positives = 186/241 (77%), Gaps = 1/241 (0%)

Query  1    MFRNQYDSDVTVWSPQGRLHQVEYAMEAVKLGSATVGLKNKSHAVLIALKRASSELSAHQ  60
            M+RNQYDSD+T +SP GR+HQ+EYAMEAVK G A V LK+K  AVL++LKR+SSEL ++Q
Sbjct  1    MYRNQYDSDITTFSPSGRIHQIEYAMEAVKQGGAAVALKSKQFAVLVSLKRSSSELGSYQ  60

Query  61   KKIFPIDKHMGISISGLTADARMLSRYMRTECLNYKYSHDDLLPVSRLLASLGNKLQTCT  120
            KKIF +D H+GI+ISGLTADARML  YMR EC NY Y ++  + V RL+  + +K Q  T
Sbjct  61   KKIFVVDDHVGIAISGLTADARMLCNYMRNECSNYNYVYESQMRVERLVTKVADKHQVHT  120

Query  121  QRYDRRPYGVGLLIAGYDDQGPHIYQTCPSSNYFDCKAMAIGARSQSARTYLEKHLNELL  180
            QRY RRPYGVGLL+AGYD  G HIYQTCPS N++D K+++IG+RSQSA+TYLEKH     
Sbjct  121  QRYGRRPYGVGLLVAGYDQLGAHIYQTCPSGNFYDYKSISIGSRSQSAKTYLEKHFESFE  180

Query  181  SCDLDELIKHGLRALRDTLPNEVD-LSVKNVSIAVVGKGTDFKIYDEDAISVYLSQIEDD  239
             C L++LI HGLRALR+T+PN  D L+ KNVSI +VG+G  FKI +E     YL+ +E++
Sbjct  181  ECTLEQLITHGLRALRETIPNTDDTLNSKNVSIGIVGEGQPFKIIEEADAQPYLNLLENE  240

Query  240  K  240
            +
Sbjct  241  E  241


>Q9VK14_DROME unnamed protein product
Length=289

 Score = 306 bits (785),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 149/271 (55%), Positives = 198/271 (73%), Gaps = 11/271 (4%)

Query  1    MFRNQYDSDVTVWSPQGRLHQVEYAMEAVKLGSATVGLKNKSHAVLIALKRASSELSAHQ  60
            MFRNQYD+D T WSPQGRL QVEYAMEAVK G+ATVGLK   +AVL AL R S + +  Q
Sbjct  1    MFRNQYDNDTTTWSPQGRLFQVEYAMEAVKQGAATVGLKGTDYAVLAALCRTSKDTNTLQ  60

Query  61   KKIFPIDKHMGISISGLTADARMLSRYMRTECLNYKYSHDDLLPVSRLLASLGNKLQTCT  120
            +KI P+D H+G+SI+GLTADAR++ +YMRTEC+ Y++S++   PV RL+++LGNKLQT T
Sbjct  61   RKIMPVDDHVGMSIAGLTADARVVCQYMRTECMAYRHSYNAEFPVRRLVSNLGNKLQTTT  120

Query  121  QRYDRRPYGVGLLIAGYDDQGPHIYQTCPSSNYFDCKAMAIGARSQSARTYLEKHLNELL  180
            QRYDRRPYGVGLL+AGYD+QGPHIYQ  P++N  +CKAMAIG+RSQSARTYLE+++    
Sbjct  121  QRYDRRPYGVGLLVAGYDEQGPHIYQVMPTANVLNCKAMAIGSRSQSARTYLERNMESFE  180

Query  181  SCDLDELIKHGLRALRDTLPNEVDLSVKNVSIAVVGKGTDFKIYDEDAISVYLSQIEDDK  240
             CD+DELI H ++A+R +L ++ D+    +++A+VGK   FK++ E     Y+      K
Sbjct  181  DCDMDELICHAIQAIRGSLGSD-DVENLTINVAIVGKDVPFKMFTEAENQKYV------K  233

Query  241  RSKPTEPDVEQDSKPPQPPPSDEGPQDPQVT  271
              K  +P +E D      P S+EG  D  +T
Sbjct  234  LVKAMDPPLEAD----HDPLSEEGMSDDDMT  260


>PSA1_CAEEL unnamed protein product
Length=260

 Score = 283 bits (725),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 129/242 (53%), Positives = 182/242 (75%), Gaps = 0/242 (0%)

Query  1    MFRNQYDSDVTVWSPQGRLHQVEYAMEAVKLGSATVGLKNKSHAVLIALKRASSELSAHQ  60
            MFRNQYD DVTVWSPQGRLHQVEYA+EA+K GSATVG+K+++HAV++ALKRA ++LS+HQ
Sbjct  1    MFRNQYDGDVTVWSPQGRLHQVEYAVEAMKQGSATVGIKSETHAVIVALKRAQNDLSSHQ  60

Query  61   KKIFPIDKHMGISISGLTADARMLSRYMRTECLNYKYSHDDLLPVSRLLASLGNKLQTCT  120
            KK++ ID H G+SI+GL +D R+L+RY++TEC ++++ +   +P+ +L  S+  KLQ  T
Sbjct  61   KKVYEIDTHAGVSIAGLLSDGRILARYLQTECSSWRWDYKQAVPIKKLAESMQLKLQANT  120

Query  121  QRYDRRPYGVGLLIAGYDDQGPHIYQTCPSSNYFDCKAMAIGARSQSARTYLEKHLNELL  180
            Q Y RRP+GVG+LIAGYD  G HI QT PS+        +IGARSQSARTYLE++++   
Sbjct  121  QYYGRRPFGVGILIAGYDKDGAHIIQTDPSAEVVSMHGTSIGARSQSARTYLERNVDNFE  180

Query  181  SCDLDELIKHGLRALRDTLPNEVDLSVKNVSIAVVGKGTDFKIYDEDAISVYLSQIEDDK  240
                ++LI H L ALRDTLP E +L+ +N SI +VGK + F + ++  ++V+L+Q+    
Sbjct  181  KSTPEQLIVHALLALRDTLPAEENLNAQNTSIGIVGKDSPFSLLEDAQVAVHLNQVSTHP  240

Query  241  RS  242
            R+
Sbjct  241  RT  242


>Q38B02_TRYB2 unnamed protein product
Length=266

 Score = 275 bits (704),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 139/266 (52%), Positives = 175/266 (66%), Gaps = 3/266 (1%)

Query  1    MFRNQYDSDVTVWSPQGRLHQVEYAMEAVKLGSATVGLKNKSHAVLIALKRAS-SELSAH  59
            MF+NQYD+D T WSP GRL QVEYA EAV  GSA VG+K   + VL ALKR   S LS++
Sbjct  1    MFKNQYDTDTTTWSPTGRLFQVEYANEAVNNGSAAVGVKGADYVVLTALKRNPVSGLSSY  60

Query  60   QKKIFPIDKHMGISISGLTADARMLSRYMRTECLNYKYSHDDLLPVSRLLASLGNKLQTC  119
            Q+K F +D+H+G++ISGL AD R LSR++RTEC+NY+Y HD   P+  L   +G K Q  
Sbjct  61   QEKAFKLDEHVGMAISGLVADGRALSRFLRTECMNYRYMHDSDAPLVMLADMVGAKHQRH  120

Query  120  TQRYDRRPYGVGLLIAGYDDQGPHIYQTCPSSNYFDCKAMAIGARSQSARTYLEKHLNEL  179
             Q   +RP+GVGLLIAGYD QGP +YQT PS + FD KA A+G RSQ+ARTYLE+H    
Sbjct  121  IQFAGKRPFGVGLLIAGYDRQGPRLYQTVPSGDVFDFKATAMGLRSQAARTYLERHFRGF  180

Query  180  LSCDLDELIKHGLRALRDTLPNEVDLSVKNVSIAVVGKGTDFKIYDEDAISVYLSQIEDD  239
             +CDLDEL+ H LRAL       V+L++KN +IA+VGKGT F I  E+    YL   +  
Sbjct  181  PACDLDELVMHALRALGAATSGGVELNIKNTTIAIVGKGTPFTILTEEEARKYLDGFKTR  240

Query  240  KRSKPTEPDVEQDSKP--PQPPPSDE  263
                P   D E+D      QPP  +E
Sbjct  241  PEDIPAVADNEEDDDELHEQPPDVEE  266



Lambda      K        H
   0.323    0.145    0.461 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 845836338


Query= XP_003392943.1 ER membrane protein complex subunit 8/9 homolog
[Bombus terrestris]

Length=207
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

EMC89_DROME  unnamed protein product                                  166     7e-52
Q93568_CAEEL  unnamed protein product                                 72.4    1e-15
Q580G6_TRYB2  unnamed protein product                                 50.1    2e-07
Q86P95_DROME  unnamed protein product                                 28.1    6.0  
Q9VW54_DROME  unnamed protein product                                 28.1    6.0  


>EMC89_DROME unnamed protein product
Length=203

 Score = 166 bits (420),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 98/215 (46%), Positives = 129/215 (60%), Gaps = 21/215 (10%)

Query  1    MADISFSSRAYCKIILHAAKYPHCAINGLLLGKQNSKSDSKSVELHIEDVIPLFHICLHV  60
            M D   S RAY K+I HAAKYPH A+NGLLL ++ SK      ++ I D IPLFH CL+V
Sbjct  1    MCDYKVSERAYAKLIFHAAKYPHQAVNGLLLAEKTSKGS----QVEIVDAIPLFHQCLYV  56

Query  61   SPMAEIALTMVDQYAIGKGLVLAGYYLANENINDLSTDK-PAHKIADKIAENCGNTLLVV  119
            +PMAE+AL ++D +A  +GLV+AGYY A EN  D   DK PA KIADKI EN  N   VV
Sbjct  57   TPMAEVALMLIDAHAEREGLVIAGYYAAPENFYDNQVDKTPAAKIADKIQENFKNACFVV  116

Query  120  VDNKEITLAMSSNPLRV--------SQFVDGKWKLKDVTDILYDKGVTHTDVLYSLLKAE  171
            VDNK +TL      ++V        +++   K+ L   +D L  +GV+       LLK  
Sbjct  117  VDNKLMTLQHDRAAIQVFNCPGDSGARWSKAKFTLSQASDTL--EGVS------LLLKRG  168

Query  172  EYRNLVDFDNHLDDISLDWQNCKLNKTIEEFMEKY  206
              R+LVDFDNHLD+   +W N  LN+ + +  + Y
Sbjct  169  AMRDLVDFDNHLDNPDKNWTNDFLNQPLNDLQKLY  203


>Q93568_CAEEL unnamed protein product
Length=196

 Score = 72.4 bits (176),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/196 (30%), Positives = 94/196 (48%), Gaps = 16/196 (8%)

Query  11   YCKIILHAAKYPHCAINGLLLGKQNSKSDSKSVELHIEDVIPLFHICLHVSPMAEIALTM  70
            Y  IILH  KYP   + GLL+G  N K D    ++ +   +PL H    ++P  E+A  +
Sbjct  12   YSTIILHCLKYPAKGVFGLLIG--NKKGD----KVTVTSCVPLCHESTPLAPPLELATAL  65

Query  71   VDQYAIGK-GLVLAGYYLANENINDLSTDKPAHKIADKIAE-NCGNTLLVVVDNKEITLA  128
            V     GK G  L G Y +N   +D S +  A ++AD+I+       +LV V N+ +   
Sbjct  66   VH----GKFGASLVGVYFSNATPSDTSLNVYATRLADRISSVTSSAAILVQVMNERLVSD  121

Query  129  MSSNPLRVSQFVDGKWKLKDVTDILYDKGVTHTDVLYSLLKAEEYRNLVDFDNHLDDISL  188
               + L   +     WK    T  ++ +G      L ++++ + YR L DF+NHLD+   
Sbjct  122  CEQDRLVAYEKDGDSWK---ETKTIF-QGSNFLRGLQAVIQKKLYRELSDFENHLDNPEF  177

Query  189  DWQNCKLNKTIEEFME  204
            D+ N  L+  + +  E
Sbjct  178  DFYNTNLSNKLVQVAE  193


>Q580G6_TRYB2 unnamed protein product
Length=272

 Score = 50.1 bits (118),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/161 (24%), Positives = 66/161 (41%), Gaps = 15/161 (9%)

Query  45   LHIEDVIPLFHICLHVSP--MAEIALTMVDQYAIGKGLVLAGYYLANENINDLSTD----  98
            + + D +PLFH  +   P  M  +A   V  YA  KGLVL GYY+ANE   D +      
Sbjct  105  IFVADAVPLFHTIIMTDPHPMMTVAYAQVSSYARTKGLVLLGYYIANERTGDTAVCSLTE  164

Query  99   ---KPAHKIADKIAENCGNTLLVVVDNKEITLAMSSNPLRVSQFVD------GKWKLKDV  149
               +  H     + E     ++       + +  +      S F D      G+W    +
Sbjct  165  NVLRMLHSRKSGVHEPLLWRIVSTPSGDSVDVRGAYYNSGSSSFTDAPSLTFGRWNSDTL  224

Query  150  TDILYDKGVTHTDVLYSLLKAEEYRNLVDFDNHLDDISLDW  190
            +    +      +   + + A +   LVDF++HL+ + L++
Sbjct  225  SCETTEPKAAAVEAFENSMDALKQFQLVDFEDHLESVQLNY  265


>Q86P95_DROME unnamed protein product
Length=453

 Score = 28.1 bits (61),  Expect = 6.0, Method: Compositional matrix adjust.
 Identities = 19/62 (31%), Positives = 33/62 (53%), Gaps = 2/62 (3%)

Query  145  KLKDVTDILYDKGVTHTDVLYSLLKAEEYRNLVDFD-NHLDDISLDWQNCKLNKTIEEFM  203
            ++ D+ D+L    V H  + Y+  +  + RNL +     +D   LDWQ+    KTI E++
Sbjct  105  RVADIADLLKTYKVKHRVLTYNFQEKID-RNLAEVQPESIDASQLDWQHFFHLKTIYEWL  163

Query  204  EK  205
            +K
Sbjct  164  DK  165


>Q9VW54_DROME unnamed protein product
Length=919

 Score = 28.1 bits (61),  Expect = 6.0, Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 33/57 (58%), Gaps = 3/57 (5%)

Query  132  NPLRVSQFVDGKWKLKDVTDILYDKGVTHTDVLYSLLKAEEYRNLVDFDNHLDDISL  188
            NP+ V+  +     L DV +++ ++  +H  +LY+L+ A + R L+ FD  L+ + +
Sbjct  800  NPMAVAGLMATLVSLLDVKNLILNR--SHY-LLYTLVPAMQARMLITFDEELNQLQV  853



Lambda      K        H
   0.323    0.145    0.461 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 845836338


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Aug 1, 2023  12:07 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_003392944.1 cysteine-rich hydrophobic domain-containing protein 2
[Bombus terrestris]

Length=165
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q581Q1_TRYB2  unnamed protein product                                 28.1    3.6  
Q9VHM3_DROME  unnamed protein product                                 27.3    6.6  


>Q581Q1_TRYB2 unnamed protein product
Length=429

 Score = 28.1 bits (61),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 22/82 (27%), Positives = 33/82 (40%), Gaps = 24/82 (29%)

Query  69   MRINSVLKKTLPVNVKWLFCGCVCCCCTLGCSL------WPVICLSKRTQHSLNKLL---  119
            +RI+SV +++           C  C  T G         W V CL ++T   L K+    
Sbjct  208  VRIDSVFQQSE---------ACDVCAVTKGHGFTGVVKRWGVACLPRKTHRGLRKVACIG  258

Query  120  EWENSRLYHTL------GLHWR  135
             W  SR+ +T+      G H R
Sbjct  259  AWHPSRVMYTVARAGQHGYHHR  280


>Q9VHM3_DROME unnamed protein product
Length=418

 Score = 27.3 bits (59),  Expect = 6.6, Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 7/57 (12%)

Query  2    ADFDAIYEEEEENEQNLE-----EQYVKMVPDPIVIRGAGNMTVFGLSNRFDSEFPN  53
            AD+D+I  E+EE +Q LE     E  V  V D  V      + V  L N  D E+ +
Sbjct  167  ADYDSIMAEDEEQQQTLELDEDTELIVGDVNDAYVYDSDDEVAV--LDNVLDDEYEH  221



Lambda      K        H
   0.324    0.139    0.448 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1051796556


Query= XP_003392945.1 60S ribosomal protein L21 [Bombus terrestris]

Length=159
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9V9M7_DROME  unnamed protein product                                 256     6e-89
RL21_DICDI  unnamed protein product                                   146     1e-45
Q8ILK3_PLAF7  unnamed protein product                                 131     2e-39
Q4FKD4_TRYB2  unnamed protein product                                 129     7e-39
I7LW01_TETTS  unnamed protein product                                 31.2    0.40 


>Q9V9M7_DROME unnamed protein product
Length=159

 Score = 256 bits (654),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 139/159 (87%), Gaps = 0/159 (0%)

Query  1    MTNSKGYRRGTRDLFSRKFRKHGTIPLSTYMKVYKVGDIVDIKGNGAVQKGMPYKVYHGK  60
            MTNSKGYRRGTRD+FSR FRKHG IPLSTYM+V+K+GDIVDIKG+GAVQKG+PYK YHGK
Sbjct  1    MTNSKGYRRGTRDMFSRPFRKHGVIPLSTYMRVFKIGDIVDIKGHGAVQKGLPYKAYHGK  60

Query  61   TGRVFNVTPHALGVIVNKRVRGRIIAKRINVRIEHLTHSKCREDFLQRVKENEKLKELAK  120
            TGR+FNVT HA+GVIVNKRVRG+I+AKR+NVRIEH+ HSKCREDFL+RVKENE+L + AK
Sbjct  61   TGRIFNVTQHAVGVIVNKRVRGKILAKRVNVRIEHIHHSKCREDFLRRVKENERLLKEAK  120

Query  121  EKNIKVKLKRQPAEPRPGHIVSGRENPILLAPIPYEFIA  159
            EK   V LKRQP +P+  H V   E PI LAPIPYEFIA
Sbjct  121  EKGQWVSLKRQPEQPKKAHFVKKLEEPIALAPIPYEFIA  159


>RL21_DICDI unnamed protein product
Length=160

 Score = 146 bits (369),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 106/159 (67%), Gaps = 1/159 (1%)

Query  1    MTNSKGYRRGTRDLFSRKFRKHGTIPLSTYMKVYKVGDIVDIKGNGAVQKGMPYKVYHGK  60
            M +S G R  TR LFSR FR HG +  +T+++ +++GD VDIK  G V KGMP+K YHG+
Sbjct  1    MPHSFGLRARTRYLFSRGFRNHGLLQTTTFLRTFRLGDYVDIKATGNVHKGMPHKFYHGR  60

Query  61   TGRVFNVTPHALGVIVNKRVRGRIIAKRINVRIEHLTHSKCREDFLQRVKENEKLKELAK  120
            TGRV+NVTP A+GVI+NKRV  RIIAK+I+VR EH+  S      L+R++EN+K    AK
Sbjct  61   TGRVWNVTPRAVGVIINKRVGPRIIAKKIHVRTEHVKPSNSMAAHLKRIQENKKAVVEAK  120

Query  121  EKNIKVKLKRQPAEPRPGHIVSGRENPIL-LAPIPYEFI  158
            +    V ++R PA P+ G  V+ R    + + P+ YE +
Sbjct  121  KAGKWVDVRRNPAAPKDGFFVNPRNTEFVEVKPVKYELL  159


>Q8ILK3_PLAF7 unnamed protein product
Length=161

 Score = 131 bits (329),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 100/153 (65%), Gaps = 1/153 (1%)

Query  4    SKGYRRGTRDLFSRKFRKHGTIPLSTYMKVYKVGDIVDIKGNGAVQKGMPYKVYHGKTGR  63
            S+G R GTR  FS+KFRKHG    + Y++    GD VDI  +   QKGMP+  YHGKTG+
Sbjct  5    SRGKRSGTRYKFSKKFRKHGECTANKYLEKLNYGDYVDIVCDSTQQKGMPFNYYHGKTGK  64

Query  64   VFNVTPHALGVIVNKRVRGRIIAKRINVRIEHLTHSKCREDFLQRVKENEKLKELAKEKN  123
            +F++T   +GV+VNKRV+ RI  K++ VRIEH+  S+C EDFL R  +N +L + AK KN
Sbjct  65   IFHITKRGVGVLVNKRVKHRIEQKKVCVRIEHVRKSRCNEDFLLRKIKNAELIKEAKLKN  124

Query  124  IKVKLKRQPAEPRPGHIVSGRENPIL-LAPIPY  155
              + +KR+   P+P  ++    + I+ + P+P+
Sbjct  125  EHINIKRKTEGPKPAAMIKVPPSKIITIEPLPF  157


>Q4FKD4_TRYB2 unnamed protein product
Length=159

 Score = 129 bits (325),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 85/120 (71%), Gaps = 0/120 (0%)

Query  1    MTNSKGYRRGTRDLFSRKFRKHGTIPLSTYMKVYKVGDIVDIKGNGAVQKGMPYKVYHGK  60
            M +S GY+ GTR LF++KFRKHG   +ST +  +KVGD VD+  + AV+ GMP+K YHG+
Sbjct  1    MVHSHGYKCGTRHLFAKKFRKHGVPSVSTILTNFKVGDYVDVVADAAVRAGMPHKYYHGR  60

Query  61   TGRVFNVTPHALGVIVNKRVRGRIIAKRINVRIEHLTHSKCREDFLQRVKENEKLKELAK  120
            TG V+NVTP  +GVI+NK VR R + KRI VR EH+  S+C+E F Q++K+ E  +   K
Sbjct  61   TGIVWNVTPRGVGVIINKPVRNRTVRKRICVRFEHVRKSRCQEAFKQKLKDLEAFRAAKK  120


>I7LW01_TETTS unnamed protein product
Length=1140

 Score = 31.2 bits (69),  Expect = 0.40, Method: Composition-based stats.
 Identities = 22/72 (31%), Positives = 34/72 (47%), Gaps = 0/72 (0%)

Query  51   GMPYKVYHGKTGRVFNVTPHALGVIVNKRVRGRIIAKRINVRIEHLTHSKCREDFLQRVK  110
            G  ++ Y GKT  +  +T     VI  K +R   + KRI V I     S   E F + + 
Sbjct  2    GKVFQFYEGKTVLLTGITGFLGKVIFEKFLRTLPMVKRIYVLIRSKKGSPVEERFKKVIH  61

Query  111  ENEKLKELAKEK  122
            ++E  + L +EK
Sbjct  62   DSEIFERLRQEK  73



Lambda      K        H
   0.324    0.139    0.448 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1051796556


Query= XP_003392947.2 nucleotide exchange factor Sil1 isoform X1 [Bombus
terrestris]

Length=457
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SIL1_DROME  unnamed protein product                                   174     2e-49
FORG_DICDI  unnamed protein product                                   31.2    2.0  
H2KZY3_CAEEL  unnamed protein product                                 30.8    2.4  
PP4R1_CAEEL  unnamed protein product                                  29.6    7.9  


>SIL1_DROME unnamed protein product
Length=429

 Score = 174 bits (442),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 122/421 (29%), Positives = 207/421 (49%), Gaps = 52/421 (12%)

Query  5    SNTIILTCLLLLPVVLGDLEKNETTFVPTREWQTVKRGTSIPAGLHVRHNFETGVTEAKL  64
             + +IL CL +      D + N+  FV T EWQT+  G +IP GLHVR N +TG+ EAKL
Sbjct  11   GSVLILGCLQVAAATETDNKTND--FVATDEWQTIAEGQAIPRGLHVRINLQTGLKEAKL  68

Query  65   MDGNDLEEEDSNKNLNSTNTNTNSVILHPENAILEEKEHVPAEKSDLFNYSIEELKDRLK  124
            +D     E +   +L S   + N+   H +N  L              +Y          
Sbjct  69   LD-----ESERGTSLQSQPDDQNARESHDDNEPLA------------LDYK---------  102

Query  125  KMKQEGEDFPEIDIEHSKKIRQKFRDYEALKKEFKAFEINITVSDSDLLSSYIKKFQTYK  184
                     P+I  E  ++++++ + Y  L+K +K F+ N   +D +L+   I +F+ + 
Sbjct  103  ---------PDIIEESIRRVKEQKKSYAELRKAYKEFQKNFR-TDGELIVQLIDQFRNF-  151

Query  185  NRVTMGILTTAETERILDILYNLEYLLHHIDNAKAFADMEGMNKIISP-CLNGTNNEIKI  243
            +R  +     +E    LD L NLEYLLH IDNA  F D  G++ ++ P  +N T+  +++
Sbjct  152  SRTPL----ESEMRSKLDCLENLEYLLHQIDNALMFIDNGGLDDVLLPIVVNDTSTSLRV  207

Query  244  EALRLLGAAVQSNPKVQLKALENDFVQKLLHILSTSSKTDLKSRCLFALGALIRQFPIGQ  303
             A+R+LG+   +NPK Q+K  E +F   L  IL++S      S  L A GAL+R+FP+ Q
Sbjct  208  SAMRVLGSLASNNPKAQIKVFEKNFGSHLAQILTSSGNVGEISAALHAFGALLRKFPLAQ  267

Query  304  KVWVDHGGIEIFGQIL--VDGQLQVQMKVMKLINDLIVERQHIEHIT-DVAQQELRVKAY  360
            +  +   G +   ++L   D +L+ + KV+ LI+DL++E++ +  ++ D  +    +  Y
Sbjct  268  QRVLSTSGTQALIKVLQSPDVELRSKAKVVTLISDLVLEKRSVLDVSKDDPEASSTMAQY  327

Query  361  SAADIERKLLKYSYCDHLSNLMITSFKIDLSDLLRTNYEFLKTISDSMITAAPICIDKWR  420
               D E  L    YC  +  ++   F      LL    E ++  + ++ T   +C   W 
Sbjct  328  VLLDFESWLKTPGYCAAVDTVLTKEFL-----LLLEQPEVVEQFATALETTEDMCTSTWS  382

Query  421  K  421
            +
Sbjct  383  Q  383


>FORG_DICDI unnamed protein product
Length=1074

 Score = 31.2 bits (69),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 31/58 (53%), Gaps = 1/58 (2%)

Query  182  TYKNRVTMGILTTAETERILDILYNLEYLLHHIDNAKAFADMEGMNKIISPCLNGTNN  239
            TY++   +  L  +ET    DI+++L+Y L   + A++F +  GM  I+    NG  N
Sbjct  116  TYRSSKWVKALNDSETNE-KDIMFHLKYKLQENEFAESFIEQNGMEGILRMVTNGKGN  172


>H2KZY3_CAEEL unnamed protein product
Length=510

 Score = 30.8 bits (68),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 5/68 (7%)

Query  50   HVRHNFETGVTEAKLMDGNDLEEEDSNKN---LNSTNTNTNSVILHPENAILEEKEHVPA  106
            H+R        E+K  +   L E D NK    +N+  T+T SVILH EN I  +  H+  
Sbjct  92   HIRITLALPFDESKWAELETLTETDLNKTPIFINNIRTSTVSVILHLENLI--KSFHLNV  149

Query  107  EKSDLFNY  114
            + +++F +
Sbjct  150  KSAEIFPF  157


>PP4R1_CAEEL unnamed protein product
Length=1562

 Score = 29.6 bits (65),  Expect = 7.9, Method: Compositional matrix adjust.
 Identities = 44/206 (21%), Positives = 89/206 (43%), Gaps = 30/206 (15%)

Query  152  EALKKEFKAFEINITVSDSDLLSSYIKK--FQTYKNRVTMGILT---TAE-----TERIL  201
            E  +  FKA E+ +     D++ +  KK  +   + ++ MG LT   T+E     T ++ 
Sbjct  161  ELFESSFKAIEVRLPF---DVILNDEKKPDWDAIRRKLIMGSLTVNTTSEKPGITTNQMT  217

Query  202  DILYNLEYLLHHID-NAKAFADMEGMNKIISPCLNGTNNEIKIEALRLLGAAVQSNPKVQ  260
             I   + +L   +  N + +     ++ I+   + G N+ I+ +++  + A ++ N    
Sbjct  218  AIFDAIPFLFDAVACNPELYEYQNTLSMIVMIAMTG-NSMIRRQSINAVQALMERN----  272

Query  261  LKALENDF-----VQKLLHILSTS----SKTDLKSRCLFALGALIRQFPIGQKVWVDHGG  311
               L+ DF     V  L +I  +        DL+  C+ AL  +I    I  + W+    
Sbjct  273  --MLDQDFMRDGVVPGLFNIYQSGVGAFQSNDLRMECVQALCQVISYDAIHDRRWLFDNF  330

Query  312  IEIFGQILVDGQLQVQMKVMKLINDL  337
            +  F Q+L D  + V+   + +  +L
Sbjct  331  LPRFSQMLKDPTMHVRKSALHIFGNL  356



Lambda      K        H
   0.324    0.139    0.448 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1051796556


Query= XP_003392951.2 protein BCCIP homolog isoform X1 [Bombus terrestris]

Length=301
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TOP2_DROME  unnamed protein product                                   32.7    0.48 
Q387U1_TRYB2  unnamed protein product                                 32.0    0.71 
Q5U117_DROME  unnamed protein product                                 29.6    4.1  
Q9VF24_DROME  unnamed protein product                                 29.3    4.9  
ALDH3_DICDI  unnamed protein product                                  28.9    5.4  


>TOP2_DROME unnamed protein product
Length=1447

 Score = 32.7 bits (73),  Expect = 0.48, Method: Compositional matrix adjust.
 Identities = 16/46 (35%), Positives = 24/46 (52%), Gaps = 0/46 (0%)

Query  155  EDDTEVLGLLINERFVNIPAQISVPLLENLMSDIKKANNKKMSFNF  200
            +D + + GLLIN    N P  + +P LE  ++ I KA  K    +F
Sbjct  524  QDGSHIKGLLINFIHTNWPELLRLPFLEEFITPIVKATKKNEELSF  569


>Q387U1_TRYB2 unnamed protein product
Length=3460

 Score = 32.0 bits (71),  Expect = 0.71, Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 42/90 (47%), Gaps = 2/90 (2%)

Query  114   TVINLSSKQSYPCIQQLRELLTQMTKEHAADTINAMIRKLLEDDTEVLGLLINERFVNIP  173
             T + L+++ S  C   +R ++ Q  ++  +DT   ++    +  T+VLG          P
Sbjct  2326  TALTLAARLS--CNPAVRHIVIQGCQQAGSDTTTVVLSSPSKSSTKVLGWGTLSGGDRSP  2383

Query  174   AQISVPLLENLMSDIKKANNKKMSFNFSYY  203
             A++S P  E L ++++  N      N  YY
Sbjct  2384  ARMSSPCNEGLQNELRIFNCWMSLCNCLYY  2413


>Q5U117_DROME unnamed protein product
Length=639

 Score = 29.6 bits (65),  Expect = 4.1, Method: Compositional matrix adjust.
 Identities = 19/58 (33%), Positives = 28/58 (48%), Gaps = 3/58 (5%)

Query  75   GLADLIIRENYVGSVVKQSADLEGSDDEDTDVNDVFGITT---VINLSSKQSYPCIQQ  129
            GL  L +  +Y G     SA L  S+ + TD+N   G+ T   V++L  +   P  QQ
Sbjct  126  GLYGLNVSTDYEGKGYGWSASLMASEPDSTDINVTLGLQTHRVVVDLLKEVGTPLQQQ  183


>Q9VF24_DROME unnamed protein product
Length=1470

 Score = 29.3 bits (64),  Expect = 4.9, Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 21/38 (55%), Gaps = 0/38 (0%)

Query  103  DTDVNDVFGITTVINLSSKQSYPCIQQLRELLTQMTKE  140
            +TD + +    T +   S+ +YPC Q LR LL+ M + 
Sbjct  581  ETDPHMINYYRTTVTSISETTYPCYQHLRRLLSYMHRH  618


>ALDH3_DICDI unnamed protein product
Length=470

 Score = 28.9 bits (63),  Expect = 5.4, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 26/57 (46%), Gaps = 2/57 (4%)

Query  62   LQQLFLKAHVDLGGLADLIIRENYVGSVVKQSADLEGSDDEDTDVNDVFGITTVINL  118
            LQQLF    V +GG AD  I E Y+   V    DL+    +D     V  I T  N+
Sbjct  302  LQQLFSMGKVVIGGEAD--IAERYIAPTVIVDPDLDSPLMQDEIFGPVLPIVTYENI  356



Lambda      K        H
   0.324    0.139    0.448 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1051796556


Query= XP_003392952.1 protein Skeletor, isoforms B/C isoform X2 [Bombus
terrestris]

Length=692
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VH23_DROME  unnamed protein product                                 447     2e-148
SKEL1_DROME  unnamed protein product                                  314     4e-96 
SKEL2_DROME  unnamed protein product                                  316     6e-93 
Q9XTR0_CAEEL  unnamed protein product                                 64.3    6e-11 
Q18225_CAEEL  unnamed protein product                                 32.0    1.7   


>Q9VH23_DROME unnamed protein product
Length=689

 Score = 447 bits (1151),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 261/673 (39%), Positives = 380/673 (56%), Gaps = 37/673 (5%)

Query  6    LRLISGLLLFAYTASHFSHANNGPNYYGKLIGSLKNYAHGIKGDVYAVDDTTIFIKGFCY  65
            L +I  + L    AS  +   +GP Y GK +G L +Y H + GDVYAV++ T  I GF Y
Sbjct  17   LLVILTIFLLCPAASAQNEEEDGP-YRGKYLGKLNSYHHQVSGDVYAVNEYTFLIVGFNY  75

Query  66   DGTGPDAYFWVGNSSTPTPQGYIVPYPEIKEGSDPVVLKLYNYTDIILKLPNGKRIRDIK  125
            DG G D +FW G S+ P PQG+IVP     E     +L  Y+  D  L LP+ K+I +IK
Sbjct  76   DGNGADTFFWSGASNRPGPQGFIVP----DEYGKTNILDRYHNKDFTLTLPDRKKITEIK  131

Query  126  WLSVWCRRFTVNFGDVFIPANLKAPKARVLPEFSRLAHGLRSGNITILDCKTIYIPNLHY  185
            WL+V+      NFGDV+IP     P +++   FS+ +H + S ++ ILD KTI I +  Y
Sbjct  132  WLAVYDLSSQNNFGDVYIPEEFDPPMSQLGGTFSKRSHNVSSSSVEILDSKTIRIKDFTY  191

Query  186  DGAGPDAYFWVGNGSEPNTFGIKVPSERQSLAPLSGYQGADIEIVLPANLTVHDIDWLSV  245
            DG G   +FW G G +P++ G K+P ER  L P+  Y    IE+ LP + T+ DIDW+SV
Sbjct  192  DGRGKRTFFWTGVGPQPSSRGSKLPDERGYLDPIRQYNKETIELELPGDKTIFDIDWISV  251

Query  246  WCVQFKHNFGHVMIPKDLDVPPALGQTKIATSSTPPPPDKETPPLSKLELTNCKEIMEGR  305
            + V    N+GHV+    L+VPP+L               K TP   +  L NC+++ +  
Sbjct  252  YDVADNENYGHVLFNDKLNVPPSLV--------------KVTP--FEFSLPNCRQLHKD-  294

Query  306  VQVQWEMIGDDIQIRVSGRINEDQYVAFGLSGREGKPEMIGGDVVVVAYDNRTGKFIAVD  365
            +QV WE+ G  I  ++SG++  + Y++FG+SG +   +MIG DVVV   D+  G    VD
Sbjct  295  MQVSWEVFGPQITFQLSGQVGGNDYMSFGISGSDVSSQMIGSDVVVAYIDDIRG--YTVD  352

Query  366  YYLSDYAQC----DGKKGVCPDERVGGKNDAVLVHGERKNGVTTVTYMRPMSTNEPVKDR  421
            Y ++  A C       KGVC D+ VGG +   L    RK+G+ T+++ R + +++     
Sbjct  353  YNITSLAPCVQVLGQNKGVCRDDVVGGLDSFQLNTYSRKDGINTISFRRTLKSSDDGDKE  412

Query  422  MIPNTETSVIAAIGPLNMRGEANAHHSFDRTNEDIRIDF-TSRNVHECTNSLYNLPDMSD  480
            +  +    VI A GPL+   E   H  + ++  DI IDF T+  V++C  +     + ++
Sbjct  413  IFLDRSNYVIWAFGPLDSNNEPAFHTYYPKS--DIVIDFNTTEPVNDCF-AFTKRAETTN  469

Query  481  IEPWPAAVITNET--TFSARIGPAGGKRGYTRITGQPAWGIAWYINDLLIPEITVERGQT  538
               W    IT+ T  TF+A +GP+GG RGY  +T   + G+AWYIN  +IPE+ ++RG T
Sbjct  470  PPVWERTRITDATVRTFNAYLGPSGGLRGYQGLTNHVSSGLAWYINGYMIPELYLKRGLT  529

Query  539  YTFIVEGGNDPANPARYHPFYITDSPEGGFGQKTETEQRAQRVFAGVKYDTDGYPYPTAA  598
            YTF V GGN+P +P  YHP  ITD P+GG+ + ++ +Q   RV AGV++   G P PTAA
Sbjct  530  YTFKVRGGNNPHSPEHYHPLVITDDPQGGYDRLSDAKQSEIRVLAGVEFTRRGRPKPTAA  589

Query  599  GRYCEWVH-KTVDMSAD--METFENFFETLRLECDKGEPAKLVWTVAEDTPDLVYYQCYT  655
            G  C   + +  D   D    TF+ F  +L  EC +GEPA L  T     PD VYY  +T
Sbjct  590  GPLCLSRYPQNSDRRLDDNFPTFKKFNRSLITECVEGEPALLEITPNITWPDTVYYNSFT  649

Query  656  HNNLGWKINVVNS  668
            H N+GWKI++V+S
Sbjct  650  HGNMGWKIHIVDS  662


>SKEL1_DROME unnamed protein product
Length=784

 Score = 314 bits (804),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 167/423 (39%), Positives = 239/423 (57%), Gaps = 21/423 (5%)

Query  31   YYGKLIGSLKNYAHGIKGDVYAVDDTTIFIKGFCYDGTGPDAYFWVGNSSTPTPQGYIVP  90
            YYG  IG+L    HG+ GDVYAVD  TIFIK F YDG  P AYF+VGN++ P+ +G    
Sbjct  32   YYGTKIGALTRLHHGVSGDVYAVDSRTIFIKKFNYDGEAPAAYFYVGNTARPSNEGAARL  91

Query  91   YPEIKEGSDPVVLKLYNYTDIILKLPNGKRIRDIKWLSVWCRRFTVNFGDVFIPANLKAP  150
              E   G    + + Y   D+ L LP GK +RDIKW SVWC  F VNFGDV IP NL  P
Sbjct  92   RDE--RGGTASLTRRYRNKDVTLSLPEGKTLRDIKWFSVWCDEFAVNFGDVSIPPNLDFP  149

Query  151  KARVLPEFSRLAHGLRSGNITILDCKTIYIPNLHYDGAGPDAYFWVGNGSEPNTFGIKVP  210
            + + +    R  HG+ S NI I+D +T+ +PN  YDG  PDA FWVG G  P + G+++P
Sbjct  150  RPQKISAL-RGVHGVSSDNIVIVDAQTLLVPNFSYDGEAPDAKFWVGRGQRPTSDGLRIP  208

Query  211  SERQSLAPLSGYQGADIEIVLPANLTVHDIDWLSVWCVQFKHNFGHVMIPKDLDVPPALG  270
             E     PL  Y+   I + LP +LT+ DI    VWC  F  +FGHV +P+ L+VPP+L 
Sbjct  209  DENGKENPLRRYERKTIVLTLPEDLTIFDIGHFGVWCEAFTVDFGHVRLPEGLNVPPSLK  268

Query  271  QTKIATSSTPPPPDKETPPLSKLELTNCKEIMEGRV-QVQWEMIGDDIQIRVSGRINEDQ  329
               I+             P SKL   NC+ + +    +V+W + G+ I +++  ++  + 
Sbjct  269  MLGIS-------------PQSKL---NCEVLYDDLAFEVRWAVAGESIVVQLVAKLEPNH  312

Query  330  YVAFGLSGREGKPEMIGGDVVVVAYDNRTGKFIAVDYYLSDYAQCDGKKGVCPDERVGGK  389
            Y++FG+S  +   +MIG D VV   D +TG   A DY+L   AQC G +G CPD ++  K
Sbjct  313  YMSFGISPNKNISQMIGADAVVAWVDPQTGNGFATDYFLEGKAQCSGGRGACPDTKISEK  372

Query  390  NDAV-LVHGERKNGVTTVTYMRPMSTNEPVKDRMIPNTETSVIAAIGPLNMRGEANAHHS  448
             +++ L++    NG + VTY R ++  + +   +      SV+ AIGPLN   E + H  
Sbjct  373  TNSIRLLNAAMVNGYSIVTYQRSLAATDRLDLPISITGAESVVWAIGPLNDYQEVSFHTF  432

Query  449  FDR  451
            +++
Sbjct  433  YNK  435


 Score = 197 bits (502),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 125/201 (62%), Gaps = 8/201 (4%)

Query  469  TNSLYNLPDMSDIEPWPAAVITNETTFSARIGPAGGKRGYTRITGQPAWGIAWYINDLLI  528
            +N  +++P +   EP        +  F A++GP GGK GY  ITG   WGI+WYIN LLI
Sbjct  531  SNGAWDIPAIQCHEP-------EDGVFYAQMGPTGGKHGYPAITGHVGWGISWYINGLLI  583

Query  529  PEITVERGQTYTFIVEGGNDPANPARYHPFYITDSPEGGFGQKTETEQRAQRVFAGVKYD  588
            PEI V RG+TYTF+VEGGN+P  PA+YHPFYI+D P GG+  K E E++A R++AGV   
Sbjct  584  PEIHVVRGKTYTFVVEGGNNPDIPAKYHPFYISDDPVGGYEHKREEEKKAVRIYAGVHRS  643

Query  589  TDGYPYPTAAGRYCEWVHKTVDMSA-DMETFENFFETLRLECDKGEPAKLVWTVAEDTPD  647
              G   PT  GR C W        A D ++F  +  TL L+CD GEP  + W    +TPD
Sbjct  644  RSGQVTPTGVGRLCNWTPDVEGPPADDYQSFGAYQRTLTLKCDAGEPGVITWKPDRNTPD  703

Query  648  LVYYQCYTHNNLGWKINVVNS  668
             VYY C+TH  LGWKI+V +S
Sbjct  704  TVYYHCFTHRYLGWKIHVHDS  724


>SKEL2_DROME unnamed protein product
Length=1503

 Score = 316 bits (809),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 167/423 (39%), Positives = 239/423 (57%), Gaps = 21/423 (5%)

Query  31   YYGKLIGSLKNYAHGIKGDVYAVDDTTIFIKGFCYDGTGPDAYFWVGNSSTPTPQGYIVP  90
            YYG  IG+L    HG+ GDVYAVD  TIFIK F YDG  P AYF+VGN++ P+ +G    
Sbjct  32   YYGTKIGALTRLHHGVSGDVYAVDSRTIFIKKFNYDGEAPAAYFYVGNTARPSNEGAARL  91

Query  91   YPEIKEGSDPVVLKLYNYTDIILKLPNGKRIRDIKWLSVWCRRFTVNFGDVFIPANLKAP  150
              E   G    + + Y   D+ L LP GK +RDIKW SVWC  F VNFGDV IP NL  P
Sbjct  92   RDE--RGGTASLTRRYRNKDVTLSLPEGKTLRDIKWFSVWCDEFAVNFGDVSIPPNLDFP  149

Query  151  KARVLPEFSRLAHGLRSGNITILDCKTIYIPNLHYDGAGPDAYFWVGNGSEPNTFGIKVP  210
            + + +    R  HG+ S NI I+D +T+ +PN  YDG  PDA FWVG G  P + G+++P
Sbjct  150  RPQKISAL-RGVHGVSSDNIVIVDAQTLLVPNFSYDGEAPDAKFWVGRGQRPTSDGLRIP  208

Query  211  SERQSLAPLSGYQGADIEIVLPANLTVHDIDWLSVWCVQFKHNFGHVMIPKDLDVPPALG  270
             E     PL  Y+   I + LP +LT+ DI    VWC  F  +FGHV +P+ L+VPP+L 
Sbjct  209  DENGKENPLRRYERKTIVLTLPEDLTIFDIGHFGVWCEAFTVDFGHVRLPEGLNVPPSLK  268

Query  271  QTKIATSSTPPPPDKETPPLSKLELTNCKEIMEGRV-QVQWEMIGDDIQIRVSGRINEDQ  329
               I+             P SKL   NC+ + +    +V+W + G+ I +++  ++  + 
Sbjct  269  MLGIS-------------PQSKL---NCEVLYDDLAFEVRWAVAGESIVVQLVAKLEPNH  312

Query  330  YVAFGLSGREGKPEMIGGDVVVVAYDNRTGKFIAVDYYLSDYAQCDGKKGVCPDERVGGK  389
            Y++FG+S  +   +MIG D VV   D +TG   A DY+L   AQC G +G CPD ++  K
Sbjct  313  YMSFGISPNKNISQMIGADAVVAWVDPQTGNGFATDYFLEGKAQCSGGRGACPDTKISEK  372

Query  390  NDAV-LVHGERKNGVTTVTYMRPMSTNEPVKDRMIPNTETSVIAAIGPLNMRGEANAHHS  448
             +++ L++    NG + VTY R ++  + +   +      SV+ AIGPLN   E + H  
Sbjct  373  TNSIRLLNAAMVNGYSIVTYQRSLAATDRLDLPISITGAESVVWAIGPLNDYQEVSFHTF  432

Query  449  FDR  451
            +++
Sbjct  433  YNK  435


 Score = 198 bits (504),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 125/201 (62%), Gaps = 8/201 (4%)

Query  469  TNSLYNLPDMSDIEPWPAAVITNETTFSARIGPAGGKRGYTRITGQPAWGIAWYINDLLI  528
            +N  +++P +   EP        +  F A++GP GGK GY  ITG   WGI+WYIN LLI
Sbjct  531  SNGAWDIPAIQCHEP-------EDGVFYAQMGPTGGKHGYPAITGHVGWGISWYINGLLI  583

Query  529  PEITVERGQTYTFIVEGGNDPANPARYHPFYITDSPEGGFGQKTETEQRAQRVFAGVKYD  588
            PEI V RG+TYTF+VEGGN+P  PA+YHPFYI+D P GG+  K E E++A R++AGV   
Sbjct  584  PEIHVVRGKTYTFVVEGGNNPDIPAKYHPFYISDDPVGGYEHKREEEKKAVRIYAGVHRS  643

Query  589  TDGYPYPTAAGRYCEWVHKTVDMSA-DMETFENFFETLRLECDKGEPAKLVWTVAEDTPD  647
              G   PT  GR C W        A D ++F  +  TL L+CD GEP  + W    +TPD
Sbjct  644  RSGQVTPTGVGRLCNWTPDVEGPPADDYQSFGAYQRTLTLKCDAGEPGVITWKPDRNTPD  703

Query  648  LVYYQCYTHNNLGWKINVVNS  668
             VYY C+TH  LGWKI+V +S
Sbjct  704  TVYYHCFTHRYLGWKIHVHDS  724


>Q9XTR0_CAEEL unnamed protein product
Length=291

 Score = 64.3 bits (155),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 40/123 (33%), Positives = 66/123 (54%), Gaps = 10/123 (8%)

Query  163  HGLRSGNITILDCKTIYIPNLHYDGAG-PDAYFWVGNGSEPNTFGIK---VPSERQSL--  216
            +G+ S  I ++D +T+ IP   Y  +  PD YF+ G GSE +    K   +    Q+L  
Sbjct  160  YGIISDPIEVIDSRTLKIPKFSYKASQTPDGYFFAGAGSEIDQKSGKKAAILRSDQTLNY  219

Query  217  AP-LSGYQGADIEIVLPANLTVHDIDWLSVWCVQFKHNFGHV---MIPKDLDVPPALGQT  272
             P L      DI I L  + T++DI+W+SV+C ++ H+FGH+   ++  +  VPP +   
Sbjct  220  CPMLKDITDQDIIIRLDQSQTIYDIEWISVFCYKYSHDFGHLDMGLVENEEQVPPYIPDI  279

Query  273  KIA  275
             I+
Sbjct  280  SIS  282


 Score = 44.7 bits (104),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 52/112 (46%), Gaps = 24/112 (21%)

Query  44   HGIKGD-VYAVDDTTIFIKGFCYDGTG-PDAYFWVGNSSTPTPQGYIVPYPEIKEGSDPV  101
            +GI  D +  +D  T+ I  F Y  +  PD YF+ G  S            + K G    
Sbjct  160  YGIISDPIEVIDSRTLKIPKFSYKASQTPDGYFFAGAGSEI----------DQKSGKKAA  209

Query  102  VLK---LYNYT---------DIILKLPNGKRIRDIKWLSVWCRRFTVNFGDV  141
            +L+     NY          DII++L   + I DI+W+SV+C +++ +FG +
Sbjct  210  ILRSDQTLNYCPMLKDITDQDIIIRLDQSQTIYDIEWISVFCYKYSHDFGHL  261


>Q18225_CAEEL unnamed protein product
Length=470

 Score = 32.0 bits (71),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 35/137 (26%), Positives = 62/137 (45%), Gaps = 15/137 (11%)

Query  266  PPALGQTKIATSSTP-PPPDKETPPLSKLELTNCKEIMEGRVQVQ-----WEMIGDDIQI  319
            PP +GQ +++T+  P     + T P  + + +      E R+  +      EM+    +I
Sbjct  305  PPVVGQKRVSTTVMPITLKSQRTTPKEEEDSSQLMSQEEFRITYELTKKLMEMMKPKTEI  364

Query  320  RVSGRINEDQYVAFGLSGREGKPEMIGGDVVVVAYDNRTGKFIAVDYYLSDYAQCDGKKG  379
             V  + +E   + F LS   G  E +   VVV+  D ++    A++ +     +C+GK  
Sbjct  365  GVRWQGDEGSILLF-LSHDNGAEENVFFPVVVMNRDEKS-LITALEGFTG--KRCEGKLA  420

Query  380  VCPDERVGGKNDAVLVH  396
            +C  +RV      VLVH
Sbjct  421  LCYSQRVN-----VLVH  432



Lambda      K        H
   0.324    0.139    0.448 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1051796556


Query= XP_003392954.2 nuclear pore complex protein Nup107 isoform X1
[Bombus terrestris]

Length=910
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A1YK58_DROME  unnamed protein product                                 517     2e-170
A1YK63_DROME  unnamed protein product                                 517     2e-170
A1YK61_DROME  unnamed protein product                                 516     3e-170
A1YK60_DROME  unnamed protein product                                 515     1e-169
A1YK62_DROME  unnamed protein product                                 514     2e-169


>A1YK58_DROME unnamed protein product
Length=845

 Score = 517 bits (1331),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 307/861 (36%), Positives = 471/861 (55%), Gaps = 66/861 (8%)

Query  83   LLDIDTSLTLAPHEVRDIMAASEKS--EFTLREMMEDSSATGMILKAREPWRDVMSKLFY  140
            LL    + ++AP  +   +   EKS  E   R +MED   TG  L   +   DV+   F+
Sbjct  14   LLRTTLNSSMAPQNLSHSLLILEKSNAEQNERSLMED---TGDDLDRGKSRMDVLFPQFF  70

Query  141  DFLHSLQANFSEAQVFNTIADFIQNCTDT-----LDIMRGMQSKVETTEISEDEISLENE  195
            D L + Q N  EA  F  I    Q C        L+I  GM  +    E       L  E
Sbjct  71   DVLQA-QGNGQEA--FEVIQSLTQVCRGVVEQLELEIDHGMGGEQGARERESMLTWLRQE  127

Query  196  RNTWRLIYCLYQNRI----------NSLNFPTPVENNIYISEKVVIDNLFKTESYIREYQ  245
             NTWRL++ L+ +RI             + PT     +  SEK VI  L+   + +REYQ
Sbjct  128  INTWRLLHALFYDRILLQTDRQADDEMQDGPT-----LGGSEKEVIQQLYALNATLREYQ  182

Query  246  LIIDWLEKNALDQADKYPITEHFTDKTVAWENTVRQLLMYKDKEQIPFRSSRPLVSSLDP  305
            L++DWLE        + P+  H  D+ +AWENT+ QL   ++ +   F     +V+ LDP
Sbjct  183  LVVDWLEACYDRGEQQNPLHAH--DRMMAWENTLFQL---ENLQGAAFGKGHKIVTRLDP  237

Query  306  DAPIREGKPLHDLDREDDARMEKRMFIEVRCGRLQKAQALAQYCGQPWRAACLLGWIPHH  365
            DAP+RE +PLH LD ED+ R+ + +F  +R GR+     L ++ GQ WRAA L GW  H 
Sbjct  238  DAPVREKRPLHALDEEDNLRLSRAIFELIRAGRVYDGLKLCKHFGQTWRAAILEGWRLHE  297

Query  366  DPNYQNPLS--DSKLPIEGNPNRSLWKLCAWELSQERRVGQFYRT---IYASLCGNVQQM  420
            DPN++  +S    KLPIEGNP R +WK CAW L+  +   ++ R    +++   G+++ +
Sbjct  298  DPNFEQNVSVLHEKLPIEGNPRRDIWKRCAWMLADSKNYDEYSRATAGVFSGHLGSLKTL  357

Query  421  LQVASSWQDALWAYMKTLLDIKVEREVRDLVAKSFTDMPDDYWKNEISLKDVFKELHASK  480
            L   S+W D LWA++K  +DI+VE E+R    K++  MPDDYW   ++++ +F+EL+ +K
Sbjct  358  LH--SNWHDLLWAHLKVQIDIRVESEIRGCCLKNYQPMPDDYWNGRMTMEQIFEELNVAK  415

Query  481  NPDIRAQSNKPDHLIQKYLILDQIPKLMEEIEDMICSKSC--DPHFLRFLAHLIYFFRQI  538
            +  +R  +     +IQ++LILD   +L++ +   +   +    PH LRF+AH++ F RQI
Sbjct  416  DASVRDFAQSQLGIIQRHLILDTCGELIQHMVRWVEKDTSQQSPHQLRFMAHIVLFLRQI  475

Query  539  GKNAKDKIGDKVLLAYVRVLIEMDDPILIAFYTAMLPQELQITNYASYLETIKDYEQRKK  598
            G+  +++  +K++ AYV  LI   +P LIA+YTA L   LQ+  Y+ +LE ++    R+ 
Sbjct  476  GRVEQERQAEKIVAAYVEALIARGEPQLIAYYTASLSNPLQVQLYSRFLEQVEQKRPREL  535

Query  599  CLAAAEDANLNVEAITKLVVESIRSKNIDVDPTD--LKGTMTDADVDKINALDWLIFYQS  656
             + AA  A L+VE IT++ V++IR  +  +        G ++  D  KI+AL+WLI    
Sbjct  536  AVDAALQAGLDVEQITRVTVQNIRLAHQPLGEFGEPQSGEISAIDQRKISALEWLIHLPE  595

Query  657  QREEALSQTNALIRYFLTNEKIDAARKAFNKIPVDSIEAIMAEYPTLEGTLTNLTMTNNL  716
            QR E L Q NA+IR +L + K++  R+ F  +P D ++ +++ Y ++          +N+
Sbjct  596  QRGELLWQANAMIRTYLASSKVECMRQTFRMVPADIVQQLVSLYGSV----------DNI  645

Query  717  SKRASSTIREYLCYKTYLDAQEGFAEW--FSHFHHGKPTPLEELPAYATFTEKVAYEHKK  774
              R    ++EYLCYK YL   + F EW         KP       +   FTE++A E K+
Sbjct  646  PPREECCLKEYLCYKAYLSGVDSFVEWNRLQQNRPKKPQTSHAASSQDNFTERMASERKE  705

Query  775  SQYNVEMERWKSTMQHHTKAVKQLLFNVLLFPDGGWLVDSNNNNDESCTPEEAT------  828
              +  E+ RW+  ++   K   +LL+NVL+FPD GWLVD          PE A       
Sbjct  706  QAHRSEVVRWEHKVKEQAKQTIELLYNVLMFPDKGWLVDPFIAK----LPENAVQLNWDH  761

Query  829  REHQMEKLRELCIPKVTLLLHSVMTEMNEHAECIQLADILASEQYQLYKVFQKGRLREVF  888
            R  QMEKLR +CIP++ L L+ VM +  + A C++LAD ++SE  QLYKV+ K +L E+ 
Sbjct  762  RLLQMEKLRSICIPEIALFLNEVMFKSGDFAGCVRLADEISSENRQLYKVYTKHKLAELL  821

Query  889  KKICESSLVLMDQKKDPWGYP  909
             KI ++SL L++ K DPWGYP
Sbjct  822  AKIADASLELLNSKLDPWGYP  842


>A1YK63_DROME unnamed protein product
Length=845

 Score = 517 bits (1331),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 306/861 (36%), Positives = 471/861 (55%), Gaps = 66/861 (8%)

Query  83   LLDIDTSLTLAPHEVRDIMAASEKS--EFTLREMMEDSSATGMILKAREPWRDVMSKLFY  140
            LL    + ++AP  +   +   EKS  E   R +MED   TG  L   +   DV+   F+
Sbjct  14   LLRTTLNSSMAPQNLSHSLLILEKSNAEQNERSLMED---TGDDLDRGKSRMDVLFPQFF  70

Query  141  DFLHSLQANFSEAQVFNTIADFIQNCTDT-----LDIMRGMQSKVETTEISEDEISLENE  195
            D L + Q N  EA  F  I    Q C        L+I  GM  +    +       L  E
Sbjct  71   DVLQA-QGNGQEA--FEVIQSLTQVCRGVVEQLELEIDHGMGGEQGARQRESMLTWLRQE  127

Query  196  RNTWRLIYCLYQNRI----------NSLNFPTPVENNIYISEKVVIDNLFKTESYIREYQ  245
             NTWRL++ L+ +RI             + PT     +  SEK VI  L+   + +REYQ
Sbjct  128  INTWRLLHALFYDRILLQTDRQADDEMQDGPT-----LGGSEKEVIQQLYALNATLREYQ  182

Query  246  LIIDWLEKNALDQADKYPITEHFTDKTVAWENTVRQLLMYKDKEQIPFRSSRPLVSSLDP  305
            L++DWLE        + P+  H  D+ +AWENT+ QL   ++ +   F     +V+ LDP
Sbjct  183  LVVDWLEACYDRGEQQNPLHAH--DRMMAWENTLFQL---ENLQGAAFGKGHKIVTRLDP  237

Query  306  DAPIREGKPLHDLDREDDARMEKRMFIEVRCGRLQKAQALAQYCGQPWRAACLLGWIPHH  365
            DAP+RE +PLH LD ED+ R+ + +F  +R GR+     L ++ GQ WRAA L GW  H 
Sbjct  238  DAPVREKRPLHALDEEDNLRLSRAIFELIRAGRVDDGLKLCKHFGQTWRAAILEGWRLHE  297

Query  366  DPNYQNPLS--DSKLPIEGNPNRSLWKLCAWELSQERRVGQFYRT---IYASLCGNVQQM  420
            DPN++  +S    KLPIEGNP R +WK CAW L+  +   ++ R    +++   G+++ +
Sbjct  298  DPNFEQNVSVLHEKLPIEGNPRRDIWKRCAWMLADSKNYDEYSRATAGVFSGHLGSLKTL  357

Query  421  LQVASSWQDALWAYMKTLLDIKVEREVRDLVAKSFTDMPDDYWKNEISLKDVFKELHASK  480
            L   S+W D LWA++K  +DI+VE E+R    K++  MPDDYW   ++++ +F+EL+ +K
Sbjct  358  LH--SNWHDVLWAHLKVQIDIRVESEIRGCCLKNYQPMPDDYWNGRMTMEQIFEELNVAK  415

Query  481  NPDIRAQSNKPDHLIQKYLILDQIPKLMEEIEDMICSKSC--DPHFLRFLAHLIYFFRQI  538
            +  +R  +     +IQ++LILD   +L++ +   +   +    PH LRF+AH++ F RQI
Sbjct  416  DASVRDFAQSQLGIIQRHLILDTCGELIQHMVRWVEKDTSQQSPHQLRFMAHIVLFLRQI  475

Query  539  GKNAKDKIGDKVLLAYVRVLIEMDDPILIAFYTAMLPQELQITNYASYLETIKDYEQRKK  598
            G+  +++  +K++ AYV  LI   +P LIA+YTA L   LQ+  Y+ +LE ++    R+ 
Sbjct  476  GRVEQERQAEKIVAAYVEALIARGEPQLIAYYTASLSNPLQVQLYSRFLEQVEQKRPREL  535

Query  599  CLAAAEDANLNVEAITKLVVESIRSKNIDVDPTD--LKGTMTDADVDKINALDWLIFYQS  656
             + AA  A L+VE IT++ V++IR  +  +        G ++  D  KI+AL+WLI    
Sbjct  536  AVDAALQAGLDVEQITRVTVQNIRLAHQPLGEFGEPQSGEISAIDQRKISALEWLIHLPE  595

Query  657  QREEALSQTNALIRYFLTNEKIDAARKAFNKIPVDSIEAIMAEYPTLEGTLTNLTMTNNL  716
            QR E L Q NA+IR +L + K++  R+ F  +P D ++ +++ Y ++          +N+
Sbjct  596  QRGELLWQANAMIRTYLASSKVECMRQTFRMVPADIVQQLVSLYGSV----------DNI  645

Query  717  SKRASSTIREYLCYKTYLDAQEGFAEW--FSHFHHGKPTPLEELPAYATFTEKVAYEHKK  774
              R    ++EYLCYK YL   + F EW         KP       +   FTE++A E K+
Sbjct  646  PPREECCLKEYLCYKAYLSGVDSFVEWNRLQQNRPKKPQTSHAASSQDNFTERMASERKE  705

Query  775  SQYNVEMERWKSTMQHHTKAVKQLLFNVLLFPDGGWLVDSNNNNDESCTPEEAT------  828
              +  E+ RW+  ++   K   +LL+NVL+FPD GWLVD          PE A       
Sbjct  706  QAHRSEVVRWEHKVKEQAKQTIELLYNVLMFPDKGWLVDPFIAK----LPENAVQLNWDH  761

Query  829  REHQMEKLRELCIPKVTLLLHSVMTEMNEHAECIQLADILASEQYQLYKVFQKGRLREVF  888
            R  QMEKLR +CIP++ L L+ VM +  + A C++LAD ++SE  QLYKV+ K +L E+ 
Sbjct  762  RLLQMEKLRSICIPEIALFLNEVMFKSGDFAGCVRLADEISSENRQLYKVYTKHKLAELL  821

Query  889  KKICESSLVLMDQKKDPWGYP  909
             KI ++SL L++ K DPWGYP
Sbjct  822  AKIADASLELLNSKLDPWGYP  842


>A1YK61_DROME unnamed protein product
Length=845

 Score = 516 bits (1330),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 306/861 (36%), Positives = 471/861 (55%), Gaps = 66/861 (8%)

Query  83   LLDIDTSLTLAPHEVRDIMAASEKS--EFTLREMMEDSSATGMILKAREPWRDVMSKLFY  140
            LL    + ++AP  +   +   EKS  E   R +MED   TG  L   +   DV+   F+
Sbjct  14   LLRTTLNSSMAPQNLSHSLLILEKSNAEQNERSLMED---TGDDLDRGKSRMDVLFPQFF  70

Query  141  DFLHSLQANFSEAQVFNTIADFIQNCTDT-----LDIMRGMQSKVETTEISEDEISLENE  195
            D L + Q N  EA  F  I    Q C        L+I  GM  +    +       L  E
Sbjct  71   DVLQA-QGNGQEA--FEVIQSLTQVCRGVVEQLELEIDHGMGGEQGARQRESMLTWLRQE  127

Query  196  RNTWRLIYCLYQNRI----------NSLNFPTPVENNIYISEKVVIDNLFKTESYIREYQ  245
             NTWRL++ L+ +RI             + PT     +  SEK VI  L+   + +REYQ
Sbjct  128  INTWRLLHALFYDRILLQTDRQADDEMQDGPT-----LGGSEKEVIQQLYALNATLREYQ  182

Query  246  LIIDWLEKNALDQADKYPITEHFTDKTVAWENTVRQLLMYKDKEQIPFRSSRPLVSSLDP  305
            L++DWLE        + P+  H  D+ +AWENT+ QL   ++ +   F     +V+ LDP
Sbjct  183  LVVDWLEACYDRGEQQNPLHAH--DRMMAWENTLFQL---ENLQGAAFGKGHKIVTRLDP  237

Query  306  DAPIREGKPLHDLDREDDARMEKRMFIEVRCGRLQKAQALAQYCGQPWRAACLLGWIPHH  365
            DAP+RE +PLH LD ED+ R+ + +F  +R GR+     L ++ GQ WRAA L GW  H 
Sbjct  238  DAPVREKRPLHALDEEDNLRLSRAIFELIRAGRVDDGLKLCKHFGQTWRAAILEGWRLHE  297

Query  366  DPNYQNPLS--DSKLPIEGNPNRSLWKLCAWELSQERRVGQFYRT---IYASLCGNVQQM  420
            DPN++  +S    KLPIEGNP R +WK CAW L+  +   ++ R    +++   G+++ +
Sbjct  298  DPNFEQNVSVLHEKLPIEGNPRRDIWKRCAWMLADSKNYDEYSRATAGVFSGHLGSLKTL  357

Query  421  LQVASSWQDALWAYMKTLLDIKVEREVRDLVAKSFTDMPDDYWKNEISLKDVFKELHASK  480
            L   S+W D LWA++K  +DI+VE E+R    K++  MPDDYW   ++++ +F+EL+ +K
Sbjct  358  LH--SNWHDLLWAHLKVQIDIRVESEIRGCCLKNYQPMPDDYWNGRMTMEQIFEELNVAK  415

Query  481  NPDIRAQSNKPDHLIQKYLILDQIPKLMEEIEDMICSKSC--DPHFLRFLAHLIYFFRQI  538
            +  +R  +     +IQ++LILD   +L++ +   +   +    PH LRF+AH++ F RQI
Sbjct  416  DASVRDFAQSQLGIIQRHLILDTCGELIQHMVRWVEKDTSQQSPHQLRFMAHIVLFLRQI  475

Query  539  GKNAKDKIGDKVLLAYVRVLIEMDDPILIAFYTAMLPQELQITNYASYLETIKDYEQRKK  598
            G+  +++  +K++ AYV  LI   +P LIA+YTA L   LQ+  Y+ +LE ++    R+ 
Sbjct  476  GRVEQERQAEKIVAAYVEALIARGEPQLIAYYTASLSNPLQVQLYSRFLEQVEQKRPREL  535

Query  599  CLAAAEDANLNVEAITKLVVESIRSKNIDVDPTD--LKGTMTDADVDKINALDWLIFYQS  656
             + AA  A L+VE IT++ V++IR  +  +        G ++  D  KI+AL+WLI    
Sbjct  536  AVDAALQAGLDVEQITRVTVQNIRLAHQPLGEFGEPQSGEISAIDQRKISALEWLIHLPE  595

Query  657  QREEALSQTNALIRYFLTNEKIDAARKAFNKIPVDSIEAIMAEYPTLEGTLTNLTMTNNL  716
            QR E L Q NA+IR +L + K++  R+ F  +P D ++ +++ Y ++          +N+
Sbjct  596  QRGELLWQANAMIRTYLASSKVECMRQTFRMVPADIVQQLVSLYGSV----------DNI  645

Query  717  SKRASSTIREYLCYKTYLDAQEGFAEW--FSHFHHGKPTPLEELPAYATFTEKVAYEHKK  774
              R    ++EYLCYK YL   + F EW         KP       +   FTE++A E K+
Sbjct  646  PPREECCLKEYLCYKAYLSGVDSFVEWNRLQQNRPKKPQTSHAASSQDNFTERMASERKE  705

Query  775  SQYNVEMERWKSTMQHHTKAVKQLLFNVLLFPDGGWLVDSNNNNDESCTPEEAT------  828
              +  E+ RW+  ++   K   +LL+NVL+FPD GWLVD          PE A       
Sbjct  706  QAHRSEVVRWEHKVKEQAKQTIELLYNVLMFPDKGWLVDPFIAK----LPENAVQLNWDH  761

Query  829  REHQMEKLRELCIPKVTLLLHSVMTEMNEHAECIQLADILASEQYQLYKVFQKGRLREVF  888
            R  QMEKLR +CIP++ L L+ VM +  + A C++LAD ++SE  QLYKV+ K +L E+ 
Sbjct  762  RLLQMEKLRSICIPEIALFLNEVMFKSGDFAGCVRLADEISSENRQLYKVYTKHKLAELL  821

Query  889  KKICESSLVLMDQKKDPWGYP  909
             KI ++SL L++ K DPWGYP
Sbjct  822  AKIADASLELLNSKLDPWGYP  842


>A1YK60_DROME unnamed protein product
Length=845

 Score = 515 bits (1326),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 305/861 (35%), Positives = 471/861 (55%), Gaps = 66/861 (8%)

Query  83   LLDIDTSLTLAPHEVRDIMAASEKS--EFTLREMMEDSSATGMILKAREPWRDVMSKLFY  140
            LL    + ++AP  +   +   EKS  E   R +MED   TG  L   +   DV+   F+
Sbjct  14   LLRTTLNSSMAPQNLSHSLLILEKSNAEQNERSLMED---TGDDLDRGKSRMDVLFPQFF  70

Query  141  DFLHSLQANFSEAQVFNTIADFIQNCTDT-----LDIMRGMQSKVETTEISEDEISLENE  195
            D L + Q N  EA  F  I    Q C        L+I  GM  +    +       L  E
Sbjct  71   DVLQA-QGNGQEA--FEVIQSLTQVCRGVVEQLELEIDHGMGGEQGARQRESMLTWLRQE  127

Query  196  RNTWRLIYCLYQNRI----------NSLNFPTPVENNIYISEKVVIDNLFKTESYIREYQ  245
             NTWRL++ L+ +RI             + PT     +  SEK VI  L+   + +REYQ
Sbjct  128  INTWRLLHALFYDRILLQTDRQADDEMQDGPT-----LGGSEKEVIQQLYALNATLREYQ  182

Query  246  LIIDWLEKNALDQADKYPITEHFTDKTVAWENTVRQLLMYKDKEQIPFRSSRPLVSSLDP  305
            +++DWLE        + P+  H  D+ +AWENT+ QL   ++ +   F     +V+ LDP
Sbjct  183  VVVDWLEACYDRGEQQNPLHAH--DRMMAWENTLFQL---ENLQGAAFGKGHKIVTRLDP  237

Query  306  DAPIREGKPLHDLDREDDARMEKRMFIEVRCGRLQKAQALAQYCGQPWRAACLLGWIPHH  365
            DAP+RE +PLH LD ED+ R+ + +F  +R GR+     L ++ GQ WRAA L GW  H 
Sbjct  238  DAPVREKRPLHALDEEDNLRLSRAIFELIRAGRVDDGLKLCKHFGQTWRAAILEGWRLHE  297

Query  366  DPNYQNPLS--DSKLPIEGNPNRSLWKLCAWELSQERRVGQFYRT---IYASLCGNVQQM  420
            DPN++  +S    KLPIEGNP R +WK CAW L+  +   ++ R    +++   G+++ +
Sbjct  298  DPNFEQNVSVLHEKLPIEGNPRRDIWKRCAWLLADSKNYDEYSRATAGVFSGHLGSLKTL  357

Query  421  LQVASSWQDALWAYMKTLLDIKVEREVRDLVAKSFTDMPDDYWKNEISLKDVFKELHASK  480
            L   S+W D LWA++K  +DI+VE E+R    K++  MPDDYW   ++++ +F+EL+ +K
Sbjct  358  LH--SNWHDLLWAHLKVQIDIRVESEIRGCCLKNYQPMPDDYWNGRMTMEQIFEELNVAK  415

Query  481  NPDIRAQSNKPDHLIQKYLILDQIPKLMEEIEDMICSKSC--DPHFLRFLAHLIYFFRQI  538
            +  +R  +     +IQ++LILD   +L++ +   +   +    PH LRF+AH++ F RQI
Sbjct  416  DASVRDFAQSQLGIIQRHLILDTCGELIQHMVRWVEKDTAQQSPHQLRFMAHIVLFLRQI  475

Query  539  GKNAKDKIGDKVLLAYVRVLIEMDDPILIAFYTAMLPQELQITNYASYLETIKDYEQRKK  598
            G+  +++  +K++ AYV  LI   +P LIA+YTA L   LQ+  Y+ +LE ++    R+ 
Sbjct  476  GRVEQERQAEKIVAAYVEALIARGEPQLIAYYTASLSNPLQVQLYSRFLEQVEQKRPREL  535

Query  599  CLAAAEDANLNVEAITKLVVESIRSKNIDVDPTD--LKGTMTDADVDKINALDWLIFYQS  656
             + AA  A L+VE IT++ V++IR  +  +        G ++  D  KI+AL+WLI    
Sbjct  536  AVDAALQAGLDVEQITRVTVQNIRLAHQPLGEFGEPQSGEISAIDQRKISALEWLIHLPE  595

Query  657  QREEALSQTNALIRYFLTNEKIDAARKAFNKIPVDSIEAIMAEYPTLEGTLTNLTMTNNL  716
            QR E L Q NA+IR +L + K++  R+ F  +P D ++ +++ Y ++          +N+
Sbjct  596  QRGELLWQANAMIRTYLASSKVECMRQTFRMVPADIVQQLVSLYGSV----------DNI  645

Query  717  SKRASSTIREYLCYKTYLDAQEGFAEW--FSHFHHGKPTPLEELPAYATFTEKVAYEHKK  774
              R    ++EYLCYK YL   + F EW         KP       +   FTE++A E K+
Sbjct  646  PPREECCLKEYLCYKAYLSGVDSFVEWNRLQQNRPKKPQTSHAASSQDNFTERMASERKE  705

Query  775  SQYNVEMERWKSTMQHHTKAVKQLLFNVLLFPDGGWLVDSNNNNDESCTPEEAT------  828
              +  E+ RW+  ++   K   +LL+NVL+FPD GWLVD          PE A       
Sbjct  706  QAHRSEVVRWEHKVKEQAKQTIELLYNVLMFPDKGWLVDPFIAK----LPENAVQLNWDH  761

Query  829  REHQMEKLRELCIPKVTLLLHSVMTEMNEHAECIQLADILASEQYQLYKVFQKGRLREVF  888
            R  QMEKLR +CIP++ L L+ VM +  + A C++LAD ++SE  QLYKV+ K +L E+ 
Sbjct  762  RLLQMEKLRSICIPEIALFLNEVMFKSGDFAGCVRLADEISSENRQLYKVYTKHKLAELL  821

Query  889  KKICESSLVLMDQKKDPWGYP  909
             KI ++SL L++ K DPWGYP
Sbjct  822  AKIADASLELLNSKLDPWGYP  842


>A1YK62_DROME unnamed protein product
Length=845

 Score = 514 bits (1324),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 305/861 (35%), Positives = 470/861 (55%), Gaps = 66/861 (8%)

Query  83   LLDIDTSLTLAPHEVRDIMAASEKS--EFTLREMMEDSSATGMILKAREPWRDVMSKLFY  140
            LL    + ++AP  +   +   EKS  E   R +MED   TG  L   +   DV+   F+
Sbjct  14   LLRTTLNSSMAPQNLSHSLLILEKSNAEQNERSLMED---TGDDLDRGKSRMDVLFPQFF  70

Query  141  DFLHSLQANFSEAQVFNTIADFIQNCTDT-----LDIMRGMQSKVETTEISEDEISLENE  195
            D L + Q N  EA  F  I    Q C        L+I  GM  +    +       L  E
Sbjct  71   DVLQA-QGNGQEA--FEVIQSLTQVCRGVVEQLELEIDHGMGGEQGARQRESMLTWLRQE  127

Query  196  RNTWRLIYCLYQNRI----------NSLNFPTPVENNIYISEKVVIDNLFKTESYIREYQ  245
             NTWRL++ L+ +RI             + PT     +  SEK VI  L+   + +REYQ
Sbjct  128  INTWRLLHALFYDRILLQTDRQADDEMQDGPT-----LGGSEKEVIQQLYALNATLREYQ  182

Query  246  LIIDWLEKNALDQADKYPITEHFTDKTVAWENTVRQLLMYKDKEQIPFRSSRPLVSSLDP  305
            +++DWLE        + P+  H  D+ +AWENT+ QL   ++ +   F     +V+ LDP
Sbjct  183  VVVDWLEACYDRGEQQNPLHAH--DRMMAWENTLFQL---ENLQGAAFGKGHKIVTRLDP  237

Query  306  DAPIREGKPLHDLDREDDARMEKRMFIEVRCGRLQKAQALAQYCGQPWRAACLLGWIPHH  365
            DAP+RE +PLH LD ED+ R+ + +F  +R GR+     L ++ GQ WRAA L GW  H 
Sbjct  238  DAPVREKRPLHALDEEDNLRLSRAIFELIRAGRVDDGLKLCKHFGQTWRAAILEGWRLHE  297

Query  366  DPNYQNPLS--DSKLPIEGNPNRSLWKLCAWELSQERRVGQFYRT---IYASLCGNVQQM  420
            DPN++  +S    KLPIEGNP R +WK CAW L+  +   ++ R    +++   G ++ +
Sbjct  298  DPNFEQNVSVLHEKLPIEGNPRRDIWKRCAWMLADSKNYDEYSRATAGVFSGHLGALKTL  357

Query  421  LQVASSWQDALWAYMKTLLDIKVEREVRDLVAKSFTDMPDDYWKNEISLKDVFKELHASK  480
            L   S+W D LWA++K  +DI+VE E+R    K++  MPDDYW   ++++ +F+EL+ +K
Sbjct  358  LH--SNWHDLLWAHLKVQIDIRVESEIRGCCLKNYQPMPDDYWNGRMTMEQIFEELNVAK  415

Query  481  NPDIRAQSNKPDHLIQKYLILDQIPKLMEEIEDMICSKSC--DPHFLRFLAHLIYFFRQI  538
            +  +R  +     +IQ++LILD   +L++ +   +   +    PH LRF+AH++ F RQI
Sbjct  416  DASVRDFAQSQLGIIQRHLILDTCGELIQHMVRWVEKDTSQQSPHQLRFMAHIVLFLRQI  475

Query  539  GKNAKDKIGDKVLLAYVRVLIEMDDPILIAFYTAMLPQELQITNYASYLETIKDYEQRKK  598
            G+  +++  +K++ AYV  LI   +P LIA+YTA L   LQ+  Y+ +LE ++    R+ 
Sbjct  476  GRVEQERQAEKIVAAYVEALIARGEPQLIAYYTASLSNPLQVQLYSRFLEQVEQKRPREL  535

Query  599  CLAAAEDANLNVEAITKLVVESIRSKNIDVDPTD--LKGTMTDADVDKINALDWLIFYQS  656
             + AA  A L+VE IT++ V++IR  +  +        G ++  D  KI+AL+WLI    
Sbjct  536  AVDAALQAGLDVEQITRVTVQNIRLAHQPLGEFGEPQSGEISAIDQRKISALEWLIHLPE  595

Query  657  QREEALSQTNALIRYFLTNEKIDAARKAFNKIPVDSIEAIMAEYPTLEGTLTNLTMTNNL  716
            QR E L Q NA+IR +L + K++  R+ F  +P D ++ +++ Y ++          +N+
Sbjct  596  QRGELLWQANAMIRTYLASSKVECMRQTFRMVPADIVQQLVSLYGSV----------DNI  645

Query  717  SKRASSTIREYLCYKTYLDAQEGFAEW--FSHFHHGKPTPLEELPAYATFTEKVAYEHKK  774
              R    ++EYLCYK YL   + F EW         KP       +   FTE++A E K+
Sbjct  646  PPREECCLKEYLCYKAYLSGVDSFVEWNRLQQNRPKKPQTSHAASSQDNFTERMASERKE  705

Query  775  SQYNVEMERWKSTMQHHTKAVKQLLFNVLLFPDGGWLVDSNNNNDESCTPEEAT------  828
              +  E+ RW+  ++   K   +LL+NVL+FPD GWLVD          PE A       
Sbjct  706  QAHRSEVVRWEHKVKEQAKQTIELLYNVLMFPDKGWLVDPFIAK----LPENAVQLNWDH  761

Query  829  REHQMEKLRELCIPKVTLLLHSVMTEMNEHAECIQLADILASEQYQLYKVFQKGRLREVF  888
            R  QMEKLR +CIP++ L L+ VM +  + A C++LAD ++SE  QLYKV+ K +L E+ 
Sbjct  762  RLLQMEKLRSICIPEIALFLNEVMFKSGDFAGCVRLADEISSENRQLYKVYTKHKLAELL  821

Query  889  KKICESSLVLMDQKKDPWGYP  909
             KI ++SL L++ K DPWGYP
Sbjct  822  AKIADASLELLNSKLDPWGYP  842



Lambda      K        H
   0.324    0.139    0.448 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1051796556


Query= XP_003392955.1 mitochondrial-processing peptidase subunit beta
[Bombus terrestris]

Length=477
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VFF0_DROME  unnamed protein product                                 716     0.0   
Q23295_CAEEL  unnamed protein product                                 433     3e-149
MPPB_DICDI  unnamed protein product                                   409     2e-139
UCR1_CAEEL  unnamed protein product                                   334     3e-110
Q57W51_TRYB2  unnamed protein product                                 228     5e-69 


>Q9VFF0_DROME unnamed protein product
Length=470

 Score = 716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/477 (71%), Positives = 397/477 (83%), Gaps = 7/477 (1%)

Query  1    MATRLLKVSSALRAYSNKTSLVKVPKQWQSTSASLKEILVNQPPTHVTTLDCGMRIATED  60
            MA R+L V+  +R++     ++K  K    ++A+L++ L+N P T VT LD G+R+A+ED
Sbjct  1    MALRVLGVTQNMRSFMRGVDMIKRYK----SAATLQKTLLNIPATQVTKLDNGLRVASED  56

Query  61   SGAPTATVGLWIDAGSRFETDEINGVAHFMEHMAFKGTTKRSQTDLELEIENMGAHLNAY  120
            SGA TATVGLWIDAGSR E ++ NGVAHF+EHMAFKGT KRSQTDLELE+EN+GAHLNAY
Sbjct  57   SGASTATVGLWIDAGSRSENEKNNGVAHFLEHMAFKGTAKRSQTDLELEVENLGAHLNAY  116

Query  121  TSREQTVFYAKCLAEDVPKAVEILSDIIQNSKLGESEIERERSVILREMQEVETNLQEVV  180
            TSREQTVFYAKCL++DVPKAVEIL+DIIQNSKLGE+EI RERSVILREMQEVE+NLQEVV
Sbjct  117  TSREQTVFYAKCLSKDVPKAVEILADIIQNSKLGEAEIARERSVILREMQEVESNLQEVV  176

Query  181  FDHLHASAYQGTPLGRTILGPTKNIKSITRNDLVNYVKQYYGPPRFILAGAGGVNHNQLV  240
            FDHLHA+AYQGTPLG+TILGPTKNI+SI + DL +Y++ +Y   R +LA AGGV H+ LV
Sbjct  177  FDHLHATAYQGTPLGQTILGPTKNIQSIGKADLTDYIQTHYKASRIVLAAAGGVKHDDLV  236

Query  241  DLAQKHFGQMKGPFYDEIPPLLEPCRYTGSEIRVRDDSIPLAHVAIAVEGAGWTDPDNIP  300
             LA    G ++      +P  + PCR+TGSE+RVRDDS+PLAHVAIAVEG GWTD DNIP
Sbjct  237  KLACSSLGGLEASV---LPAEVTPCRFTGSEVRVRDDSLPLAHVAIAVEGCGWTDQDNIP  293

Query  301  LMVANTLMGAWDRSQGGGVNNISFLAEASATDGLCHSYQSFNTCYQDTGLWGVYFVSDPM  360
            LMVANTL+GAWDRSQGGG NN S LA ASA D LCHS+QSFNTCY+DTGLWG+YFV DP+
Sbjct  294  LMVANTLVGAWDRSQGGGANNASNLARASAEDNLCHSFQSFNTCYKDTGLWGIYFVCDPL  353

Query  361  EIEWFVHNVQREWMRLCTSVTEKEVERAKNILKTNMLLQLDGTTAICEDIGRQMLCYNRR  420
            + E  + NVQ EWMRLCT VTE EVERAKN+LKTNMLLQLDGTT ICEDIGRQ+LCYNRR
Sbjct  354  QCEDMLFNVQTEWMRLCTMVTEAEVERAKNLLKTNMLLQLDGTTPICEDIGRQILCYNRR  413

Query  421  IPLHELEARINSITASNIHDIGMKYIYDQCPVIAAVGPVENLQDYNVIRSGMYRLRV  477
            IPLHELE RI++++  N+ D+ MKYIYD+CP +AAVGPVENL DYN IRS MY LRV
Sbjct  414  IPLHELEQRIDAVSVGNVRDVAMKYIYDRCPAVAAVGPVENLPDYNRIRSSMYWLRV  470


>Q23295_CAEEL unnamed protein product
Length=458

 Score = 433 bits (1114),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 211/418 (50%), Positives = 286/418 (68%), Gaps = 3/418 (1%)

Query  43   PPTHVTTLDCGMRIATEDSGAPTATVGLWIDAGSRFETDEINGVAHFMEHMAFKGTTKRS  102
            P T VTTL  G R+ATE++G  TAT+G++IDAGSR+E ++ NG AHF+EHMAFKGT +R+
Sbjct  28   PETIVTTLPNGFRVATENTGGSTATIGVFIDAGSRYENEKNNGTAHFLEHMAFKGTPRRT  87

Query  103  QTDLELEIENMGAHLNAYTSREQTVFYAKCLAEDVPKAVEILSDIIQNSKLGESEIERER  162
            +  LELE+EN+GAHLNAYTSRE T +YAKC  E + ++V+ILSDI+ NS L   +IE ER
Sbjct  88   RMGLELEVENIGAHLNAYTSRESTTYYAKCFTEKLDQSVDILSDILLNSSLATKDIEAER  147

Query  163  SVILREMQEVETNLQEVVFDHLHASAYQGTPLGRTILGPTKNIKSITRNDLVNYVKQYYG  222
             VI+REM+EV  N QEVVFD LHA  ++G PL  TILGP + I++I +NDL  Y+  +Y 
Sbjct  148  GVIIREMEEVAQNFQEVVFDILHADVFKGNPLSYTILGPIELIQTINKNDLQGYINTHYR  207

Query  223  PPRFILAGAGGVNHNQLVDLAQKHFGQMKGPFYDEIPPLLEPCRYTGSEIRVRDDSIPLA  282
              R +LA AGGVNH+ +V +A+K+FG++K   + +      P  Y+  E+R     +P+ 
Sbjct  208  SGRMVLAAAGGVNHDAIVKMAEKYFGELK---HGDSSTEFVPATYSPCEVRGDIPDLPML  264

Query  283  HVAIAVEGAGWTDPDNIPLMVANTLMGAWDRSQGGGVNNISFLAEASATDGLCHSYQSFN  342
            + A+ VEG  WT  DN+ LMVANTLMG +DR +G GVN  + LAE  + D     +QSFN
Sbjct  265  YGAMVVEGVSWTHEDNLALMVANTLMGEYDRMRGFGVNAPTRLAEKLSQDAGIEVFQSFN  324

Query  343  TCYQDTGLWGVYFVSDPMEIEWFVHNVQREWMRLCTSVTEKEVERAKNILKTNMLLQLDG  402
            TCY++TGL G YFV+ P  I+  + +V ++W+ L  ++ E  V+RAK  L TN+LL LDG
Sbjct  325  TCYKETGLVGTYFVAAPESIDNLIDSVLQQWVWLANNIDEAAVDRAKRSLHTNLLLMLDG  384

Query  403  TTAICEDIGRQMLCYNRRIPLHELEARINSITASNIHDIGMKYIYDQCPVIAAVGPVE  460
            +T +CEDIGRQ+LCY RRIP  EL ARI SIT   + D+  +   +     A VG  +
Sbjct  385  STPVCEDIGRQLLCYGRRIPTPELHARIESITVQQLRDVCRRVFLEGQVSAAVVGKTQ  442


>MPPB_DICDI unnamed protein product
Length=469

 Score = 409 bits (1050),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 201/437 (46%), Positives = 275/437 (63%), Gaps = 2/437 (0%)

Query  43   PPTHVTTLDCGMRIATEDSGAPTATVGLWIDAGSRFETDEINGVAHFMEHMAFKGTTKR-  101
            P T +TTL  G+R+ATE +    A+VG+W+D+GS +ETD+ NGVAHF+EHM FKGT KR 
Sbjct  33   PETKITTLSNGIRVATEQTYGEVASVGVWVDSGSVYETDKNNGVAHFLEHMIFKGTAKRP  92

Query  102  SQTDLELEIENMGAHLNAYTSREQTVFYAKCLAEDVPKAVEILSDIIQNSKLGESEIERE  161
            +   +E EIENMG  LNA+TSRE + +Y K L ++VP AV+ILSDI+QNSK   S IE+E
Sbjct  93   TPQSIETEIENMGGSLNAFTSREHSAYYMKVLKDNVPNAVDILSDILQNSKFETSLIEQE  152

Query  162  RSVILREMQEVETNLQEVVFDHLHASAYQGTPLGRTILGPTKNIKSITRNDLVNYVKQYY  221
            R  IL E   +++   EVVFD LHA+A+QG+ LGRTILGP +NIKSITR  +  ++ + Y
Sbjct  153  RDTILSENDYIQSKEDEVVFDQLHAAAFQGSALGRTILGPVENIKSITREQIQEFINENY  212

Query  222  GPPRFILAGAGGVNHNQLVDLAQKHFGQMK-GPFYDEIPPLLEPCRYTGSEIRVRDDSIP  280
               R +++ AG VNH QLV+  ++ F  +K      ++        + GSE+RVRDD  P
Sbjct  213  TGDRLVISAAGAVNHEQLVEQVKEKFANVKMSQVSKDVKRAAITNDFIGSELRVRDDEQP  272

Query  281  LAHVAIAVEGAGWTDPDNIPLMVANTLMGAWDRSQGGGVNNISFLAEASATDGLCHSYQS  340
            L H A+AV    WTDPD   L +  T++G W+R    G N  S L E  AT+ L  SY +
Sbjct  273  LIHFAVAVRALPWTDPDYFVLELIQTMIGNWNRGIAAGKNIASNLGEIVATEDLAESYST  332

Query  341  FNTCYQDTGLWGVYFVSDPMEIEWFVHNVQREWMRLCTSVTEKEVERAKNILKTNMLLQL  400
            F TCYQDTGL+G Y V  P  ++  V  + +EW R+ TS  + EVER K  L    L+Q 
Sbjct  333  FFTCYQDTGLFGNYGVCQPERVDDLVAEMLKEWQRIATSCNKNEVERNKQKLLATTLMQY  392

Query  401  DGTTAICEDIGRQMLCYNRRIPLHELEARINSITASNIHDIGMKYIYDQCPVIAAVGPVE  460
            DGT+ +CE IGRQ+L   RR+   E+  RIN IT +++  +    + D  P + A+GP+ 
Sbjct  393  DGTSKVCEGIGRQILTLGRRLSPFEVYTRINEITVADVQRVASTLLRDVSPAVTAIGPIA  452

Query  461  NLQDYNVIRSGMYRLRV  477
            N  DYN ++   Y  R+
Sbjct  453  NYPDYNFVKGWTYWNRL  469


>UCR1_CAEEL unnamed protein product
Length=471

 Score = 334 bits (857),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 182/475 (38%), Positives = 281/475 (59%), Gaps = 12/475 (3%)

Query  1    MATRLLKVSSALRAYSNKTSLVKVPKQWQSTSASLKEILVNQPPTHVTTLDCGMRIATED  60
            MA RL  VSSALR   N  S V+      S++ S+K++L + P   VTTL  G R+ TED
Sbjct  1    MALRL-AVSSALRPALN--SQVRNA----SSAVSVKDVLASAPQAEVTTLKNGFRVVTED  53

Query  61   SGAPTATVGLWIDAGSRFETDEINGVAHFMEHMAFKGTTKRSQTDLELEIENMGAHLNAY  120
            +G+ TATVG+WI+ GSRFE ++ NGVAHF+E +  KGT KR+   LE E+  +GA LN++
Sbjct  54   NGSATATVGVWIETGSRFENEKNNGVAHFLERLIHKGTGKRASAALESELNAIGAKLNSF  113

Query  121  TSREQTVFYAKCLAEDVPKAVEILSDIIQNSKLGESEIERERSVILREMQEVETNLQEVV  180
            T R+QT  + +  A+DV K V+IL+D+++NSKL  S I+ ER  +L+E++  +   Q V+
Sbjct  114  TERDQTAVFVQAGAQDVEKVVDILADVLRNSKLEASTIDTERVNLLKELEASDDYHQLVL  173

Query  181  FDHLHASAYQGTPLGRTILGPTKNIKSITRNDLVNYVKQYYGPPRFILAGAGGVNHNQLV  240
            FD LHA+ +QGTPL  ++LG +++I +I+   L  + + +Y P R +L+  GG   N + 
Sbjct  174  FDMLHAAGFQGTPLALSVLGTSESIPNISAQQLKEWQEDHYRPVRMVLSAVGGGVSN-VS  232

Query  241  DLAQKHFGQMKGPFYDEIPPLLEPCRYTGSEIRVRDDSIPLAHVAIAVEGAGWTDPDNIP  300
             LA K+FG +   +  ++P  ++  R+TGSE R R+D++P  + A AVEG G+   D + 
Sbjct  233  SLADKYFGDLSNEYPRKVPQ-VDGTRFTGSEYRYRNDNVPHMYAAFAVEGVGYAHKDALA  291

Query  301  LMVANTLMGAWDRSQGGGVNNISFLAEASATDGLCHSYQSFNTCYQDTGLWGVYFVSDPM  360
            L +AN  +G WD +        S L +    D   H+ Q FN  Y+DTGL+G+YFV+D  
Sbjct  292  LQIANQFIGQWDVTHATSRTAASRLVQKIGHDHGVHNLQHFNINYKDTGLFGIYFVADAH  351

Query  361  EI---EWFVHNVQREWMRLCTSVTEKEVERAKNILKTNMLLQLDGTTAICEDIGRQMLCY  417
            ++      + +V  EW  L ++ TE+EV  AKN  +TN+   L+  T       +++L  
Sbjct  352  DLNDTSGIMKSVAHEWKHLASAATEEEVAMAKNQFRTNLYQNLETNTQKAGFNAKELLYT  411

Query  418  NRRIPLHELEARINSITASNIHDIGMKYIYDQCPVIAAVGPVENLQDYNVIRSGM  472
                 L ELEA+I  + A  + +   +++YD+      VG  E   +Y + R+GM
Sbjct  412  GNLRQLSELEAQIQKVDAGAVREAISRHVYDRDLAAVGVGRTEAFPNYALTRAGM  466


>Q57W51_TRYB2 unnamed protein product
Length=489

 Score = 228 bits (582),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 147/481 (31%), Positives = 241/481 (50%), Gaps = 39/481 (8%)

Query  25   PKQWQSTSASLKEILVNQPPTHVTTLDCGMRIATEDSG-APTATVGLWIDAGSRFETDEI  83
            P    +T+  L  +L   PPT ++T+  G+R+A E++  A  ATVG+W+DAG+R E  + 
Sbjct  14   PSSNHATTKLLSNVLAKIPPTTLSTVGSGVRVACEENPIASLATVGVWLDAGTRHEPAQY  73

Query  84   NGVAHFMEHMAFKGTTKRSQTDLELEIENMGAHLNAYTSREQTVFYAKCLAEDVPKAVEI  143
             G A  ++   F GT+ ++   +   ++ +G  L A   RE T  Y +   ED  +AV +
Sbjct  74   AGTARVLQKCGFLGTSNQTAAQIAAAVDELGGQLTANVGREHTHLYMRVAREDTERAVSL  133

Query  144  LSDIIQNSKLGESEIERERSVILREMQEVETNLQEVVFDHLHASAYQ------GTPLGRT  197
            L+D+++N++L + ++E  +  +LR+  + E    ++  D+LH  A+       GTPL  T
Sbjct  134  LADVVRNARLSDEDVEVAKQAVLRDQHDFEQRPDDICMDNLHRCAFDSTTHGPGTPLYGT  193

Query  198  ILGPTKNIKSITRNDLVNYVKQYYGPPRFILAGAGGVNHNQLVDLAQKHFGQM-KGPFYD  256
             +G T+    ++   L  Y  +     R ++ G+G VNH  L   A   FG + KG    
Sbjct  194  EVGTTR----LSNAQLREYRDKMLSAGRVVVVGSGAVNHTALERAATSAFGDLQKGTVTL  249

Query  257  EIPPLLEPCRYTGSEIRVRDDSIPLAHVAIAVEGAGWTDPDNIPLMVANTLMGAWDRSQG  316
               P     R+ G E ++ +      H+  A E  G    D++PL +A  + G + RSQ 
Sbjct  250  AGVP---EARFVGGEYKLWNLRYKTVHIGWAFETCGAACEDSLPLALACEVPGPFHRSQH  306

Query  317  --GGVNNISFLAEASATDGLCHSYQSFN-TC----------YQDTGLWGVYFVSDPME--  361
              G       L   S+ D    +   FN  C          Y+DTGL G+Y V  P +  
Sbjct  307  ELGQHAMHRVLKTFSSLDHSTPTNTHFNEKCIEIANPFLHQYKDTGLCGMYVVGRPAQAG  366

Query  362  -------IEWFVHNVQREWMRLCTSVT-EKEVERAKNILKTNMLLQLDGTTAICEDIGRQ  413
                   IE F + +  EW R+C  +  E+E+ +AK  LK+ +L  +DG++   EDIGRQ
Sbjct  367  PGDGTAMIEVFQYTIA-EWCRICQKILHEQELAQAKVNLKSQLLFNMDGSSNSAEDIGRQ  425

Query  414  MLCYNRRIPLHELEARINSITASNIHDIGMKYIYDQCPVIAAVGPVENLQDYNVIRSGMY  473
            +L Y RRIPL E+ ARI+ +T +N+ ++   Y Y + PV + +G   N+  Y+  +   Y
Sbjct  426  VLHYGRRIPLEEMYARIDDVTPTNVQEVLQHYFYGRKPVYSYLGYCANIPGYDWTQHWSY  485

Query  474  R  474
            +
Sbjct  486  K  486



Lambda      K        H
   0.324    0.139    0.448 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1051796556


Query= XP_003392957.2 mitochondrial proton/calcium exchanger protein
[Bombus terrestris]

Length=774
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

LETM1_DROME  unnamed protein product                                  513     6e-169
C9ZLK0_TRYB9  unnamed protein product                                 52.8    6e-07 


>LETM1_DROME unnamed protein product
Length=1013

 Score = 513 bits (1322),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 284/600 (47%), Positives = 419/600 (70%), Gaps = 42/600 (7%)

Query  111  IVQSSSKSVEKVEKLTVWQKVKGEIIHYYHGFRLLGLDMKISAKLIWRILKGKELSRREH  170
            + +++ KSV K +K  +  ++  E++HYYHGFRLL +D+ I +KL+WR+L GK L+RRE+
Sbjct  166  LAKTADKSVAKPKK-PLRTRIWDELVHYYHGFRLLFIDVAICSKLLWRVLNGKTLTRREN  224

Query  171  RLLIKTTGDVFRLIPFSVFIIVPFMEFLLPIVIKFFPGLLPSTFQTATEKEDKLKQALKM  230
            + L +TT D+FRLIPFSVFIIVPFME LLP+ IKFFPG+LPSTFQT+T++++KL+Q+L +
Sbjct  225  KQLQRTTSDLFRLIPFSVFIIVPFMELLLPLFIKFFPGMLPSTFQTSTDRQEKLRQSLSV  284

Query  231  KIEVAKFLQKTLDDMAVQSPGYKSKRAKEFAEFFYKVRSSGAVASNDEIMQFSKLFEDEI  290
            ++EVAKFLQ+TLD M VQ   + S+ AK+F  FF K+R+     SNDEI++F+K F+DEI
Sbjct  285  RLEVAKFLQQTLDQMPVQHKEHSSEEAKQFEAFFTKIRNPTEPVSNDEIIKFAKRFDDEI  344

Query  291  TLDSLTRPQLVALCRVLDVQTLGTSNFLRFLLRMRLRSLTADDKLIEKEGIDSLTRTELQ  350
            TLDSL+R QL ALCRVL++ T+GT+  LRF LR++LRSL  DD++I +EG+DSL   ELQ
Sbjct  345  TLDSLSREQLAALCRVLELNTIGTTTLLRFQLRLKLRSLATDDRVIAREGVDSLDLLELQ  404

Query  351  QACRARGMRAYGLPDSKLKEQLSQWLDLSLNKKVPPSLLLLSRALMVPETIPMSDKLKAT  410
            QAC+ARGMRAYGL + +L+ QL +W+DLSLN++VPP+LLLLSR +++ +    +DKLK T
Sbjct  405  QACKARGMRAYGLTEERLRFQLKEWIDLSLNEQVPPTLLLLSRTMLISDDSITTDKLKET  464

Query  411  ISALPDTVVARTQGAIGEKEGKMDHKTNIEIIKMEERKIEEER--------------QEK  456
            I  LPD V A T+ AIGE EGK+D+KT IEIIK EERKI EER              +E+
Sbjct  465  IRVLPDAVGAHTRHAIGESEGKVDNKTKIEIIKEEERKIREEREEEREETIAKRSAIKEE  524

Query  457  EPQTTTVA--------FQNHK-------TDE-ITNSDVKVIEQALDSLGKDKKMSVEKEE  500
             P     A          +HK       TD+ I+++DV+++ +AL +L  DK++ VEKE 
Sbjct  525  IPAPYVFAEKLSGSQDLLDHKEQSSVSETDKGISSTDVQLLSEALKTLSSDKQLVVEKET  584

Query  501  LKELKEEMAEYQEDIKELYEIKAAAKGQEDIENIKVSKGATRLFKKVNKMINKMDAVLTQ  560
            +KELKEE+A+Y+ED++EL E++   K     E ++ S+ A  L+ +VNKMI+++D VL  
Sbjct  585  IKELKEELADYKEDVEELREVRQVVK-----EPVRESRAAKLLYNRVNKMISQLDNVLND  639

Query  561  LES-EKQMKELQKNTVGEEEVTVSQTAEELVKIDELISVIKKIQNVPDQHRLQRIAEILA  619
            LE+ + Q+K+ + +       TV    +++V IDEL++ I++++   D+ R + + ++L 
Sbjct  640  LEARQHQIKQAESSDYAASSPTVE--PQQMVHIDELVATIRRMKEASDEERFKVVGDLLV  697

Query  620  KIDDDRDGSIKIEDVLKVVELIGKEDIKLSKKQVDELLELIDKEEILEEKGQTEKVVQKD  679
            K+D D+DG I + ++ K V+ I +E   + KKQ++E  EL+ K   L  + + E++V  D
Sbjct  698  KLDADKDGVISVNEITKAVQSIDREATNIDKKQLEEFTELLSK---LASRRRHEEIVHID  754


 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 67/96 (70%), Gaps = 0/96 (0%)

Query  587  EELVKIDELISVIKKIQNVPDQHRLQRIAEILAKIDDDRDGSIKIEDVLKVVELIGKEDI  646
            EE+V ID+L++ IK ++   D+ RL+ I  +L K D D+DG + + D+ KV+E IG+++I
Sbjct  748  EEIVHIDDLMNNIKVLKETSDEARLKHIEAVLEKFDADKDGVVTVNDIRKVLESIGRDNI  807

Query  647  KLSKKQVDELLELIDKEEILEEKGQTEKVVQKDASE  682
            KLS K ++EL+ L+DKE++L+ + + EK + K   E
Sbjct  808  KLSDKAIEELISLLDKEQVLQAEQKIEKAIAKSMKE  843


>C9ZLK0_TRYB9 unnamed protein product
Length=377

 Score = 52.8 bits (125),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 58/220 (26%), Positives = 90/220 (41%), Gaps = 25/220 (11%)

Query  205  FFPGLLPSTFQTATEKEDKLKQALKMKIEVAKFLQKTLDDMAVQSPGYKSKRAKEFAEFF  264
             FP L+PSTF++  +  +K    L   +   + L + L   A  S    +K  +E   F 
Sbjct  1    MFPDLIPSTFESENQGRNKAFTTLMGTVRARRRLAEYLSSTAFVS---FTKEQQEVVRF-  56

Query  265  YKVRSSGAVASNDEIMQFSKLFEDEITLDSLTRPQ--LVALCRVLDVQTLGTSNFLR---  319
                + G   + ++I   +  F  E   +    P    VAL R + V       FL    
Sbjct  57   ---SAMGEAVTANQIRLIAPHFGREGPFNVYQIPNGIAVALARTVGVYKAYHGLFLTKMA  113

Query  320  -FLLRMRLRSLTA---DDKLIEKEGIDSLTRTELQQACRARGMRAYGLPDSKLKEQLSQW  375
             ++ R  LR       DD+++  EG+D LT  EL +A   RGMR +      L+ QL  W
Sbjct  114  PYMRRKILRQYHKTREDDRMLRLEGLDDLTDEELIKANLVRGMR-WTEDAETLRIQLEWW  172

Query  376  LDLSLNKKVPPSLLLLSRALMVPETIPMSDKLKATISALP  415
            + L  +  VP + L   +        P    LK ++  LP
Sbjct  173  ISLGRDPDVPYNTLFWVK--------PTRYSLKESMKRLP  204



Lambda      K        H
   0.324    0.139    0.448 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1051796556


Query= XP_003392959.1 hrp65 protein isoform X1 [Bombus terrestris]

Length=508
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

HRP65_CHITE  unnamed protein product                                  419     5e-142
NONA_DROME  unnamed protein product                                   385     1e-126
B3GWA1_CAEEL  unnamed protein product                                 229     2e-68 
Q8I7K5_CAEEL  unnamed protein product                                 219     1e-66 
B3GWA0_CAEEL  unnamed protein product                                 67.0    5e-12 


>HRP65_CHITE unnamed protein product
Length=535

 Score = 419 bits (1077),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 196/338 (58%), Positives = 276/338 (82%), Gaps = 1/338 (0%)

Query  67   IMERIMSISGPTHDLPPQETIEKKFSGRNRLYIGNLTNDVTEEEIQQMFQQYGETSELFL  126
            +  ++ +++GPTHDLP     E KFSGRNRLYIGNLT+DVTEEE++++F  YGE SE F+
Sbjct  85   VNSKLKNLAGPTHDLPELVCEEIKFSGRNRLYIGNLTSDVTEEELKELFSPYGEISEAFI  144

Query  127  NKEKNFSFVKMDYRVNAEKAKHELDRKMVKGRALKVRFAPLDSTIKVKNLTPWISNELLE  186
            N EKNF+F+K+DYR NAE+AK +LD +M K + +++RFAP  +TI+VKNLTP++SNELL 
Sbjct  145  NAEKNFAFLKIDYRANAERAKKDLDGRMRKNKPIRIRFAPNATTIRVKNLTPFVSNELLF  204

Query  187  KAFSVFGEIERAIVIVDKKGKSSGEGIIEFCKKNSAQLALRKCTEGCYRLTASPLPVIVE  246
            K+F VFG++ERA++IVD +GK++GEGI+EF +K+ A  AL+ C+E CY LT+S  P +VE
Sbjct  205  KSFEVFGQVERAVIIVDDRGKTTGEGIVEFARKSGAMSALKYCSEKCYFLTSSLRPCVVE  264

Query  247  LFEQQDDIDGYPDKSLPR-TTEFFKAREIGPRFAEVGSFEYEYGTRWKQLYELRKQKIEA  305
             F+  D+ DG+P+KSL R + +++KAR+ GPRFAE+GSFE+E+GT+WKQ+Y++ KQK +A
Sbjct  265  TFDHIDETDGFPEKSLMRKSNDYYKARQNGPRFAEMGSFEHEFGTKWKQMYDMYKQKHDA  324

Query  306  IEREMAIEEEKLEAQMEFERCEFETKRLREELRMREADRERQKREWEMKERQAEEQRTRE  365
            ++REM +EEEKLEAQME+ + E ET+ LRE+LR RE DR+RQK+EWE +ERQA+E R R+
Sbjct  325  LKREMQLEEEKLEAQMEYAKFEHETESLREQLRKREQDRDRQKKEWEDRERQADESRIRD  384

Query  366  EELRRRQQEEMAMAIRRQEEELHRRQQENNLFLQGQAM  403
            E+  RRQQ++M M ++RQ+EE+ RRQQEN+LF+Q Q +
Sbjct  385  EQQMRRQQDDMQMRMQRQDEEMRRRQQENSLFMQAQQL  422


>NONA_DROME unnamed protein product
Length=700

 Score = 385 bits (989),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 193/339 (57%), Positives = 251/339 (74%), Gaps = 3/339 (1%)

Query  67   IMERIMSISGPTHDLPPQET-IEKKFSGRNRLYIGNLTNDVTEEEIQQMFQQYGETSELF  125
            I +R+ SISGPT +L P E   E KFSGRNRLY+GNLTND+T++E+++MF+ YGE SE+F
Sbjct  273  ITQRLRSISGPTFELEPVEVPTETKFSGRNRLYVGNLTNDITDDELREMFKPYGEISEIF  332

Query  126  LNKEKNFSFVKMDYRVNAEKAKHELDRKMVKGRALKVRFAPLDSTIKVKNLTPWISNELL  185
             N +KNF+F+K+DY  NAEKAK  LD  M KGR L+VRFAP  + ++V NLTP++SNELL
Sbjct  333  SNLDKNFTFLKVDYHPNAEKAKRALDGSMRKGRQLRVRFAPNATILRVSNLTPFVSNELL  392

Query  186  EKAFSVFGEIERAIVIVDKKGKSSGEGIIEFCKKNSAQLALRKCTEGCYRLTASPLPVIV  245
             K+F +FG IERA + VD +GK  GEGI+EF KK+SA   LR C E C+ LTAS  P +V
Sbjct  393  YKSFEIFGPIERASITVDDRGKHMGEGIVEFAKKSSASACLRMCNEKCFFLTASLRPCLV  452

Query  246  ELFEQQDDIDGYPDKSL-PRTTEFFKAREIGPRFAEVGSFEYEYGTRWKQLYELRKQKIE  304
            +  E  DD DG P+K+   +  +F + R IGPRFA+  SFE+EYG+RWKQL+ L K K +
Sbjct  453  DPMEVNDDTDGLPEKAFNKKMPDFNQERSIGPRFADPNSFEHEYGSRWKQLHNLFKTKQD  512

Query  305  AIEREMAIEEEKLEAQMEFERCEFETKRLREELRMREADRERQKREWEMKERQAEEQRTR  364
            A++RE+ +EE+KLEAQME+ R E ET+ LR+ELR RE D ER+K EWEM+E+QAEE R R
Sbjct  513  ALKRELKMEEDKLEAQMEYARYEQETELLRQELRKREVDNERKKLEWEMREKQAEEMRKR  572

Query  365  EEELRRRQQEEMAMAIRRQEEELHRRQQENNLFLQGQAM  403
            EEE  RR Q EM   + RQEE++ RRQQE  LF++ Q +
Sbjct  573  EEETMRRHQTEMQSHMNRQEEDMLRRQQE-TLFMKAQQL  610


>B3GWA1_CAEEL unnamed protein product
Length=562

 Score = 229 bits (585),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/262 (42%), Positives = 178/262 (68%), Gaps = 1/262 (0%)

Query  85   ETIEKKFSGRNRLYIGNLTNDVTEEEIQQMFQQYGETSELFLNKEKNFSFVKMDYRVNAE  144
            E  +KKF+GR RL++GNL N+V E E++++F  +G+ +E +L+  K F+F+++D R +AE
Sbjct  106  EVPKKKFTGRCRLFVGNLPNEVKETELKELFSPHGDIAECYLSG-KGFAFLRLDTRAHAE  164

Query  145  KAKHELDRKMVKGRALKVRFAPLDSTIKVKNLTPWISNELLEKAFSVFGEIERAIVIVDK  204
             AK  +D +++ GR ++VRFA   + I+VK L+P +SNE+L  AFS FG++ERA+ IVD+
Sbjct  165  SAKEAIDGRIIHGRQVRVRFAVHGAAIRVKELSPTVSNEMLYHAFSHFGDVERAVHIVDE  224

Query  205  KGKSSGEGIIEFCKKNSAQLALRKCTEGCYRLTASPLPVIVELFEQQDDIDGYPDKSLPR  264
            KG+ +GEGI+EF +K +   A+    +  + LTASP P+I E+ E +D+ DG  ++ +PR
Sbjct  225  KGRPTGEGIVEFERKPNCNEAMAAIRDKVFLLTASPKPLICEVLEPRDEDDGLAERMIPR  284

Query  265  TTEFFKAREIGPRFAEVGSFEYEYGTRWKQLYELRKQKIEAIEREMAIEEEKLEAQMEFE  324
            T    K RE+GPRF    SFEY YG +WK+LY + +++   ++ E+     +LE+ ME  
Sbjct  285  TPGLSKERELGPRFPTPNSFEYVYGMKWKELYVVEQKRRAQLDEELRESRRRLESDMELA  344

Query  325  RCEFETKRLREELRMREADRER  346
              +++ + LRE+L+ R+ + ER
Sbjct  345  YQDYQAQMLREDLQRRQQELER  366


>Q8I7K5_CAEEL unnamed protein product
Length=374

 Score = 219 bits (559),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/251 (42%), Positives = 170/251 (68%), Gaps = 1/251 (0%)

Query  85   ETIEKKFSGRNRLYIGNLTNDVTEEEIQQMFQQYGETSELFLNKEKNFSFVKMDYRVNAE  144
            E  +KKF+GR RL++GNL N+V E E++++F  +G+ +E +L+  K F+F+++D R +AE
Sbjct  106  EVPKKKFTGRCRLFVGNLPNEVKETELKELFSPHGDIAECYLSG-KGFAFLRLDTRAHAE  164

Query  145  KAKHELDRKMVKGRALKVRFAPLDSTIKVKNLTPWISNELLEKAFSVFGEIERAIVIVDK  204
             AK  +D +++ GR ++VRFA   + I+VK L+P +SNE+L  AFS FG++ERA+ IVD+
Sbjct  165  SAKEAIDGRIIHGRQVRVRFAVHGAAIRVKELSPTVSNEMLYHAFSHFGDVERAVHIVDE  224

Query  205  KGKSSGEGIIEFCKKNSAQLALRKCTEGCYRLTASPLPVIVELFEQQDDIDGYPDKSLPR  264
            KG+ +GEGI+EF +K +   A+    +  + LTASP P+I E+ E +D+ DG  ++ +PR
Sbjct  225  KGRPTGEGIVEFERKPNCNEAMAAIRDKVFLLTASPKPLICEVLEPRDEDDGLAERMIPR  284

Query  265  TTEFFKAREIGPRFAEVGSFEYEYGTRWKQLYELRKQKIEAIEREMAIEEEKLEAQMEFE  324
            T    K RE+GPRF    SFEY YG +WK+LY + +++   ++ E+     +LE+ ME  
Sbjct  285  TPGLSKERELGPRFPTPNSFEYVYGMKWKELYVVEQKRRAQLDEELRESRRRLESDMELA  344

Query  325  RCEFETKRLRE  335
              +++ + LRE
Sbjct  345  YQDYQAQMLRE  355


>B3GWA0_CAEEL unnamed protein product
Length=282

 Score = 67.0 bits (162),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 53/85 (62%), Gaps = 0/85 (0%)

Query  262  LPRTTEFFKAREIGPRFAEVGSFEYEYGTRWKQLYELRKQKIEAIEREMAIEEEKLEAQM  321
            +PRT    K RE+GPRF    SFEY YG +WK+LY + +++   ++ E+     +LE+ M
Sbjct  2    IPRTPGLSKERELGPRFPTPNSFEYVYGMKWKELYVVEQKRRAQLDEELRESRRRLESDM  61

Query  322  EFERCEFETKRLREELRMREADRER  346
            E    +++ + LRE+L+ R+ + ER
Sbjct  62   ELAYQDYQAQMLREDLQRRQQELER  86



Lambda      K        H
   0.324    0.139    0.448 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1051796556


Query= XP_003392960.1 putative tyramine receptor 2 isoform X2 [Bombus
terrestris]

Length=402
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SER2_CAEEL  unnamed protein product                                   323     6e-107
G5EF04_CAEEL  unnamed protein product                                 318     7e-106
H2FLI4_CAEEL  unnamed protein product                                 318     1e-105
OAR_DROME  unnamed protein product                                    313     1e-101
5HT1R_DROME  unnamed protein product                                  244     2e-75 


>SER2_CAEEL unnamed protein product
Length=455

 Score = 323 bits (827),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 174/398 (44%), Positives = 251/398 (63%), Gaps = 36/398 (9%)

Query  29   SNLPVWEAAAASLTLGFLVLATVLGNALVILSVFTYRPLRIVQNFFIVSLAVADLAVAIL  88
            S +P  E    ++T   ++  TV+GN LV+++VF+YRPL+ VQN+F+VSLA +DLAVAI 
Sbjct  50   SIIPTVELVLGTITYLVIIAMTVVGNTLVVVAVFSYRPLKKVQNYFLVSLAASDLAVAIF  109

Query  89   VMPFNVA-YLLLGKWIFGIHLCKLWLTCDVLCCTASILNLCAIALDRYWAITDPINYAQK  147
            VMP +V  +L  GKW+ G+ +C+ + T D+L CT+SILNLCAIALDRYWAI +PINYAQK
Sbjct  110  VMPLHVVTFLAGGKWLLGVTVCQFFTTADILLCTSSILNLCAIALDRYWAIHNPINYAQK  169

Query  148  RTLKRVLATIAGVWILSGAISSPPLIGWNDWPEELEPGTPCQLTRRQGYVIYSSLGSFFI  207
            RT K V   I  VWILS  IS PP+IGWN+W E +   + C L+  + +V++S+ GSFF+
Sbjct  170  RTTKFVCIVIVIVWILSMLISVPPIIGWNNWQENMMEDS-CGLSTEKAFVVFSAAGSFFL  228

Query  208  PLLLMSLVYLEIFLATRRRLRERARQSRINAVQSTRHREVDDAEESVSSETNHNERSTPR  267
            PLL+M +VY++IF++ R+R+R    +S +  +Q+    E DD    +S      +R++  
Sbjct  229  PLLVMVVVYVKIFISARQRIRTNRGRSALMRIQNA---EGDDDYRKMSI-----KRASVE  280

Query  268  SHAKPSLIDDEPTEVTIGGGGTVTTSSSRRTTGGRAPATTTTVYQ---------------  312
            S    S + ++   V   G  TVTT ++  T GG  P   TT +                
Sbjct  281  SARTSSRVGEKTPLVIADGQTTVTTLAAHSTDGGSLPKDETTKHMKYHNNGSCKVKVKDV  340

Query  313  -----------FIEERQRISLSKERRAARTLGVIMGVFVVCWLPFFLMYVIVPFCPACCP  361
                        + +R++IS++KE+RAA+T+ VI+ VF  CWLPFF+ YVI PFC  C  
Sbjct  341  KEDEGNPNPTAVLRKREKISVAKEKRAAKTIAVIIFVFSFCWLPFFVAYVIRPFCETCKL  400

Query  362  SDRMVYFITWLGYVNSALNPLIYTIFNLDYRRAFRKLL  399
              ++    TWLGY+NS+LNP +Y I NL++RRAF+K+L
Sbjct  401  HAKVEQAFTWLGYINSSLNPFLYGILNLEFRRAFKKIL  438


>G5EF04_CAEEL unnamed protein product
Length=421

 Score = 318 bits (816),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 175/402 (44%), Positives = 255/402 (63%), Gaps = 19/402 (5%)

Query  3    SSGESSGTMTE-DYEVTGCGPSEEETGSNLPVWEAAAASLTLGFLVLATVLGNALVILSV  61
            SS  S+ T+   D  +T   P      S +P  E    ++T   ++  TV+GN LV+++V
Sbjct  17   SSAVSTTTLPPLDIPMTSMKPP-----SIIPTVELVLGTITYLVIIAMTVVGNTLVVVAV  71

Query  62   FTYRPLRIVQNFFIVSLAVADLAVAILVMPFNVA-YLLLGKWIFGIHLCKLWLTCDVLCC  120
            F+YRPL+ VQN+F+VSLA +DLAVAI VMP +V  +L  GKW+ G+ +C+ + T D+L C
Sbjct  72   FSYRPLKKVQNYFLVSLAASDLAVAIFVMPLHVVTFLAGGKWLLGVTVCQFFTTADILLC  131

Query  121  TASILNLCAIALDRYWAITDPINYAQKRTLKRVLATIAGVWILSGAISSPPLIGWNDWPE  180
            T+SILNLCAIALDRYWAI +PINYAQKRT K V   I  VWILS  IS PP+IGWN+W E
Sbjct  132  TSSILNLCAIALDRYWAIHNPINYAQKRTTKFVCIVIVIVWILSMLISVPPIIGWNNWQE  191

Query  181  ELEPGTPCQLTRRQGYVIYSSLGSFFIPLLLMSLVYLEIFLATRRRLRERARQSRINAVQ  240
             +   + C L+  + +V++S+ GSFF+PLL+M +VY++IF++ R+R+R    +S +  +Q
Sbjct  192  NMMEDS-CGLSTEKAFVVFSAAGSFFLPLLVMVVVYVKIFISARQRIRTNRGRSALMRIQ  250

Query  241  STRHREVDDAEESVSSETNHNERSTPRSHAKPSLIDDEPT---EVTIGGGGTVTTSSSRR  297
            +    + D  + S+   +  + R++ R+    SL  DE T   +    G   V     + 
Sbjct  251  NAEGDD-DYRKMSIKRASVESARTSSRTDGG-SLPKDETTKHMKYHNNGSCKVKVKDVKE  308

Query  298  TTGGRAPATTTTVYQFIEERQRISLSKERRAARTLGVIMGVFVVCWLPFFLMYVIVPFCP  357
              G   P         + +R++IS++KE+RAA+T+ VI+ VF  CWLPFF+ YVI PFC 
Sbjct  309  DEGNPNPTAV------LRKREKISVAKEKRAAKTIAVIIFVFSFCWLPFFVAYVIRPFCE  362

Query  358  ACCPSDRMVYFITWLGYVNSALNPLIYTIFNLDYRRAFRKLL  399
             C    ++    TWLGY+NS+LNP +Y I NL++RRAF+K+L
Sbjct  363  TCKLHAKVEQAFTWLGYINSSLNPFLYGILNLEFRRAFKKIL  404


>H2FLI4_CAEEL unnamed protein product
Length=420

 Score = 318 bits (814),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 176/399 (44%), Positives = 255/399 (64%), Gaps = 25/399 (6%)

Query  3    SSGESSGTMTE-DYEVTGCGPSEEETGSNLPVWEAAAASLTLGFLVLATVLGNALVILSV  61
            SS  S+ T+   D  +T   P      S +P  E    ++T   ++  TV+GN LV+++V
Sbjct  28   SSAVSTTTLPPLDIPMTSMKPP-----SIIPTVELVLGTITYLVIIAMTVVGNTLVVVAV  82

Query  62   FTYRPLRIVQNFFIVSLAVADLAVAILVMPFNVA-YLLLGKWIFGIHLCKLWLTCDVLCC  120
            F+YRPL+ VQN+F+VSLA +DLAVAI VMP +V  +L  GKW+ G+ +C+ + T D+L C
Sbjct  83   FSYRPLKKVQNYFLVSLAASDLAVAIFVMPLHVVTFLAGGKWLLGVTVCQFFTTADILLC  142

Query  121  TASILNLCAIALDRYWAITDPINYAQKRTLKRVLATIAGVWILSGAISSPPLIGWNDWPE  180
            T+SILNLCAIALDRYWAI +PINYAQKRT K V   I  VWILS  IS PP+IGWN+W E
Sbjct  143  TSSILNLCAIALDRYWAIHNPINYAQKRTTKFVCIVIVIVWILSMLISVPPIIGWNNWQE  202

Query  181  ELEPGTPCQLTRRQGYVIYSSLGSFFIPLLLMSLVYLEIFLATRRRLRERARQSRINAVQ  240
             +   + C L+  + +V++S+ GSFF+PLL+M +VY++IF++ R+R+R    +S +  +Q
Sbjct  203  NMMEDS-CGLSTEKAFVVFSAAGSFFLPLLVMVVVYVKIFISARQRIRTNRGRSALMRIQ  261

Query  241  STRHREVDDAEESVSSETNHNERSTPRSHAKPSLIDDEPTEVTIGGGGTVTTSSSRRTTG  300
            +    E DD    +S      +R++  S    S + ++   V   G  TVTT ++     
Sbjct  262  NA---EGDDDYRKMSI-----KRASVESARTSSRVGEKTPLVIADGQTTVTTLAAHSNPN  313

Query  301  GRAPATTTTVYQFIEERQRISLSKERRAARTLGVIMGVFVVCWLPFFLMYVIVPFCPACC  360
              A          + +R++IS++KE+RAA+T+ VI+ VF  CWLPFF+ YVI PFC  C 
Sbjct  314  PTA---------VLRKREKISVAKEKRAAKTIAVIIFVFSFCWLPFFVAYVIRPFCETCK  364

Query  361  PSDRMVYFITWLGYVNSALNPLIYTIFNLDYRRAFRKLL  399
               ++    TWLGY+NS+LNP +Y I NL++RRAF+K+L
Sbjct  365  LHAKVEQAFTWLGYINSSLNPFLYGILNLEFRRAFKKIL  403


>OAR_DROME unnamed protein product
Length=601

 Score = 313 bits (803),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 160/235 (68%), Positives = 195/235 (83%), Gaps = 2/235 (1%)

Query  31   LPVWEAAAASLTLGFLVLATVLGNALVILSVFTYRPLRIVQNFFIVSLAVADLAVAILVM  90
            +P WEA   +L L  +++ T++GN LVILSVFTY+PLRIVQNFFIVSLAVADL VA+LV+
Sbjct  104  VPEWEALLTALVLSVIIVLTIIGNILVILSVFTYKPLRIVQNFFIVSLAVADLTVALLVL  163

Query  91   PFNVAYLLLGKWIFGIHLCKLWLTCDVLCCTASILNLCAIALDRYWAITDPINYAQKRTL  150
            PFNVAY +LG+W FGIHLCKLWLTCDVLCCT+SILNLCAIALDRYWAITDPINYAQKRT+
Sbjct  164  PFNVAYSILGRWEFGIHLCKLWLTCDVLCCTSSILNLCAIALDRYWAITDPINYAQKRTV  223

Query  151  KRVLATIAGVWILSGAISSPPLIGWNDWPEELEPGTPCQLTRRQGYVIYSSLGSFFIPLL  210
             RVL  I+GVW+LS  ISSPPLIGWNDWP+E    TPC+LT ++GYVIYSSLGSFFIPL 
Sbjct  224  GRVLLLISGVWLLSLLISSPPLIGWNDWPDEFTSATPCELTSQRGYVIYSSLGSFFIPLA  283

Query  211  LMSLVYLEIFLATRRRLRERARQSRIN--AVQSTRHREVDDAEESVSSETNHNER  263
            +M++VY+EIF+ATRRRLRERAR +++N  A++ST    + ++    +S +    R
Sbjct  284  IMTIVYIEIFVATRRRLRERARANKLNTIALKSTELEPMANSSPVAASNSGSKSR  338


 Score = 169 bits (429),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 94/124 (76%), Gaps = 9/124 (7%)

Query  279  PTEVTIGGGGTVTTSSSRRTTGGRAPATTTTVYQFIEERQRISLSKERRAARTLGVIMGV  338
            P + + G      T   ++T+G         V QFIEE+Q+ISLSKERRAARTLG+IMGV
Sbjct  487  PPQSSTGVAAVSVTPLQKKTSG---------VNQFIEEKQKISLSKERRAARTLGIIMGV  537

Query  339  FVVCWLPFFLMYVIVPFCPACCPSDRMVYFITWLGYVNSALNPLIYTIFNLDYRRAFRKL  398
            FV+CWLPFFLMYVI+PFC  CCP+++   FITWLGY+NS LNP+IYTIFNLDYRRAF++L
Sbjct  538  FVICWLPFFLMYVILPFCQTCCPTNKFKNFITWLGYINSGLNPVIYTIFNLDYRRAFKRL  597

Query  399  LRIR  402
            L + 
Sbjct  598  LGLN  601


>5HT1R_DROME unnamed protein product
Length=564

 Score = 244 bits (624),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 146/377 (39%), Positives = 217/377 (58%), Gaps = 13/377 (3%)

Query  31   LPVWEAAAASLTLGFLVLATVLGNALVILSVFTYRPLRIVQNFFIVSLAVADLAVAILVM  90
            LP   +   S+ L  ++L TV+GN LV ++V   R LR   N+ +VSLA++DL VA+LVM
Sbjct  157  LPPLTSIFVSIVLLIVILGTVVGNVLVCIAVCMVRKLRRPCNYLLVSLALSDLCVALLVM  216

Query  91   PFNVAYLLLGKWIFGIHLCKLWLTCDVLCCTASILNLCAIALDRYWAITDPINYAQKRTL  150
            P  + Y +L KW FG  LC +W++ DVLCCTASILNLCAI++DRY AIT P+ Y  KRT 
Sbjct  217  PMALLYEVLEKWNFGPLLCDIWVSFDVLCCTASILNLCAISVDRYLAITKPLEYGVKRTP  276

Query  151  KRVLATIAGVWILSGAISSPPLIGWNDWPEELEPGTPCQLTRRQGYVIYSSLGSFFIPLL  210
            +R++  +  VW+ +  IS PPL+   +  E+ E    C + +   Y IY++LGSF+IPL 
Sbjct  277  RRMMLCVGIVWLAAACISLPPLLILGNEHEDEEGQPICTVCQNFAYQIYATLGSFYIPLS  336

Query  211  LMSLVYLEIFLATRRRLRERAR-----QSRINAVQSTRHREVDDAEESVSSETNHNERST  265
            +M  VY +IF A RR + E  R     Q  +N   S    +      +  + + + +R +
Sbjct  337  VMLFVYYQIFRAARRIVLEEKRAQTHLQQALNGTGSPSAPQAPPLGHTELASSGNGQRHS  396

Query  266  PRSHAKPSLIDDEPTEVTIGGGGTVTTSSSRRTTGGRAPATTTTVYQFIEERQRISLSKE  325
                   S+ +   T  T GG  +   + +   +GG    +T  +     ++ R  L+KE
Sbjct  397  -------SVGNTSLTYSTCGGLSSGGGALAGHGSGGGVSGSTGLLGSPHHKKLRFQLAKE  449

Query  326  RRAARTLGVIMGVFVVCWLPFFLMYVIVPFCPACCPSDRMVYFITWLGYVNSALNPLIYT  385
            ++A+ TLG+IM  F VCWLPFF++ +I PF     P+     F+ WLGY NS LNP+IY 
Sbjct  450  KKASTTLGIIMSAFTVCWLPFFILALIRPFETMHVPASLSSLFL-WLGYANSLLNPIIYA  508

Query  386  IFNLDYRRAFRKLLRIR  402
              N D+R+ F+++L  R
Sbjct  509  TLNRDFRKPFQEILYFR  525



Lambda      K        H
   0.324    0.139    0.448 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1051796556


Query= XP_003392961.1 delta-1-pyrroline-5-carboxylate synthase isoform X2
[Bombus terrestris]

Length=775
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ALH13_CAEEL  unnamed protein product                                  822     0.0  
Q8IR55_DROME  unnamed protein product                                 32.0    2.7  
Q9NCW7_DROME  unnamed protein product                                 32.0    2.8  
M9PEK6_DROME  unnamed protein product                                 32.0    2.8  
Q1KN24_DROME  unnamed protein product                                 32.0    2.9  


>ALH13_CAEEL unnamed protein product
Length=802

 Score = 822 bits (2124),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/738 (56%), Positives = 544/738 (74%), Gaps = 21/738 (3%)

Query  39   RKPTMFNERSQLTYTRRLVVKLGSAVITREDEHGLALGRLASIVEQVAECQNGGRECIMV  98
            +K  + N R+ L   +R+VVKLGSAVITREDE GLALGRLASIVEQV+E Q  GR+ ++V
Sbjct  67   QKHPLINTRNDLKKAQRVVVKLGSAVITREDECGLALGRLASIVEQVSELQQSGRQMLIV  126

Query  99   TSGAVAFGKQKLAQELLMSLSMRETLSPGGHMRKRSGTPLEPRAAAAVGQSGLMSLYDAM  158
            +SGAVAFG+QKL QEL+MS+SMR+TL      R  SG   + RA AA G  GLMSLY+ +
Sbjct  127  SSGAVAFGRQKLRQELVMSMSMRQTL------RGPSGMTADKRACAASGMPGLMSLYEQL  180

Query  159  FAQYGVKLAQVLVTKPDFYNEETRKNLFSTLSELLSLNIVPIINTNDAVSPPPHVDEEVA  218
            F QYG+ +AQVL+TKPD  +++ RKNL +T+  LLSLNI+PI+N NDAV+P P ++    
Sbjct  181  FQQYGITVAQVLLTKPDIDDDQRRKNLQATIESLLSLNIIPIVNANDAVAPDPKLN----  236

Query  219  GSGGRRGISIKDNDSLAAMLAAEIQADLLILMSDVDGIYNLPPWHDGAKMLHTFSMDLRD  278
                   + I DNDSLAA L+AEI+A+LLI++S+V+G+Y  PP  +G+++L+T+      
Sbjct  237  -------MHISDNDSLAARLSAEIEAELLIILSNVNGVYTGPPDLEGSRLLYTYVPSENS  289

Query  279  TIQFGQKSKVGTGGMDAKVNAALWALDRGVSVVICNGTQEKAIKNILSGRKIGTFFTQTT  338
             + FG  SK GTGGM++KV A + AL+ GV+ VI NG  + AI + ++G+KIGT F  T 
Sbjct  290  GVTFGANSKFGTGGMESKVTACVNALNNGVTTVITNGLAQDAITDAVAGKKIGTMFCNTK  349

Query  339  -ETFAPVEVVAEEARAGSRILQALQPEERASCINTLADLLESRQREILSANAKDLEAAEK  397
                 P+E VAE+ R   R L AL  +ER + +  LA LL  +++ I+ AN  DL  A+ 
Sbjct  350  GYEGPPIEEVAEKCRDAGRQLAALSNKERGAMVRHLAALLVDKEKYIIEANQTDLANAKS  409

Query  398  SGLAKALLSRLSLTPAKLKSLSCGLRQIANDSLTNVGRVLRRTRLAEGLELKQITVPIGV  457
            +GL   LL+RL +TP K++ L  GL  IA+ + T VGRVL++ +++EGL L+Q+TVPIG 
Sbjct  410  AGLDPQLLNRLKMTPEKIQDLHAGLNTIADSAETLVGRVLKKVKISEGLFLEQVTVPIGS  469

Query  458  LLVIFESRPDSLPQVAALAMSSANGLLLKGGKEAANSNRYLMELVKEALSTVG--AANAI  515
            L+VIFESRPD LPQVA+LAM+S N LLLKGGKEA  SN+ L  LV+EAL T G    +A+
Sbjct  470  LMVIFESRPDCLPQVASLAMASGNALLLKGGKEAEESNKALHALVQEALGTHGFEMRDAV  529

Query  516  SLISTREDVGDLLSMGKHIDLVIPRGSSDLVRSIQEQSKHIPVLGHAEGICHVYVDKDAD  575
            +L+ +REDV DLL +   IDL+IPRGSSDLVRS+QE+SK IPVLGHAEG+CHVY+DKD D
Sbjct  530  TLVRSREDVADLLQLKDLIDLIIPRGSSDLVRSMQEKSKGIPVLGHAEGVCHVYIDKDCD  589

Query  576  LMKAMKIIRDSKCDYPAACNAMETLLIHESHMKSSFFTDVCNMLQKEGVKVNSGPRLREQ  635
              KA++I+RDSKCDYP+ACNA ET+LIH+    + FF  +C+M + EGVK+++GP+L   
Sbjct  590  EQKAIQIVRDSKCDYPSACNAAETILIHKDLATAPFFDSLCSMFKAEGVKLHAGPKLAAL  649

Query  636  LTFGPPAAKSMKTEYGALECAIEVVTDVDDAINHIHKYGSGHTDVIVTENSQSATHFGRE  695
            L F PP A+SM  EYG+LEC +EVV +V++A+ HI +YGSGHT+ I+TEN+ +A HF + 
Sbjct  650  LKFAPPPAESMSFEYGSLECTLEVVDNVEEAVAHIIRYGSGHTESIITENTNTAEHFLKH  709

Query  696  VDSACVFHNASTRFSDGYRFGLGAEVGISTARIHARGPVGVDGLLTTKWVLHGDGHAAAD  755
            VDSAC FHNASTRF+DGYRFGLGAEVGIST RIHARGPVGV+GLLTTKW+L G+GH   D
Sbjct  710  VDSACAFHNASTRFADGYRFGLGAEVGISTGRIHARGPVGVEGLLTTKWLLRGEGHLVED  769

Query  756  FAEGGDKVWLHQSLPINE  773
            F + G   +LH++L  +E
Sbjct  770  F-KNGKYSYLHENLNPSE  786


>Q8IR55_DROME unnamed protein product
Length=2567

 Score = 32.0 bits (71),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 2/37 (5%)

Query  585  DSKCDYPAACNAMETLLIHESHMK--SSFFTDVCNML  619
            D + D P  C  + TLL+H S +K  S FF ++CN L
Sbjct  83   DKEVDLPLDCLYVYTLLLHYSCVKKPSLFFHNICNKL  119


>Q9NCW7_DROME unnamed protein product
Length=2501

 Score = 32.0 bits (71),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 2/37 (5%)

Query  585  DSKCDYPAACNAMETLLIHESHMK--SSFFTDVCNML  619
            D + D P  C  + TLL+H S +K  S FF ++CN L
Sbjct  83   DKEVDLPLDCLYVYTLLLHYSCVKKPSLFFHNICNKL  119


>M9PEK6_DROME unnamed protein product
Length=2501

 Score = 32.0 bits (71),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 2/37 (5%)

Query  585  DSKCDYPAACNAMETLLIHESHMK--SSFFTDVCNML  619
            D + D P  C  + TLL+H S +K  S FF ++CN L
Sbjct  83   DKEVDLPLDCLYVYTLLLHYSCVKKPSLFFHNICNKL  119


>Q1KN24_DROME unnamed protein product
Length=2501

 Score = 32.0 bits (71),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 2/37 (5%)

Query  585  DSKCDYPAACNAMETLLIHESHMK--SSFFTDVCNML  619
            D + D P  C  + TLL+H S +K  S FF ++CN L
Sbjct  83   DKEVDLPLDCLYVYTLLLHYSCVKKPSLFFHNICNKL  119



Lambda      K        H
   0.324    0.139    0.448 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1051796556


Query= XP_003392963.1 U4/U6 small nuclear ribonucleoprotein Prp4 [Bombus
terrestris]

Length=525
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VVI0_DROME  unnamed protein product                                 652     0.0  
Q57W14_TRYB2  unnamed protein product                                 141     7e-37
WDS_DROME  unnamed protein product                                    133     2e-34
LIS1_DROME  unnamed protein product                                   124     1e-30
LIS1_CAEEL  unnamed protein product                                   119     3e-29


>Q9VVI0_DROME unnamed protein product
Length=553

 Score = 652 bits (1681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/563 (59%), Positives = 411/563 (73%), Gaps = 49/563 (9%)

Query  1    MSDDEDLVYVKKQKTVHYGSLEEAERARLVAVA---------------------------  33
            MSDD+D+ Y+K+Q+T+HYGSLEE+ER R  A A                           
Sbjct  1    MSDDDDIQYIKRQRTLHYGSLEESERKRQNAAASGAAATTTSGTTASSGAGTTTTGTGGQ  60

Query  34   -----------ESSEEEKNITNLGDNANATATLGNIHISNEYMELEDEMSKDRQALLEEF  82
                       ES+++  N    G      ATL N  I ++Y +LE EM +D+ ALLEEF
Sbjct  61   LEDIDSDEDYEESTKKTSNAKQAGAPPPTAATLAN-KIDDDYFDLEMEMERDKVALLEEF  119

Query  83   ERRKKARQINVSTDDSEVKKNLRQLDEPICLFGEGPADRRTRLRELLANLGEDAI-KKKH  141
            ER+K+ARQINVSTDD+E+K NLRQL+EPIC FGEGPA+RR RL+ELLA LGE+AI K+++
Sbjct  120  ERKKRARQINVSTDDTEIKSNLRQLNEPICYFGEGPAERRRRLKELLAGLGENAINKRQY  179

Query  142  EEEEKPSHPIERDTETTWYHEGPDSLQIARSWIATYSLPRAKARLGKARQDLELPTATRT  201
            E+EE+     E+D + TWYHEGPDSL+IAR W+A YSLPRAK RL +AR+ LE+P+A R 
Sbjct  180  EDEERKQQQREQD-QATWYHEGPDSLRIARLWLADYSLPRAKDRLVRAREALEVPSAARA  238

Query  202  ARRQELLKKLQALTIYCSQIGDTRPISFCQFSPNSKLLATASWSGLCKIWSVPDCTLLRT  261
             R  E+ KKLQ+L   CSQ+GDTRP+S   FS +S LL T+SWSGLCK+WSVPDC L +T
Sbjct  239  GRMVEMQKKLQSLAPLCSQVGDTRPVSSAAFSEDSSLLLTSSWSGLCKLWSVPDCELKQT  298

Query  262  LKGHTCNVGCIVFHPKATITEEVVGEKSGQTCVLASCASDGTVKLWSGGSGEEPLAEVEG  321
            L+GH   VG +   P     EE V         +AS   DG VKLW G + EE +A++ G
Sbjct  299  LRGHASYVGGVALRPGVKADEENV-------VAMASGGHDGAVKLW-GFNNEESIADITG  350

Query  322  HEPHRVSRLAFHPSGRFLGTCCYDASWRLWDLEQQAEVLHQEGHARAVHCISFQGDGSVS  381
            H PHRVS++AFHPSGRFL T CYD+SWRLWDLEQ+ EVLHQEGHA+ VHC+S+  DGSV 
Sbjct  351  HMPHRVSKVAFHPSGRFLATACYDSSWRLWDLEQKTEVLHQEGHAKPVHCLSYHSDGSVL  410

Query  382  ATGGHDSFGRVWDLRTGRCIMFMEGHLKSIFGIDFSPNGFHIATASEDNTSKIWDLRKRS  441
             TGG D+FGRVWDLRTGRCIMF+EGHL ++FG+DFSPNGFHIAT S+DNT KIWDLR+R 
Sbjct  411  VTGGLDAFGRVWDLRTGRCIMFLEGHLGAVFGVDFSPNGFHIATGSQDNTCKIWDLRRRQ  470

Query  442  CVYTIPAHTNLLSDVKYQRIEGQYLVTASYDNTAKIWSNKTWQPLKTLPGHDGKVMSVDI  501
             VYTIPAHTNL+SDVKYQ+  G +LVT SYD+T KIWSNKTWQPLKTL GHD KV+SVDI
Sbjct  471  PVYTIPAHTNLISDVKYQQECGSFLVTCSYDSTTKIWSNKTWQPLKTLQGHDNKVISVDI  530

Query  502  SPDHKFIGTSSYDRTFKLWAPEN  524
            +P+ ++I T+S+DRTFKLW+P++
Sbjct  531  APNSQYIATTSFDRTFKLWSPDS  553


>Q57W14_TRYB2 unnamed protein product
Length=419

 Score = 141 bits (356),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 86/288 (30%), Positives = 145/288 (50%), Gaps = 17/288 (6%)

Query  233  SPNSKLLATASWSGLCKIWSVPDCTLLRTLKGHTCNVGCIVFHPKATITEEVVGEKSGQT  292
            +P    +AT S+   CKIW         TL GH   + C+ F+P++T             
Sbjct  147  NPYGNRVATGSFDKTCKIWDARTAQCYCTLAGHMAEIVCMSFNPQST-------------  193

Query  293  CVLASCASDGTVKLWSGGSGEEPLAEVEGHEPHRVSRLAFHPSGRFLGTCCYDASWRLWD  352
              L+S + D T K+W+  +G+E L  + GH    VS L F+ +G  + T  +D + +LWD
Sbjct  194  -HLSSGSMDYTAKVWNVETGQE-LYTLLGHTAEIVS-LNFNTNGDLILTGSFDTTAKLWD  250

Query  353  LEQQAEVLHQEGHARAVHCISFQGDGSVSATGGHDSFGRVWDLRTGRCIMFMEGHLKSIF  412
            +     V     H   +    F   G++  TG  D   ++WD+ +G+C+  + GH   I 
Sbjct  251  VRTGKCVHTLSSHRAEISSTQFNFAGNLCVTGCIDRTSKLWDVGSGQCVSTLRGHTDEIL  310

Query  413  GIDFSPNGFHIATASEDNTSKIWDLRKRSCVYTIPAHTNLLSDVKYQRIEGQYLVTASYD  472
             + FS +G  I TAS D T++++D    +CV ++  H   +S V++   +G  +++A+ D
Sbjct  311  DVAFSTSGSQIVTASADATARVYDTATFNCVASLVGHEGEISKVQFNP-QGTKIISAAND  369

Query  473  NTAKIWSNKTWQPLKTLPGHDGKVMSVDISPDHKFIGTSSYDRTFKLW  520
             T ++WS +T Q L+TL GH+ ++ S   + +   I T S D T  +W
Sbjct  370  KTCRVWSVETGQNLQTLTGHNDEIFSCAFNYEGDTILTGSKDNTCGIW  417


 Score = 133 bits (335),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 80/298 (27%), Positives = 145/298 (49%), Gaps = 16/298 (5%)

Query  226  PISFCQFSPNSKLLATASWSGLCKIWSVPDCTLLRTLKGHTCNVGCIVFHPKATITEEVV  285
            P++ C F+       T S+   CK+W       + +L+GH   V  + F+          
Sbjct  97   PLTNCAFNKGGDSFITGSYDRTCKVWDTATGNEIVSLEGHRNVVYSVSFNNP-------Y  149

Query  286  GEKSGQTCVLASCASDGTVKLWSGGSGEEPLAEVEGHEPHRVSRLAFHPSGRFLGTCCYD  345
            G +      +A+ + D T K+W   + +     + GH    V  ++F+P    L +   D
Sbjct  150  GNR------VATGSFDKTCKIWDARTAQ-CYCTLAGHMAEIVC-MSFNPQSTHLSSGSMD  201

Query  346  ASWRLWDLEQQAEVLHQEGHARAVHCISFQGDGSVSATGGHDSFGRVWDLRTGRCIMFME  405
             + ++W++E   E+    GH   +  ++F  +G +  TG  D+  ++WD+RTG+C+  + 
Sbjct  202  YTAKVWNVETGQELYTLLGHTAEIVSLNFNTNGDLILTGSFDTTAKLWDVRTGKCVHTLS  261

Query  406  GHLKSIFGIDFSPNGFHIATASEDNTSKIWDLRKRSCVYTIPAHTNLLSDVKYQRIEGQY  465
             H   I    F+  G    T   D TSK+WD+    CV T+  HT+ + DV +    G  
Sbjct  262  SHRAEISSTQFNFAGNLCVTGCIDRTSKLWDVGSGQCVSTLRGHTDEILDVAFST-SGSQ  320

Query  466  LVTASYDNTAKIWSNKTWQPLKTLPGHDGKVMSVDISPDHKFIGTSSYDRTFKLWAPE  523
            +VTAS D TA+++   T+  + +L GH+G++  V  +P    I +++ D+T ++W+ E
Sbjct  321  IVTASADATARVYDTATFNCVASLVGHEGEISKVQFNPQGTKIISAANDKTCRVWSVE  378


 Score = 102 bits (253),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 72/264 (27%), Positives = 114/264 (43%), Gaps = 21/264 (8%)

Query  217  YCSQIGDTRPISFCQFSPNSKLLATASWSGLCKIWSVPDCTLLRTLKGHTCNVGCIVFHP  276
            YC+  G    I    F+P S  L++ S     K+W+V     L TL GHT  +  + F+ 
Sbjct  173  YCTLAGHMAEIVCMSFNPQSTHLSSGSMDYTAKVWNVETGQELYTLLGHTAEIVSLNFNT  232

Query  277  KATITEEVVGEKSGQTCVLASCASDGTVKLWSGGSGEEPLAEVEGHEPHR--VSRLAFHP  334
               +              + + + D T KLW   +G+     V     HR  +S   F+ 
Sbjct  233  NGDL--------------ILTGSFDTTAKLWDVRTGKC----VHTLSSHRAEISSTQFNF  274

Query  335  SGRFLGTCCYDASWRLWDLEQQAEVLHQEGHARAVHCISFQGDGSVSATGGHDSFGRVWD  394
            +G    T C D + +LWD+     V    GH   +  ++F   GS   T   D+  RV+D
Sbjct  275  AGNLCVTGCIDRTSKLWDVGSGQCVSTLRGHTDEILDVAFSTSGSQIVTASADATARVYD  334

Query  395  LRTGRCIMFMEGHLKSIFGIDFSPNGFHIATASEDNTSKIWDLRKRSCVYTIPAHTNLLS  454
              T  C+  + GH   I  + F+P G  I +A+ D T ++W +     + T+  H + + 
Sbjct  335  TATFNCVASLVGHEGEISKVQFNPQGTKIISAANDKTCRVWSVETGQNLQTLTGHNDEIF  394

Query  455  DVKYQRIEGQYLVTASYDNTAKIW  478
               +   EG  ++T S DNT  IW
Sbjct  395  SCAFNY-EGDTILTGSKDNTCGIW  417


 Score = 69.3 bits (168),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 57/120 (48%), Gaps = 0/120 (0%)

Query  404  MEGHLKSIFGIDFSPNGFHIATASEDNTSKIWDLRKRSCVYTIPAHTNLLSDVKYQRIEG  463
            +  H+  +    F+  G    T S D T K+WD    + + ++  H N++  V +    G
Sbjct  91   LRAHMLPLTNCAFNKGGDSFITGSYDRTCKVWDTATGNEIVSLEGHRNVVYSVSFNNPYG  150

Query  464  QYLVTASYDNTAKIWSNKTWQPLKTLPGHDGKVMSVDISPDHKFIGTSSYDRTFKLWAPE  523
              + T S+D T KIW  +T Q   TL GH  +++ +  +P    + + S D T K+W  E
Sbjct  151  NRVATGSFDKTCKIWDARTAQCYCTLAGHMAEIVCMSFNPQSTHLSSGSMDYTAKVWNVE  210


>WDS_DROME unnamed protein product
Length=361

 Score = 133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 86/311 (28%), Positives = 149/311 (48%), Gaps = 21/311 (7%)

Query  215  TIYCSQIGDTRPISFCQFSPNSKLLATASWSGLCKIWSVPDCTLLRTLKGHTCNVGCIVF  274
            T+  +  G T+ +S  +FSPN + LA++S   L KIW   D    +T+ GH   +  + +
Sbjct  63   TLKFTLAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAW  122

Query  275  HPKATITEEVVGEKSGQTCVLASCASDGTVKLWSGGSGEEPLAEVEGHEPHRVSRLAFHP  334
                          S  + +L S + D T+K+W   +G+  L  ++GH  + V    F+P
Sbjct  123  --------------SSDSRLLVSGSDDKTLKVWELSTGKS-LKTLKGHS-NYVFCCNFNP  166

Query  335  SGRFLGTCCYDASWRLWDLEQQAEVLHQEGHARAVHCISFQGDGSVSATGGHDSFGRVWD  394
                + +  +D S R+WD+     +     H+  V  + F  DGS+  +  +D   R+WD
Sbjct  167  QSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWD  226

Query  395  LRTGRCI-MFMEGHLKSIFGIDFSPNGFHIATASEDNTSKIWDLRKRSCVYTIPAHTN--  451
              +G+C+   ++     +  + FSPNG +I  A+ DNT K+WD  K  C+ T   H N  
Sbjct  227  TASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEK  286

Query  452  LLSDVKYQRIEGQYLVTASYDNTAKIWSNKTWQPLKTLPGHDGKVMSVDISPDHKFIGTS  511
                  +    G+++V+ S DN   IW+ ++ + ++ L GH   V+     P    I ++
Sbjct  287  YCIFANFSVTGGKWIVSGSEDNMVYIWNLQSKEVVQKLQGHTDTVLCTACHPTENIIASA  346

Query  512  SY--DRTFKLW  520
            +   D+T KLW
Sbjct  347  ALENDKTIKLW  357


>LIS1_DROME unnamed protein product
Length=411

 Score = 124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 89/323 (28%), Positives = 146/323 (45%), Gaps = 38/323 (12%)

Query  219  SQIGDTRPISFCQFSPNSKLLATASWSGLCKIWSVPDCTLLRTLKGHTCNVGCIVFHPKA  278
            S  G    I+   F P   L+ +AS     +IW        R+LKGHT +V  + F    
Sbjct  103  SLTGHRASITRVIFHPIFALMVSASEDATIRIWDFETGEYERSLKGHTDSVQDVAF----  158

Query  279  TITEEVVGEKSGQTCVLASCASDGTVKLWSGGSGEEPLAEVEGHEPHRVSRLAFHPSGRF  338
                        Q  +LASC++D ++KLW      E +  + GH+ H VS +AF P+G +
Sbjct  159  ----------DAQGKLLASCSADLSIKLWDFQQSYECIKTMHGHD-HNVSSVAFVPAGDY  207

Query  339  LGTCCYDASWRLWDLEQQAEVLHQEGHARAVHCISFQGDGSVSATGGHDSFGRVWDLRTG  398
            + +   D + ++W++     V    GH   V  +    +GS+ AT  +D   RVW   + 
Sbjct  208  VLSASRDRTIKMWEVATGYCVKTYTGHREWVRMVRVHIEGSIFATCSNDQTIRVWLTNSK  267

Query  399  RCIMFMEGHLKSI-----------------FGIDFSPNGFH----IATASEDNTSKIWDL  437
             C + +  H  ++                  G D +  G H    +A+ S D T +IWD+
Sbjct  268  DCKVELRDHEHTVECIAWAPEAAASAINEAAGAD-NKKGHHQGPFLASGSRDKTIRIWDV  326

Query  438  RKRSCVYTIPAHTNLLSDVKYQRIEGQYLVTASYDNTAKIWSNKTWQPLKTLPGHDGKVM  497
                C+ T+  H N +  + +    G+YLV+AS D T ++W  +  + +KTL  H     
Sbjct  327  SVGLCLLTLSGHDNWVRGLAFHP-GGKYLVSASDDKTIRVWDLRNKRCMKTLYAHQHFCT  385

Query  498  SVDISPDHKFIGTSSYDRTFKLW  520
            S+D    H ++ + S D+T K+W
Sbjct  386  SIDFHKAHPYVISGSVDQTVKVW  408


 Score = 107 bits (266),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 71/284 (25%), Positives = 122/284 (43%), Gaps = 36/284 (13%)

Query  261  TLKGHTCNVGCIVFHPKATITEEVVGEKSGQTCVLASCASDGTVKLWSGGSGEEPLAEVE  320
            +L GH  ++  ++FHP   +              + S + D T+++W   +GE   + ++
Sbjct  103  SLTGHRASITRVIFHPIFAL--------------MVSASEDATIRIWDFETGEYERS-LK  147

Query  321  GHEPHRVSRLAFHPSGRFLGTCCYDASWRLWDLEQQAEVLH-QEGHARAVHCISFQGDGS  379
            GH    V  +AF   G+ L +C  D S +LWD +Q  E +    GH   V  ++F   G 
Sbjct  148  GHTD-SVQDVAFDAQGKLLASCSADLSIKLWDFQQSYECIKTMHGHDHNVSSVAFVPAGD  206

Query  380  VSATGGHDSFGRVWDLRTGRCIMFMEGHLKSIFGIDFSPNGFHIATASEDNTSKIWDLRK  439
               +   D   ++W++ TG C+    GH + +  +     G   AT S D T ++W    
Sbjct  207  YVLSASRDRTIKMWEVATGYCVKTYTGHREWVRMVRVHIEGSIFATCSNDQTIRVWLTNS  266

Query  440  RSCVYTIPAHTNLL-------------------SDVKYQRIEGQYLVTASYDNTAKIWSN  480
            + C   +  H + +                   +D K    +G +L + S D T +IW  
Sbjct  267  KDCKVELRDHEHTVECIAWAPEAAASAINEAAGADNKKGHHQGPFLASGSRDKTIRIWDV  326

Query  481  KTWQPLKTLPGHDGKVMSVDISPDHKFIGTSSYDRTFKLWAPEN  524
                 L TL GHD  V  +   P  K++ ++S D+T ++W   N
Sbjct  327  SVGLCLLTLSGHDNWVRGLAFHPGGKYLVSASDDKTIRVWDLRN  370


 Score = 74.3 bits (181),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 60/237 (25%), Positives = 95/237 (40%), Gaps = 36/237 (15%)

Query  222  GDTRPISFCQFSPNSKLLATASWSGLCKIWSVPDCTLLRTLKGHTCNVGCIVFHPKATIT  281
            G    +S   F P    + +AS     K+W V     ++T  GH   V  +  H + +I 
Sbjct  191  GHDHNVSSVAFVPAGDYVLSASRDRTIKMWEVATGYCVKTYTGHREWVRMVRVHIEGSI-  249

Query  282  EEVVGEKSGQTCVLASCASDGTVKLWSGGSGEEPLAEVEGHEPHRVSRLAF---------  332
                          A+C++D T+++W   S ++   E+  HE H V  +A+         
Sbjct  250  -------------FATCSNDQTIRVWLTNS-KDCKVELRDHE-HTVECIAWAPEAAASAI  294

Query  333  -----------HPSGRFLGTCCYDASWRLWDLEQQAEVLHQEGHARAVHCISFQGDGSVS  381
                       H  G FL +   D + R+WD+     +L   GH   V  ++F   G   
Sbjct  295  NEAAGADNKKGHHQGPFLASGSRDKTIRIWDVSVGLCLLTLSGHDNWVRGLAFHPGGKYL  354

Query  382  ATGGHDSFGRVWDLRTGRCIMFMEGHLKSIFGIDFSPNGFHIATASEDNTSKIWDLR  438
             +   D   RVWDLR  RC+  +  H      IDF     ++ + S D T K+W+ R
Sbjct  355  VSASDDKTIRVWDLRNKRCMKTLYAHQHFCTSIDFHKAHPYVISGSVDQTVKVWECR  411


>LIS1_CAEEL unnamed protein product
Length=404

 Score = 119 bits (299),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 84/314 (27%), Positives = 141/314 (45%), Gaps = 31/314 (10%)

Query  222  GDTRPISFCQFSPNSKLLATASWSGLCKIWSVPDCTLLRTLKGHTCNVGCIVFHPKATIT  281
            G   PI+   F P   ++A+ S     K+W      L RTLKGHT  V  I         
Sbjct  104  GHRLPITRVIFHPLWTIMASCSEDATIKVWDYETGQLERTLKGHTDAVNDIAI-------  156

Query  282  EEVVGEKSGQTCVLASCASDGTVKLWSGGSGEEPLAEVEGHEPHRVSRLAFHPSGRFLGT  341
             +  G++      L SC+SD ++KLW  G   + L  ++GHE H VS + F P+G F+ +
Sbjct  157  -DAAGKQ------LVSCSSDLSIKLWDFGQTYDCLKSLKGHE-HTVSSVTFLPTGDFVLS  208

Query  342  CCYDASWRLWDLEQQAEVLHQEGHARAVHCISFQGDGSVSATGGHDSFGRVWDLRTGRCI  401
               D + + WD+     V    GH   V  I    DG++ A+   D    VW   T    
Sbjct  209  ASRDHTIKQWDISTGYCVYTFRGHNDWVRMIRISNDGTLFASASLDQTVTVWSFATKSAK  268

Query  402  MFMEGHLKSIFGIDFSP--------------NGFHIA-TASEDNTSKIWDLRKRSCVYTI  446
            + +  H  ++  ++++P              N  HI  + S D + K W++     ++T+
Sbjct  269  LVLRDHEHAVECVEWAPDTAYTNVTGQQPEGNSTHILFSGSRDRSIKAWNINTGDVLFTL  328

Query  447  PAHTNLLSDVKYQRIEGQYLVTASYDNTAKIWSNKTWQPLKTLPGHDGKVMSVDISPDHK  506
             AH N +  + +   +G+YL++ + D T ++W     + +K +  H+  V +V       
Sbjct  329  LAHENWVRGLAFHP-KGKYLISVADDKTLRVWELSAQRCMKAIEAHEHFVSTVAFHQTSP  387

Query  507  FIGTSSYDRTFKLW  520
            F+ T S D + K+W
Sbjct  388  FVITGSVDMSCKVW  401


 Score = 106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 74/274 (27%), Positives = 120/274 (44%), Gaps = 31/274 (11%)

Query  262  LKGHTCNVGCIVFHPKATITEEVVGEKSGQTCVLASCASDGTVKLWSGGSGEEPLAEVEG  321
            L GH   +  ++FHP  TI              +ASC+ D T+K+W   +G+     ++G
Sbjct  102  LTGHRLPITRVIFHPLWTI--------------MASCSEDATIKVWDYETGQLERT-LKG  146

Query  322  HEPHRVSRLAFHPSGRFLGTCCYDASWRLWDLEQQAEVLHQ-EGHARAVHCISFQGDGSV  380
            H    V+ +A   +G+ L +C  D S +LWD  Q  + L   +GH   V  ++F   G  
Sbjct  147  HTD-AVNDIAIDAAGKQLVSCSSDLSIKLWDFGQTYDCLKSLKGHEHTVSSVTFLPTGDF  205

Query  381  SATGGHDSFGRVWDLRTGRCIMFMEGHLKSIFGIDFSPNGFHIATASEDNTSKIWDLRKR  440
              +   D   + WD+ TG C+    GH   +  I  S +G   A+AS D T  +W    +
Sbjct  206  VLSASRDHTIKQWDISTGYCVYTFRGHNDWVRMIRISNDGTLFASASLDQTVTVWSFATK  265

Query  441  SCVYTIPAHTNLLS------DVKYQRIEGQ--------YLVTASYDNTAKIWSNKTWQPL  486
            S    +  H + +       D  Y  + GQ         L + S D + K W+  T   L
Sbjct  266  SAKLVLRDHEHAVECVEWAPDTAYTNVTGQQPEGNSTHILFSGSRDRSIKAWNINTGDVL  325

Query  487  KTLPGHDGKVMSVDISPDHKFIGTSSYDRTFKLW  520
             TL  H+  V  +   P  K++ + + D+T ++W
Sbjct  326  FTLLAHENWVRGLAFHPKGKYLISVADDKTLRVW  359


 Score = 72.0 bits (175),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 58/208 (28%), Positives = 92/208 (44%), Gaps = 9/208 (4%)

Query  195  LPTA--TRTARRQELLKKLQALTIYCSQI--GDTRPISFCQFSPNSKLLATASWSGLCKI  250
            LPT     +A R   +K+    T YC     G    +   + S +  L A+AS      +
Sbjct  200  LPTGDFVLSASRDHTIKQWDISTGYCVYTFRGHNDWVRMIRISNDGTLFASASLDQTVTV  259

Query  251  WSVPDCTLLRTLKGHTCNVGCIVFHPKATITEEVVGEK--SGQTCVLASCASDGTVKLWS  308
            WS    +    L+ H   V C+ + P    T  V G++     T +L S + D ++K W+
Sbjct  260  WSFATKSAKLVLRDHEHAVECVEWAPDTAYTN-VTGQQPEGNSTHILFSGSRDRSIKAWN  318

Query  309  GGSGEEPLAEVEGHEPHRVSRLAFHPSGRFLGTCCYDASWRLWDLEQQAEVLHQEGHARA  368
              +G+  L  +  HE + V  LAFHP G++L +   D + R+W+L  Q  +   E H   
Sbjct  319  INTGD-VLFTLLAHE-NWVRGLAFHPKGKYLISVADDKTLRVWELSAQRCMKAIEAHEHF  376

Query  369  VHCISFQGDGSVSATGGHDSFGRVWDLR  396
            V  ++F        TG  D   +VW+ R
Sbjct  377  VSTVAFHQTSPFVITGSVDMSCKVWECR  404


 Score = 70.5 bits (171),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 78/159 (49%), Gaps = 2/159 (1%)

Query  364  GHARAVHCISFQGDGSVSATGGHDSFGRVWDLRTGRCIMFMEGHLKSIFGIDFSPNGFHI  423
            GH   +  + F    ++ A+   D+  +VWD  TG+    ++GH  ++  I     G  +
Sbjct  104  GHRLPITRVIFHPLWTIMASCSEDATIKVWDYETGQLERTLKGHTDAVNDIAIDAAGKQL  163

Query  424  ATASEDNTSKIWDL-RKRSCVYTIPAHTNLLSDVKYQRIEGQYLVTASYDNTAKIWSNKT  482
             + S D + K+WD  +   C+ ++  H + +S V +    G ++++AS D+T K W   T
Sbjct  164  VSCSSDLSIKLWDFGQTYDCLKSLKGHEHTVSSVTFLPT-GDFVLSASRDHTIKQWDIST  222

Query  483  WQPLKTLPGHDGKVMSVDISPDHKFIGTSSYDRTFKLWA  521
               + T  GH+  V  + IS D     ++S D+T  +W+
Sbjct  223  GYCVYTFRGHNDWVRMIRISNDGTLFASASLDQTVTVWS  261


 Score = 53.1 bits (126),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 52/232 (22%), Positives = 82/232 (35%), Gaps = 31/232 (13%)

Query  222  GDTRPISFCQFSPNSKLLATASWSGLCKIWSVPDCTLLRTLKGHTCNVGCIVFHPKATIT  281
            G    +S   F P    + +AS     K W +     + T +GH   V  I      T+ 
Sbjct  189  GHEHTVSSVTFLPTGDFVLSASRDHTIKQWDISTGYCVYTFRGHNDWVRMIRISNDGTL-  247

Query  282  EEVVGEKSGQTCVLASCASDGTVKLWSGGSGEEPLAEVEGHEPHRVSRLAFHP-------  334
                          AS + D TV +WS  +    L  +  HE H V  + + P       
Sbjct  248  -------------FASASLDQTVTVWSFATKSAKLV-LRDHE-HAVECVEWAPDTAYTNV  292

Query  335  --------SGRFLGTCCYDASWRLWDLEQQAEVLHQEGHARAVHCISFQGDGSVSATGGH  386
                    S   L +   D S + W++     +     H   V  ++F   G    +   
Sbjct  293  TGQQPEGNSTHILFSGSRDRSIKAWNINTGDVLFTLLAHENWVRGLAFHPKGKYLISVAD  352

Query  387  DSFGRVWDLRTGRCIMFMEGHLKSIFGIDFSPNGFHIATASEDNTSKIWDLR  438
            D   RVW+L   RC+  +E H   +  + F      + T S D + K+W+ R
Sbjct  353  DKTLRVWELSAQRCMKAIEAHEHFVSTVAFHQTSPFVITGSVDMSCKVWECR  404



Lambda      K        H
   0.324    0.139    0.448 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1051796556


Query= XP_003392964.1 histone H4 [Bombus terrestris]

Length=103
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

H4_DROME  unnamed protein product                                     199     3e-68
H4_PENVA  unnamed protein product                                     192     2e-65
H4_DICDI  unnamed protein product                                     141     4e-45
Q57Z31_TRYB2  unnamed protein product                                 123     4e-38
Q587H6_TRYB2  unnamed protein product                                 120     4e-37


>H4_DROME unnamed protein product
Length=103

 Score = 199 bits (507),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 103/103 (100%), Positives = 103/103 (100%), Gaps = 0/103 (0%)

Query  1    MTGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK  60
            MTGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
Sbjct  1    MTGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK  60

Query  61   VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG  103
            VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct  61   VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG  103


>H4_PENVA unnamed protein product
Length=103

 Score = 192 bits (489),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/103 (97%), Positives = 100/103 (97%), Gaps = 0/103 (0%)

Query  1    MTGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK  60
            MTGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
Sbjct  1    MTGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK  60

Query  61   VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG  103
            VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKR   TLYGFGG
Sbjct  61   VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRXXXTLYGFGG  103


>H4_DICDI unnamed protein product
Length=108

 Score = 141 bits (355),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 76/88 (86%), Gaps = 0/88 (0%)

Query  16   AKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTE  75
            AKRH+K  +++I GITKPAIRRLARRGGVKRIS  IYEETR VL+ FL NVIRD+V YTE
Sbjct  21   AKRHKKTQKEHINGITKPAIRRLARRGGVKRISFPIYEETRNVLRTFLTNVIRDSVAYTE  80

Query  76   HAKRKTVTAMDVVYALKRQGRTLYGFGG  103
            HA R+TVTAMDVVYALKRQGRTLYGF  
Sbjct  81   HAGRRTVTAMDVVYALKRQGRTLYGFNS  108


>Q57Z31_TRYB2 unnamed protein product
Length=100

 Score = 123 bits (309),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 79/93 (85%), Gaps = 0/93 (0%)

Query  10   GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRD  69
            G  KG  KR +KVLR+N++GIT+ +IRRLARRGGVKRISG+IY+E RGVLK F+E V+RD
Sbjct  8    GEAKGSQKRQKKVLRENVRGITRGSIRRLARRGGVKRISGVIYDEVRGVLKSFVEGVVRD  67

Query  70   AVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFG  102
            A  YTE++++KTVTA+DVV AL+++G+ LYG+ 
Sbjct  68   ATAYTEYSRKKTVTAVDVVNALRKRGKILYGYA  100


>Q587H6_TRYB2 unnamed protein product
Length=100

 Score = 120 bits (302),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 78/92 (85%), Gaps = 0/92 (0%)

Query  10   GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRD  69
            G  KG  KR +KVLRDN++GIT+ +IRRLARR GVKRISG+IY+E RGVLK F+E+++RD
Sbjct  8    GESKGAQKRQKKVLRDNVRGITRGSIRRLARRAGVKRISGVIYDEVRGVLKTFVESIVRD  67

Query  70   AVTYTEHAKRKTVTAMDVVYALKRQGRTLYGF  101
            A  YTE++++KTVTA  VV+AL+++G+ LYG+
Sbjct  68   AGAYTEYSRKKTVTAAHVVFALRKRGKVLYGY  99



Lambda      K        H
   0.324    0.139    0.448 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1051796556


Query= XP_003392965.1 histone H3 [Bombus terrestris]

Length=136
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

H3_DROME  unnamed protein product                                     274     8e-97
H33B_DROME  unnamed protein product                                   267     4e-94
H33A_DROME  unnamed protein product                                   267     4e-94
H332_CAEEL  unnamed protein product                                   266     2e-93
H33B_DICDI  unnamed protein product                                   236     1e-81


>H3_DROME unnamed protein product
Length=136

 Score = 274 bits (701),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 136/136 (100%), Positives = 136/136 (100%), Gaps = 0/136 (0%)

Query  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  120
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  121  MPKDIQLARRIRGERA  136
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136


>H33B_DROME unnamed protein product
Length=136

 Score = 267 bits (683),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 135/136 (99%), Gaps = 0/136 (0%)

Query  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60
            MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPGTVALREIRRYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  120
            LLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  121  MPKDIQLARRIRGERA  136
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136


>H33A_DROME unnamed protein product
Length=136

 Score = 267 bits (683),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 135/136 (99%), Gaps = 0/136 (0%)

Query  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60
            MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPGTVALREIRRYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  120
            LLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  121  MPKDIQLARRIRGERA  136
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136


>H332_CAEEL unnamed protein product
Length=136

 Score = 266 bits (679),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 134/136 (99%), Gaps = 0/136 (0%)

Query  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGTVALREIRRYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  120
            LLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  121  MPKDIQLARRIRGERA  136
            MPKD+QLARRIRGERA
Sbjct  121  MPKDMQLARRIRGERA  136


>H33B_DICDI unnamed protein product
Length=136

 Score = 236 bits (602),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 126/136 (93%), Gaps = 0/136 (0%)

Query  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60
            MARTKQTARKSTG K PRK L  K+++KS P+T G+KK HR+RPGTVALREIRRYQKS+E
Sbjct  1    MARTKQTARKSTGAKVPRKHLGNKSSQKSFPSTQGLKKTHRFRPGTVALREIRRYQKSSE  60

Query  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  120
            LLI+KLPFQRLVREIAQ+FKTDLRFQ++A+ ALQEASEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIKKLPFQRLVREIAQEFKTDLRFQAAAIQALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  121  MPKDIQLARRIRGERA  136
            M KDIQLARRIRGERA
Sbjct  121  MVKDIQLARRIRGERA  136



Lambda      K        H
   0.324    0.139    0.448 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1051796556


Query= XP_003392968.1 histone H2A [Bombus terrestris]

Length=124
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

H2A_DROME  unnamed protein product                                    243     1e-84
H2A_PENVA  unnamed protein product                                    238     8e-83
C6KT18_PLAF7  unnamed protein product                                 184     2e-61
H2AV_DROME  unnamed protein product                                   137     1e-42
H2AV_CAEEL  unnamed protein product                                   134     2e-41


>H2A_DROME unnamed protein product
Length=124

 Score = 243 bits (619),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 123/124 (99%), Positives = 123/124 (99%), Gaps = 0/124 (0%)

Query  1    MSGRGKGGKAKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAA  60
            MSGRGKGGK KGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAA
Sbjct  1    MSGRGKGGKVKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAA  60

Query  61   EVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKT  120
            EVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKT
Sbjct  61   EVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKT  120

Query  121  EKKA  124
            EKKA
Sbjct  121  EKKA  124


>H2A_PENVA unnamed protein product
Length=123

 Score = 238 bits (607),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 119/123 (97%), Positives = 122/123 (99%), Gaps = 0/123 (0%)

Query  1    MSGRGKGGKAKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAA  60
            MSGRGKGGK KGK+KSRS+RAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAA
Sbjct  1    MSGRGKGGKVKGKSKSRSSRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAA  60

Query  61   EVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKT  120
            EVLELAGNAARDNKKTRI+PRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKT
Sbjct  61   EVLELAGNAARDNKKTRIVPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKT  120

Query  121  EKK  123
            EKK
Sbjct  121  EKK  123


>C6KT18_PLAF7 unnamed protein product
Length=132

 Score = 184 bits (467),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 105/125 (84%), Gaps = 1/125 (1%)

Query  1    MSGRGKGGKAKG-KAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLA  59
            MS +GK G+ K  K  S S +AGLQFPVGRI R L+KG YA+RVGAGAPVYLAAV+EYL 
Sbjct  1    MSAKGKTGRKKASKGTSNSAKAGLQFPVGRIGRYLKKGKYAKRVGAGAPVYLAAVLEYLC  60

Query  60   AEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKK  119
            AE+LELAGNAARDNKK+RI PRH+QLA+RNDEELNK L+GVT A GGVLPNI  VLLPKK
Sbjct  61   AEILELAGNAARDNKKSRITPRHIQLAVRNDEELNKFLAGVTFASGGVLPNIHNVLLPKK  120

Query  120  TEKKA  124
            ++ KA
Sbjct  121  SQLKA  125


>H2AV_DROME unnamed protein product
Length=141

 Score = 137 bits (344),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 86/115 (75%), Gaps = 2/115 (2%)

Query  8    GKAKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAE-RVGAGAPVYLAAVMEYLAAEVLELA  66
            GKAK KA SRS RAGLQFPVGRIHR L+    +  RVGA A VY AA++EYL AEVLELA
Sbjct  11   GKAKAKAVSRSARAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELA  70

Query  67   GNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTE  121
            GNA++D K  RI PRHLQLAIR DEEL+ L+   TIA GGV+P+I   L+ KK E
Sbjct  71   GNASKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKKEE  124


>H2AV_CAEEL unnamed protein product
Length=140

 Score = 134 bits (336),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 89/122 (73%), Gaps = 6/122 (5%)

Query  3    GRGKGGKAKGKAKS----RSNRAGLQFPVGRIHRLLRKGNYAE-RVGAGAPVYLAAVMEY  57
            G+GK GK  GK+KS    RS RAGLQFPVGRIHR L++   +  RVGA A VY AA++EY
Sbjct  4    GKGKAGKDSGKSKSKVVSRSARAGLQFPVGRIHRFLKQRTTSSGRVGATAAVYSAAILEY  63

Query  58   LAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLP  117
            L AEVLELAGNA++D K  RI PRHL LAIR DEEL+ L+   TIA GGV+P+I   L+ 
Sbjct  64   LTAEVLELAGNASKDLKVKRITPRHLHLAIRGDEELDTLIK-ATIAGGGVIPHIHRYLMN  122

Query  118  KK  119
            KK
Sbjct  123  KK  124



Lambda      K        H
   0.324    0.139    0.448 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1051796556


Query= XP_003392969.1 histone H3 [Bombus terrestris]

Length=136
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

H3_DROME  unnamed protein product                                     274     8e-97
H33B_DROME  unnamed protein product                                   267     4e-94
H33A_DROME  unnamed protein product                                   267     4e-94
H332_CAEEL  unnamed protein product                                   266     2e-93
H33B_DICDI  unnamed protein product                                   236     1e-81


>H3_DROME unnamed protein product
Length=136

 Score = 274 bits (701),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 136/136 (100%), Positives = 136/136 (100%), Gaps = 0/136 (0%)

Query  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  120
            LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  121  MPKDIQLARRIRGERA  136
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136


>H33B_DROME unnamed protein product
Length=136

 Score = 267 bits (683),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 135/136 (99%), Gaps = 0/136 (0%)

Query  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60
            MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPGTVALREIRRYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  120
            LLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  121  MPKDIQLARRIRGERA  136
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136


>H33A_DROME unnamed protein product
Length=136

 Score = 267 bits (683),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 135/136 (99%), Gaps = 0/136 (0%)

Query  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60
            MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPGTVALREIRRYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  120
            LLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  121  MPKDIQLARRIRGERA  136
            MPKDIQLARRIRGERA
Sbjct  121  MPKDIQLARRIRGERA  136


>H332_CAEEL unnamed protein product
Length=136

 Score = 266 bits (679),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 134/136 (99%), Gaps = 0/136 (0%)

Query  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGTVALREIRRYQKSTE
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  120
            LLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  121  MPKDIQLARRIRGERA  136
            MPKD+QLARRIRGERA
Sbjct  121  MPKDMQLARRIRGERA  136


>H33B_DICDI unnamed protein product
Length=136

 Score = 236 bits (602),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 126/136 (93%), Gaps = 0/136 (0%)

Query  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60
            MARTKQTARKSTG K PRK L  K+++KS P+T G+KK HR+RPGTVALREIRRYQKS+E
Sbjct  1    MARTKQTARKSTGAKVPRKHLGNKSSQKSFPSTQGLKKTHRFRPGTVALREIRRYQKSSE  60

Query  61   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  120
            LLI+KLPFQRLVREIAQ+FKTDLRFQ++A+ ALQEASEAYLVGLFEDTNLCAIHAKRVTI
Sbjct  61   LLIKKLPFQRLVREIAQEFKTDLRFQAAAIQALQEASEAYLVGLFEDTNLCAIHAKRVTI  120

Query  121  MPKDIQLARRIRGERA  136
            M KDIQLARRIRGERA
Sbjct  121  MVKDIQLARRIRGERA  136



Lambda      K        H
   0.324    0.139    0.448 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1051796556


Query= XP_003392970.1 histone H4 [Bombus terrestris]

Length=103
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

H4_DROME  unnamed protein product                                     199     3e-68
H4_PENVA  unnamed protein product                                     192     2e-65
H4_DICDI  unnamed protein product                                     141     4e-45
Q57Z31_TRYB2  unnamed protein product                                 123     4e-38
Q587H6_TRYB2  unnamed protein product                                 120     4e-37


>H4_DROME unnamed protein product
Length=103

 Score = 199 bits (507),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 103/103 (100%), Positives = 103/103 (100%), Gaps = 0/103 (0%)

Query  1    MTGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK  60
            MTGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
Sbjct  1    MTGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK  60

Query  61   VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG  103
            VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct  61   VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG  103


>H4_PENVA unnamed protein product
Length=103

 Score = 192 bits (489),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/103 (97%), Positives = 100/103 (97%), Gaps = 0/103 (0%)

Query  1    MTGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK  60
            MTGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
Sbjct  1    MTGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK  60

Query  61   VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG  103
            VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKR   TLYGFGG
Sbjct  61   VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRXXXTLYGFGG  103


>H4_DICDI unnamed protein product
Length=108

 Score = 141 bits (355),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 76/88 (86%), Gaps = 0/88 (0%)

Query  16   AKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTE  75
            AKRH+K  +++I GITKPAIRRLARRGGVKRIS  IYEETR VL+ FL NVIRD+V YTE
Sbjct  21   AKRHKKTQKEHINGITKPAIRRLARRGGVKRISFPIYEETRNVLRTFLTNVIRDSVAYTE  80

Query  76   HAKRKTVTAMDVVYALKRQGRTLYGFGG  103
            HA R+TVTAMDVVYALKRQGRTLYGF  
Sbjct  81   HAGRRTVTAMDVVYALKRQGRTLYGFNS  108


>Q57Z31_TRYB2 unnamed protein product
Length=100

 Score = 123 bits (309),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 79/93 (85%), Gaps = 0/93 (0%)

Query  10   GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRD  69
            G  KG  KR +KVLR+N++GIT+ +IRRLARRGGVKRISG+IY+E RGVLK F+E V+RD
Sbjct  8    GEAKGSQKRQKKVLRENVRGITRGSIRRLARRGGVKRISGVIYDEVRGVLKSFVEGVVRD  67

Query  70   AVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFG  102
            A  YTE++++KTVTA+DVV AL+++G+ LYG+ 
Sbjct  68   ATAYTEYSRKKTVTAVDVVNALRKRGKILYGYA  100


>Q587H6_TRYB2 unnamed protein product
Length=100

 Score = 120 bits (302),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 78/92 (85%), Gaps = 0/92 (0%)

Query  10   GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRD  69
            G  KG  KR +KVLRDN++GIT+ +IRRLARR GVKRISG+IY+E RGVLK F+E+++RD
Sbjct  8    GESKGAQKRQKKVLRDNVRGITRGSIRRLARRAGVKRISGVIYDEVRGVLKTFVESIVRD  67

Query  70   AVTYTEHAKRKTVTAMDVVYALKRQGRTLYGF  101
            A  YTE++++KTVTA  VV+AL+++G+ LYG+
Sbjct  68   AGAYTEYSRKKTVTAAHVVFALRKRGKVLYGY  99



Lambda      K        H
   0.324    0.139    0.448 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1051796556


Query= XP_003392977.1 iron-sulfur cluster co-chaperone protein HscB [Bombus
terrestris]

Length=251
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A8JNT7_DROME  unnamed protein product                                 118     3e-32
Q38BB1_TRYB2  unnamed protein product                                 43.9    6e-05
Q584G5_TRYB2  unnamed protein product                                 43.1    1e-04
Q38DS8_TRYB2  unnamed protein product                                 42.0    2e-04
Q7KQK3_PLAF7  unnamed protein product                                 38.9    0.002


>A8JNT7_DROME unnamed protein product
Length=240

 Score = 118 bits (295),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/210 (30%), Positives = 117/210 (56%), Gaps = 9/210 (4%)

Query  43   LTNVSQYSSNSLSKCWNCN--FVYKSDLFCSKCKVLQEPPENLTYFDIIGVPKSYDVKVT  100
            L  + ++S  S   CWNC      K ++ CS C  LQ+    + YF ++  P  + ++  
Sbjct  32   LPEIRKFSVESSPACWNCQKKSELKQNMICSDCGHLQDVNSGINYFKLLSFPIQFSLESQ  91

Query  101  EIQKKYKELQKLLHPDKFGTKSEKEKQFSETLSSLVNNAYSTLIHPLKRGLYMLKLNDIT  160
            ++ + +++LQ ++HPDK+  K+ +E+  S   SSL+N AY TL  P+ RG Y+L+L    
Sbjct  92   KLTRSFRQLQTIVHPDKYSNKTSREQTNSSDWSSLINKAYKTLSTPIDRGQYLLQLEGEQ  151

Query  161  ISEETDNVNAEFLIEIMEKNEEIEDVGD--DIEKIK-KLVQENETMLNNLTKEIADAFRQ  217
            + ++   +N EFL+ +ME+NEE+ED  D   +E +  +L++E E M     +++   F  
Sbjct  152  MPQDNSALNKEFLMAMMERNEEVEDAEDTQTLENLNIQLIKELEEM----ARKLNALFDS  207

Query  218  ENIKKAEFLLIRMKYYDSINTKLRKLKHDL  247
            +++   +  L+ MKY  SI   +++ +  L
Sbjct  208  KDLSGVKETLVEMKYLLSIQNSIKQKQQSL  237


>Q38BB1_TRYB2 unnamed protein product
Length=499

 Score = 43.9 bits (102),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 47/87 (54%), Gaps = 2/87 (2%)

Query  85   YFDIIGVPKSYDVKVTEIQKKYKELQKLLHPDKFGTKSEKEKQFSETLSSLVNNAYSTLI  144
            Y+ I+G+P+  +   + I++ YK+     HPDK+   +E+EK  +E +   V  A+S L 
Sbjct  370  YYKILGLPQG-ESDDSSIKRAYKKGCLQWHPDKWAHATEEEKAHAEKMFKEVGEAFSILS  428

Query  145  HPLKRGLY-MLKLNDITISEETDNVNA  170
             P K+ LY   +L+D +    T +  A
Sbjct  429  DPQKKRLYDSGQLDDASSPGGTSDFPA  455


>Q584G5_TRYB2 unnamed protein product
Length=705

 Score = 43.1 bits (100),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 42/72 (58%), Gaps = 2/72 (3%)

Query  85   YFDIIGVPKSYDVKVTEIQKKYKELQKLLHPDKFGTKSEKEKQFSETLSSLVNNAYSTLI  144
            Y+ ++GV  S +    EI+ +Y+EL    HPDK  +  E+E+  +E    ++  A++TLI
Sbjct  599  YYYVLGV--SRNATEREIKARYRELSLRWHPDKCMSLPEEERVVAERKFKIIVEAHTTLI  656

Query  145  HPLKRGLYMLKL  156
              +KR  Y LK+
Sbjct  657  DAVKRRDYDLKM  668


>Q38DS8_TRYB2 unnamed protein product
Length=287

 Score = 42.0 bits (97),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 56/124 (45%), Gaps = 23/124 (19%)

Query  85   YFDIIGVPKSYDVKVTEIQKKYKELQKLLHPDKFGTKSEKEKQFSETLSSLVNNAYSTLI  144
            Y+ ++ +  S   K  EI++ +K    L HPD+  T +++ + FSE     V +AY  L 
Sbjct  5    YYAVLNLHPSCTAK--EIREAFKRFALLCHPDR--TDADQSRNFSE-----VKDAYDVLS  55

Query  145  HPLKRGLYMLKLNDITISEETDNVNAEFLIEIMEKNEEIEDVGDDIEKIKKLVQENETML  204
             P +R LY L   D               I  +++   ++  G D+E +  +V+  +   
Sbjct  56   DPARRYLYDLGYADA--------------ISAIQRQTLMQKKGRDVEAVAPVVRSPQPFF  101

Query  205  NNLT  208
            ++ T
Sbjct  102  SSTT  105


>Q7KQK3_PLAF7 unnamed protein product
Length=244

 Score = 38.9 bits (89),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 41/77 (53%), Gaps = 8/77 (10%)

Query  83   LTYFDIIGVPKSYDVKVTEIQKKYKELQKLLHPDK-FGTKSEKEKQFSETLSSLVNNAYS  141
            + Y++++GVP+  D+ V  I+K Y+ L    HPDK    K+E  ++F +     ++ AY 
Sbjct  5    VNYYEVLGVPQDADLTV--IKKSYRTLAMKWHPDKNPNNKAEATERFKQ-----ISEAYE  57

Query  142  TLIHPLKRGLYMLKLND  158
             L  P +R  Y L   D
Sbjct  58   VLSDPKRRRKYDLYGTD  74



Lambda      K        H
   0.324    0.139    0.448 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1051796556


Query= XP_003392978.1 adenylate kinase isoenzyme 6 [Bombus terrestris]

Length=178
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

KAD6_DROME  unnamed protein product                                   179     4e-58
Q584W4_TRYB2  unnamed protein product                                 104     2e-28
KAD6_PLAF7  unnamed protein product                                   77.4    5e-18
Q57W41_TRYB2  unnamed protein product                                 35.4    0.015
Q95TQ1_DROME  unnamed protein product                                 35.0    0.023


>KAD6_DROME unnamed protein product
Length=175

 Score = 179 bits (455),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 109/164 (66%), Gaps = 0/164 (0%)

Query  9    PNILITGTPGVGKSLLSRTLCQKTGLTSINVSDFAIEKGCVEFYDAVYECPILDEEKLLD  68
            PNILITGTPG GKS L   +  +     ++ S  A EK  VE YD  Y+CPILDEEKL+D
Sbjct  10   PNILITGTPGAGKSYLCERIASELKFEWLDCSKIAKEKNFVEEYDEEYDCPILDEEKLMD  69

Query  69   EMEDLICKGGVVVDYHGCDFFPKEWFDIVFVLRTDNTILYDRLTDRGYTGKKLEDNIQCE  128
             +E L+ KGG VV+YHGCDFFP+ WF  VFV+   NT LYDRL +R Y  KKL  NIQCE
Sbjct  70   HLEPLMAKGGNVVEYHGCDFFPERWFQAVFVVTCPNTTLYDRLKERNYNEKKLASNIQCE  129

Query  129  IFQIILEQARTTFEEEIVYELTSDNRNQLRSNVNSIFQWIQQWK  172
            IF  ILE+AR +++ +IV+EL  + +     ++ ++  W + WK
Sbjct  130  IFGTILEEARDSYKSDIVFELKGETKADAHISIKTVKNWYRMWK  173


>Q584W4_TRYB2 unnamed protein product
Length=177

 Score = 104 bits (259),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 93/160 (58%), Gaps = 5/160 (3%)

Query  10   NILITGTPGVGK-SLLSRTLCQKTGLTSINVSDFAIEKGCVEFYDAVYECPILDEE---K  65
            NILITGTPG GK SL    + +  G + I+V     E      YD  ++  ++DE+   +
Sbjct  8    NILITGTPGTGKTSLAELLVEELEGFSRIDVGKVVKENEFYTEYDKEFDTHVIDEDDEGR  67

Query  66   LLDEMEDLICKGG-VVVDYHGCDFFPKEWFDIVFVLRTDNTILYDRLTDRGYTGKKLEDN  124
            LLD ME ++ +GG  VVDYH  + FPK WF +V VLRT   +L++RL DR Y   K  +N
Sbjct  68   LLDFMEPIMVQGGNHVVDYHSSELFPKRWFHLVVVLRTSTEVLFERLMDRKYGELKRNEN  127

Query  125  IQCEIFQIILEQARTTFEEEIVYELTSDNRNQLRSNVNSI  164
            ++ EI  I  E+AR  ++E+I+    ++   ++ + V+ I
Sbjct  128  MEAEIHGICEEEARGAYDEDIIIVRDNNTLEEMAATVSLI  167


>KAD6_PLAF7 unnamed protein product
Length=186

 Score = 77.4 bits (189),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 56/183 (31%), Positives = 94/183 (51%), Gaps = 17/183 (9%)

Query  6    RSFPNILITGTPGVGKS-------------LLSRTLCQKTGLTSINVSDFAIEKGCVEFY  52
            R  PNI+ITG PG GKS             LL R   +   +T +N+S+   ++   + +
Sbjct  3    RKVPNIIITGVPGSGKSTLCEELKEIINKELLKRNDMEGFEMTHLNLSNIIKDERLYKEF  62

Query  53   DAVYECPILDEEKL--LDEMEDLICKGGVVVDYHGCDFFPK-EWFDIVFVLRTDNTILYD  109
            D   +  I  EE L    + +  + KGG ++D+H  +F    +  D +F+L      LY+
Sbjct  63   DDELDASIYSEELLNEYLKKKYKLEKGGYIIDFHDINFVKDVDIIDKIFLLTIQTNFLYE  122

Query  110  RLTDRGYTGKKLEDNIQCEIFQIILEQARTTFEE-EIVYELTSDNRNQLRSNVNSIFQWI  168
            RL  R YT +K+++NI+CEIFQ+I E     F    I+ E+ +++  Q  +N++ I  W+
Sbjct  123  RLEKRNYTKEKIKNNIECEIFQVIKEDILDHFPNTNILQEIENNDLQQYDNNLSIIKNWV  182

Query  169  QQW  171
              +
Sbjct  183  LSY  185


>Q57W41_TRYB2 unnamed protein product
Length=335

 Score = 35.4 bits (80),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 23/35 (66%), Gaps = 1/35 (3%)

Query  6    RSFP-NILITGTPGVGKSLLSRTLCQKTGLTSINV  39
            RS P  IL+ G PG GK+L++R L ++ G   INV
Sbjct  113  RSHPKGILLYGPPGTGKTLIARALARELGCAFINV  147


>Q95TQ1_DROME unnamed protein product
Length=508

 Score = 35.0 bits (79),  Expect = 0.023, Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 24/40 (60%), Gaps = 6/40 (15%)

Query  8    FPNILITGTPGVGKSLLSRTLCQKTGLTSINVSDFAIEKG  47
            + N+L+ G PG GK++ ++ L + +G+      DFAI  G
Sbjct  351  YRNVLMHGPPGTGKTMFAKKLAEHSGM------DFAIMTG  384



Lambda      K        H
   0.324    0.139    0.448 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1051796556


Query= XP_003392979.1 maternal B9.15 protein [Bombus terrestris]

Length=265
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VXJ9_DROME  unnamed protein product                                 82.8    1e-17
BTG_DICDI  unnamed protein product                                    58.9    9e-10
Q4V5V6_DROME  unnamed protein product                                 32.3    0.16 
ABCB7_DICDI  unnamed protein product                                  28.5    6.8  


>Q9VXJ9_DROME unnamed protein product
Length=564

 Score = 82.8 bits (203),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 68/117 (58%), Gaps = 7/117 (6%)

Query  1    MRNEITAAVLFLVQLIEKNEKFSPDQLECFKRRLVELLTERFKNHWFPDKPFKGQGYRCI  60
            M  EI  A+ F++  +    K    ++  F   L + L ++F++HW+P+KPFKG  YRC+
Sbjct  1    MHIEIQVALNFVISYLYN--KLPRRRVNIFGEELEKALRDKFQDHWYPEKPFKGSAYRCL  58

Query  61   RVNGHNRRDATLESAANAAGVKYEDL--SLPVELTLWVDPNEVCCRFGESKGSYCTL  115
            +    +  D+ LE AA  +GV   D+  +LP EL++W+DP EV  R GE KG+   L
Sbjct  59   KTG--DPIDSVLERAARESGVPIGDILENLPNELSVWIDPGEVSFRIGE-KGAVKIL  112


>BTG_DICDI unnamed protein product
Length=423

 Score = 58.9 bits (141),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 33/104 (32%), Positives = 51/104 (49%), Gaps = 3/104 (3%)

Query  5    ITAAVLFLVQLIEKNEKFSPDQLECFKRRLVELLTERFKNHWFPDKPFKGQGYRCIRVNG  64
            + AA  +   L + N     + ++ F++ L+  L +R K HW+PD P +GQGYR I    
Sbjct  114  VVAACWWAESLGKLNMNIPKENIKRFRKELIFALRDRIKGHWYPDYPERGQGYRAIIC--  171

Query  65   HNRRDATLESAANAAGVKYEDLSLPVE-LTLWVDPNEVCCRFGE  107
                D  L  AA  + +  E   L  +  T+W+DP  V  R G+
Sbjct  172  EETTDRLLMDAAKKSDIVGEFRQLVKQNTTMWIDPGNVTYRHGK  215


>Q4V5V6_DROME unnamed protein product
Length=150

 Score = 32.3 bits (72),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 2/44 (5%)

Query  101  VCCRFGESKGSYCTLASFDD--KENTVPIFQGNEGLEKENKQSE  142
            VCC  G S GS+C+L        E    +FQ +EG  ++ +  E
Sbjct  17   VCCLMGSSSGSFCSLERMKKFAMEACEHLFQADEGARRDRRSIE  60


>ABCB7_DICDI unnamed protein product
Length=824

 Score = 28.5 bits (62),  Expect = 6.8, Method: Composition-based stats.
 Identities = 12/38 (32%), Positives = 22/38 (58%), Gaps = 0/38 (0%)

Query  134  LEKENKQSEGPTKIQKSPLTSNTDQQQKSKPLSSANQN  171
            L+++N + E P  +  SP+  N D++ K+K  +S   N
Sbjct  10   LDEDNIEDESPIGLGTSPIEFNLDKENKNKKRNSVKFN  47



Lambda      K        H
   0.324    0.139    0.448 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1051796556


Query= XP_003392980.1 heterogeneous nuclear ribonucleoprotein L isoform X1
[Bombus terrestris]

Length=479
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A0A0B4K8A1_DROME  unnamed protein product                             489     2e-170
A0A0B4K7W3_DROME  unnamed protein product                             484     9e-169
A0A0B4K852_DROME  unnamed protein product                             483     5e-168
A0A0B4K8A2_DROME  unnamed protein product                             483     5e-168
Q6NND8_DROME  unnamed protein product                                 474     9e-165


>A0A0B4K8A1_DROME unnamed protein product
Length=515

 Score = 489 bits (1260),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 253/445 (57%), Positives = 312/445 (70%), Gaps = 41/445 (9%)

Query  30   DELRRKREDNNKPNHVLLFTIINPVYPITVEVLHAISAPSGQVQRIVIFKKNGVQAMVEF  89
            D+LRRKR +  +PNH+LLFTIINP YPITV+VLH I  P GQV RIVIFKKNGVQAMVEF
Sbjct  62   DDLRRKRPETTRPNHILLFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEF  121

Query  90   DTVESATRAKETLHGADIYSGCCTLKIDFAKPTKLNVYKNDAE-SWDYTTPTLGSSAHKN  148
            D +++ATRA+E L+GADIY+GCCTLKID+AKP KLNVYKN+ + SWDYT  T        
Sbjct  122  DNLDAATRARENLNGADIYAGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLST--GEILPI  179

Query  149  DATGNGRPAPLLAEPRYGAAPQPYGST-------------------PQVTFPPGAG---H  186
               GNGR +PLL EP YG  PQPY  +                   P   FPP      H
Sbjct  180  KEIGNGR-SPLLQEPLYGTRPQPYSKSLFSIPENVVMLESQPPLLGPGAAFPPFGAPEYH  238

Query  187  DRYEENFNGPATYPEPYVERYGIKSDFSGREPIHPTPPRPGYVPTLGQTPPSSTQGSVMM  246
                EN+ G A +P       G+  + +G  P    P        +  TP    QG+VMM
Sbjct  239  TTTPENWKGAAIHPT------GLMKEPAGVVPGRNAP--------VAFTPQGQAQGAVMM  284

Query  247  VYGLQPDKVNTDKLFNLFCLYGNVTKVKFLKTKEGCAMIQMGDNIAVERCLQNLNNVTIG  306
            VYGL  D  NTDKLFNL CLYGNV ++KFLKTKEG AM+QMGD +AVERC+Q+LNN+ +G
Sbjct  285  VYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMGDAVAVERCVQHLNNIPVG  344

Query  307  TDGRLQLGFSKQAFLSDVTNPYILPDKTASFKDFTGSKNNRFLNPAMANKNRIQPPSKIV  366
            T G++Q+ FSKQ FLS+V NP++LPD + SFK++TGSKNNRFL+PA A+KNRIQPPSKI+
Sbjct  345  TGGKIQIAFSKQNFLSEVINPFLLPDHSPSFKEYTGSKNNRFLSPAQASKNRIQPPSKIL  404

Query  367  HFFNTPPDLTEETVHRVFVERGIEAPTTVKLFPLKSERSSSGLIEFSSVGIAVAAIMECN  426
            HFFNTPP LTE+ +  +F  + + A T+V+LFPLK+ERSSSGLIEFS++  AV AIM+CN
Sbjct  405  HFFNTPPGLTEDQLIGIFNIKDVPA-TSVRLFPLKTERSSSGLIEFSNISQAVLAIMKCN  463

Query  427  HTALENSNGKFPYIMKLCFSSSRTI  451
            H  +E    KFP+IMKLCFSSS+++
Sbjct  464  HLPIEGKGTKFPFIMKLCFSSSKSM  488


>A0A0B4K7W3_DROME unnamed protein product
Length=492

 Score = 484 bits (1247),  Expect = 9e-169, Method: Compositional matrix adjust.
 Identities = 249/426 (58%), Positives = 309/426 (73%), Gaps = 31/426 (7%)

Query  30   DELRRKREDNNKPNHVLLFTIINPVYPITVEVLHAISAPSGQVQRIVIFKKNGVQAMVEF  89
            D+LRRKR +  +PNH+LLFTIINP YPITV+VLH I  P GQV RIVIFKKNGVQAMVEF
Sbjct  67   DDLRRKRPETTRPNHILLFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEF  126

Query  90   DTVESATRAKETLHGADIYSGCCTLKIDFAKPTKLNVYKNDAE-SWDYTTPTLGSSAHKN  148
            D +++ATRA+E L+GADIY+GCCTLKID+AKP KLNVYKN+ + SWDYT  T+       
Sbjct  127  DNLDAATRARENLNGADIYAGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLSTV-------  179

Query  149  DATGNGRPAPLLAEPRYGAAPQPYGSTPQVTFPPGAG---HDRYEENFNGPATYPEPYVE  205
               GNGR +PLL EP Y    +P    P   FPP      H    EN+ G A +P     
Sbjct  180  KEIGNGR-SPLLQEPLY----EPPLLGPGAAFPPFGAPEYHTTTPENWKGAAIHPT----  230

Query  206  RYGIKSDFSGREPIHPTPPRPGYVPTLGQTPPSSTQGSVMMVYGLQPDKVNTDKLFNLFC  265
              G+  + +G  P    P        +  TP    QG+VMMVYGL  D  NTDKLFNL C
Sbjct  231  --GLMKEPAGVVPGRNAP--------VAFTPQGQAQGAVMMVYGLDHDTSNTDKLFNLVC  280

Query  266  LYGNVTKVKFLKTKEGCAMIQMGDNIAVERCLQNLNNVTIGTDGRLQLGFSKQAFLSDVT  325
            LYGNV ++KFLKTKEG AM+QMGD +AVERC+Q+LNN+ +GT G++Q+ FSKQ FLS+V 
Sbjct  281  LYGNVARIKFLKTKEGTAMVQMGDAVAVERCVQHLNNIPVGTGGKIQIAFSKQNFLSEVI  340

Query  326  NPYILPDKTASFKDFTGSKNNRFLNPAMANKNRIQPPSKIVHFFNTPPDLTEETVHRVFV  385
            NP++LPD + SFK++TGSKNNRFL+PA A+KNRIQPPSKI+HFFNTPP LTE+ +  +F 
Sbjct  341  NPFLLPDHSPSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIFN  400

Query  386  ERGIEAPTTVKLFPLKSERSSSGLIEFSSVGIAVAAIMECNHTALENSNGKFPYIMKLCF  445
             + + A T+V+LFPLK+ERSSSGLIEFS++  AV AIM+CNH  +E    KFP+IMKLCF
Sbjct  401  IKDVPA-TSVRLFPLKTERSSSGLIEFSNISQAVLAIMKCNHLPIEGKGTKFPFIMKLCF  459

Query  446  SSSRTI  451
            SSS+++
Sbjct  460  SSSKSM  465


>A0A0B4K852_DROME unnamed protein product
Length=497

 Score = 483 bits (1243),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 249/426 (58%), Positives = 308/426 (72%), Gaps = 26/426 (6%)

Query  30   DELRRKREDNNKPNHVLLFTIINPVYPITVEVLHAISAPSGQVQRIVIFKKNGVQAMVEF  89
            D+LRRKR +  +PNH+LLFTIINP YPITV+VLH I  P GQV RIVIFKKNGVQAMVEF
Sbjct  67   DDLRRKRPETTRPNHILLFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEF  126

Query  90   DTVESATRAKETLHGADIYSGCCTLKIDFAKPTKLNVYKNDAE-SWDYTTPTLGSSAHKN  148
            D +++ATRA+E L+GADIY+GCCTLKID+AKP KLNVYKN+ + SWDYT  T        
Sbjct  127  DNLDAATRARENLNGADIYAGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLST--GEILPI  184

Query  149  DATGNGRPAPLLAEPRYGAAPQPYGSTPQVTFPPGAG---HDRYEENFNGPATYPEPYVE  205
               GNGR +PLL EP Y    +P    P   FPP      H    EN+ G A +P     
Sbjct  185  KEIGNGR-SPLLQEPLY----EPPLLGPGAAFPPFGAPEYHTTTPENWKGAAIHPT----  235

Query  206  RYGIKSDFSGREPIHPTPPRPGYVPTLGQTPPSSTQGSVMMVYGLQPDKVNTDKLFNLFC  265
              G+  + +G  P    P        +  TP    QG+VMMVYGL  D  NTDKLFNL C
Sbjct  236  --GLMKEPAGVVPGRNAP--------VAFTPQGQAQGAVMMVYGLDHDTSNTDKLFNLVC  285

Query  266  LYGNVTKVKFLKTKEGCAMIQMGDNIAVERCLQNLNNVTIGTDGRLQLGFSKQAFLSDVT  325
            LYGNV ++KFLKTKEG AM+QMGD +AVERC+Q+LNN+ +GT G++Q+ FSKQ FLS+V 
Sbjct  286  LYGNVARIKFLKTKEGTAMVQMGDAVAVERCVQHLNNIPVGTGGKIQIAFSKQNFLSEVI  345

Query  326  NPYILPDKTASFKDFTGSKNNRFLNPAMANKNRIQPPSKIVHFFNTPPDLTEETVHRVFV  385
            NP++LPD + SFK++TGSKNNRFL+PA A+KNRIQPPSKI+HFFNTPP LTE+ +  +F 
Sbjct  346  NPFLLPDHSPSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIFN  405

Query  386  ERGIEAPTTVKLFPLKSERSSSGLIEFSSVGIAVAAIMECNHTALENSNGKFPYIMKLCF  445
             + + A T+V+LFPLK+ERSSSGLIEFS++  AV AIM+CNH  +E    KFP+IMKLCF
Sbjct  406  IKDVPA-TSVRLFPLKTERSSSGLIEFSNISQAVLAIMKCNHLPIEGKGTKFPFIMKLCF  464

Query  446  SSSRTI  451
            SSS+++
Sbjct  465  SSSKSM  470


>A0A0B4K8A2_DROME unnamed protein product
Length=508

 Score = 483 bits (1244),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 250/438 (57%), Positives = 308/438 (70%), Gaps = 34/438 (8%)

Query  30   DELRRKREDNNKPNHVLLFTIINPVYPITVEVLHAISAPSGQVQRIVIFKKNGVQAMVEF  89
            D+LRRKR +  +PNH+LLFTIINP YPITV+VLH I  P GQV RIVIFKKNGVQAMVEF
Sbjct  62   DDLRRKRPETTRPNHILLFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEF  121

Query  90   DTVESATRAKETLHGADIYSGCCTLKIDFAKPTKLNVYKNDAE-SWDYTTPTLGSSAHKN  148
            D +++ATRA+E L+GADIY+GCCTLKID+AKP KLNVYKN+ + SWDYT  T        
Sbjct  122  DNLDAATRARENLNGADIYAGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLST--GEILPI  179

Query  149  DATGNGRPAPLLAEPRYGAA------------PQPYGSTPQVTFPPGAG---HDRYEENF  193
               GNGR +PLL EP YG +             QP    P   FPP      H    EN+
Sbjct  180  KEIGNGR-SPLLQEPLYGKSLFSIPENVVMLESQPPLLGPGAAFPPFGAPEYHTTTPENW  238

Query  194  NGPATYPEPYVERYGIKSDFSGREPIHPTPPRPGYVPTLGQTPPSSTQGSVMMVYGLQPD  253
             G A +P   ++               P    PG    +  TP    QG+VMMVYGL  D
Sbjct  239  KGAAIHPTGLMKE--------------PAGVVPGRNAPVAFTPQGQAQGAVMMVYGLDHD  284

Query  254  KVNTDKLFNLFCLYGNVTKVKFLKTKEGCAMIQMGDNIAVERCLQNLNNVTIGTDGRLQL  313
              NTDKLFNL CLYGNV ++KFLKTKEG AM+QMGD +AVERC+Q+LNN+ +GT G++Q+
Sbjct  285  TSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMGDAVAVERCVQHLNNIPVGTGGKIQI  344

Query  314  GFSKQAFLSDVTNPYILPDKTASFKDFTGSKNNRFLNPAMANKNRIQPPSKIVHFFNTPP  373
             FSKQ FLS+V NP++LPD + SFK++TGSKNNRFL+PA A+KNRIQPPSKI+HFFNTPP
Sbjct  345  AFSKQNFLSEVINPFLLPDHSPSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPP  404

Query  374  DLTEETVHRVFVERGIEAPTTVKLFPLKSERSSSGLIEFSSVGIAVAAIMECNHTALENS  433
             LTE+ +  +F  + + A T+V+LFPLK+ERSSSGLIEFS++  AV AIM+CNH  +E  
Sbjct  405  GLTEDQLIGIFNIKDVPA-TSVRLFPLKTERSSSGLIEFSNISQAVLAIMKCNHLPIEGK  463

Query  434  NGKFPYIMKLCFSSSRTI  451
              KFP+IMKLCFSSS+++
Sbjct  464  GTKFPFIMKLCFSSSKSM  481


>Q6NND8_DROME unnamed protein product
Length=480

 Score = 474 bits (1220),  Expect = 9e-165, Method: Compositional matrix adjust.
 Identities = 244/423 (58%), Positives = 304/423 (72%), Gaps = 37/423 (9%)

Query  30   DELRRKREDNNKPNHVLLFTIINPVYPITVEVLHAISAPSGQVQRIVIFKKNGVQAMVEF  89
            D+LRRKR +  +PNH+LLFTIINP YPITV+VLH I  P GQV RIVIFKKNGVQAMVEF
Sbjct  67   DDLRRKRPETTRPNHILLFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEF  126

Query  90   DTVESATRAKETLHGADIYSGCCTLKIDFAKPTKLNVYKNDAE-SWDYTTPTLGSSAHKN  148
            D +++ATRA+E L+GADIY+GCCTLKID+AKP KLNVYKN+ + SWDYT           
Sbjct  127  DNLDAATRARENLNGADIYAGCCTLKIDYAKPEKLNVYKNEPDTSWDYTL----------  176

Query  149  DATGNGRPAPLLAEPRYGAAPQPYGSTPQVTFPPGAGHDRYEENFNGPATYPEPYVERYG  208
             +TG   P P L  P  GAA  P+G+ P+        H    EN+ G A +P   ++   
Sbjct  177  -STGEILPKPPLLGP--GAAFPPFGA-PEY-------HTTTPENWKGAAIHPTGLMKE--  223

Query  209  IKSDFSGREPIHPTPPRPGYVPTLGQTPPSSTQGSVMMVYGLQPDKVNTDKLFNLFCLYG  268
                        P    PG    +  TP    QG+VMMVYGL  D  NTDKLFNL CLYG
Sbjct  224  ------------PAGVVPGRNAPVAFTPQGQAQGAVMMVYGLDHDTSNTDKLFNLVCLYG  271

Query  269  NVTKVKFLKTKEGCAMIQMGDNIAVERCLQNLNNVTIGTDGRLQLGFSKQAFLSDVTNPY  328
            NV ++KFLKTKEG AM+QMGD +AVERC+Q+LNN+ +GT G++Q+ FSKQ FLS+V NP+
Sbjct  272  NVARIKFLKTKEGTAMVQMGDAVAVERCVQHLNNIPVGTGGKIQIAFSKQNFLSEVINPF  331

Query  329  ILPDKTASFKDFTGSKNNRFLNPAMANKNRIQPPSKIVHFFNTPPDLTEETVHRVFVERG  388
            +LPD + SFK++TGSKNNRFL+PA A+KNRIQPPSKI+HFFNTPP LTE+ +  +F  + 
Sbjct  332  LLPDHSPSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIFNIKD  391

Query  389  IEAPTTVKLFPLKSERSSSGLIEFSSVGIAVAAIMECNHTALENSNGKFPYIMKLCFSSS  448
            + A T+V+LFPLK+ERSSSGLIEFS++  AV AIM+CNH  +E    KFP+IMKLCFSSS
Sbjct  392  VPA-TSVRLFPLKTERSSSGLIEFSNISQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSS  450

Query  449  RTI  451
            +++
Sbjct  451  KSM  453



Lambda      K        H
   0.324    0.139    0.448 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1051796556


Query= XP_003392981.3 methyltransferase-like protein 25B [Bombus
terrestris]

Length=493
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q93574_CAEEL  unnamed protein product                                 112     2e-26
Q8I4K4_CAEEL  unnamed protein product                                 105     2e-24
ADH2_ENTHI  unnamed protein product                                   34.7    0.23 
Q584T5_TRYB2  unnamed protein product                                 32.0    1.6  
Q9VF24_DROME  unnamed protein product                                 30.4    4.1  


>Q93574_CAEEL unnamed protein product
Length=478

 Score = 112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 125/506 (25%), Positives = 214/506 (42%), Gaps = 77/506 (15%)

Query  27   VLDVYGWLLNSYIVDFFQDELWDKLPGSWRF-----ALQDTPP--REFGKWLSGDISCTR  79
            V+  Y  +LNS  +++F    WD L   WR      +L+D           +S D  C  
Sbjct  9    VVSKYRRILNSRSIEYFASSSWDLLEDEWREYLNLESLEDVIVFVNSSDNLVSAD--CAS  66

Query  80   VWPLTLLALRQVANILQVNRDHEDPKSTLTCEFNKVITNNNNKICKISRNDTFDKLYSQD  139
            + P +L  L+    + + NR   +  S L  ++     +          N +F  + S  
Sbjct  67   I-PHSLRDLKANLKLFEYNRKCVENPSDLWRQWTGTTRD--------GLNASFRTISSA-  116

Query  140  QKFNNLFSKHIKKKKRYEIHEIAEVCAGCAY-----EASCKCIIDIGSGMGHLARILAFQ  194
               N L  K IK KK++EI  I E+ +               ++DIG+G+GHL+R+++  
Sbjct  117  ---NGLVRKRIKAKKQHEIDRIVELISQIQIFQKDSADPIDSLVDIGAGIGHLSRMISIH  173

Query  195  YGLNVTCIEQDCILLQQARKWDQELL---TSIRKHIPNFHQKCPQHFTAKLESSSLVESE  251
              ++V  +E +      A   D++LL     I   I NF+ K     +  +  ++ V  +
Sbjct  174  NNISVMAVEGNQQFTLAANSLDEKLLLDSAKIGSRIENFNVK-----STPIRYTNFVTED  228

Query  252  LVNRLKELFQNEFDLSETETEFGLIGLHPCGDLAPILLKFYSSRSEAKFICIVGCCY---  308
            L  ++ +   N            L+GLH CGD +  +LK +    ++K + + GCCY   
Sbjct  229  LALKIDDFAVNSA---------ILVGLHCCGDFSSTILKVFQKSEKSKALVLFGCCYHKE  279

Query  309  ------MKLTIQSETRELKG---------YPLSQYLLARKNHLLTYTALEVACHAIEKYC  353
                  ++       RE+           +PLS+     +N  + Y   E ACH  E   
Sbjct  280  FQCFHFLRPENNENEREISENTSFGKSTVFPLSKKW---ENVEIDYLLREAACHNNENLE  336

Query  354  DKLKNGNYEDLIVHTYRAALETILVKKNE--KLRHSQFRNVK-VSKGMTFEQYCNVATAN  410
            ++      +  +    R+ LE  + K +E  + R+    +VK +    TFE+Y   A AN
Sbjct  337  ERFLKQKID--LSRYARSYLEKWIWKVSELPEDRNIGMCSVKCIENQTTFEEYIRKAMAN  394

Query  411  -----FDAYLQPQESDINNLEINNLLNRWEQVIIFGSLRMMLAPLVETIVLYDRFLFLSE  465
                  D  LQ       +  +++L  R  Q   F  LR M AP +E+ ++ DR   L E
Sbjct  395  RGNHLLDKVLQIIPQSELSAHVSSL--RSSQFDSFEVLRCMFAPAIESAIIDDRVELLRE  452

Query  466  KSLTPTLKPVFDSRLSPRNLVLMSRK  491
              +   + P+F+  +SPRNL +++ K
Sbjct  453  NGINSRVVPLFEPSISPRNLAIIAYK  478


>Q8I4K4_CAEEL unnamed protein product
Length=440

 Score = 105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 99/383 (26%), Positives = 169/383 (44%), Gaps = 55/383 (14%)

Query  143  NNLFSKHIKKKKRYEIHEIAEVCAGCAY-----EASCKCIIDIGSGMGHLARILAFQYGL  197
            N L  K IK KK++EI  I E+ +               ++DIG+G+GHL+R+++    +
Sbjct  79   NGLVRKRIKAKKQHEIDRIVELISQIQIFQKDSADPIDSLVDIGAGIGHLSRMISIHNNI  138

Query  198  NVTCIEQDCILLQQARKWDQELL---TSIRKHIPNFHQKCPQHFTAKLESSSLVESELVN  254
            +V  +E +      A   D++LL     I   I NF+ K     +  +  ++ V  +L  
Sbjct  139  SVMAVEGNQQFTLAANSLDEKLLLDSAKIGSRIENFNVK-----STPIRYTNFVTEDLAL  193

Query  255  RLKELFQNEFDLSETETEFGLIGLHPCGDLAPILLKFYSSRSEAKFICIVGCCY------  308
            ++ +   N            L+GLH CGD +  +LK +    ++K + + GCCY      
Sbjct  194  KIDDFAVNSA---------ILVGLHCCGDFSSTILKVFQKSEKSKALVLFGCCYHKEFQC  244

Query  309  ---MKLTIQSETRELKG---------YPLSQYLLARKNHLLTYTALEVACHAIEKYCDKL  356
               ++       RE+           +PLS+     +N  + Y   E ACH  E   ++ 
Sbjct  245  FHFLRPENNENEREISENTSFGKSTVFPLSKKW---ENVEIDYLLREAACHNNENLEERF  301

Query  357  KNGNYEDLIVHTYRAALETILVKKNE--KLRHSQFRNVK-VSKGMTFEQYCNVATAN---  410
                 +  +    R+ LE  + K +E  + R+    +VK +    TFE+Y   A AN   
Sbjct  302  LKQKID--LSRYARSYLEKWIWKVSELPEDRNIGMCSVKCIENQTTFEEYIRKAMANRGN  359

Query  411  --FDAYLQPQESDINNLEINNLLNRWEQVIIFGSLRMMLAPLVETIVLYDRFLFLSEKSL  468
               D  LQ       +  +++L  R  Q   F  LR M AP +E+ ++ DR   L E  +
Sbjct  360  HLLDKVLQIIPQSELSAHVSSL--RSSQFDSFEVLRCMFAPAIESAIIDDRVELLRENGI  417

Query  469  TPTLKPVFDSRLSPRNLVLMSRK  491
               + P+F+  +SPRNL +++ K
Sbjct  418  NSRVVPLFEPSISPRNLAIIAYK  440


>ADH2_ENTHI unnamed protein product
Length=870

 Score = 34.7 bits (78),  Expect = 0.23, Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 47/137 (34%), Gaps = 19/137 (14%)

Query  283  DLAPILLKFYSSRSEAKFICI-----VGCCYMKLTIQSETRELKGYPLSQYLL-------  330
            DL     KF +   +A+ ICI      G       + S+    K YPL+ Y L       
Sbjct  585  DLRKRAFKFPTMGKKARLICIPTTSGTGSEVTPFAVISDHETGKKYPLADYSLTPSVAIV  644

Query  331  ------ARKNHLLTYTALEVACHAIEKYCDKLKNGNYEDLIVHTYRAALETILVKKNEKL  384
                  +     +  T L+V  HA E Y   + N   + L     +   E +L   N  L
Sbjct  645  DPMFTMSLPKRAIADTGLDVLVHATEAYVSVMANEYTDGLAREAVKLVFENLLKSYNGDL  704

Query  385  R-HSQFRNVKVSKGMTF  400
                +  N     GM F
Sbjct  705  EAREKMHNAATIAGMAF  721


>Q584T5_TRYB2 unnamed protein product
Length=1128

 Score = 32.0 bits (71),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 24/76 (32%), Positives = 29/76 (38%), Gaps = 0/76 (0%)

Query  231  HQKCPQHFTAKLESSSLVESELVNRLKELFQNEFDLSETETEFGLIGLHPCGDLAPILLK  290
            H  C   FT  L S   V S  V  LKE  QN   +    T      L+P GD    L +
Sbjct  106  HYYCTDEFTVSLFSEFEVPSVAVRALKEAPQNSHLVLAGCTLLSHFNLYPIGDGISQLTR  165

Query  291  FYSSRSEAKFICIVGC  306
              S  S+   +C   C
Sbjct  166  ALSMHSKDPLVCKAAC  181


>Q9VF24_DROME unnamed protein product
Length=1470

 Score = 30.4 bits (67),  Expect = 4.1, Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 30/56 (54%), Gaps = 8/56 (14%)

Query  391  NVKVSKGMTFEQYCNVATANFDAYLQPQESD--------INNLEINNLLNRWEQVI  438
            NV V+KG+  E++       F+AYL  ++ D        +NNL++ N+ N  E ++
Sbjct  453  NVYVAKGIDKEKFEEYVQKYFNAYLSDRDFDQKMLYLQGLNNLQLGNVANYLEPIV  508



Lambda      K        H
   0.324    0.139    0.448 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1051796556


Query= XP_003392983.3 smad nuclear interacting protein 1 [Bombus
terrestris]

Length=194
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8IEN7_PLAF7  unnamed protein product                                 139     2e-38
Q580T9_TRYB2  unnamed protein product                                 73.6    1e-15
Q9V7W9_DROME  unnamed protein product                                 68.9    8e-14
Q55EZ0_DICDI  unnamed protein product                                 63.5    3e-12
Q57XM6_TRYB2  unnamed protein product                                 63.2    9e-12


>Q8IEN7_PLAF7 unnamed protein product
Length=561

 Score = 139 bits (349),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 101/151 (67%), Gaps = 12/151 (8%)

Query  38   NFELSGKLTEDTNTVNGVVIKYSEPADARKPKRRWRLYPFKEEKA---LPTLYIHRQSAY  94
            NF  SG L ++    NG+ +KY+E  DA KP ++WRLY FK+         L+IH +S Y
Sbjct  415  NFNPSGLLAQEKIYKNGIEMKYTESIDAEKPDKKWRLYMFKDSNNNEPQKILHIHDKSYY  474

Query  95   LMGRDRKVADIPLDHPSCSKQHAVLQYRLVSFQKEDGGEGRRIRPYLIDLESANGTFVNN  154
            L+G+++   DI L++ S SKQHAV+Q     F+K +     +I P+L+DL S NGT++NN
Sbjct  475  LIGKEQLAVDIQLNNISISKQHAVIQ-----FKKHES----KILPFLLDLNSTNGTYINN  525

Query  155  VKLEPRRYHELLERDVIRFGYSSREYVLLHE  185
             K++P +Y+EL E D+IRFG S+RE+VLLH+
Sbjct  526  EKIQPNKYYELRETDIIRFGSSNREFVLLHD  556


>Q580T9_TRYB2 unnamed protein product
Length=274

 Score = 73.6 bits (179),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/153 (31%), Positives = 70/153 (46%), Gaps = 41/153 (27%)

Query  72   WRLYPFKEEKALPTLY-IHRQSAYLMGRDRKVADIPLDHPSCSKQHAVLQYRLV------  124
            +RL   KE + + T   I R++  LMG+DR + DIPLDHPSCS QHA L+   V      
Sbjct  120  YRLRVLKEGETVATFNDISRRAVTLMGKDRGINDIPLDHPSCSAQHAALEVNFVHRNSEP  179

Query  125  --------------------------------SFQKEDGGEGRR--IRPYLIDLESANGT  150
                                               +E GG+     +   ++DL S NGT
Sbjct  180  FQQRLHTLMQEEYRNINWSSPDEVGKLCAHALQLMREFGGDEDMWLMELQVVDLGSTNGT  239

Query  151  FVNNVKLEPRRYHELLERDVIRFGYSSREYVLL  183
             +N   L P     ++E DV+ FGYS+R+Y+++
Sbjct  240  NLNGELLRPLERATVIEGDVLTFGYSTRKYLIV  272


>Q9V7W9_DROME unnamed protein product
Length=383

 Score = 68.9 bits (167),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 61/125 (49%), Gaps = 13/125 (10%)

Query  59   YSEPADARKPKRRWRLYPFKEEKALPTLYIHRQSAYLMGRDRKVADIPLDHPSCSKQHAV  118
            Y  P+ A KP     L   K++K +  L +  +  YL GR+ ++ D  +DH SCS+ H+ 
Sbjct  5    YDIPSWAGKPPTGLHLDVLKDDKLVQKLMVDEKRCYLFGRNSQMNDFCIDHASCSRVHSA  64

Query  119  LQYRLVSFQKEDGGEGRRIR-PYLIDLESANGTFVNNVKLEPRRYHELLERDVIRFGYSS  177
              Y             + +   YL+DL S +GTF+  ++LE  +  +L       FG S+
Sbjct  65   FVYH------------KHLNIAYLVDLGSTHGTFIGTLRLEAHKPTQLQINSTFHFGAST  112

Query  178  REYVL  182
            R Y+L
Sbjct  113  RNYIL  117


>Q55EZ0_DICDI unnamed protein product
Length=268

 Score = 63.5 bits (153),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 60/124 (48%), Gaps = 11/124 (9%)

Query  59   YSEPADARKPKRRWRLYPFKEEKALPTLYIHRQSAYLMGRDRKVADIPLDHPSCSKQHAV  118
            +  P  A KP     L   K    +  + I +    + GR  +VA + LDHPS S++HA 
Sbjct  23   FKCPEWASKPISNVYLEIIKNGVNIDRVDISKDKFTVFGRSSEVASVLLDHPSVSRRHAA  82

Query  119  LQYRLVSFQKEDGGEGRRIRPYLIDLESANGTFVNNVKLEPRRYHELLERDVIRFGYSSR  178
            L Y            G   R YLIDL+SA GT VN+ +++P     + E    +FG SS+
Sbjct  83   LVY-----------HGANNRFYLIDLQSATGTQVNDEQVKPLTPTTVKENFTFKFGSSSK  131

Query  179  EYVL  182
             ++L
Sbjct  132  HFIL  135


>Q57XM6_TRYB2 unnamed protein product
Length=383

 Score = 63.2 bits (152),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 62/133 (47%), Gaps = 12/133 (9%)

Query  48   DTNTVNGVVIKYSEPADARKPKRRWRLYPFKEEKALPTLYIHRQSAYLMGRDRKVADIPL  107
            D   +N  V  +  P  A  P     L   ++   LP L +HR   YL GR  KV D  L
Sbjct  47   DPTKLNAQVSYFQCPPWAALPSVACHLQCTRDGLPLPALGLHRFPFYLFGRS-KVCDYVL  105

Query  108  DHPSCSKQHAVLQYRLVSFQKEDGGEGRRIRPYLIDLESANGTFVNNVKLEPRRYHELLE  167
            +HPS S  HAVL +         GG+   +   L+DL S NG  +N  ++E RR      
Sbjct  106  EHPSISSVHAVLVFH--------GGQRCFV---LMDLGSTNGVKLNGNRIEKRRPLPAPV  154

Query  168  RDVIRFGYSSREY  180
               I+FG+SSR Y
Sbjct  155  GSSIQFGFSSRVY  167



Lambda      K        H
   0.324    0.139    0.448 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1051796556


Query= XP_003392984.2 proto-oncogene tyrosine-protein kinase ROS isoform X1
[Bombus terrestris]

Length=2586
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

7LESS_DROME  unnamed protein product                                  741     0.0  
Q8SWV4_DROME  unnamed protein product                                 295     1e-81
Q7KJ08_DROME  unnamed protein product                                 295     6e-80
A0A0C4UQS4_NILLU  unnamed protein product                             253     3e-67
A0A0C4UR07_NILLU  unnamed protein product                             249     3e-66


>7LESS_DROME unnamed protein product
Length=2554

 Score = 741 bits (1913),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 668/2392 (28%), Positives = 1090/2392 (46%), Gaps = 264/2392 (11%)

Query  39    ECASKC-PDLDLNQNRTDDSSSEVGCGIRCKIDQCTKGCGAWQRALDT--SCQAVCNGTQ  95
             +C  +C  + DL  +       +   G +C   +CTKGC  W RAL    SCQ  C   Q
Sbjct  219   DCVQRCIVEEDLFLDEFGIQCEKADNGEKCYKTRCTKGCAQWYRALKELESCQEACLSLQ  278

Query  96    ELLPPKELYCVLGCHDALNRYFQQLKAEIG---------IPSAPALVADSLTATSLRLEW  146
                 P ++ C+  C  A   Y+   +  I          +  AP   AD   +T L + W
Sbjct  279   --FYPYDMPCIGACEMAQRDYWHLQRLAISHLVERTQPQLERAPR--ADG-QSTPLTIRW  333

Query  147   KGIDIERRGGGISYLVQWRY-----EEL--------------AETWQYCRNQSWGEDDQI  187
                  E       + +Q+++     EEL              +  W    +    E    
Sbjct  334   AMHFPEHYLASRPFNIQYQFVDHHGEELDLEQEDQDASGETGSSAWFNLADYDCDEYYVC  393

Query  188   -LVENLQPYTKYRFRVALLLKSSQHNPEPIVSAPSVVIRTLAAGLPTSAPVIVRAVAVDS  246
              ++E L PYT+YRFR  L     ++  E + S  +   +T   G P SAPVI   + +D 
Sbjct  394   EILEALIPYTQYRFRFELPF--GENRDEVLYSPATPAYQTPPEGAPISAPVIEHLMGLDD  451

Query  247   CRASVSWEPGPFPNGPLLSYVLRLQGADHSQLKD--IPASENTDHYMFQNLEPNKNYSIS  304
                +V W PG F NGP+  Y LRL  ++ +   +  +PA   +  Y+F  L+   NY+++
Sbjct  452   SHLAVHWHPGRFTNGPIEGYRLRLSSSEGNATSEQLVPAGRGS--YIFSQLQAGTNYTLA  509

Query  305   VTMRNGVGEGPPAVTCVMTTP---EPAVKDTQQPILILGGQHVVMKQDADMLDDPSVVYE  361
             ++M N  GEGP A   V T     E   KD  + +L++G +  VM Q  +   + S++Y+
Sbjct  510   LSMINKQGEGPVAKGFVQTHSARNEKPAKDLTESVLLVG-RRAVMWQSLEPAGENSMIYQ  568

Query  362   NTSTIRGVAIHVASARLFISDSLGYVYRTSITKRTKPTVILSPSQ-----------ANFK  410
             +   +  +A      +L++ +  G +     + + +   ++SP+Q             + 
Sbjct  569   SQEELADIAWSKREQQLWLLNVHGELR----SLKFESGQMVSPAQQLKLDLGNISSGRWV  624

Query  411   PLSLSVDWLNLHLYILGEV-KHATTVWQIARCNLDGRGLTVAVAGFLTRPTHIEVDPYNG  469
             P  LS DWL+  LY   E  +   + +QI   +L G         F      +EVD  NG
Sbjct  625   PRRLSFDWLHHRLYFAMESPERNQSSFQIISTDLLGESAQKVGESFDLPVEQLEVDALNG  684

Query  470   YLFWVTRGGLYRLDLADISNGVKHEVQPYLILEDANLGAFTVDHTNF--RLLVPHHIQNT  527
             ++FW     L+R DL        H    + +L     G F V   +F   L++P   +  
Sbjct  685   WIFWRNEESLWRQDL--------HGRMIHRLLRIRQPGWFLVQPQHFIIHLMLPQ--EGK  734

Query  528   VISVSLDG--REVINL----RANTQQPKFKNVVSLAM-ANGLFYWTNGEEVLIEGYHSGQ  580
              + +S DG  +  + L          P   +  S A+    L    +G+ +L+E    GQ
Sbjct  735   FLEISYDGGFKHPLPLPPPSNGAGNGPASSHWQSFALLGRSLLLPDSGQLILVE--QQGQ  792

Query  581   NRYFHNAYPDRSNGSFVSVNVLMDASQPVPVPVNPPTGVQAVLGVERAKVSWQAPHLLGG  640
                   ++P ++     +V +L+  SQP+      P  ++A+LG + AK+SW+ P     
Sbjct  793   AASPSASWPLKNLPDCWAVILLVPESQPLTSAGGKPHSLKALLGAQAAKISWKEPERNPY  852

Query  641   QGKGAWQNWSYELEIKDESTGETIHQKDIAGSSHTVHNLREKSEYSIKAAAYTSAGR-GP  699
             Q   A ++WSYELE+ D ++      ++I G    +  L+  + Y ++  A    G  G 
Sbjct  853   QSADAARSWSYELEVLDVASQSAFSIRNIRGPIFGLQRLQPDNLYQLRVRAINVDGEPGE  912

Query  700   WSTEFRGRTLRDGSHASILWSANEG-LLRSDVTGENIDTLIYKAGLKETEVDYHIVDVSW  758
             W+     RT   G H  + W++ +G ++ ++  GE ++  + +  L+       +V+ S 
Sbjct  913   WTEPLAARTWPLGPH-RLRWASRQGSVIHTNELGEGLE--VQQEQLERLPGPMTMVNES-  968

Query  759   YKDILYIVGNNSALYRYNITSHQ---KTKMNIHSVGSVAVDWISKKLYWANPKQQIITRA  815
                + Y V  +  L+  N+   Q        +  VGSV  DW   ++YW +  +  + R 
Sbjct  969   ---VGYYVTGDGLLHCINLVHSQWGCPISEPLQHVGSVTYDWRGGRVYWTDLARNCVVRM  1025

Query  816   NLNGSHQEPMSILAIVKELMIDSLEAYLYWSTGHAVEVARLNGQDRRYYHSDEIFNGKQV  875
             +     +E + +      L +D  + +LY++T   +        +   Y+      G  +
Sbjct  1026  DPWSGSRELLPVFE-ANFLALDPRQGHLYYATSSQLSRHGSTPDEAVTYYRVNGLEGS-I  1083

Query  876   MGLTLDTENRYVYWIVRSYESGSI-VYRAPTS---------ERISMSHKIVPEKVSALQY  925
                 LDT+   ++W+V+   SG++ +YRAP +         ++I    + VP+ +  L+ 
Sbjct  1084  ASFVLDTQQDQLFWLVKG--SGALRLYRAPLTAGGDSLQMIQQIKGVFQAVPDSLQLLR-  1140

Query  926   PNMQGPLCYFSEHLLWLQ-DDRNAVIGDLSGQNTAIINGISLSGLHMVAVMDPALHQYPK  984
                  PL      LLWL+   R A +  L+    A ++ + L      +         P+
Sbjct  1141  -----PLGA----LLWLERSGRRARLVRLA----APLDVMELPTPDQASPASALQLLDPQ  1187

Query  985   NLTSETVAVLPNAVNYSSIRVE-GTWRNFNISWDPVENINYGTVFYEV--KFADYINTNS  1041
              L      V+P  V   S+R++ G W +F++ W P  +    +V Y +  +F   + T  
Sbjct  1188  PLPPRDEGVIPMTVLPDSVRLDDGHWDDFHVRWQPSTSGGNHSVSYRLLLEFGQRLQT--  1245

Query  1042  NPEITTETSMPYNNSEQILPYSVLE--VTVKAFTYWETAHHTRKILRSPQSVPSQPTNPR  1099
                   + S P+    Q LP + L+  +++   T W +   TR  L +P   PSQP   R
Sbjct  1246  -----LDLSTPFARLTQ-LPQAQLQLKISITPRTAWRSGDTTRVQLTTPPVAPSQPRRLR  1299

Query  1100  AFIEFRKEPLSENVDIFAIFRWDQPEFTNGL---ITGYTVQCWFKENNVEMQICDQSLIP  1156
              F+E     L E  ++ A+ RWD PE           Y + CW     V  ++ ++  + 
Sbjct  1300  VFVERLATALQE-ANVSAVLRWDAPEQGQEAPMQALEYHISCW-----VGSELHEELRLN  1353

Query  1157  STLLEHTVQDLLPNTTYYFQVRAHTEIGAGPYTDVISVSTIYENP----IPQLLVATMDA  1212
              + LE  V+ L P+ TY+FQV A             +   ++  P    +P++L A  + 
Sbjct  1354  QSALEARVEHLQPDQTYHFQVEARVAATG--AAAGAASHALHVAPEVQAVPRVLYANAEF  1411

Query  1213  VRISDLDQEMNYTVTRHIAVEVTYLAA---ESKIYWINEMQELVTSDLDGTNATKILTLN  1269
             +   DLD   N     H A  V +L     E ++ W+NE  EL+T  + G+   K+  + 
Sbjct  1412  IGELDLDTR-NRRRLVHTASPVEHLVGIEGEQRLLWVNEHVELLT-HVPGSAPAKLARMR  1469

Query  1270  NSAFSITVDWVARHLYWSE-SSYRENGGCIMKLDLTMWQAGILKYENIVTT--SRRIVNL  1326
                 ++ VDW+ R +YW+E  +       I +LDL  ++  IL+ E + +T   R + +L
Sbjct  1470  AEVLALAVDWIQRIVYWAELDATAPQAAIIYRLDLCNFEGKILQGERVWSTPRGRLLKDL  1529

Query  1327  DILPSTGSLYWIEQTK---KDGGVIMRSNLSGSD-----IQPFFDHIDDCSCPYRPSVIP  1378
               LP   SL W+E  +   ++G +  R+   GS+     +QP    I   +    P    
Sbjct  1530  VALPQAQSLIWLEYEQGSPRNGSLRGRNLTDGSELEWATVQPL---IRLHAGSLEPGSET  1586

Query  1379  VMTIDST------DYQKPVMYWISLEGHLNSADIDGCKCNLIVSAGFNKGLPARSLTVDK  1432
             +  +D+       D  + +    +L   LN    D     L   +G+          V  
Sbjct  1587  LNLVDNQGKLCVYDVARQLCTASALRAQLNLLGEDSIAGQLAQDSGY-------LYAVKN  1639

Query  1433  MNIYWSNIPEDQIYFVNKKYPDDQEIKHFYLPSVRSIKALGKSLQTYPITNCLI-PRQDS  1491
              +I        Q+ +  +  P++          VR ++A   + Q YP  NCL+ P    
Sbjct  1640  WSIRAYGRRRQQLEYTVELEPEE----------VRLLQA--HNYQAYPPKNCLLLPSSGG  1687

Query  1492  YNVEEVRKTASSITVRLPEPVPQFGCEGYSLPTTLYTIYVSQCLENDPNMCEDSDRTK--  1549
               ++          + LP       C    +P   Y + ++  L   P   E     +  
Sbjct  1688  SLLKATDCEEQRCLLNLPMITASEDCP-LPIPGVRYQLNLT--LARGPGSEEHDHGVEPL  1744

Query  1550  ---LQTYEKEYEIKDLKPFTKYRLKLALSNYYADSESMSLEFDSGVVLRTEAGAPTAPEN  1606
                L    +   + DL PFT+YR+   LS++Y    ++     + + L T +  P+ P N
Sbjct  1745  GQWLLGAGESLNLTDLLPFTRYRVSGILSSFYQKKLALPTLVLAPLELLTASATPSPPRN  1804

Query  1607  VTVEALTPTLAIVYWMPPKILNAAAVRYEVHWRLVRLINGARQKGEQFIKGTERTTDGRF  1666
              +V  L+P    V W+PP+ L + +V Y +HW+  + ++G   +  +  +  ER  +   
Sbjct  1805  FSVRVLSPRELEVSWLPPEQLRSESVYYTLHWQ--QELDGENVQDRREWEAHERRLETAG  1862

Query  1667  FTMLEPWLPDQEYLVFVRAYPAHVNDVYSESSGQV-VKMYPEPNNLTLTGVSVNSLNVSW  1725
                L    P   Y ++V+A   H     S SS ++ V+ + E   L L  +   SL+++W
Sbjct  1863  THRLTGIKPGSGYSLWVQA---HATPTKSNSSERLHVRSFAELPELQLLELGPYSLSLTW  1919

Query  1726  VPTVDLMVKYTLEYKDVAVENWQEANDFTMENDKVTYFIRKLQPRTLYKFHLLLRYPNYK  1785
               T D +    LE +  A     E     +  +     +  LQPRT Y+  LLL Y    
Sbjct  1920  AGTPDPLGSLQLECRSSA-----EQLRRNVAGNHTKMVVEPLQPRTRYQCRLLLGYAATP  1974

Query  1786  KDFVWPTDGRFTFQTLGDVPSAPGMPTVTKLRNSVYQLNWEPAQAHGSQITLYRVEGMKI  1845
                ++       ++TLGD PS PG P +  +   V+++ W  A+ +G+ I LY +E ++ 
Sbjct  1975  GAPLYHGTAE-VYETLGDAPSQPGKPQLEHIAEEVFRVTWTAARGNGAPIALYNLEALQA  2033

Query  1846  NK------INEQIDSTGNAS--------------WKLYYNGTDNYWIITGDMNDKYR-FR  1884
                        + +S G+                W  + N T+   I+    + +   FR
Sbjct  2034  RSDIRRRRRRRRRNSGGSLEQLPWAEEPVVVEDQWLDFCNTTELSCIVKSLHSSRLLLFR  2093

Query  1885  IQARN-AYGFGSWSRSSPIIDLTEATGGILAAQQHLGLVLGLSVPVITIMLVCFCFFLCP  1943
             ++AR+  +G+G +S  S  +         ++ ++   LVL +  P   +        L  
Sbjct  2094  VRARSLEHGWGPYSEESERV-----AEPFVSPEKRGSLVLAIIAPAAIVSSCVLALVLVR  2148

Query  1944  VYRQRKDDKKAVL----PPLVSDVELATLREIPRGNFVQSNALYASTLQNDPDDSTLPKI  1999
               ++R+   K +L    P + S+  L+TL+   +   V++ A   ST  +D D + LP+I
Sbjct  2149  KVQKRRLRAKKLLQQSRPSIWSN--LSTLQTQQQLMAVRNRAF--STTLSDADIALLPQI  2204

Query  2000  RREQITLAKFLGSGAFGEVFQGNAKDLERPGITPVAIKTLRKGASAQEKTEFLQEARLMS  2059
                Q+ L +FLGSGAFGEV++G  K  +      VAIK+LRKGAS  E  E LQEA+LMS
Sbjct  2205  NWSQLKLLRFLGSGAFGEVYEGQLKTEDSEEPQRVAIKSLRKGAS--EFAELLQEAQLMS  2262

Query  2060  HFRHKHVLRLLGVCLDTDPPLLVLELMEAGDLLSYLRASRSLQPSDPH---ALRLQDLLA  2116
             +F+H++++ L+G+C DT+   L++E MEAGDLLSYLRA+R+    +P     L L +LLA
Sbjct  2263  NFKHENIVCLVGICFDTESISLIMEHMEAGDLLSYLRAARATSTQEPQPTAGLSLSELLA  2322

Query  2117  MCEDVARGCRYLEELHFVHRDLACRNCLVS----ARDRENRVVKIGDFGLARDIYKNDYY  2172
             MC DVA GC YLE++HFVHRDLACRNCLV+    + DR  R VKIGDFGLARDIYK+DYY
Sbjct  2323  MCIDVANGCSYLEDMHFVHRDLACRNCLVTESTGSTDR-RRTVKIGDFGLARDIYKSDYY  2381

Query  2173  RKEGEGLLPVRWMAPESLVDGVFTSQSDVWAFGVLMWEITSLGQQPYPARTNIEVLHHVR  2232
             RKEGEGLLPVRWM+PESLVDG+FT+QSDVWAFGVL WEI +LGQQPY AR N EVL HV+
Sbjct  2382  RKEGEGLLPVRWMSPESLVDGLFTTQSDVWAFGVLCWEILTLGQQPYAARNNFEVLAHVK  2441

Query  2233  AGGRLPKSLNCPPALHQLMLRCWSVAD-ARPSFKVCLENIVSLRSTIEDAQL  2283
              GGRL +   C   L+ L+L CW      RPSF+ C   + ++ + +   Q+
Sbjct  2442  EGGRLQQPPMCTEKLYSLLLLCWRTDPWERPSFRRCYNTLHAISTDLRRTQM  2493


>Q8SWV4_DROME unnamed protein product
Length=1158

 Score = 295 bits (756),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 152/400 (38%), Positives = 244/400 (61%), Gaps = 9/400 (2%)

Query  1879  DKYRFRIQARNAYGFGSWSRSSPIIDLTEATGGILAAQQHLGLVLGLSVPVITIMLVCFC  1938
             D++R +++     G+     +    ++ E  G   ++ Q+L  +L +S+ V+ I +    
Sbjct  524   DEFRSKVRCICPDGWSLKRDNHTACEIREEAGK--SSFQYLVSILMISLAVLFICIAALI  581

Query  1939  FFLCPVYRQRKDDKKAVLPPLVSDVELATLRE-IPRGNFVQSNALYA--STLQNDPDDST  1995
             F L   Y+++K  KK     +  D++L  LR  I   N    N  Y     L    D ++
Sbjct  582   FMLYNRYQRKKQSKKRHKMLVEQDLQLTRLRNNIDDSNLNNFNPNYGCDGILNGHIDVNS  641

Query  1996  LPKIRREQITLAKFLGSGAFGEVFQGNAKDLERPGI-TPVAIKTLRKGASAQEKTEFLQE  2054
             LP++ R+ + L   LG GAFGEV+    +  +   +   VA+KTLR+    +++ +FL+E
Sbjct  642   LPQVARDSLQLVNALGKGAFGEVYMALYRHRDGDAVEMGVAVKTLREDPKREKEEDFLKE  701

Query  2055  ARLMSHFRHKHVLRLLGVCLDTDPPLLVLELMEAGDLLSYLRASRSLQPSDPHALRLQDL  2114
             A +M+ F H +++ L+GVC D  P  +VLEL+  GDL  +LR +R+  P  P  L ++DL
Sbjct  702   AAIMAKFNHPNMVHLIGVCFDRQPYYIVLELLAGGDLQKFLRENRN-TPERPSLLTMKDL  760

Query  2115  LAMCEDVARGCRYLEELHFVHRDLACRNCLVSARDRENRVVKIGDFGLARDIYKNDYYRK  2174
             L    DVA+GCRY+E   F+HRD+A RNCL+S++    RVVKI DFG++RDIY++DYYRK
Sbjct  761   LFCALDVAKGCRYMESKRFIHRDIAARNCLLSSKG-PGRVVKIADFGMSRDIYRSDYYRK  819

Query  2175  EGEGLLPVRWMAPESLVDGVFTSQSDVWAFGVLMWEITSLGQQPYPARTNIEVLHHVRAG  2234
              G+ +LP++WM PE+ +DG+FTS++DVW+FG+L+WE+ SLG+ PYP + N +V+  V  G
Sbjct  820   GGKAMLPIKWMPPEAFLDGIFTSKTDVWSFGILLWEVFSLGRSPYPGQHNTQVMELVVRG  879

Query  2235  GRLPKSLNCPPALHQLMLRCWS-VADARPSFKVCLENIVS  2273
             GRL     CP +++++M  CW+   + RP+F   LE++ +
Sbjct  880   GRLGSPTECPVSIYKVMADCWNPTPEDRPTFITLLEHLTA  919


>Q7KJ08_DROME unnamed protein product
Length=1701

 Score = 295 bits (754),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 152/400 (38%), Positives = 244/400 (61%), Gaps = 9/400 (2%)

Query  1879  DKYRFRIQARNAYGFGSWSRSSPIIDLTEATGGILAAQQHLGLVLGLSVPVITIMLVCFC  1938
             D++R +++     G+     +    ++ E  G   ++ Q+L  +L +S+ V+ I +    
Sbjct  1067  DEFRSKVRCICPDGWSLKRDNHTACEIREEAGK--SSFQYLVSILMISLAVLFICIAALI  1124

Query  1939  FFLCPVYRQRKDDKKAVLPPLVSDVELATLRE-IPRGNFVQSNALYA--STLQNDPDDST  1995
             F L   Y+++K  KK     +  D++L  LR  I   N    N  Y     L    D ++
Sbjct  1125  FMLYNRYQRKKQSKKRHKMLVEQDLQLTRLRNNIDDSNLNNFNPNYGCDGILNGHIDVNS  1184

Query  1996  LPKIRREQITLAKFLGSGAFGEVFQGNAKDLERPGI-TPVAIKTLRKGASAQEKTEFLQE  2054
             LP++ R+ + L   LG GAFGEV+    +  +   +   VA+KTLR+    +++ +FL+E
Sbjct  1185  LPQVARDSLQLVNALGKGAFGEVYMALYRHRDGDAVEMGVAVKTLREDPKREKEEDFLKE  1244

Query  2055  ARLMSHFRHKHVLRLLGVCLDTDPPLLVLELMEAGDLLSYLRASRSLQPSDPHALRLQDL  2114
             A +M+ F H +++ L+GVC D  P  +VLEL+  GDL  +LR +R+  P  P  L ++DL
Sbjct  1245  AAIMAKFNHPNMVHLIGVCFDRQPYYIVLELLAGGDLQKFLRENRNT-PERPSLLTMKDL  1303

Query  2115  LAMCEDVARGCRYLEELHFVHRDLACRNCLVSARDRENRVVKIGDFGLARDIYKNDYYRK  2174
             L    DVA+GCRY+E   F+HRD+A RNCL+S++    RVVKI DFG++RDIY++DYYRK
Sbjct  1304  LFCALDVAKGCRYMESKRFIHRDIAARNCLLSSKG-PGRVVKIADFGMSRDIYRSDYYRK  1362

Query  2175  EGEGLLPVRWMAPESLVDGVFTSQSDVWAFGVLMWEITSLGQQPYPARTNIEVLHHVRAG  2234
              G+ +LP++WM PE+ +DG+FTS++DVW+FG+L+WE+ SLG+ PYP + N +V+  V  G
Sbjct  1363  GGKAMLPIKWMPPEAFLDGIFTSKTDVWSFGILLWEVFSLGRSPYPGQHNTQVMELVVRG  1422

Query  2235  GRLPKSLNCPPALHQLMLRCWS-VADARPSFKVCLENIVS  2273
             GRL     CP +++++M  CW+   + RP+F   LE++ +
Sbjct  1423  GRLGSPTECPVSIYKVMADCWNPTPEDRPTFITLLEHLTA  1462


>A0A0C4UQS4_NILLU unnamed protein product
Length=1454

 Score = 253 bits (645),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 165/450 (37%), Positives = 245/450 (54%), Gaps = 44/450 (10%)

Query  1820  VYQLNWEPAQAHGSQITLYRVEGMKINKINEQIDSTGNASWKLYYNGTDNYWIITGDMND  1879
             + +L W+   A    I +Y++    + + N+Q   T   S + +    +++  +T     
Sbjct  930   IVKLYWKEPPAPNGLIVMYQISHWLVFE-NQQHKKTHCISRRQFLEEGNSH-TLTNLAPG  987

Query  1880  KYRFRIQARNAYGFGSWSRSSPIIDLTEATGGILAAQQHLGLVLGLSVPVITIMLVCFCF  1939
              Y +++ A +  G  + S+S   +   E  G   ++   L ++    +    ++L+ F  
Sbjct  988   NYSYQVCATSLAGLANCSQSP--LRYFEIQG--YSSVTSLQIIFATFMTAGMLILLGFVV  1043

Query  1940  FLCPVYRQRKDDKKAVLPPLVSDVELATLREIPRGNFVQSNALYASTLQNDPDDSTLPKI  1999
             FL     + K +K+    PL+++                 N  Y ST+   PDD  +P  
Sbjct  1044  FL-----RNKSNKQT---PLIAEC----------------NPEYVSTVYV-PDDWEVP--  1076

Query  2000  RREQITLAKFLGSGAFGEVFQGNAKDLERPG--ITPVAIKTLRKGASAQEKTEFLQEARL  2057
              R QI L   LG G+FG V++G A ++  PG      AIKT+ + AS +E+ EFL EA +
Sbjct  1077  -RSQIELDGELGQGSFGMVYEGIATNV-VPGEPRKKCAIKTVNENASLRERVEFLNEASV  1134

Query  2058  MSHFRHKHVLRLLGVCLDTDPPLLVLELMEAGDLLSYLRASRSLQPSDPHAL--RLQDLL  2115
             M      HV+RL+GV     PP +V+ELM  GDL SYLR  R     +PH     L+ + 
Sbjct  1135  MKASNTHHVVRLIGVVSQGQPPYVVMELMANGDLKSYLRLHRPDATVEPHKQPPTLKRIR  1194

Query  2116  AMCEDVARGCRYLEELHFVHRDLACRNCLVSARDRENRVVKIGDFGLARDIYKNDYYRKE  2175
              M  ++A G  YL    FVHRDLA RNC+V+    E+  VKIGDFG+ RDIY+ DYYRK 
Sbjct  1195  QMAIEIADGMAYLAAKKFVHRDLAARNCMVA----EDLTVKIGDFGMTRDIYETDYYRKG  1250

Query  2176  GEGLLPVRWMAPESLVDGVFTSQSDVWAFGVLMWEITSLGQQPYPARTNIEVLHHVRAGG  2235
              +GLLPVRWM+PESL DGVFTS SDVW++GV++WE+ +L  QPY   +N +VL++V+ GG
Sbjct  1251  TKGLLPVRWMSPESLKDGVFTSSSDVWSYGVVIWEMATLASQPYQGLSNEQVLNYVKTGG  1310

Query  2236  RLPKSLNCPPALHQLMLRCWSVADA-RPSF  2264
              + +  NCP  L+ LM +CW    A RP+F
Sbjct  1311  CMERPDNCPDVLYNLMRQCWQHKPADRPTF  1340


 Score = 32.7 bits (73),  Expect = 4.9, Method: Compositional matrix adjust.
 Identities = 26/97 (27%), Positives = 44/97 (45%), Gaps = 17/97 (18%)

Query  1543  EDSDRTKLQTYEKEYEIKDLKPFTKYRLKLALSNYYADSESMSLEFDSG-----VVLRTE  1597
             ED ++TK  +      I  LKP+T+Y        +Y  + +++ E +SG     +  RTE
Sbjct  627   EDKNKTKHMSQL----ITQLKPYTQYA-------FYVKTYTIASE-NSGAQSPIIYFRTE  674

Query  1598  AGAPTAPENVTVEALTPTLAIVYWMPPKILNAAAVRY  1634
                P+ P+N+  +  + +   V W PP   N     Y
Sbjct  675   PDIPSMPQNLVAKIESSSEIKVAWQPPLNPNGNVTHY  711


 Score = 32.7 bits (73),  Expect = 5.4, Method: Compositional matrix adjust.
 Identities = 24/81 (30%), Positives = 40/81 (49%), Gaps = 5/81 (6%)

Query  188  LVENLQPYTKYRFRVALLLKSSQHNPEPIVSAPSVVIRTLAAGLPTSAPVIVRAVAVDSC  247
            L+  L+PYT+Y F V     +S+++      +P +  RT    +P S P  + A    S 
Sbjct  638  LITQLKPYTQYAFYVKTYTIASENSG---AQSPIIYFRT-EPDIP-SMPQNLVAKIESSS  692

Query  248  RASVSWEPGPFPNGPLLSYVL  268
               V+W+P   PNG +  Y++
Sbjct  693  EIKVAWQPPLNPNGNVTHYLI  713


>A0A0C4UR07_NILLU unnamed protein product
Length=1427

 Score = 249 bits (637),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 148/387 (38%), Positives = 207/387 (53%), Gaps = 46/387 (12%)

Query  1880  KYRFRIQARNAYGFGSWSRSSPIIDLTEATGGILAAQQHLGLVLGLSVPVITIMLVCFCF  1939
             KY +RI+A +    G ++ SS               ++       L   V  IM+  F  
Sbjct  961   KYAYRIRALSMASEGEYTESS-----------YFEIEEEFSFSFKLIFAVCFIMMTVF-M  1008

Query  1940  FLCPVYRQRKDDKKAVLPPLVSDVELATLREIPRGNFVQSNALYASTLQNDPDDSTLPKI  1999
              +C +Y  RK  K  V+ P V+                +  ++Y      D  +     +
Sbjct  1009  IICSLYYWRK--KPVVMFPDVNP---------------EYQSIYNCRYVEDEWE-----L  1046

Query  2000  RREQITLAKFLGSGAFGEVFQGNAKDLERPGITPVAIKTLRKGASAQEKTEFLQEARLMS  2059
              RE + + K LG G FG V++G    + +P   P AIKT+    +  E  +FL EA +M 
Sbjct  1047  CRENVEIVKELGKGTFGMVYEG----ILKPNNVPCAIKTVSARQNESEYFDFLLEASIMK  1102

Query  2060  HFR-HKHVLRLLGVCLDTDPPLLVLELMEAGDLLSYLRASRSLQPSDPHALRLQDLLAMC  2118
              F    H++RLLGV     PPL+V+ELM  GDL  +LR++R      P   R   +L M 
Sbjct  1103  SFSGSNHIIRLLGVVSRGTPPLVVMELMALGDLKMFLRSTRDSSLRPPPTGR--TVLHMA  1160

Query  2119  EDVARGCRYLEELHFVHRDLACRNCLVSARDRENRVVKIGDFGLARDIYKNDYYRKEGEG  2178
               +A G  YLE   FVHRDLA RNC+V+    ++  VKIGDFG+ RDIY+ DYYRK  +G
Sbjct  1161  AQIADGMAYLESKKFVHRDLAARNCMVA----DDLTVKIGDFGMTRDIYETDYYRKGTKG  1216

Query  2179  LLPVRWMAPESLVDGVFTSQSDVWAFGVLMWEITSLGQQPYPARTNIEVLHHVRAGGRLP  2238
             LLP+RWMAPES  DG+F+S SDVW++GV++WEI++L +QPY  ++N EVL +V AG  L 
Sbjct  1217  LLPIRWMAPESCYDGIFSSHSDVWSYGVVLWEISTLAEQPYQGKSNEEVLAYVLAGNSLQ  1276

Query  2239  KSLNCPPALHQLMLRCWSV-ADARPSF  2264
               L CP  +  +ML CW+     RPSF
Sbjct  1277  APLFCPEVIKPIMLSCWNFRPTKRPSF  1303


 Score = 37.7 bits (86),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 37/89 (42%), Gaps = 4/89 (4%)

Query  1756  ENDKVTYFIRKLQPRTLYKFHLLLRYPNYKKDFVWPTDGRFTFQTLGDVPSAPGMPTVTK  1815
             E   +TY I +L+P T Y F++      Y  D      G   F+TL   P+ P   T T 
Sbjct  560   EPHNITYPITQLEPNTQYAFYV----KTYTIDSFALKSGVQYFRTLPSKPTFPTKLTATS  615

Query  1816  LRNSVYQLNWEPAQAHGSQITLYRVEGMK  1844
               +S   L W P      ++  Y V G K
Sbjct  616   ESSSSITLKWNPPSIANGKLEKYIVHGYK  644


 Score = 36.2 bits (82),  Expect = 0.43, Method: Compositional matrix adjust.
 Identities = 26/82 (32%), Positives = 37/82 (45%), Gaps = 7/82 (9%)

Query  1557  YEIKDLKPFTKYRLKLALSNYYADSESMSLEFDSGV-VLRTEAGAPTAPENVTVEALTPT  1615
             Y I  L+P T+Y     +  Y  DS ++     SGV   RT    PT P  +T  + + +
Sbjct  566   YPITQLEPNTQY--AFYVKTYTIDSFALK----SGVQYFRTLPSKPTFPTKLTATSESSS  619

Query  1616  LAIVYWMPPKILNAAAVRYEVH  1637
                + W PP I N    +Y VH
Sbjct  620   SITLKWNPPSIANGKLEKYIVH  641



Lambda      K        H
   0.324    0.139    0.448 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1051796556


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Aug 1, 2023  12:07 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_003392985.2 prefoldin subunit 3 [Bombus terrestris]

Length=190
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PFD3_DROME  unnamed protein product                                   226     5e-76
PFD3_CAEEL  unnamed protein product                                   136     1e-40
ACT2_TRYBB  unnamed protein product                                   31.2    0.48 
Q23067_CAEEL  unnamed protein product                                 30.0    1.1  
A0A0B4K7K9_DROME  unnamed protein product                             30.4    1.1  


>PFD3_DROME unnamed protein product
Length=194

 Score = 226 bits (576),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 140/174 (80%), Gaps = 3/174 (2%)

Query  12   LDKEKKSYAGIPEAEFVDDVDAFMARPENESADKVLQMLDESHGKYKFMEYNLFNKRRRL  71
            L + +K++AGIPEA F++++D FM++PENE+ +KVLQ LDE HGKY+FM  NL  +RR+L
Sbjct  13   LPENQKTFAGIPEAVFLEEIDTFMSQPENENCEKVLQRLDEQHGKYRFMACNLEARRRKL  72

Query  72   KAQIPDLERSLEMIKKLQQEKNKSKELETQFLLSEQVYAKAVIPPTDKVCLWLGANVMLE  131
            K+QIPDLERSLEM+  L++E    +E ETQFLLS+QV+ K ++PPT  V LWLGA+VMLE
Sbjct  73   KSQIPDLERSLEMVNVLRKE---DEERETQFLLSDQVFIKTLVPPTKTVYLWLGASVMLE  129

Query  132  YTLDDAQEMLTKNIEAAKRNLGYVEHDLDFVRDQFTTTEVNMARIYNWEVKRRQ  185
            Y LD+A+ +L +NI +A  NL  VEHD DF+RDQ TTTEVNMAR+YNW VK+RQ
Sbjct  130  YPLDEAEALLNQNITSAVGNLKSVEHDQDFLRDQITTTEVNMARVYNWGVKKRQ  183


>PFD3_CAEEL unnamed protein product
Length=185

 Score = 136 bits (342),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 66/170 (39%), Positives = 116/170 (68%), Gaps = 1/170 (1%)

Query  18   SYAGIPEAEFVDDVDAFMARPENESADKVLQMLDESHGKYKFMEYNLFNKRRRLKAQIPD  77
            S  GIP++E ++DV++++ + E  S ++   +L E +GKYK++E ++  ++ R+  +IP+
Sbjct  9    SARGIPKSELIEDVESWLTK-EKLSIEEAEVVLREKYGKYKYVESSMLAQKVRMSEKIPE  67

Query  78   LERSLEMIKKLQQEKNKSKELETQFLLSEQVYAKAVIPPTDKVCLWLGANVMLEYTLDDA  137
             E SL +I  L  ++   +  ET FLLS+ VY KA +   +KV +WLGANVM+EY L++A
Sbjct  68   FENSLSIIDTLIAKRAADESFETTFLLSDDVYTKATVQKPEKVSIWLGANVMVEYDLENA  127

Query  138  QEMLTKNIEAAKRNLGYVEHDLDFVRDQFTTTEVNMARIYNWEVKRRQAA  187
            +++L KN  + ++ +  + ++L +++DQ TTTEVNM+ I N+ V +R+AA
Sbjct  128  RKLLDKNRGSVQKVVDELTNELSYIKDQITTTEVNMSHIVNFGVNKRRAA  177


>ACT2_TRYBB unnamed protein product
Length=376

 Score = 31.2 bits (69),  Expect = 0.48, Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 37/89 (42%), Gaps = 11/89 (12%)

Query  50   LDESHGKYKFMEYNLFNK-----RRRLKAQIPDLERSLEMIKKLQQEKNKSKELETQFLL  104
            LDE+ G ++ M +   NK     RR L   I  L     M K L +   K    E   L 
Sbjct  269  LDEAPGFHE-MTFQSINKCDIDVRRDLYGNI-VLSGGTTMFKNLPERLGK----EISNLA  322

Query  105  SEQVYAKAVIPPTDKVCLWLGANVMLEYT  133
               +  K V PP  K  +W+G +++   T
Sbjct  323  PSSIKPKVVAPPERKYSVWIGGSILSSLT  351


>Q23067_CAEEL unnamed protein product
Length=359

 Score = 30.0 bits (66),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 2/53 (4%)

Query  27   FVDDVDAFMARP--ENESADKVLQMLDESHGKYKFMEYNLFNKRRRLKAQIPD  77
            F   V   M RP    ++ +  ++ +DE H KY    YNLF + + L +  PD
Sbjct  301  FRKPVTTVMGRPIRVTQTDEPTVEQIDELHAKYCDALYNLFEEYKHLHSIPPD  353


>A0A0B4K7K9_DROME unnamed protein product
Length=2238

 Score = 30.4 bits (67),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 18/57 (32%), Positives = 30/57 (53%), Gaps = 3/57 (5%)

Query  18   SYAGIPEAEFVDDVDAFMARP-ENESADKVLQMLDESHGKYKFME--YNLFNKRRRL  71
            S AG+P A   +DV  + A P +  S+  ++ +L+E+H          NL N+ R+L
Sbjct  413  SIAGLPSATMYNDVYGYPAPPLQQTSSSNIVNLLNEAHKSISRSSQILNLTNQARQL  469



Lambda      K        H
   0.314    0.131    0.366 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1387782160


Query= XP_003392987.1 c-Myc-binding protein isoform X1 [Bombus terrestris]

Length=93
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q38E79_TRYB2  unnamed protein product                                 75.9    1e-19
Q9VF23_DROME  unnamed protein product                                 73.9    7e-17
Q38BT6_TRYB2  unnamed protein product                                 29.6    0.32 
C1P640_CAEEL  unnamed protein product                                 28.9    0.63 
EPI1_CAEEL  unnamed protein product                                   28.9    0.65 


>Q38E79_TRYB2 unnamed protein product
Length=84

 Score = 75.9 bits (185),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 59/81 (73%), Gaps = 2/81 (2%)

Query  3   NFKPPDSKREEFRKYLERAGVMDALTKVLVSLYEEPEKPDDALEYIRQNLGGITEVDIEV  62
           +++  ++K+EEFRKYLE   V+D LT+VLV+LYEEPEKPDD +++I++ LGG +  D E 
Sbjct  2   SYQSSEAKKEEFRKYLEGKQVIDTLTRVLVNLYEEPEKPDDPVDFIKKVLGGASTADYE-  60

Query  63  QTLKKELEEAKAKITELKAKL  83
             L++E    KA++  LK +L
Sbjct  61  -ALQQENACLKAEVAALKKRL  80


>Q9VF23_DROME unnamed protein product
Length=457

 Score = 73.9 bits (180),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 55/76 (72%), Gaps = 0/76 (0%)

Query  8   DSKREEFRKYLERAGVMDALTKVLVSLYEEPEKPDDALEYIRQNLGGITEVDIEVQTLKK  67
           +SKR ++RKYLERAGV+DAL+K L+ LYEE  KP+DA+ ++R+ +      D +   +K 
Sbjct  5   ESKRVQYRKYLERAGVIDALSKALIKLYEEQNKPEDAIRFVRKFMCESCPDDAQYDVMKN  64

Query  68  ELEEAKAKITELKAKL  83
           +LEEAK  I++L+ +L
Sbjct  65  DLEEAKTHISKLEQEL  80


>Q38BT6_TRYB2 unnamed protein product
Length=698

 Score = 29.6 bits (65),  Expect = 0.32, Method: Composition-based stats.
 Identities = 16/43 (37%), Positives = 27/43 (63%), Gaps = 1/43 (2%)

Query  9    SKREEFRKYLERAGVMDALTKVLVSLYEEPEKPDDALEYIRQN  51
            SK ++F K  ER   + ALTKVLV  + +PE  ++   Y++++
Sbjct  630  SKHKQFCKLYERRRALVALTKVLVKKW-DPELEEELQHYVQES  671


>C1P640_CAEEL unnamed protein product
Length=3683

 Score = 28.9 bits (63),  Expect = 0.63, Method: Composition-based stats.
 Identities = 28/93 (30%), Positives = 45/93 (48%), Gaps = 21/93 (23%)

Query  12    EEFRKYLERAGVMDALTKVLVSLYEEPEKPDDALE-----YIRQNLGGITEVDIEVQTLK  66
             E+ +K LE+          L  L E+  K  +A++     Y +  L  I E   EV+ LK
Sbjct  2558  EKLKKQLEQ----------LTELSEKLRKRKEAVKAGIPKYSKNTLDSIDEKVQEVEKLK  2607

Query  67    KEL----EEAKAKITEL--KAKLVKYEADEGAE  93
              E+    EE +AKI+E+  KA+ +  +A+   E
Sbjct  2608  AEIDANIEETRAKISEIAGKAEEITEKANSAME  2640


>EPI1_CAEEL unnamed protein product
Length=3672

 Score = 28.9 bits (63),  Expect = 0.65, Method: Composition-based stats.
 Identities = 28/93 (30%), Positives = 45/93 (48%), Gaps = 21/93 (23%)

Query  12    EEFRKYLERAGVMDALTKVLVSLYEEPEKPDDALE-----YIRQNLGGITEVDIEVQTLK  66
             E+ +K LE+          L  L E+  K  +A++     Y +  L  I E   EV+ LK
Sbjct  2547  EKLKKQLEQ----------LTELSEKLRKRKEAVKAGIPKYSKNTLDSIDEKVQEVEKLK  2596

Query  67    KEL----EEAKAKITEL--KAKLVKYEADEGAE  93
              E+    EE +AKI+E+  KA+ +  +A+   E
Sbjct  2597  AEIDANIEETRAKISEIAGKAEEITEKANSAME  2629



Lambda      K        H
   0.314    0.131    0.366 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1387782160


Query= XP_003392988.2 transmembrane protein 267 isoform X1 [Bombus
terrestris]

Length=206


***** No hits found *****



Lambda      K        H
   0.314    0.131    0.366 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1387782160


Query= XP_003392989.1 uncharacterized protein LOC100648386 [Bombus
terrestris]

Length=103
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q582Y4_TRYB2  unnamed protein product                                 32.3    0.037
Q388N2_TRYB2  unnamed protein product                                 31.2    0.12 
Q54D12_DICDI  unnamed protein product                                 27.3    2.6  
M9MSI8_DROME  unnamed protein product                                 26.6    5.4  
M9MRP6_DROME  unnamed protein product                                 26.6    5.4  


>Q582Y4_TRYB2 unnamed protein product
Length=313

 Score = 32.3 bits (72),  Expect = 0.037, Method: Composition-based stats.
 Identities = 22/71 (31%), Positives = 31/71 (44%), Gaps = 7/71 (10%)

Query  4    DDLLLYLAIAAGIVGGALLLLFVLVFVLFVKVNRLSKDGFNHPNRQ--NMIADYCYTNPT  61
            D LLLY+AI     G A   LF+L+ V       L+   +   N+Q    ++D C     
Sbjct  87   DSLLLYIAITHSYEGAAFQFLFILLLVA-----SLTPFAWRFANKQCAEEVSDRCPAGIN  141

Query  62   IVPGELLSRRG  72
             +P  L  R G
Sbjct  142  PLPQHLFRREG  152


>Q388N2_TRYB2 unnamed protein product
Length=472

 Score = 31.2 bits (69),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 14/57 (25%), Positives = 29/57 (51%), Gaps = 6/57 (11%)

Query  36   NRLSKDGFNHPNR------QNMIADYCYTNPTIVPGELLSRRGFSMYSGSENIDDDY  86
            ++++ D   HPNR        +I +  +++P  +PG   S+RG S  S   ++ + +
Sbjct  334  DKVTLDDLQHPNRFRDIPESGLICESLWSDPQPMPGRAPSKRGVSCLSFGPDVTETF  390


>Q54D12_DICDI unnamed protein product
Length=455

 Score = 27.3 bits (59),  Expect = 2.6, Method: Composition-based stats.
 Identities = 11/18 (61%), Positives = 13/18 (72%), Gaps = 0/18 (0%)

Query  48   RQNMIADYCYTNPTIVPG  65
            R+ MI D  YT PT+VPG
Sbjct  254  REQMIPDVEYTLPTLVPG  271


>M9MSI8_DROME unnamed protein product
Length=5075

 Score = 26.6 bits (57),  Expect = 5.4, Method: Composition-based stats.
 Identities = 15/37 (41%), Positives = 20/37 (54%), Gaps = 0/37 (0%)

Query  60    PTIVPGELLSRRGFSMYSGSENIDDDYRMKRDQSGTY  96
             PTI    LLS   F   S    +++D  +KRDQS +Y
Sbjct  1769  PTIQSMHLLSVVNFIHTSCIAKVNNDNILKRDQSLSY  1805


>M9MRP6_DROME unnamed protein product
Length=5095

 Score = 26.6 bits (57),  Expect = 5.4, Method: Composition-based stats.
 Identities = 15/37 (41%), Positives = 20/37 (54%), Gaps = 0/37 (0%)

Query  60    PTIVPGELLSRRGFSMYSGSENIDDDYRMKRDQSGTY  96
             PTI    LLS   F   S    +++D  +KRDQS +Y
Sbjct  1769  PTIQSMHLLSVVNFIHTSCIAKVNNDNILKRDQSLSY  1805



Lambda      K        H
   0.314    0.131    0.366 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1387782160


Query= XP_003392992.2 CWF19-like protein 1 [Bombus terrestris]

Length=527
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q57X52_TRYB2  unnamed protein product                                 31.6    1.9  
Q3S4X5_DROME  unnamed protein product                                 31.2    2.7  
Q38AF8_TRYB2  unnamed protein product                                 30.4    4.0  
CADE_DROME  unnamed protein product                                   29.6    7.8  
Q9W0F4_DROME  unnamed protein product                                 29.6    8.7  


>Q57X52_TRYB2 unnamed protein product
Length=926

 Score = 31.6 bits (70),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 32/63 (51%), Gaps = 7/63 (11%)

Query  22   KFLFNKIDAINKKSGPFDFLLCVGNFFGEDNTELED-YKSGMKSIPVPTYIIGANEEVDL  80
            K L ++IDA   + G  D L   G   GE N   ED Y+  M+S    T +  A EE+ L
Sbjct  428  KDLTSEIDA---RRGVIDKL--TGQL-GEANARNEDLYRKVMQSSEFSTQLRSATEEMQL  481

Query  81   NNY  83
            NN+
Sbjct  482  NNF  484


>Q3S4X5_DROME unnamed protein product
Length=973

 Score = 31.2 bits (69),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 46/175 (26%), Positives = 69/175 (39%), Gaps = 29/175 (17%)

Query  87   DGCEICQNLTYLGKRGLYTASSGLKIAYISGTENNSLEMKPTCFNENDVMSIKQACLKGQ  146
            D C + + L     RGL  A++ L I        N LE +  C     ++ +   C   Q
Sbjct  342  DVCRVLEQLIMAANRGLAQAAADLFI-----LRRNGLEGETFCQRVKHLLQLFIECGHEQ  396

Query  147  PNFRGIDIL----MTSPWPAYITNL--DPNKPNLK-YQGSKLIAWLTAQVKPRYHVSALE  199
             ++    ++    +   W + I  L  +P    L     S LIA L A VK        +
Sbjct  397  ADYLVDSLIDNCELVVDWKSMIAVLLENPKSHELSDIHCSSLIAILLAGVK--------Q  448

Query  200  GIYYERPPYR-----NRSLQEGSIEIATRFIALAPVVNSQKRKWLYALNLTPVDR  249
                E PP R      R  ++G+ E AT+   LAPV+    R   YA  L  ++R
Sbjct  449  ATTGEIPPGRYTKDLKREPRQGAQERATK--CLAPVLPELLRT--YANRLQVIER  499


>Q38AF8_TRYB2 unnamed protein product
Length=457

 Score = 30.4 bits (67),  Expect = 4.0, Method: Compositional matrix adjust.
 Identities = 24/87 (28%), Positives = 41/87 (47%), Gaps = 12/87 (14%)

Query  408  CQLQVVPIHKNQAAALKEAFEEMAQCNNFKISELPPHTDLQQIAQPGVLYFYAELPDRQK  467
            C+++V+P     AAA  +AFEE  +   F   +L   +  Q I   G L  ++  P+ Q 
Sbjct  331  CKVKVIP----DAAARMDAFEEKVRAAGFDARQLMCGSRGQGIYTIGCLLNHSCEPNLQV  386

Query  468  LYHRIKKDFPLHFGREVLASDRILDLD  494
            LY  +        G E L+ + + D++
Sbjct  387  LYTAV--------GDETLSIEALRDIE  405


>CADE_DROME unnamed protein product
Length=1507

 Score = 29.6 bits (65),  Expect = 7.8, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 27/57 (47%), Gaps = 5/57 (9%)

Query  403   FKTSHCQLQVVPIHKNQAAALKEAFEEMAQCNNFKIS-ELPPHTDLQQIAQPGVLYF  458
             F   HC+L  V  + +  A     +E +A CNN KIS E+ P  D   I   G L F
Sbjct  1118  FTGPHCELVSVAFYGSGYAF----YEPIAACNNTKISLEITPQIDQGLIMYLGPLNF  1170


>Q9W0F4_DROME unnamed protein product
Length=973

 Score = 29.6 bits (65),  Expect = 8.7, Method: Compositional matrix adjust.
 Identities = 47/176 (27%), Positives = 71/176 (40%), Gaps = 31/176 (18%)

Query  87   DGCEICQNLTYLGKRGLYTASSGLKIAYISGTENNSLEMKPTCFNENDVMSIKQACLKGQ  146
            D C + + L     RGL  A++ L I        N L+ +  C     ++ +   C   Q
Sbjct  342  DVCRVLEQLIMAANRGLAQAAADLFI-----LRRNGLDGETFCQRVKHLLQLFIECGHEQ  396

Query  147  PNFRGIDILMTS-----PWPAYITNL--DPNKPNLK-YQGSKLIAWLTAQVKPRYHVSAL  198
             ++  +D L+ +      W + I  L  +P    L     S LIA L A VK        
Sbjct  397  ADYL-VDSLIDNCELVLDWKSMIAVLLENPKSRELSDIHCSSLIAILLAGVK--------  447

Query  199  EGIYYERPPYR-----NRSLQEGSIEIATRFIALAPVVNSQKRKWLYALNLTPVDR  249
            +    E PP R      R  ++G+ E AT+   LAPV+    R   YA  L  ++R
Sbjct  448  QATAGEIPPGRYTKDLKREPRQGAQERATK--CLAPVLPELLRT--YANRLQDIER  499



Lambda      K        H
   0.314    0.131    0.366 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1387782160


Query= XP_003392993.1 probable methylthioribulose-1-phosphate dehydratase
[Bombus terrestris]

Length=233
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9PF12_DROME  unnamed protein product                                 32.7    0.24 
Q9GQQ6_DROME  unnamed protein product                                 32.7    0.25 
Q9VX41_DROME  unnamed protein product                                 32.7    0.25 
E1JJN6_DROME  unnamed protein product                                 32.7    0.25 
X2JE74_DROME  unnamed protein product                                 32.7    0.26 


>M9PF12_DROME unnamed protein product
Length=1162

 Score = 32.7 bits (73),  Expect = 0.24, Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 47/123 (38%), Gaps = 20/123 (16%)

Query  73    ELPPVEKRLKKSQCTPLFMCAYIRRNAGAVIHTHSKFAVMVTLHWPGKEFRVTHLEMIK-  131
             E PP E  L K   TP  +C           H              G+ F+V ++E +K 
Sbjct  895   ESPPKEP-LSKHNRTPKMIC-----------HVFESDEAQFIAQSIGQAFQVAYMEFLKA  942

Query  132   -GIRNQKLGKAYRYDEELVVPIIENTPFEEDLKDELEKAII---AYPETCAVLVRRHGVY  187
              GI N+ L K   Y E L    I     E   K EL+K ++   A  E   V++   G  
Sbjct  943   NGIENESLAKEMDYQEVLNSQEIFGDELEIFAKKELQKEVVVPKAKGEILGVVIVESG--  1000

Query  188   VWG  190
              WG
Sbjct  1001  -WG  1002


>Q9GQQ6_DROME unnamed protein product
Length=1168

 Score = 32.7 bits (73),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 47/123 (38%), Gaps = 20/123 (16%)

Query  73    ELPPVEKRLKKSQCTPLFMCAYIRRNAGAVIHTHSKFAVMVTLHWPGKEFRVTHLEMIK-  131
             E PP E  L K   TP  +C           H              G+ F+V ++E +K 
Sbjct  901   ESPPKEP-LSKHNRTPKMIC-----------HVFESDEAQFIAQSIGQAFQVAYMEFLKA  948

Query  132   -GIRNQKLGKAYRYDEELVVPIIENTPFEEDLKDELEKAII---AYPETCAVLVRRHGVY  187
              GI N+ L K   Y E L    I     E   K EL+K ++   A  E   V++   G  
Sbjct  949   NGIENESLAKEMDYQEVLNSQEIFGDELEIFAKKELQKEVVVPKAKGEILGVVIVESG--  1006

Query  188   VWG  190
              WG
Sbjct  1007  -WG  1008


>Q9VX41_DROME unnamed protein product
Length=1167

 Score = 32.7 bits (73),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 47/123 (38%), Gaps = 20/123 (16%)

Query  73    ELPPVEKRLKKSQCTPLFMCAYIRRNAGAVIHTHSKFAVMVTLHWPGKEFRVTHLEMIK-  131
             E PP E  L K   TP  +C           H              G+ F+V ++E +K 
Sbjct  900   ESPPKEP-LSKHNRTPKMIC-----------HVFESDEAQFIAQSIGQAFQVAYMEFLKA  947

Query  132   -GIRNQKLGKAYRYDEELVVPIIENTPFEEDLKDELEKAII---AYPETCAVLVRRHGVY  187
              GI N+ L K   Y E L    I     E   K EL+K ++   A  E   V++   G  
Sbjct  948   NGIENESLAKEMDYQEVLNSQEIFGDELEIFAKKELQKEVVVPKAKGEILGVVIVESG--  1005

Query  188   VWG  190
              WG
Sbjct  1006  -WG  1007


>E1JJN6_DROME unnamed protein product
Length=1168

 Score = 32.7 bits (73),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 47/123 (38%), Gaps = 20/123 (16%)

Query  73    ELPPVEKRLKKSQCTPLFMCAYIRRNAGAVIHTHSKFAVMVTLHWPGKEFRVTHLEMIK-  131
             E PP E  L K   TP  +C           H              G+ F+V ++E +K 
Sbjct  901   ESPPKEP-LSKHNRTPKMIC-----------HVFESDEAQFIAQSIGQAFQVAYMEFLKA  948

Query  132   -GIRNQKLGKAYRYDEELVVPIIENTPFEEDLKDELEKAII---AYPETCAVLVRRHGVY  187
              GI N+ L K   Y E L    I     E   K EL+K ++   A  E   V++   G  
Sbjct  949   NGIENESLAKEMDYQEVLNSQEIFGDELEIFAKKELQKEVVVPKAKGEILGVVIVESG--  1006

Query  188   VWG  190
              WG
Sbjct  1007  -WG  1008


>X2JE74_DROME unnamed protein product
Length=1170

 Score = 32.7 bits (73),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 47/123 (38%), Gaps = 20/123 (16%)

Query  73    ELPPVEKRLKKSQCTPLFMCAYIRRNAGAVIHTHSKFAVMVTLHWPGKEFRVTHLEMIK-  131
             E PP E  L K   TP  +C           H              G+ F+V ++E +K 
Sbjct  903   ESPPKEP-LSKHNRTPKMIC-----------HVFESDEAQFIAQSIGQAFQVAYMEFLKA  950

Query  132   -GIRNQKLGKAYRYDEELVVPIIENTPFEEDLKDELEKAII---AYPETCAVLVRRHGVY  187
              GI N+ L K   Y E L    I     E   K EL+K ++   A  E   V++   G  
Sbjct  951   NGIENESLAKEMDYQEVLNSQEIFGDELEIFAKKELQKEVVVPKAKGEILGVVIVESG--  1008

Query  188   VWG  190
              WG
Sbjct  1009  -WG  1010



Lambda      K        H
   0.314    0.131    0.366 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1387782160


Query= XP_003392994.1 COMM domain-containing protein 10 [Bombus terrestris]

Length=197
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q387A7_TRYB2  unnamed protein product                                 32.0    0.37 
Q7KK96_DROME  unnamed protein product                                 27.7    9.2  
Q8T0F9_DROME  unnamed protein product                                 27.3    9.6  


>Q387A7_TRYB2 unnamed protein product
Length=1008

 Score = 32.0 bits (71),  Expect = 0.37, Method: Composition-based stats.
 Identities = 17/52 (33%), Positives = 24/52 (46%), Gaps = 0/52 (0%)

Query  1     MASWITVTPRLERGLKIANQVDNSKFRLLINRICQTLQSAIDTKIFSEEEEE  52
             M SW  V PRL+R L+      +S F   + R+     S     + +EEE E
Sbjct  950   MGSWAYVRPRLQRLLRHLGMAGSSDFLPYVGRVTAASPSTGYATVHAEEEAE  1001


>Q7KK96_DROME unnamed protein product
Length=1179

 Score = 27.7 bits (60),  Expect = 9.2, Method: Compositional matrix adjust.
 Identities = 18/49 (37%), Positives = 29/49 (59%), Gaps = 3/49 (6%)

Query  149  KKDARPMSLLQLNLTGEEESKLTVEFDKKELIDLYHNLEKIQSQLDAFK  197
            KK  +    LQL +T   E + ++E  KK+  ++  NLEK +++LDA K
Sbjct  811  KKREQEFETLQLEIT---ELQKSIETAKKQHQEMIDNLEKFKAELDALK  856


>Q8T0F9_DROME unnamed protein product
Length=985

 Score = 27.3 bits (59),  Expect = 9.6, Method: Compositional matrix adjust.
 Identities = 18/49 (37%), Positives = 29/49 (59%), Gaps = 3/49 (6%)

Query  149  KKDARPMSLLQLNLTGEEESKLTVEFDKKELIDLYHNLEKIQSQLDAFK  197
            KK  +    LQL +T   E + ++E  KK+  ++  NLEK +++LDA K
Sbjct  617  KKREQEFETLQLEIT---ELQKSIETAKKQHQEMIDNLEKFKAELDALK  662



Lambda      K        H
   0.314    0.131    0.366 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1387782160


Query= XP_003392995.2 ankyrin repeat domain-containing protein 16 [Bombus
terrestris]

Length=272
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

G5ECZ1_CAEEL  unnamed protein product                                 115     1e-28
Q8MQG0_CAEEL  unnamed protein product                                 115     1e-28
Q17490_CAEEL  unnamed protein product                                 113     6e-28
SECG_DICDI  unnamed protein product                                   100     2e-23
Q24241_DROME  unnamed protein product                                 100     2e-23


>G5ECZ1_CAEEL unnamed protein product
Length=1867

 Score = 115 bits (287),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 76/232 (33%), Positives = 124/232 (53%), Gaps = 9/232 (4%)

Query  40   TTSGDTALHLATREGHLNIVRYLCENFKKPDFRVNVASRDMKRPLHEAAQFARSDILKYL  99
            T  G T LHLA++ G+L +VR L E        V++  ++   PLH AA +    +   L
Sbjct  554  TKKGFTPLHLASKYGNLEVVRLLLERGTP----VDIEGKNQVTPLHVAAHYNNDKVAMLL  609

Query  100  IEKGADVDALKRADWTPLMLACTKTGSDAYKCIVALLEAKANPLLRNKDGWTSLHLVCRS  159
            +E GA   A  +  +TPL +A  K   +  +    LL+ KA+P  +++ G+T LHL  + 
Sbjct  610  LENGASAKAAAKNGYTPLHIAAKK---NQMEIASTLLQFKADPNAKSRAGFTPLHLSAQE  666

Query  160  GDENAFDLLVNKFVERIDDRSNNGRSVMHIAAFHGHEGLVNRLMALNTKLLNARDSSGST  219
            G +    LL+    + +  ++NNG + MH+ A   H   V +++  N   +N++ ++G T
Sbjct  667  GHKEISGLLIENGSD-VGAKANNGLTAMHLCAQEDHVP-VAQILYNNGAEINSKTNAGYT  724

Query  220  PLHEAVKGGHLSVAKRLIDLGADVEAKDNASQTILHIAAVIGNTEAIKAILK  271
            PLH A   G L++ K L++ GADV  K  AS T LH AA  G+   ++ +L+
Sbjct  725  PLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLE  776


 Score = 106 bits (264),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 75/225 (33%), Positives = 116/225 (52%), Gaps = 9/225 (4%)

Query  40   TTSGDTALHLATREGHLNIVRYLCENFKKPDFRVNVASRDMKRPLHEAAQFARSDILKYL  99
            T  G+T LHLA R    ++VR L  N  K    V+  +R+++ PLH A++   +DI+  L
Sbjct  455  TVRGETPLHLAARANQTDVVRVLIRNGAK----VDAQARELQTPLHIASRLGNTDIVILL  510

Query  100  IEKGADVDALKRADWTPLMLACTKTGSDAYKCIVALLEAKANPLLRNKDGWTSLHLVCRS  159
            ++ GA+ +A  R +++PL +A  K G +    I  LL+  A+  L  K G+T LHL  + 
Sbjct  511  LQAGANSNATTRDNYSPLHIAA-KEGQEEVAGI--LLDHNADKTLLTKKGFTPLHLASKY  567

Query  160  GDENAFDLLVNKFVERIDDRSNNGRSVMHIAAFHGHEGLVNRLMALNTKLLNARDSSGST  219
            G+     LL+ +    +D    N  + +H+AA H +   V  L+  N     A   +G T
Sbjct  568  GNLEVVRLLLERGTP-VDIEGKNQVTPLHVAA-HYNNDKVAMLLLENGASAKAAAKNGYT  625

Query  220  PLHEAVKGGHLSVAKRLIDLGADVEAKDNASQTILHIAAVIGNTE  264
            PLH A K   + +A  L+   AD  AK  A  T LH++A  G+ E
Sbjct  626  PLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKE  670


 Score = 88.6 bits (218),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 80/267 (30%), Positives = 126/267 (47%), Gaps = 19/267 (7%)

Query  7    SRNFLHACQNGDLSRV-ETLVSKHDIQDWTHFRHTTSGDTALHLATREGHLNIVRYLCEN  65
            S +FL A + GDL +V E L +  DI          +G  +LHLA++EGH  +VR L   
Sbjct  34   SASFLRAARAGDLEKVLELLRAGTDINT-----SNANGLNSLHLASKEGHSEVVRELI--  86

Query  66   FKKPDFRVNVASRDMKRPLHEAAQFARSDILKYLIEKGADVDALKRADWTPLMLACTKTG  125
              K   +V+ A+R     LH A+   +S I+  L+E GA+V+      +TPL +A  +  
Sbjct  87   --KRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENH  144

Query  126  SDAYKCIVALLEAKANPLLRNKDGWTSLHLVCRSGDENAFDLLVNKFVERIDDRSNNGRS  185
             +  K    LL+  AN  L  +DG+T L +  + G +    +L+       D +      
Sbjct  145  EEVVKY---LLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLEN-----DSKGKVRLP  196

Query  186  VMHIAAFHGHEGLVNRLMALNTKLLNARDSSGSTPLHEAVKGGHLSVAKRLIDLGADVEA  245
             +HIAA    +     L+  N    +    SG TPLH A   GH +V + L++ GA+V  
Sbjct  197  ALHIAA-KKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNY  255

Query  246  KDNASQTILHIAAVIGNTEAIKAILKK  272
            +   + + LH+A   G T     +L +
Sbjct  256  QARHNISPLHVATKWGRTNMANLLLSR  282


 Score = 86.3 bits (212),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 72/231 (31%), Positives = 111/231 (48%), Gaps = 17/231 (7%)

Query  45   TALHLATREGHLNIVRYLCENFKKPDFRVNVASRDMKRPLHEAAQFARSDILKYLIEKGA  104
            T LH A R GH  +V  L          ++  +++   PLH AAQ    D  + L+   A
Sbjct  295  TPLHCAARSGHDQVVDLLVVQGAP----ISAKTKNGLAPLHMAAQGDHVDAARTLLYHRA  350

Query  105  DVDALKRADWTPLMLA--CTKTGSDAYKCIVALLEAKANPLLRNKDGWTSLHLVCRSGDE  162
             VD +     TPL +A  C        +    LL+  A+P  R  +G+T LH+ C+    
Sbjct  351  PVDDVTVDYLTPLHVAAHCGHV-----RVAKLLLDRSADPNSRALNGFTPLHIACKKNRI  405

Query  163  NAFDLLVNKFVERIDDRSNNGRSVMHIAAFHGHEGLVNRLM--ALNTKLLNARDSSGSTP  220
               +LL+ K+   I+  + +G + +H+AAF G   +V  L+    N  +   R   G TP
Sbjct  406  KVVELLL-KYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVR---GETP  461

Query  221  LHEAVKGGHLSVAKRLIDLGADVEAKDNASQTILHIAAVIGNTEAIKAILK  271
            LH A +     V + LI  GA V+A+    QT LHIA+ +GNT+ +  +L+
Sbjct  462  LHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQ  512


 Score = 82.8 bits (203),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 72/236 (31%), Positives = 121/236 (51%), Gaps = 15/236 (6%)

Query  40   TTSGDTALHLATREGHLNIVRYLCENFKKPDFRVNVASRDMKRPLHEAAQFARSDILKYL  99
            + SG T LH+A   GH N+ + L E        VN  +R    PLH A ++ R+++   L
Sbjct  224  SKSGFTPLHIAAHYGHENVGQLLLEK----GANVNYQARHNISPLHVATKWGRTNMANLL  279

Query  100  IEKGADVDALKRADWTPLMLACTKTGSDAYKCIVALLEAKANPL-LRNKDGWTSLHLVCR  158
            + +GA +D+  +   TPL  A  ++G D    +V LL  +  P+  + K+G   LH+  +
Sbjct  280  LSRGAIIDSRTKDLLTPLHCAA-RSGHDQ---VVDLLVVQGAPISAKTKNGLAPLHMAAQ  335

Query  159  SGD--ENAFDLLVNKFVERIDDRSNNGRSVMHIAAFHGHEGLVNRLMALNTKLLNARDSS  216
             GD  + A  LL ++    +DD + +  + +H+AA  GH   V +L+   +   N+R  +
Sbjct  336  -GDHVDAARTLLYHR--APVDDVTVDYLTPLHVAAHCGHV-RVAKLLLDRSADPNSRALN  391

Query  217  GSTPLHEAVKGGHLSVAKRLIDLGADVEAKDNASQTILHIAAVIGNTEAIKAILKK  272
            G TPLH A K   + V + L+   A +EA   +  T LH+AA +G    +  +L++
Sbjct  392  GFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQ  447


 Score = 78.2 bits (191),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 63/228 (28%), Positives = 109/228 (48%), Gaps = 9/228 (4%)

Query  45   TALHLATREGHLNIVRYLCENFKKPDFRVNVASRDMKRPLHEAAQFARSDILKYLIEKGA  104
            T LH+A   GH+ + + L +    P+ R    + +   PLH A +  R  +++ L++  A
Sbjct  361  TPLHVAAHCGHVRVAKLLLDRSADPNSR----ALNGFTPLHIACKKNRIKVVELLLKYRA  416

Query  105  DVDALKRADWTPLMLACTKTGSDAYKCIVALLEAKANPLLRNKDGWTSLHLVCRSGDENA  164
             ++A   +  TPL +A       A   ++ LL+  ANP +    G T LHL  R+   + 
Sbjct  417  AIEATTESGLTPLHVAAFM---GAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDV  473

Query  165  FDLLVNKFVERIDDRSNNGRSVMHIAAFHGHEGLVNRLMALNTKLLNARDSSGSTPLHEA  224
              +L+     ++D ++   ++ +HIA+  G+  +V  L+       NA      +PLH A
Sbjct  474  VRVLIRNGA-KVDAQARELQTPLHIASRLGNTDIVILLLQAGANS-NATTRDNYSPLHIA  531

Query  225  VKGGHLSVAKRLIDLGADVEAKDNASQTILHIAAVIGNTEAIKAILKK  272
             K G   VA  L+D  AD         T LH+A+  GN E ++ +L++
Sbjct  532  AKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLER  579


 Score = 53.5 bits (127),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 44/81 (54%), Gaps = 4/81 (5%)

Query  40   TTSGDTALHLATREGHLNIVRYLCENFKKPDFRVNVASRDMKRPLHEAAQFARSDILKYL  99
            T +G T LH+A   G LN+V++L EN       V   +R    PLH+AAQ   ++ ++YL
Sbjct  719  TNAGYTPLHVACHFGQLNMVKFLVENGAD----VGEKTRASYTPLHQAAQQGHNNCVRYL  774

Query  100  IEKGADVDALKRADWTPLMLA  120
            +E GA  +       TPL +A
Sbjct  775  LENGASPNEQTATGQTPLSIA  795


>Q8MQG0_CAEEL unnamed protein product
Length=1841

 Score = 115 bits (287),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 76/232 (33%), Positives = 124/232 (53%), Gaps = 9/232 (4%)

Query  40   TTSGDTALHLATREGHLNIVRYLCENFKKPDFRVNVASRDMKRPLHEAAQFARSDILKYL  99
            T  G T LHLA++ G+L +VR L E        V++  ++   PLH AA +    +   L
Sbjct  554  TKKGFTPLHLASKYGNLEVVRLLLERGTP----VDIEGKNQVTPLHVAAHYNNDKVAMLL  609

Query  100  IEKGADVDALKRADWTPLMLACTKTGSDAYKCIVALLEAKANPLLRNKDGWTSLHLVCRS  159
            +E GA   A  +  +TPL +A  K   +  +    LL+ KA+P  +++ G+T LHL  + 
Sbjct  610  LENGASAKAAAKNGYTPLHIAAKK---NQMEIASTLLQFKADPNAKSRAGFTPLHLSAQE  666

Query  160  GDENAFDLLVNKFVERIDDRSNNGRSVMHIAAFHGHEGLVNRLMALNTKLLNARDSSGST  219
            G +    LL+    + +  ++NNG + MH+ A   H   V +++  N   +N++ ++G T
Sbjct  667  GHKEISGLLIENGSD-VGAKANNGLTAMHLCAQEDHVP-VAQILYNNGAEINSKTNAGYT  724

Query  220  PLHEAVKGGHLSVAKRLIDLGADVEAKDNASQTILHIAAVIGNTEAIKAILK  271
            PLH A   G L++ K L++ GADV  K  AS T LH AA  G+   ++ +L+
Sbjct  725  PLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLE  776


 Score = 106 bits (264),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 75/225 (33%), Positives = 116/225 (52%), Gaps = 9/225 (4%)

Query  40   TTSGDTALHLATREGHLNIVRYLCENFKKPDFRVNVASRDMKRPLHEAAQFARSDILKYL  99
            T  G+T LHLA R    ++VR L  N  K    V+  +R+++ PLH A++   +DI+  L
Sbjct  455  TVRGETPLHLAARANQTDVVRVLIRNGAK----VDAQARELQTPLHIASRLGNTDIVILL  510

Query  100  IEKGADVDALKRADWTPLMLACTKTGSDAYKCIVALLEAKANPLLRNKDGWTSLHLVCRS  159
            ++ GA+ +A  R +++PL +A  K G +    I  LL+  A+  L  K G+T LHL  + 
Sbjct  511  LQAGANSNATTRDNYSPLHIAA-KEGQEEVAGI--LLDHNADKTLLTKKGFTPLHLASKY  567

Query  160  GDENAFDLLVNKFVERIDDRSNNGRSVMHIAAFHGHEGLVNRLMALNTKLLNARDSSGST  219
            G+     LL+ +    +D    N  + +H+AA H +   V  L+  N     A   +G T
Sbjct  568  GNLEVVRLLLERGTP-VDIEGKNQVTPLHVAA-HYNNDKVAMLLLENGASAKAAAKNGYT  625

Query  220  PLHEAVKGGHLSVAKRLIDLGADVEAKDNASQTILHIAAVIGNTE  264
            PLH A K   + +A  L+   AD  AK  A  T LH++A  G+ E
Sbjct  626  PLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKE  670


 Score = 88.6 bits (218),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 80/267 (30%), Positives = 126/267 (47%), Gaps = 19/267 (7%)

Query  7    SRNFLHACQNGDLSRV-ETLVSKHDIQDWTHFRHTTSGDTALHLATREGHLNIVRYLCEN  65
            S +FL A + GDL +V E L +  DI          +G  +LHLA++EGH  +VR L   
Sbjct  34   SASFLRAARAGDLEKVLELLRAGTDINT-----SNANGLNSLHLASKEGHSEVVRELI--  86

Query  66   FKKPDFRVNVASRDMKRPLHEAAQFARSDILKYLIEKGADVDALKRADWTPLMLACTKTG  125
              K   +V+ A+R     LH A+   +S I+  L+E GA+V+      +TPL +A  +  
Sbjct  87   --KRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENH  144

Query  126  SDAYKCIVALLEAKANPLLRNKDGWTSLHLVCRSGDENAFDLLVNKFVERIDDRSNNGRS  185
             +  K    LL+  AN  L  +DG+T L +  + G +    +L+       D +      
Sbjct  145  EEVVKY---LLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLEN-----DSKGKVRLP  196

Query  186  VMHIAAFHGHEGLVNRLMALNTKLLNARDSSGSTPLHEAVKGGHLSVAKRLIDLGADVEA  245
             +HIAA    +     L+  N    +    SG TPLH A   GH +V + L++ GA+V  
Sbjct  197  ALHIAA-KKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNY  255

Query  246  KDNASQTILHIAAVIGNTEAIKAILKK  272
            +   + + LH+A   G T     +L +
Sbjct  256  QARHNISPLHVATKWGRTNMANLLLSR  282


 Score = 86.3 bits (212),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 72/231 (31%), Positives = 111/231 (48%), Gaps = 17/231 (7%)

Query  45   TALHLATREGHLNIVRYLCENFKKPDFRVNVASRDMKRPLHEAAQFARSDILKYLIEKGA  104
            T LH A R GH  +V  L          ++  +++   PLH AAQ    D  + L+   A
Sbjct  295  TPLHCAARSGHDQVVDLLVVQGAP----ISAKTKNGLAPLHMAAQGDHVDAARTLLYHRA  350

Query  105  DVDALKRADWTPLMLA--CTKTGSDAYKCIVALLEAKANPLLRNKDGWTSLHLVCRSGDE  162
             VD +     TPL +A  C        +    LL+  A+P  R  +G+T LH+ C+    
Sbjct  351  PVDDVTVDYLTPLHVAAHCGHV-----RVAKLLLDRSADPNSRALNGFTPLHIACKKNRI  405

Query  163  NAFDLLVNKFVERIDDRSNNGRSVMHIAAFHGHEGLVNRLM--ALNTKLLNARDSSGSTP  220
               +LL+ K+   I+  + +G + +H+AAF G   +V  L+    N  +   R   G TP
Sbjct  406  KVVELLL-KYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVR---GETP  461

Query  221  LHEAVKGGHLSVAKRLIDLGADVEAKDNASQTILHIAAVIGNTEAIKAILK  271
            LH A +     V + LI  GA V+A+    QT LHIA+ +GNT+ +  +L+
Sbjct  462  LHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQ  512


 Score = 83.2 bits (204),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 72/236 (31%), Positives = 121/236 (51%), Gaps = 15/236 (6%)

Query  40   TTSGDTALHLATREGHLNIVRYLCENFKKPDFRVNVASRDMKRPLHEAAQFARSDILKYL  99
            + SG T LH+A   GH N+ + L E        VN  +R    PLH A ++ R+++   L
Sbjct  224  SKSGFTPLHIAAHYGHENVGQLLLEKGAN----VNYQARHNISPLHVATKWGRTNMANLL  279

Query  100  IEKGADVDALKRADWTPLMLACTKTGSDAYKCIVALLEAKANPL-LRNKDGWTSLHLVCR  158
            + +GA +D+  +   TPL  A  ++G D    +V LL  +  P+  + K+G   LH+  +
Sbjct  280  LSRGAIIDSRTKDLLTPLHCAA-RSGHDQ---VVDLLVVQGAPISAKTKNGLAPLHMAAQ  335

Query  159  SGD--ENAFDLLVNKFVERIDDRSNNGRSVMHIAAFHGHEGLVNRLMALNTKLLNARDSS  216
             GD  + A  LL ++    +DD + +  + +H+AA  GH   V +L+   +   N+R  +
Sbjct  336  -GDHVDAARTLLYHR--APVDDVTVDYLTPLHVAAHCGHV-RVAKLLLDRSADPNSRALN  391

Query  217  GSTPLHEAVKGGHLSVAKRLIDLGADVEAKDNASQTILHIAAVIGNTEAIKAILKK  272
            G TPLH A K   + V + L+   A +EA   +  T LH+AA +G    +  +L++
Sbjct  392  GFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQ  447


 Score = 78.6 bits (192),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 63/228 (28%), Positives = 109/228 (48%), Gaps = 9/228 (4%)

Query  45   TALHLATREGHLNIVRYLCENFKKPDFRVNVASRDMKRPLHEAAQFARSDILKYLIEKGA  104
            T LH+A   GH+ + + L +    P+ R    + +   PLH A +  R  +++ L++  A
Sbjct  361  TPLHVAAHCGHVRVAKLLLDRSADPNSR----ALNGFTPLHIACKKNRIKVVELLLKYRA  416

Query  105  DVDALKRADWTPLMLACTKTGSDAYKCIVALLEAKANPLLRNKDGWTSLHLVCRSGDENA  164
             ++A   +  TPL +A       A   ++ LL+  ANP +    G T LHL  R+   + 
Sbjct  417  AIEATTESGLTPLHVAAFM---GAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDV  473

Query  165  FDLLVNKFVERIDDRSNNGRSVMHIAAFHGHEGLVNRLMALNTKLLNARDSSGSTPLHEA  224
              +L+     ++D ++   ++ +HIA+  G+  +V  L+       NA      +PLH A
Sbjct  474  VRVLIRNGA-KVDAQARELQTPLHIASRLGNTDIVILLLQAGANS-NATTRDNYSPLHIA  531

Query  225  VKGGHLSVAKRLIDLGADVEAKDNASQTILHIAAVIGNTEAIKAILKK  272
             K G   VA  L+D  AD         T LH+A+  GN E ++ +L++
Sbjct  532  AKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLER  579


 Score = 53.5 bits (127),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 44/81 (54%), Gaps = 4/81 (5%)

Query  40   TTSGDTALHLATREGHLNIVRYLCENFKKPDFRVNVASRDMKRPLHEAAQFARSDILKYL  99
            T +G T LH+A   G LN+V++L EN       V   +R    PLH+AAQ   ++ ++YL
Sbjct  719  TNAGYTPLHVACHFGQLNMVKFLVENGAD----VGEKTRASYTPLHQAAQQGHNNCVRYL  774

Query  100  IEKGADVDALKRADWTPLMLA  120
            +E GA  +       TPL +A
Sbjct  775  LENGASPNEQTATGQTPLSIA  795


>Q17490_CAEEL unnamed protein product
Length=6994

 Score = 113 bits (282),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 76/232 (33%), Positives = 124/232 (53%), Gaps = 9/232 (4%)

Query  40   TTSGDTALHLATREGHLNIVRYLCENFKKPDFRVNVASRDMKRPLHEAAQFARSDILKYL  99
            T  G T LHLA++ G+L +VR L E        V++  ++   PLH AA +    +   L
Sbjct  554  TKKGFTPLHLASKYGNLEVVRLLLERGTP----VDIEGKNQVTPLHVAAHYNNDKVAMLL  609

Query  100  IEKGADVDALKRADWTPLMLACTKTGSDAYKCIVALLEAKANPLLRNKDGWTSLHLVCRS  159
            +E GA   A  +  +TPL +A  K   +  +    LL+ KA+P  +++ G+T LHL  + 
Sbjct  610  LENGASAKAAAKNGYTPLHIAAKK---NQMEIASTLLQFKADPNAKSRAGFTPLHLSAQE  666

Query  160  GDENAFDLLVNKFVERIDDRSNNGRSVMHIAAFHGHEGLVNRLMALNTKLLNARDSSGST  219
            G +    LL+    + +  ++NNG + MH+ A   H   V +++  N   +N++ ++G T
Sbjct  667  GHKEISGLLIENGSD-VGAKANNGLTAMHLCAQEDHVP-VAQILYNNGAEINSKTNAGYT  724

Query  220  PLHEAVKGGHLSVAKRLIDLGADVEAKDNASQTILHIAAVIGNTEAIKAILK  271
            PLH A   G L++ K L++ GADV  K  AS T LH AA  G+   ++ +L+
Sbjct  725  PLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLE  776


 Score = 106 bits (264),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 75/225 (33%), Positives = 116/225 (52%), Gaps = 9/225 (4%)

Query  40   TTSGDTALHLATREGHLNIVRYLCENFKKPDFRVNVASRDMKRPLHEAAQFARSDILKYL  99
            T  G+T LHLA R    ++VR L  N  K    V+  +R+++ PLH A++   +DI+  L
Sbjct  455  TVRGETPLHLAARANQTDVVRVLIRNGAK----VDAQARELQTPLHIASRLGNTDIVILL  510

Query  100  IEKGADVDALKRADWTPLMLACTKTGSDAYKCIVALLEAKANPLLRNKDGWTSLHLVCRS  159
            ++ GA+ +A  R +++PL +A  K G +    I  LL+  A+  L  K G+T LHL  + 
Sbjct  511  LQAGANSNATTRDNYSPLHIA-AKEGQEEVAGI--LLDHNADKTLLTKKGFTPLHLASKY  567

Query  160  GDENAFDLLVNKFVERIDDRSNNGRSVMHIAAFHGHEGLVNRLMALNTKLLNARDSSGST  219
            G+     LL+ +    +D    N  + +H+AA H +   V  L+  N     A   +G T
Sbjct  568  GNLEVVRLLLERGTP-VDIEGKNQVTPLHVAA-HYNNDKVAMLLLENGASAKAAAKNGYT  625

Query  220  PLHEAVKGGHLSVAKRLIDLGADVEAKDNASQTILHIAAVIGNTE  264
            PLH A K   + +A  L+   AD  AK  A  T LH++A  G+ E
Sbjct  626  PLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKE  670


 Score = 92.8 bits (229),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 80/267 (30%), Positives = 126/267 (47%), Gaps = 19/267 (7%)

Query  7    SRNFLHACQNGDLSRV-ETLVSKHDIQDWTHFRHTTSGDTALHLATREGHLNIVRYLCEN  65
            S +FL A + GDL +V E L +  DI          +G  +LHLA++EGH  +VR L   
Sbjct  34   SASFLRAARAGDLEKVLELLRAGTDINT-----SNANGLNSLHLASKEGHSEVVRELI--  86

Query  66   FKKPDFRVNVASRDMKRPLHEAAQFARSDILKYLIEKGADVDALKRADWTPLMLACTKTG  125
              K   +V+ A+R     LH A+   +S I+  L+E GA+V+      +TPL +A  +  
Sbjct  87   --KRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENH  144

Query  126  SDAYKCIVALLEAKANPLLRNKDGWTSLHLVCRSGDENAFDLLVNKFVERIDDRSNNGRS  185
             +  K    LL+  AN  L  +DG+T L +  + G +    +L+       D +      
Sbjct  145  EEVVK---YLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLEN-----DSKGKVRLP  196

Query  186  VMHIAAFHGHEGLVNRLMALNTKLLNARDSSGSTPLHEAVKGGHLSVAKRLIDLGADVEA  245
             +HIAA    +     L+  N    +    SG TPLH A   GH +V + L++ GA+V  
Sbjct  197  ALHIAA-KKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNY  255

Query  246  KDNASQTILHIAAVIGNTEAIKAILKK  272
            +   + + LH+A   G T     +L +
Sbjct  256  QARHNISPLHVATKWGRTNMANLLLSR  282


 Score = 87.0 bits (214),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 74/266 (28%), Positives = 119/266 (45%), Gaps = 43/266 (16%)

Query  38   RHTTSGDTALHLATREGHLNIVRYLCENFKKPDFRVNVASRDMKRPLHEAAQFARSDILK  97
            RH  S    LH+AT+ G  N+   L       D R    ++D+  PLH AA+     ++ 
Sbjct  258  RHNIS---PLHVATKWGRTNMANLLLSRGAIIDSR----TKDLLTPLHCAARSGHDQVVD  310

Query  98   YLIEKGADVDALKRADWTPLMLACTKTGSDAYKCIV------------------------  133
             L+ +GA + A  +    PL +A      DA + ++                        
Sbjct  311  LLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCG  370

Query  134  ------ALLEAKANPLLRNKDGWTSLHLVCRSGDENAFDLLVNKFVERIDDRSNNGRSVM  187
                   LL+  A+P  R  +G+T LH+ C+       +LL+ K+   I+  + +G + +
Sbjct  371  HVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLL-KYRAAIEATTESGLTPL  429

Query  188  HIAAFHGHEGLVNRLM--ALNTKLLNARDSSGSTPLHEAVKGGHLSVAKRLIDLGADVEA  245
            H+AAF G   +V  L+    N  +   R   G TPLH A +     V + LI  GA V+A
Sbjct  430  HVAAFMGAINIVIYLLQQGANPDVETVR---GETPLHLAARANQTDVVRVLIRNGAKVDA  486

Query  246  KDNASQTILHIAAVIGNTEAIKAILK  271
            +    QT LHIA+ +GNT+ +  +L+
Sbjct  487  QARELQTPLHIASRLGNTDIVILLLQ  512


 Score = 85.1 bits (209),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 72/236 (31%), Positives = 121/236 (51%), Gaps = 15/236 (6%)

Query  40   TTSGDTALHLATREGHLNIVRYLCENFKKPDFRVNVASRDMKRPLHEAAQFARSDILKYL  99
            + SG T LH+A   GH N+ + L E        VN  +R    PLH A ++ R+++   L
Sbjct  224  SKSGFTPLHIAAHYGHENVGQLLLEK----GANVNYQARHNISPLHVATKWGRTNMANLL  279

Query  100  IEKGADVDALKRADWTPLMLACTKTGSDAYKCIVALLEAKANPL-LRNKDGWTSLHLVCR  158
            + +GA +D+  +   TPL  A  ++G D    +V LL  +  P+  + K+G   LH+  +
Sbjct  280  LSRGAIIDSRTKDLLTPLHCA-ARSGHDQ---VVDLLVVQGAPISAKTKNGLAPLHMAAQ  335

Query  159  SGD--ENAFDLLVNKFVERIDDRSNNGRSVMHIAAFHGHEGLVNRLMALNTKLLNARDSS  216
             GD  + A  LL ++    +DD + +  + +H+AA  GH   V +L+   +   N+R  +
Sbjct  336  -GDHVDAARTLLYHR--APVDDVTVDYLTPLHVAAHCGHV-RVAKLLLDRSADPNSRALN  391

Query  217  GSTPLHEAVKGGHLSVAKRLIDLGADVEAKDNASQTILHIAAVIGNTEAIKAILKK  272
            G TPLH A K   + V + L+   A +EA   +  T LH+AA +G    +  +L++
Sbjct  392  GFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQ  447


 Score = 79.7 bits (195),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 63/228 (28%), Positives = 109/228 (48%), Gaps = 9/228 (4%)

Query  45   TALHLATREGHLNIVRYLCENFKKPDFRVNVASRDMKRPLHEAAQFARSDILKYLIEKGA  104
            T LH+A   GH+ + + L +    P+ R    + +   PLH A +  R  +++ L++  A
Sbjct  361  TPLHVAAHCGHVRVAKLLLDRSADPNSR----ALNGFTPLHIACKKNRIKVVELLLKYRA  416

Query  105  DVDALKRADWTPLMLACTKTGSDAYKCIVALLEAKANPLLRNKDGWTSLHLVCRSGDENA  164
             ++A   +  TPL +A       A   ++ LL+  ANP +    G T LHL  R+   + 
Sbjct  417  AIEATTESGLTPLHVAAFM---GAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDV  473

Query  165  FDLLVNKFVERIDDRSNNGRSVMHIAAFHGHEGLVNRLMALNTKLLNARDSSGSTPLHEA  224
              +L+     ++D ++   ++ +HIA+  G+  +V  L+       NA      +PLH A
Sbjct  474  VRVLIRNGA-KVDAQARELQTPLHIASRLGNTDIVILLLQAGANS-NATTRDNYSPLHIA  531

Query  225  VKGGHLSVAKRLIDLGADVEAKDNASQTILHIAAVIGNTEAIKAILKK  272
             K G   VA  L+D  AD         T LH+A+  GN E ++ +L++
Sbjct  532  AKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLER  579


 Score = 51.2 bits (121),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 30/81 (37%), Positives = 44/81 (54%), Gaps = 4/81 (5%)

Query  40   TTSGDTALHLATREGHLNIVRYLCENFKKPDFRVNVASRDMKRPLHEAAQFARSDILKYL  99
            T +G T LH+A   G LN+V++L EN       V   +R    PLH+AAQ   ++ ++YL
Sbjct  719  TNAGYTPLHVACHFGQLNMVKFLVENGAD----VGEKTRASYTPLHQAAQQGHNNCVRYL  774

Query  100  IEKGADVDALKRADWTPLMLA  120
            +E GA  +       TPL +A
Sbjct  775  LENGASPNEQTATGQTPLSIA  795


 Score = 30.4 bits (67),  Expect = 2.2, Method: Composition-based stats.
 Identities = 14/58 (24%), Positives = 28/58 (48%), Gaps = 0/58 (0%)

Query  215  SSGSTPLHEAVKGGHLSVAKRLIDLGADVEAKDNASQTILHIAAVIGNTEAIKAILKK  272
            + GS     A + G L     L+  G D+   +      LH+A+  G++E ++ ++K+
Sbjct  31   AEGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKR  88


>SECG_DICDI unnamed protein product
Length=986

 Score = 100 bits (248),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 75/230 (33%), Positives = 114/230 (50%), Gaps = 8/230 (3%)

Query  41   TSGDTALHLATREGHLNIVRYLCENFKKPDFRVNVASRDMKRPLHEAAQFARSDILKYLI  100
            ++G+T L  A+  GHL  ++ L E   K    VN        PLH+A+ FA ++ + YL+
Sbjct  100  SAGNTPLQWASSRGHLECIKLLVE---KGGVDVNTKDDKNGTPLHKASLFASAECVLYLL  156

Query  101  EKGADVDALKRADWTPLMLACTKTGSDAYKCIVALLEAKANPLLRNKDGWTSLHLVCRSG  160
               AD  A+     TPL  A   +     +C+  L++A +     + D  T LH    SG
Sbjct  157  NGKADPRAVTTNGETPLHHA---SAGGNPQCVELLIKADSKVNAVDNDCITPLHQASFSG  213

Query  161  DENAFDLLVNKFVERIDDRSNNGRSVMHIAAFHGHEGLVNRLMALNTKLLNARDSSGSTP  220
              +   LL+ K   ++D R  +G S +H AA  G+   V +L+  N + +N  D  G TP
Sbjct  214  HSSCVSLLLKKGA-KVDPRDIHGISPLHNAASAGYVDCVEQLVR-NGENINCVDIEGVTP  271

Query  221  LHEAVKGGHLSVAKRLIDLGADVEAKDNASQTILHIAAVIGNTEAIKAIL  270
            LH     G+L + KRLI+LGA +   D   +T LH AA  G+ E  + +L
Sbjct  272  LHHTCFNGNLQLTKRLIELGAKINMVDEMGETPLHKAAFNGHKEVCEYLL  321


 Score = 92.8 bits (229),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 73/236 (31%), Positives = 112/236 (47%), Gaps = 14/236 (6%)

Query  40   TTSGDTALHLATREGHLNIVRYLCENFKKPDFRVNVASRDMKRPLHEAAQFARSDILKYL  99
            TT+G+T LH A+  G+   V  L     K D +VN    D   PLH+A+    S  +  L
Sbjct  166  TTNGETPLHHASAGGNPQCVELLI----KADSKVNAVDNDCITPLHQASFSGHSSCVSLL  221

Query  100  IEKGADVDALKRADWTPLMLACTKTGSDAYKCIVALLEAKANPLLRNKDGWTSLHLVCRS  159
            ++KGA VD       +PL  A +    D   C+  L+    N    + +G T LH  C +
Sbjct  222  LKKGAKVDPRDIHGISPLHNAASAGYVD---CVEQLVRNGENINCVDIEGVTPLHHTCFN  278

Query  160  GDENAFDLLVNKFVE---RIDDRSNNGRSVMHIAAFHGHEGLVNRLMALNTKLLNARDSS  216
            G+      L  + +E   +I+     G + +H AAF+GH+ +   L+ L+  +++ RDS 
Sbjct  279  GNLQ----LTKRLIELGAKINMVDEMGETPLHKAAFNGHKEVCEYLLYLDPTMIDCRDSR  334

Query  217  GSTPLHEAVKGGHLSVAKRLIDLGADVEAKDNASQTILHIAAVIGNTEAIKAILKK  272
             ST LH A   G L +   LI   A +  KD    T LH A+  G++   K ++ K
Sbjct  335  QSTSLHLAAFNGLLDMVDLLIRYKAQINIKDEEGATPLHKASFNGHSSCAKLLVDK  390


 Score = 81.3 bits (199),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 67/233 (29%), Positives = 110/233 (47%), Gaps = 14/233 (6%)

Query  43   GDTALHLATREGHLNIVRYLCENFKKPDFRVNVASRDMKRPLHEAAQFARSDILKYLIEK  102
            G + LH A   G+++ V  L  N +     +N    +   PLH         + K LIE 
Sbjct  235  GISPLHNAASAGYVDCVEQLVRNGE----NINCVDIEGVTPLHHTCFNGNLQLTKRLIEL  290

Query  103  GADVDALKRADWTPLMLACTKTGSDAYKCIVALLEAKANPLL---RNKDGWTSLHLVCRS  159
            GA ++ +     TPL  A      +  + ++ L     +P +   R+    TSLHL   +
Sbjct  291  GAKINMVDEMGETPLHKAAFNGHKEVCEYLLYL-----DPTMIDCRDSRQSTSLHLAAFN  345

Query  160  GDENAFDLLVNKFVERIDDRSNNGRSVMHIAAFHGHEGLVNRLMALNTKLLNARDSSGST  219
            G  +  DLL+ ++  +I+ +   G + +H A+F+GH     +L+      +   DS G+T
Sbjct  346  GLLDMVDLLI-RYKAQINIKDEEGATPLHKASFNGHSSCA-KLLVDKGAPICIVDSQGAT  403

Query  220  PLHEAVKGGHLSVAKRLIDLGADVEAKDNASQTILHIAAVIGNTEAIKAILKK  272
            PLH+A   G       LI  GA++E KD+   T LH AA  G+++  + +LKK
Sbjct  404  PLHKAAFNGRSKCLATLIRSGAELEVKDSQGGTPLHNAAYNGHSDCCRILLKK  456


 Score = 73.6 bits (179),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 66/230 (29%), Positives = 106/230 (46%), Gaps = 10/230 (4%)

Query  43   GDTALHLATREGHLNIVRYLCENFKKPDFRVNVASRDMKRPLHEAAQFARSDILKYLIEK  102
            G T LH     G+L + + L E   K    +N+     + PLH+AA     ++ +YL+  
Sbjct  268  GVTPLHHTCFNGNLQLTKRLIELGAK----INMVDEMGETPLHKAAFNGHKEVCEYLLYL  323

Query  103  GAD-VDALKRADWTPLMLACTKTGSDAYKCIVALLEAKANPLLRNKDGWTSLHLVCRSGD  161
                +D       T L LA      D    +  L+  KA   +++++G T LH    +G 
Sbjct  324  DPTMIDCRDSRQSTSLHLAAFNGLLDM---VDLLIRYKAQINIKDEEGATPLHKASFNGH  380

Query  162  ENAFDLLVNKFVERIDDRSNNGRSVMHIAAFHGHEGLVNRLMALNTKLLNARDSSGSTPL  221
             +   LLV+K    I    + G + +H AAF+G    +  L+    +L   +DS G TPL
Sbjct  381  SSCAKLLVDKGAP-ICIVDSQGATPLHKAAFNGRSKCLATLIRSGAEL-EVKDSQGGTPL  438

Query  222  HEAVKGGHLSVAKRLIDLGADVEAKDNASQTILHIAAVIGNTEAIKAILK  271
            H A   GH    + L+  GA+V A D  S T LH+A+  G  + +  +++
Sbjct  439  HNAAYNGHSDCCRILLKKGANVNAVDTHSSTPLHLASAAGARDTVDVLIQ  488


 Score = 72.4 bits (176),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 102/202 (50%), Gaps = 13/202 (6%)

Query  45   TALHLATREGHLNIVRYLCENFKKPDFRVNVASRDMKRPLHEAAQFARSDILKYLIEKGA  104
            T+LHLA   G L++V  L   +K    ++N+   +   PLH+A+    S   K L++KGA
Sbjct  337  TSLHLAAFNGLLDMVDLLIR-YKA---QINIKDEEGATPLHKASFNGHSSCAKLLVDKGA  392

Query  105  DVDALKRADWTPLMLACTKTGSDAYKCIVALLEAKANPLLRNKDGWTSLHLVCRSGDENA  164
             +  +     TPL  A     S   KC+  L+ + A   +++  G T LH    +G  + 
Sbjct  393  PICIVDSQGATPLHKAAFNGRS---KCLATLIRSGAELEVKDSQGGTPLHNAAYNGHSDC  449

Query  165  FDLLVNKF--VERIDDRSNNGRSVMHIAAFHGHEGLVNRLMALNTKLLNARDSSGSTPLH  222
              +L+ K   V  +D  S+   + +H+A+  G    V+ L+    ++ +A++ +G TPL 
Sbjct  450  CRILLKKGANVNAVDTHSS---TPLHLASAAGARDTVDVLIQFKARI-DAKNFAGKTPLV  505

Query  223  EAVKGGHLSVAKRLIDLGADVE  244
             A+K  H  VA+ LI  GAD++
Sbjct  506  YAIKKNHSDVARVLIRAGADLD  527


 Score = 63.5 bits (153),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 69/266 (26%), Positives = 115/266 (43%), Gaps = 24/266 (9%)

Query  12   HACQNGDLSRVETLV---SKHDIQDWTHFRHTTSGDTALHLATREGHLNIVRYLCENFKK  68
            H C NG+L   + L+   +K ++ D         G+T LH A   GH  +  YL   +  
Sbjct  274  HTCFNGNLQLTKRLIELGAKINMVDEM-------GETPLHKAAFNGHKEVCEYLL--YLD  324

Query  69   PDFRVNVASRDMKRP--LHEAAQFARSDILKYLIEKGADVDALKRADWTPLMLACTKTGS  126
            P     +  RD ++   LH AA     D++  LI   A ++       TPL     K   
Sbjct  325  PTM---IDCRDSRQSTSLHLAAFNGLLDMVDLLIRYKAQINIKDEEGATPLH----KASF  377

Query  127  DAYKCIVALLEAKANPL-LRNKDGWTSLHLVCRSGDENAFDLLVNKFVERIDDRSNNGRS  185
            + +     LL  K  P+ + +  G T LH    +G       L+    E ++ + + G +
Sbjct  378  NGHSSCAKLLVDKGAPICIVDSQGATPLHKAAFNGRSKCLATLIRSGAE-LEVKDSQGGT  436

Query  186  VMHIAAFHGHEGLVNRLMALNTKLLNARDSSGSTPLHEAVKGGHLSVAKRLIDLGADVEA  245
             +H AA++GH     R++      +NA D+  STPLH A   G       LI   A ++A
Sbjct  437  PLHNAAYNGHSDCC-RILLKKGANVNAVDTHSSTPLHLASAAGARDTVDVLIQFKARIDA  495

Query  246  KDNASQTILHIAAVIGNTEAIKAILK  271
            K+ A +T L  A    +++  + +++
Sbjct  496  KNFAGKTPLVYAIKKNHSDVARVLIR  521


 Score = 38.9 bits (89),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 38/153 (25%), Positives = 57/153 (37%), Gaps = 33/153 (22%)

Query  152  SLHLVCRSGDENAFDLLVNKFVERIDDRSNNGRSVMHIAAFHGHEGLVNRLM--------  203
            S+H    +GD      L+N      D   +  R+ +H AAF G    VN L+        
Sbjct  38   SVHYYSSTGDIEKLSNLLNNSATSPDTPDSEKRTPLHHAAFCGSAACVNFLLDKKANANI  97

Query  204  ---ALNTKL----------------------LNARDSSGSTPLHEAVKGGHLSVAKRLID  238
               A NT L                      +N +D    TPLH+A           L++
Sbjct  98   KDSAGNTPLQWASSRGHLECIKLLVEKGGVDVNTKDDKNGTPLHKASLFASAECVLYLLN  157

Query  239  LGADVEAKDNASQTILHIAAVIGNTEAIKAILK  271
              AD  A     +T LH A+  GN + ++ ++K
Sbjct  158  GKADPRAVTTNGETPLHHASAGGNPQCVELLIK  190


 Score = 36.6 bits (83),  Expect = 0.024, Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 31/59 (53%), Gaps = 0/59 (0%)

Query  214  DSSGSTPLHEAVKGGHLSVAKRLIDLGADVEAKDNASQTILHIAAVIGNTEAIKAILKK  272
            DS   TPLH A   G  +    L+D  A+   KD+A  T L  A+  G+ E IK +++K
Sbjct  66   DSEKRTPLHHAAFCGSAACVNFLLDKKANANIKDSAGNTPLQWASSRGHLECIKLLVEK  124


>Q24241_DROME unnamed protein product
Length=1549

 Score = 100 bits (248),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 75/257 (29%), Positives = 125/257 (49%), Gaps = 37/257 (14%)

Query  45   TALHLATREGHLNIVRYLCENFKKPDFRVNVASRDMKRPLHEAAQFARSDILKYLIEKGA  104
            +ALH+A +EG  NIV+ L EN  +     N  ++    PLH A ++ + ++++ L++ GA
Sbjct  532  SALHIAAKEGQENIVQVLLENGAEN----NAVTKKGFTPLHLACKYGKQNVVQILLQNGA  587

Query  105  DVDALKRADWTPLMLA---------------------CTKTGSDAY---------KCIVA  134
             +D   + D TPL +A                     C + G  A          +  + 
Sbjct  588  SIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQ  647

Query  135  LLEAKANPLLRNKDGWTSLHLVCRSGDENAFDLLVNKFVERIDDRSNNGRSVMHIAAFHG  194
            LL+  A+  + +K G++ LHL  + G+ +   LL+   V  I   + NG + +H+AA  G
Sbjct  648  LLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGV--ISAAAKNGLTPLHVAAQEG  705

Query  195  HEGLVNRLMALNTKLLNARDSSGSTPLHEAVKGGHLSVAKRLIDLGADVEAKDNASQTIL  254
            H  LV++++  +   ++ R  +G TPLH A   GHL + K  I+  AD+E   N   T L
Sbjct  706  HV-LVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPL  764

Query  255  HIAAVIGNTEAIKAILK  271
            H AA  G+   I  +L+
Sbjct  765  HQAAQQGHIMIINLLLR  781


 Score = 90.1 bits (222),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 70/260 (27%), Positives = 130/260 (50%), Gaps = 39/260 (15%)

Query  43   GDTALHLATREGHLNIVRYLCENFKKPDFRVNVASRDMKRPLHEAAQFARSDILKYLIEK  102
            G T LH+A+R G++NI+  L ++  +    +N  S D    LH AA+  + +I++ L+E 
Sbjct  497  GQTPLHVASRLGNINIIMLLLQHGAE----INAQSNDKYSALHIAAKEGQENIVQVLLEN  552

Query  103  GADVDALKRADWTPLMLACTKTGSDAYKCIVA----------------------------  134
            GA+ +A+ +  +TPL LAC     +  + ++                             
Sbjct  553  GAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIV  612

Query  135  --LLEAKANPLLRNKDGWTSLHLVCRSGD-ENAFDLLVNKFVERIDDRSNNGRSVMHIAA  191
              LL+  ++P L  ++G  ++H+ C+    E A  LL  +    ++  S +G S +H+AA
Sbjct  613  ELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLL--QHGADVNIISKSGFSPLHLAA  670

Query  192  FHGHEGLVNRLMALNTKLLNARDSSGSTPLHEAVKGGHLSVAKRLIDLGADVEAKDNASQ  251
              G+  +V  L  L   +++A   +G TPLH A + GH+ V++ L++ GA++  +     
Sbjct  671  QGGNVDMVQLL--LEYGVISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGY  728

Query  252  TILHIAAVIGNTEAIKAILK  271
            T LH+AA  G+ + +K  ++
Sbjct  729  TPLHMAAHYGHLDLVKFFIE  748


 Score = 88.2 bits (217),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 82/301 (27%), Positives = 139/301 (46%), Gaps = 40/301 (13%)

Query  1    MKDPNLSRNFLHACQNGDLSRVETLVSKHDIQDWTHFRHTTSGDTALHLATREGHLNIVR  60
            +K  + + +FL A ++GD+ +V   +   +I D        +G  ALHLA ++G+++I  
Sbjct  33   IKQNDATISFLRAARSGDIKKVMDFLDCGEISDINSCN--ANGLNALHLAAKDGYVDIC-  89

Query  61   YLCENFKKPDFRVNVASRDMKRPLHEAAQFARSDILKYLIEKGADVDALKRADWTPLMLA  120
              CE  ++   +++ A++     LH A+   + D++  LI   A+V+      +TPL +A
Sbjct  90   --CELLRR-GIKIDNATKKGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMA  146

Query  121  CTKTGSDAYKCIVALLEAKANPLLRNKDGWT-----------------------------  151
              +   +   C   LL   ANP L  +DG+T                             
Sbjct  147  AQENHDN---CCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLENDVRGKVRLP  203

Query  152  SLHLVCRSGDENAFDLLVNKFVERIDDRSNNGRSVMHIAAFHGHEGLVNRLMALNTKLLN  211
            +LH+  +  D NA  LL+ +     D  S +G + +HIAA +G+  +   L+  N   +N
Sbjct  204  ALHIAAKKNDVNAAKLLL-QHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLN-NKADVN  261

Query  212  ARDSSGSTPLHEAVKGGHLSVAKRLIDLGADVEAKDNASQTILHIAAVIGNTEAIKAILK  271
                   TPLH A K G LS+   L+  GA ++A      T LH A+  G+ E IK +L+
Sbjct  262  YVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQ  321

Query  272  K  272
            +
Sbjct  322  Q  322


 Score = 84.7 bits (208),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 70/260 (27%), Positives = 126/260 (48%), Gaps = 20/260 (8%)

Query  13   ACQNGDLSRVETLVSKHDIQDWTHFRHTTSGD-TALHLATREGHLNIVRYLCENFKKPDF  71
            AC+ G  + V+ L     +Q+          D T LH+AT   + +IV  L +N   P  
Sbjct  570  ACKYGKQNVVQIL-----LQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSP--  622

Query  72   RVNVASRDMKRPLHEAAQFARSDILKYLIEKGADVDALKRADWTPLMLACTKTGSDAYKC  131
              N+ +R+ +  +H A +    +I   L++ GADV+ + ++ ++PL LA      D  + 
Sbjct  623  --NLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQL  680

Query  132  IV--ALLEAKANPLLRNKDGWTSLHLVCRSGDENAFDLLVNKFVERIDDRSNNGRSVMHI  189
            ++   ++ A A      K+G T LH+  + G      +L+ +    I +R+ NG + +H+
Sbjct  681  LLEYGVISAAA------KNGLTPLHVAAQEGHVLVSQILL-EHGANISERTRNGYTPLHM  733

Query  190  AAFHGHEGLVNRLMALNTKLLNARDSSGSTPLHEAVKGGHLSVAKRLIDLGADVEAKDNA  249
            AA +GH  LV +    N   +    + G TPLH+A + GH+ +   L+   A+  A    
Sbjct  734  AAHYGHLDLV-KFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKD  792

Query  250  SQTILHIAAVIGNTEAIKAI  269
              T LHIA+ +G    ++++
Sbjct  793  GNTALHIASNLGYVTVMESL  812


 Score = 77.4 bits (189),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 74/290 (26%), Positives = 126/290 (43%), Gaps = 43/290 (15%)

Query  13   ACQNGDLSRVETLVSKHDIQDWTHFRHTTSGDTALHLATREGHLNIVRYLCENFKKPDFR  72
            AC+ G LS    L+ +    D      T  G T LH A+R GH+ ++++L +     +  
Sbjct  274  ACKWGKLSLCTLLLCRGAKIDAA----TRDGLTPLHCASRSGHVEVIKHLLQQ----NAP  325

Query  73   VNVASRDMKRPLHEAAQFARSDILKYLIEKGADVDALKRADWTPLMLACTKTGSDAYKCI  132
            +   +++    LH AAQ    +    L++  A VD +     T L +A         K  
Sbjct  326  ILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVA---AHCGHVKVA  382

Query  133  VALLEAKANPLLRNKDGWTSLHLVCRSGDENAFDLLVNKFVERIDDRSNNGRSVMHIAAF  192
              LL+ KANP  R  +G+T LH+ C+       +LL+ K    I   + +G + +H+A+F
Sbjct  383  KLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLI-KHGANIGATTESGLTPLHVASF  441

Query  193  HGHEGLVNRLMA-------------------------------LNTKLLNARDSSGSTPL  221
             G   +V  L+                                L +  ++A    G TPL
Sbjct  442  MGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLRSAKVDAIVREGQTPL  501

Query  222  HEAVKGGHLSVAKRLIDLGADVEAKDNASQTILHIAAVIGNTEAIKAILK  271
            H A + G++++   L+  GA++ A+ N   + LHIAA  G    ++ +L+
Sbjct  502  HVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLE  551


 Score = 69.7 bits (169),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 66/231 (29%), Positives = 107/231 (46%), Gaps = 13/231 (6%)

Query  40   TTSGDTALHLATREGHLNIVRYLCENFKKPDFRVNVASRDMKRPLHEAAQFARSDILKYL  99
            T  G T L +A ++GH  IV  L EN  +   R+          LH AA+    +  K L
Sbjct  169  TEDGFTPLAVAMQQGHDKIVAVLLENDVRGKVRLPA--------LHIAAKKNDVNAAKLL  220

Query  100  IEKGADVDALKRADWTPLMLACTKTGSDAYKCIVALLEAKANPLLRNKDGWTSLHLVCRS  159
            ++   + D + ++ +TPL +A      D       LL  KA+     K   T LH+ C+ 
Sbjct  221  LQHDPNADIVSKSGFTPLHIAAHYGNVD---IATLLLNNKADVNYVAKHNITPLHVACKW  277

Query  160  GDENAFDLLVNKFVERIDDRSNNGRSVMHIAAFHGHEGLVNRLMALNTKLLNARDSSGST  219
            G  +   LL+ +   +ID  + +G + +H A+  GH  ++  L+  N  +L  +  +G +
Sbjct  278  GKLSLCTLLLCRGA-KIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPIL-TKTKNGLS  335

Query  220  PLHEAVKGGHLSVAKRLIDLGADVEAKDNASQTILHIAAVIGNTEAIKAIL  270
             LH A +G H   A  L+D  A V+       T LH+AA  G+ +  K +L
Sbjct  336  ALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLL  386



Lambda      K        H
   0.314    0.131    0.366 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1387782160


Query= XP_003392998.1 uncharacterized protein LOC100649485 isoform X1
[Bombus terrestris]

Length=697
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9W2G5_DROME  unnamed protein product                                 66.6    5e-11
RAD50_DROME  unnamed protein product                                  34.3    0.43 
Q9XZ61_DROME  unnamed protein product                                 32.7    0.97 
H2L0M5_CAEEL  unnamed protein product                                 30.8    5.4  
Q24605_DROME  unnamed protein product                                 30.4    7.7  


>Q9W2G5_DROME unnamed protein product
Length=842

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 87/402 (22%), Positives = 163/402 (41%), Gaps = 45/402 (11%)

Query  144  DIAKIIDKDPDPCFEGVYNWYYTGGSIDYIQLYNKNILLFPFMGELVSVPLNNIEDF---  200
            ++A+ I +  +  F   Y++YYTGG+++ I     + L     G  +   L+   D+   
Sbjct  154  EMAEHIAQQENSFFRDSYDYYYTGGNLNTIPFDGNDQLAMHVSGNKLR-DLHFSRDYGEA  212

Query  201  -LWKPLFKKAAKCELNGTLYEL--KHNINVDACMFLGRYKRHCNFYTLSENDDKCNLTEI  257
              W+PL     + E +  ++EL   HN+N  + MFL R  +  + Y L   D++ + ++ 
Sbjct  213  EFWQPLHSATIE-ESSSEVFELLPLHNLN-RSQMFLARLLKEVSLYELKCKDEQDSDSDY  270

Query  258  HT------QTSKIPYIGADLSPINANQYCLVNVERCVTLWDIVKMKPI-NCNTIMQATVL  310
                     +   P+  A  S  NAN   L + +R +   DI   + I   +  +   + 
Sbjct  271  ELIRHCMFSSQVAPFTSAAQSLANANTLALASQDRSLRFVDISTQQDIAKLDVCLLKGLK  330

Query  311  DDSWSSIKFQSTDPNILLFVDRCCLHYLDVRVPFDQPALTMCPKF----YLEKCEHLSID  366
              S +  + +  + +    + +  L  +DVR       L + P F    + + CE  S  
Sbjct  331  KTSSTWAQLKQAEESTFHCLTQPVLFTVDVRC-----NLPLNPCFASGVHSKACERFSCL  385

Query  367  VASRNNFCRYIGTYHSMLMCDSRSPQQCVQQK--------WTHQFKSPPLTSSVIARDDK  418
                N    Y+ + H+    D R    C+ +K        WTHQ   PP         D 
Sbjct  386  AKGVNPNLLYVASNHNFHCLDIR----CLGKKLTDRAVVTWTHQMTYPPCFIDTSVHQDS  441

Query  419  EFVVLSSQIAGETTVI-VNTWTDSEISQSYN--FPYTPPHIKETLNESQIQGMC-LNPYL  474
            E++ L   +  +  +  +       + + ++   P+ P  ++E L ++++ G   +   +
Sbjct  442  EYIALGGLLPKDLRICELQGAQAKSVDEMFSPAIPFAPVTLEEALIDARLGGFVDVYADI  501

Query  475  RDRFELSNTGSFLI----KNDTQNIFLFLQNSIGDIYYQCLT  512
             +R     TG   I     +D     L   NS+GD+Y Q LT
Sbjct  502  AERVTTCITGMRFIGLEGASDQAFTQLLTSNSLGDVYCQRLT  543


 Score = 33.9 bits (76),  Expect = 0.51, Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 36/73 (49%), Gaps = 13/73 (18%)

Query  584  WKQSLEKLNTYMDILAPELLAVW-------------EICEEVPLPLTAAPHQKVLNWLES  630
            W++S  KL+ Y D+++  LL VW             E+ +E        P Q++ NWLE 
Sbjct  684  WQKSAYKLSHYTDMMSTRLLDVWDMEEYDTTRDVTREMFDERIKGKELEPEQRMANWLEQ  743

Query  631  ADTKPSILSQEEI  643
              ++  + +++E+
Sbjct  744  LPSQTVVPTEDEV  756


>RAD50_DROME unnamed protein product
Length=1318

 Score = 34.3 bits (77),  Expect = 0.43, Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 47/93 (51%), Gaps = 12/93 (13%)

Query  531  LNAWQNAVSIETDAIAPLTMSSKSNMHFPFKSFTNKKLRLKRKHESVDCFEPSWKQSLEK  590
            L + QNAV  + DA+  L    K N      S  ++++ L+   +S+    P  K+ LEK
Sbjct  853  LESAQNAVQQQMDALNRL--REKKN------SLKDRQIHLREGLQSL----PQLKERLEK  900

Query  591  LNTYMDILAPELLAVWEICEEVPLPLTAAPHQK  623
            LN+++  +A E+  +    + + L L AA  +K
Sbjct  901  LNSFLTTVASEISELKAKIQPLKLNLRAAIEEK  933


>Q9XZ61_DROME unnamed protein product
Length=324

 Score = 32.7 bits (73),  Expect = 0.97, Method: Compositional matrix adjust.
 Identities = 23/73 (32%), Positives = 36/73 (49%), Gaps = 11/73 (15%)

Query  41   LHSTFSAADSDLENVIEQYQEYPYHCDLPKPLLPPAKVPRNMLNEEDPALELVTLKNYVN  100
            +H    A  SD + + EQ  E          LL PA  P  M  EED   E+ +L+ Y+ 
Sbjct  215  IHFNLMALISDRQRIYEQQIE---------KLLNPA--PNAMDTEEDRQAEISSLRTYIE  263

Query  101  SDIERMKRYYLKH  113
             +I++ KRY +++
Sbjct  264  YEIQKKKRYKVEN  276


>H2L0M5_CAEEL unnamed protein product
Length=1144

 Score = 30.8 bits (68),  Expect = 5.4, Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 30/64 (47%), Gaps = 6/64 (9%)

Query  396  QQKWTHQFKS------PPLTSSVIARDDKEFVVLSSQIAGETTVIVNTWTDSEISQSYNF  449
             + W  QFK+      PP+++ ++A    EFV L S+      V V T+ +  +S  +  
Sbjct  358  HKSWEDQFKTTVFQTTPPMSTYLLAFAIGEFVKLESRTERGIPVTVWTYPEDVMSMKFTL  417

Query  450  PYTP  453
             Y P
Sbjct  418  EYAP  421


>Q24605_DROME unnamed protein product
Length=2529

 Score = 30.4 bits (67),  Expect = 7.7, Method: Compositional matrix adjust.
 Identities = 15/42 (36%), Positives = 24/42 (57%), Gaps = 10/42 (24%)

Query  576   SVDCFEPSWKQSLEKLNTYMDILAPELLAVWEICEE-VPLPL  616
             +V+C +PS+   + KL+ Y         +VW++CEE  P PL
Sbjct  1619  TVNCPQPSYVAGMHKLSMY---------SVWQVCEENQPHPL  1651



Lambda      K        H
   0.314    0.131    0.366 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1387782160


Query= XP_003392999.1 mitochondrial import inner membrane translocase
subunit TIM50-C [Bombus terrestris]

Length=387
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TI50C_DROME  unnamed protein product                                  350     2e-118
CTDS_DICDI  unnamed protein product                                   90.9    2e-20 
SCPL1_CAEEL  unnamed protein product                                  81.6    1e-16 
Q7YU53_DROME  unnamed protein product                                 78.6    5e-16 
Q9VUX0_DROME  unnamed protein product                                 78.2    6e-16 


>TI50C_DROME unnamed protein product
Length=428

 Score = 350 bits (899),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 166/279 (59%), Positives = 202/279 (72%), Gaps = 2/279 (1%)

Query  101  LKYSFAFLGVFTTVGLSYVIYNLTRTKYDEHGNVIEDEFSNLPFYERIYKMLKREFNYYT  160
            +K  FA  G        + +Y   + + D +G  IEDEF++ P  ++  + + +  +YY 
Sbjct  145  MKLGFAIFGGSAVAAGFWAVYEFGKPEVDPNGQPIEDEFTHKPLVQQYLQRMWKSIHYYQ  204

Query  161  KMVQEPSRNKLLPDPLKYPYIQPPYTLVLELTDVLVHPDWTYETGWRFKKRPGVDQFLEA  220
            +M+QEPSR KLLPDPLK PY+QP YTLVLE+ DVLVHPDWTY+TGWRFKKRPGVD FL  
Sbjct  205  RMIQEPSRAKLLPDPLKPPYVQPRYTLVLEMKDVLVHPDWTYQTGWRFKKRPGVDHFLAE  264

Query  221  IAPPQFEIVVYTAEQGMTVFPILDILDPNGYIMYRLVRDTTRFVDGHHVKDLNALNRDLS  280
             A   FEIVV+TAEQGMTVFPILD LDPNGYIMYRLVRD T FVDGHHVK+L+ LNRDL 
Sbjct  265  CAK-DFEIVVFTAEQGMTVFPILDALDPNGYIMYRLVRDATHFVDGHHVKNLDNLNRDLK  323

Query  281  KVIVVDWNPKSTKFHPENTLQLLQWTGNDDDTTLYDLAAFLKVILATNVEDVREVLTYYR  340
            KVIVVDW+  +TK HP+NT  L +W GNDDD  L DL AFLK+I   NV+DVREVL YYR
Sbjct  324  KVIVVDWDANATKMHPDNTFGLARWHGNDDDGQLLDLIAFLKIIAQNNVDDVREVLHYYR  383

Query  341  QFENPLKVFRENQRKFLMQMEAEENKAQQESSKVLTSKW  379
            QF++P+  FRENQRK   QM  E  + +Q  +K +  +W
Sbjct  384  QFDDPINQFRENQRKLAEQM-LEAERIEQSKTKPMVKQW  421


>CTDS_DICDI unnamed protein product
Length=306

 Score = 90.9 bits (224),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 72/135 (53%), Gaps = 16/135 (12%)

Query  186  TLVLELTDVLVH--------PDWTYETGWR-------FKKRPGVDQFLEAIAPPQFEIVV  230
            TLVL+L + LVH        PD+                KRP VD FL AIA  +FEIVV
Sbjct  138  TLVLDLDETLVHSSFKPVHNPDFIVPVEIEGTIHQVYVVKRPFVDDFLRAIAE-KFEIVV  196

Query  231  YTAEQGMTVFPILDILDPNGYIMYRLVRDTTRFVDGHHVKDLNALNRDLSKVIVVDWNPK  290
            +TA       P+LD LD    I YRL R++     G++VKDL+ L RDL   I+VD +P 
Sbjct  197  FTASLAKYADPVLDFLDTGRVIHYRLFRESCHNHKGNYVKDLSRLGRDLKSTIIVDNSPS  256

Query  291  STKFHPENTLQLLQW  305
            S  FHPEN + +  W
Sbjct  257  SYLFHPENAIPIDSW  271


>SCPL1_CAEEL unnamed protein product
Length=491

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/175 (31%), Positives = 85/175 (49%), Gaps = 21/175 (12%)

Query  186  TLVLELTDVLVH--------PDWTYET---GWRFK----KRPGVDQFLEAIAPPQFEIVV  230
             LV++L + LVH        PD+       G   +    KRP VD+FL  +    FE ++
Sbjct  313  CLVIDLDETLVHSSFKPVKNPDFVIPVEIDGVEHQVYVLKRPYVDEFLAKVGE-HFECIL  371

Query  231  YTAEQGMTVFPILDILDPNGYIMYRLVRDTTRFVDGHHVKDLNALNRDLSKVIVVDWNPK  290
            +TA       P+ D+LD       RL R+   F  G++VKDL+ L R+L++ +++D +P 
Sbjct  372  FTASLAKYADPVADLLDKKRVFRGRLFREACVFHKGNYVKDLSRLGRNLNQTLIIDNSPA  431

Query  291  STKFHPENTLQLLQWTGNDDDTTLYDLAAFLKVILATNVEDVREVLTYYRQFENP  345
            S  FHPEN + +  W  +  DT L D+   L+     ++     +   YR  E P
Sbjct  432  SYAFHPENAVPVTTWFDDPSDTELLDILPSLE-----HLNGFSSIYDLYRPEEGP  481


>Q7YU53_DROME unnamed protein product
Length=329

 Score = 78.6 bits (192),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 72/132 (55%), Gaps = 3/132 (2%)

Query  210  KRPGVDQFLEAIAPPQFEIVVYTAEQGMTVFPILDILDPNGYIMYRLVRDTTRFVDGHHV  269
            KRP VD+FL+ +    +E V++TA       P+ D+LD       RL R++  +  G+++
Sbjct  130  KRPHVDEFLQKMGE-LYECVLFTASLAKYADPVADLLDKWNVFRARLFRESCVYYRGNYI  188

Query  270  KDLNALNRDLSKVIVVDWNPKSTKFHPENTLQLLQWTGNDDDTTLYDLAAFLKVILATNV  329
            KDLN L RDL K+++VD +P S  FHP+N + +  W  +  D  L +L    + +  + V
Sbjct  189  KDLNRLGRDLQKIVIVDNSPASYIFHPDNAVPVKSWFDDVTDCELRELIPLFEKL--SKV  246

Query  330  EDVREVLTYYRQ  341
            + V  VL    Q
Sbjct  247  DSVYSVLCNSNQ  258


>Q9VUX0_DROME unnamed protein product
Length=329

 Score = 78.2 bits (191),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 72/132 (55%), Gaps = 3/132 (2%)

Query  210  KRPGVDQFLEAIAPPQFEIVVYTAEQGMTVFPILDILDPNGYIMYRLVRDTTRFVDGHHV  269
            KRP VD+FL+ +    +E V++TA       P+ D+LD       RL R++  +  G+++
Sbjct  130  KRPHVDEFLQKMGE-LYECVLFTASLAKYADPVADLLDKWNVFRARLFRESCVYYRGNYI  188

Query  270  KDLNALNRDLSKVIVVDWNPKSTKFHPENTLQLLQWTGNDDDTTLYDLAAFLKVILATNV  329
            KDLN L RDL K+++VD +P S  FHP+N + +  W  +  D  L +L    + +  + V
Sbjct  189  KDLNRLGRDLQKIVIVDNSPASYIFHPDNAVPVKSWFDDVTDCELRELIPLFEKL--SKV  246

Query  330  EDVREVLTYYRQ  341
            + V  VL    Q
Sbjct  247  DSVYSVLCNSNQ  258



Lambda      K        H
   0.314    0.131    0.366 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1387782160


Query= XP_003393002.1 very long-chain-fatty-acid--CoA ligase bubblegum
isoform X2 [Bombus terrestris]

Length=684
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

BGM_DROME  unnamed protein product                                    632     0.0   
BGML_DROME  unnamed protein product                                   499     7e-169
FCSA_DICDI  unnamed protein product                                   202     8e-56 
FCSB_DICDI  unnamed protein product                                   166     4e-43 
Q38BS1_TRYB2  unnamed protein product                                 144     1e-35 


>BGM_DROME unnamed protein product
Length=666

 Score = 632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/660 (49%), Positives = 451/660 (68%), Gaps = 21/660 (3%)

Query  39   GPDQILPADSFTTTKIDGHVRIQLNNEDF---KPISVPGLLSNTVRKYPNHIALAATPDE  95
            GP+++  AD++ TT     V+I++  +     +PISVPGLL  TV  Y ++ AL     +
Sbjct  12   GPNRLRQADAYRTTNRQDAVKIRMAKDGIGAEEPISVPGLLKRTVNNYGDYPALRTKNGK  71

Query  96   TGHRKTYTFIEYENQIKTVAKAFLKLGLERFHGVCILGFNSPEWLFSNLGAIYAGGIAVG  155
             G+  T T+ +YE ++  VAKAF+KLGLE  H V +L FN  EW +S +GAI+A GI  G
Sbjct  72   NGYH-TVTYKQYEQKVHQVAKAFIKLGLEEHHSVGVLAFNCAEWFYSAMGAIHARGIIAG  130

Query  156  IYATNTPDACQHCLQISQANIVVVEDSKQLEKILQIRHNLPHLKAIIQ----YTGTPNEK  211
            IY TN+ DA QH L+ S A IVVV+D+KQ++KI  IR  LP LKA IQ    Y+    ++
Sbjct  131  IYTTNSADAVQHVLESSHAQIVVVDDAKQMDKIHAIRDKLPKLKAAIQIQEPYSPYLKKE  190

Query  212  D-VLSWNDLIKIGEAESDDKLNEILKRIATNECCTLVFTSGTVGYPKAVMLSHDNLIYNV  270
            D    W+++  +  ++ +D+    L+ +A NECC LV+TSGTVG PK VMLSHDN+ ++V
Sbjct  191  DGYYRWSEIESMNVSDVEDQYMTRLENVAINECCCLVYTSGTVGMPKGVMLSHDNITFDV  250

Query  271  R----SMNRVFKFKTACEHIISYLPLSHVAAQAIDIYYSIYIVATLHFADRNALKGSLIN  326
            R    +M+RV       E I+SYLPLSHVAAQ +DIY   ++   + FAD++ALKG+L+ 
Sbjct  251  RGIVKAMDRVV---VGAESIVSYLPLSHVAAQTVDIYTCAFVAGCIWFADKDALKGTLVK  307

Query  327  TLLEVRPTIFVGVPRVWEKIYSKLQS-EVNTGFIKTCIVSWATSQGY-HYNVNKMNGNDH  384
            +L + RPT F+GVPRV+EK   ++ +   ++G +K  + SWA      HY V++  G   
Sbjct  308  SLQDARPTRFMGVPRVYEKFQERMVAVASSSGSLKKMLASWAKGITLKHYMVSQ--GKSS  365

Query  385  KHWGYIFAKWLIFNKIKTALGLDRCHRCITAAAPLSIQIKEYFLSLDIPILEAYGMSECS  444
              + Y  AK LI +K+K ALG DR     +AAAP+S + K+YFLSLD+ I++A+GMSE +
Sbjct  366  GGFRYKIAKSLIMSKVKQALGFDRVLTLASAAAPMSPETKKYFLSLDLKIVDAFGMSETA  425

Query  445  GGHILTAPDQFKLGSIGRTVPGLKTKLDNPDSNGEGEVCMYGRHIFMGYLNEPEKTGEAL  504
            G H +  PD   L +IG+T+PG ++K  N D+NG GE+C+ GRH+FMGY++  EKT E+L
Sbjct  426  GCHTICLPDSVGLNTIGKTLPGCESKFINKDANGHGELCIRGRHVFMGYIDNKEKTEESL  485

Query  505  DGERWLHSGDVGKIDSNGFLHITGRIKEIIITAGGENIPPVHIEELVLAELPALSNALLI  564
            D + WLHSGD+G +D  G++ +TGR KEIIITAGGENIPPVHIE  +  EL A+SNA L+
Sbjct  486  DDDCWLHSGDLGFVDDKGYVSLTGRSKEIIITAGGENIPPVHIENTIKKELDAISNAFLV  545

Query  565  GDKRKYLTILVTLKTTVNTETSEPTDDFTEETLKWLQSIGSTSKTISDVLKTHD-PLVYE  623
            G++RKYLT+L+TLKT V+ ++ EP D+ + E+  W++S+G   KT+SD+L     P V++
Sbjct  546  GEQRKYLTVLITLKTEVDKDSGEPLDELSHESSVWVKSLGVEHKTVSDILAAGPCPKVWK  605

Query  624  EIDKAIKRANTKSISNAQKVQKFQILPKDFSLATGELGPTLKLKRNVVYKKYENLIEDMY  683
             I+ AIKRAN +SISNAQKVQKF ILP DFS+ TGELGPTLK+KRNVV K Y + IE +Y
Sbjct  606  SIEDAIKRANKQSISNAQKVQKFTILPHDFSIPTGELGPTLKVKRNVVSKMYADEIEKLY  665


>BGML_DROME unnamed protein product
Length=681

 Score = 499 bits (1286),  Expect = 7e-169, Method: Compositional matrix adjust.
 Identities = 280/682 (41%), Positives = 398/682 (58%), Gaps = 48/682 (7%)

Query  45   PADSFTTTKIDGHVRIQLN-----NEDFKPISVPGLLSNTVRKYPNHIALAATPDETGHR  99
            PA S+ +T +   V+++L+     ++   P ++P     +  KY +  AL      +G+ 
Sbjct  6    PATSYRSTSLHDAVKLRLDEPSSFSQTVPPQTIPEFFKESCEKYSDLPALVWETPGSGND  65

Query  100  --KTYTFIEYENQIKTVAKAFLKLGLERFHGVCILGFNSPEWLFSNLGAIYAGGIAVGIY  157
               T TF EY+ +++  A   L +G+E    V IL FN PEW F+  GA+ AG +  G+Y
Sbjct  66   GWTTLTFGEYQERVEQAALMLLSVGVEERSSVGILAFNCPEWFFAEFGALRAGAVVAGVY  125

Query  158  ATNTPDACQHCLQISQANIVVVEDSKQLEKILQIRHNLPHLKAIIQYTG-----TPNEKD  212
             +N+ +A  H L   ++++ VV+D++Q+ K+  I+  LP LKA+IQ  G       +E  
Sbjct  126  PSNSAEAVHHVLATGESSVCVVDDAQQMAKLRAIKERLPRLKAVIQLHGPFEAFVDHEPG  185

Query  213  VLSWNDLIKIGEAESDDKLNEIL----KRIATNECCTLVFTSGTVGYPKAVMLSHDNLIY  268
              SW    K+ E     +L E L     RI  NEC  L+FTSGTVG PKAVMLSHDNL++
Sbjct  186  YFSWQ---KLQEQTFSSELKEELLARESRIRANECAMLIFTSGTVGMPKAVMLSHDNLVF  242

Query  269  NVRSMNRVFK-FKTACEHIISYLPLSHVAAQAIDIYYSIYIVATLHFADRNALKGSLINT  327
            + +S     +  +   E  +SYLPLSHVAAQ  D++  +     + FAD++ALKG+LI T
Sbjct  243  DTKSAAAHMQDIQVGKESFVSYLPLSHVAAQIFDVFLGLSHAGCVTFADKDALKGTLIKT  302

Query  328  LLEVRPTIFVGVPRVWEKIYSKL-QSEVNTGFIKTCIVSWATSQGYHYNVNKMNGNDHKH  386
              + RPT   GVPRV+EK+  +L  +E         +++ A +    +    M G     
Sbjct  303  FRKARPTKMFGVPRVFEKLQERLVAAEAKARPYSRLLLARARAAVAEHQTTLMAGKSPSI  362

Query  387  WGYIFAK-WL---IFNKIKTALGLDRCHRCITAAAPLSIQIKEYFLSLDIPILEAYGMSE  442
            +G   AK WL   +   I+  +G+D C    T  AP S ++K++FL LDI + E YGMSE
Sbjct  363  YGN--AKYWLACRVVKPIREMIGVDNCRVFFTGGAPTSEELKQFFLGLDIALGECYGMSE  420

Query  443  CSGGHILTAPDQFKLGSIGRTVPGLKTKLDNPDSNGEGEVCMYGRHIFMGYLNEPEKTGE  502
             SG   L   D   L S G+   G+  K+  PD NG+GE+ M GR +FMGYL  P+KT E
Sbjct  421  TSGAITLNV-DISNLYSAGQACEGVTLKIHEPDCNGQGEILMRGRLVFMGYLGLPDKTEE  479

Query  503  ALDGERWLHSGDVGKIDSNGFLHITGRIKEIIITAGGENIPPVHIEELVLAELPALSNAL  562
             +  + WLHSGD+G ID  G L I+GR+KE+IITAGGENIPPVHIEEL+  ELP +SN L
Sbjct  480  TVKEDGWLHSGDLGYIDPKGNLIISGRLKELIITAGGENIPPVHIEELIKKELPCVSNVL  539

Query  563  LIGDKRKYLTILVTLKTTVNTETSEPTDDFTEETLKWLQSIGSTSKTISDVLK-------  615
            LIGD RKYLT+L++LKT  + +T  P D   EET++WL+ +      +S++L        
Sbjct  540  LIGDHRKYLTVLLSLKTKCDAKTGIPLDALREETIEWLRDLDIHETRLSELLNIPADLQL  599

Query  616  -------------THDPLVYEEIDKAIKRANTKSISNAQKVQKFQILPKDFSLATGELGP  662
                         T  P + E I++ IKRAN  +ISNAQKVQKF ++  +FS+ATGELGP
Sbjct  600  PNDTAALAATLEITAKPKLLEAIEEGIKRANKYAISNAQKVQKFALIAHEFSVATGELGP  659

Query  663  TLKLKRNVVYKKYENLIEDMYK  684
            TLK++RN+V+ KY  +IE +YK
Sbjct  660  TLKIRRNIVHAKYAKVIERLYK  681


>FCSA_DICDI unnamed protein product
Length=667

 Score = 202 bits (513),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 162/610 (27%), Positives = 281/610 (46%), Gaps = 55/610 (9%)

Query  97   GHRKTYTFIEYEN---QIKTVAKAFLKLGLERFHGVCILGFNSPEWLFSNLGAIYAGGIA  153
            G R  Y +I Y+    +   +  A ++LGL +   + I   N PEW+ S++ A+    + 
Sbjct  80   GKRGDYKWISYKQACIRANNIGSALVQLGLNKGDRIGIFSINRPEWVLSDMAAMNHSLVP  139

Query  154  VGIYATNTPDACQHCLQISQANIVVVEDSKQLEKILQIRHNLPHLKAIIQYTGTPNEK-D  212
            V +YAT   +A ++ +  S+ ++++ E  K +EKIL +      +K I+ Y   P    D
Sbjct  140  VALYATLGANAIEYVVNHSEISVLLCE-GKNVEKILSMPGTT--IKTIVSYDPLPQATLD  196

Query  213  VLSWNDLIKIGEAESDDKLNEILKRIATNEC------CTLVFTSGTVGYPKAVMLSHDNL  266
                N+ +K+      +KL E  +  A +E       CTL++TSG+ G PK VML+H N+
Sbjct  197  KFKDNENVKLYLLSDFEKLGE--QNPAQHEVPSPEDLCTLLYTSGSTGNPKGVMLTHTNM  254

Query  267  IYNVRSMNRVFKFKTACEHIISYLPLSHVAAQAIDIYYSIYIVATLHFADRNALKGSLIN  326
            +  V   N         +  +SYLPL+H   +A+ +    Y+   + F   + L   L N
Sbjct  255  VSEVAGANFSPAGVIPEDVHMSYLPLAHSFERAV-VSLMCYVGGQIGFF--SGLIPELFN  311

Query  327  TLLEVRPTIFVGVPRVWEKIYSKLQSEVNTGFIKTCIVSWATSQGYHYNVNKMNGNDHKH  386
             +  +RPT   G PRVW++++ KL   VN         SW     +++ +N  +      
Sbjct  312  DIQVLRPTFLCGAPRVWQRLHDKLWFTVNND-------SWLKKFLFNWGLN--SKQSALR  362

Query  387  WGYIFAKW--LIFNKIKTALGLDRCHRCITAAAPLSIQIKEYFLS-LDIPILEAYGMSEC  443
             G     W  L+F+K K  LG  R    ++ +APL  ++ E+  +    P++  YG+SE 
Sbjct  363  LGSTTPIWDKLVFSKTKDRLG-GRVKFILSGSAPLDPKLAEFLRACFCCPVVSGYGLSEN  421

Query  444  SGGHILTAPDQFKLGSIGRTVPGLKTKL-DNPDSN--------GEGEVCMYGRHIFMGYL  494
             GG  +  P+   +G +G  +   + KL D P+ N          GEVC+ G ++F GY 
Sbjct  422  VGGASVAYPEDNNVGHVGPPLSACEMKLIDVPEMNYFSTDKPCPRGEVCIRGFNVFKGYF  481

Query  495  NEPEKTGEALDGERWLHSGDVGKIDSNGFLHITGRIKEIIITAGGENIPPVHIEELVLAE  554
             +PEKT E L  + W H+GD+G+ + NG L I  R K I   + GE +   ++E  V   
Sbjct  482  KDPEKTKEDLKEDGWFHTGDIGRWNENGTLSIIDRKKNIFKLSQGEYVAAEYLES-VFVR  540

Query  555  LPALSNALLIGDK-RKYLTILVTLKTTVNTETSEPTDDFTEETLKWLQSIGSTSKTISDV  613
             P  S   + GD    +L  +V     V  +       + E  +    ++  + +   ++
Sbjct  541  SPFASQVFVYGDSLNSFLVGVVVPDFEVVQKLF--ASKYPELDVSNHATLAKSKELYKEI  598

Query  614  LKTHDPLVYEEIDKAIKRANTKSISNAQKVQKFQILPKDFSLATGELGPTLKLKRNVVYK  673
            L + D    E             +   +K++   +  + F+     L P+ K KR  + +
Sbjct  599  LSSFDACAAE-----------AKLHGFEKLKHIYVEHEPFTEENNLLTPSFKPKRPQLKE  647

Query  674  KYENLIEDMY  683
            +Y+ +I+ +Y
Sbjct  648  RYQTIIDTLY  657


>FCSB_DICDI unnamed protein product
Length=673

 Score = 166 bits (419),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 173/639 (27%), Positives = 281/639 (44%), Gaps = 69/639 (11%)

Query  76   LSNTVRKYPNHIALAA-TPDETGHRKTYTFIEYENQIKT---VAKAFLKLGLERFHGVCI  131
            L  + +KY           D  G+   + +I Y   ++    + +   +LGL+    V I
Sbjct  69   LVKSCKKYGERKCFGERKKDSNGNLGKFEWISYNTYLERCEYIQQGLCELGLKPKSKVGI  128

Query  132  LGFNSPEWLFSNLGAIYAGGIAVGIYATNTPDACQHCLQISQANIVVVEDSKQLEKILQI  191
               N  EWL  +  +       V  Y T   ++  +  + ++  +     ++ L+K L I
Sbjct  129  FSKNRLEWLIVHSASFIQSYCVVSFYETLGVESLSYVTEHAEIGLAFC-SAETLQKTLDI  187

Query  192  RHNLPHLKAIIQYTGTPNEK---------DVLSWNDLIKIGEAESDDKLNEILKRIATNE  242
               +  LK II +     E           + ++++++K G+ E++ K          + 
Sbjct  188  AKGVKVLKTIICFDSIDKEHYNIAKELGVTLYTYDEIMKKGK-EANGKHKHTPP--TPDT  244

Query  243  CCTLVFTSGTVGYPKAVMLSHDNLIYNVRSMNRVFKFKTACEHIISYLPLSHVAAQAIDI  302
              T+++TSGT G PK VM++H NL   V +++   K      H  SYLP +HV  + +  
Sbjct  245  LSTIMYTSGTTGPPKGVMITHKNLTSVVCAVSDFIKVYDTDVHY-SYLPYAHVLERVV--  301

Query  303  YYSIYIVATLHF-ADRNALKGSLINTLLEVR---PTIFVGVPRVWEKIYSKLQSEVNTGF  358
                 I+A  HF A      G + N L+EV+   PT+F+GVPRV+E+I + +  E++   
Sbjct  302  -----ILAAFHFGAAIGIFSGDISNILVEVKLLSPTLFIGVPRVFERIKTNVFKEISK--  354

Query  359  IKTCIVSWATSQGYHYNVNKMNGNDHKHWGYIFAKWL---IFNKIKTALGLDRCHRCITA  415
             K  ++    +  Y+     +    H     I  K L    F+KIK ALG  +    ++ 
Sbjct  355  -KPALLRTLFNGAYNLKYLSIQ---HGFKLPIIEKVLDLVFFSKIKQALG-GKVRVILSG  409

Query  416  AAPLSIQIKEYFLSLDIP--ILEAYGMSECSGGHILTAPDQFKLGSIGRTVPGLKTKL-D  472
            +APLS    E FL + +   +L+ YG SE  GG      D   +G+IG      + KL D
Sbjct  410  SAPLSFDT-EVFLRVVMCCCVLQGYGASEGCGGDACKRLDDESVGTIGPPFASNEIKLVD  468

Query  473  NP----DSNGE---GEVCMYGRHIFMGYLNEPEKTGEAL-DGERWLHSGDVGKIDSNGFL  524
             P    DSNGE   GEVC+ G  I  GY  + EKT E   DG  W H+GD+G+ + +G L
Sbjct  469  VPELGYDSNGEVQTGEVCLRGPSISSGYYKDEEKTREEFKDG--WFHTGDIGRWNRDGSL  526

Query  525  HITGRIKEIIITAGGENIPPVHIEELVLAELPALSNALLIGDKRKYLTILVTLKTTVNTE  584
             I  R K I   + GE +    IE +V+     +    + GD +K   I +         
Sbjct  527  SIVDRKKNIFKLSQGEYVAVEKIETIVVKS-EYVEQVCIYGDSQKSCVIAI---------  576

Query  585  TSEPTDDFTEETLKWLQSIGSTSKTISDVLKTHDPLVYEEIDKAIKRANTKSISNAQKVQ  644
                     E   +W  S   T K I ++ K  D  +   +D  IK      +   +  +
Sbjct  577  ----IHPHPESCSEWAGS-KKTDKDIKEICKNQD-FIKVVLDDIIKNCKKSGLHGFEIPK  630

Query  645  KFQILPKDFSLATGELGPTLKLKRNVVYKKYENLIEDMY  683
               + P+ FS     L P+ KLKR+ + K +E+ I+ +Y
Sbjct  631  AIHLTPEAFSDQNNLLTPSFKLKRHEIKKYFEDEIKKLY  669


>Q38BS1_TRYB2 unnamed protein product
Length=703

 Score = 144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 147/617 (24%), Positives = 271/617 (44%), Gaps = 67/617 (11%)

Query  99   RKTYTFIEYENQIKTVAKAFLKLGLERFHGVCILGFNSPEWLFSNLGAIYAGGIAVGIYA  158
            R+  ++ +    ++  +K   ++GL+    + +      EW  S L A     I   +YA
Sbjct  120  RRNISYKQLWETVENFSKGLCEIGLQERQCLALFEETRWEWYASLLSAWCHNMIVATVYA  179

Query  159  TNTPDACQHCLQISQANIVVVEDSKQLEKIL-QIRHNLPHLKAIIQYTGTPNEKDVLS--  215
                DA ++ L+ +Q   ++  + K +  +L +++        +I     P   D++   
Sbjct  180  NLGEDALRYALREAQCGCIIC-NGKNVPVLLDKVKLKEMGNPVVIYLDDLPTNVDIMDLR  238

Query  216  ---WNDLIKIGEAESDDKLNEILKRIATNECCT----LVFTSGTVGYPKAVMLSHDNLIY  268
               W+ ++++G      +LN     I T E C     +++TSGT G PK V+ +H +L  
Sbjct  239  VYKWSTVVEMGAKSEKAQLN-----IPTCENCDDTALIMYTSGTTGDPKGVVHTHGSLAS  293

Query  269  NVRSMN----RVFKFKTACEHIISYLPLSHVAAQAIDIYYSIYIV--ATLHFADRNALKG  322
             V +++     VF      E   SYLPL+H+   A+    SI ++    + F     +  
Sbjct  294  GVYALSIRLSEVFGDPRDDETYCSYLPLAHIMELAV---LSILMLRGCLIGFGSPRTITN  350

Query  323  SLI---NTLLEVRPTIFVGVPRVWEKIYSKLQSEV-NTGFIKTCIVSWATSQGYHYNVNK  378
            +       L+E RP +   VPRV++ I   +++ + + G IK  +      +GY   +  
Sbjct  351  TFSKPHGDLVEYRPFVLSAVPRVFDTIKKNVEAMLPSPGSIKRTVFE----RGYQARLKA  406

Query  379  MNGNDHKHWGYIFAKWLIFNKIKTALGLDRCHRCITAAAPLSIQIKEYFLSLDIPILEAY  438
            +   D K   Y+  K  +FNK++ A G        +  APLS   +E+   +   +++ +
Sbjct  407  LR--DGKETPYLNEK--VFNKVRQATG-GNVRLYFSGGAPLSPATQEFINVVLGTVIQGW  461

Query  439  GMSE--CSGGHILTAPDQFKLGSIGRTVPGLKTKL-DNPD------SNGEGEVCMYGRHI  489
            G++E  C GG     P   +  SIGR +  ++ +L D P+          GE+ + G  +
Sbjct  462  GLTETVCCGGTQF--PGSLESESIGRMIDTVELRLLDTPEYRHTDKPEPRGEILLRGPFL  519

Query  490  FMGYLNEPEKTGEALDGERWLHSGDVGKIDSNGFLHITGRIKEIIITAGGENIPPVHIEE  549
            F  Y  +   T E +D E W H+GDVG +  NG L I GR+K ++  + GE +    +E 
Sbjct  520  FKEYYKQKALTEEVIDSEGWFHTGDVGCVSKNGTLRIIGRVKALVKNSNGEYLALESLEA  579

Query  550  LVLAELPALSNA--LLIGDKRKYLTILVTLKTTVNTETSEPTDDFTEETLKWLQSIGSTS  607
                      N   +L+  +R Y+  L          T +    F +E       I  T 
Sbjct  580  TYGQNKLCTPNGVCVLVHPQRSYIAALALT-------TEQLIMPFAKE-----HKIRGTY  627

Query  608  KTISDVLKTHDPLVYEEIDKAIKRANTKSISNAQKVQKFQILPKDFSLATGELGPTLKLK  667
              I + ++     V E   +  + A  KS    + V+  ++L  +++   G L    KLK
Sbjct  628  PEILENVELRKK-VCESFQETGRAAGKKSF---EIVRDVRLLSDEWTPENGVLTAAAKLK  683

Query  668  RNVVYKKYENLIEDMYK  684
            R ++ ++Y+ LIE++++
Sbjct  684  RRIIDERYKELIEEIFR  700



Lambda      K        H
   0.314    0.131    0.366 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1387782160


Query= XP_003393005.1 actin-related protein 2 isoform X2 [Bombus
terrestris]

Length=400
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ARP2_DROME  unnamed protein product                                   705     0.0   
ARP2_CAEEL  unnamed protein product                                   608     0.0   
ARP2_DICDI  unnamed protein product                                   570     0.0   
Q387T4_TRYB2  unnamed protein product                                 378     2e-129
ACT4_CAEEL  unnamed protein product                                   365     1e-124


>ARP2_DROME unnamed protein product
Length=399

 Score = 705 bits (1820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/395 (84%), Positives = 369/395 (93%), Gaps = 1/395 (0%)

Query  1    MDSKGRKIIVCDNGTGFVKCGYAGANFPAHIFPSIVGRPIIRAVNKIGDIDVKDVLNMPD  60
            MDSKGR +IVCDNGTGFVKCGYAG+NFP HIFPS+VGRP+IRAVNKIGDI+VKD L++ D
Sbjct  1    MDSKGRNVIVCDNGTGFVKCGYAGSNFPTHIFPSMVGRPMIRAVNKIGDIEVKD-LHVDD  59

Query  61   LMVGDEASKLRSMLEISYPMQNGIVRNWEDMCHVWDYTFGKEKMNINPRECKILLTEPPM  120
            LMVGDEAS+LRS+LE+SYPM+NG+VRNW+DMCHVWDYTFG +KM+I+P   KILLTEPPM
Sbjct  60   LMVGDEASQLRSLLEVSYPMENGVVRNWDDMCHVWDYTFGPKKMDIDPTNTKILLTEPPM  119

Query  121  NPITNREKMIEVMFEKYGFAGTYIAIQAVLTLYAQGLISGVVVDSGDGVTHICPVFEEYA  180
            NP  NREKMIEVMFEKYGF   YIAIQAVLTLYAQGLISGVV+DSGDGVTHICPV+EE+A
Sbjct  120  NPTKNREKMIEVMFEKYGFDSAYIAIQAVLTLYAQGLISGVVIDSGDGVTHICPVYEEFA  179

Query  181  LPHLTRRLDIAGRDITMYLIKLLLLRGYAFNHSADFETVRMLKEKLCYIGYNIETEEKLA  240
            LPHLTRRLDIAGRDIT YLIKLLLLRGYAFNHSADFETVR++KEKLCYIGY+IE E++LA
Sbjct  180  LPHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRIMKEKLCYIGYDIEMEQRLA  239

Query  241  LETTVLVESYTLPDGRVIKVGGERFAAPEALFQPHLINVEAQGIAELVFSTIQAADIDIR  300
            LETTVLVESYTLPDGRVIKVGGERF APEALFQPHLINVE  GIAEL F+TIQAADIDIR
Sbjct  240  LETTVLVESYTLPDGRVIKVGGERFEAPEALFQPHLINVEGPGIAELAFNTIQAADIDIR  299

Query  301  SELYKHIVLSGGSTMYPGLPSRLEREIKQLYLQRVLKNDTSKLNKFKIKIEDSPRRKDMV  360
             ELYKHIVLSGGSTMYPGLPSRLEREIKQLYL+RVLKNDT KL KFKI+IED PRRKDMV
Sbjct  300  PELYKHIVLSGGSTMYPGLPSRLEREIKQLYLERVLKNDTEKLAKFKIRIEDPPRRKDMV  359

Query  361  FMGGAVLAEITKDRESVWITREEYEEKGLSVLKKL  395
            F+GGAVLAE+TKDR+  W++++EY+E+GL VL+KL
Sbjct  360  FIGGAVLAEVTKDRDGFWMSKQEYQEQGLKVLQKL  394


>ARP2_CAEEL unnamed protein product
Length=395

 Score = 608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/398 (71%), Positives = 339/398 (85%), Gaps = 8/398 (2%)

Query  1    MDSKGRKIIVCDNGTGFVKCGYAGANFPAHIFPSIVGRPIIRAVNKIGDIDVKDVLNMPD  60
            MDS+GRK+IV DNGTGFVKCGYAG NFPAHIFPS+VGRPI+R+  ++G+I++KD      
Sbjct  1    MDSQGRKVIVVDNGTGFVKCGYAGTNFPAHIFPSMVGRPIVRSTQRVGNIEIKD------  54

Query  61   LMVGDEASKLRSMLEISYPMQNGIVRNWEDMCHVWDYTFGKEKMNINPRECKILLTEPPM  120
            LMVG+E S+LR ML+I+YPM NGIVRNW+DM HVWD+TFG EK++I+P+ECK+LLTEPP+
Sbjct  55   LMVGEECSQLRQMLDINYPMDNGIVRNWDDMAHVWDHTFGPEKLDIDPKECKLLLTEPPL  114

Query  121  NPITNREKMIEVMFEKYGFAGTYIAIQAVLTLYAQGLISGVVVDSGDGVTHICPVFEEYA  180
            NP +NREKM +VMFE+YGF   Y+A+QAVLTLYAQGL++GVVVDSGDGVTHICPV+E +A
Sbjct  115  NPNSNREKMFQVMFEQYGFNSIYVAVQAVLTLYAQGLLTGVVVDSGDGVTHICPVYEGFA  174

Query  181  LPHLTRRLDIAGRDITMYLIKLLLLRGYAFNHSADFETVRMLKEKLCYIGYNIETEEKLA  240
            L HLTRRLDIAGRDIT YLIKLLL RGY FNHSADFETVR +KEKLCYI Y++E EE+LA
Sbjct  175  LHHLTRRLDIAGRDITKYLIKLLLQRGYNFNHSADFETVRQMKEKLCYIAYDVEQEERLA  234

Query  241  LETTVLVESYTLPDGRVIKVGGERFAAPEALFQPHLINVEAQGIAELVFSTIQAADIDIR  300
            LETTVL + YTLPDGRVI++GGERF APE LFQPHLINVE  G++EL+F  IQA+DID R
Sbjct  235  LETTVLSQQYTLPDGRVIRLGGERFEAPEILFQPHLINVEKAGLSELLFGCIQASDIDTR  294

Query  301  SELYKHIVLSGGSTMYPGLPSRLEREIKQLYLQRVLKNDTSKLNKFKIKIEDSPRRKDMV  360
             + YKHIVLSGG+TMYPGLPSRLE+E+KQLYL RVL  +T    KFKI+IE  P RK MV
Sbjct  295  LDFYKHIVLSGGTTMYPGLPSRLEKELKQLYLDRVLHGNTDAFQKFKIRIEAPPSRKHMV  354

Query  361  FMGGAVLAEITKDR-ESVWITREEYEEKGLS-VLKKLG  396
            F+GGAVLA + KDR +  W++++EYEE G++  + KLG
Sbjct  355  FLGGAVLANLMKDRDQDFWVSKKEYEEGGIARCMAKLG  392


>ARP2_DICDI unnamed protein product
Length=392

 Score = 570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/396 (68%), Positives = 326/396 (82%), Gaps = 10/396 (3%)

Query  1    MDSKGRKIIVCDNGTGFVKCGYAGANFPAHIFPSIVGRPIIRAVNKIGDIDVKDVLNMPD  60
            MDS   K+IV DNGTGFVKCG+AGANFP  IFPS+VGRPI+R+  K+ ++++KD+     
Sbjct  1    MDSN--KVIVMDNGTGFVKCGFAGANFPTAIFPSMVGRPILRSEEKVENVEIKDI-----  53

Query  61   LMVGDEASKLRSMLEISYPMQNGIVRNWEDMCHVWDYTFGKEKMNI-NPRECKILLTEPP  119
             MVGDEA+KLRSML+I+YP++NGI+RNW+D+ HVWDY   KEK+ + +P ECKILLTEPP
Sbjct  54   -MVGDEAAKLRSMLQITYPLENGIIRNWDDITHVWDYAL-KEKLKVSDPTECKILLTEPP  111

Query  120  MNPITNREKMIEVMFEKYGFAGTYIAIQAVLTLYAQGLISGVVVDSGDGVTHICPVFEEY  179
            MNP+ NR+KMIE MFEKYGF   Y+AIQAVLTLYAQGL++GVVVDSGDGVTHI PV+E Y
Sbjct  112  MNPVANRQKMIECMFEKYGFQAVYVAIQAVLTLYAQGLLTGVVVDSGDGVTHIIPVYEGY  171

Query  180  ALPHLTRRLDIAGRDITMYLIKLLLLRGYAFNHSADFETVRMLKEKLCYIGYNIETEEKL  239
            ++PHLTRRLD+AGRD+T YLIKLLLLRGYAFN +ADFET+R +KEKLCY+ Y+++ E KL
Sbjct  172  SIPHLTRRLDVAGRDVTRYLIKLLLLRGYAFNRTADFETIRQIKEKLCYVAYDVQQEMKL  231

Query  240  ALETTVLVESYTLPDGRVIKVGGERFAAPEALFQPHLINVEAQGIAELVFSTIQAADIDI  299
            A ETTVLVE+YTLPDGRVIKVG ERF A EALF P L++VE  G+ E +F  I  AD D+
Sbjct  232  ASETTVLVENYTLPDGRVIKVGQERFQASEALFNPSLVDVEGGGVHEQLFDCITKADRDL  291

Query  300  RSELYKHIVLSGGSTMYPGLPSRLEREIKQLYLQRVLKNDTSKLNKFKIKIEDSPRRKDM  359
            +   Y+HIVLSGGS+MYPGLPSRLE+EI+ LYL+RVLK +   L KFK +IED PRRK M
Sbjct  292  QQGFYQHIVLSGGSSMYPGLPSRLEKEIRSLYLERVLKGNKEGLAKFKCRIEDPPRRKHM  351

Query  360  VFMGGAVLAEITKDRESVWITREEYEEKGLSVLKKL  395
            VF+GGAVLA++TKDR+  WIT+ EY EKG   L KL
Sbjct  352  VFLGGAVLADLTKDRDDFWITKAEYMEKGFGALDKL  387


>Q387T4_TRYB2 unnamed protein product
Length=400

 Score = 378 bits (970),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 172/390 (44%), Positives = 270/390 (69%), Gaps = 6/390 (2%)

Query  9    IVCDNGTGFVKCGYAGANFPAHIFPSIVGRPIIRA--VNKIGDIDVKDVLNMP---DLMV  63
            +V DNG+GF+KCG+AG+NFP   F + VGRP++R   V++      KD    P   DL++
Sbjct  7    VVLDNGSGFLKCGFAGSNFPEVFFRTAVGRPVLRQTKVSEGRSSKRKDTQVDPLTKDLVL  66

Query  64   GDEASKLRSMLEISYPMQNGIVRNWEDMCHVWDYTFGKEKMNINPRECKILLTEPPMNPI  123
            GDE +    +L++++P+ NG+++N +DM ++W + F    ++I P +  +L++E P+   
Sbjct  67   GDECNGAHHLLDMTFPIHNGVIQNMDDMRYLWKHAF-HNLLSIEPEDHSLLISEAPLFSH  125

Query  124  TNREKMIEVMFEKYGFAGTYIAIQAVLTLYAQGLISGVVVDSGDGVTHICPVFEEYALPH  183
             +R K+ EVMFE++ F       Q VL+L++ GL +GV V+ G+ V+H  P+FE Y +P 
Sbjct  126  KDRVKLYEVMFEEFKFPFVQSTPQGVLSLFSNGLQTGVAVECGECVSHCTPIFEGYTIPK  185

Query  184  LTRRLDIAGRDITMYLIKLLLLRGYAFNHSADFETVRMLKEKLCYIGYNIETEEKLALET  243
              RR+D+ GR+IT +L++L+  RGY+FN S+DFETVR +KE+ CY   + + E++LALET
Sbjct  186  ANRRVDLGGRNITEFLVRLMQRRGYSFNQSSDFETVRCIKERFCYAAVDPKLEQRLALET  245

Query  244  TVLVESYTLPDGRVIKVGGERFAAPEALFQPHLINVEAQGIAELVFSTIQAADIDIRSEL  303
            TVL +++ LPDG    +G ERF A EALFQP LI+VE +GI+  +++ IQA DID+R  L
Sbjct  246  TVLEKTFLLPDGSSCSIGQERFEATEALFQPRLIDVECEGISSQLWNCIQATDIDVRFAL  305

Query  304  YKHIVLSGGSTMYPGLPSRLEREIKQLYLQRVLKNDTSKLNKFKIKIEDSPRRKDMVFMG  363
            Y H+VLSGGSTM+PG PSR+ER+++  Y +R++K D  +L++F + +ED PRR+ M F+G
Sbjct  306  YSHVVLSGGSTMFPGFPSRIERDMRAAYSERIVKGDPERLSRFPLCVEDPPRRRWMSFLG  365

Query  364  GAVLAEITKDRESVWITREEYEEKGLSVLK  393
            GA LA +T     +W++++E++E G S ++
Sbjct  366  GAALAAVTAGNHDMWLSKKEWDEGGASAIQ  395


>ACT4_CAEEL unnamed protein product
Length=376

 Score = 365 bits (937),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 182/386 (47%), Positives = 255/386 (66%), Gaps = 21/386 (5%)

Query  9    IVCDNGTGFVKCGYAGANFPAHIFPSIVGRPIIRAVNKIGDIDVKDVLNMPDLMVGDEAS  68
            +V DNG+G  K G+AG + P  +FPSIVGRP  + V  +G       +   D  VGDEA 
Sbjct  9    LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGV-MVG-------MGQKDSYVGDEAQ  60

Query  69   KLRSMLEISYPMQNGIVRNWEDMCHVWDYTFGKEKMNINPRECKILLTEPPMNPITNREK  128
              R +L + YP+++GIV NW+DM  +W +TF  E + + P E  +LLTE P+NP  NREK
Sbjct  61   SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANREK  119

Query  129  MIEVMFEKYGFAGTYIAIQAVLTLYAQGLISGVVVDSGDGVTHICPVFEEYALPHLTRRL  188
            M ++MFE +     Y+AIQAVL+LYA G  +GVV+DSGDGVTH  P++E YALPH   RL
Sbjct  120  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGVVLDSGDGVTHTVPIYEGYALPHAILRL  179

Query  189  DIAGRDITMYLIKLLLLRGYAFNHSADFETVRMLKEKLCYIGYNIETEEKLALETTVLVE  248
            D+AGRD+T YL+K+L  RGY+F  +A+ E VR +KEKLCY+  + E E   A  ++ L +
Sbjct  180  DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEK  239

Query  249  SYTLPDGRVIKVGGERFAAPEALFQPHLINVEAQGIAELVFSTIQAADIDIRSELYKHIV  308
            SY LPDG+VI VG ERF  PEALFQP  + +E+ GI E  +++I   DIDIR +LY + V
Sbjct  240  SYELPDGQVITVGNERFRCPEALFQPSFLGMESAGIHETSYNSIMKCDIDIRKDLYANTV  299

Query  309  LSGGSTMYPGLPSRLEREIKQLYLQRVLKNDTSKLNKFKIKIEDSPRRKDMVFMGGAVLA  368
            LSGG+TMYPG+  R+++EI  L             +  KIKI   P RK  V++GG++LA
Sbjct  300  LSGGTTMYPGIADRMQKEITAL-----------APSTMKIKIIAPPERKYSVWIGGSILA  348

Query  369  EITKDRESVWITREEYEEKGLSVLKK  394
             ++  ++ +WI+++EY+E G S++ +
Sbjct  349  SLSTFQQ-MWISKQEYDESGPSIVHR  373



Lambda      K        H
   0.314    0.131    0.366 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1387782160


Query= XP_003393006.1 mitochondrial RNA pseudouridine synthase rpusd4
[Bombus terrestris]

Length=347
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q38FJ3_TRYB2  unnamed protein product                                 42.7    3e-04
SERA_PLAF7  unnamed protein product                                   31.2    1.4  
Q381G5_TRYB2  unnamed protein product                                 31.2    1.5  
Q9W430_DROME  unnamed protein product                                 29.6    4.6  
Q387F7_TRYB2  unnamed protein product                                 29.3    6.2  


>Q38FJ3_TRYB2 unnamed protein product
Length=406

 Score = 42.7 bits (99),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 56/282 (20%), Positives = 109/282 (39%), Gaps = 46/282 (16%)

Query  53   NNIIYNKDGLVVLNKPYGIRRKSLDTSIIHVQSKVPNSVDYTLDDALPYIAKQLNYLNLT  112
            N +++  + ++V+NKP+G+     D           +  + ++   LP   K  N     
Sbjct  158  NMVLFKNEHVIVINKPHGLPMMPTD-----------DPQEMSIAAMLP-AWKFTNVAKPV  205

Query  113  IVKCPEIYMSGITLLAANEHVHRAIELAYARSHFQANTYWIVTVGISKQLEGQIRLGMKP  172
            +    +   SG  +LA   + HR +   + +     + YW   VG      G++R+    
Sbjct  206  VCHNLDRETSGCVVLARTRNAHRMLGRMFVKRVVPNSVYWSFCVGKPTVNYGRVRMHF--  263

Query  173  ISDPQFKHRKIILTSSWSRNEEKYRKIKLLKAEYKVLSNSTFNLCSLVELKSSTHAKNAI  232
              D    ++  I+ +  S  +      K+  AE+ V++ S     S +     T  ++  
Sbjct  264  --DITRGNKGDIIVARPSPTKTS----KVAIAEF-VVNASALEFGSFISFYPLTTRRHQE  316

Query  233  RLFAATYLYSPILGDNIYASRIQKIGNTYVRVDPFLSCPGLPKLDMKLLRLLNVRVKQQE  292
            R+ AA  L  P+LGD  Y        +  +  DP                       + +
Sbjct  317  RIMAAHALRCPVLGDAKYGGDAAFPSSLSLFWDP-----------------------ENK  353

Query  293  IIPAHIHLKSVVLP--SFFGKTLTIEAPLMPPFDWTCKQLDF  332
             +P H+H + + LP  +  G+ + + APL    + T K+L +
Sbjct  354  GLPLHLHHRKIQLPYKNTAGEFICVTAPLPTQMEKTFKKLGW  395


>SERA_PLAF7 unnamed protein product
Length=997

 Score = 31.2 bits (69),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 17/52 (33%), Positives = 27/52 (52%), Gaps = 1/52 (2%)

Query  163  EGQIRLGMKPISDPQFKHRKIILTSSWSRNEEKYRK-IKLLKAEYKVLSNST  213
            +G+IR+GM+   D Q  ++K   T S++ N E Y K + L    +K     T
Sbjct  926  DGKIRMGMRKYIDTQDVNKKHSCTRSYAFNPENYEKCVNLCNVNWKTCEEKT  977


>Q381G5_TRYB2 unnamed protein product
Length=705

 Score = 31.2 bits (69),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 30/63 (48%), Gaps = 8/63 (13%)

Query  25   LKRNYLKNHPYKHIHPWISFTQFSDDLLNNIIYNKDGLVVLNKPYGIRRKSLDTSIIHVQ  84
            L+  +L++ PY        F QFS+  L NII   + +V+ N  +   +  LD S   +Q
Sbjct  373  LRVEFLRSFPY--------FVQFSNAALENIISKAEPIVLHNNDHLFSKSELDPSAYFIQ  424

Query  85   SKV  87
              V
Sbjct  425  DGV  427


>Q9W430_DROME unnamed protein product
Length=553

 Score = 29.6 bits (65),  Expect = 4.6, Method: Compositional matrix adjust.
 Identities = 35/161 (22%), Positives = 68/161 (42%), Gaps = 19/161 (12%)

Query  146  FQANTYWIVTVGISKQLEGQIRLGMKPISDPQFKHRKIILTSSWSRNEEKYRKIKLLKAE  205
            F+  T  ++   + K+  GQ+     PI +PQ K +++   +++  N     + +LL  +
Sbjct  281  FEQPTTKLLIAEVPKREHGQLAPTFTPIFEPQRKTQRLTGLATYRDNNVDIFESELLDDD  340

Query  206  Y----KVLSNSTFNLCSLVELKSSTHAKNAIRLFAATYLYSPILGDNIYASRIQKI-GN-  259
            +    + L + +F     +E K ++ A+N +          P  G   Y  RI    GN 
Sbjct  341  FLSFERQLCHGSFCCTFSIERKVTSAAENEL----------PSSGAKSYRYRIGVYWGNE  390

Query  260  -TYVRVD--PFLSCPGLPKLDMKLLRLLNVRVKQQEIIPAH  297
             T + VD     +C      D++L     +  + +E+I  H
Sbjct  391  TTVIGVDRTEQATCALFACTDVRLASCGYIYPENEEVINTH  431


>Q387F7_TRYB2 unnamed protein product
Length=740

 Score = 29.3 bits (64),  Expect = 6.2, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 25/44 (57%), Gaps = 1/44 (2%)

Query  39   HPWISFTQFSDDLLNNIIYNKDGLVVLNKPYGIRRKSLDTSIIH  82
            HP+  F + +  + N  +  +D + +LN  +G RR S D+SI H
Sbjct  450  HPF-GFLKATLPVRNRYLKREDTIDMLNSWWGFRRNSFDSSIKH  492



Lambda      K        H
   0.314    0.131    0.366 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1387782160


Query= XP_003393007.1 alkaline ceramidase isoform X2 [Bombus terrestris]

Length=269
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ACASE_DROME  unnamed protein product                                  348     2e-121
G5EFK9_CAEEL  unnamed protein product                                 28.5    7.0   
Q38AX3_TRYB2  unnamed protein product                                 28.5    7.0   
G5EDU1_CAEEL  unnamed protein product                                 28.5    7.0   


>ACASE_DROME unnamed protein product
Length=283

 Score = 348 bits (892),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 161/266 (61%), Positives = 202/266 (76%), Gaps = 0/266 (0%)

Query  2    WKPFEAGSSPIDWCERNYSISSSIAEFMNTLSNVVFLLLPPVLMHLFRDYGRFVNPGIHV  61
            W+    GSSP+DWCE NY ISS+IAEF+NT SN +F+LLPPVL+ LF++YGRFV PGIHV
Sbjct  17   WEHLRPGSSPVDWCEGNYLISSNIAEFVNTFSNFLFILLPPVLIMLFKEYGRFVTPGIHV  76

Query  62   IWFLLMIVGLSSAYFHATLSLIGQLLDELAILWVYMAGFCMFLPRRYFPNILHNDRKLLA  121
            IW LL++VGLSS YFHATLSLIGQLLDELAILWV+MA F +F P+RY+P  + NDRK  +
Sbjct  77   IWVLLIVVGLSSMYFHATLSLIGQLLDELAILWVFMAAFSLFYPKRYYPKFVKNDRKTFS  136

Query  122  ICATLPTLIATGLSFIHPAINAFALMSLGIPAFGFMIIELKRTKSMRVYRLGLRCGAVWL  181
                L  + ATGLS+  P +NAF LM + +P    +  EL+R    RVYRLG+R   VW 
Sbjct  137  WLMLLSAIAATGLSWWKPIVNAFVLMFMSVPTMVMLYTELQRVSDQRVYRLGIRSTTVWA  196

Query  182  LAVACWLNDRLFCDTWLNLNFPYLHALWHLFIFIASYTAAVLFAYFSVKEEKPQQSPVLK  241
            +AV CW+NDR+FC+ W ++NFPYLH  WH+FIFIA+YT  VLFAYF V+ E PQ+ P+LK
Sbjct  197  VAVFCWINDRIFCEAWSSINFPYLHGFWHIFIFIAAYTVLVLFAYFYVESELPQRQPLLK  256

Query  242  YWPKNDFELGIPYVTIRSYVKLDINT  267
            YWPKN+FE GIP+++IR+  K   NT
Sbjct  257  YWPKNEFEFGIPFISIRNPGKALRNT  282


>G5EFK9_CAEEL unnamed protein product
Length=901

 Score = 28.5 bits (62),  Expect = 7.0, Method: Composition-based stats.
 Identities = 21/84 (25%), Positives = 39/84 (46%), Gaps = 7/84 (8%)

Query  163  RTKSMRVYRLGLRCGAVWLLAVACWLNDRLFCDTWLNLNFPYLHALWHLF--IFIASYTA  220
            R+    ++++GLR   ++ LAV+  L  +L    W  L   +      LF  IF+ + T+
Sbjct  813  RSSRKMIWQIGLRRNRMFSLAVSASLICQLLVIYWAPLQHIFQTEALSLFDLIFLTTITS  872

Query  221  AVLF-----AYFSVKEEKPQQSPV  239
            +V        YFS++ +     P+
Sbjct  873  SVFIFNETRKYFSLRSKSLNHDPL  896


>Q38AX3_TRYB2 unnamed protein product
Length=1594

 Score = 28.5 bits (62),  Expect = 7.0, Method: Composition-based stats.
 Identities = 23/83 (28%), Positives = 34/83 (41%), Gaps = 12/83 (14%)

Query  41   PPVLMHLFRDYGRFVNPGIHVIWFLLMIVGLSSAYFHATLSLIGQLLDEL--AILWVYMA  98
            P V MHL+R   R   PG+          G S+ Y+    ++I   LD++    L +   
Sbjct  329  PAVRMHLYRKLLRLCTPGM----------GTSNPYYLCICAIIQPFLDDVTEGSLEIVSL  378

Query  99   GFCMFLPRRYFPNILHNDRKLLA  121
              C+     YF   L  D +L A
Sbjct  379  VKCLMPHAAYFVATLTLDTRLQA  401


>G5EDU1_CAEEL unnamed protein product
Length=978

 Score = 28.5 bits (62),  Expect = 7.0, Method: Composition-based stats.
 Identities = 21/84 (25%), Positives = 39/84 (46%), Gaps = 7/84 (8%)

Query  163  RTKSMRVYRLGLRCGAVWLLAVACWLNDRLFCDTWLNLNFPYLHALWHLF--IFIASYTA  220
            R+    ++++GLR   ++ LAV+  L  +L    W  L   +      LF  IF+ + T+
Sbjct  890  RSSRKMIWQIGLRRNRMFSLAVSASLICQLLVIYWAPLQHIFQTEALSLFDLIFLTTITS  949

Query  221  AVLF-----AYFSVKEEKPQQSPV  239
            +V        YFS++ +     P+
Sbjct  950  SVFIFNETRKYFSLRSKSLNHDPL  973



Lambda      K        H
   0.314    0.131    0.366 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1387782160


Query= XP_003393008.2 alkaline ceramidase isoform X1 [Bombus terrestris]

Length=305
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ACASE_DROME  unnamed protein product                                  350     7e-122
G5EDU1_CAEEL  unnamed protein product                                 28.5    8.5   
Q38AX3_TRYB2  unnamed protein product                                 28.5    8.5   


>ACASE_DROME unnamed protein product
Length=283

 Score = 350 bits (899),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 163/272 (60%), Positives = 205/272 (75%), Gaps = 0/272 (0%)

Query  32   NIYFDMWKPFEAGSSPIDWCERNYSISSSIAEFMNTLSNVVFLLLPPVLMHLFRDYGRFV  91
            +IY   W+    GSSP+DWCE NY ISS+IAEF+NT SN +F+LLPPVL+ LF++YGRFV
Sbjct  11   DIYAMAWEHLRPGSSPVDWCEGNYLISSNIAEFVNTFSNFLFILLPPVLIMLFKEYGRFV  70

Query  92   NPGIHVIWFLLMIVGLSSAYFHATLSLIGQLLDELAILWVYMAGFCMFLPRRYFPNILHN  151
             PGIHVIW LL++VGLSS YFHATLSLIGQLLDELAILWV+MA F +F P+RY+P  + N
Sbjct  71   TPGIHVIWVLLIVVGLSSMYFHATLSLIGQLLDELAILWVFMAAFSLFYPKRYYPKFVKN  130

Query  152  DRKLLAICATLPTLIATGLSFIHPAINAFALMSLGIPAFGFMIIELKRTKSMRVYRLGLR  211
            DRK  +    L  + ATGLS+  P +NAF LM + +P    +  EL+R    RVYRLG+R
Sbjct  131  DRKTFSWLMLLSAIAATGLSWWKPIVNAFVLMFMSVPTMVMLYTELQRVSDQRVYRLGIR  190

Query  212  CGAVWLLAVACWLNDRLFCDTWLNLNFPYLHALWHLFIFIASYTAAVLFAYFSVKEEKPQ  271
               VW +AV CW+NDR+FC+ W ++NFPYLH  WH+FIFIA+YT  VLFAYF V+ E PQ
Sbjct  191  STTVWAVAVFCWINDRIFCEAWSSINFPYLHGFWHIFIFIAAYTVLVLFAYFYVESELPQ  250

Query  272  QSPVLKYWPKNDFELGIPYVTIRSYVKLDINT  303
            + P+LKYWPKN+FE GIP+++IR+  K   NT
Sbjct  251  RQPLLKYWPKNEFEFGIPFISIRNPGKALRNT  282


>G5EDU1_CAEEL unnamed protein product
Length=978

 Score = 28.5 bits (62),  Expect = 8.5, Method: Composition-based stats.
 Identities = 21/84 (25%), Positives = 39/84 (46%), Gaps = 7/84 (8%)

Query  199  RTKSMRVYRLGLRCGAVWLLAVACWLNDRLFCDTWLNLNFPYLHALWHLF--IFIASYTA  256
            R+    ++++GLR   ++ LAV+  L  +L    W  L   +      LF  IF+ + T+
Sbjct  890  RSSRKMIWQIGLRRNRMFSLAVSASLICQLLVIYWAPLQHIFQTEALSLFDLIFLTTITS  949

Query  257  AVLF-----AYFSVKEEKPQQSPV  275
            +V        YFS++ +     P+
Sbjct  950  SVFIFNETRKYFSLRSKSLNHDPL  973


>Q38AX3_TRYB2 unnamed protein product
Length=1594

 Score = 28.5 bits (62),  Expect = 8.5, Method: Composition-based stats.
 Identities = 23/83 (28%), Positives = 34/83 (41%), Gaps = 12/83 (14%)

Query  77   PPVLMHLFRDYGRFVNPGIHVIWFLLMIVGLSSAYFHATLSLIGQLLDEL--AILWVYMA  134
            P V MHL+R   R   PG+          G S+ Y+    ++I   LD++    L +   
Sbjct  329  PAVRMHLYRKLLRLCTPGM----------GTSNPYYLCICAIIQPFLDDVTEGSLEIVSL  378

Query  135  GFCMFLPRRYFPNILHNDRKLLA  157
              C+     YF   L  D +L A
Sbjct  379  VKCLMPHAAYFVATLTLDTRLQA  401



Lambda      K        H
   0.314    0.131    0.366 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1387782160


Query= XP_003393009.1 translocon-associated protein subunit beta isoform X1
[Bombus terrestris]

Length=199
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VUZ0_DROME  unnamed protein product                                 215     1e-71
SSRB_DICDI  unnamed protein product                                   69.3    9e-15
GDPP1_CAEEL  unnamed protein product                                  30.4    1.1  
IXOSB_IXOSI  unnamed protein product                                  27.7    2.1  
STAN_DROME  unnamed protein product                                   29.6    2.2  


>Q9VUZ0_DROME unnamed protein product
Length=190

 Score = 215 bits (548),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 137/188 (73%), Gaps = 1/188 (1%)

Query  12   HIIFIAFAAFLLTTYAEEEEEAARLLVSKQLLNKYLVQNMDIVIKYTVYNIGSAAALEVK  71
            H++ +     + +T   E+E  ARLLVSKQ+LNKYLV+  D++++YT++N+GS AA +V+
Sbjct  4    HLLTLFALCAVFSTCLSEDETRARLLVSKQILNKYLVEKSDLLVRYTIFNVGSGAATKVR  63

Query  72   ITDNSFHPDYFTHVSGELNARIDRVPPYTNVSHIVIVRSRKFGYFNFTSAEVLYKRKEDA  131
            + D+ FHP+ F  V G+  A +DR+ P TN +H+++VR + FGYFNFT+AEV YK  E++
Sbjct  64   LVDSGFHPEAFDVVGGQPTAVVDRIAPQTNFTHVLVVRPKAFGYFNFTAAEVSYKAVEES  123

Query  132  PNLQFAASSEPGTAIIVSFRDYDKQFSSHVVDWAAFAVMTLPSLAIPFALWYSSKSKYEK  191
              LQ A SSEPG   IV+  +Y+K+FSSH  DW AFAVMTLPSLAIP ALW+ SKSKYE+
Sbjct  124  ETLQLAVSSEPGEGGIVNLNEYNKRFSSHFFDWVAFAVMTLPSLAIPLALWHQSKSKYER  183

Query  192  LLKTTKKH  199
              K  KKH
Sbjct  184  SGK-NKKH  190


>SSRB_DICDI unnamed protein product
Length=184

 Score = 69.3 bits (168),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 83/164 (51%), Gaps = 1/164 (1%)

Query  31   EEAARLLVSKQLLNKYLVQNMDIVIKYTVYNIGSAAALEVKITDNSFHPDYFTHVSGELN  90
            E  A LL  K+++   +V   ++ I++ +YN+GS  A ++   DN F    F  VSG   
Sbjct  21   ENGAELLFHKKIVEGPVV-GKELPIQFIIYNVGSEPAYDISFIDNDFSNAEFEFVSGSSE  79

Query  91   ARIDRVPPYTNVSHIVIVRSRKFGYFNFTSAEVLYKRKEDAPNLQFAASSEPGTAIIVSF  150
             + + + P + V   + V  +K G ++ TS  + Y++ + +     ++++      + S 
Sbjct  80   GKWETLAPNSQVQTNLTVIPKKSGIYSLTSTVLNYRKTQTSSEFTVSSAASYSGMYVESQ  139

Query  151  RDYDKQFSSHVVDWAAFAVMTLPSLAIPFALWYSSKSKYEKLLK  194
             DY+K+ S  + +W  F V+   ++A+P+++    K  YE  +K
Sbjct  140  ADYEKRTSLLIKEWITFFVLCAGAIALPYSISTYYKKNYENGIK  183


>GDPP1_CAEEL unnamed protein product
Length=482

 Score = 30.4 bits (67),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 20/61 (33%), Positives = 32/61 (52%), Gaps = 2/61 (3%)

Query  6    TKSMKWHIIFIAFAAFLLTTYAEEEEEAARLLVSKQLLNKYLVQNMDIVIKYTVYNIGSA  65
            T+S + H +F+A A  + TT AE+EE+  R     QL+  Y+   M+++      N   A
Sbjct  319  TESNQAHNLFLARAQPIRTTGAEKEED--RRGERPQLVTCYVFPRMNMIGAKPPSNFNPA  376

Query  66   A  66
            A
Sbjct  377  A  377


>IXOSB_IXOSI unnamed protein product
Length=89

 Score = 27.7 bits (60),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 18/49 (37%), Positives = 24/49 (49%), Gaps = 4/49 (8%)

Query  46  YLVQNMDIVIKYTVYNIGSAAALEVKI--TDNSFHPDYFTHVSGELNAR  92
           YL  N DI I   V N  SA  L+V +  T +   P+   H SG+ + R
Sbjct  37  YLTPNADIKITAVVTNPSSAGQLKVDLWGTRSGIQPEQ--HSSGKSDVR  83


>STAN_DROME unnamed protein product
Length=3579

 Score = 29.6 bits (65),  Expect = 2.2, Method: Composition-based stats.
 Identities = 17/47 (36%), Positives = 23/47 (49%), Gaps = 3/47 (6%)

Query  97    PPYTNVSHIVIVRSRKFGYFNFTSAEVLYKRKEDAPNLQFAASSEPG  143
             PPYT    +   R+R FG  +F + E L +R      L+FA   E G
Sbjct  1548  PPYTATCEL---RARAFGRNSFLTFESLKQRHRFNLKLRFATVQENG  1591



Lambda      K        H
   0.314    0.131    0.366 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1387782160


Query= XP_003393010.1 BLOC-1-related complex subunit 8 homolog [Bombus
terrestris]

Length=170
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

IPLA_DICDI  unnamed protein product                                   28.1    5.2  
Q389X2_TRYB2  unnamed protein product                                 27.7    5.3  
NCBP2_DROME  unnamed protein product                                  27.3    5.6  
A0A0B4K785_DROME  unnamed protein product                             27.7    6.7  
A0A0B4KH06_DROME  unnamed protein product                             27.7    6.7  


>IPLA_DICDI unnamed protein product
Length=3177

 Score = 28.1 bits (61),  Expect = 5.2, Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 21/34 (62%), Gaps = 0/34 (0%)

Query  123   SVYKRLSAHIPTLDHLPNEISDVVRETANKVESM  156
             S+Y  L + I  L  LPNE++   +E+  K+ES+
Sbjct  1340  SIYAMLWSPIQKLFLLPNELTPTYKESLQKMESL  1373


>Q389X2_TRYB2 unnamed protein product
Length=1221

 Score = 27.7 bits (60),  Expect = 5.3, Method: Composition-based stats.
 Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 1/50 (2%)

Query  103  LKQQLNYEEQRRH-KKDVNRDSVYKRLSAHIPTLDHLPNEISDVVRETAN  151
            LKQ+   E +RR  +KD  R +   +    IP+L ++  ++ D  RE  N
Sbjct  842  LKQKEKVESRRRKDEKDPTRCTSDSKPKQFIPSLQNIGAQVGDNCREDGN  891


>NCBP2_DROME unnamed protein product
Length=154

 Score = 27.3 bits (59),  Expect = 5.6, Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 26/47 (55%), Gaps = 4/47 (9%)

Query  36  LAFYRLQEHVRKILPPMVDKRVEVLGL---QQQLLGRCFDVDYAVSA  79
           L+FY  +E + ++     D RV V+GL   ++   G CF V+Y V +
Sbjct  37  LSFYTTEEQIHELFSRCGDVRVIVMGLDKYKKTPCGFCF-VEYYVRS  82


>A0A0B4K785_DROME unnamed protein product
Length=1212

 Score = 27.7 bits (60),  Expect = 6.7, Method: Composition-based stats.
 Identities = 14/47 (30%), Positives = 27/47 (57%), Gaps = 5/47 (11%)

Query  46   RKILPPMVDKRVEVLGLQQQLLGRCFD-----VDYAVSAIDAMNGAG  87
            R    P +D+RV +LG+ ++L  R F+     +D  + A+ + +G+G
Sbjct  431  RTYTGPSMDERVRILGMDEKLHQRIFNDNLALIDTPLIAMGSGSGSG  477


>A0A0B4KH06_DROME unnamed protein product
Length=1217

 Score = 27.7 bits (60),  Expect = 6.7, Method: Composition-based stats.
 Identities = 14/47 (30%), Positives = 27/47 (57%), Gaps = 5/47 (11%)

Query  46   RKILPPMVDKRVEVLGLQQQLLGRCFD-----VDYAVSAIDAMNGAG  87
            R    P +D+RV +LG+ ++L  R F+     +D  + A+ + +G+G
Sbjct  431  RTYTGPSMDERVRILGMDEKLHQRIFNDNLALIDTPLIAMGSGSGSG  477



Lambda      K        H
   0.314    0.131    0.366 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1387782160


Query= XP_003393011.1 alpha-endosulfine [Bombus terrestris]

Length=109
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VUB8_DROME  unnamed protein product                                 110     1e-32
Q389Z5_TRYB2  unnamed protein product                                 27.7    2.2  
GR08A_DROME  unnamed protein product                                  26.6    4.8  
LAMB1_DROME  unnamed protein product                                  26.6    5.6  
Q381E8_TRYB2  unnamed protein product                                 26.2    5.9  


>Q9VUB8_DROME unnamed protein product
Length=119

 Score = 110 bits (275),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 75/106 (71%), Gaps = 5/106 (5%)

Query  5    QANELSETVELSSNDIEKIEEAKLRAKFPNTGRPISGHSAFLQKRLAKGQKYFDSGDYQM  64
            Q  E +E   L+  D+EKIEE KL++K+P+  R   GHSAFLQKRL KGQK+FDSGDYQM
Sbjct  16   QDTETTEQANLT--DLEKIEEEKLKSKYPSGMRVPGGHSAFLQKRLQKGQKFFDSGDYQM  73

Query  65   AKQKYTA-KPKPAGVLPTGDAIPTPETVPQRKTSIIQ--QKFNTTS  107
            AKQK    K   A  + TG+AIPTPETVP RKTSIIQ   KF  TS
Sbjct  74   AKQKGGGVKQVFANKVTTGEAIPTPETVPARKTSIIQPCNKFPATS  119


>Q389Z5_TRYB2 unnamed protein product
Length=301

 Score = 27.7 bits (60),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 17/33 (52%), Gaps = 0/33 (0%)

Query  37   RPISGHSAFLQKRLAKGQKYFDSGDYQMAKQKY  69
            R +    A L+      Q YF SGDYQ A++ Y
Sbjct  230  RAVENDPANLEFACRLAQAYFHSGDYQNARRWY  262


>GR08A_DROME unnamed protein product
Length=385

 Score = 26.6 bits (57),  Expect = 4.8, Method: Composition-based stats.
 Identities = 13/32 (41%), Positives = 19/32 (59%), Gaps = 1/32 (3%)

Query  35   TGRPISGHSAFLQKRLAKGQKYFDSGDYQMAK  66
            TGR   G  +FL++RL + Q+ + S  Y M K
Sbjct  211  TGRSFPGFESFLRRRLVQKQRIY-SHVYDMLK  241


>LAMB1_DROME unnamed protein product
Length=1788

 Score = 26.6 bits (57),  Expect = 5.6, Method: Composition-based stats.
 Identities = 14/49 (29%), Positives = 26/49 (53%), Gaps = 2/49 (4%)

Query  2     SNDQANELSETVELSSNDIEKIEEAKLRAKFP--NTGRPISGHSAFLQK  48
             + D   + +  +EL+  D+EKI+E    A+ P  NT + +   +  +QK
Sbjct  1611  AKDAIQQANSNIELAGQDLEKIDEETYSAEAPANNTAQQVEKLAKKVQK  1659


>Q381E8_TRYB2 unnamed protein product
Length=211

 Score = 26.2 bits (56),  Expect = 5.9, Method: Compositional matrix adjust.
 Identities = 11/46 (24%), Positives = 21/46 (46%), Gaps = 1/46 (2%)

Query  42   HSAFLQKRLAKGQKYFDSGDYQMAKQKYTAKPKPAGVLPTGDAIPT  87
            H   +Q ++ +G ++F  G Y+ A + Y         L + DA+  
Sbjct  73   HEMLMQMKV-RGNEFFQEGQYEAALEAYQNCIDACSALGSHDAVAV  117



Lambda      K        H
   0.314    0.131    0.366 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1387782160


Query= XP_003393015.1 39S ribosomal protein L34, mitochondrial [Bombus
terrestris]

Length=80
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

X2JKQ8_DROME  unnamed protein product                                 28.1    0.78 
Q9VXE3_DROME  unnamed protein product                                 28.1    0.81 
Q9U779_DROME  unnamed protein product                                 28.1    0.81 
X2JE40_DROME  unnamed protein product                                 28.1    0.82 
X2JC83_DROME  unnamed protein product                                 28.1    0.82 


>X2JKQ8_DROME unnamed protein product
Length=1381

 Score = 28.1 bits (61),  Expect = 0.78, Method: Composition-based stats.
 Identities = 10/25 (40%), Positives = 16/25 (64%), Gaps = 0/25 (0%)

Query  43    PNERRRIKRHGWDTRMSTLSGRKIL  67
             PN++ R + HGW  +   +S RKI+
Sbjct  1134  PNKQNRRRGHGWKRQYVIVSSRKII  1158


>Q9VXE3_DROME unnamed protein product
Length=1390

 Score = 28.1 bits (61),  Expect = 0.81, Method: Composition-based stats.
 Identities = 10/25 (40%), Positives = 16/25 (64%), Gaps = 0/25 (0%)

Query  43    PNERRRIKRHGWDTRMSTLSGRKIL  67
             PN++ R + HGW  +   +S RKI+
Sbjct  1143  PNKQNRRRGHGWKRQYVIVSSRKII  1167


>Q9U779_DROME unnamed protein product
Length=1390

 Score = 28.1 bits (61),  Expect = 0.81, Method: Composition-based stats.
 Identities = 10/25 (40%), Positives = 16/25 (64%), Gaps = 0/25 (0%)

Query  43    PNERRRIKRHGWDTRMSTLSGRKIL  67
             PN++ R + HGW  +   +S RKI+
Sbjct  1143  PNKQNRRRGHGWKRQYVIVSSRKII  1167


>X2JE40_DROME unnamed protein product
Length=1374

 Score = 28.1 bits (61),  Expect = 0.82, Method: Composition-based stats.
 Identities = 10/25 (40%), Positives = 16/25 (64%), Gaps = 0/25 (0%)

Query  43    PNERRRIKRHGWDTRMSTLSGRKIL  67
             PN++ R + HGW  +   +S RKI+
Sbjct  1143  PNKQNRRRGHGWKRQYVIVSSRKII  1167


>X2JC83_DROME unnamed protein product
Length=1381

 Score = 28.1 bits (61),  Expect = 0.82, Method: Composition-based stats.
 Identities = 10/25 (40%), Positives = 16/25 (64%), Gaps = 0/25 (0%)

Query  43    PNERRRIKRHGWDTRMSTLSGRKIL  67
             PN++ R + HGW  +   +S RKI+
Sbjct  1134  PNKQNRRRGHGWKRQYVIVSSRKII  1158



Lambda      K        H
   0.314    0.131    0.366 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1387782160


Query= XP_003393017.1 DNA repair protein complementing XP-A cells homolog
[Bombus terrestris]

Length=274
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

XPA_DROME  unnamed protein product                                    284     5e-96
Q21302_CAEEL  unnamed protein product                                 176     3e-54
G5EBR0_CAEEL  unnamed protein product                                 33.9    0.12 
Q384B1_TRYB2  unnamed protein product                                 32.3    0.52 
VINC_DICDI  unnamed protein product                                   31.6    0.72 


>XPA_DROME unnamed protein product
Length=296

 Score = 284 bits (727),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 149/298 (50%), Positives = 196/298 (66%), Gaps = 26/298 (9%)

Query  1    MSITLDVND---PSKDEELIENCQHFKERAERNRQKALLLRKSKIVSHPYIR-SENEDSG  56
            MS  +  N+   P++ +  + N Q  K R ERN+ KA  LR++K+VSHP+   + N++ G
Sbjct  1    MSAEVSTNESAPPAEKKSKLTNAQ--KARIERNQAKAQKLREAKLVSHPFKELASNKEGG  58

Query  57   K---------STSYKVQGQRVIDSGGGFLIEES-----------DELEQQMLQIISKPAP  96
                      S+  KVQG + IDSGGGFL+E+            ++  ++   I+     
Sbjct  59   THPEAALSQGSSVIKVQGTKYIDSGGGFLLEQPVMPTGVGPAGLNKSGEEAPPILDDAIA  118

Query  97   ILIDFPHCDECKNEFKDSYLLQTFNLSVCDNCRDPKGKHSLITKTEAKQEYLLKDCDLDK  156
            I + +  C EC + F DSYL   F  SVCD CRD   +++LIT+TEAK EYLLKDCD DK
Sbjct  119  IPVQYEECLECGDMFADSYLFNNFGHSVCDKCRDKDERYALITRTEAKAEYLLKDCDFDK  178

Query  157  REPPLKCIIKKNPHNANWGEMKLYLQLQIEERALQVWGSEEKLLKEKELRDVKREGAKIK  216
            REP L+ I +KNPHN  WGEMKLYL LQI +RAL+VWGSEE+L+++ E R+ KRE  K +
Sbjct  179  REPKLRYISRKNPHNVRWGEMKLYLHLQIHQRALEVWGSEEELVRQHEAREDKREEGKAR  238

Query  217  KFNKKIKQLRMQVRSSLYDKTSKASHMHEFGEDTYNEHDDTYTHTCITCGYEETYEKM  274
            K+NKK+KQLRM+VRSS+Y K +   H HEFG DTY+E +DTYTHTCITC Y ETYEKM
Sbjct  239  KYNKKMKQLRMEVRSSIYTKKTHEVHEHEFGPDTYDEEEDTYTHTCITCPYSETYEKM  296


>Q21302_CAEEL unnamed protein product
Length=241

 Score = 176 bits (445),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 99/210 (47%), Positives = 133/210 (63%), Gaps = 8/210 (4%)

Query  72   GGGFL-----IEESDELEQQMLQIISKPAPILIDFP-HCDECKNEFKDSYLLQTFNLSVC  125
            GGGF      ++E  E   +M Q   + A  LI  P +C++C     DS+L + +N +VC
Sbjct  33   GGGFCDDDDEVQERREQISEMRQKREEAAHNLIQAPENCEKCDKGLMDSWLWERYNCAVC  92

Query  126  DNCRDPKGKHSLITKTEAKQEYLLKDCDLDKREPPLKCIIKKNPHNANWGEMKLYLQLQI  185
            D CRD KG+H L+ +TE K  YLLKDCDLD R+P L+   KKNPHN  +G+MKLYL+ QI
Sbjct  93   DACRDDKGEHKLLARTEVKNTYLLKDCDLDLRKPKLRYWAKKNPHNPRYGDMKLYLKCQI  152

Query  186  EERALQVWGSEEKLLKEKELRDVKREGAKIKKFNKKIKQLRMQVRSSLYDKTSKA-SHMH  244
            E R L+V GS E L  +KELR+  +E    K+F KK+K LR Q+R +   K      H H
Sbjct  153  ETRVLEVHGSWEDLELKKELREQSKEVRSEKRFEKKLKDLRQQIRGTSGVKVDFGRPHTH  212

Query  245  EFGEDTYNEHDDTYTHTCITCGYEETYEKM  274
            EFG++T+ E +DT+  TCITC YEE +EK+
Sbjct  213  EFGKETHVE-EDTWRRTCITCEYEEVFEKL  241


>G5EBR0_CAEEL unnamed protein product
Length=309

 Score = 33.9 bits (76),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 49/94 (52%), Gaps = 16/94 (17%)

Query  3   ITLDVNDPSKDEELIENCQHFKERAERNRQKALLLRKSKIVSHPYIRSENEDSGKSTSYK  62
           + +++ND +   +L+  C       ++N ++  LL  +++  HPY+R + +     T  +
Sbjct  5   VVIELNDDAATIDLLSYC------VKKNFERVSLL--TRLEDHPYLRDDQDVVQDDT--Q  54

Query  63  VQGQRVIDSGGGFLIEESDELEQQMLQIISKPAP  96
            QG        G L++ +DE  Q+++++IS P P
Sbjct  55  SQGT------DGMLLQLNDEERQRLMKMISTPGP  82


>Q384B1_TRYB2 unnamed protein product
Length=841

 Score = 32.3 bits (72),  Expect = 0.52, Method: Composition-based stats.
 Identities = 16/41 (39%), Positives = 19/41 (46%), Gaps = 2/41 (5%)

Query  101  FPHCDECKNE--FKDSYLLQTFNLSVCDNCRDPKGKHSLIT  139
            FP C  C N   F D+ +     L  CD C+ P   HSL T
Sbjct  674  FPICPNCYNNPPFPDARVQGGRQLMACDECKHPTCYHSLAT  714


>VINC_DICDI unnamed protein product
Length=842

 Score = 31.6 bits (70),  Expect = 0.72, Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 3/67 (4%)

Query  74   GFLIEESDELEQQMLQIISKPAPILIDFPHCDECKNEFKDSY-LLQTFNLSVCDNCRDPK  132
            G L++ SDE+ QQM  I S    +  D         +  D+   +QT    + DNC DP+
Sbjct  715  GILVQLSDEIAQQMALIAS--FAMNGDVKGMITAARKIADTIKQVQTQAKHIADNCTDPR  772

Query  133  GKHSLIT  139
             K +++T
Sbjct  773  LKQNVLT  779



Lambda      K        H
   0.314    0.131    0.366 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1387782160


Query= XP_003393020.2 UDP-glucosyltransferase 2 [Bombus terrestris]

Length=516
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VGT3_DROME  unnamed protein product                                 268     1e-83
Q9V9X9_DROME  unnamed protein product                                 208     1e-60
Q93242_CAEEL  unnamed protein product                                 114     8e-27
O17757_CAEEL  unnamed protein product                                 102     4e-23
UGT52_DICDI  unnamed protein product                                  52.4    7e-07


>Q9VGT3_DROME unnamed protein product
Length=528

 Score = 268 bits (686),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 161/478 (34%), Positives = 263/478 (55%), Gaps = 9/478 (2%)

Query  19   GFNILGICPSASYSHQQPFQALMKALAVRGHNVTVISTIPSKQAIKNYEDVDLS--FSYR  76
             +N L +  +A+ SH     AL K LA  GH VT+IS    K+ IKN +DV      +  
Sbjct  24   AYNYLVVLHTAARSHYHVGSALAKGLAAAGHQVTIISPFELKKPIKNIKDVPAKSILTSM  83

Query  77   KKDCTGLRHMGAFTLLRK--NMREAN-ELCEEQLFSPAIEHLISRNKSFDAVVIEQLWYQ  133
            +     L       ++++  N  E   E+ E  L  P++  L+  N++FDAV+ E    +
Sbjct  84   QGRIANLLQSSKEPIIKQIINFHEMGIEITELLLKEPSVIELMKSNQTFDAVISEVFLNE  143

Query  134  CYYALVKHYNSPVLIGFLSVGNLPYVMDSVGNPDDPLLNPDMAYPFTNKMSLNERIWNIV  193
             ++   +H+ +P LIG  + G + +  D VG+P  P   P     F+++MSL ER+ N  
Sbjct  144  AHFGFAEHFKAP-LIGLGTFGAISWNTDLVGSPSPPSYVPSALLKFSDRMSLVERVGNQA  202

Query  194  YTTWTRMYYKYWHLPRAQEIVNKWMPDVSIE--DIDRNFSLVILGNNHVFGYPKPLLPNV  251
            + T+  ++  Y++LPR + +  K+ P+   +  D+ +N +LV+L  +    +P+P  PN+
Sbjct  203  FLTYEYIFLNYFYLPRQEVLYRKYFPNNKQDFYDMRKNTALVLLNQHVSLSFPRPYSPNM  262

Query  252  IEVHSLQITEKRETLPKDIEEFLDKAEHGAIYFSLGSNLQTHQLPVGPLTALCNALSSLR  311
            IEV  + I  KR+ LPKDI EF++ AEHG IYFS+GSNL++  LP+    AL +  + L+
Sbjct  263  IEVGGMHINRKRQPLPKDILEFIEGAEHGVIYFSMGSNLKSKTLPLEKRQALIDTFAQLK  322

Query  312  QRVLWK-HSGDMAIHPANIKFVKWAPQQAILAHPKLMVYVMQGGLQSLQEAVYYSVPVVA  370
            QRVLWK    D+   PAN+    W PQ  ILAH  ++ ++  GGL S  E++Y+  P V 
Sbjct  323  QRVLWKFEDTDLPGKPANVFISDWFPQDDILAHDNVLAFITHGGLLSTTESIYHRKPFVG  382

Query  371  IPFFGDQLFNARKILDAGIGLTLNIDTITEESVVRTLTEVIENKTYYNNIKEMSEIVKDE  430
            IP FGDQ  N  +    G G+T++ + ++   ++  + ++I N      +++MS+  +D+
Sbjct  383  IPIFGDQFLNMARAEQNGYGVTVHYEELSSAKLLAAIQKIINNPEATQRVRDMSDRYRDQ  442

Query  431  LIKPMDRAIWNVEHVIKFSKSKHLRYYGHDISLIDYYATIAILILPLFFIICYVCFVL  488
               P++RA++ VEHV +   +K+LR    D++ I Y+   A+LIL    I    C  L
Sbjct  443  QQTPLERAVYWVEHVSRHKGAKYLRSASQDLNFIQYHNLDAMLILYGGIIFVLYCIFL  500


>Q9V9X9_DROME unnamed protein product
Length=521

 Score = 208 bits (529),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 133/491 (27%), Positives = 237/491 (48%), Gaps = 35/491 (7%)

Query  19   GFNILGICPSASYSHQQPFQALMKALAVRGHNVTVISTIPSKQAIKNYEDVDLS------  72
            G  IL + P  S SH       +K+LA  GH +T +S  P ++  +N  D+ +       
Sbjct  17   GARILAVFPLPSSSHYFFALPYLKSLASLGHEITSVSPYPQREPFRNIHDIPVPEVFENF  76

Query  73   ------FSYRKKDCTGLRHMGAFTLLRKNMREANELCEEQLFSPAIEHLISRNKSFDAVV  126
                   S  +        +  + L        NE     +  P   H       FD V+
Sbjct  77   NEVLRIASTPRSTWQSSDFINEYVLNLTKTVLNNEGVRRDILGPQKPH-------FDLVI  129

Query  127  IEQLWYQCYYALVKHYNSPVLIGFLSVGNLPYVMDSVGN--PDDPLLNPDMAYPFTNKMS  184
            ++         L  ++++P+ IG  S G    + + +GN  P   L +P     F +  +
Sbjct  130  MDLWRMDVLSGLAAYFDAPI-IGMASYGTDWKIDELMGNVSPISYLQSPSSR--FYDLEA  186

Query  185  LNERIWNIVYTTWTRMYYKYWHLPRAQEIVNKWMPDVS----IEDIDRNFSLVILGNNHV  240
              ER+ +++  T++ M YK+ H+ + + + +++ P V+    + +I RNF LV++  +  
Sbjct  187  YGERLLHLMERTFSYMNYKWRHVRKQETLYSQFFPSVAERKPLSEISRNFDLVLVNQHFT  246

Query  241  FGYPKPLLPNVIEVHSLQITEKRETLPKDIEEFLDKA-EHGAIYFSLGSNLQTHQLPVGP  299
             G P+P +PN+I+V  L +    E L  +++ F+  A E G IYFSLG+N+++  L    
Sbjct  247  LGPPRPYVPNMIQVGGLHVDHSTEALSAELDHFIQGAGESGVIYFSLGTNVKSKSLSEDR  306

Query  300  LTALCNALSSLRQRVLWKHSGDM-AIHPANIKFVKWAPQQAILAHPKLMVYVMQGGLQSL  358
               L    +SL QR++WK   ++    P N+   KW PQQAILAHP + +++  GGL S 
Sbjct  307  RKVLLETFASLPQRIVWKFEDELLPGKPPNVFISKWFPQQAILAHPNVKLFITHGGLLST  366

Query  359  QEAVYYSVPVVAIPFFGDQLFNARKILDAGIGLTLNIDTITEESVVRTLTEVIENKTYYN  418
             E++++  P++ +P   DQ  N   +   G+GL LNI  +T E    T+  ++ NK++  
Sbjct  367  IESIHHGKPMLGLPCLFDQFRNMDHVRQVGLGLVLNIKQMTSEEFRSTIIRLLTNKSFEE  426

Query  419  NIKEMSEIVKDELIKPMDRAIWNVEHVIKFSKSKHLRYYGHDISLIDY-----YATIAIL  473
              +  +   +D+ +KPM+ AIW  E+V+    + H++  G D+  + Y     + T  + 
Sbjct  427  TARITAARYRDQPMKPMETAIWWTEYVLSHKGAAHMQVAGKDLGFVRYHSLDVFGTFLVG  486

Query  474  ILPLFFIICYV  484
             L +  I+ Y+
Sbjct  487  ALVILGIVTYL  497


>Q93242_CAEEL unnamed protein product
Length=530

 Score = 114 bits (284),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 114/511 (22%), Positives = 217/511 (42%), Gaps = 57/511 (11%)

Query  30   SYSHQQPFQALMKALAVRGHNVTVI-----STIPSKQAIKNY---------EDVDLSFSY  75
             +SH +   +++  L   GH+VTV+     ST  ++ +IK+          E+V   FS 
Sbjct  29   GHSHIKFVGSVVDTLVDAGHDVTVVLPVIDSTQKNRTSIKSGAKQIIIDADEEVVEIFSQ  88

Query  76   RKKDCTGLRHMGAFTLLRKNMREANELCEEQLFSPAIEHLIS--------RNKSFDAVVI  127
             +K    L +M    +    M   N     QLF      ++         +++ FD  + 
Sbjct  89   TEK---FLSNMWTMEMSNPLMMWMNPRILTQLFGKQCTKVMKLSELLDQLKSEKFDLAIT  145

Query  128  EQLWYQCYYALVKHYNSPVLIGFLSVGNLPYVMDSVGNPDDPLLNPDMAYPFTNKMSLNE  187
            E  +  C Y + ++   P  +  LS   + +V D +G P  P   P     ++++M++ +
Sbjct  146  EA-FDSCGYGIFEYLQIPAHVSILSCARMDHVSDVLGQPIAPSYVPGTQSLYSDRMTMTQ  204

Query  188  RIWN-IVYTTWTRMY-----YKYWHLPRAQEIVNKWMPDVSIEDIDRNFSLVILGNNHVF  241
            R  N + +     M+     Y+  +  +   +   W       +I    S ++  +  V 
Sbjct  205  RFLNYLQFLNGNSMFSDIGDYESANAKKLLGVERSW------REILPESSFLLTNHIPVL  258

Query  242  GYPKPLLPNVIEVHSLQITEKRETLPKDIEEFLD---KAEHGAIYFSLGSNLQTHQLPVG  298
             +P P    ++ +  + + + +ETL   +E + D         +  S GSN+++  +P  
Sbjct  259  EFPAPTFDKIVPIGGISVNKNKETL--KLEHYFDTMVSMRKKNVIISFGSNIKSMDMPDE  316

Query  299  PLTALCNALSSLRQ-RVLWKHSG----DMAIHPANIKFVKWAPQQAILAHPKLMVYVMQG  353
               +L      +     +WK+             NI  V+W PQ  +LA  ++  ++  G
Sbjct  317  YKKSLAELFQLMPDVTFIWKYENLADKKYTCGIMNINRVEWIPQTELLADSRVDAFITHG  376

Query  354  GLQSLQEAVYYSVPVVAIPFFGDQLFNARKILDAGIGLTLN-IDTITEESVVRTLTEVIE  412
            GL S+ E      P V IP F DQ  NA  +   G    L+  D    E++ +TL +V++
Sbjct  377  GLGSVTELATMGKPAVVIPIFADQTRNAEMLKRHGGAEVLHKTDLANPETLRKTLRKVMD  436

Query  413  NKTYYNNIKEMSEIVKDELIKPMDRAIWNVEHVIKFSKSKHLRYYGHDISLIDYY-----  467
            + +Y  N + ++E++ ++   P +  + +VE   +F K   +  YG   ++I+YY     
Sbjct  437  DPSYRQNAQRLAEMLNNQPTNPKETLVKHVEFAARFGKLPSMDPYGRHQNIIEYYNLDIL  496

Query  468  --ATIAILILPLFFIICYVCFVLNNLGDKRK  496
              ATI +L L ++  I  V  V+     K+K
Sbjct  497  AIATI-LLTLVVYLKIFAVGVVVRCCCGKKK  526


>O17757_CAEEL unnamed protein product
Length=542

 Score = 102 bits (255),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 121/535 (23%), Positives = 226/535 (42%), Gaps = 56/535 (10%)

Query  3    SMLLVLLLFRQFSPAIGF--NILGICPSASYSHQQPFQALMKALAVRGHNVTVI------  54
            ++LL+++ + Q    I     +L   P + +SH +    +   L   G+NVT++      
Sbjct  7    ALLLIIVYYSQTINGIERPKKVLVFMPISGHSHLKFMGTIANILQDEGYNVTLLLPILDE  66

Query  55   ---STIPSKQAIKNY-------EDVDLSFSYRK---KDCTGLRHMGAFTLLRKNMREANE  101
                T P  + IKN        E ++ +  +R    ++ T + + G    L+   + AN 
Sbjct  67   GLRDTTPLVRKIKNRILVEQSEELIEANAQFRAGGGRENTWVMNSGIIGFLKLGTKVAN-  125

Query  102  LCE---EQLFSPAIEHLIS--RNKSFDAVVIEQLWYQCYYALVKHYNSPVLIGFLSVGNL  156
            +C+   + +F    E LI+  R++ FD  + E L Y C +AL  H      I   S   L
Sbjct  126  ICKASCKNVFQN--EDLINYLRDQRFDVAISEPL-YTCGFALFDHLGIETTISTDSHLGL  182

Query  157  PYVMDSVGNPDDPLLNPDMAYPFTNKMSLNERIWNIVYTTWTRMYYKYWHLPRAQE----  212
                 + G        P +    + +M+L  R  N V +     Y+ Y+   +  E    
Sbjct  183  EVSKIAHGASISTSYLPAVFSSGSERMTLIGRAKNYVES-----YFNYYFNSKIYENELA  237

Query  213  -IVNKWMPDVSIEDIDRNFSLVILGNNHVFGYPKPLLPNVIEVHSLQITE-KRETLPKDI  270
             I   +       ++ R  + + + +N     P P     IE+  +     K+E LP++ 
Sbjct  238  GIEGIYKNGKGWRELSRKNAYMFVNSNPQMDIPSPRTSKFIEIGGISSGPVKQERLPEEY  297

Query  271  EEFLDKAEHGAIYFSLGSNLQTHQLPVGPLTALCNALSSLRQRV-LWKHSGDMA------  323
            +  L   +   +  S G+N ++  +      +L     S+     +WK+           
Sbjct  298  DRVLSLRKKNVL-ISFGTNAKSMFMSDDMKESLIKTFESMPDTTFIWKYENTTVDIVKQY  356

Query  324  -IHPANIKFVKWAPQQAILAHPKLMVYVMQGGLQSLQEAVYYSVPVVAIPFFGDQLFNAR  382
                 N+    W PQ A+LA P+L ++V  GGL S  E  +   P + +P FGDQ  NAR
Sbjct  357  NKRINNVMLTDWMPQTALLADPRLTLFVTHGGLGSTNEVAFSGKPSIMVPVFGDQTRNAR  416

Query  383  KILDAGIGLTLNIDTITEESVVR-TLTEVIENKTYYNNIKEMSEIVKDELIKPMDRAIWN  441
             +    + L L    +T    VR T+ +++ +K+Y    ++++++++++   P +  I  
Sbjct  417  MLERHEVALVLTKYDLTNFKKVRGTIRKMLNDKSYSMKAEKLAQMLRNQPESPKEIFIKY  476

Query  442  VEHVIKFSKSKHLRYYGHDISLIDYY-----ATIAILILPLFFIICYVCFVLNNL  491
               V +F K   L  Y  ++S I++Y     A ++I  + L+ I+  V    +NL
Sbjct  477  FNFVARFGKPHGLDSYAAEMSFIEFYYIDFMAILSIFSVALYMIVSKVLRASHNL  531


>UGT52_DICDI unnamed protein product
Length=1697

 Score = 52.4 bits (124),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 22/86 (26%), Positives = 46/86 (53%), Gaps = 0/86 (0%)

Query  345   KLMVYVMQGGLQSLQEAVYYSVPVVAIPFFGDQLFNARKILDAGIGLTLNIDTITEESVV  404
             K+ + +  GG  ++  ++  + P + +PFFGDQ F   +I   GIG ++  D +T +S+ 
Sbjct  1510  KVSLVISHGGAGTVAASLLAAKPTIVVPFFGDQFFWGERIKQTGIGTSIPFDILTAKSLS  1569

Query  405   RTLTEVIENKTYYNNIKEMSEIVKDE  430
               +  ++   +    + +MS ++K E
Sbjct  1570  SHIISILNEPSVRAKVNKMSHLLKRE  1595


 Score = 30.8 bits (68),  Expect = 3.5, Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 53/117 (45%), Gaps = 25/117 (21%)

Query  35    QPFQALMKALAVRGHNVTVISTIPSKQAIKNYEDVDLSFSYRKKDCTGLRHMGAFTLLRK  94
             QPF AL   L   GHNV    T+ + +  ++    +   +Y+               L  
Sbjct  1178  QPFIALSLGLKEYGHNV----TLATHELYRDLISKEFGLNYQP--------------LGG  1219

Query  95    NMREANELC-EEQLFSPA-IEHLISRNKSFDAVVIEQLWYQCYYALVKHYNSPVLIG  149
             + RE  +LC    +F+P  I+  +SR +SF    I+ L   C+ A V++ N+ VLI 
Sbjct  1220  DPRELMDLCVRNGIFTPKFIKEALSRFRSF----IDDLLLTCWKA-VQNSNTQVLIA  1271



Lambda      K        H
   0.314    0.131    0.366 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1387782160


Query= XP_003393022.1 43 kDa receptor-associated protein of the synapse
homolog isoform X1 [Bombus terrestris]

Length=537
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RAPSN_CAEEL  unnamed protein product                                  240     9e-72
Q8T089_DROME  unnamed protein product                                 36.6    0.047
Q9VI20_DROME  unnamed protein product                                 36.6    0.050
A0A0B4KFV0_DROME  unnamed protein product                             35.8    0.094
Q7K2X1_DROME  unnamed protein product                                 35.8    0.096


>RAPSN_CAEEL unnamed protein product
Length=596

 Score = 240 bits (612),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 135/421 (32%), Positives = 232/421 (55%), Gaps = 12/421 (3%)

Query  77   LDQHMARRRVEQGLKLYRAHKQQAAVRKWRGALKNIRQREDKFALLGYLYQAYMDWGKYR  136
            + Q  A++ ++ G+KLY       A+ KWR +L  +   ED+F  LGYL QA  D G+Y 
Sbjct  1    MGQRQAKQHMQAGVKLYHQRHYAQAINKWRQSLNRLNNAEDRFITLGYLAQALCDQGEYE  60

Query  137  DSIDFGHKQLCISEELDSPNMRAEAYLNLARAHERLGALDRALDYARHSLYNECDQCATA  196
              + +   Q+ ++ + +   M+ EA+LNLA+A+ERL    +AL Y + SL +      T 
Sbjct  61   GMLSYALSQMQLATDQNDSAMKCEAFLNLAKAYERLADFTKALQYGKASLEHPSMDPRTP  120

Query  197  GLVHLTVGRVHLELAGFCKALEAFQRAHKIAHSIQDPSLELQVYVGLSELFCRLHDADKS  256
            G  HLT+   HL ++ F + LE+F+ A  +A+   D  LELQ+ VGL  LF  L D  K+
Sbjct  121  GYAHLTIALAHLGMSQFQQCLESFESAMNVANETSDRLLELQICVGLGSLFTLLRDITKA  180

Query  257  ARYAARAYDLSRSLQLGDLNSRHHRAALLQMAAALRKKGELGDAHDYCSEATRLSLVSGD  316
              +   A  + +S+ + D+++++    L  ++ ALR KG L DA + C EA++L++  G+
Sbjct  181  LIFLRNALAIVQSVTVDDVHAKYRCLILYHLSVALRMKGSLVDAKEACDEASQLAVEMGN  240

Query  317  QASYARSIRIMGDIYRK------KSDINKAFRQYESAMGSAAATGDRLCQMEAMDGAARC  370
            +A +AR +  + DIYR+      K  I K++ +YE A        D++ ++  +   A+ 
Sbjct  241  RAIHARCMCSLADIYRELGESEAKETITKSWARYEDAYRVMRGANDKMGEVLVLSSMAKS  300

Query  371  LEALRLQHK-ICNCRPLEFNTRLLEVAGSVGAKFLVRTVRSRLSRIYGSLGDEEQKAHHE  429
                R  +   C C+ ++ N + +E+A  +G K +V     RL+ +Y  L D++ +    
Sbjct  301  ASESRSHYTGQCECQAIQLNKKCIEIANQIGCKHVVLKCHLRLAELYSQLNDDDSEETAR  360

Query  430  RLATAMEEDLELRCGGCNEPFGLEADSLEALPCSHILHARCAYD-ILKRRDKKKKRLCPD  488
            R A+ + ++++L C  C + +GL+ +SL+AL CSHI H +C +  +L+R D+     CP 
Sbjct  361  RAASRLTQEMQLFCNFCGQRYGLKDESLQALRCSHIFHEKCLHTYLLQRTDQT----CPK  416

Query  489  C  489
            C
Sbjct  417  C  417


>Q8T089_DROME unnamed protein product
Length=352

 Score = 36.6 bits (83),  Expect = 0.047, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 27/54 (50%), Gaps = 5/54 (9%)

Query  443  CGGCNEPFGLEADSLEALPCSHILHARCAYDILKRRDKKKKRLCPDCHKSVSSR  496
            C  C E F +E D L  LPCSH  H  C    L     + +R+CP C + V ++
Sbjct  51   CVICLEDF-IEDDKLRVLPCSHPYHTHCIDPWL----TENRRVCPICKRKVFTK  99


>Q9VI20_DROME unnamed protein product
Length=536

 Score = 36.6 bits (83),  Expect = 0.050, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 27/54 (50%), Gaps = 5/54 (9%)

Query  443  CGGCNEPFGLEADSLEALPCSHILHARCAYDILKRRDKKKKRLCPDCHKSVSSR  496
            C  C E F +E D L  LPCSH  H  C    L     + +R+CP C + V ++
Sbjct  235  CVICLEDF-IEDDKLRVLPCSHPYHTHCIDPWL----TENRRVCPICKRKVFTK  283


>A0A0B4KFV0_DROME unnamed protein product
Length=434

 Score = 35.8 bits (81),  Expect = 0.094, Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 26/58 (45%), Gaps = 6/58 (10%)

Query  439  LELRCGGCNEPFGLEADSLEALPCSHILHARCAYDILKRRDKKKKRLCPDCHKSVSSR  496
            L L C  C E FG +AD + A  C H+ H  C    L R      + CP C    ++R
Sbjct  2    LNLNCVICAELFG-QADEVFATVCGHMFHHNCLNQWLDR-----SKTCPQCRNKCTTR  53


>Q7K2X1_DROME unnamed protein product
Length=435

 Score = 35.8 bits (81),  Expect = 0.096, Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 26/58 (45%), Gaps = 6/58 (10%)

Query  439  LELRCGGCNEPFGLEADSLEALPCSHILHARCAYDILKRRDKKKKRLCPDCHKSVSSR  496
            L L C  C E FG +AD + A  C H+ H  C    L R      + CP C    ++R
Sbjct  2    LNLNCVICAELFG-QADEVFATVCGHMFHHNCLNQWLDR-----SKTCPQCRNKCTTR  53



Lambda      K        H
   0.314    0.131    0.366 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1387782160


Query= XP_003393028.1 clavesin-2 [Bombus terrestris]

Length=314
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VM12_DROME  unnamed protein product                                 118     3e-31
PINTA_DROME  unnamed protein product                                  73.2    9e-15
Q9W324_DROME  unnamed protein product                                 50.8    7e-07
Q9W323_DROME  unnamed protein product                                 50.8    7e-07
Q8IRM7_DROME  unnamed protein product                                 50.8    7e-07


>Q9VM12_DROME unnamed protein product
Length=294

 Score = 118 bits (296),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 83/248 (33%), Positives = 123/248 (50%), Gaps = 4/248 (2%)

Query  13   LSESTRTIARVELREDDAIREETLKQFRDWIQKHPNIKRCRTDAAFLLRFLRTKKFSVPM  72
            L   T  IARVELRE + ++ E + + R+ ++  P +   + D AFL  FLR   F    
Sbjct  18   LKPETVEIARVELRETEEVKAEAIIKLRELLKATPELNY-KDDDAFLTVFLRACHFYPEG  76

Query  73   AEEMLERYLTIRQLYPNWFQNLDVEDKDIEAIIDAGYLIPLMQRDRHGRRV-ILSCAGRF  131
            A E ++   + R+ Y +  + L VE    E  +    +  L   D+ GRRV I++C   +
Sbjct  77   ALEKMKTTASFRKEYASLVRGLLVEQVK-EKFVKGSVINVLKNCDQKGRRVLIVNCGKLW  135

Query  132  DPYKYTSAQMARAHSLVVESLMDDEENQVRGYTHINDESGLTMGHLSAWSLTDIRNMLRC  191
            DP   TS +M R   +V  +   +EE QVRG   I D  GL+M  + A S +  + +L  
Sbjct  136  DPSDITSDEMFRMLYMVHLAAQLEEETQVRGVVCIMDFEGLSMKQVKALSPSFSKRLLTF  195

Query  192  IQNSTPMRHKETHFVNIPSCAIKVIEFGISLLNDKLKNRILVHKS-LDELKTAIDPRILP  250
            IQ + P+R KE HFV  P     V       +  KL NR+  H S +  L+  +DP +LP
Sbjct  196  IQEAMPLRMKEVHFVKQPFIFNMVWSLFKPFVKQKLNNRMHFHGSDMKSLQKFLDPSVLP  255

Query  251  KEYGGEIP  258
              Y G +P
Sbjct  256  ANYKGTLP  263


>PINTA_DROME unnamed protein product
Length=273

 Score = 73.2 bits (178),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 71/280 (25%), Positives = 122/280 (44%), Gaps = 28/280 (10%)

Query  14   SESTRTIARVELREDDAIREETLKQFRD---WIQKHPNIKRCRTDAAFLLRFLRTKKFSV  70
            S S R +A       D   E  L Q +D   W+  +P I  C T    L  FLRT KF V
Sbjct  6    SSSKRQVATT-----DGDPERVLAQVQDLSDWLVANPQINGCNTFEN-LHFFLRTSKFDV  59

Query  71   PMAEEMLERYLTIRQLYPNWFQNLDVEDKDIEAIIDAGYLIPLMQRDRHGRRVILSCAGR  130
              A++ L+ +  +R     WF N D +  +I+ ++  G  +P+   D   R V++     
Sbjct  60   ERAKKKLKTFYQMRAERTEWFDNRDPQLPEIQDLLKLGVFLPI-GPDAEQRMVVVIRTAA  118

Query  131  FDPYKYTSAQMARAHSLVVESLMD-DEENQVRGYTHINDESGLTMGHLSAWSLTDIRNML  189
             DP  ++   + +   ++++ L+  D E   RG   I D  G+ +GH    +   I+   
Sbjct  119  HDPKLHSQNNVFKTSKMILDLLLKLDPETCARGMVAILDMQGVQLGHALQMNPKLIK---  175

Query  190  RCIQNST--PMRHKETHFVNIPSCAIKVIEFGISLLNDKLKNRILVHKSLDELKTAIDPR  247
            R +++ T  P + K   F N P      +      +  K+++R+ V +      T++   
Sbjct  176  RSVESWTAYPCQPKLLEFTNAPRHVNFFLNTFRIFMTPKIRSRLFVRRE----GTSVSCD  231

Query  248  ILPKEYGGE-IPLCEMIANFKKTLREQRNRIKELDDMYIE  286
             LPKE GG+ +   E+   +K+ + E         D Y+E
Sbjct  232  QLPKELGGQGLSYMELSVKWKQLVEENA-------DFYVE  264


>Q9W324_DROME unnamed protein product
Length=802

 Score = 50.8 bits (120),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 45/201 (22%), Positives = 84/201 (42%), Gaps = 12/201 (6%)

Query  60   LRFLRTKKFSVPMAEEMLERYLTIRQLYPNWFQNLDVEDKDIEAIIDAGYLIPLMQRDRH  119
            ++FL  +KF +P A  + E++  IR     +  N+D + + + + +  G    L  R   
Sbjct  99   VKFLYARKFDIPRAVSLYEQHEQIR--LKEYLYNIDPDVEPLRSELQTGKFTILPARTSS  156

Query  120  GRRVILSCAGRFDPYKYTSAQMARAHSLVVESLMDDEENQVRGYTHINDESGLTMGHLSA  179
            G  + L  A R  P   +     +     ++S + D E Q  G   I D SG    +   
Sbjct  157  GAAIALFTANRHSPLSVSHTTTLQGIVYQLDSALQDSETQRAGLVFIYDMSGSKYSNFD-  215

Query  180  WSLTDIRNMLRCIQNSTPMRHKETHFVNIP---SCAIKVIEFGISLLNDKLKNRILVHKS  236
            + L+  + +L  ++   P R K+   V  P       K++      + +KL+ R+    S
Sbjct  216  YDLS--QKILTLLKGGYPARLKKVLIVTAPLWFKAPFKILRL---FVREKLRERVFT-VS  269

Query  237  LDELKTAIDPRILPKEYGGEI  257
            + +L   +  + LP   GG +
Sbjct  270  VPQLALHVPRKALPIHLGGTL  290


>Q9W323_DROME unnamed protein product
Length=827

 Score = 50.8 bits (120),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 45/201 (22%), Positives = 84/201 (42%), Gaps = 12/201 (6%)

Query  60   LRFLRTKKFSVPMAEEMLERYLTIRQLYPNWFQNLDVEDKDIEAIIDAGYLIPLMQRDRH  119
            ++FL  +KF +P A  + E++  IR     +  N+D + + + + +  G    L  R   
Sbjct  124  VKFLYARKFDIPRAVSLYEQHEQIR--LKEYLYNIDPDVEPLRSELQTGKFTILPARTSS  181

Query  120  GRRVILSCAGRFDPYKYTSAQMARAHSLVVESLMDDEENQVRGYTHINDESGLTMGHLSA  179
            G  + L  A R  P   +     +     ++S + D E Q  G   I D SG    +   
Sbjct  182  GAAIALFTANRHSPLSVSHTTTLQGIVYQLDSALQDSETQRAGLVFIYDMSGSKYSNFD-  240

Query  180  WSLTDIRNMLRCIQNSTPMRHKETHFVNIP---SCAIKVIEFGISLLNDKLKNRILVHKS  236
            + L+  + +L  ++   P R K+   V  P       K++      + +KL+ R+    S
Sbjct  241  YDLS--QKILTLLKGGYPARLKKVLIVTAPLWFKAPFKILRL---FVREKLRERVFT-VS  294

Query  237  LDELKTAIDPRILPKEYGGEI  257
            + +L   +  + LP   GG +
Sbjct  295  VPQLALHVPRKALPIHLGGTL  315


>Q8IRM7_DROME unnamed protein product
Length=797

 Score = 50.8 bits (120),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 45/201 (22%), Positives = 84/201 (42%), Gaps = 12/201 (6%)

Query  60   LRFLRTKKFSVPMAEEMLERYLTIRQLYPNWFQNLDVEDKDIEAIIDAGYLIPLMQRDRH  119
            ++FL  +KF +P A  + E++  IR     +  N+D + + + + +  G    L  R   
Sbjct  94   VKFLYARKFDIPRAVSLYEQHEQIR--LKEYLYNIDPDVEPLRSELQTGKFTILPARTSS  151

Query  120  GRRVILSCAGRFDPYKYTSAQMARAHSLVVESLMDDEENQVRGYTHINDESGLTMGHLSA  179
            G  + L  A R  P   +     +     ++S + D E Q  G   I D SG    +   
Sbjct  152  GAAIALFTANRHSPLSVSHTTTLQGIVYQLDSALQDSETQRAGLVFIYDMSGSKYSNFD-  210

Query  180  WSLTDIRNMLRCIQNSTPMRHKETHFVNIP---SCAIKVIEFGISLLNDKLKNRILVHKS  236
            + L+  + +L  ++   P R K+   V  P       K++      + +KL+ R+    S
Sbjct  211  YDLS--QKILTLLKGGYPARLKKVLIVTAPLWFKAPFKILRL---FVREKLRERVFT-VS  264

Query  237  LDELKTAIDPRILPKEYGGEI  257
            + +L   +  + LP   GG +
Sbjct  265  VPQLALHVPRKALPIHLGGTL  285



Lambda      K        H
   0.314    0.131    0.366 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1387782160


Query= XP_003393030.1 facilitated trehalose transporter Tret1 isoform X2
[Bombus terrestris]

Length=639
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TRET1_APILI  unnamed protein product                                  813     0.0  
TRET1_ANOGA  unnamed protein product                                  666     0.0  
TRE12_DROME  unnamed protein product                                  635     0.0  
TRET1_POLVA  unnamed protein product                                  635     0.0  
TRE11_DROME  unnamed protein product                                  614     0.0  


>TRET1_APILI unnamed protein product
Length=502

 Score = 813 bits (2100),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/501 (78%), Positives = 450/501 (90%), Gaps = 2/501 (0%)

Query  137  GVELTKPSMSSQNVKPTKDSDTVMRTQFQKEPKPSIMRYANQVLAALSVSMCSMVVGYSS  196
            GVE TK +MSSQN+KP KDSD V+ TQF KE K S MRY  Q+LAAL+VSM S+++GYSS
Sbjct  2    GVENTKQTMSSQNIKPAKDSDDVLHTQF-KEVKRSPMRYTMQLLAALAVSMASLMIGYSS  60

Query  197  SYTSPGLVSMRDNATATFEVTKETGMWIGSIMPLSALFGGMIGGPSIEYLGRRNTILATA  256
            SYTSP LVSMRDN TATFEVT +  MWIGSIMPLSAL GG+IGGP IEY+GRRNTIL+TA
Sbjct  61   SYTSPALVSMRDNTTATFEVTMDMAMWIGSIMPLSALIGGIIGGPCIEYIGRRNTILSTA  120

Query  257  LPFIAAWLLISLAANVAMVLAGRALCGFCVGIASLSLPVYLGETIQAEVRGTLGLLPTAF  316
            LPF+A WL I+LA NVAM+L GR++CGFCVG+ASLSLPVYLGE+IQ EVRG+LGLLPT F
Sbjct  121  LPFLAGWLFIALATNVAMILVGRSICGFCVGVASLSLPVYLGESIQPEVRGSLGLLPTVF  180

Query  317  GNTGILVCFIAGMYLDWRNLALLGAALPIPFMILMFVIPETPRWYISKGKTKRARKSLQW  376
            GN+GIL+CF AGMYL WRNLALLGA +PI F+ILMF+IPETPRWYISKGK K ARKSLQW
Sbjct  181  GNSGILMCFTAGMYLAWRNLALLGACIPIIFLILMFLIPETPRWYISKGKIKEARKSLQW  240

Query  377  LRGKGTDITDELSSVQKLHTESERNVSQGAFMQLFKKNHLKPLFISLGLMFFQQFSGINA  436
            LRGK  DI++EL S+QK+H ESER  ++GA ++LF+KNH+KP+FISLGLMFFQQFSGINA
Sbjct  241  LRGKTADISEELDSIQKMHIESERIATEGALIELFRKNHIKPVFISLGLMFFQQFSGINA  300

Query  437  VIFYTVQIFRDAGSSIDENISTIVVGIVNFISTFVAASVIDRLGRKMLLYISAISMCLTL  496
            VIFYTVQIF+D+GS++DEN+STI+VG+VNFISTFVAA +IDRLGRKMLLYIS+I MC+TL
Sbjct  301  VIFYTVQIFKDSGSTVDENLSTIIVGLVNFISTFVAAMIIDRLGRKMLLYISSILMCITL  360

Query  497  FTFGTFFYVKATGVDVTAFGWIPLMSLIVYVIGFSLGFGPIPWLMMGEILPVKIRGSAAS  556
            FTFGTFFYVK   +DVTAFGWIPLMSLIVYVIGFS GFGPIPWLMMGEILPVKIRG+AAS
Sbjct  361  FTFGTFFYVKEL-MDVTAFGWIPLMSLIVYVIGFSFGFGPIPWLMMGEILPVKIRGTAAS  419

Query  557  VATAFNWSCTFIVTKTYEDIVSVIGPYGTFWMFGTIVLVGFVFVIVSVPETRGRSLEEIE  616
            VATAFNWSCTF+VTKTYED+V  IGPYGTFW+FGT+V V F+FVI+ VPETRGRSLEEIE
Sbjct  420  VATAFNWSCTFVVTKTYEDLVLHIGPYGTFWLFGTLVAVAFIFVIICVPETRGRSLEEIE  479

Query  617  KRFTGPVRRMSAVANMKPMPM  637
            +RF GPVRR SA+AN+KPMP+
Sbjct  480  RRFAGPVRRTSAIANLKPMPI  500


>TRET1_ANOGA unnamed protein product
Length=793

 Score = 666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/482 (67%), Positives = 389/482 (81%), Gaps = 9/482 (2%)

Query  163  QFQKEPKPSIMRYA---------NQVLAALSVSMCSMVVGYSSSYTSPGLVSMRDNATAT  213
            Q  +E KP +  Y           QVLAALSVS+ SMVVG+SS+YTSP LVSM+D    +
Sbjct  308  QITEEGKPKLEVYRPTTNPIYIWTQVLAALSVSLGSMVVGFSSAYTSPALVSMKDRNITS  367

Query  214  FEVTKETGMWIGSIMPLSALFGGMIGGPSIEYLGRRNTILATALPFIAAWLLISLAANVA  273
            FEVT ++G W+G IMPL+ L GG++GGP IEYLGR+NTILATA PFI +WLLI  A +VA
Sbjct  368  FEVTDQSGSWVGGIMPLAGLAGGILGGPMIEYLGRKNTILATATPFIISWLLIGCATHVA  427

Query  274  MVLAGRALCGFCVGIASLSLPVYLGETIQAEVRGTLGLLPTAFGNTGILVCFIAGMYLDW  333
            MVL GRAL G CVGIASLSLPVYLGET+Q EVRGTLGLLPTAFGN GIL+CF+AG YLDW
Sbjct  428  MVLVGRALSGLCVGIASLSLPVYLGETVQPEVRGTLGLLPTAFGNIGILLCFVAGKYLDW  487

Query  334  RNLALLGAALPIPFMILMFVIPETPRWYISKGKTKRARKSLQWLRGKGTDITDELSSVQK  393
              LA LGAALPIPF++LMF+IPETPRWY+S+ +  RARK+LQWLRG+  D+  EL  + K
Sbjct  488  SGLAFLGAALPIPFLLLMFLIPETPRWYVSRNREDRARKALQWLRGRKADVEPELKGISK  547

Query  394  LHTESERNVSQGAFMQLFKKNHLKPLFISLGLMFFQQFSGINAVIFYTVQIFRDAGSSID  453
             H ++ER+ S  A + L  K +LKPL ISLGLMFFQQ SGINAVIFYTVQIF+ AGS+ID
Sbjct  548  SHQDAERHASSSAMLDLLNKANLKPLLISLGLMFFQQLSGINAVIFYTVQIFQSAGSTID  607

Query  454  ENISTIVVGIVNFISTFVAASVIDRLGRKMLLYISAISMCLTLFTFGTFFYVKATGVDVT  513
            E + TI+VG+VNFI+TF+A  +IDRLGRK+LLYIS ++M +TL T GTFFY+K  G DV+
Sbjct  608  EKLCTIIVGVVNFIATFIATVLIDRLGRKILLYISDVAMIITLMTLGTFFYMKNNGDDVS  667

Query  514  AFGWIPLMSLIVYVIGFSLGFGPIPWLMMGEILPVKIRGSAASVATAFNWSCTFIVTKTY  573
              GW+PL + +V+V+GFSLGFGPIPWLMMGEILP KIRGSAASVATAFNWSCTF+VTKT+
Sbjct  668  EIGWLPLAAFVVFVVGFSLGFGPIPWLMMGEILPGKIRGSAASVATAFNWSCTFVVTKTF  727

Query  574  EDIVSVIGPYGTFWMFGTIVLVGFVFVIVSVPETRGRSLEEIEKRFTGPVRRMSAVANMK  633
             DI + IG +G FWMFG+I +VG +FVIV VPET+G+SLE+IE++  G VRRMS+VAN+K
Sbjct  728  ADITASIGNHGAFWMFGSICIVGLLFVIVYVPETQGKSLEDIERKMMGRVRRMSSVANIK  787

Query  634  PM  635
            P+
Sbjct  788  PL  789


>TRE12_DROME unnamed protein product
Length=488

 Score = 635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/460 (65%), Positives = 374/460 (81%), Gaps = 1/460 (0%)

Query  177  NQVLAALSVSMCSMVVGYSSSYTSPGLVSMRDNATATFEVTKETGMWIGSIMPLSALFGG  236
            +QVLAALSVS+CS+VVG+ S+YTSP LVSM D    +FEVTK+ G W+G IMPL+AL GG
Sbjct  27   SQVLAALSVSLCSLVVGFVSAYTSPALVSMTDRTITSFEVTKDAGSWVGGIMPLAALAGG  86

Query  237  MIGGPSIEYLGRRNTILATALPFIAAWLLISLAANVAMVLAGRALCGFCVGIASLSLPVY  296
            + GGP IEYLGRR+TILATA+PFI + LLI+ A NV M+L GR L GFCVGIASLSLPVY
Sbjct  87   ITGGPLIEYLGRRSTILATAVPFIVSSLLIACAVNVIMILCGRFLTGFCVGIASLSLPVY  146

Query  297  LGETIQAEVRGTLGLLPTAFGNTGILVCFIAGMYLDWRNLALLGAALPIPFMILMFVIPE  356
            LGET+Q EVRGTLGLLPTA GN GILVC++AG +++W  LA LGAALP+PF+ILM +IPE
Sbjct  147  LGETLQPEVRGTLGLLPTALGNIGILVCYVAGSFMNWSMLAFLGAALPVPFLILMIIIPE  206

Query  357  TPRWYISKGKTKRARKSLQWLRGKGTDITDELSSVQKLHTESERNVSQGAFMQLFKKNHL  416
            TPRW++++G+ +RARK+L+WLRGK  D+  EL  + +   +++R  +Q   ++LFK+N+L
Sbjct  207  TPRWFVNRGQEERARKALKWLRGKEADVEPELKELMQSQADADRQATQNTCLELFKRNNL  266

Query  417  KPLFISLGLMFFQQFSGINAVIFYTVQIFRDAGSSIDENISTIVVGIVNFISTFVAASVI  476
            KPL ISLGLMFFQQFSGINAVIFYTVQIF+DAGS+ID N+STI+VG+VNF +TF+   +I
Sbjct  267  KPLSISLGLMFFQQFSGINAVIFYTVQIFKDAGSTIDSNLSTIIVGVVNFFATFMGIILI  326

Query  477  DRLGRKMLLYISAISMCLTLFTFGTFFYVKATGVDVTAFGWIPLMSLIVYVIGFSLGFGP  536
            DRLGRK+LLY+S I+M +TL   G FFY KA G DV+  GW+PL   ++Y++GFSLGFGP
Sbjct  327  DRLGRKILLYVSDIAMIVTLSILGGFFYCKAHGPDVSHLGWLPLTCFVIYILGFSLGFGP  386

Query  537  IPWLMMGEILPVKIRGSAASVATAFNWSCTFIVTKTYEDIVSVIGPYGTFWMFGTIVLVG  596
            IPWLMMGEILP KIRG AASV TAFNW CTF+VTKT++D+   +G +G FW+FG I +VG
Sbjct  387  IPWLMMGEILPAKIRGPAASVVTAFNWFCTFVVTKTFQDLTVAMGAHGAFWLFGAICIVG  446

Query  597  FVFVIVSVPETRGRSLEEIEKRFTGPVRRMSAVANMKPMP  636
              FVI+ VPETRG+SLEEIE++  G V  MS+V N+KP P
Sbjct  447  LFFVIIFVPETRGKSLEEIERKMMGRV-PMSSVVNIKPFP  485


>TRET1_POLVA unnamed protein product
Length=504

 Score = 635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/458 (67%), Positives = 377/458 (82%), Gaps = 0/458 (0%)

Query  178  QVLAALSVSMCSMVVGYSSSYTSPGLVSMRDNATATFEVTKETGMWIGSIMPLSALFGGM  237
            Q+LAA++VSM SMVVG++S+YTSP LVSM++    +F+VT++   W+G IMPL+ L GG+
Sbjct  43   QILAAIAVSMGSMVVGFASAYTSPALVSMQNTTITSFKVTEQEASWVGGIMPLAGLAGGI  102

Query  238  IGGPSIEYLGRRNTILATALPFIAAWLLISLAANVAMVLAGRALCGFCVGIASLSLPVYL  297
             GGP IEYLGR+NTILATA+PFI AWLLI+ A ++ MVLAGRAL GFCVGIASLSLPVYL
Sbjct  103  AGGPFIEYLGRKNTILATAVPFIVAWLLIAFANSIWMVLAGRALSGFCVGIASLSLPVYL  162

Query  298  GETIQAEVRGTLGLLPTAFGNTGILVCFIAGMYLDWRNLALLGAALPIPFMILMFVIPET  357
            GET+Q EVRGTLGLLPTAFGN GIL+CF+AG Y++W  LA +G+ LPIPFM+L  +IPET
Sbjct  163  GETVQPEVRGTLGLLPTAFGNIGILICFVAGKYVNWSGLAFIGSILPIPFMVLTLLIPET  222

Query  358  PRWYISKGKTKRARKSLQWLRGKGTDITDELSSVQKLHTESERNVSQGAFMQLFKKNHLK  417
            PRW++++G+ +RARK+LQWLRGK  D+  EL  + K H E+ER+ SQ A   L K+++LK
Sbjct  223  PRWFVTRGREERARKALQWLRGKKADVEPELKGIVKSHCEAERHASQNAIFDLMKRSNLK  282

Query  418  PLFISLGLMFFQQFSGINAVIFYTVQIFRDAGSSIDENISTIVVGIVNFISTFVAASVID  477
            PL I+LGLMFFQQ SGINAVIFYTV IF+DAGS+IDEN+ TI+VG+VNF +TF A  +ID
Sbjct  283  PLLIALGLMFFQQLSGINAVIFYTVSIFKDAGSTIDENLCTIIVGVVNFGATFFATVLID  342

Query  478  RLGRKMLLYISAISMCLTLFTFGTFFYVKATGVDVTAFGWIPLMSLIVYVIGFSLGFGPI  537
            RLGRK+LLYIS ++M +TL T GTFFY K +G DV+  GW+PL S ++YVIGFS G GPI
Sbjct  343  RLGRKILLYISEVAMVITLLTLGTFFYYKNSGNDVSNIGWLPLASFVIYVIGFSSGVGPI  402

Query  538  PWLMMGEILPVKIRGSAASVATAFNWSCTFIVTKTYEDIVSVIGPYGTFWMFGTIVLVGF  597
            PWLM+GEILP KIRGSAASVAT FNW+CTFIVTKT+ DIV+ IG +G FW FG I L+G 
Sbjct  403  PWLMLGEILPGKIRGSAASVATGFNWTCTFIVTKTFADIVAAIGNHGAFWFFGVICLIGL  462

Query  598  VFVIVSVPETRGRSLEEIEKRFTGPVRRMSAVANMKPM  635
             FVI  VPET+G+SLEEIE++  G VRRMS+VANMKP+
Sbjct  463  FFVIFFVPETQGKSLEEIERKMMGRVRRMSSVANMKPL  500


>TRE11_DROME unnamed protein product
Length=857

 Score = 614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/458 (66%), Positives = 373/458 (81%), Gaps = 0/458 (0%)

Query  178  QVLAALSVSMCSMVVGYSSSYTSPGLVSMRDNATATFEVTKETGMWIGSIMPLSALFGGM  237
            QVLAALSVS+ S+VVG+ S+YTSP LVSM D    +FEVT++ G W+G IMPL+ L GG+
Sbjct  396  QVLAALSVSLGSLVVGFVSAYTSPALVSMTDRNITSFEVTQDAGSWVGGIMPLAGLAGGI  455

Query  238  IGGPSIEYLGRRNTILATALPFIAAWLLISLAANVAMVLAGRALCGFCVGIASLSLPVYL  297
             GGP IEYLGRRNTILATA+PFI + LLI+ A NVAMVL GR L GFCVGIASLSLPVYL
Sbjct  456  AGGPLIEYLGRRNTILATAVPFIVSSLLIACAVNVAMVLCGRFLAGFCVGIASLSLPVYL  515

Query  298  GETIQAEVRGTLGLLPTAFGNTGILVCFIAGMYLDWRNLALLGAALPIPFMILMFVIPET  357
            GET+Q EVRGTLGLLPTAFGN GIL+CF+AG +++W  LA LGAALP+PF+ILMF+IPET
Sbjct  516  GETVQPEVRGTLGLLPTAFGNIGILLCFVAGSFMNWSMLAFLGAALPVPFLILMFLIPET  575

Query  358  PRWYISKGKTKRARKSLQWLRGKGTDITDELSSVQKLHTESERNVSQGAFMQLFKKNHLK  417
            PRW++ +G  +RARK+L+WLRGK  D+  EL  + +   +++R  S+   ++L K N+LK
Sbjct  576  PRWFVGRGLEERARKALKWLRGKEADVEPELKGLMRSQADADRQASRNTMLELLKLNNLK  635

Query  418  PLFISLGLMFFQQFSGINAVIFYTVQIFRDAGSSIDENISTIVVGIVNFISTFVAASVID  477
            PL ISLGLMFFQQFSGINAVIFYTVQIF+DAGS+ID N+ TI+VGIVNF++TF+   +ID
Sbjct  636  PLSISLGLMFFQQFSGINAVIFYTVQIFKDAGSTIDGNLCTIIVGIVNFLATFIGIVLID  695

Query  478  RLGRKMLLYISAISMCLTLFTFGTFFYVKATGVDVTAFGWIPLMSLIVYVIGFSLGFGPI  537
            R GRK+LLY+S I+M LTLF  G FFY K  G DV+  GW+PL   ++Y++GFSLGFGPI
Sbjct  696  RAGRKILLYVSDIAMVLTLFVLGGFFYCKTYGPDVSHLGWLPLTCFVIYILGFSLGFGPI  755

Query  538  PWLMMGEILPVKIRGSAASVATAFNWSCTFIVTKTYEDIVSVIGPYGTFWMFGTIVLVGF  597
            PWLMMGEILP KIRGSAASVATAFNW CTF+VTKT++D+   +G +G FW+FG I  VG 
Sbjct  756  PWLMMGEILPAKIRGSAASVATAFNWFCTFVVTKTFQDLTVAMGAHGAFWLFGAICFVGL  815

Query  598  VFVIVSVPETRGRSLEEIEKRFTGPVRRMSAVANMKPM  635
             FVI+ VPET+G++LE+IE++  G VRRMS+VAN+KP+
Sbjct  816  FFVIIYVPETQGKTLEDIERKMMGRVRRMSSVANIKPL  853



Lambda      K        H
   0.314    0.131    0.366 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1387782160


Query= XP_003393031.1 RING-box protein 2 [Bombus terrestris]

Length=110
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7JWH5_DROME  unnamed protein product                                 175     3e-58
RBX1A_DROME  unnamed protein product                                  100     5e-29
RBX1_CAEEL  unnamed protein product                                   99.8    2e-28
RBX1B_DROME  unnamed protein product                                  96.7    4e-27
Q38DY9_TRYB2  unnamed protein product                                 60.5    2e-13


>Q7JWH5_DROME unnamed protein product
Length=113

 Score = 175 bits (443),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 98/113 (87%), Gaps = 3/113 (3%)

Query  1    MAETEQDLGDRA--DNDNLKPDKLFILKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQ  58
            MA+  ++  DR   D D  KP+K+F LKKWNAVAMWSWDVECD CAICRVQVMD+CLRCQ
Sbjct  1    MADDPENSVDRPTDDGDAGKPEKMFTLKKWNAVAMWSWDVECDICAICRVQVMDSCLRCQ  60

Query  59   AESKKDD-SRQDCVVVWGECNHSFHYCCMSLWVQQNNRCPLCQQEWSIQRMGK  110
            A++K+D   RQDCVVVWGECNHSFH+CCMSLWV+QNNRCPLCQQEWSIQRMGK
Sbjct  61   ADNKRDVMGRQDCVVVWGECNHSFHHCCMSLWVKQNNRCPLCQQEWSIQRMGK  113


>RBX1A_DROME unnamed protein product
Length=108

 Score = 100 bits (250),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 68/107 (64%), Gaps = 1/107 (1%)

Query  3    ETEQDLGDRADNDNLKPDKLFILKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAESK  62
            E ++D  +   + +    K F +KKWNAVA+W+WD+  D CAICR  +MD C+ CQA ++
Sbjct  2    EVDEDGYEVPSSSSKGDKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQA-NQ  60

Query  63   KDDSRQDCVVVWGECNHSFHYCCMSLWVQQNNRCPLCQQEWSIQRMG  109
               + ++C V WG CNH+FH+ C+S W++    CPL  +EW  Q+ G
Sbjct  61   ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWDFQKYG  107


>RBX1_CAEEL unnamed protein product
Length=110

 Score = 99.8 bits (247),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 66/100 (66%), Gaps = 3/100 (3%)

Query  10   DRADNDNLKPDKLFILKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAESKKDDSRQD  69
            + A N  +K  K F +KKW+AVA+W+WD++ D CAICR  +MD C+ CQA ++    + +
Sbjct  13   EEATNQTVK--KRFEVKKWSAVALWAWDIQVDNCAICRNHIMDLCIECQA-NQAAGLKDE  69

Query  70   CVVVWGECNHSFHYCCMSLWVQQNNRCPLCQQEWSIQRMG  109
            C V WG CNH+FH+ C+S W++    CPL  +EW  Q+ G
Sbjct  70   CTVAWGNCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYG  109


>RBX1B_DROME unnamed protein product
Length=122

 Score = 96.7 bits (239),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 59/88 (67%), Gaps = 2/88 (2%)

Query  23   FILKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAESKKDDSRQDCVVVWGECNHSFH  82
            F++KKW A AMW WDV  D CAICR  +M+ C+ CQA+   +  + +C V WGECNH+FH
Sbjct  37   FVVKKWVAHAMWGWDVAVDNCAICRNHIMNLCIECQADPNAN--QDECTVAWGECNHAFH  94

Query  83   YCCMSLWVQQNNRCPLCQQEWSIQRMGK  110
            Y C++ W++    CPL  +EW  Q+ G+
Sbjct  95   YHCIARWLKTRLVCPLDNKEWVYQKYGR  122


>Q38DY9_TRYB2 unnamed protein product
Length=82

 Score = 60.5 bits (145),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 43/84 (51%), Gaps = 9/84 (11%)

Query  25   LKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAESKKDDSRQDCVVVWGECNHSFHYC  84
            +K  + VA W WD   DTC ICR Q    C +C+         +DC +V G+C H+FH  
Sbjct  5    VKSAHFVARWVWDCRDDTCGICRQQFEACCPQCRFPG------EDCPIVTGKCTHTFHIH  58

Query  85   CMSLWV---QQNNRCPLCQQEWSI  105
            C+  W    Q N  CP+C+Q W  
Sbjct  59   CIERWAEREQDNTECPMCRQTWEF  82



Lambda      K        H
   0.314    0.131    0.366 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1387782160


Query= XP_003393032.1 gastrula zinc finger protein XlCGF57.1 isoform X1
[Bombus terrestris]

Length=576
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9PD94_DROME  unnamed protein product                                 298     1e-90
O61360_DROME  unnamed protein product                                 298     5e-90
O61361_DROME  unnamed protein product                                 290     1e-87
Q8MRK4_DROME  unnamed protein product                                 286     4e-86
M9PCY3_DROME  unnamed protein product                                 281     3e-84


>M9PD94_DROME unnamed protein product
Length=907

 Score = 298 bits (764),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 170/448 (38%), Positives = 220/448 (49%), Gaps = 9/448 (2%)

Query  136  CSICKKWFLNNDSMVTHLRMHCSGN--QCEVCQQNFQDNSSLHAHMLTHVGMSPLECNVC  193
            C IC K F     ++ H R H       C+VC Q F  +  L  H   H+G     C VC
Sbjct  223  CDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTCIVC  282

Query  194  QKRFAYKWCLRSHMQMHVLEKPYDNDALQQVFMKRPDSEHDQSLNIEERVFECDVCHATF  253
               FA    L  HM+ H  +KP+     Q+ F ++   ++    +  E  F C  C  TF
Sbjct  283  FNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYCAKTF  342

Query  254  KEKSSLNRHVLTHTEERPYKCDVCFAAFREKAKLNMHMTLHSGNKQFKCTMCHRSFTQKT  313
              K  +  HV  HT + P++CDVC   +  K  L  HM  H+    F+C +C +SF++K 
Sbjct  343  TRKEHMVNHVRKHTGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKE  402

Query  314  ALNNHMLAHS-GEKPHACNICEKTYKRKSELIRHTMVHTGERPYECKECLMTFREKAKLN  372
               NH+L H+ GE PH C+ C KT+ RK  L+ H   HTGE P+ C  C+ TF  K  L 
Sbjct  403  HFTNHILWHTAGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLV  462

Query  373  SHMLVHTGEKPHACQICHKACARKSDLNSHMLLHTG-GQYDCKVCDKIFTRKSDLNRHTL  431
            +H+  HTGE PH C  C K   RK  L +H+  HTG   + C  C K FTRK  L  H  
Sbjct  463  NHIRQHTGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHVR  522

Query  432  IHTGEKPFACELCDMAFREKTRLNSHMLVHTGDKRHACHICQKSFKEKSSLRKHMLS-HT  490
            +HTG+ P  CE C   F  K  LN+HM  H+ D  H C++C K F  K  L  HM   HT
Sbjct  523  LHTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHT  582

Query  491  GDRPYECYVCHKAFTQKTTL----NSHILVHAGERPYECSACQKIFKDKATLKKHLSVHI  546
            GDRP+ C  C K+F  K  L     SH      ERP+ C  C K F  K  L  H+  H 
Sbjct  583  GDRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHS  642

Query  547  NEKTHECLICLKKFTHKAALNSHLSTNH  574
             EK H C +C K F  +  L  H+  NH
Sbjct  643  GEKPHACTLCSKAFVERGNLKRHMKMNH  670


 Score = 168 bits (425),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 90/245 (37%), Positives = 123/245 (50%), Gaps = 2/245 (1%)

Query  328  HACNICEKTYKRKSELIRHTMVHTGERPYECKECLMTFREKAKLNSHMLVHTGEKPHACQ  387
            H C+IC K ++ + +LI H   H+  +P+ C+ C   F     L  H  +H G     C 
Sbjct  221  HVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTCI  280

Query  388  ICHKACARKSDLNSHMLLH-TGGQYDCKVCDKIFTRKSDLNRHTLIHTGEKPFACELCDM  446
            +C    A  + L  HM  H T   + C +C K F RK  L+ H   HTGE PF C+ C  
Sbjct  281  VCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYCAK  340

Query  447  AFREKTRLNSHMLVHTGDKRHACHICQKSFKEKSSLRKHMLSHTGDRPYECYVCHKAFTQ  506
             F  K  + +H+  HTG   H C +C K +  K  L  HM SHT + P+ C +C K+F++
Sbjct  341  TFTRKEHMVNHVRKHTGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSR  400

Query  507  KTTLNSHILVH-AGERPYECSACQKIFKDKATLKKHLSVHINEKTHECLICLKKFTHKAA  565
            K    +HIL H AGE P+ C  C K F  K  L  H+  H  E  H C  C+K FT K  
Sbjct  401  KEHFTNHILWHTAGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEH  460

Query  566  LNSHL  570
            L +H+
Sbjct  461  LVNHI  465


 Score = 117 bits (292),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/164 (34%), Positives = 83/164 (51%), Gaps = 0/164 (0%)

Query  409  GQYDCKVCDKIFTRKSDLNRHTLIHTGEKPFACELCDMAFREKTRLNSHMLVHTGDKRHA  468
            G + C +C K+F  +  L  H   H+  KPF C++C   F     L  H  +H G     
Sbjct  219  GTHVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFT  278

Query  469  CHICQKSFKEKSSLRKHMLSHTGDRPYECYVCHKAFTQKTTLNSHILVHAGERPYECSAC  528
            C +C   F   +SL +HM  H+ D+P+ C +C K F +K  L++H   H GE P+ C  C
Sbjct  279  CIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYC  338

Query  529  QKIFKDKATLKKHLSVHINEKTHECLICLKKFTHKAALNSHLST  572
             K F  K  +  H+  H  +  H+C +C KK+T K  L +H+ +
Sbjct  339  AKTFTRKEHMVNHVRKHTGQTPHQCDVCGKKYTRKEHLANHMRS  382


>O61360_DROME unnamed protein product
Length=962

 Score = 298 bits (762),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 162/447 (36%), Positives = 224/447 (50%), Gaps = 8/447 (2%)

Query  136  CSICKKWFLNNDSMVTHLRMHCSGNQ--CEVCQQNFQDNSSLHAHMLTHVGMSPLECNVC  193
            C +C   F NN S+  H++ H +     C +CQ+ F     L  H  +H G +P  C  C
Sbjct  279  CIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYC  338

Query  194  QKRFAYKWCLRSHMQMHVLEKPYDNDALQQVFMKRPDSEHDQSLNIEERVFECDVCHATF  253
             K F  K  + +H++ H  E P+  D  ++ F ++    +    +  +   +CDVC   +
Sbjct  339  AKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHYMWHTGQTPHQCDVCGKKY  398

Query  254  KEKSSLNRHVLTHTEERPYKCDVCFAAFREKAKLNMHMTLHSGNKQFKCTMCHRSFTQKT  313
              K  L  H+ +HT E P++C++C  +F  K     H+  H+G    +C  C ++FT+K 
Sbjct  399  TRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTFTRKE  458

Query  314  ALNNHMLAHSGEKPHACNICEKTYKRKSELIRHTMVHTGERPYECKECLMTFREKAKLNS  373
             L NH+  H+GE PH C+ C KT+ RK  L+ H   HTGE P++C  C   F  K  + +
Sbjct  459  HLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTRKDHMVN  518

Query  374  HMLVHTGEKPHACQICHKACARKSDLNSHMLLHTG-GQYDCKVCDKIFTRKSDLNRHTLI  432
            H+  HTGE PH C  C K   RK  L +H+  HTG   + C  C K FTRK  L  H  +
Sbjct  519  HVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRL  578

Query  433  HTGEKPFACELCDMAFREKTRLNSHMLVHTGDKRHACHICQKSFKEKSSLRKHMLS-HTG  491
            HTG+ P  CE C   F  K  LN+HM  H+ D  H C++C K F  K  L  HM   HTG
Sbjct  579  HTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTG  638

Query  492  DRPYECYVCHKAFTQKTTL----NSHILVHAGERPYECSACQKIFKDKATLKKHLSVHIN  547
            DRP+ C  C K+F  K  L     SH      ERP+ C  C K F  K  L  H+  H  
Sbjct  639  DRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSG  698

Query  548  EKTHECLICLKKFTHKAALNSHLSTNH  574
            EK H C +C K F  +  L  H+  NH
Sbjct  699  EKPHACTLCSKAFVERGNLKRHMKMNH  725


 Score = 286 bits (732),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 162/444 (36%), Positives = 214/444 (48%), Gaps = 31/444 (7%)

Query  136  CSICKKWFLNNDSMVTHLRMHCSGN--QCEVCQQNFQDNSSLHAHMLTHVGMSPLECNVC  193
            C IC K F     ++ H R H       C+VC Q F  +  L  H   H+G     C VC
Sbjct  223  CDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTCIVC  282

Query  194  QKRFAYKWCLRSHMQMHVLEKPYDNDALQQVFMKRPDSEHDQSLNIEERVFECDVCHATF  253
               FA    L  HM+ H  +KP                            F C +C  TF
Sbjct  283  FNVFANNTSLERHMKRHSTDKP----------------------------FACTICQKTF  314

Query  254  KEKSSLNRHVLTHTEERPYKCDVCFAAFREKAKLNMHMTLHSGNKQFKCTMCHRSFTQKT  313
              K  L+ H  +HT E P++C  C   F  K  +  H+  H+G    +C +C +SFT+K 
Sbjct  315  ARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKE  374

Query  314  ALNNHMLAHSGEKPHACNICEKTYKRKSELIRHTMVHTGERPYECKECLMTFREKAKLNS  373
               NH + H+G+ PH C++C K Y RK  L  H   HT E P+ C+ C  +F  K    +
Sbjct  375  HYVNHYMWHTGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTN  434

Query  374  HMLVHTGEKPHACQICHKACARKSDLNSHMLLHTG-GQYDCKVCDKIFTRKSDLNRHTLI  432
            H+L HTGE PH C  C K   RK  L +H+  HTG   + C  C K FTRK  L  H   
Sbjct  435  HILWHTGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQ  494

Query  433  HTGEKPFACELCDMAFREKTRLNSHMLVHTGDKRHACHICQKSFKEKSSLRKHMLSHTGD  492
            HTGE PF C  C  AF  K  + +H+  HTG+  H C  C K+F  K  L  H+  HTGD
Sbjct  495  HTGETPFKCTYCTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQHTGD  554

Query  493  RPYECYVCHKAFTQKTTLNSHILVHAGERPYECSACQKIFKDKATLKKHLSVHINEKTHE  552
             P+ C  C K FT+K  L +H+ +H G+ P++C  CQK F  K  L  H+  H ++  H 
Sbjct  555  SPHRCSYCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHC  614

Query  553  CLICLKKFTHKAALNSHLSTNHTS  576
            C +C K FT K  L +H+S  HT 
Sbjct  615  CNVCNKPFTRKEHLINHMSRCHTG  638


 Score = 256 bits (655),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 143/389 (37%), Positives = 206/389 (53%), Gaps = 8/389 (2%)

Query  134  IQCSICKKWFLNNDSMVTHLRMHC--SGNQCEVCQQNFQDNSSLHAHMLTHVGMSPLECN  191
             +C  C K F   + MV H+R H   + ++C++C+++F        H + H G +P +C+
Sbjct  333  FRCQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHYMWHTGQTPHQCD  392

Query  192  VCQKRFAYKWCLRSHMQMHVLEKPYDNDALQQVFMKRPDSEHDQSLNIEERVFECDVCHA  251
            VC K++  K  L +HM+ H  E P+  +   + F ++    +    +  E    CD C  
Sbjct  393  VCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTGETPHRCDFCSK  452

Query  252  TFKEKSSLNRHVLTHTEERPYKCDVCFAAFREKAKLNMHMTLHSGNKQFKCTMCHRSFTQ  311
            TF  K  L  HV  HT E P++C  C   F  K  L  H+  H+G   FKCT C ++FT+
Sbjct  453  TFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTR  512

Query  312  KTALNNHMLAHSGEKPHACNICEKTYKRKSELIRHTMVHTGERPYECKECLMTFREKAKL  371
            K  + NH+  H+GE PH C  C KT+ RK  L  H   HTG+ P+ C  C  TF  K  L
Sbjct  513  KDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHL  572

Query  372  NSHMLVHTGEKPHACQICHKACARKSDLNSHMLLHTG-GQYDCKVCDKIFTRKSDLNRH-  429
             +H+ +HTG+ PH C+ C K   RK  LN+HM  H+    + C VC+K FTRK  L  H 
Sbjct  573  TNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHM  632

Query  430  TLIHTGEKPFACELCDMAFREKTRLNSHMLVHTG----DKRHACHICQKSFKEKSSLRKH  485
            +  HTG++PF CE C  +F  K  L  H   HT     ++  AC  C K+F  K  L  H
Sbjct  633  SRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSH  692

Query  486  MLSHTGDRPYECYVCHKAFTQKTTLNSHI  514
            M SH+G++P+ C +C KAF ++  L  H+
Sbjct  693  MRSHSGEKPHACTLCSKAFVERGNLKRHM  721


 Score = 171 bits (434),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 96/272 (35%), Positives = 129/272 (47%), Gaps = 29/272 (11%)

Query  328  HACNICEKTYKRKSELI----------------------------RHTMVHTGERPYECK  359
            H C+IC K ++ + +LI                            RH  +H G   + C 
Sbjct  221  HVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTCI  280

Query  360  ECLMTFREKAKLNSHMLVHTGEKPHACQICHKACARKSDLNSHMLLHTG-GQYDCKVCDK  418
             C   F     L  HM  H+ +KP AC IC K  ARK  L++H   HTG   + C+ C K
Sbjct  281  VCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYCAK  340

Query  419  IFTRKSDLNRHTLIHTGEKPFACELCDMAFREKTRLNSHMLVHTGDKRHACHICQKSFKE  478
             FTRK  +  H   HTGE P  C++C  +F  K    +H + HTG   H C +C K +  
Sbjct  341  TFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHYMWHTGQTPHQCDVCGKKYTR  400

Query  479  KSSLRKHMLSHTGDRPYECYVCHKAFTQKTTLNSHILVHAGERPYECSACQKIFKDKATL  538
            K  L  HM SHT + P+ C +C K+F++K    +HIL H GE P+ C  C K F  K  L
Sbjct  401  KEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTFTRKEHL  460

Query  539  KKHLSVHINEKTHECLICLKKFTHKAALNSHL  570
              H+  H  E  H C  C+K FT K  L +H+
Sbjct  461  LNHVRQHTGESPHRCSYCMKTFTRKEHLVNHI  492


 Score = 166 bits (419),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 99/307 (32%), Positives = 141/307 (46%), Gaps = 35/307 (11%)

Query  134  IQCSICKKWFLNNDSMVTHLRMHC--SGNQCEVCQQNFQDNSSLHAHMLTHVGMSPLECN  191
             +C IC K F   +    H+  H   + ++C+ C + F     L  H+  H G SP  C+
Sbjct  417  FRCEICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCS  476

Query  192  VCQKRFAYKWCLRSHMQMHVLEKPYDNDALQQVFMKRPDSEHDQSLNIEERVFECDVCHA  251
             C K F  K  L +H++ H  E P+      + F ++    +    +  E   +C  C  
Sbjct  477  YCMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTRKDHMVNHVRQHTGESPHKCTYCTK  536

Query  252  TFKEKSSLNRHVLTHTEERPYKCDVCFAAFREKAKLNMHMTLHSGNKQFKCTMCHRSFTQ  311
            TF  K  L  HV  HT + P++C  C   F  K  L  H+ LH+G+   KC  C ++FT+
Sbjct  537  TFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTR  596

Query  312  KTALNNHMLAHSGEKPHACNICEKTYKRKSELIRH-TMVHTGERPYECKECLMTFREKAK  370
            K  LNNHM  HS + PH CN+C K + RK  LI H +  HTG+RP+ C+ C  +F  K  
Sbjct  597  KEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGN  656

Query  371  L--------------------------------NSHMLVHTGEKPHACQICHKACARKSD  398
            L                                 SHM  H+GEKPHAC +C KA   + +
Sbjct  657  LLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSKAFVERGN  716

Query  399  LNSHMLL  405
            L  HM +
Sbjct  717  LKRHMKM  723


 Score = 114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/161 (35%), Positives = 78/161 (48%), Gaps = 0/161 (0%)

Query  409  GQYDCKVCDKIFTRKSDLNRHTLIHTGEKPFACELCDMAFREKTRLNSHMLVHTGDKRHA  468
            G + C +C K+F  +  L  H   H+  KPF C++C   F     L  H  +H G     
Sbjct  219  GTHVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFT  278

Query  469  CHICQKSFKEKSSLRKHMLSHTGDRPYECYVCHKAFTQKTTLNSHILVHAGERPYECSAC  528
            C +C   F   +SL +HM  H+ D+P+ C +C K F +K  L++H   H GE P+ C  C
Sbjct  279  CIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYC  338

Query  529  QKIFKDKATLKKHLSVHINEKTHECLICLKKFTHKAALNSH  569
             K F  K  +  H+  H  E  H C IC K FT K    +H
Sbjct  339  AKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNH  379


 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 52/106 (49%), Gaps = 0/106 (0%)

Query  467  HACHICQKSFKEKSSLRKHMLSHTGDRPYECYVCHKAFTQKTTLNSHILVHAGERPYECS  526
            H C IC K F+ +  L  H   H+  +P+ C VC + FT    L  H  +H G   + C 
Sbjct  221  HVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTCI  280

Query  527  ACQKIFKDKATLKKHLSVHINEKTHECLICLKKFTHKAALNSHLST  572
             C  +F +  +L++H+  H  +K   C IC K F  K  L++H  +
Sbjct  281  VCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRS  326


>O61361_DROME unnamed protein product
Length=891

 Score = 290 bits (742),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 165/448 (37%), Positives = 224/448 (50%), Gaps = 8/448 (2%)

Query  136  CSICKKWFLNNDSMVTHLRMHCSGNQ--CEVCQQNFQDNSSLHAHMLTHVGMSPLECNVC  193
            C +C + F  +  +  H ++H  G    C VC   F +N+SL  HM  H    P  C +C
Sbjct  251  CQVCGQGFTTSQDLTRHGKIHIGGPMFTCIVCFNVFANNTSLERHMKRHSTDKPFACTIC  310

Query  194  QKRFAYKWCLRSHMQMHVLEKPYDNDALQQVFMKRPDSEHDQSLNIEERVFECDVCHATF  253
            QK FA K  L +H + H  E P+      + F ++    +    +  E    CD+C  +F
Sbjct  311  QKTFARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSF  370

Query  254  KEKSSLNRHVLTHTEERPYKCDVCFAAFREKAKLNMHMTLHSGNKQFKCTMCHRSFTQKT  313
              K     H + HT + P++CDVC   +  K  L  HM  H+    F+C +C +SF++K 
Sbjct  371  TRKEHYVNHYMWHTGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKE  430

Query  314  ALNNHMLAHSGEKPHACNICEKTYKRKSELIRHTMVHTGERPYECKECLMTFREKAKLNS  373
               NH+L H+GE PH C+ C KT+ RK  L+ H   HTGE P+ C  C+ TF  K  L +
Sbjct  431  HFTNHILWHTGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVN  490

Query  374  HMLVHTGEKPHACQICHKACARKSDLNSHMLLHTG-GQYDCKVCDKIFTRKSDLNRHTLI  432
            H+  HTGE P  C  C KA  RK  + +H+  HTG   + C  C K FTRK  L  H   
Sbjct  491  HIRQHTGETPFKCTYCTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQ  550

Query  433  HTGEKPFACELCDMAFREKTRLNSHMLVHTGDKRHACHICQKSFKEKSSLRKHMLSHTGD  492
            HTG+ P  C  C   F  K  L +H+ +HTGD  H C  CQK+F  K  L  HM  H+ D
Sbjct  551  HTGDSPHRCSYCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSD  610

Query  493  RPYECYVCHKAFTQKTTLNSHI-LVHAGERPYECSACQKIFKDKATLKKHLSVHIN----  547
             P+ C VC+K FT+K  L +H+   H G+RP+ C  C K F  K  L  H   H      
Sbjct  611  NPHCCNVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQEM  670

Query  548  EKTHECLICLKKFTHKAALNSHLSTNHT  575
            E+   C  C K F  K   +S  +T HT
Sbjct  671  ERPFACEKCPKNFICKVPHHSATTTMHT  698


 Score = 286 bits (733),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 162/444 (36%), Positives = 214/444 (48%), Gaps = 31/444 (7%)

Query  136  CSICKKWFLNNDSMVTHLRMHCSGN--QCEVCQQNFQDNSSLHAHMLTHVGMSPLECNVC  193
            C IC K F     ++ H R H       C+VC Q F  +  L  H   H+G     C VC
Sbjct  223  CDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTCIVC  282

Query  194  QKRFAYKWCLRSHMQMHVLEKPYDNDALQQVFMKRPDSEHDQSLNIEERVFECDVCHATF  253
               FA    L  HM+ H  +KP                            F C +C  TF
Sbjct  283  FNVFANNTSLERHMKRHSTDKP----------------------------FACTICQKTF  314

Query  254  KEKSSLNRHVLTHTEERPYKCDVCFAAFREKAKLNMHMTLHSGNKQFKCTMCHRSFTQKT  313
              K  L+ H  +HT E P++C  C   F  K  +  H+  H+G    +C +C +SFT+K 
Sbjct  315  ARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKE  374

Query  314  ALNNHMLAHSGEKPHACNICEKTYKRKSELIRHTMVHTGERPYECKECLMTFREKAKLNS  373
               NH + H+G+ PH C++C K Y RK  L  H   HT E P+ C+ C  +F  K    +
Sbjct  375  HYVNHYMWHTGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTN  434

Query  374  HMLVHTGEKPHACQICHKACARKSDLNSHMLLHTG-GQYDCKVCDKIFTRKSDLNRHTLI  432
            H+L HTGE PH C  C K   RK  L +H+  HTG   + C  C K FTRK  L  H   
Sbjct  435  HILWHTGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQ  494

Query  433  HTGEKPFACELCDMAFREKTRLNSHMLVHTGDKRHACHICQKSFKEKSSLRKHMLSHTGD  492
            HTGE PF C  C  AF  K  + +H+  HTG+  H C  C K+F  K  L  H+  HTGD
Sbjct  495  HTGETPFKCTYCTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQHTGD  554

Query  493  RPYECYVCHKAFTQKTTLNSHILVHAGERPYECSACQKIFKDKATLKKHLSVHINEKTHE  552
             P+ C  C K FT+K  L +H+ +H G+ P++C  CQK F  K  L  H+  H ++  H 
Sbjct  555  SPHRCSYCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHC  614

Query  553  CLICLKKFTHKAALNSHLSTNHTS  576
            C +C K FT K  L +H+S  HT 
Sbjct  615  CNVCNKPFTRKEHLINHMSRCHTG  638


 Score = 227 bits (579),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 128/351 (36%), Positives = 183/351 (52%), Gaps = 8/351 (2%)

Query  134  IQCSICKKWFLNNDSMVTHLRMHC--SGNQCEVCQQNFQDNSSLHAHMLTHVGMSPLECN  191
             +C  C K F   + MV H+R H   + ++C++C+++F        H + H G +P +C+
Sbjct  333  FRCQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHYMWHTGQTPHQCD  392

Query  192  VCQKRFAYKWCLRSHMQMHVLEKPYDNDALQQVFMKRPDSEHDQSLNIEERVFECDVCHA  251
            VC K++  K  L +HM+ H  E P+  +   + F ++    +    +  E    CD C  
Sbjct  393  VCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTGETPHRCDFCSK  452

Query  252  TFKEKSSLNRHVLTHTEERPYKCDVCFAAFREKAKLNMHMTLHSGNKQFKCTMCHRSFTQ  311
            TF  K  L  HV  HT E P++C  C   F  K  L  H+  H+G   FKCT C ++FT+
Sbjct  453  TFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTR  512

Query  312  KTALNNHMLAHSGEKPHACNICEKTYKRKSELIRHTMVHTGERPYECKECLMTFREKAKL  371
            K  + NH+  H+GE PH C  C KT+ RK  L  H   HTG+ P+ C  C  TF  K  L
Sbjct  513  KDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHL  572

Query  372  NSHMLVHTGEKPHACQICHKACARKSDLNSHMLLHTG-GQYDCKVCDKIFTRKSDLNRH-  429
             +H+ +HTG+ PH C+ C K   RK  LN+HM  H+    + C VC+K FTRK  L  H 
Sbjct  573  TNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHM  632

Query  430  TLIHTGEKPFACELCDMAFREKTRLNSHMLVHTG----DKRHACHICQKSF  476
            +  HTG++PF CE C  +F  K  L  H   HT     ++  AC  C K+F
Sbjct  633  SRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNF  683


 Score = 171 bits (434),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 96/272 (35%), Positives = 129/272 (47%), Gaps = 29/272 (11%)

Query  328  HACNICEKTYKRKSELI----------------------------RHTMVHTGERPYECK  359
            H C+IC K ++ + +LI                            RH  +H G   + C 
Sbjct  221  HVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTCI  280

Query  360  ECLMTFREKAKLNSHMLVHTGEKPHACQICHKACARKSDLNSHMLLHTG-GQYDCKVCDK  418
             C   F     L  HM  H+ +KP AC IC K  ARK  L++H   HTG   + C+ C K
Sbjct  281  VCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYCAK  340

Query  419  IFTRKSDLNRHTLIHTGEKPFACELCDMAFREKTRLNSHMLVHTGDKRHACHICQKSFKE  478
             FTRK  +  H   HTGE P  C++C  +F  K    +H + HTG   H C +C K +  
Sbjct  341  TFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHYMWHTGQTPHQCDVCGKKYTR  400

Query  479  KSSLRKHMLSHTGDRPYECYVCHKAFTQKTTLNSHILVHAGERPYECSACQKIFKDKATL  538
            K  L  HM SHT + P+ C +C K+F++K    +HIL H GE P+ C  C K F  K  L
Sbjct  401  KEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTFTRKEHL  460

Query  539  KKHLSVHINEKTHECLICLKKFTHKAALNSHL  570
              H+  H  E  H C  C+K FT K  L +H+
Sbjct  461  LNHVRQHTGESPHRCSYCMKTFTRKEHLVNHI  492


 Score = 114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/161 (35%), Positives = 78/161 (48%), Gaps = 0/161 (0%)

Query  409  GQYDCKVCDKIFTRKSDLNRHTLIHTGEKPFACELCDMAFREKTRLNSHMLVHTGDKRHA  468
            G + C +C K+F  +  L  H   H+  KPF C++C   F     L  H  +H G     
Sbjct  219  GTHVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFT  278

Query  469  CHICQKSFKEKSSLRKHMLSHTGDRPYECYVCHKAFTQKTTLNSHILVHAGERPYECSAC  528
            C +C   F   +SL +HM  H+ D+P+ C +C K F +K  L++H   H GE P+ C  C
Sbjct  279  CIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYC  338

Query  529  QKIFKDKATLKKHLSVHINEKTHECLICLKKFTHKAALNSH  569
             K F  K  +  H+  H  E  H C IC K FT K    +H
Sbjct  339  AKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNH  379


 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 52/106 (49%), Gaps = 0/106 (0%)

Query  467  HACHICQKSFKEKSSLRKHMLSHTGDRPYECYVCHKAFTQKTTLNSHILVHAGERPYECS  526
            H C IC K F+ +  L  H   H+  +P+ C VC + FT    L  H  +H G   + C 
Sbjct  221  HVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTCI  280

Query  527  ACQKIFKDKATLKKHLSVHINEKTHECLICLKKFTHKAALNSHLST  572
             C  +F +  +L++H+  H  +K   C IC K F  K  L++H  +
Sbjct  281  VCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRS  326


>Q8MRK4_DROME unnamed protein product
Length=878

 Score = 286 bits (731),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 165/447 (37%), Positives = 209/447 (47%), Gaps = 36/447 (8%)

Query  136  CSICKKWFLNNDSMVTHLRMHCSGN--QCEVCQQNFQDNSSLHAHMLTHVGMSPLECNVC  193
            C IC K F     ++ H R H       C+VC Q F  +  L  H   H+G     C VC
Sbjct  223  CDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTCIVC  282

Query  194  QKRFAYKWCLRSHMQMHVLEKPYDNDALQQVFMKRPDSEHDQSLNIEERVFECDVCHATF  253
               FA    L  HM+ H  +KP                            F C +C  TF
Sbjct  283  FNVFANNTSLERHMKRHSTDKP----------------------------FACTICQKTF  314

Query  254  KEKSSLNRHVLTHTEERPYKCDVCFAAFREKAKLNMHMTLHSGNKQFKCTMCHRSFTQKT  313
              K  L+ H  +HT E P++C  C   F  K  +  H+  H+G    +C +C +SFT+K 
Sbjct  315  ARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKE  374

Query  314  ALNNHMLAHSGEKPHACNICEKTYKRKSELIRHTMVHTGERPYECKECLMTFREKAKLNS  373
               NH + H+GE PH C+ C KT+ RK  L+ H   HTGE P+ C  C+ TF  K  L +
Sbjct  375  HYVNHYMWHTGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVN  434

Query  374  HMLVHTGEKPHACQICHKACARKSDLNSHMLLHTG-GQYDCKVCDKIFTRKSDLNRHTLI  432
            H+  HTGE PH C  C K   RK  L +H+  HTG   + C  C K FTRK  L  H  +
Sbjct  435  HIRQHTGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRL  494

Query  433  HTGEKPFACELCDMAFREKTRLNSHMLVHTGDKRHACHICQKSFKEKSSLRKHMLS-HTG  491
            HTG+ P  CE C   F  K  LN+HM  H+ D  H C++C K F  K  L  HM   HTG
Sbjct  495  HTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTG  554

Query  492  DRPYECYVCHKAFTQKTTL----NSHILVHAGERPYECSACQKIFKDKATLKKHLSVHIN  547
            DRP+ C  C K+F  K  L     SH      ERP+ C  C K F  K  L  H+  H  
Sbjct  555  DRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSG  614

Query  548  EKTHECLICLKKFTHKAALNSHLSTNH  574
            EK H C +C K F  +  L  H+  NH
Sbjct  615  EKPHACTLCSKAFVERGNLKRHMKMNH  641


 Score = 250 bits (639),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 134/332 (40%), Positives = 174/332 (52%), Gaps = 1/332 (0%)

Query  246  CDVCHATFKEKSSLNRHVLTHTEERPYKCDVCFAAFREKAKLNMHMTLHSGNKQFKCTMC  305
            CD+C   F+ +  L  H   H+E +P+ C VC   F     L  H  +H G   F C +C
Sbjct  223  CDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTCIVC  282

Query  306  HRSFTQKTALNNHMLAHSGEKPHACNICEKTYKRKSELIRHTMVHTGERPYECKECLMTF  365
               F   T+L  HM  HS +KP AC IC+KT+ RK  L  H   HTGE P+ C+ C  TF
Sbjct  283  FNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYCAKTF  342

Query  366  REKAKLNSHMLVHTGEKPHACQICHKACARKSDLNSHMLLHTG-GQYDCKVCDKIFTRKS  424
              K  + +H+  HTGE PH C IC K+  RK    +H + HTG   + C  C K FTRK 
Sbjct  343  TRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHYMWHTGETPHRCDFCSKTFTRKE  402

Query  425  DLNRHTLIHTGEKPFACELCDMAFREKTRLNSHMLVHTGDKRHACHICQKSFKEKSSLRK  484
             L  H   HTGE P  C  C   F  K  L +H+  HTG+  H C  C K+F  K  L  
Sbjct  403  HLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGESPHKCTYCTKTFTRKEHLTN  462

Query  485  HMLSHTGDRPYECYVCHKAFTQKTTLNSHILVHAGERPYECSACQKIFKDKATLKKHLSV  544
            H+  HTGD P+ C  C K FT+K  L +H+ +H G+ P++C  CQK F  K  L  H+  
Sbjct  463  HVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHMRQ  522

Query  545  HINEKTHECLICLKKFTHKAALNSHLSTNHTS  576
            H ++  H C +C K FT K  L +H+S  HT 
Sbjct  523  HSSDNPHCCNVCNKPFTRKEHLINHMSRCHTG  554


 Score = 180 bits (457),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 105/304 (35%), Positives = 154/304 (51%), Gaps = 8/304 (3%)

Query  134  IQCSICKKWFLNNDSMVTHLRMHC--SGNQCEVCQQNFQDNSSLHAHMLTHVGMSPLECN  191
             +C  C K F   + MV H+R H   + ++C++C+++F        H + H G +P  C+
Sbjct  333  FRCQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHYMWHTGETPHRCD  392

Query  192  VCQKRFAYKWCLRSHMQMHVLEKPYDNDALQQVFMKRPDSEHDQSLNIEERVFECDVCHA  251
             C K F  K  L +H++ H  E P+      + F ++    +    +  E   +C  C  
Sbjct  393  FCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGESPHKCTYCTK  452

Query  252  TFKEKSSLNRHVLTHTEERPYKCDVCFAAFREKAKLNMHMTLHSGNKQFKCTMCHRSFTQ  311
            TF  K  L  HV  HT + P++C  C   F  K  L  H+ LH+G+   KC  C ++FT+
Sbjct  453  TFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTR  512

Query  312  KTALNNHMLAHSGEKPHACNICEKTYKRKSELIRH-TMVHTGERPYECKECLMTFREKAK  370
            K  LNNHM  HS + PH CN+C K + RK  LI H +  HTG+RP+ C+ C  +F  K  
Sbjct  513  KEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGN  572

Query  371  LNSHMLVHTG----EKPHACQICHKACARKSDLNSHMLLHTGGQ-YDCKVCDKIFTRKSD  425
            L  H   HT     E+P AC+ C K    K  L SHM  H+G + + C +C K F  + +
Sbjct  573  LLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSKAFVERGN  632

Query  426  LNRH  429
            L RH
Sbjct  633  LKRH  636


 Score = 171 bits (433),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 91/244 (37%), Positives = 123/244 (50%), Gaps = 1/244 (0%)

Query  328  HACNICEKTYKRKSELIRHTMVHTGERPYECKECLMTFREKAKLNSHMLVHTGEKPHACQ  387
            H C+IC K ++ + +LI H   H+  +P+ C+ C   F     L  H  +H G     C 
Sbjct  221  HVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTCI  280

Query  388  ICHKACARKSDLNSHMLLH-TGGQYDCKVCDKIFTRKSDLNRHTLIHTGEKPFACELCDM  446
            +C    A  + L  HM  H T   + C +C K F RK  L+ H   HTGE PF C+ C  
Sbjct  281  VCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYCAK  340

Query  447  AFREKTRLNSHMLVHTGDKRHACHICQKSFKEKSSLRKHMLSHTGDRPYECYVCHKAFTQ  506
             F  K  + +H+  HTG+  H C IC+KSF  K     H + HTG+ P+ C  C K FT+
Sbjct  341  TFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHYMWHTGETPHRCDFCSKTFTR  400

Query  507  KTTLNSHILVHAGERPYECSACQKIFKDKATLKKHLSVHINEKTHECLICLKKFTHKAAL  566
            K  L +H+  H GE P+ CS C K F  K  L  H+  H  E  H+C  C K FT K  L
Sbjct  401  KEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGESPHKCTYCTKTFTRKEHL  460

Query  567  NSHL  570
             +H+
Sbjct  461  TNHV  464


 Score = 114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/161 (35%), Positives = 78/161 (48%), Gaps = 0/161 (0%)

Query  409  GQYDCKVCDKIFTRKSDLNRHTLIHTGEKPFACELCDMAFREKTRLNSHMLVHTGDKRHA  468
            G + C +C K+F  +  L  H   H+  KPF C++C   F     L  H  +H G     
Sbjct  219  GTHVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFT  278

Query  469  CHICQKSFKEKSSLRKHMLSHTGDRPYECYVCHKAFTQKTTLNSHILVHAGERPYECSAC  528
            C +C   F   +SL +HM  H+ D+P+ C +C K F +K  L++H   H GE P+ C  C
Sbjct  279  CIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYC  338

Query  529  QKIFKDKATLKKHLSVHINEKTHECLICLKKFTHKAALNSH  569
             K F  K  +  H+  H  E  H C IC K FT K    +H
Sbjct  339  AKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNH  379


 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 52/106 (49%), Gaps = 0/106 (0%)

Query  467  HACHICQKSFKEKSSLRKHMLSHTGDRPYECYVCHKAFTQKTTLNSHILVHAGERPYECS  526
            H C IC K F+ +  L  H   H+  +P+ C VC + FT    L  H  +H G   + C 
Sbjct  221  HVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTCI  280

Query  527  ACQKIFKDKATLKKHLSVHINEKTHECLICLKKFTHKAALNSHLST  572
             C  +F +  +L++H+  H  +K   C IC K F  K  L++H  +
Sbjct  281  VCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRS  326


>M9PCY3_DROME unnamed protein product
Length=878

 Score = 281 bits (718),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 163/447 (36%), Positives = 208/447 (47%), Gaps = 36/447 (8%)

Query  136  CSICKKWFLNNDSMVTHLRMHCSGN--QCEVCQQNFQDNSSLHAHMLTHVGMSPLECNVC  193
            C IC K F     ++ H R H       C+VC Q F  +  L  H   H+G     C VC
Sbjct  223  CDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTCIVC  282

Query  194  QKRFAYKWCLRSHMQMHVLEKPYDNDALQQVFMKRPDSEHDQSLNIEERVFECDVCHATF  253
               FA    L  HM+ H  +KP                            F C +C  TF
Sbjct  283  FNVFANNTSLERHMKRHSTDKP----------------------------FACTICQKTF  314

Query  254  KEKSSLNRHVLTHTEERPYKCDVCFAAFREKAKLNMHMTLHSGNKQFKCTMCHRSFTQKT  313
              K  L+ H  +HT E P++C  C   F  K  +  H+  H+G    +C  C ++FT+K 
Sbjct  315  ARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEHMVNHVRKHTGETPHRCDFCSKTFTRKE  374

Query  314  ALNNHMLAHSGEKPHACNICEKTYKRKSELIRHTMVHTGERPYECKECLMTFREKAKLNS  373
             L NH+  H+GE PH C+ C KT+ RK  L+ H   HTGE P++C  C   F  K  + +
Sbjct  375  HLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTRKDHMVN  434

Query  374  HMLVHTGEKPHACQICHKACARKSDLNSHMLLHTG-GQYDCKVCDKIFTRKSDLNRHTLI  432
            H+  HTGE PH C  C K   RK  L +H+  HTG   + C  C K FTRK  L  H  +
Sbjct  435  HVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRL  494

Query  433  HTGEKPFACELCDMAFREKTRLNSHMLVHTGDKRHACHICQKSFKEKSSLRKHMLS-HTG  491
            HTG+ P  CE C   F  K  LN+HM  H+ D  H C++C K F  K  L  HM   HTG
Sbjct  495  HTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTG  554

Query  492  DRPYECYVCHKAFTQKTTL----NSHILVHAGERPYECSACQKIFKDKATLKKHLSVHIN  547
            DRP+ C  C K+F  K  L     SH      ERP+ C  C K F  K  L  H+  H  
Sbjct  555  DRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSG  614

Query  548  EKTHECLICLKKFTHKAALNSHLSTNH  574
            EK H C +C K F  +  L  H+  NH
Sbjct  615  EKPHACTLCSKAFVERGNLKRHMKMNH  641


 Score = 252 bits (643),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 135/332 (41%), Positives = 175/332 (53%), Gaps = 1/332 (0%)

Query  246  CDVCHATFKEKSSLNRHVLTHTEERPYKCDVCFAAFREKAKLNMHMTLHSGNKQFKCTMC  305
            CD+C   F+ +  L  H   H+E +P+ C VC   F     L  H  +H G   F C +C
Sbjct  223  CDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTCIVC  282

Query  306  HRSFTQKTALNNHMLAHSGEKPHACNICEKTYKRKSELIRHTMVHTGERPYECKECLMTF  365
               F   T+L  HM  HS +KP AC IC+KT+ RK  L  H   HTGE P+ C+ C  TF
Sbjct  283  FNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYCAKTF  342

Query  366  REKAKLNSHMLVHTGEKPHACQICHKACARKSDLNSHMLLHTG-GQYDCKVCDKIFTRKS  424
              K  + +H+  HTGE PH C  C K   RK  L +H+  HTG   + C  C K FTRK 
Sbjct  343  TRKEHMVNHVRKHTGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKE  402

Query  425  DLNRHTLIHTGEKPFACELCDMAFREKTRLNSHMLVHTGDKRHACHICQKSFKEKSSLRK  484
             L  H   HTGE PF C  C  AF  K  + +H+  HTG+  H C  C K+F  K  L  
Sbjct  403  HLVNHIRQHTGETPFKCTYCTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTN  462

Query  485  HMLSHTGDRPYECYVCHKAFTQKTTLNSHILVHAGERPYECSACQKIFKDKATLKKHLSV  544
            H+  HTGD P+ C  C K FT+K  L +H+ +H G+ P++C  CQK F  K  L  H+  
Sbjct  463  HVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHMRQ  522

Query  545  HINEKTHECLICLKKFTHKAALNSHLSTNHTS  576
            H ++  H C +C K FT K  L +H+S  HT 
Sbjct  523  HSSDNPHCCNVCNKPFTRKEHLINHMSRCHTG  554


 Score = 181 bits (459),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 107/304 (35%), Positives = 152/304 (50%), Gaps = 8/304 (3%)

Query  134  IQCSICKKWFLNNDSMVTHLRMHC--SGNQCEVCQQNFQDNSSLHAHMLTHVGMSPLECN  191
             +C  C K F   + MV H+R H   + ++C+ C + F     L  H+  H G SP  C+
Sbjct  333  FRCQYCAKTFTRKEHMVNHVRKHTGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCS  392

Query  192  VCQKRFAYKWCLRSHMQMHVLEKPYDNDALQQVFMKRPDSEHDQSLNIEERVFECDVCHA  251
             C K F  K  L +H++ H  E P+      + F ++    +    +  E   +C  C  
Sbjct  393  YCMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTRKDHMVNHVRQHTGESPHKCTYCTK  452

Query  252  TFKEKSSLNRHVLTHTEERPYKCDVCFAAFREKAKLNMHMTLHSGNKQFKCTMCHRSFTQ  311
            TF  K  L  HV  HT + P++C  C   F  K  L  H+ LH+G+   KC  C ++FT+
Sbjct  453  TFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTR  512

Query  312  KTALNNHMLAHSGEKPHACNICEKTYKRKSELIRH-TMVHTGERPYECKECLMTFREKAK  370
            K  LNNHM  HS + PH CN+C K + RK  LI H +  HTG+RP+ C+ C  +F  K  
Sbjct  513  KEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGN  572

Query  371  LNSHMLVHTG----EKPHACQICHKACARKSDLNSHMLLHTGGQ-YDCKVCDKIFTRKSD  425
            L  H   HT     E+P AC+ C K    K  L SHM  H+G + + C +C K F  + +
Sbjct  573  LLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSKAFVERGN  632

Query  426  LNRH  429
            L RH
Sbjct  633  LKRH  636


 Score = 169 bits (428),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 89/244 (36%), Positives = 123/244 (50%), Gaps = 1/244 (0%)

Query  328  HACNICEKTYKRKSELIRHTMVHTGERPYECKECLMTFREKAKLNSHMLVHTGEKPHACQ  387
            H C+IC K ++ + +LI H   H+  +P+ C+ C   F     L  H  +H G     C 
Sbjct  221  HVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTCI  280

Query  388  ICHKACARKSDLNSHMLLH-TGGQYDCKVCDKIFTRKSDLNRHTLIHTGEKPFACELCDM  446
            +C    A  + L  HM  H T   + C +C K F RK  L+ H   HTGE PF C+ C  
Sbjct  281  VCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYCAK  340

Query  447  AFREKTRLNSHMLVHTGDKRHACHICQKSFKEKSSLRKHMLSHTGDRPYECYVCHKAFTQ  506
             F  K  + +H+  HTG+  H C  C K+F  K  L  H+  HTG+ P+ C  C K FT+
Sbjct  341  TFTRKEHMVNHVRKHTGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTR  400

Query  507  KTTLNSHILVHAGERPYECSACQKIFKDKATLKKHLSVHINEKTHECLICLKKFTHKAAL  566
            K  L +HI  H GE P++C+ C K F  K  +  H+  H  E  H+C  C K FT K  L
Sbjct  401  KEHLVNHIRQHTGETPFKCTYCTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTRKEHL  460

Query  567  NSHL  570
             +H+
Sbjct  461  TNHV  464


 Score = 114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/162 (35%), Positives = 79/162 (49%), Gaps = 0/162 (0%)

Query  409  GQYDCKVCDKIFTRKSDLNRHTLIHTGEKPFACELCDMAFREKTRLNSHMLVHTGDKRHA  468
            G + C +C K+F  +  L  H   H+  KPF C++C   F     L  H  +H G     
Sbjct  219  GTHVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFT  278

Query  469  CHICQKSFKEKSSLRKHMLSHTGDRPYECYVCHKAFTQKTTLNSHILVHAGERPYECSAC  528
            C +C   F   +SL +HM  H+ D+P+ C +C K F +K  L++H   H GE P+ C  C
Sbjct  279  CIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYC  338

Query  529  QKIFKDKATLKKHLSVHINEKTHECLICLKKFTHKAALNSHL  570
             K F  K  +  H+  H  E  H C  C K FT K  L +H+
Sbjct  339  AKTFTRKEHMVNHVRKHTGETPHRCDFCSKTFTRKEHLLNHV  380


 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 52/106 (49%), Gaps = 0/106 (0%)

Query  467  HACHICQKSFKEKSSLRKHMLSHTGDRPYECYVCHKAFTQKTTLNSHILVHAGERPYECS  526
            H C IC K F+ +  L  H   H+  +P+ C VC + FT    L  H  +H G   + C 
Sbjct  221  HVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTCI  280

Query  527  ACQKIFKDKATLKKHLSVHINEKTHECLICLKKFTHKAALNSHLST  572
             C  +F +  +L++H+  H  +K   C IC K F  K  L++H  +
Sbjct  281  VCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRS  326



Lambda      K        H
   0.314    0.131    0.366 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1387782160


Query= XP_003393033.2 plasma protease C1 inhibitor [Bombus terrestris]

Length=848
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SP27A_DROME  unnamed protein product                                  229     8e-67
SP42D_DROME  unnamed protein product                                  186     5e-52
Q7KA66_DROME  unnamed protein product                                 167     4e-45
Q0E8V6_DROME  unnamed protein product                                 167     5e-45
Q7JV69_DROME  unnamed protein product                                 163     8e-44


>SP27A_DROME unnamed protein product
Length=447

 Score = 229 bits (585),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 140/391 (36%), Positives = 234/391 (60%), Gaps = 16/391 (4%)

Query  57   EDDEIFIPYQGERFNIFDWALFRTMSKKYSG--NMLLSPISLKIVLVLLYEGAQD--ETA  112
            +D + F+P++ +  + F W L +T+ +  +   N+++SP S+K+VL LL E A    +T 
Sbjct  60   DDIDTFVPFRSDSHDPFSWHLLKTVLQNETADKNVIISPFSVKLVLALLAEAAGAGTQTQ  119

Query  113  HELATAMQLPANENVIRKRFSTILQSLQ-SNPPAYILNIGTRIYIDSNILIRQKYEATVK  171
             ELA       ++N +R+ +   L S +  N     L++ T+++ DS I  +QK+ AT+K
Sbjct  120  VELANTQTDIRSQNNVREFYRKTLNSFKKENQLHETLSVRTKLFTDSFIETQQKFTATLK  179

Query  172  AYYDTDVISANLSDAQPVVQAINDWVSNITDANIDQMIKDENNVKNSLMLIMNTLFFKGS  231
             +YD++V + + ++ +    AIN W +NIT   + Q++  +N V++S+ML+ N ++F G 
Sbjct  180  HFYDSEVEALDFTNPEAAADAINAWAANITQGRLQQLVAPDN-VRSSVMLLTNLIYFNGL  238

Query  232  WRRKYFSPENTRTGKFYTIDNQTIDVPFMHTFGRFYYANSPELDATILRIPYDGRKFALY  291
            WRR++ +   T  G F+   +      FM     FYY  S +L A ILR+PY G+  +L+
Sbjct  239  WRRQFAT---TFQGSFFRSKDDQSRAEFMEQTDYFYYTTSEKLKAQILRLPYKGKN-SLF  294

Query  292  LLLPRNKTLDGIEHLVNEVTPFVLTRYVWQMQNLPIAVTIPKFKYQFSSHMEPVLREVGI  351
            +LLP    L+GI  LV  +    L    W M+ + + VT+PKF + +  +++  LR +G+
Sbjct  295  VLLPY--ALNGIHDLVKNLENDELKSAQWAMEEVKVKVTLPKFHFDYQQNLKETLRSLGV  352

Query  352  RNIFDDTATLTGIAQTRRISSNLKVSDILQKTGIEVNENGTTAYVATEVDIGNKIGE---  408
            R IF+D+A+L G+ +   ++  +KVS+ILQK GI VNE GT AY AT V+I NK G    
Sbjct  353  REIFEDSASLPGLTRGADVAGKVKVSNILQKAGINVNEKGTEAYAATVVEIENKFGGSTA  412

Query  409  -EIFHADHPFVFYIEDESTGTVIYIGRMMNP  438
             E F+ + PFVF+IE+ESTG +++ G++ +P
Sbjct  413  IEEFNVNRPFVFFIEEESTGNILFAGKVHSP  443


 Score = 100 bits (248),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 97/371 (26%), Positives = 181/371 (49%), Gaps = 27/371 (7%)

Query  491  LTKKYKDGNLVSSPASVKTILTMLMEGANGNTKSEIISVLRLPEGKSRRG--ELAQRILA  548
            L  +  D N++ SP SVK +L +L E A   T++++       + +S+    E  ++ L 
Sbjct  85   LQNETADKNVIISPFSVKLVLALLAEAAGAGTQTQVELANTQTDIRSQNNVREFYRKTLN  144

Query  549  SLNR-NENGTEIALTTRLWIHENLRVSNNYKNILRSRYQGDIESVNFMESQSTARHINEW  607
            S  + N+    +++ T+L+    +     +   L+  Y  ++E+++F   ++ A  IN W
Sbjct  145  SFKKENQLHETLSVRTKLFTDSFIETQQKFTATLKHFYDSEVEALDFTNPEAAADAINAW  204

Query  608  VRRVTHNTISSALLLNELPPDTR---LILTSVIYFKGLWLKSFDKANTKLQCFYIPNGEC  664
               +T   +   +     P + R   ++LT++IYF GLW + F  A T    F+    + 
Sbjct  205  AANITQGRLQQLVA----PDNVRSSVMLLTNLIYFNGLWRRQF--ATTFQGSFFRSKDDQ  258

Query  665  RNTYFMKHGSIYRYAYIPSIEAHVLEIPYSDGKTSMLTLMPRSRK--NDPYLRILSDDLI  722
                FM+    + Y     ++A +L +PY  GK S+  L+P +    +D    + +D+L 
Sbjct  259  SRAEFMEQTDYFYYTTSEKLKAQILRLPYK-GKNSLFVLLPYALNGIHDLVKNLENDEL-  316

Query  723  TVPVSAILANLKKQDITIHLPKFNIENNLDLVPTLRHLGIENIFQPNTNLSKMISDS---  779
                SA  A +++  + + LPKF+ +   +L  TLR LG+  IF+ + +L  +   +   
Sbjct  317  ---KSAQWA-MEEVKVKVTLPKFHFDYQQNLKETLRSLGVREIFEDSASLPGLTRGADVA  372

Query  780  -SIHVASILQNVKLEIDEEGT--LAATDTEIGYKLLSSWS-NDVKMDRPFLFMIIDSVLN  835
              + V++ILQ   + ++E+GT   AAT  EI  K   S +  +  ++RPF+F I +    
Sbjct  373  GKVKVSNILQKAGINVNEKGTEAYAATVVEIENKFGGSTAIEEFNVNRPFVFFIEEESTG  432

Query  836  MTLFSGRFIEP  846
              LF+G+   P
Sbjct  433  NILFAGKVHSP  443


>SP42D_DROME unnamed protein product
Length=372

 Score = 186 bits (472),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 108/365 (30%), Positives = 190/365 (52%), Gaps = 16/365 (4%)

Query  77   LFRTMSKKYSG-NMLLSPISLKIVLVLLYEGAQDETAHELATAMQLPA-NENVIRKRFST  134
            +++ +SK ++  N+++SP+S++ +L +++ GA+  TA EL +A+ LP+ ++  +  R+  
Sbjct  21   IYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALGLPSEDKEAVAARYGA  80

Query  135  ILQSLQSNPPAYILNIGTRIYIDSNILIRQKYEATVKAYYDTDVISANLSDAQPVVQAIN  194
            +L  LQ      IL +  RIY++    + Q Y   V+  + ++  S +L++     + IN
Sbjct  81   LLNDLQGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTNGPVAAERIN  140

Query  195  DWVSNITDANIDQMIKDENNVKNSLMLIMNTLFFKGSWRRKYFSPENTRTGKFYTIDNQT  254
             WV + T   I  MI   +   +   L++N ++FKG W  K F P  TR   F    N++
Sbjct  141  QWVLDQTSGKIKGMIDPGSMTSDVKALLVNAIYFKGQWESK-FDPAKTRASTFQVTANKS  199

Query  255  IDVPFMHTFGRFYYANSPELDATILRIPYDGRKFALYLLLPRNKTLDGIEHLVNEVTPFV  314
            + V  M   G F      +LDA ++ +PY     ++ + LPR   ++G+  L  ++  F 
Sbjct  200  VPVQMMAQMGTFRANYFRDLDAQVIELPYLNSNLSMTIFLPRE--VEGLSALEEKIVGFA  257

Query  315  LTRYVWQMQNLPIAVTIPKFKYQFSSHMEPVLREVGIRNIFDDTATLTGIAQTRRISSNL  374
                  +     + + +PKFK +F   ++  L ++GIR +F D + L+G+   +   S  
Sbjct  258  RPLVAKE-----VYLKLPKFKIEFRDELKETLEKLGIRELFTDKSDLSGLFADK---SGG  309

Query  375  KVSDILQKTGIEVNENGTTAYVATEVDIGNKIGEEIF-HADHPFVFYIEDESTGTVIYIG  433
            KVS +  K  +EVNE G  A  AT V + N+ G   F  ADHPF F I D    T+ + G
Sbjct  310  KVSQVSHKAFLEVNEEGAEAAGATSVAVTNRAGFSTFLMADHPFAFVIRD--ANTIYFQG  367

Query  434  RMMNP  438
            R+++P
Sbjct  368  RVVSP  372


 Score = 172 bits (437),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 108/360 (30%), Positives = 173/360 (48%), Gaps = 12/360 (3%)

Query  489  QALTKKYKDGNLVSSPASVKTILTMLMEGANGNTKSEIISVLRLP-EGKSRRGELAQRIL  547
            Q L+K + + NLV SP S++TIL+M+  GA G+T  E+ S L LP E K         +L
Sbjct  23   QLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALGLPSEDKEAVAARYGALL  82

Query  548  ASLNRNENGTEIALTTRLWIHENLRVSNNYKNILRSRYQGDIESVNFMESQSTARHINEW  607
              L   E G  + L  R+++++   ++ NY   +R  ++ + ES++       A  IN+W
Sbjct  83   NDLQGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTNGPVAAERINQW  142

Query  608  VRRVTHNTISSALLLNELPPDTRLILTSVIYFKGLWLKSFDKANTKLQCFYIPNGECRNT  667
            V   T   I   +    +  D + +L + IYFKG W   FD A T+   F +   +    
Sbjct  143  VLDQTSGKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTFQVTANKSVPV  202

Query  668  YFMKHGSIYRYAYIPSIEAHVLEIPYSDGKTSMLTLMPRSRKNDPYLRILSDDLITVPVS  727
              M     +R  Y   ++A V+E+PY +   SM   +PR  +    L  L + ++     
Sbjct  203  QMMAQMGTFRANYFRDLDAQVIELPYLNSNLSMTIFLPREVEG---LSALEEKIV-----  254

Query  728  AILANLKKQDITIHLPKFNIENNLDLVPTLRHLGIENIFQPNTNLSKMISD-SSIHVASI  786
                 L  +++ + LPKF IE   +L  TL  LGI  +F   ++LS + +D S   V+ +
Sbjct  255  GFARPLVAKEVYLKLPKFKIEFRDELKETLEKLGIRELFTDKSDLSGLFADKSGGKVSQV  314

Query  787  LQNVKLEIDEEGTLAATDTEIGYKLLSSWSNDVKMDRPFLFMIIDSVLNMTLFSGRFIEP  846
                 LE++EEG  AA  T +     + +S  +  D PF F+I D+  N   F GR + P
Sbjct  315  SHKAFLEVNEEGAEAAGATSVAVTNRAGFSTFLMADHPFAFVIRDA--NTIYFQGRVVSP  372


>Q7KA66_DROME unnamed protein product
Length=390

 Score = 167 bits (423),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 107/373 (29%), Positives = 198/373 (53%), Gaps = 19/373 (5%)

Query  71   NIFDWALFRTMS-KKYSGNMLLSPISLKIVLVLLYEGAQDETAHELATAMQLPANE--NV  127
            N+F   LF+T++  +   N+++SP+S+++ L L Y GA+  TA EL   +   A E  + 
Sbjct  28   NLFATELFQTLATDRQDENVIISPVSIQLALGLAYYGAEGRTAAELQKTLHASAKESKDG  87

Query  128  IRKRFSTILQSLQSNPPAYILNIGTRIYIDSNILIRQKYEATVKAYYDTDVISANLSDAQ  187
            + + +  +L S   +    +L I  ++Y   N+ +   +    + Y+D++V   + S   
Sbjct  88   LAESYHNLLHSYIKSKT--VLEIANKVYTRQNLTVSSHFREVAQKYFDSEVEPLDFSRET  145

Query  188  PVVQAINDWVSNITDANIDQMIKDENNVKNSLMLIMNTLFFKGSWRRKYFSPENTRTGKF  247
              V+ IN WV   T+  I++++  E+   ++ + ++N ++FK  W R  F+ E+TR  +F
Sbjct  146  EAVEQINRWVKQQTENKIERVV--ESLEPDTNVALVNAIYFKARWARP-FNDEDTRDREF  202

Query  248  YTIDNQTIDVPFMHTFGRFYYANSPELDATILRIPYDGRKFALYLLLPRNKT-LDGIEHL  306
            +  ++++I VP M     +YYA+ PELDA  + + ++     ++ +LP  ++ L  +E  
Sbjct  203  WLSESRSIQVPTMFADNWYYYADYPELDAKAIELFFENINLTMWFILPNQRSGLQALEQK  262

Query  307  VNEVTPFVLTRYVWQMQNLPIAVTIPKFKYQFSSHMEPVLREVGIRNIFDDTATLTGIAQ  366
            +  V  F L    WQ Q+  ++V +PKFK++F + + P L ++GI  +F D A  + I Q
Sbjct  263  LKGVD-FNLLEDRWQWQS--VSVYLPKFKFEFDTDLRPTLHKMGISAMFSDAADFSNIFQ  319

Query  367  TRRISSNLKVSDILQKTGIEVNENGTTAY---VATEVDIGNKIGEEIFHADHPFVFYIED  423
               I +  +++ +  KT I+VNE G  A     A  V +   +  + F ADHPF F I D
Sbjct  320  DSPIGT--RITKVQHKTFIDVNEIGCEAAGASYAAGVPMSLPLDPKTFVADHPFAFIIRD  377

Query  424  ESTGTVIYIGRMM  436
            +    V + G ++
Sbjct  378  KH--AVYFTGHIV  388


 Score = 142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 104/402 (26%), Positives = 187/402 (47%), Gaps = 37/402 (9%)

Query  459  LNAGISSADSISQAGLNAEDRNNLFNMYFPQALTKKYKDGNLVSSPASVKTILTMLMEGA  518
            L   IS+ + +   G   +DRN LF     Q L    +D N++ SP S++  L +   GA
Sbjct  10   LGVWISAPEGL---GNTIKDRN-LFATELFQTLATDRQDENVIISPVSIQLALGLAYYGA  65

Query  519  NGNTKSEIISVLRLPEGKSRRG--ELAQRILASLNRNENGTEIALTTRLWIHENLRVSNN  576
             G T +E+   L     +S+ G  E    +L S  +++   EIA   +++  +NL VS++
Sbjct  66   EGRTAAELQKTLHASAKESKDGLAESYHNLLHSYIKSKTVLEIA--NKVYTRQNLTVSSH  123

Query  577  YKNILRSRYQGDIESVNFMESQSTARHINEWVRRVTHNTISSALLLNELPPDTRLILTSV  636
            ++ + +  +  ++E ++F         IN WV++ T N I    ++  L PDT + L + 
Sbjct  124  FREVAQKYFDSEVEPLDFSRETEAVEQINRWVKQQTENKIER--VVESLEPDTNVALVNA  181

Query  637  IYFKGLWLKSFDKANTKLQCFYIPNGECRNTYFMKHGSIYRYAYIPSIEAHVLEIPYSDG  696
            IYFK  W + F+  +T+ + F++          M   + Y YA  P ++A  +E+ + + 
Sbjct  182  IYFKARWARPFNDEDTRDREFWLSESRSIQVPTMFADNWYYYADYPELDAKAIELFFENI  241

Query  697  KTSMLTLMPRSRKNDPYLRILSDDLITVPVSAILANLKKQDITIHLPKFNIENNLDLVPT  756
              +M  ++P  R     L+ L   L  V  + +    + Q ++++LPKF  E + DL PT
Sbjct  242  NLTMWFILPNQRSG---LQALEQKLKGVDFNLLEDRWQWQSVSVYLPKFKFEFDTDLRPT  298

Query  757  LRHLGIENIFQPNTNLSKMISDSSI--HVASILQNVKLEIDEEGTLAATDTEIGYKLLSS  814
            L  +GI  +F    + S +  DS I   +  +     ++++E G  AA          +S
Sbjct  299  LHKMGISAMFSDAADFSNIFQDSPIGTRITKVQHKTFIDVNEIGCEAAG---------AS  349

Query  815  WSNDVKM-----------DRPFLFMIIDSVLNMTLFSGRFIE  845
            ++  V M           D PF F+I D   +   F+G  ++
Sbjct  350  YAAGVPMSLPLDPKTFVADHPFAFIIRDK--HAVYFTGHIVK  389


>Q0E8V6_DROME unnamed protein product
Length=384

 Score = 167 bits (422),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 98/356 (28%), Positives = 189/356 (53%), Gaps = 14/356 (4%)

Query  496  KDGNLVSSPASVKTILTMLMEGANGNTKSEIISVLRLPEGKSRRGELAQRILASLNRNEN  555
            K  N+++SP  V+  ++M++ GA+GNT +E+ + L LPE K     +  ++L  L R + 
Sbjct  30   KQYNIIASPLCVEIGMSMILMGADGNTANELRTALNLPEDKKNVATIYDKLLTKLERGKK  89

Query  556  GTEIALTTRLWIHENLRVSNNYKNILRSRYQGDIESVNFMESQSTARHINEWVRRVTHNT  615
               + L  RL+++E + V+  Y  ++   ++ + E++   +    A  IN+WV   T + 
Sbjct  90   VAILHLANRLFVNETIGVNKRYNKLVNKHFRAEAEAIKLADRLKAAWAINDWVLDQTLDN  149

Query  616  ISSALLLNELPPDTRLILTSVIYFKGLWLKSFDKANTKLQCFYIPNGECRNTYFMKHGSI  675
            +   ++ ++L PD   ++ +  +FKG W   FDK NTK + FY+      N   M    +
Sbjct  150  VKDIIIPSDLTPDESAVMINAAFFKGYWKTRFDKMNTKPKVFYVSKSYQVNVNMMSQ--V  207

Query  676  YRYAYIPSIEAHVLEIPYSDGKTSMLTLMPRSRKNDPYLRILSDDLITVPVSAILANLKK  735
             R+    S    ++E+P++    SM+ ++P   K++  L      + + P       L +
Sbjct  208  GRFKMRTSTIDQIIELPFAYSNLSMVIVLP---KDNGSLTQAEATIESYPQIV----LTE  260

Query  736  QDITIHLPKFNIENNLDLVPTLRHLGIENIFQPNTNLSKMISDSSIHVASILQNVKLEID  795
             D+ + LPKF I+  ++LV TL+ +GI+++F  ++++S +++ S   ++ ++    +EID
Sbjct  261  MDVHVQLPKFKIDFRMELVETLKSMGIQDLFNSSSDISVLLNQSGTRISQVVHKAFIEID  320

Query  796  EEGTLAATDTEIGYKLLSSWSNDV---KMDRPFLFMIIDSVLNMTLFSGRFIEPLK  848
            EEG  A + +    + LS ++  V    ++ PF+FMI D   +   F GR ++PLK
Sbjct  321  EEGGSAGSASASPIRGLSDYATSVVTFTVNSPFVFMIRDD--DNIYFRGRVVDPLK  374


 Score = 131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 96/384 (25%), Positives = 185/384 (48%), Gaps = 44/384 (11%)

Query  73   FDWALFRTM---SKKYSGNMLLSPISLKIVLVLLYEGAQDETAHELATAMQLPANENVIR  129
            F   L+R+    +K+Y  N++ SP+ ++I + ++  GA   TA+EL TA+ LP ++  + 
Sbjct  17   FTKQLYRSFLQDNKQY--NIIASPLCVEIGMSMILMGADGNTANELRTALNLPEDKKNVA  74

Query  130  KRFSTILQSLQSNPPAYILNIGTRIYIDSNILIRQKYEATVKAYYDTDVISANLSDAQPV  189
              +  +L  L+      IL++  R++++  I + ++Y   V  ++  +  +  L+D    
Sbjct  75   TIYDKLLTKLERGKKVAILHLANRLFVNETIGVNKRYNKLVNKHFRAEAEAIKLADRLKA  134

Query  190  VQAINDWVSNITDANIDQMIKDENNVKNSLMLIMNTLFFKGSWRRKYFSPENTRTGKFYT  249
              AINDWV + T  N+  +I   +   +   +++N  FFKG W+ + F   NT+   FY 
Sbjct  135  AWAINDWVLDQTLDNVKDIIIPSDLTPDESAVMINAAFFKGYWKTR-FDKMNTKPKVFYV  193

Query  250  IDNQTIDVPFMHTFGRFYYANSPELDATILRIPYDGRKFALYLLLPR-NKTLDGIEHLVN  308
              +  ++V  M   GRF    S  +D  I+ +P+     ++ ++LP+ N +L   E  + 
Sbjct  194  SKSYQVNVNMMSQVGRFKMRTS-TIDQ-IIELPFAYSNLSMVIVLPKDNGSLTQAEATIE  251

Query  309  EVTPFVLTRYVWQMQNLPIAVTIPKFKYQFSSHMEPVLREVGIRNIFDDTATLTGIAQTR  368
                 VLT        + + V +PKFK  F   +   L+ +GI+++F+ ++ ++ +    
Sbjct  252  SYPQIVLTE-------MDVHVQLPKFKIDFRMELVETLKSMGIQDLFNSSSDISVLLN--  302

Query  369  RISSNLKVSDILQKTGIEVNEN-------------GTTAYVATEVDIGNKIGEEIFHADH  415
               S  ++S ++ K  IE++E              G + Y  + V          F  + 
Sbjct  303  --QSGTRISQVVHKAFIEIDEEGGSAGSASASPIRGLSDYATSVV---------TFTVNS  351

Query  416  PFVFYIEDESTGTVIYIGRMMNPL  439
            PFVF I D+    + + GR+++PL
Sbjct  352  PFVFMIRDDD--NIYFRGRVVDPL  373


>Q7JV69_DROME unnamed protein product
Length=374

 Score = 163 bits (412),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 94/349 (27%), Positives = 173/349 (50%), Gaps = 9/349 (3%)

Query  499  NLVSSPASVKTILTMLMEGANGNTKSEIISVLRLPEGKSRRGELAQRILASLNRNENGTE  558
            N+V SP S++T + +   G+ G T  EI   L      +   E+AQ     L +  N   
Sbjct  31   NVVFSPFSIQTCIALAFAGSQGETADEIAKALHFV--SNFPPEVAQTFQFVLEKYRNSNL  88

Query  559  IALTTRLWIHENLRVSNNYKNILRSRYQGDIESVNFMESQSTARHINEWVRRVTHNTISS  618
            + +  +L++ E  ++   Y++ ++ +Y  + ES+NF  + + A+ IN WV   T   I+ 
Sbjct  89   LRVANKLYVQEGKQLKPAYQSAIKEQYHSEAESINFALNDAAAQAINAWVNAKTQGKITE  148

Query  619  ALLLNELPPDTRLILTSVIYFKGLWLKSFDKANTKLQCFYIPNGECRNTYFMKHGSIYRY  678
             +  +    +TRL+L + ++FKG W   F +  T+   F++   E     +M   + + Y
Sbjct  149  LVSADSFSDNTRLVLLNALHFKGSWAHKFSEERTEEDIFWVGEEEQVKINYMNQKAKFNY  208

Query  679  AYIPSIEAHVLEIPYSDGKTSMLTLMPRSRKNDPYLRILSDDLITVPVSAILANLKKQDI  738
             +   +    LE+PY D   SM  L+P+ R     +  L++ L TV +  +   L  +++
Sbjct  209  GFFEDLGCTALEMPYQDSDLSMFVLLPQERTG---IYALAEKLKTVNLVDLADKLTVEEV  265

Query  739  TIHLPKFNIENNLDLVPTLRHLGIENIFQPNTNLSKMI-SDSSIHVASILQNVKLEIDEE  797
             +  PKF ++ +L+L   L+ LGI  +F      S ++ S   + V+ +L    +E++EE
Sbjct  266  HVKFPKFKVDYSLELAEKLKQLGITKMFTDQAEFSNLLESPEGVFVSKVLHKATIEVNEE  325

Query  798  GTLAATDTE-IGYKLLSSWSNDVKMDRPFLFMIIDSVLNMTLFSGRFIE  845
            GT AA  T  I    + ++    + DRPFL++I +      LF+G F++
Sbjct  326  GTEAAAATGMIMMTRMMTFPLQFQADRPFLYVIWNK--KNILFAGAFVK  372


 Score = 153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 93/337 (28%), Positives = 173/337 (51%), Gaps = 12/337 (4%)

Query  88   NMLLSPISLKIVLVLLYEGAQDETAHELATAMQLPAN-ENVIRKRFSTILQSLQSNPPAY  146
            N++ SP S++  + L + G+Q ETA E+A A+   +N    + + F  +L+  +++    
Sbjct  31   NVVFSPFSIQTCIALAFAGSQGETADEIAKALHFVSNFPPEVAQTFQFVLEKYRNSN---  87

Query  147  ILNIGTRIYIDSNILIRQKYEATVKAYYDTDVISANLSDAQPVVQAINDWVSNITDANID  206
            +L +  ++Y+     ++  Y++ +K  Y ++  S N +      QAIN WV+  T   I 
Sbjct  88   LLRVANKLYVQEGKQLKPAYQSAIKEQYHSEAESINFALNDAAAQAINAWVNAKTQGKIT  147

Query  207  QMIKDENNVKNSLMLIMNTLFFKGSWRRKYFSPENTRTGKFYTIDNQTIDVPFMHTFGRF  266
            +++  ++   N+ ++++N L FKGSW  K FS E T    F+  + + + + +M+   +F
Sbjct  148  ELVSADSFSDNTRLVLLNALHFKGSWAHK-FSEERTEEDIFWVGEEEQVKINYMNQKAKF  206

Query  267  YYANSPELDATILRIPYDGRKFALYLLLPRNKTLDGIEHLVNEVTPFVLTRYVWQMQNLP  326
             Y    +L  T L +PY     ++++LLP+ +T  GI  L  ++    L     ++    
Sbjct  207  NYGFFEDLGCTALEMPYQDSDLSMFVLLPQERT--GIYALAEKLKTVNLVDLADKLTVEE  264

Query  327  IAVTIPKFKYQFSSHMEPVLREVGIRNIFDDTATLTGIAQTRRISSNLKVSDILQKTGIE  386
            + V  PKFK  +S  +   L+++GI  +F D A  + + ++      + VS +L K  IE
Sbjct  265  VHVKFPKFKVDYSLELAEKLKQLGITKMFTDQAEFSNLLES---PEGVFVSKVLHKATIE  321

Query  387  VNENGTTAYVATEVDIGNKIGEE--IFHADHPFVFYI  421
            VNE GT A  AT + +  ++      F AD PF++ I
Sbjct  322  VNEEGTEAAAATGMIMMTRMMTFPLQFQADRPFLYVI  358



Lambda      K        H
   0.314    0.131    0.366 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1387782160


Query= XP_003393035.1 phospholipase A2 group XV [Bombus terrestris]

Length=407
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

C6KTC8_PLAF7  unnamed protein product                                 102     3e-23
Q17936_CAEEL  unnamed protein product                                 32.0    0.93 
Q585D5_TRYB2  unnamed protein product                                 30.4    3.1  
Q581T2_TRYB2  unnamed protein product                                 30.0    4.5  


>C6KTC8_PLAF7 unnamed protein product
Length=863

 Score = 102 bits (254),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 110/420 (26%), Positives = 183/420 (44%), Gaps = 64/420 (15%)

Query  34   LVPGDGGSQVEAKINKTTVVHYLCEK--VSAEYFNIWLNLELLVPVI--IDCWIDNMKLT  89
            L+PG GGS + A+    T+  + C +  ++++ F IW++L  L+ +   I C  D ++L 
Sbjct  448  LLPGLGGSTLIAEYKNATI--HSCSRYLLNSKPFRIWISLSRLLSIQSNIYCTFDTIRLK  505

Query  90   YDNITRTTRNQDGVDIRIPGWGDPFVVEYLD---PSKASPGAYFKDIGNMLVNQLGYVRN  146
            YD       NQ GV I +  +G+   +EYLD    +      YF  +G    +  GYV  
Sbjct  506  YDEKKNIYYNQPGVFIDVEKFGNLKGIEYLDYFNNTGIGITKYFNVVGQYFTSH-GYVDG  564

Query  147  HSLRGAPYDFRKAPNENEMFFNRLKDLVEETYNNNNQVPVTLLAHSMGGPMSLIFLQR-Q  205
             S+ GAPYD+R   ++    +  LK+ +E  Y   N   V L+ HS+GG     FL R  
Sbjct  565  ESIIGAPYDWRYPLSQQN--YKILKEHIEYIYEKRNGTKVNLIGHSLGGLYLNFFLSRVV  622

Query  206  SQKWKDKYINCLITLSAVWGGSVKALKVFAVG-DDLGAYLLR--------QSILKDEQIT  256
            S+KWK K+++ +I +S  + GSVK ++       D  ++ +         +S++K    +
Sbjct  623  SKKWKQKHLSKIIFISTPFKGSVKTIRALIQSRKDFISFRITKLIKLSIPESMMKALGNS  682

Query  257  SPSLGWLLPSRLFWKDTEILV------------------------------QSEQKNYTL  286
              SL  +LP R ++K  ++++                                   N  +
Sbjct  683  LGSLFDILPYREYYKRDQVVILINMSNTPIDEDHVQYLVTLCGIYKPECYRNRADVNLKV  742

Query  287  LTLQDY--LIDINVPNGWEFRK--DNEKYQLDFTAPEVEVHCLYGS-GIDTVEKLYYKPG  341
             TL+++  L+D  +   +E  K      Y  D   P   ++CLY +      E L Y   
Sbjct  743  YTLKNWHELLDDKLKAKYENYKLYRERYYNKDHGVP---IYCLYSTINKKETEYLLYFET  799

Query  342  ISIEGTPQLIPGDGDGTVNLRSLEGCKYWQGKQKRKVYSQVFPGVNHMEILNNSSVLNYI  401
             +    P +  G GDGTV   SL+ C  +       V +  F   +H+ IL  +    YI
Sbjct  800  QNTREEPTIYYGTGDGTVGTESLQACSNF----YNTVLTHHFSDTSHVGILYTNETAKYI  855


>Q17936_CAEEL unnamed protein product
Length=611

 Score = 32.0 bits (71),  Expect = 0.93, Method: Compositional matrix adjust.
 Identities = 18/65 (28%), Positives = 29/65 (45%), Gaps = 3/65 (5%)

Query  304  FRKDNEKYQLDFTAPEVEVHCLYGSGIDTVEKLYYKPGISIEGTPQLIPGDGDGTVNLRS  363
            F  DNE     +  PE  V  + G G   ++ +  K G  ++ +P   P  G   V + +
Sbjct  63   FMDDNEAVNEKYPIPESAVGIVIGRGGSEIQGIQAKAGCRVQMSPDADPSSG---VRMVT  119

Query  364  LEGCK  368
            LEG +
Sbjct  120  LEGSR  124


>Q585D5_TRYB2 unnamed protein product
Length=739

 Score = 30.4 bits (67),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 20/61 (33%), Positives = 30/61 (49%), Gaps = 4/61 (7%)

Query  3    LYLVIYTIISLSCFISVKSWHSRNKQISPVILVPGD---GGSQVEAKINKTTVVHYLCEK  59
            L L++Y I SLS    V+    R +    V+L+P D   GG+ +E  +      HY C K
Sbjct  253  LTLLLYDISSLSALCRVRQSTRRTRIRFSVLLLPDDLAYGGALLEESLRGPMSCHY-CVK  311

Query  60   V  60
            +
Sbjct  312  L  312


>Q581T2_TRYB2 unnamed protein product
Length=603

 Score = 30.0 bits (66),  Expect = 4.5, Method: Compositional matrix adjust.
 Identities = 29/113 (26%), Positives = 47/113 (42%), Gaps = 20/113 (18%)

Query  140  QLGYVRNHSLRGAPYDFRKAPNENEMFFNRLKDLVEETYNNNNQVPVTLLAHSMGGPMSL  199
             LG+   HSL    +  R + +  E     L+++VEET   + +V          GP   
Sbjct  408  ALGFHCYHSLEDLEHGVRTSGSYVEKVVTMLREVVEETVTMDEEVS--------AGP---  456

Query  200  IFLQRQSQKWKDKYINCLITLSAVWGG--SVKALKVFAVGDDLGAYLLRQSIL  250
                   +  K  Y   ++   AV G   SV AL  ++   D+  +LL Q+I+
Sbjct  457  -------RTEKACYKTLVVVACAVMGFLISVAALLEYSQSSDVRVHLLNQNII  502



Lambda      K        H
   0.314    0.131    0.366 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1387782160


Query= XP_003393036.1 TBC1 domain family member 20 isoform X2 [Bombus
terrestris]

Length=453
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9W5H8_DROME  unnamed protein product                                 166     6e-47
A0A0B4KEC2_DROME  unnamed protein product                             163     7e-46
A0A0B4KEH8_DROME  unnamed protein product                             156     2e-43
Q5LJQ4_DROME  unnamed protein product                                 137     3e-37
Q4GYQ1_TRYB2  unnamed protein product                                 50.4    2e-06


>Q9W5H8_DROME unnamed protein product
Length=378

 Score = 166 bits (420),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 104/328 (32%), Positives = 162/328 (49%), Gaps = 4/328 (1%)

Query  95   RERMKISVIRGSVANPNLTLGELKLLGCSSEGLVNDDIRRALWPTLLRLSEETTFSINGL  154
            ++R++I  +     + N++   L  L  +  GLVNDD RR LWP L  +          L
Sbjct  22   KKRLEIEKLINKNIDKNISFDVLVKLSLAPYGLVNDDFRRILWPQLAGVDINHLGQAPTL  81

Query  155  ETIHSHIPNEVYQQILKDVARSGSHISQNATQHEIDHFHEQLTQLMCWVLHKHSMLNYYQ  214
            +    H P   Y Q++ DV RS           +     +QLT L+  V+ K+  L YYQ
Sbjct  82   DKFQCH-PE--YNQVVLDVNRSLKRFPPGIPYEQRIALQDQLTVLILRVIQKYPNLRYYQ  138

Query  215  GYNDIAATVLLVMGLEKGLRVLESISLEFLERFMEKTMEKVNQELFYIFALLERVHPTLL  274
            GY+D+A T LLV+G E    ++E +S       M++TME   + L +I+ +++  +P L 
Sbjct  139  GYHDVAVTFLLVVGEEIAFAIMEQLSTTHFSECMQETMEATQRRLMFIWPIIKFENPELY  198

Query  275  EHLENVELFPHFALAEYTTWYAHKYAENRKLLHRLFDYFLGSPPLMPLYLSTVIVAHRAT  334
            + L+N  +   F+L  Y TW+ H     R ++ RL+DYFL SP    ++++  I+ +R+ 
Sbjct  199  QFLQNSTVGTLFSLPWYLTWFGHSLTSYRTVV-RLYDYFLASPIYTSIFVTAAILLYRSD  257

Query  335  EIFNTTPDMGHTHKVLCTLPDDLPFETLLVEAKNLYREYPPESISNDVREFDRKRKCKEQ  394
            EI     DM   H +L  +P+DLPFE LL  + +L  +Y    I  DV E   + + K +
Sbjct  258  EILKEDCDMASVHCLLSVIPEDLPFEDLLKTSSSLLNKYSLTLIEKDVEELICQERRKRK  317

Query  395  EWKAKAEASRQEREKQRQLRIVKSAPRI  422
              +A     RQ     R   I K  P I
Sbjct  318  TDEALIVKRRQPATSNRIPIITKWLPNI  345


>A0A0B4KEC2_DROME unnamed protein product
Length=376

 Score = 163 bits (413),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 108/331 (33%), Positives = 164/331 (50%), Gaps = 12/331 (4%)

Query  95   RERMKISVIRGSVANPNLTLGELKLLGCSSEGLVNDDIRRALWPTLLRLSEETTFSINGL  154
            ++R++I  +     + N++   L  L  +  GLVNDD RR LWP L  +          L
Sbjct  22   KKRLEIEKLINKNIDKNISFDVLVKLSLAPYGLVNDDFRRILWPQLAGVDINHLGQAPTL  81

Query  155  ETIHSHIPNEVYQQILKDVARSGSHISQNATQHEIDHFHEQLTQLMCWVLHKHSMLNYYQ  214
            +    H P   Y Q++ DV RS           +     +QLT L+  V+ K+  L YYQ
Sbjct  82   DKFQCH-PE--YNQVVLDVNRSLKRFPPGIPYEQRIALQDQLTVLILRVIQKYPNLRYYQ  138

Query  215  GYNDIAATVLLVMGLEKGLRVLESISLEFLERFMEKTMEKVNQELFYIFALLERVHPTLL  274
            GY+D+A T LLV+G E    ++E +S       M++TME   + L +I+ +++  +P L 
Sbjct  139  GYHDVAVTFLLVVGEEIAFAIMEQLSTTHFSECMQETMEATQRRLMFIWPIIKFENPELY  198

Query  275  EHLENVELFPHFALAEYTTWYAHKYAENRKLLHRLFDYFLGSPPLMPLYLSTVIVAHRAT  334
            + L+N  +   F+L  Y TW+ H     R ++ RL+DYFL SP    ++++  I+ +R+ 
Sbjct  199  QFLQNSTVGTLFSLPWYLTWFGHSLTSYRTVV-RLYDYFLASPIYTSIFVTAAILLYRSD  257

Query  335  EIFNTTPDMGHTHKVLCTLPDDLPFETLLVEAKNLYREYPPESISNDVREF---DRKRKC  391
            EI     DM   H +L ++P+DLPFE LL  + +L  +Y    I  DV E    +RKRK 
Sbjct  258  EILKEDCDMASVHCLL-SIPEDLPFEDLLKTSSSLLNKYSLTLIEKDVEELICQERKRKT  316

Query  392  KEQEWKAKAEASRQEREKQRQLRIVKSAPRI  422
             E    A     RQ     R   I K  P I
Sbjct  317  DE----ALIVKRRQPATSNRIPIITKWLPNI  343


>A0A0B4KEH8_DROME unnamed protein product
Length=371

 Score = 156 bits (395),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 102/328 (31%), Positives = 160/328 (49%), Gaps = 11/328 (3%)

Query  95   RERMKISVIRGSVANPNLTLGELKLLGCSSEGLVNDDIRRALWPTLLRLSEETTFSINGL  154
            ++R++I  +     + N++   L  L  +  GLVNDD RR LWP L  +          L
Sbjct  22   KKRLEIEKLINKNIDKNISFDVLVKLSLAPYGLVNDDFRRILWPQLAGVDINHLGQAPTL  81

Query  155  ETIHSHIPNEVYQQILKDVARSGSHISQNATQHEIDHFHEQLTQLMCWVLHKHSMLNYYQ  214
            +    H P   Y Q++ DV RS           +     +QLT L+  V+ K+  L YYQ
Sbjct  82   DKFQCH-PE--YNQVVLDVNRSLKRFPPGIPYEQRIALQDQLTVLILRVIQKYPNLRYYQ  138

Query  215  GYNDIAATVLLVMGLEKGLRVLESISLEFLERFMEKTMEKVNQELFYIFALLERVHPTLL  274
            GY+D+A T LLV+G E    ++E +S       M++TME   + L +I+ +++  +P L 
Sbjct  139  GYHDVAVTFLLVVGEEIAFAIMEQLSTTHFSECMQETMEATQRRLMFIWPIIKFENPELY  198

Query  275  EHLENVELFPHFALAEYTTWYAHKYAENRKLLHRLFDYFLGSPPLMPLYLSTVIVAHRAT  334
            + L+N  +   F+L  Y TW+ H     R ++ RL+DYFL SP    ++++  I+ +R+ 
Sbjct  199  QFLQNSTVGTLFSLPWYLTWFGHSLTSYRTVV-RLYDYFLASPIYTSIFVTAAILLYRSD  257

Query  335  EIFNTTPDMGHTHKVLCTLPDDLPFETLLVEAKNLYREYPPESISNDVREFDRKRKCKEQ  394
            EI     DM        ++P+DLPFE LL  + +L  +Y    I  DV E   + + K +
Sbjct  258  EILKEDCDMA-------SIPEDLPFEDLLKTSSSLLNKYSLTLIEKDVEELICQERRKRK  310

Query  395  EWKAKAEASRQEREKQRQLRIVKSAPRI  422
              +A     RQ     R   I K  P I
Sbjct  311  TDEALIVKRRQPATSNRIPIITKWLPNI  338


>Q5LJQ4_DROME unnamed protein product
Length=282

 Score = 137 bits (346),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 82/265 (31%), Positives = 133/265 (50%), Gaps = 4/265 (2%)

Query  95   RERMKISVIRGSVANPNLTLGELKLLGCSSEGLVNDDIRRALWPTLLRLSEETTFSINGL  154
            ++R++I  +     + N++   L  L  +  GLVNDD RR LWP L  +          L
Sbjct  22   KKRLEIEKLINKNIDKNISFDVLVKLSLAPYGLVNDDFRRILWPQLAGVDINHLGQAPTL  81

Query  155  ETIHSHIPNEVYQQILKDVARSGSHISQNATQHEIDHFHEQLTQLMCWVLHKHSMLNYYQ  214
            +    H P   Y Q++ DV RS           +     +QLT L+  V+ K+  L YYQ
Sbjct  82   DKFQCH-PE--YNQVVLDVNRSLKRFPPGIPYEQRIALQDQLTVLILRVIQKYPNLRYYQ  138

Query  215  GYNDIAATVLLVMGLEKGLRVLESISLEFLERFMEKTMEKVNQELFYIFALLERVHPTLL  274
            GY+D+A T LLV+G E    ++E +S       M++TME   + L +I+ +++  +P L 
Sbjct  139  GYHDVAVTFLLVVGEEIAFAIMEQLSTTHFSECMQETMEATQRRLMFIWPIIKFENPELY  198

Query  275  EHLENVELFPHFALAEYTTWYAHKYAENRKLLHRLFDYFLGSPPLMPLYLSTVIVAHRAT  334
            + L+N  +   F+L  Y TW+ H     R ++ RL+DYFL SP    ++++  I+ +R+ 
Sbjct  199  QFLQNSTVGTLFSLPWYLTWFGHSLTSYRTVV-RLYDYFLASPIYTSIFVTAAILLYRSD  257

Query  335  EIFNTTPDMGHTHKVLCTLPDDLPF  359
            EI     DM   H +L  +   L +
Sbjct  258  EILKEDCDMASVHCLLSVVSYSLKY  282


>Q4GYQ1_TRYB2 unnamed protein product
Length=533

 Score = 50.4 bits (119),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 45/183 (25%), Positives = 84/183 (46%), Gaps = 19/183 (10%)

Query  143  LSEETTFSINGLETIHSHIPNEVYQQ-ILKDVARSGSHISQNATQHEIDHFHEQLTQLMC  201
            L E +T S    ++  + +P   + + I+ DV RS   +  N T  E     + L  ++ 
Sbjct  180  LEESSTIS----DSWGADLPANCHARVIVADVKRSLWKLYPNETVRE--KKRKMLCNILA  233

Query  202  WVLHKHSMLNYYQGYNDIAATVLLVMGLEKGLR------VLESISLEFLERFMEKTMEKV  255
             +L  +   +YYQG +++   V+ VM   +G R      V   + ++    F  K +E+ 
Sbjct  234  QILSNNPERHYYQGLHEMVGFVMYVM---EGAREADIVAVCSRLLVQQWRSFSCKQLERS  290

Query  256  NQELFYIFALLERVHPTLLEHLENVELFP--HFALAEYTTWYAHKYAENRKLLHRLFDYF  313
               ++ +  ++ +    L E LE   + P  H+A+    TWY H   ++ + L RLFD+ 
Sbjct  291  QSMMYAMHTIVVKEEKILAEELEACSVGPESHYAMPWLITWYTH-VCDDVEALSRLFDFL  349

Query  314  LGS  316
            + S
Sbjct  350  VAS  352



Lambda      K        H
   0.314    0.131    0.366 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1387782160


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Aug 1, 2023  12:07 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_003393038.1 suppressor of cytokine signaling 5 [Bombus
terrestris]

Length=516
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VJA1_DROME  unnamed protein product                                 275     5e-85
Q86P82_DROME  unnamed protein product                                 275     6e-85
Q8INY1_DROME  unnamed protein product                                 275     4e-84
M9PHY7_DROME  unnamed protein product                                 75.9    3e-14
Q9VX18_DROME  unnamed protein product                                 75.9    3e-14


>Q9VJA1_DROME unnamed protein product
Length=633

 Score = 275 bits (703),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 141/171 (82%), Gaps = 0/171 (0%)

Query  328  AHTQVDYVHCLVPDLRSITACSFYWGKMDRYEAERLLEGKQEGTFLLRDSAQEEFIFSVS  387
             H+Q+D++HCLVPDL  IT  SFYWGKMDRYEAE LLEGK EGTFLLRDSAQEEF+FSV+
Sbjct  452  VHSQIDFMHCLVPDLEKITNSSFYWGKMDRYEAEHLLEGKPEGTFLLRDSAQEEFLFSVT  511

Query  388  FRKYGRSLHARIEQWNHKFSFDSHDPGVYASETVCGLIEHYKHPSCSMFFEPMLTIPFHR  447
            FRKYGRSLHARIEQ  HKFSFD HDP V+ + TV GL+EHYK P+C MFFEP LTIP HR
Sbjct  512  FRKYGRSLHARIEQSGHKFSFDCHDPCVFTAPTVTGLLEHYKDPACVMFFEPCLTIPLHR  571

Query  448  NFAFPLQHLCRAVITTRTTYDGINKLQLPKTLKSYLKEYHYKQRVRVRRLD  498
               F LQ L RA I + T+YDGIN+++LP  LKSYLKEYHYKQ++RV+ +D
Sbjct  572  RQTFSLQQLSRATIVSNTSYDGINQMELPGRLKSYLKEYHYKQKLRVKPID  622


>Q86P82_DROME unnamed protein product
Length=634

 Score = 275 bits (703),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 141/171 (82%), Gaps = 0/171 (0%)

Query  328  AHTQVDYVHCLVPDLRSITACSFYWGKMDRYEAERLLEGKQEGTFLLRDSAQEEFIFSVS  387
             H+Q+D++HCLVPDL  IT  SFYWGKMDRYEAE LLEGK EGTFLLRDSAQEEF+FSV+
Sbjct  453  VHSQIDFMHCLVPDLEKITNSSFYWGKMDRYEAEHLLEGKPEGTFLLRDSAQEEFLFSVT  512

Query  388  FRKYGRSLHARIEQWNHKFSFDSHDPGVYASETVCGLIEHYKHPSCSMFFEPMLTIPFHR  447
            FRKYGRSLHARIEQ  HKFSFD HDP V+ + TV GL+EHYK P+C MFFEP LTIP HR
Sbjct  513  FRKYGRSLHARIEQSGHKFSFDCHDPCVFTAPTVTGLLEHYKDPACVMFFEPCLTIPLHR  572

Query  448  NFAFPLQHLCRAVITTRTTYDGINKLQLPKTLKSYLKEYHYKQRVRVRRLD  498
               F LQ L RA I + T+YDGIN+++LP  LKSYLKEYHYKQ++RV+ +D
Sbjct  573  RQTFSLQQLSRATIVSNTSYDGINQMELPGRLKSYLKEYHYKQKLRVKPID  623


>Q8INY1_DROME unnamed protein product
Length=737

 Score = 275 bits (704),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 141/171 (82%), Gaps = 0/171 (0%)

Query  328  AHTQVDYVHCLVPDLRSITACSFYWGKMDRYEAERLLEGKQEGTFLLRDSAQEEFIFSVS  387
             H+Q+D++HCLVPDL  IT  SFYWGKMDRYEAE LLEGK EGTFLLRDSAQEEF+FSV+
Sbjct  452  VHSQIDFMHCLVPDLEKITNSSFYWGKMDRYEAEHLLEGKPEGTFLLRDSAQEEFLFSVT  511

Query  388  FRKYGRSLHARIEQWNHKFSFDSHDPGVYASETVCGLIEHYKHPSCSMFFEPMLTIPFHR  447
            FRKYGRSLHARIEQ  HKFSFD HDP V+ + TV GL+EHYK P+C MFFEP LTIP HR
Sbjct  512  FRKYGRSLHARIEQSGHKFSFDCHDPCVFTAPTVTGLLEHYKDPACVMFFEPCLTIPLHR  571

Query  448  NFAFPLQHLCRAVITTRTTYDGINKLQLPKTLKSYLKEYHYKQRVRVRRLD  498
               F LQ L RA I + T+YDGIN+++LP  LKSYLKEYHYKQ++RV+ +D
Sbjct  572  RQTFSLQQLSRATIVSNTSYDGINQMELPGRLKSYLKEYHYKQKLRVKPID  622


>M9PHY7_DROME unnamed protein product
Length=1021

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 57/167 (34%), Positives = 82/167 (49%), Gaps = 18/167 (11%)

Query  342   LRSITACSFYWGKMDRYEAERLLEGKQEGTFLLRDSAQEEFIFSVSFRKYGRSLHARIEQ  401
             +  +    +YWG +    AE++L  + +G+F++RDS+ + +IFS+SF+      H RIEQ
Sbjct  842   IEKVKDYGWYWGPLSSEAAEKVLSSEPDGSFIVRDSSDDHYIFSLSFKLNNCVRHVRIEQ  901

Query  402   WNHKFSFDSHDPGVYASETVCGLIEHYKHPSCS---MFF-------EPM---LTIPFHR-  447
                 FSF S+    + S+T+   IE     S S   +FF        PM   LT P  R 
Sbjct  902   DQGTFSFGSY--AKFKSQTITEFIEKAVEHSRSGRYLFFLHRRPEHGPMRVQLTNPVSRF  959

Query  448   NFAFPLQHLCRAVITTRTT-YDGINKLQLPKTLKSYLKEYH-YKQRV  492
                  LQH+CR VI       D I  L LP+ L  YL   H Y ++V
Sbjct  960   KHVQSLQHMCRFVILKAVIRKDLIQTLPLPRRLLDYLNYKHCYSEQV  1006


>Q9VX18_DROME unnamed protein product
Length=1016

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 57/167 (34%), Positives = 82/167 (49%), Gaps = 18/167 (11%)

Query  342   LRSITACSFYWGKMDRYEAERLLEGKQEGTFLLRDSAQEEFIFSVSFRKYGRSLHARIEQ  401
             +  +    +YWG +    AE++L  + +G+F++RDS+ + +IFS+SF+      H RIEQ
Sbjct  837   IEKVKDYGWYWGPLSSEAAEKVLSSEPDGSFIVRDSSDDHYIFSLSFKLNNCVRHVRIEQ  896

Query  402   WNHKFSFDSHDPGVYASETVCGLIEHYKHPSCS---MFF-------EPM---LTIPFHR-  447
                 FSF S+    + S+T+   IE     S S   +FF        PM   LT P  R 
Sbjct  897   DQGTFSFGSY--AKFKSQTITEFIEKAVEHSRSGRYLFFLHRRPEHGPMRVQLTNPVSRF  954

Query  448   NFAFPLQHLCRAVITTRTT-YDGINKLQLPKTLKSYLKEYH-YKQRV  492
                  LQH+CR VI       D I  L LP+ L  YL   H Y ++V
Sbjct  955   KHVQSLQHMCRFVILKAVIRKDLIQTLPLPRRLLDYLNYKHCYSEQV  1001



Lambda      K        H
   0.318    0.133    0.400 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5924962958


Query= XP_003393040.1 bis(5'-nucleosyl)-tetraphosphatase [asymmetrical]
[Bombus terrestris]

Length=141
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

AP4A_CAEEL  unnamed protein product                                   149     4e-47
C0H4F3_PLAF7  unnamed protein product                                 74.7    9e-18
Q9VUU4_DROME  unnamed protein product                                 35.0    0.013
Q8T3N6_DROME  unnamed protein product                                 35.0    0.013
Q5U127_DROME  unnamed protein product                                 35.0    0.014


>AP4A_CAEEL unnamed protein product
Length=138

 Score = 149 bits (376),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 95/136 (70%), Gaps = 1/136 (1%)

Query  1    MTTRACGFVVFRRVQGIIEYLLMQVSYGTHHWTPPKGHVDPGESDMEAALRETEEEAGLL  60
            M  +A G V++R++ G IE+LL+Q SY  HHWTPPKGHVDPGE + +AA+RET+EEA + 
Sbjct  1    MVVKAAGLVIYRKLAGKIEFLLLQASYPPHHWTPPKGHVDPGEDEWQAAIRETKEEANIT  60

Query  61   VNDLNIFENVKEEQNYKANGKPKVVIYWLAELLDPKKPIRLSHEHQAFKWLPLEEACSVA  120
               L I E+  E   Y+A GKPK V YWLA+L +P   ++LSHEHQ +KW  LE+A  +A
Sbjct  61   KEQLTIHEDCHETLFYEAKGKPKSVKYWLAKLNNPDD-VQLSHEHQNWKWCELEDAIKIA  119

Query  121  KYEEMQNTLRNFNDYI  136
             Y EM + LR F+ ++
Sbjct  120  DYAEMGSLLRKFSAFL  135


>C0H4F3_PLAF7 unnamed protein product
Length=152

 Score = 74.7 bits (182),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 67/121 (55%), Gaps = 1/121 (1%)

Query  18   IEYLLMQVSYGTHHWTPPKGHVDPGESDMEAALRETEEEAGLLVNDLNIFENVKEEQNYK  77
             E+L ++ SY   HWTPPKG  +  ES +E A+RET EE G+  +   +  N ++   Y 
Sbjct  30   FEFLFLKASYADKHWTPPKGLHENNESGLETAVRETLEETGINKDKYKLL-NYQKTLKYN  88

Query  78   ANGKPKVVIYWLAELLDPKKPIRLSHEHQAFKWLPLEEACSVAKYEEMQNTLRNFNDYIL  137
               KPK   Y+LA LL+ ++ + LS EH  +KW+   E+ +    E + + L+   +++ 
Sbjct  89   VKDKPKETTYYLAMLLNNEENVILSDEHTDYKWIGSHESDTYNLPESLADLLKEAEEFLN  148

Query  138  K  138
            K
Sbjct  149  K  149


>Q9VUU4_DROME unnamed protein product
Length=791

 Score = 35.0 bits (79),  Expect = 0.013, Method: Composition-based stats.
 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 0/44 (0%)

Query  21   LLMQVSYGTHHWTPPKGHVDPGESDMEAALRETEEEAGLLVNDL  64
            LL+Q  +  + W  PKG ++  E     A RE  EE G  + DL
Sbjct  326  LLVQSYFARNSWGFPKGKINENEDPAHCATREVYEETGFDITDL  369


>Q8T3N6_DROME unnamed protein product
Length=512

 Score = 35.0 bits (79),  Expect = 0.013, Method: Composition-based stats.
 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 0/44 (0%)

Query  21  LLMQVSYGTHHWTPPKGHVDPGESDMEAALRETEEEAGLLVNDL  64
           LL+Q  +  + W  PKG ++  E     A RE  EE G  + DL
Sbjct  47  LLVQSYFARNSWGFPKGKINENEDPAHCATREVYEETGFDITDL  90


>Q5U127_DROME unnamed protein product
Length=792

 Score = 35.0 bits (79),  Expect = 0.014, Method: Composition-based stats.
 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 0/44 (0%)

Query  21   LLMQVSYGTHHWTPPKGHVDPGESDMEAALRETEEEAGLLVNDL  64
            LL+Q  +  + W  PKG ++  E     A RE  EE G  + DL
Sbjct  326  LLVQSYFARNSWGFPKGKINENEDPAHCATREVYEETGFDITDL  369



Lambda      K        H
   0.318    0.133    0.400 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5924962958


Query= XP_003393042.1 uncharacterized protein LOC100645359 [Bombus
terrestris]

Length=371
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9V9S0_DROME  unnamed protein product                                 47.4    8e-06
Q8SZP0_DROME  unnamed protein product                                 46.6    2e-05
Q580M4_TRYB2  unnamed protein product                                 32.3    0.58 
C0PVB3_DROME  unnamed protein product                                 30.4    1.9  
Q7KUU5_DROME  unnamed protein product                                 30.4    2.0  


>Q9V9S0_DROME unnamed protein product
Length=318

 Score = 47.4 bits (111),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 50/209 (24%), Positives = 91/209 (44%), Gaps = 20/209 (10%)

Query  160  GNNGQACILLQVDALITVKYRTKKGEDDEANIYVPTDATVT-GNCDNENTVTMLLKWDAY  218
            G    +CI+LQ+ A +   Y  ++G        +P++A+V    C ++ T  + L W   
Sbjct  109  GAWNTSCIMLQMAAQLNFTYEAREGNFTTGLYNIPSNASVEDAECKSQTTQFIHLIWGPE  168

Query  219  I----LSWSFAKTPGGERWYVEKIELTYNSSDRHFVNIDQPNKTIRLSTGQKHSSMLFPT  274
                 L   F K+         +I L     D  F +  + N+T++L T    S   F T
Sbjct  169  TSKQSLIMYFNKSNDTTVLSFMQIHLALLPED--FPDAKE-NQTVQLIT---RSDGAFKT  222

Query  275  PVGKSYACSEETEVQLTDGKNHAIVL----LRDMKLQPFKFKNNE-FAVEFSCTSLSARG  329
            P   SY C+   ++ +T+  +   ++    +  ++++ F+  N+  F+V   C S     
Sbjct  223  PENMSYHCTRVQKINMTETLDAEQLIGWISVSHVQVEAFRRANDTGFSVGHDCDSSET--  280

Query  330  FRDETAPVAVGSTLAAAVLLTITGYAAYR  358
               +  P+AVG  LAA +L+ +  Y   R
Sbjct  281  --SDVVPIAVGIALAALILVVLISYLCAR  307


>Q8SZP0_DROME unnamed protein product
Length=318

 Score = 46.6 bits (109),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 50/209 (24%), Positives = 91/209 (44%), Gaps = 20/209 (10%)

Query  160  GNNGQACILLQVDALITVKYRTKKGEDDEANIYVPTDATVT-GNCDNENTVTMLLKWDAY  218
            G    +CI+LQ+ A +   Y  ++G        +P++A+V    C ++ T  + L W   
Sbjct  109  GAWNTSCIMLQMAAQLNFTYEAREGNFTTGLDNIPSNASVEDAECKSQTTQFIHLIWGPE  168

Query  219  I----LSWSFAKTPGGERWYVEKIELTYNSSDRHFVNIDQPNKTIRLSTGQKHSSMLFPT  274
                 L   F K+         +I L     D  F +  + N+T++L T    S   F T
Sbjct  169  TSKQSLIMYFNKSNDTTVLSFMQIHLALLPED--FPDAKE-NQTVQLIT---RSDGAFKT  222

Query  275  PVGKSYACSEETEVQLTDGKNHAIVL----LRDMKLQPFKFKNNE-FAVEFSCTSLSARG  329
            P   SY C+   ++ +T+  +   ++    +  ++++ F+  N+  F+V   C S     
Sbjct  223  PENMSYHCTRVQKINMTETLDAEQLIGWISVSHVQVEAFRRANDTGFSVGHDCDSSET--  280

Query  330  FRDETAPVAVGSTLAAAVLLTITGYAAYR  358
               +  P+AVG  LAA +L+ +  Y   R
Sbjct  281  --SDVVPIAVGIALAALILVVLISYLCAR  307


>Q580M4_TRYB2 unnamed protein product
Length=408

 Score = 32.3 bits (72),  Expect = 0.58, Method: Compositional matrix adjust.
 Identities = 19/60 (32%), Positives = 32/60 (53%), Gaps = 1/60 (2%)

Query  125  LVGNLNEAKSTTTMSSESTTTHRS-SSVEQPLYRLDGNNGQACILLQVDALITVKYRTKK  183
            ++G+++ A +   + S   TTH+   SV  PLYR DG  G +C   +  +  ++  RT K
Sbjct  115  IIGSIDMAAAINVLRSRLGTTHKKVMSVGSPLYRRDGKGGCSCKSPRASSPGSMTSRTFK  174


>C0PVB3_DROME unnamed protein product
Length=266

 Score = 30.4 bits (67),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 20/34 (59%), Gaps = 0/34 (0%)

Query  7   IDPSAPELSRSAHKLRVRRLGEIVLRAIDTTDQI  40
           I P+  ELSR A +L +RRL   VLR I   D I
Sbjct  40  ISPTHIELSREATRLVIRRLQRTVLRLIRDPDFI  73


>Q7KUU5_DROME unnamed protein product
Length=261

 Score = 30.4 bits (67),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 20/34 (59%), Gaps = 0/34 (0%)

Query  7   IDPSAPELSRSAHKLRVRRLGEIVLRAIDTTDQI  40
           I P+  ELSR A +L +RRL   VLR I   D I
Sbjct  35  ISPTHIELSREATRLVIRRLQRTVLRLIRDPDFI  68



Lambda      K        H
   0.318    0.133    0.400 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5924962958


Query= XP_003393044.1 macro domain-containing protein CT2219 isoform X2
[Bombus terrestris]

Length=230
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q57ZT5_TRYB2  unnamed protein product                                 186     2e-58
Q55AK6_DICDI  unnamed protein product                                 92.4    3e-21
Q583Q5_TRYB2  unnamed protein product                                 32.0    0.35 
MTH1_DROME  unnamed protein product                                   30.4    1.3  
Q54B72_DICDI  unnamed protein product                                 29.6    2.2  


>Q57ZT5_TRYB2 unnamed protein product
Length=265

 Score = 186 bits (471),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 82/179 (46%), Positives = 127/179 (71%), Gaps = 2/179 (1%)

Query  49   MNLEKVEKVE--EEMAKKISIWQGDITSLEIDAIVNAANSSLLGGGGVDGAIHKAAGPNL  106
            + +E++  V+  + + + I++++G +T L++DAIVNAAN+  LGGGGVDGAIH+ AGP L
Sbjct  84   VTIEQLRPVDPSDAILRHIALYRGPVTDLQLDAIVNAANTRCLGGGGVDGAIHRVAGPLL  143

Query  107  KKECATLGGCRVGEAKITGAYMLPAKHVIHTVGPQGEKPEKLKECYENSLTVARANELRT  166
             +ECAT  GC+ GE ++T  Y LPA++V+HTVGP GEKP+ L++CY + L++A  N LR+
Sbjct  144  LRECATFNGCQTGECRLTKGYQLPARYVLHTVGPVGEKPDMLRKCYRSILSLALKNGLRS  203

Query  167  IAFPCISTGIYGYPQKPAAKVALSTVKKFLLDNKDSVDRVIFCLFLKSDKDIYEELLQK  225
            I F C+STG+YGYP  PA ++AL   +KFL ++  ++D   F  F + +   YE+ + +
Sbjct  204  IGFCCVSTGVYGYPLLPATRIALGETRKFLEEHGGALDMCCFACFQEDEYKTYEKCVGR  262


>Q55AK6_DICDI unnamed protein product
Length=1618

 Score = 92.4 bits (228),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 79/250 (32%), Positives = 121/250 (48%), Gaps = 28/250 (11%)

Query  1     MSFEVEKQKFLTMPLEEKRKYYKGSV----ITLDQIPTWVEYWTKNKGNIGIMNLEKVE-  55
             +S + E  K + + L +++  Y+ S+    IT+D+I   + +  K  G +       VE 
Sbjct  841   ISGDPENIKIIYLELLKEKYSYENSIETRAITIDKIRHDILFDLKKVGKLQKETFTLVEL  900

Query  56    KVEEEM--------AKKISIWQGDITSLEIDAIVNAANSSLLGGGGVDGAIHKAAGPNLK  107
             KVE E          K I I +GDIT  +  AIVN AN  L   GG   +I +AAG   K
Sbjct  901   KVENETIISLNLSNGKIIRIIKGDITKQKTHAIVNPANEKLKNLGGAAFSIQEAAGATFK  960

Query  108   KECATL--------GGCRVGEAKITGAYMLPAKHVIHTVGPQGEKPEK---LKECYENSL  156
             + C +          GC V  +K     +     VI+TVGP+ + P K   L     +SL
Sbjct  961   EFCESYYEKNGPIGTGCSVYGSKFKMGNIF----VINTVGPKNDNPNKARILHMSIHSSL  1016

Query  157   TVARANELRTIAFPCISTGIYGYPQKPAAKVALSTVKKFLLDNKDSVDRVIFCLFLKSDK  216
               A A   ++I+ P ISTGI+GY  K A  + + +  +FLL N+ +++ V F    +S  
Sbjct  1017  RSATALNCQSISIPAISTGIFGYDPKEAVPIIIKSAIEFLLTNETTLNEVNFVDLNQSTA  1076

Query  217   DIYEELLQKY  226
             +I+E  L K+
Sbjct  1077  NIFENSLIKF  1086


>Q583Q5_TRYB2 unnamed protein product
Length=332

 Score = 32.0 bits (71),  Expect = 0.35, Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 32/68 (47%), Gaps = 7/68 (10%)

Query  48   IMNLEKVEKVEEEMAKKISIWQG-----DITSLEIDAIVNAANSSLLGGGGVDGAIHKAA  102
            IMN   V  V +   + +  W       D  S+ +  I++AA  +L GGG  D AIH   
Sbjct  148  IMNPSTVYGVTKVYTELLGTWYRQKYGVDFRSVRLPGIISAA--TLPGGGATDYAIHMYH  205

Query  103  GPNLKKEC  110
               L+K+C
Sbjct  206  SALLQKKC  213


>MTH1_DROME unnamed protein product
Length=676

 Score = 30.4 bits (67),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 36/73 (49%), Gaps = 6/73 (8%)

Query  69   QGDITSLEIDAIVNAANSSLLGGGGVDGAIHKAAGPNLKKECATLGGCRVG----EAKIT  124
            +G++  +    + ++A  + +  G + G I +A G NL+K   T GG  V      A + 
Sbjct  290  EGEVKIIACQHLFSSAAGAGIHDGSIGGTIEQANGQNLQKAVLT-GGILVSIVFLSATLV  348

Query  125  GAYMLPA-KHVIH  136
              ++LPA  H +H
Sbjct  349  AGFLLPAVHHALH  361


>Q54B72_DICDI unnamed protein product
Length=563

 Score = 29.6 bits (65),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 10/32 (31%), Positives = 21/32 (66%), Gaps = 0/32 (0%)

Query  165  RTIAFPCISTGIYGYPQKPAAKVALSTVKKFL  196
            R++AFP IST  +G+    A +++ + + ++L
Sbjct  362  RSLAFPFISTSTFGFNIDDATEISANAISEYL  393



Lambda      K        H
   0.318    0.133    0.400 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5924962958


Query= XP_003393045.1 macro domain-containing protein CT2219 isoform X1
[Bombus terrestris]

Length=271
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q57ZT5_TRYB2  unnamed protein product                                 186     5e-58
Q55AK6_DICDI  unnamed protein product                                 93.2    4e-21
Q583Q5_TRYB2  unnamed protein product                                 32.0    0.48 
MTH1_DROME  unnamed protein product                                   30.4    1.8  
Q54B72_DICDI  unnamed protein product                                 29.6    3.5  


>Q57ZT5_TRYB2 unnamed protein product
Length=265

 Score = 186 bits (472),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 82/179 (46%), Positives = 127/179 (71%), Gaps = 2/179 (1%)

Query  90   MNLEKVEKVE--EEMAKKISIWQGDITSLEIDAIVNAANSSLLGGGGVDGAIHKAAGPNL  147
            + +E++  V+  + + + I++++G +T L++DAIVNAAN+  LGGGGVDGAIH+ AGP L
Sbjct  84   VTIEQLRPVDPSDAILRHIALYRGPVTDLQLDAIVNAANTRCLGGGGVDGAIHRVAGPLL  143

Query  148  KKECATLGGCRVGEAKITGAYMLPAKHVIHTVGPQGEKPEKLKECYENSLTVARANELRT  207
             +ECAT  GC+ GE ++T  Y LPA++V+HTVGP GEKP+ L++CY + L++A  N LR+
Sbjct  144  LRECATFNGCQTGECRLTKGYQLPARYVLHTVGPVGEKPDMLRKCYRSILSLALKNGLRS  203

Query  208  IAFPCISTGIYGYPQKPAAKVALSTVKKFLLDNKDSVDRVIFCLFLKSDKDIYEELLQK  266
            I F C+STG+YGYP  PA ++AL   +KFL ++  ++D   F  F + +   YE+ + +
Sbjct  204  IGFCCVSTGVYGYPLLPATRIALGETRKFLEEHGGALDMCCFACFQEDEYKTYEKCVGR  262


>Q55AK6_DICDI unnamed protein product
Length=1618

 Score = 93.2 bits (230),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 80/251 (32%), Positives = 122/251 (49%), Gaps = 28/251 (11%)

Query  41    KMSFEVEKQKFLTMPLEEKRKYYKGSV----ITLDQIPTWVEYWTKNKGNIGIMNLEKVE  96
             K+S + E  K + + L +++  Y+ S+    IT+D+I   + +  K  G +       VE
Sbjct  840   KISGDPENIKIIYLELLKEKYSYENSIETRAITIDKIRHDILFDLKKVGKLQKETFTLVE  899

Query  97    -KVEEEM--------AKKISIWQGDITSLEIDAIVNAANSSLLGGGGVDGAIHKAAGPNL  147
              KVE E          K I I +GDIT  +  AIVN AN  L   GG   +I +AAG   
Sbjct  900   LKVENETIISLNLSNGKIIRIIKGDITKQKTHAIVNPANEKLKNLGGAAFSIQEAAGATF  959

Query  148   KKECATL--------GGCRVGEAKITGAYMLPAKHVIHTVGPQGEKPEK---LKECYENS  196
             K+ C +          GC V  +K     +     VI+TVGP+ + P K   L     +S
Sbjct  960   KEFCESYYEKNGPIGTGCSVYGSKFKMGNIF----VINTVGPKNDNPNKARILHMSIHSS  1015

Query  197   LTVARANELRTIAFPCISTGIYGYPQKPAAKVALSTVKKFLLDNKDSVDRVIFCLFLKSD  256
             L  A A   ++I+ P ISTGI+GY  K A  + + +  +FLL N+ +++ V F    +S 
Sbjct  1016  LRSATALNCQSISIPAISTGIFGYDPKEAVPIIIKSAIEFLLTNETTLNEVNFVDLNQST  1075

Query  257   KDIYEELLQKY  267
              +I+E  L K+
Sbjct  1076  ANIFENSLIKF  1086


>Q583Q5_TRYB2 unnamed protein product
Length=332

 Score = 32.0 bits (71),  Expect = 0.48, Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 32/68 (47%), Gaps = 7/68 (10%)

Query  89   IMNLEKVEKVEEEMAKKISIWQG-----DITSLEIDAIVNAANSSLLGGGGVDGAIHKAA  143
            IMN   V  V +   + +  W       D  S+ +  I++AA  +L GGG  D AIH   
Sbjct  148  IMNPSTVYGVTKVYTELLGTWYRQKYGVDFRSVRLPGIISAA--TLPGGGATDYAIHMYH  205

Query  144  GPNLKKEC  151
               L+K+C
Sbjct  206  SALLQKKC  213


>MTH1_DROME unnamed protein product
Length=676

 Score = 30.4 bits (67),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 19/69 (28%), Positives = 34/69 (49%), Gaps = 5/69 (7%)

Query  110  QGDITSLEIDAIVNAANSSLLGGGGVDGAIHKAAGPNLKKECATLGGCRVG----EAKIT  165
            +G++  +    + ++A  + +  G + G I +A G NL+K   T GG  V      A + 
Sbjct  290  EGEVKIIACQHLFSSAAGAGIHDGSIGGTIEQANGQNLQKAVLT-GGILVSIVFLSATLV  348

Query  166  GAYMLPAKH  174
              ++LPA H
Sbjct  349  AGFLLPAVH  357


>Q54B72_DICDI unnamed protein product
Length=563

 Score = 29.6 bits (65),  Expect = 3.5, Method: Compositional matrix adjust.
 Identities = 10/32 (31%), Positives = 21/32 (66%), Gaps = 0/32 (0%)

Query  206  RTIAFPCISTGIYGYPQKPAAKVALSTVKKFL  237
            R++AFP IST  +G+    A +++ + + ++L
Sbjct  362  RSLAFPFISTSTFGFNIDDATEISANAISEYL  393



Lambda      K        H
   0.318    0.133    0.400 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5924962958


Query= XP_003393047.1 homeobox protein six1 [Bombus terrestris]

Length=434
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9Y1P6_DROME  unnamed protein product                                 283     6e-92
SO_DROME  unnamed protein product                                     235     6e-73
OPTIX_DROME  unnamed protein product                                  193     3e-56
HM32_CAEEL  unnamed protein product                                   186     4e-54
HM34_CAEEL  unnamed protein product                                   167     5e-49


>Q9Y1P6_DROME unnamed protein product
Length=392

 Score = 283 bits (724),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 127/204 (62%), Positives = 157/204 (77%), Gaps = 0/204 (0%)

Query  68   SSANTSTNIGNIGGLSLGITASNYTPDQISCMCKALSQRQDIEKLTRLLWSLPPGELLRR  127
            S+   + N+  +    +      ++ DQI CMC+AL Q+ DIEKLT  L SLPP E  + 
Sbjct  158  SNLTAAHNMSAVSSFPIDAKMLQFSTDQIQCMCEALQQKGDIEKLTTFLCSLPPSEFFKT  217

Query  128  DENVLIARATVAFHRGAYHELYSILESHPFSPDRHPELQQMWFKSHYSEAEKIRGRPLGA  187
            +E+VL ARA VA++ G +HELY++LE+H FS   H +LQ +WFK+HY EAEK+RGRPLGA
Sbjct  218  NESVLRARAMVAYNLGQFHELYNLLETHCFSIKYHVDLQNLWFKAHYKEAEKVRGRPLGA  277

Query  188  VDKYRLRKKYPLPKTIWDGEEVVYCFKERSRNALKQCYMRTKYPLSEEKKNLAKETGLTL  247
            VDKYRLRKKYPLPKTIWDGEE VYCFKE+SRNALK CY+  +YP  +EKK LAK+TGLTL
Sbjct  278  VDKYRLRKKYPLPKTIWDGEETVYCFKEKSRNALKDCYLTNRYPTPDEKKTLAKKTGLTL  337

Query  248  TQVANWFKNRRQRDRTPQTRTDML  271
            TQV+NWFKNRRQRDRTPQ R D++
Sbjct  338  TQVSNWFKNRRQRDRTPQQRPDIM  361


>SO_DROME unnamed protein product
Length=416

 Score = 235 bits (599),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 133/175 (76%), Gaps = 0/175 (0%)

Query  91   YTPDQISCMCKALSQRQDIEKLTRLLWSLPPGELLRRDENVLIARATVAFHRGAYHELYS  150
            +T +Q++C+C+ L Q  +IE+L R LWSLP  + L+ +E+VL A+A VAFHRG Y ELY 
Sbjct  103  FTQEQVACVCEVLQQAGNIERLGRFLWSLPQCDKLQLNESVLKAKAVVAFHRGQYKELYR  162

Query  151  ILESHPFSPDRHPELQQMWFKSHYSEAEKIRGRPLGAVDKYRLRKKYPLPKTIWDGEEVV  210
            +LE H FS   H +LQ +W K+HY EAEK+RGRPLGAV KYR+R+K+PLP+TIWDGEE  
Sbjct  163  LLEHHHFSAQNHAKLQALWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETS  222

Query  211  YCFKERSRNALKQCYMRTKYPLSEEKKNLAKETGLTLTQVANWFKNRRQRDRTPQ  265
            YCFKE+SR+ L+  Y    YP   EK++LA+ TGLT TQV+NWFKNRRQRDR  +
Sbjct  223  YCFKEKSRSVLRDWYSHNPYPSPREKRDLAEATGLTTTQVSNWFKNRRQRDRAAE  277


>OPTIX_DROME unnamed protein product
Length=487

 Score = 193 bits (491),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/179 (51%), Positives = 122/179 (68%), Gaps = 6/179 (3%)

Query  84   LGITASNYTPDQISCMCKALSQRQDIEKLTRLLWSLPPG-----ELLRRDENVLIARATV  138
            L +    ++  Q+  +CK L    DIE+L R LWSLP       E+L   E VL ARA V
Sbjct  30   LAVPTLAFSAAQVEIVCKTLEDSGDIERLARFLWSLPVALPNMHEILN-CEAVLRARAVV  88

Query  139  AFHRGAYHELYSILESHPFSPDRHPELQQMWFKSHYSEAEKIRGRPLGAVDKYRLRKKYP  198
            A+H G + ELY+I+E+H F+   + +LQ MW ++HY EAEK+RGR LG VDKYR+RKK+P
Sbjct  89   AYHVGNFRELYAIIENHKFTKASYGKLQAMWLEAHYIEAEKLRGRSLGPVDKYRVRKKFP  148

Query  199  LPKTIWDGEEVVYCFKERSRNALKQCYMRTKYPLSEEKKNLAKETGLTLTQVANWFKNR  257
            LP TIWDGE+  +CFKER+R+ L++ Y++  YP   +K+ LAK TGL  TQV NWFKNR
Sbjct  149  LPPTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPTKKRELAKATGLNPTQVGNWFKNR  207


>HM32_CAEEL unnamed protein product
Length=439

 Score = 186 bits (473),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/173 (51%), Positives = 119/173 (69%), Gaps = 2/173 (1%)

Query  87   TASNYTPDQISCMCKALSQRQDIEKLTRLLWSLPPGEL--LRRDENVLIARATVAFHRGA  144
            T SN T DQI   C+ L    D++ L R + ++PP +   +  +E  L ARA V FH   
Sbjct  64   TTSNLTADQIVKTCEQLETDGDVDGLFRFMCTIPPQKTQEVAGNEAFLRARALVCFHASH  123

Query  145  YHELYSILESHPFSPDRHPELQQMWFKSHYSEAEKIRGRPLGAVDKYRLRKKYPLPKTIW  204
            + ELY+ILE++ FSP  HP+LQ+MW ++HY E EK RG+ L AVDKYR+RKKYP+P+TIW
Sbjct  124  FRELYAILENNKFSPKYHPKLQEMWHEAHYREQEKNRGKSLCAVDKYRVRKKYPMPRTIW  183

Query  205  DGEEVVYCFKERSRNALKQCYMRTKYPLSEEKKNLAKETGLTLTQVANWFKNR  257
            DGE+  +CFKER+R+ L++ Y++  YP   +KK LA  TGLT  QV NWFKNR
Sbjct  184  DGEQKTHCFKERTRSLLREWYLKDPYPNPPKKKELANATGLTQMQVGNWFKNR  236


>HM34_CAEEL unnamed protein product
Length=256

 Score = 167 bits (424),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 85/184 (46%), Positives = 117/184 (64%), Gaps = 7/184 (4%)

Query  83   SLGITASNYTPDQISCMCKALS----QRQDIEKLTRLLWSLPPGELLRRDENVLIARATV  138
            SL  T S Y+  +I C+C++L     Q    E+L   +++LP  +  +  E+VL A+A V
Sbjct  10   SLTATTS-YSEQEIVCICESLFNEGLQTGRTEQLANFIYNLP--QCYQVMESVLKAQALV  66

Query  139  AFHRGAYHELYSILESHPFSPDRHPELQQMWFKSHYSEAEKIRGRPLGAVDKYRLRKKYP  198
             F    +  LY +LE   FSP  H  LQ +W  +HY EA K + R LGAV KYR+RKK P
Sbjct  67   YFTTQNWKMLYKLLECSKFSPHNHTVLQNLWLDAHYKEAAKTKDRELGAVCKYRIRKKNP  126

Query  199  LPKTIWDGEEVVYCFKERSRNALKQCYMRTKYPLSEEKKNLAKETGLTLTQVANWFKNRR  258
             P TIWDGEE  YCFK +SRN L+  Y + +YP  E+K+ LA++T L++ QV+NWFKN+R
Sbjct  127  FPNTIWDGEETNYCFKSKSRNVLRDAYKKCQYPSVEDKRRLAQQTELSIIQVSNWFKNKR  186

Query  259  QRDR  262
            QR+R
Sbjct  187  QRER  190



Lambda      K        H
   0.318    0.133    0.400 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5924962958


Query= XP_003393048.1 nucleoporin Nup188 [Bombus terrestris]

Length=1901
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7KTG2_DROME  unnamed protein product                                 38.1    0.10 
Q8MRJ0_DROME  unnamed protein product                                 36.6    0.26 
GRP1_CAEEL  unnamed protein product                                   35.0    0.62 
Q38A50_TRYB2  unnamed protein product                                 33.9    1.3  
Q584W8_TRYB2  unnamed protein product                                 33.1    2.0  


>Q7KTG2_DROME unnamed protein product
Length=4333

 Score = 38.1 bits (87),  Expect = 0.10, Method: Compositional matrix adjust.
 Identities = 36/150 (24%), Positives = 61/150 (41%), Gaps = 37/150 (25%)

Query  1205  LLLGCVQCVKSTLREDVTS-LEYLLSHSCIIAASELEELKEAATEFEKRKQQQYSVERKG  1263
             +LL C +C    +R D TS L+YLL          L  L +   +FE+ K+ ++     G
Sbjct  4153  ILLSCSKCAARDMRFDYTSILQYLLEEGV-----NLHILADTEFDFERNKKLRHFF---G  4204

Query  1264  IDKTITIDSVIAQKNADERNAETVRGIRESLPATLAVCMVTQLLRSYVERSSTLKHQRKS  1323
             +D  +       + +A+ RN   +        + L +C             +TL  + + 
Sbjct  4205  LDSKLVYSKRFPEGDAETRNTTHIP------KSNLGIC-------------TTLAVETQG  4245

Query  1324  SCVQLRQMIPELMTCIGITLQKYPYLRFST  1353
             S    R++ PE         +KYP  RF+T
Sbjct  4246  SVFSARKLQPE---------RKYPIKRFAT  4266


>Q8MRJ0_DROME unnamed protein product
Length=719

 Score = 36.6 bits (83),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 36/150 (24%), Positives = 61/150 (41%), Gaps = 37/150 (25%)

Query  1205  LLLGCVQCVKSTLREDVTS-LEYLLSHSCIIAASELEELKEAATEFEKRKQQQYSVERKG  1263
             +LL C +C    +R D TS L+YLL          L  L +   +FE+ K+ ++     G
Sbjct  539   ILLSCSKCAARDMRFDYTSILQYLLEEGV-----NLHILADTEFDFERNKKLRHFF---G  590

Query  1264  IDKTITIDSVIAQKNADERNAETVRGIRESLPATLAVCMVTQLLRSYVERSSTLKHQRKS  1323
             +D  +       + +A+ RN   +        + L +C             +TL  + + 
Sbjct  591   LDSKLVYSKRFPEGDAETRNTTHIP------KSNLGIC-------------TTLAVETQG  631

Query  1324  SCVQLRQMIPELMTCIGITLQKYPYLRFST  1353
             S    R++ PE         +KYP  RF+T
Sbjct  632   SVFSARKLQPE---------RKYPIKRFAT  652


>GRP1_CAEEL unnamed protein product
Length=393

 Score = 35.0 bits (79),  Expect = 0.62, Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 44/114 (39%), Gaps = 17/114 (15%)

Query  769  KLIRTGERTLHNKMMAETDWIRGKGFKAMKSVQLAL----------SVVNRLLIFRKSLG  818
            K++  G +  +       DW+  +   A     LAL          S +  +L   +   
Sbjct  62   KIVVNGRKKFNQDPWKALDWLASRNVVAKDPQALALWMKAGEGLSKSAIGEILGDNRPFA  121

Query  819  LEIRDRSPLEAALYSSPRVPNGLLIVPTIVNYLYVWFSPPLQAMAVRLLKKFAE  872
            LE  DR   E  L+  P       IVP +  YL+ +  P       R+L+KFAE
Sbjct  122  LETLDRFTKEHKLHDVP-------IVPALRQYLFSFRLPGESQKINRILEKFAE  168


>Q38A50_TRYB2 unnamed protein product
Length=365

 Score = 33.9 bits (76),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 40/92 (43%), Gaps = 14/92 (15%)

Query  1572  TLVDTIYTQDFWYTPMAEMNFGPPQMSMSSGPRLTYGTIISSTQLFTQALHSRS-QPVNT  1630
             +L D     DF     A ++ GPP  S  + P+ T+G   S      +A  SR+  P +T
Sbjct  54    SLADEQVGSDFGLCNGATLHLGPPSFSEPAVPQRTHGQGFSD-----EAAGSRTGDPTDT  108

Query  1631  LSVSLSGQP----DKSDSAKKE----WEHAAP  1654
                SLSG       K+DS  ++      HA P
Sbjct  109   PHSSLSGDSRERNSKADSTHRDPCGGLSHADP  140


>Q584W8_TRYB2 unnamed protein product
Length=323

 Score = 33.1 bits (74),  Expect = 2.0, Method: Composition-based stats.
 Identities = 19/55 (35%), Positives = 28/55 (51%), Gaps = 0/55 (0%)

Query  732  CLHRALESSLPKEDIRNELQLVVAYSLLYLEPRHALLKLIRTGERTLHNKMMAET  786
            C H   E S   E  R+E+      S L  EP HAL + I TG++ L  +++ +T
Sbjct  222  CPHHYGEDSPEAESCRHEIASSSLLSHLRYEPLHALPRAIPTGDKELIPRLVGDT  276



Lambda      K        H
   0.318    0.133    0.400 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5924962958


Query= XP_003393051.4 carnitine O-palmitoyltransferase 2, mitochondrial
[Bombus terrestris]

Length=664
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VZW7_DROME  unnamed protein product                                 584     0.0  
Q8MQY1_DROME  unnamed protein product                                 582     0.0  
Q57WC6_TRYB2  unnamed protein product                                 246     2e-72
Q7JQH9_DROME  unnamed protein product                                 239     8e-69
Q9V3K9_DROME  unnamed protein product                                 237     7e-68


>Q9VZW7_DROME unnamed protein product
Length=667

 Score = 584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/633 (46%), Positives = 413/633 (65%), Gaps = 12/633 (2%)

Query  39   YQYIEKSKTPTMHFQPSLPRLPIPKLEDTCKRYLNAQKPLLSKEQLEKTEIYVNEFLTKD  98
            YQY++ SK PT++FQ SLPRLPIP LE++C+R+L A KPLLS  +  +T+  V +F    
Sbjct  28   YQYLQCSKLPTLYFQRSLPRLPIPLLENSCRRFLEATKPLLSPAEQAQTQQTVEQFRQGI  87

Query  99   GIRLHKELIEKDTKNHDTSYISEPWFDMYLRDRRPLPINYNPFLVLNPASNPEHNIQLVK  158
            G+ LH +L   D +N  TSYIS+PWFDMYL DR PLP+NYNP LV+   + PE+  Q+V+
Sbjct  88   GMELHAKLKSHDAENKHTSYISQPWFDMYLADRAPLPLNYNPLLVMKSDARPEYQQQVVR  147

Query  159  ATNLIVSSLRFMKSLKDNVLRPEVFYLKPKTNENNVYHTITRLLPPQFSWYGAYLFKAFP  218
            ATNLI+SSLRF +SL+ ++L PEV+++  K ++ + Y    ++ P  F+ Y +Y FKAFP
Sbjct  148  ATNLIISSLRFWRSLQADLLEPEVYHMNAKKSDTSSYRRWMKVAPKAFATYASYAFKAFP  207

Query  219  LDMSQYHNLFNTTRLPKPEKDQIYENATSRNIIVMRKGHFYSFNVIDENGYIRKPKEIAS  278
            LDMSQY+ LF T+R+P+  KD++ ++  +++I+VMR+GH Y+ NV+D +GYI  P  I  
Sbjct  208  LDMSQYNRLFGTSRIPRIGKDELVQSPDAKHILVMRRGHMYAVNVLDSSGYIESPSVILG  267

Query  279  CLESILK--ATISINERPIGILTTSERDLWANTRT-YLSQIGNQEILQK-IDSAIFTMIL  334
             L ++LK  A       P+G+LT+ +RD WA TR  ++S   N ++L++ +D+A+F + L
Sbjct  268  RLRAVLKLDADREAASVPLGVLTSGQRDEWAKTRQHFVSNTKNADLLEREVDAALFCVCL  327

Query  335  DDIHVGTDYNE-----LIRTYLHADGTNRWFDKSFSLIVTNDGYAGINFEHSWGDGVAVL  389
            D    G  +NE     L++  L     NRWFDKS SL+++ DG   INFEHSWGDGVAVL
Sbjct  328  DGEEDGV-FNENQQEPLLKHLLAGKAQNRWFDKSISLLISADGTTAINFEHSWGDGVAVL  386

Query  390  RFLKDIGNDITKQPKFCADDIKYLQKGAVE-VEKLNFVIDDKVQNIVNRQKEKFGEWIGE  448
            R+  ++  D  KQP    + +    +G    V  +NF IDD  ++ V+    K    +  
Sbjct  387  RYFNELYKDTLKQPFVSTETVHTPAEGDFSNVRPINFEIDDATKSAVSEAYNKNASIVDN  446

Query  449  LSVDHMIFNEFGKNECKTFGVSPDAIMQLAFQLALYYQRNCVVPTYESCSTAAFKHGRTE  508
            L ++ + +    K  CK +G+SPD+I+QL+FQLA     +  V +YESCST+AF+HGRTE
Sbjct  447  LDMNVLKYPHINKPTCKQYGLSPDSIIQLSFQLAYRQAYSGYVGSYESCSTSAFRHGRTE  506

Query  509  TLRSCTIETKKACEAIAQ-KNNNLSKSELKNLIINCSNVHNKLSKEAVMGQGFDRHLFAL  567
            T+R CT  T+  CEAI Q + +  S  EL+ +I NCS VH +L+KEA MGQGFDRHLFAL
Sbjct  507  TMRPCTNATRDFCEAILQPERSKPSAGELRAMIDNCSKVHGQLTKEAAMGQGFDRHLFAL  566

Query  568  KKIWEHSNTPKPAIFSDPAYDNINHNILSTSTLSDPAICAGGFGPVVSNGYGIAYMIQDE  627
            +   +    P P ++   AY  IN+NI+STSTL   A+ AG FGPVV NG+GI Y IQ++
Sbjct  567  RHTAQKEGIPIPDLYETEAYKRINNNIISTSTLGSDALLAGSFGPVVKNGFGIGYSIQND  626

Query  628  RLGAIVTSYKRNNNANEYVKCLEKAFKNIHSIM  660
              GAIVT+YK   +   ++  LE AF  I +++
Sbjct  627  FAGAIVTTYKNQADGKVFIDSLESAFDKICAVI  659


>Q8MQY1_DROME unnamed protein product
Length=696

 Score = 582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/633 (46%), Positives = 413/633 (65%), Gaps = 12/633 (2%)

Query  39   YQYIEKSKTPTMHFQPSLPRLPIPKLEDTCKRYLNAQKPLLSKEQLEKTEIYVNEFLTKD  98
            YQY++ SK PT++FQ SLPRLPIP LE++C+R+L A KPLLS  +  +T+  V +F    
Sbjct  57   YQYLQCSKLPTLYFQRSLPRLPIPLLENSCRRFLEATKPLLSPAEQAETQQTVEQFRQGI  116

Query  99   GIRLHKELIEKDTKNHDTSYISEPWFDMYLRDRRPLPINYNPFLVLNPASNPEHNIQLVK  158
            G+ LH +L   D +N  TSYIS+PWFDMYL DR PLP+NYNP LV+   + PE+  Q+V+
Sbjct  117  GMELHAKLKSHDAQNKHTSYISQPWFDMYLADRAPLPLNYNPLLVMKSDTRPEYQQQVVR  176

Query  159  ATNLIVSSLRFMKSLKDNVLRPEVFYLKPKTNENNVYHTITRLLPPQFSWYGAYLFKAFP  218
            ATNLI+SSLRF +SL+ ++L PEV+++  K ++ + Y    ++ P  F+ Y +Y FKAFP
Sbjct  177  ATNLIISSLRFWRSLQADLLEPEVYHMNAKKSDTSSYRRWMKVAPKAFATYASYAFKAFP  236

Query  219  LDMSQYHNLFNTTRLPKPEKDQIYENATSRNIIVMRKGHFYSFNVIDENGYIRKPKEIAS  278
            LDMSQY+ LF T+R+P+  KD++ ++  +++I+VMR+GH Y+ NV+D +GYI  P  I  
Sbjct  237  LDMSQYNRLFGTSRIPRIGKDELVQSPDAKHILVMRRGHMYAVNVLDSSGYIESPSVILG  296

Query  279  CLESILK--ATISINERPIGILTTSERDLWANTRT-YLSQIGNQEILQK-IDSAIFTMIL  334
             L ++LK  A       P+G+LT+ +RD WA TR  ++S   N ++L++ +D+A+F + L
Sbjct  297  RLRAVLKLDADREAASVPLGVLTSGQRDEWAKTRQHFVSNNKNADLLEREVDAALFCVCL  356

Query  335  DDIHVGTDYNE-----LIRTYLHADGTNRWFDKSFSLIVTNDGYAGINFEHSWGDGVAVL  389
            D    G  +NE     L++  L     NRWFDKS SL+++ DG   INFEHSWGDGVAVL
Sbjct  357  DGEEDGV-FNENQQEPLLKHLLAGKAQNRWFDKSISLLISADGTTAINFEHSWGDGVAVL  415

Query  390  RFLKDIGNDITKQPKFCADDIKYLQKGAVE-VEKLNFVIDDKVQNIVNRQKEKFGEWIGE  448
            R+  ++  D  KQP    + +    +G    V  +NF IDD  ++ V+    K    +  
Sbjct  416  RYFNELYKDTLKQPFVSTETVHTPAEGDFSNVRPINFEIDDATKSAVSEAYNKNASIVDN  475

Query  449  LSVDHMIFNEFGKNECKTFGVSPDAIMQLAFQLALYYQRNCVVPTYESCSTAAFKHGRTE  508
            L ++ + +    K  CK +G+SPD+I+QL+FQLA     +  V +YESCST+AF+HGRTE
Sbjct  476  LDMNVLKYPHINKPTCKQYGLSPDSIIQLSFQLAYRQAYSGYVGSYESCSTSAFRHGRTE  535

Query  509  TLRSCTIETKKACEAIAQ-KNNNLSKSELKNLIINCSNVHNKLSKEAVMGQGFDRHLFAL  567
            T+R CT  T+  CEAI Q + +  S  EL+ +I NCS VH +L+KEA MGQGFDRHLFAL
Sbjct  536  TMRPCTNATRDFCEAILQPERSKPSAGELRAMIDNCSKVHGQLTKEAAMGQGFDRHLFAL  595

Query  568  KKIWEHSNTPKPAIFSDPAYDNINHNILSTSTLSDPAICAGGFGPVVSNGYGIAYMIQDE  627
            +   +    P P ++   AY  IN+NI+STSTL   A+ AG FGPVV NG+GI Y IQ++
Sbjct  596  RHTAQKEGIPIPDLYETEAYKRINNNIISTSTLGSDALLAGSFGPVVKNGFGIGYSIQND  655

Query  628  RLGAIVTSYKRNNNANEYVKCLEKAFKNIHSIM  660
              GAIVT+YK   +   ++  LE AF  I +++
Sbjct  656  FAGAIVTTYKNQADGKVFIDSLESAFDKICAVI  688


>Q57WC6_TRYB2 unnamed protein product
Length=621

 Score = 246 bits (627),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 193/638 (30%), Positives = 292/638 (46%), Gaps = 66/638 (10%)

Query  56   LPRLPIPKLEDTCKRYLNAQKPLLSKEQLEKTEIYVNEFLTKDGIRLHKELIEKDTKN--  113
            LPRLPIP LE T +RY  +  PL S E ++      + FLT     L   L+E DT    
Sbjct  16   LPRLPIPTLEATAERYRASIWPLKSAEMVKNHLQKFDTFLTSSAGGLQAALVEADTAAAA  75

Query  114  ---HDTSYISEPWFDMYLRDRRPLPINYNPFLVLNPASNPEHNIQLVKATNLIVSSLRFM  170
               +  SYI   W DMYL +R P+ +N NP +      N   + Q      ++ S  R++
Sbjct  76   CGVYPYSYIEALWEDMYLSNREPVLVNVNPAITTKKLKNA-GDTQAAVGAAVVHSIARWV  134

Query  171  KSLKDNVLRPEVFYLKPKTNENNVYHTITRLLPPQFSWYGAYLFKAFPLDMSQYHNLFNT  230
             +  +  +  EVF      +E       TR + P    +GA +         +  + F+T
Sbjct  135  YNAVNKGV--EVF------DE-------TRDVSPLLRQFGASVIPG------EKKDTFHT  173

Query  231  TRLPKPEKDQIYENATSRNIIVMRKGHFYSFNVIDENGYIRKPKEIASCLESILKATISI  290
            T + K            R+IIV+  GH Y+  V D+         +   +E +L  T   
Sbjct  174  TPMEK-----------LRHIIVLHDGHPYAVRVFDDKQVPLDRAVVQKSIEYVLSITPDA  222

Query  291  -NERPIGILTTSERDLWANTRTYLSQI-GNQEILQKIDSAIFTMILDDIHVGTDYNELIR  348
             N  P+ +LT   R  WA     L +   N E L+KI   I  + LD    G D   +  
Sbjct  223  DNTTPVSVLTAGNRQTWAGAYAELVKTPENAENLKKIQEGIVVVCLDTESWGGDGKLVDG  282

Query  349  TYLHADGT---NRWFDKSFSLIVTNDGYAGINFEHSWGDGVAVLRFLKDIGNDI----TK  401
              LH + T   NRW+DK   +IV+ DG    NFEHS  DGV  LR++ DI +D+      
Sbjct  283  ASLHGNNTEFENRWYDK-HQIIVSADGRVAFNFEHSGSDGVQWLRWISDIISDVEGGDGS  341

Query  402  QPKFCADDIKYLQKGAVEVEKLNFVIDDKVQNIVNRQKEKFGEWIGELSVDHMIFNEFGK  461
                 A  +   + G + V+ L           +   +    E I   +++ +    +GK
Sbjct  342  SVSTSATSLDPAKVGTL-VQPLTLTFGKTFAAHIRAARAGALELIAGTALEDVTI-PYGK  399

Query  462  NECKTFGVSPDAIMQLAFQLALYYQRNCVVPTYESCSTAAFKHGRTETLRSCTIETKKAC  521
             + K  GVSPDA +Q+  Q+A +  RN + PTYE+ ST  F HGRTET+RS T E +   
Sbjct  400  TQLKQLGVSPDAFVQMCLQVAHHKCRNKLAPTYEAASTGRFFHGRTETIRSATREMQLVA  459

Query  522  EAIAQ--KNNNLSKSELKN-----------LIINCSNVHNKLSKEAVMGQGFDRHLFALK  568
            EA+ +  K N  S  E              L+   +  H +L+K A  G+G DRHL ALK
Sbjct  460  EAVNRMTKANAASDEEGSTTYVASVEEQVALLKAAAERHVRLAKAAANGEGIDRHLTALK  519

Query  569  KIW-EHSNTPKPAIFSDPAYDNINHNILSTSTLSDPAICAGGFGPVVSNGYGIAYMIQDE  627
            ++  E ++    A F+D  Y + +   LSTS L+ P +    FGPV +NGYG+ Y I   
Sbjct  520  RLAVERNDAAALAFFNDETYTSCSTWRLSTSNLTAPWVERFMFGPVTANGYGLGYTIDGT  579

Query  628  RLGAIVTSYKR--NNNANEYVKCLEKAFKNIHSIMTCG  663
             +   V+++ R  + +A +    + +A  N++ ++  G
Sbjct  580  EVRLTVSAFTRSPSTDAGDMKLAVSEAASNVYGLLKAG  617


>Q7JQH9_DROME unnamed protein product
Length=780

 Score = 239 bits (610),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 197/651 (30%), Positives = 297/651 (46%), Gaps = 101/651 (16%)

Query  52   FQPSLPRLPIPKLEDTCKRYLNAQKPLLSKEQLEKTEIYVNEFLTKDGIRLHKELIEKDT  111
            FQ SLPRLP+P ++DT  RYL + +PLL  E   + E    EF    G +L   LI K  
Sbjct  167  FQGSLPRLPLPSVKDTMTRYLRSVRPLLDDENYTRMERLAKEFEQTIGKKLQWYLILKSW  226

Query  112  KNHDTSYISEPWFD-MYLRDRRPLPINYNPFLVLNPASNPEHNIQLVKATNLIVSSLRFM  170
             +  T+Y+S+ W + +YLR R PL +N N F   +       + Q  +A N+I   L F 
Sbjct  227  WS--TNYVSDWWEEYVYLRGRSPLCVNSN-FYGTDAIFMNLTDKQAARAANVISLLLNFR  283

Query  171  KSLKDNVLRPEVFYLKPKTNENNVYHTITRLLPPQFSWYGAYLFKAFPLDMSQYHNLFNT  230
            + ++   L+P                 + + + P  SW              QY   FNT
Sbjct  284  RLIEHQELQP----------------IMVQGMIPLCSW--------------QYERTFNT  313

Query  231  TRLPKPEKDQIYENATSRNIIVMRKGHFYSFNVIDENGYIRKPKEIASCLESIL--KATI  288
             R+P  E D+I     S +I+V+ KG +Y   +I   G I +P E+   +E IL  KAT 
Sbjct  314  ARVPGLETDRIIHYRDSNHIVVLHKGCYYKM-LIYYKGRILRPCELQVQIEEILKGKATP  372

Query  289  SINERPIGILTTSERDLWANTR-TYLSQIGNQEILQKIDSAIFTMILDDIHVGTDYN--E  345
               E  +  LT   R  WA  R T+ S   NQ  L+ I+SA F + LDD     D    E
Sbjct  373  VEGEEHLAALTAWNRSKWAEARNTFFSWGVNQTSLRTIESAAFVLSLDDEPFEFDLARPE  432

Query  346  LIRTY----LHADGTNRWFDKSFSLIVTNDGYAGINFEHSWGDGVAVLRFLKDI-GNDI-  399
            L+  +    LH +G NRWFDK F++ V  +G  G N EH+W D   +    + I G+DI 
Sbjct  433  LLDNFGKKLLHGNGYNRWFDKCFTVCVGTNGRVGFNAEHTWADAPVLGHLWEYIFGDDIY  492

Query  400  -------TK--------QPKFCADDIK----YLQKGAVEVEKLNFVIDDKVQNIVNRQKE  440
                   TK         P     D+K     +++  ++V KL                 
Sbjct  493  GYDETGNTKGTPAFQPPTPTRLTWDLKPCLAQIEEATIDVTKL-----------------  535

Query  441  KFGEWIGELSVDHMIFNEFGKNECKTFGVSPDAIMQLAFQLALYYQRNCVVPTYESCSTA  500
                 I E+++  ++  ++GK   K   +SPDA +Q+A QLA Y        TYE+  T 
Sbjct  536  -----INEVNLRILVHQDYGKGFMKKCRISPDAYIQMALQLAYYRDAGRFSLTYEASMTR  590

Query  501  AFKHGRTETLRSCTIETKKACEAIAQKNNNLSKSELKNLIINCSNVHNKLSKEAVMGQGF  560
             F+ GRTET+R CTIE+    +A+  +N N +  E   ++    + H    ++A+ G+G 
Sbjct  591  LFREGRTETVRPCTIESSAWVKAM--QNPNTTNDERVKMMQAACDRHQLGYQDAMCGRGI  648

Query  561  DRHLFALKKIWEHSNTPKP---AIFSDP---AYDNINHNILSTSTLSDPAIC---AGGFG  611
            DRHLF L  + ++     P    + S+P   +     H       L     C    GGFG
Sbjct  649  DRHLFCLYVVSKYLEVDSPFLNEVLSEPWRLSTSQTPHGQTPKMDLKKHPNCISAGGGFG  708

Query  612  PVVSNGYGIAYMIQDERLGAIVTSYK---RNNNANEYVKCLEKAFKNIHSI  659
            PV  +GYG++Y+I  E L     S K   +  + + + + + +A  +I S+
Sbjct  709  PVADDGYGVSYIIAGENLIFFHISAKTTCQQTDVHRFAQNISQALSDIRSM  759


>Q9V3K9_DROME unnamed protein product
Length=782

 Score = 237 bits (604),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 194/653 (30%), Positives = 294/653 (45%), Gaps = 103/653 (16%)

Query  52   FQPSLPRLPIPKLEDTCKRYLNAQKPLLSKEQLEKTEIYVNEFLTKDGIRLHKELIEKDT  111
            FQ SLPRLP+P ++DT  RYL + +PLL  E   + E    EF    G +L   LI K  
Sbjct  167  FQGSLPRLPLPSVKDTMTRYLRSVRPLLDDENYTRMERLAKEFEQTIGKKLQWYLILKSW  226

Query  112  KNHDTSYISEPWFD-MYLRDRRPLPINYNPFLVLNPASNPEHNIQLVKATNLIVSSLRFM  170
             +  T+Y+S+ W + +YLR R PL +N N F   +       + Q  +A N+I   L F 
Sbjct  227  WS--TNYVSDWWEEYVYLRGRSPLCVNSN-FYGTDAIFMNLTDKQAARAANVISLLLNFR  283

Query  171  KSLKDNVLRPEVFYLKPKTNENNVYHTITRLLPPQFSWYGAYLFKAFPLDMSQYHNLFNT  230
            + ++   L+P                 + + + P  SW              QY   FNT
Sbjct  284  RLIEHQELQP----------------IMVQGMIPLCSW--------------QYERTFNT  313

Query  231  TRLPKPEKDQIYENATSRNIIVMRKGHFYSFNVIDENGYIRKPKEIASCLESIL--KATI  288
             R+P  E D+I     S +I+V+ KG +Y   +I   G I +P E+   +E IL  KAT 
Sbjct  314  ARVPGLETDRIIHYRDSNHIVVLHKGCYYKM-LIYYKGRILRPCELQVQIEEILKGKATP  372

Query  289  SINERPIGILTTSERDLWANTR-TYLSQIGNQEILQKIDSAIFTMILDDIHVGTDYN--E  345
               E  +  LT   R  WA  R T+ S   NQ  L+ I+SA F + LDD     D    E
Sbjct  373  VEGEEHLAALTAWNRSKWAEARNTFFSWGVNQTSLRTIESAAFVLSLDDEPFEFDLARPE  432

Query  346  LIRTY----LHADGTNRWFDKSFSLIVTNDGYAGINFEHSWGDGVAVLRFLKDI------  395
            L+  +    LH +G NRWFDK F++ V  +G  G N EH+W D        +++      
Sbjct  433  LLDNFGKKLLHGNGYNRWFDKCFTVCVGTNGRVGFNAEHTWSDAAIASHMWENLIVDDLV  492

Query  396  --GNDITKQ-----------PKFCADDIK----YLQKGAVEVEKLNFVIDDKVQNIVNRQ  438
              G D T             P     D+K     +++  ++V KL               
Sbjct  493  SDGYDETGNTKGTPAFQPPTPTRLTWDLKPCLAQIEEATIDVTKL---------------  537

Query  439  KEKFGEWIGELSVDHMIFNEFGKNECKTFGVSPDAIMQLAFQLALYYQRNCVVPTYESCS  498
                   I E+++  ++  ++GK   K   +SPDA +Q+A QLA Y        TYE+  
Sbjct  538  -------INEVNLRILVHQDYGKGFMKKCRISPDAYIQMALQLAYYRDAGRFSLTYEASM  590

Query  499  TAAFKHGRTETLRSCTIETKKACEAIAQKNNNLSKSELKNLIINCSNVHNKLSKEAVMGQ  558
            T  F+ GRTET+R CTIE+    +A+  +N N +  E   ++    + H    ++A+ G+
Sbjct  591  TRLFREGRTETVRPCTIESSAWVKAM--QNPNTTNDERVKMMQAACDRHQLGYQDAMCGR  648

Query  559  GFDRHLFALKKIWEHSNTPKP---AIFSDP---AYDNINHNILSTSTLSDPAIC---AGG  609
            G DRHLF L  + ++     P    + S+P   +     H       L     C    GG
Sbjct  649  GIDRHLFCLYVVSKYLEVDSPFLNEVLSEPWRLSTSQTPHGQTPKMDLKKHPNCISAGGG  708

Query  610  FGPVVSNGYGIAYMIQDERLGAIVTSYK---RNNNANEYVKCLEKAFKNIHSI  659
            FGPV  +GYG++Y+I  E L     S K   +  + + + + + +A  +I S+
Sbjct  709  FGPVADDGYGVSYIIAGENLIFFHISAKTTCQQTDVHRFAQNISQALSDIRSM  761



Lambda      K        H
   0.318    0.133    0.400 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5924962958


Query= XP_003393053.1 V-type proton ATPase 21 kDa proteolipid subunit c''
[Bombus terrestris]

Length=206
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VFE3_DROME  unnamed protein product                                 284     3e-98
G5EDB8_CAEEL  unnamed protein product                                 208     2e-68
Q586H7_TRYB2  unnamed protein product                                 157     2e-48
VATL_DROME  unnamed protein product                                   84.7    1e-20
VATL_DICDI  unnamed protein product                                   82.4    2e-19


>Q9VFE3_DROME unnamed protein product
Length=212

 Score = 284 bits (726),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 158/207 (76%), Positives = 178/207 (86%), Gaps = 2/207 (1%)

Query  1    MRYILGTTFAGTASATTLVLVLYHVFTGKGERVSVAWFLENTSPHMWATLGIGLAVALSV  60
            +R ++  TF     A   +L LY V TGKGERVSV WFL +++P+MWA LGIGL+V+LSV
Sbjct  5    IRTVVSQTFLWLFLAVATILTLYFVMTGKGERVSVGWFLASSNPYMWACLGIGLSVSLSV  64

Query  61   VGAALGINTTGVSIIGGGVKAPRIKTKNLISVIFCEAVAIYGLITAIVLSGMLDEFSYP-  119
            VGAALGI+TTG SI+GGGVKAPRIKTKNLISVIFCEAVAIYGLITAIVLSG L++FS   
Sbjct  65   VGAALGIHTTGTSIVGGGVKAPRIKTKNLISVIFCEAVAIYGLITAIVLSGQLEQFSMET  124

Query  120  -IQKEEVRNQNWLAGYLIFGAGLAVGLVNLFCGIAVGIVGSGAALSDAANSALFVKILIV  178
             + +  ++N NW +GYLIFGAGLAVGLVNLFCGIAVGIVGSGAALSDAAN+ALFVKILIV
Sbjct  125  ALSQAAIQNTNWFSGYLIFGAGLAVGLVNLFCGIAVGIVGSGAALSDAANAALFVKILIV  184

Query  179  EIFGSAIGLFGLIVGIYMTSKVKMGDK  205
            EIFGSAIGLFGLIVGIYMTSK KMGDK
Sbjct  185  EIFGSAIGLFGLIVGIYMTSKSKMGDK  211


>G5EDB8_CAEEL unnamed protein product
Length=214

 Score = 208 bits (529),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 115/193 (60%), Positives = 148/193 (77%), Gaps = 13/193 (7%)

Query  22   LYHVFTGKGERVSVAWFLENTSPHMWATLGIGLAVALSVVGAALGINTTGVSIIGGGVKA  81
            L+++ +G+G R  + WFL +TSPHMWA LGIG +++LSV+GA  GI TTG SI+GGGVKA
Sbjct  26   LFYMLSGQGHRFDIGWFLTSTSPHMWAGLGIGFSLSLSVLGAGWGIFTTGSSILGGGVKA  85

Query  82   PRIKTKNLISVIFCEAVAIYGLITAIVLSGMLDEFSYPIQKEEVRN---------QNWLA  132
            PRI+TKNL+S+IFCEAVAI+G+I A V  G L EF    ++E++ +         +N  +
Sbjct  86   PRIRTKNLVSIIFCEAVAIFGIIMAFVFVGKLAEF----RREDLPDTEDGMAILARNLAS  141

Query  133  GYLIFGAGLAVGLVNLFCGIAVGIVGSGAALSDAANSALFVKILIVEIFGSAIGLFGLIV  192
            GY+IFG GL VGL NL CG+AVGIVGSGAA++DAAN ALFVKILI+EIF SAIGLFG+I+
Sbjct  142  GYMIFGGGLTVGLSNLVCGLAVGIVGSGAAIADAANPALFVKILIIEIFASAIGLFGMII  201

Query  193  GIYMTSKVKMGDK  205
            GI  T+K   G+K
Sbjct  202  GIVQTNKASFGNK  214


>Q586H7_TRYB2 unnamed protein product
Length=224

 Score = 157 bits (398),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 118/161 (73%), Gaps = 1/161 (1%)

Query  43   SPHMWATLGIGLAVALSVVGAALGINTTGVSIIGGGVKAPRIKTKNLISVIFCEAVAIYG  102
            SP+ W ++GIG+ ++LS+ GAA GI TT  S+ G  ++AP+I++KNLIS+IFCEAVAIYG
Sbjct  63   SPYTWGSVGIGIGISLSIGGAAWGILTTASSLSGAAIRAPQIRSKNLISIIFCEAVAIYG  122

Query  103  LITAIVLSGMLDEFSYPIQKEEVRN-QNWLAGYLIFGAGLAVGLVNLFCGIAVGIVGSGA  161
            +I +I++ G ++     +    +   +   AG+ +F AGLAVGL N+ CGIAVG+VGS  
Sbjct  123  VILSIIMMGKMEADGKAVDSSGIFTYRAAAAGFTLFAAGLAVGLGNMCCGIAVGVVGSSC  182

Query  162  ALSDAANSALFVKILIVEIFGSAIGLFGLIVGIYMTSKVKM  202
            A++DA +S+LFVKIL++EIF SA+G+F +IVGI M  K  M
Sbjct  183  AIADAHSSSLFVKILVIEIFASALGIFSVIVGILMAQKAVM  223


>VATL_DROME unnamed protein product
Length=159

 Score = 84.7 bits (208),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 81/153 (53%), Gaps = 9/153 (6%)

Query  47   WATLGIGLAVALSVVGAALGINTTGVSIIGGGVKAPRIKTKNLISVIFCEAVAIYGLITA  106
            +  +G   A+  S +GAA G   +G  I    V  P +  K++I V+    +AIYGL+ A
Sbjct  16   FGVMGAASAIIFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVA  75

Query  107  IVLSGMLDEFSYPIQKEEVRNQNWLAGYLIFGAGLAVGLVNLFCGIAVGIVGSGAALSDA  166
            ++++G L         EE    +   G++  GAGLAVG   L  G A+GIVG       A
Sbjct  76   VLIAGAL---------EEPSKYSLYRGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVRGTA  126

Query  167  ANSALFVKILIVEIFGSAIGLFGLIVGIYMTSK  199
                LFV ++++ IF   +GL+GLIV IY+ +K
Sbjct  127  QQPRLFVGMILILIFAEVLGLYGLIVAIYLYTK  159


>VATL_DICDI unnamed protein product
Length=196

 Score = 82.4 bits (202),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 58/176 (33%), Positives = 88/176 (50%), Gaps = 12/176 (7%)

Query  26   FTGKGERVSVAWFLENTSP---HMWATLGIGLAVALSVVGAALGINTTGVSIIGGGVKAP  82
            F   GE  +V   + +  P     +  +G+  A+  +V+GAA G     V I   GV  P
Sbjct  7    FLLSGEATAVERIITDACPVYAPFFGAMGVTAALVFTVMGAAYGTAKASVGISNMGVMKP  66

Query  83   RIKTKNLISVIFCEAVAIYGLITAIVLSGMLDEFSYPIQKEEVRNQNWLAGYLIFGAGLA  142
             +  K  I VIF   +AIYGLI  ++L G +   +         N   +  +   GAGL 
Sbjct  67   DLVIKAFIPVIFAGVIAIYGLIICVILVGGIKPNA---------NYTLMKSFTDLGAGLT  117

Query  143  VGLVNLFCGIAVGIVGSGAALSDAANSALFVKILIVEIFGSAIGLFGLIVGIYMTS  198
            VGL  L  G+A+GIVG     +      L+V ++++ IF  A+GL+GLI+GI ++S
Sbjct  118  VGLCGLAAGMAIGIVGDSGVRAFGQQPKLYVIMMLILIFSEALGLYGLIIGILLSS  173


 Score = 36.6 bits (83),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 26/88 (30%), Positives = 43/88 (49%), Gaps = 5/88 (6%)

Query  47   WATLGIGLAVALSVVGAALGINTTGVSIIGGGVKAPRIKTKNLISVIFCEAVAIYGLITA  106
            +  LG GL V L  + A + I   G S +    + P++    ++ +IF EA+ +YGLI  
Sbjct  109  FTDLGAGLTVGLCGLAAGMAIGIVGDSGVRAFGQQPKLYVIMMLILIFSEALGLYGLIIG  168

Query  107  IVLSGMLDEFS-----YPIQKEEVRNQN  129
            I+LS + D +       P+    V  +N
Sbjct  169  ILLSSVSDTYCPGQALVPLNSGNVIGKN  196



Lambda      K        H
   0.318    0.133    0.400 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5924962958


Query= XP_003393058.1 acetyl-CoA acetyltransferase, mitochondrial isoform
X1 [Bombus terrestris]

Length=502
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9W3N9_DROME  unnamed protein product                                 584     0.0   
THILH_CAEEL  unnamed protein product                                  472     7e-165
THIL1_DICDI  unnamed protein product                                  394     6e-134
YKA3_CAEEL  unnamed protein product                                   174     1e-48 
Q9W1H8_DROME  unnamed protein product                                 172     9e-48 


>Q9W3N9_DROME unnamed protein product
Length=410

 Score = 584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/398 (70%), Positives = 329/398 (83%), Gaps = 3/398 (1%)

Query  16   RSYSSKVKLNDVVIVSATRTPMGSFLGGLSSLTAPKLGAITIKAAIERAGISKDEVTEVY  75
            R+YSSK+   +VV+VSA RTP+GSF   L+ LTA +LGA  I+AAIE+AGI+K +V EV 
Sbjct  16   RNYSSKIA--EVVVVSAARTPIGSFQSQLAPLTATQLGARAIEAAIEKAGIAKTDVQEVI  73

Query  76   MGNVCQAALGQAPARQATLFAGLPKSTICTTVNKVCASGMKSIMLASQSLQCGHQEIVLA  135
            MGNV  A LGQAPARQA +FAGLP +  CTTVNKVC+SGMK++ML +QSL  G+ ++V+A
Sbjct  74   MGNVVSAGLGQAPARQAAIFAGLPTNVCCTTVNKVCSSGMKAVMLGAQSLMLGYADVVVA  133

Query  136  GGMESMSNVPFYLPRGEIKYGGTKLEDGIVFDGLTDVYNKFHMGNCAENTAKKLNITRDE  195
            GGMESMSNVP+YL RG   YGG  L DGIVFDGL DVYNKFHMGNCAENTAKKL ITR +
Sbjct  134  GGMESMSNVPYYLKRGATPYGGVNLTDGIVFDGLWDVYNKFHMGNCAENTAKKLEITRQQ  193

Query  196  QDRYAINSYKRSATAYANKIFQDELVPVPVPQKRGNPDIVFNEDEEYKKVNFDKFGKLNT  255
            QD +AI SYKRSA A+ANK+FQDE+ PV + QKR  P+IV +EDEEYK+VNFDKFG+L T
Sbjct  194  QDDFAIESYKRSAAAWANKVFQDEIAPVKIQQKR-KPEIVISEDEEYKRVNFDKFGQLAT  252

Query  256  VFQKENGTVTAGNASTLNDGAAALILTTTVVAQKMNLKPLARVIAFQDAATDPIDFPTAP  315
            VFQ+ENGTVTAGNASTLNDG AA++L +   AQK  +KPLAR++AFQDA TDPIDFP AP
Sbjct  253  VFQRENGTVTAGNASTLNDGGAAVVLMSAEAAQKAGIKPLARIVAFQDAETDPIDFPIAP  312

Query  316  SFGISKLLEKTGLNKNDIALWEINEAFSVVVIANQKLLDLDPNTVNIHGGAVSLGHPIGM  375
            +  I KLL++ G+ K D+A+WE+NEAFS+VV+AN K LD+DP  VN+HGGAVS+GHPIGM
Sbjct  313  ALAIPKLLKRAGVRKEDVAMWEVNEAFSLVVLANIKKLDVDPAKVNVHGGAVSIGHPIGM  372

Query  376  SGARLVVHLVHALKAGEKGIASICNGGGGASSILIEKL  413
            SGARLV HL H+LK GE G ASICNGGGGASSILIEKL
Sbjct  373  SGARLVAHLSHSLKKGELGCASICNGGGGASSILIEKL  410


>THILH_CAEEL unnamed protein product
Length=407

 Score = 472 bits (1215),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 226/385 (59%), Positives = 292/385 (76%), Gaps = 3/385 (1%)

Query  29   IVSATRTPMGSFLGGLSSLTAPKLGAITIKAAIERAGISKDEVTEVYMGNVCQAALGQAP  88
            IV A RTP+GSF   LSS+TAP+L ++ IKAA+ER  +    + EV++G VCQA  GQAP
Sbjct  26   IVGAARTPIGSFRSSLSSVTAPELASVAIKAALERGAVKPSSIQEVFLGQVCQANAGQAP  85

Query  89   ARQATLFAGLPKSTICTTVNKVCASGMKSIMLASQSLQCGHQEIVLAGGMESMSNVPFYL  148
            ARQA L AGL  S   TTVNKVC+SG+K+I+LA+Q +Q GHQ+  + GGMESMS VPFY+
Sbjct  86   ARQAALGAGLDLSVAVTTVNKVCSSGLKAIILAAQQIQTGHQDFAIGGGMESMSQVPFYV  145

Query  149  PRGEIKYGGTKLEDGIVFDGLTDVYNKFHMGNCAENTAKKLNITRDEQDRYAINSYKRSA  208
             RGEI YGG ++ DGIV DGLTD Y+K HMGNC E T+K++ ITR +QD YAINSYK+SA
Sbjct  146  QRGEIPYGGFQVIDGIVKDGLTDAYDKVHMGNCGEKTSKEMGITRKDQDEYAINSYKKSA  205

Query  209  TAYANKIFQDELVPVPVPQKRGNPDIVFNEDEEYKKVNFDKFGKLNTVFQKENGTVTAGN  268
             A+ N     E+VPV V  K+G    + ++DEE+ KVNFDKF  L TVFQK+ GT+TA N
Sbjct  206  KAWENGNIGPEVVPVNVKSKKGV--TIVDKDEEFTKVNFDKFTSLRTVFQKD-GTITAAN  262

Query  269  ASTLNDGAAALILTTTVVAQKMNLKPLARVIAFQDAATDPIDFPTAPSFGISKLLEKTGL  328
            ASTLNDGAAA+I+ +     + +LKPLAR++A+ DAAT P+DF  AP+    K+LE+ G+
Sbjct  263  ASTLNDGAAAVIVASQEAVSEQSLKPLARILAYGDAATHPLDFAVAPTLMFPKILERAGV  322

Query  329  NKNDIALWEINEAFSVVVIANQKLLDLDPNTVNIHGGAVSLGHPIGMSGARLVVHLVHAL  388
             ++D+A WE+NEAFS V +A  K L +DP+ VN HGGAVS+GHPIGMSGARL+ HLVH L
Sbjct  323  KQSDVAQWEVNEAFSCVPLAFIKKLGVDPSLVNPHGGAVSIGHPIGMSGARLITHLVHTL  382

Query  389  KAGEKGIASICNGGGGASSILIEKL  413
            K+G+ G+A+ICNGGGG+S ++I+KL
Sbjct  383  KSGQIGVAAICNGGGGSSGMVIQKL  407


>THIL1_DICDI unnamed protein product
Length=414

 Score = 394 bits (1012),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 207/402 (51%), Positives = 275/402 (68%), Gaps = 6/402 (1%)

Query  16   RSYSSKVKLNDVVIVSATRTPMGSFLGGLSSLTAPKLGAITIKAAIERAGISKDEVTEVY  75
            R Y++   L  VVIVSA RTP+GS  G LS++   KL +ITI+ A++RAGI   +V E  
Sbjct  15   RMYTTAKNLESVVIVSAVRTPIGSIGGSLSTIPGTKLSSITIEEAVKRAGIKPSDVDEAI  74

Query  76   MGNVCQAALGQAPARQATLFAGLPKSTICTTVNKVCASGMKSIMLASQSLQCGHQEIVLA  135
            +GNV  A LGQAPARQ  L AGL + TI TT+NKVC+SGMK+I+  +QS+  GH + V+A
Sbjct  75   IGNVISANLGQAPARQCALGAGLEQKTITTTINKVCSSGMKAIVFGAQSIALGHSKTVVA  134

Query  136  GGMESMSNVPFYLP--RGEIKYGGTKLEDGIVFDGLTDVYNKFHMGNCAENTAKKLNITR  193
            GG ESMS VP+Y    R   KYG     DG+V DGL D YN   MG C ++ A K  ITR
Sbjct  135  GGFESMSQVPYYADKMRFGAKYGNQTFIDGLVRDGLADAYNGSAMGVCGDDCADKYKITR  194

Query  194  DEQDRYAINSYKRSATAYANKIFQDELVPVPVPQKRGNPDIVFNEDEEYKKVNFDKFGKL  253
            ++QD++A++SY R+  A  N  F DE+V VP+  + G    V  EDEE KKV FDK   L
Sbjct  195  EQQDKFAVDSYLRALEAQKNGFFNDEIVQVPIVGRGGKVTYVV-EDEEPKKVLFDKIPNL  253

Query  254  NTVFQKENGTVTAGNASTLNDGAAALILTTTVVAQKMNLKPLARVIAFQDAATDPIDFPT  313
               F   NGTVT  NAS LNDGA+++IL +   A+++ LKPLAR+I + DA   PI+FPT
Sbjct  254  KPAFT-PNGTVTPANASKLNDGASSVILMSESHAKELGLKPLARIIGYADAEQAPIEFPT  312

Query  314  APSFGISKLLEKTGLNKNDIALWEINEAFSVVVIANQKLLDLDPNTVNIHGGAVSLGHPI  373
            AP+  I K L+  G+N + + L+EINEAF+VV +AN K+LD+D N +N++GGAV+LGHPI
Sbjct  313  APALAIPKALKNAGINMSQVDLFEINEAFAVVGLANAKILDIDHNKLNVNGGAVALGHPI  372

Query  374  GMSGARLVVHLVHAL--KAGEKGIASICNGGGGASSILIEKL  413
            G SG R+VV L H L  K  + G+A+ICNGGGG++++++EKL
Sbjct  373  GSSGCRIVVTLTHLLQNKNLKYGVAAICNGGGGSTALVLEKL  414


>YKA3_CAEEL unnamed protein product
Length=448

 Score = 174 bits (440),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 134/438 (31%), Positives = 206/438 (47%), Gaps = 44/438 (10%)

Query  14   TLRSYSSKVKLN--DVVIVSATRTPMGSFLGGLSSLTAPKLGAITIKAAIERAGISKDEV  71
            T R+ S+  K N  ++V+V A RTP          L A  L    IKA +E+  +  +++
Sbjct  11   TARAASAVAKKNMPNIVLVDAVRTPFVVSGTVFKDLMAVDLQKEAIKALVEKTKLPYEQL  70

Query  72   TEVYMGNVCQAALGQAPARQATLFAGLPKSTICTTVNKVCASGMKSIMLASQSLQCGHQE  131
              +  G V Q       AR+A L AG+P      TV   C S   ++      L  G+  
Sbjct  71   DHIICGTVIQECKTSNIAREAALLAGVPDKIPAHTVTLACISSNVAMTTGMGMLATGNAN  130

Query  132  IVLAGGMESMSNVPFYLPR----------------GEIKYGGTKLEDGIV--FDGLTDVY  173
             ++AGG+E +S+VP    R                 ++K GG  +++ +      + +  
Sbjct  131  AIIAGGVELLSDVPIRYNRNARKAMLGMNKAKDVPSKLKIGGQIVKNLLSPELPAVAEFS  190

Query  174  NKFHMGNCAENTAKKLNITRDEQDRYAINSYKRSATAYANKIFQDELVPVPVPQKRGNPD  233
                MG+  +  A   N++R EQD +AI S+  ++ A  N  F D +VPV +  K+  P 
Sbjct  191  TGETMGHSGDRLAAAFNVSRREQDEFAIRSHTLASEAAKNGKFTD-VVPVFLDGKK--PK  247

Query  234  IVFNEDEEYKKVNFDKFGKLNTVFQKENGTVTAGNASTLNDGAAALILTTTVVAQKMNLK  293
             +  ED   +    +K   L   F K +GTVTA NAS L DGA+A ++ T   A     K
Sbjct  248  TI-KEDNGIRVSTLEKLSSLKPAFVKPHGTVTAANASYLTDGASAALIMTEEYALANGYK  306

Query  294  PLARVIAFQDAATDPID-FPTAPSFGISKLLEKTGLNKNDIALWEINEAFSVVVIANQKL  352
            P A +  +   A DP D    +P++ I KLL+K GL   D+ ++EI+EAF+  V+AN   
Sbjct  307  PKAYLRDYLYVAQDPKDQLLLSPAYVIPKLLDKAGLTLKDVDVFEIHEAFAGQVLANLNA  366

Query  353  LDLD-----------------PNTVNIHGGAVSLGHPIGMSGARLVVHLVHALK--AGEK  393
            +D D                  + +N+ GG++S+GHP G +G RL  H  H LK   G+ 
Sbjct  367  MDSDYFCKEQMKRSGKFGRVPMDKLNLWGGSLSIGHPFGATGVRLATHSAHRLKEEKGQY  426

Query  394  GIASICNGGGGASSILIE  411
             + + C  GG    +LIE
Sbjct  427  AVIAACAAGGHGVGMLIE  444


>Q9W1H8_DROME unnamed protein product
Length=469

 Score = 172 bits (435),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 128/425 (30%), Positives = 201/425 (47%), Gaps = 43/425 (10%)

Query  26   DVVIVSATRTPMGSFLGGLSSLTAPKLGAITIKAAIERAGISKDEVTEVYMGNVCQAALG  85
            ++V+V   RTP  +     S L   +L   ++ + +++  + K+ +  +  G+V Q    
Sbjct  43   NIVLVDGVRTPFLTSGTTYSKLMPHELARHSLLSLLQKNRLDKELIDYIVYGSVIQEVKT  102

Query  86   QAPARQATLFAGLPKSTICTTVNKVCASGMKSIMLASQSLQCGHQEIVLAGGMESMSNVP  145
               AR+A L AG    T   TV   C S   +I      +     ++++AGG+E MS+VP
Sbjct  103  SNIAREAALAAGFSNKTPAHTVTMACISSNAAITTGMGLIATNTYDVIVAGGVEFMSDVP  162

Query  146  FYLPR---------GEIKYGGTKLEDGIVFD---------GLTDVYNKFHMGNCAENTAK  187
                R          + K  G +L     F           + +  +   MG+ A+  A 
Sbjct  163  IRHSRKMRSLLLKANKAKTLGQRLALLSTFRPDFLAPELPAVAEFSSGETMGHSADRLAS  222

Query  188  KLNITRDEQDRYAINSYKRSATAYANKIFQDELVPVPVPQKRGNPDIVFNEDEEYKKVNF  247
              N++R EQD YA+ S+  +  A     F D      VP K    D + ++D   +  + 
Sbjct  223  AFNVSRSEQDEYALRSHTLAKEAQEKGYFTDL-----VPFKVSGVDQIVDKDNGIRVSSP  277

Query  248  DKFGKLNTVFQKENGTVTAGNASTLNDGAAALILTTTVVAQKMNLKPLARVIAFQDAATD  307
            +   KL   F K  GTVTA NAS L DGA+A I+ T   A+++ LKP A +  F   + D
Sbjct  278  ESLAKLRPAFVKPYGTVTAANASFLTDGASACIIMTEEKAKQLGLKPKAYLRDFLFVSQD  337

Query  308  PID-FPTAPSFGISKLLEKTGLNKNDIALWEINEAFSVVVIANQKLLDLD----------  356
            P++     P++GI KLL+K GL   DI  WEI+EAF+  ++AN K LD D          
Sbjct  338  PVNQLLLGPAYGIPKLLKKAGLTLKDIDSWEIHEAFAGQIVANLKALDSDWFCKTYLGLN  397

Query  357  -----PN--TVNIHGGAVSLGHPIGMSGARLVVHLVHAL--KAGEKGIASICNGGGGASS  407
                 P+    N  GG++S+GHP   +G RL +H  + L  + G+ G+ + C  GG   +
Sbjct  398  EKVGTPDLSKWNNWGGSLSIGHPFAATGVRLCMHTANRLVREDGKLGVVAACAAGGQGVA  457

Query  408  ILIEK  412
            +LIE+
Sbjct  458  MLIER  462



Lambda      K        H
   0.318    0.133    0.400 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5924962958


Query= XP_003393059.1 baculoviral IAP repeat-containing protein 7 isoform
X3 [Bombus terrestris]

Length=523
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DIAP2_DROME  unnamed protein product                                  335     2e-109
DIAP1_DROME  unnamed protein product                                  111     3e-26 
Q9VEM2_DROME  unnamed protein product                                 54.3    1e-08 
CBLA_DICDI  unnamed protein product                                   53.9    2e-07 
Q8SWW8_DROME  unnamed protein product                                 53.5    3e-07 


>DIAP2_DROME unnamed protein product
Length=498

 Score = 335 bits (858),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 194/549 (35%), Positives = 276/549 (50%), Gaps = 82/549 (15%)

Query  1    MNVEESRLRTFTDWPVNATVDAARIAKAGFYYTGHALEVQCFLCGVKISDWNYGDQAIVR  60
            M +E  RL TF +WP+NA V A  +   GF+ TG+ LE +C  C V+I  W YGDQ   R
Sbjct  6    MELESVRLATFGEWPLNAPVSAEDLVANGFFATGNWLEAECHFCHVRIDRWEYGDQVAER  65

Query  61   HRLAEPNCPFVQNPSSTCNVPLIPIPINNLGLASSSTETSQDNNIVE----CQSINLYQN  116
            HR + P C  V  P+   NVP             S    ++ N++V+    C   +L   
Sbjct  66   HRRSSPICSMVLAPNHCGNVP------------RSQESDNEGNSVVDSPESCSCPDLL--  111

Query  117  KEPQKECRVMSQRLQSFTNWPISSIVSPEKLAKAGFYYLQHDDEVQCTYCGGILRKWKLG  176
                    + + RL +F +WP  +I +P+ LAKAGFYYL   D V+C +C G++ KW+  
Sbjct  112  --------LEANRLVTFKDWPNPNI-TPQALAKAGFYYLNRLDHVKCVWCNGVIAKWEKN  162

Query  177  DDPERKHREYFPNCNFYVHQDKDDNLYLTNVKLMP----GATSNLSDLGIQIHTTPKKPD  232
            D+   +H+ +FP C                V++ P        NL +LGIQ  T P +P 
Sbjct  163  DNAFEEHKRFFPQC--------------PRVQMGPLIEFATGKNLDELGIQPTTLPLRPK  208

Query  233  CATYEGRLRTFNGWPENIKQTPEILASAGFYYDGFGDHVRCFHCDGGLRNWEATDDAWTE  292
             A  + RLRTF  WP +  Q    LA AG YY   GD VRCFHC+ GLR+W+  D+ W E
Sbjct  209  YACVDARLRTFTDWPISNIQPASALAQAGLYYQKIGDQVRCFHCNIGLRSWQKEDEPWFE  268

Query  293  HARWFPKCEFVNLVRGQEFIKQCINNRPPLDQSIFEGVTEDESTDITDTRATTIPSLEIT  352
            HA+W PKC+FV L +G  ++ +           +      + S+      A T+ +    
Sbjct  269  HAKWSPKCQFVLLAKGPAYVSE-----------VLATTAANASSQPATAPAPTLQA----  313

Query  353  EATLKKLLESPPAMEALEIGLHVGRVKRALKKRMEEIGTPYTNSDQLIEDVLCDQIMEEL  412
                  L++  PA EAL +G+  G V+ A+++++   G  ++  D+L+ D+  D      
Sbjct  314  ----DVLMDEAPAKEALALGIDGGVVRNAIQRKLLSSGCAFSTLDELLHDIFDDAGAGAA  369

Query  413  TR-----EQTNSDIEQCNTDKKDEYSV-CSVEDE-------NSVISNDKSNTDKKANFKE  459
                   E +   IE C        SV   V D           ++N    TD+      
Sbjct  370  LEVREPPEPSAPFIEPCQATTSKAASVPIPVADSIPAKPQAAEAVANISKITDEIQKMSV  429

Query  460  ST-----ALEEENRKLKEARLCKICMDREIAIVFLPCGHLATCVYCAPSLTYCLMCRQEI  514
            +T     +LEEENR+LK+ARLCK+C+D E+ +VFLPCGHLATC  CAPS+  C MCR +I
Sbjct  430  ATPNGNLSLEEENRQLKDARLCKVCLDEEVGVVFLPCGHLATCNQCAPSVANCPMCRADI  489

Query  515  KATVRTFLS  523
            K  VRTFLS
Sbjct  490  KGFVRTFLS  498


>DIAP1_DROME unnamed protein product
Length=438

 Score = 111 bits (278),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 63/184 (34%), Positives = 89/184 (48%), Gaps = 16/184 (9%)

Query  228  PKKPDCATYEGRLRTFNGWPENIKQTPEILASAGFYYDGFGDHVRCFHCDGGLRNWEATD  287
            P+ P+ A    RLRTF  WP N+KQ P  LA AGF+Y G GD VRCF C GGL +W   D
Sbjct  218  PQYPEYAIETARLRTFEAWPRNLKQKPHQLAEAGFFYTGVGDRVRCFSCGGGLMDWNDND  277

Query  288  DAWTEHARWFPKCEFVNLVRGQEFIKQCINNRPPLDQSIFEGVTEDESTDITDTRATTIP  347
            + W +HA W  +C FV L++GQ +I          D    + V  +E  + +      + 
Sbjct  278  EPWEQHALWLSQCRFVKLMKGQLYI----------DTVAAKPVLAEEKEESSSIGGVAVA  327

Query  348  SLEITEATLKKLLESPPAMEA-LEIGLHVGRVKRALKKRME--EIGTPYTNSD---QLIE  401
            S + +E   +  L S  A+   +   +      R   K +E   + TP TNS     + E
Sbjct  328  STQASEEEQQTSLSSEEAVSGDVAPSVAPTAATRIFNKIVEATAVATPSTNSSGSTSIPE  387

Query  402  DVLC  405
            + LC
Sbjct  388  EKLC  391


 Score = 107 bits (267),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 78/273 (29%), Positives = 115/273 (42%), Gaps = 66/273 (24%)

Query  1    MNVEESRLRTFTDWPVNATVDAARIAKAGFYYTGHALEVQCFLCGVKISDWNYGDQAIVR  60
            +N EE+RL+TFTDWP++  +D  ++A+ G Y+T    +V+CF CGV+I  W   DQ +  
Sbjct  41   LNREETRLKTFTDWPLD-WLDKRQLAQTGMYFTHAGDKVKCFFCGVEIGCWEQEDQPVPE  99

Query  61   HRLAEPNCPFVQNPSSTCNVPL-----------------------------------IP-  84
            H+   PNCP ++   +T NVP+                                   IP 
Sbjct  100  HQRWSPNCPLLRR-RTTNNVPINAEALDRILPPISYDICGANDSTLEMREHAYAEGVIPM  158

Query  85   ------IPINNLGLASSSTETSQDNNIV-------------------ECQSINLYQNKEP  119
                  I +N +  A S T T+     V                    C+      N  P
Sbjct  159  SQLIQSIGMNAVNAAGSVTGTAAPQPRVTVATHASTATQATGDVQPETCRPSAASGNYFP  218

Query  120  Q-KECRVMSQRLQSFTNWPISSIVSPEKLAKAGFYYLQHDDEVQCTYCGGILRKWKLGDD  178
            Q  E  + + RL++F  WP +    P +LA+AGF+Y    D V+C  CGG L  W   D+
Sbjct  219  QYPEYAIETARLRTFEAWPRNLKQKPHQLAEAGFFYTGVGDRVRCFSCGGGLMDWNDNDE  278

Query  179  PERKHREYFPNCNFYVHQDKDDNLYLTNVKLMP  211
            P  +H  +   C F   +     LY+  V   P
Sbjct  279  PWEQHALWLSQCRFV--KLMKGQLYIDTVAAKP  309


 Score = 57.8 bits (138),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 31/54 (57%), Gaps = 0/54 (0%)

Query  470  LKEARLCKICMDREIAIVFLPCGHLATCVYCAPSLTYCLMCRQEIKATVRTFLS  523
            + E +LCKIC   E    FLPCGH+  C  CA S+T C +CR+     +R + S
Sbjct  385  IPEEKLCKICYGAEYNTAFLPCGHVVACAKCASSVTKCPLCRKPFTDVMRVYFS  438


 Score = 55.1 bits (131),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 45/89 (51%), Gaps = 1/89 (1%)

Query  102  DNNIVECQSINLYQNKEPQKECRVMSQRLQSFTNWPISSIVSPEKLAKAGFYYLQHDDEV  161
            DNN    Q      NK    +      RL++FT+WP+  +    +LA+ G Y+    D+V
Sbjct  20   DNNTNATQLFKNNINKTRMNDLNREETRLKTFTDWPLDWL-DKRQLAQTGMYFTHAGDKV  78

Query  162  QCTYCGGILRKWKLGDDPERKHREYFPNC  190
            +C +CG  +  W+  D P  +H+ + PNC
Sbjct  79   KCFFCGVEIGCWEQEDQPVPEHQRWSPNC  107


 Score = 53.9 bits (128),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 47/110 (43%), Gaps = 10/110 (9%)

Query  237  EGRLRTFNGWPENIKQTPEILASAGFYYDGFGDHVRCFHCDGGLRNWEATDDAWTEHARW  296
            E RL+TF  WP +     + LA  G Y+   GD V+CF C   +  WE  D    EH RW
Sbjct  45   ETRLKTFTDWPLDWLDKRQ-LAQTGMYFTHAGDKVKCFFCGVEIGCWEQEDQPVPEHQRW  103

Query  297  FPKCEFVNLVRGQEFIKQCINNRPPLDQSIFEGVTEDESTDITDTRATTI  346
             P C           +++   N  P++    + +    S DI     +T+
Sbjct  104  SPNC---------PLLRRRTTNNVPINAEALDRILPPISYDICGANDSTL  144


>Q9VEM2_DROME unnamed protein product
Length=153

 Score = 54.3 bits (129),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 35/72 (49%), Gaps = 5/72 (7%)

Query  239  RLRTFNGWP--ENIKQTPEILASAGFYYDGF---GDHVRCFHCDGGLRNWEATDDAWTEH  293
            R+ ++  WP  E    +   +A AGFY+ G     D   CF C   L  WE  DD W EH
Sbjct  31   RVESYKSWPFPETASCSISKMAEAGFYWTGTKRENDTATCFVCGKTLDGWEPEDDPWKEH  90

Query  294  ARWFPKCEFVNL  305
             +  P+CEF  L
Sbjct  91   VKHAPQCEFAKL  102


 Score = 51.6 bits (122),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 40/70 (57%), Gaps = 5/70 (7%)

Query  128  QRLQSFTNWPI--SSIVSPEKLAKAGFYYL---QHDDEVQCTYCGGILRKWKLGDDPERK  182
             R++S+ +WP   ++  S  K+A+AGFY+    + +D   C  CG  L  W+  DDP ++
Sbjct  30   HRVESYKSWPFPETASCSISKMAEAGFYWTGTKRENDTATCFVCGKTLDGWEPEDDPWKE  89

Query  183  HREYFPNCNF  192
            H ++ P C F
Sbjct  90   HVKHAPQCEF  99


 Score = 48.5 bits (114),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/75 (31%), Positives = 37/75 (49%), Gaps = 5/75 (7%)

Query  3    VEESRLRTFTDWPV--NATVDAARIAKAGFYYTGHALE---VQCFLCGVKISDWNYGDQA  57
            +E+ R+ ++  WP    A+   +++A+AGFY+TG   E     CF+CG  +  W   D  
Sbjct  27   LEQHRVESYKSWPFPETASCSISKMAEAGFYWTGTKRENDTATCFVCGKTLDGWEPEDDP  86

Query  58   IVRHRLAEPNCPFVQ  72
               H    P C F +
Sbjct  87   WKEHVKHAPQCEFAK  101


>CBLA_DICDI unnamed protein product
Length=665

 Score = 53.9 bits (128),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 28/49 (57%), Gaps = 0/49 (0%)

Query  475  LCKICMDREIAIVFLPCGHLATCVYCAPSLTYCLMCRQEIKATVRTFLS  523
            LC +CMD EI  VFL CGHL+ C  C+  L  C +CR  I   +  F S
Sbjct  617  LCTVCMDNEINTVFLECGHLSCCSLCSVKLKKCPICRSRITRVINIFKS  665


>Q8SWW8_DROME unnamed protein product
Length=676

 Score = 53.5 bits (127),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 32/54 (59%), Gaps = 0/54 (0%)

Query  469  KLKEARLCKICMDREIAIVFLPCGHLATCVYCAPSLTYCLMCRQEIKATVRTFL  522
            ++ EA  CKICMDR I  VF PC H+  C  CA   + C  CR +I + V+ +L
Sbjct  541  RISEAMQCKICMDRAINTVFNPCCHVIACAQCAARCSNCPNCRVKITSVVKIYL  594



Lambda      K        H
   0.318    0.133    0.400 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5924962958


Query= XP_003393060.1 death-associated inhibitor of apoptosis 1 isoform X1
[Bombus terrestris]

Length=406
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DIAP1_DROME  unnamed protein product                                  236     2e-73
DIAP2_DROME  unnamed protein product                                  144     3e-38
Q9VEM2_DROME  unnamed protein product                                 57.4    7e-10
A0A0B4KGR9_DROME  unnamed protein product                             61.2    1e-09
Q9VH01_DROME  unnamed protein product                                 61.2    1e-09


>DIAP1_DROME unnamed protein product
Length=438

 Score = 236 bits (602),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 140/407 (34%), Positives = 203/407 (50%), Gaps = 53/407 (13%)

Query  43   DYHFEAARLQSFENWPVTYIEPEKLAAAGFYYTGESDKVKCFECQVEICKWVEGDIPMVD  102
            D + E  RL++F +WP+ +++  +LA  G Y+T   DKVKCF C VEI  W + D P+ +
Sbjct  40   DLNREETRLKTFTDWPLDWLDKRQLAQTGMYFTHAGDKVKCFFCGVEIGCWEQEDQPVPE  99

Query  103  HQRWSARCRFIRKLNCGNVPIGVDP-DTVTPPRPRSRDVCSP--YGLEYR---------P  150
            HQRWS  C  +R+    NVPI  +  D + PP   S D+C      LE R         P
Sbjct  100  HQRWSPNCPLLRRRTTNNVPINAEALDRILPPI--SYDICGANDSTLEMREHAYAEGVIP  157

Query  151  TS------GPDDHNFSM----------ELQLASTAKLGCLGLGRTK-------------G  181
             S      G +  N +            + +A+ A       G  +              
Sbjct  158  MSQLIQSIGMNAVNAAGSVTGTAAPQPRVTVATHASTATQATGDVQPETCRPSAASGNYF  217

Query  182  PVHPEYASYDARLHTFVTWPKSMPQTKEQLADAGFFYTGKGDQTLCYHCGGGLKDWEPED  241
            P +PEYA   ARL TF  WP+++ Q   QLA+AGFFYTG GD+  C+ CGGGL DW   D
Sbjct  218  PQYPEYAIETARLRTFEAWPRNLKQKPHQLAEAGFFYTGVGDRVRCFSCGGGLMDWNDND  277

Query  242  DPWEQHAKWFSKCCYLLMVQGQDYISKITGQHVSPPSKEETMQMNLPSFIKKVQPTSVEV  301
            +PWEQHA W S+C ++ +++GQ YI  +  + V    KEE+      S I  V   S + 
Sbjct  278  EPWEQHALWLSQCRFVKLMKGQLYIDTVAAKPVLAEEKEES------SSIGGVAVASTQA  331

Query  302  ERKEETESNPGSSSQNNDIW---GIASNTEPIKRSLESEPTENPSNIKTQNTKPTDDARM  358
              +E+  S     + + D+       + T    + +E+     PS   + +T   ++ ++
Sbjct  332  SEEEQQTSLSSEEAVSGDVAPSVAPTAATRIFNKIVEATAVATPSTNSSGSTSIPEE-KL  390

Query  359  CKICYNGELGVVFLPCGHMVACVKCAPGMTTCAVCREPVTMTVRAFI  405
            CKICY  E    FLPCGH+VAC KCA  +T C +CR+P T  +R + 
Sbjct  391  CKICYGAEYNTAFLPCGHVVACAKCASSVTKCPLCRKPFTDVMRVYF  437


 Score = 75.1 bits (183),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 53/95 (56%), Gaps = 8/95 (8%)

Query  30   VTPDTCHDEADNVDYH-------FEAARLQSFENWPVTYIE-PEKLAAAGFYYTGESDKV  81
            V P+TC   A + +Y         E ARL++FE WP    + P +LA AGF+YTG  D+V
Sbjct  202  VQPETCRPSAASGNYFPQYPEYAIETARLRTFEAWPRNLKQKPHQLAEAGFFYTGVGDRV  261

Query  82   KCFECQVEICKWVEGDIPMVDHQRWSARCRFIRKL  116
            +CF C   +  W + D P   H  W ++CRF++ +
Sbjct  262  RCFSCGGGLMDWNDNDEPWEQHALWLSQCRFVKLM  296


>DIAP2_DROME unnamed protein product
Length=498

 Score = 144 bits (363),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 85/254 (33%), Positives = 119/254 (47%), Gaps = 48/254 (19%)

Query  27   SVSVTPDTCHDEADNVDYHFEAARLQSFENWPVTYIEPEKLAAAGFYYTGESDKVKCFEC  86
            SV  +P++C       D   EA RL +F++WP   I P+ LA AGFYY    D VKC  C
Sbjct  97   SVVDSPESCSCP----DLLLEANRLVTFKDWPNPNITPQALAKAGFYYLNRLDHVKCVWC  152

Query  87   QVEICKWVEGDIPMVDHQRWSARCRFIRKLNCGNVPIGVDPDTVTPPRPRSRDVCSPYGL  146
               I KW + D    +H+R+  +C                        PR +        
Sbjct  153  NGVIAKWEKNDNAFEEHKRFFPQC------------------------PRVQ--------  180

Query  147  EYRPTSGPDDHNFSMELQLASTAKLGCLGLGRTKGPVHPEYASYDARLHTFVTWPKSMPQ  206
                  GP        ++ A+   L  LG+  T  P+ P+YA  DARL TF  WP S  Q
Sbjct  181  -----MGP-------LIEFATGKNLDELGIQPTTLPLRPKYACVDARLRTFTDWPISNIQ  228

Query  207  TKEQLADAGFFYTGKGDQTLCYHCGGGLKDWEPEDDPWEQHAKWFSKCCYLLMVQGQDYI  266
                LA AG +Y   GDQ  C+HC  GL+ W+ ED+PW +HAKW  KC ++L+ +G  Y+
Sbjct  229  PASALAQAGLYYQKIGDQVRCFHCNIGLRSWQKEDEPWFEHAKWSPKCQFVLLAKGPAYV  288

Query  267  SKITGQHVSPPSKE  280
            S++     +  S +
Sbjct  289  SEVLATTAANASSQ  302


 Score = 80.9 bits (198),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 64/235 (27%), Positives = 91/235 (39%), Gaps = 47/235 (20%)

Query  42   VDYHFEAARLQSFENWPVTY-IEPEKLAAAGFYYTGESDKVKCFECQVEICKWVEGDIPM  100
            +    E+ RL +F  WP+   +  E L A GF+ TG   + +C  C V I +W  GD   
Sbjct  4    LGMELESVRLATFGEWPLNAPVSAEDLVANGFFATGNWLEAECHFCHVRIDRWEYGDQVA  63

Query  101  VDHQRWSARCRFIRKLN-CGNVPIGVDPDTVTPPRPRSRDVCSPYGLEYRPTSGPDDHNF  159
              H+R S  C  +   N CGNVP   + D        S + CS                 
Sbjct  64   ERHRRSSPICSMVLAPNHCGNVPRSQESDNEGNSVVDSPESCS-----------------  106

Query  160  SMELQLASTAKLGCLGLGRTKGPVHPEYASYDARLHTFVTWPKSMPQTKEQLADAGFFYT  219
                                     P+      RL TF  WP     T + LA AGF+Y 
Sbjct  107  ------------------------CPDLLLEANRLVTFKDWPNPN-ITPQALAKAGFYYL  141

Query  220  GKGDQTLCYHCGGGLKDWEPEDDPWEQHAKWFSKCCYLLMVQGQDYISKITGQHV  274
             + D   C  C G +  WE  D+ +E+H ++F +C     VQ    I   TG+++
Sbjct  142  NRLDHVKCVWCNGVIAKWEKNDNAFEEHKRFFPQC---PRVQMGPLIEFATGKNL  193


 Score = 71.2 bits (173),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 56/99 (57%), Gaps = 2/99 (2%)

Query  307  TESNPGSSSQNNDIWGIASNTEPIKRSLESEPTENPSNIKTQNTKPTDDARMCKICYNGE  366
             +S P        +  I+  T+ I++   + P  N S ++ +N +   DAR+CK+C + E
Sbjct  401  ADSIPAKPQAAEAVANISKITDEIQKMSVATPNGNLS-LEEEN-RQLKDARLCKVCLDEE  458

Query  367  LGVVFLPCGHMVACVKCAPGMTTCAVCREPVTMTVRAFI  405
            +GVVFLPCGH+  C +CAP +  C +CR  +   VR F+
Sbjct  459  VGVVFLPCGHLATCNQCAPSVANCPMCRADIKGFVRTFL  497


>Q9VEM2_DROME unnamed protein product
Length=153

 Score = 57.4 bits (137),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 43/71 (61%), Gaps = 9/71 (13%)

Query  193  RLHTFVTWPKSMPQTKE----QLADAGFFYTG---KGDQTLCYHCGGGLKDWEPEDDPWE  245
            R+ ++ +WP   P+T      ++A+AGF++TG   + D   C+ CG  L  WEPEDDPW+
Sbjct  31   RVESYKSWP--FPETASCSISKMAEAGFYWTGTKRENDTATCFVCGKTLDGWEPEDDPWK  88

Query  246  QHAKWFSKCCY  256
            +H K   +C +
Sbjct  89   EHVKHAPQCEF  99


 Score = 43.9 bits (102),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 41/79 (52%), Gaps = 7/79 (9%)

Query  46   FEAARLQSFENWP---VTYIEPEKLAAAGFYYTG---ESDKVKCFECQVEICKWVEGDIP  99
             E  R++S+++WP          K+A AGFY+TG   E+D   CF C   +  W   D P
Sbjct  27   LEQHRVESYKSWPFPETASCSISKMAEAGFYWTGTKRENDTATCFVCGKTLDGWEPEDDP  86

Query  100  MVDHQRWSARCRFIRKLNC  118
              +H + + +C F  KL+C
Sbjct  87   WKEHVKHAPQCEFA-KLSC  104


>A0A0B4KGR9_DROME unnamed protein product
Length=4875

 Score = 61.2 bits (147),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 48/90 (53%), Gaps = 6/90 (7%)

Query  42   VDYHFEAARLQSFENWP---VTYIEPEKLAAAGFYYTGES---DKVKCFECQVEICKWVE  95
            V  H EA R Q+FE WP     +  P+++A AGFY+   S   D+  CF C V +  W +
Sbjct  243  VLMHSEAVRRQTFEKWPHMDYKWALPDQMAQAGFYHQPSSSGEDRAMCFTCSVCLVCWEK  302

Query  96   GDIPMVDHQRWSARCRFIRKLNCGNVPIGV  125
             D P  +H+R S  C F++     NVP+ +
Sbjct  303  TDEPWSEHERHSPLCPFVKGEYTQNVPLSI  332


 Score = 42.4 bits (98),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/74 (30%), Positives = 37/74 (50%), Gaps = 11/74 (15%)

Query  192  ARLHTFVTWPK-----SMPQTKEQLADAGFFY---TGKGDQTLCYHCGGGLKDWEPEDDP  243
             R  TF  WP      ++P   +Q+A AGF++   +   D+ +C+ C   L  WE  D+P
Sbjct  250  VRRQTFEKWPHMDYKWALP---DQMAQAGFYHQPSSSGEDRAMCFTCSVCLVCWEKTDEP  306

Query  244  WEQHAKWFSKCCYL  257
            W +H +    C ++
Sbjct  307  WSEHERHSPLCPFV  320


>Q9VH01_DROME unnamed protein product
Length=4876

 Score = 61.2 bits (147),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 48/90 (53%), Gaps = 6/90 (7%)

Query  42   VDYHFEAARLQSFENWP---VTYIEPEKLAAAGFYYTGES---DKVKCFECQVEICKWVE  95
            V  H EA R Q+FE WP     +  P+++A AGFY+   S   D+  CF C V +  W +
Sbjct  243  VLMHSEAVRRQTFEKWPHMDYKWALPDQMAQAGFYHQPSSSGEDRAMCFTCSVCLVCWEK  302

Query  96   GDIPMVDHQRWSARCRFIRKLNCGNVPIGV  125
             D P  +H+R S  C F++     NVP+ +
Sbjct  303  TDEPWSEHERHSPLCPFVKGEYTQNVPLSI  332


 Score = 42.4 bits (98),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/74 (30%), Positives = 37/74 (50%), Gaps = 11/74 (15%)

Query  192  ARLHTFVTWPK-----SMPQTKEQLADAGFFY---TGKGDQTLCYHCGGGLKDWEPEDDP  243
             R  TF  WP      ++P   +Q+A AGF++   +   D+ +C+ C   L  WE  D+P
Sbjct  250  VRRQTFEKWPHMDYKWALP---DQMAQAGFYHQPSSSGEDRAMCFTCSVCLVCWEKTDEP  306

Query  244  WEQHAKWFSKCCYL  257
            W +H +    C ++
Sbjct  307  WSEHERHSPLCPFV  320



Lambda      K        H
   0.318    0.133    0.400 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5924962958


Query= XP_003393061.1 death-associated inhibitor of apoptosis 1 isoform X1
[Bombus terrestris]

Length=406
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DIAP1_DROME  unnamed protein product                                  236     2e-73
DIAP2_DROME  unnamed protein product                                  144     3e-38
Q9VEM2_DROME  unnamed protein product                                 57.4    7e-10
A0A0B4KGR9_DROME  unnamed protein product                             61.2    1e-09
Q9VH01_DROME  unnamed protein product                                 61.2    1e-09


>DIAP1_DROME unnamed protein product
Length=438

 Score = 236 bits (602),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 140/407 (34%), Positives = 203/407 (50%), Gaps = 53/407 (13%)

Query  43   DYHFEAARLQSFENWPVTYIEPEKLAAAGFYYTGESDKVKCFECQVEICKWVEGDIPMVD  102
            D + E  RL++F +WP+ +++  +LA  G Y+T   DKVKCF C VEI  W + D P+ +
Sbjct  40   DLNREETRLKTFTDWPLDWLDKRQLAQTGMYFTHAGDKVKCFFCGVEIGCWEQEDQPVPE  99

Query  103  HQRWSARCRFIRKLNCGNVPIGVDP-DTVTPPRPRSRDVCSP--YGLEYR---------P  150
            HQRWS  C  +R+    NVPI  +  D + PP   S D+C      LE R         P
Sbjct  100  HQRWSPNCPLLRRRTTNNVPINAEALDRILPPI--SYDICGANDSTLEMREHAYAEGVIP  157

Query  151  TS------GPDDHNFSM----------ELQLASTAKLGCLGLGRTK-------------G  181
             S      G +  N +            + +A+ A       G  +              
Sbjct  158  MSQLIQSIGMNAVNAAGSVTGTAAPQPRVTVATHASTATQATGDVQPETCRPSAASGNYF  217

Query  182  PVHPEYASYDARLHTFVTWPKSMPQTKEQLADAGFFYTGKGDQTLCYHCGGGLKDWEPED  241
            P +PEYA   ARL TF  WP+++ Q   QLA+AGFFYTG GD+  C+ CGGGL DW   D
Sbjct  218  PQYPEYAIETARLRTFEAWPRNLKQKPHQLAEAGFFYTGVGDRVRCFSCGGGLMDWNDND  277

Query  242  DPWEQHAKWFSKCCYLLMVQGQDYISKITGQHVSPPSKEETMQMNLPSFIKKVQPTSVEV  301
            +PWEQHA W S+C ++ +++GQ YI  +  + V    KEE+      S I  V   S + 
Sbjct  278  EPWEQHALWLSQCRFVKLMKGQLYIDTVAAKPVLAEEKEES------SSIGGVAVASTQA  331

Query  302  ERKEETESNPGSSSQNNDIW---GIASNTEPIKRSLESEPTENPSNIKTQNTKPTDDARM  358
              +E+  S     + + D+       + T    + +E+     PS   + +T   ++ ++
Sbjct  332  SEEEQQTSLSSEEAVSGDVAPSVAPTAATRIFNKIVEATAVATPSTNSSGSTSIPEE-KL  390

Query  359  CKICYNGELGVVFLPCGHMVACVKCAPGMTTCAVCREPVTMTVRAFI  405
            CKICY  E    FLPCGH+VAC KCA  +T C +CR+P T  +R + 
Sbjct  391  CKICYGAEYNTAFLPCGHVVACAKCASSVTKCPLCRKPFTDVMRVYF  437


 Score = 75.1 bits (183),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 53/95 (56%), Gaps = 8/95 (8%)

Query  30   VTPDTCHDEADNVDYH-------FEAARLQSFENWPVTYIE-PEKLAAAGFYYTGESDKV  81
            V P+TC   A + +Y         E ARL++FE WP    + P +LA AGF+YTG  D+V
Sbjct  202  VQPETCRPSAASGNYFPQYPEYAIETARLRTFEAWPRNLKQKPHQLAEAGFFYTGVGDRV  261

Query  82   KCFECQVEICKWVEGDIPMVDHQRWSARCRFIRKL  116
            +CF C   +  W + D P   H  W ++CRF++ +
Sbjct  262  RCFSCGGGLMDWNDNDEPWEQHALWLSQCRFVKLM  296


>DIAP2_DROME unnamed protein product
Length=498

 Score = 144 bits (363),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 85/254 (33%), Positives = 119/254 (47%), Gaps = 48/254 (19%)

Query  27   SVSVTPDTCHDEADNVDYHFEAARLQSFENWPVTYIEPEKLAAAGFYYTGESDKVKCFEC  86
            SV  +P++C       D   EA RL +F++WP   I P+ LA AGFYY    D VKC  C
Sbjct  97   SVVDSPESCSCP----DLLLEANRLVTFKDWPNPNITPQALAKAGFYYLNRLDHVKCVWC  152

Query  87   QVEICKWVEGDIPMVDHQRWSARCRFIRKLNCGNVPIGVDPDTVTPPRPRSRDVCSPYGL  146
               I KW + D    +H+R+  +C                        PR +        
Sbjct  153  NGVIAKWEKNDNAFEEHKRFFPQC------------------------PRVQ--------  180

Query  147  EYRPTSGPDDHNFSMELQLASTAKLGCLGLGRTKGPVHPEYASYDARLHTFVTWPKSMPQ  206
                  GP        ++ A+   L  LG+  T  P+ P+YA  DARL TF  WP S  Q
Sbjct  181  -----MGP-------LIEFATGKNLDELGIQPTTLPLRPKYACVDARLRTFTDWPISNIQ  228

Query  207  TKEQLADAGFFYTGKGDQTLCYHCGGGLKDWEPEDDPWEQHAKWFSKCCYLLMVQGQDYI  266
                LA AG +Y   GDQ  C+HC  GL+ W+ ED+PW +HAKW  KC ++L+ +G  Y+
Sbjct  229  PASALAQAGLYYQKIGDQVRCFHCNIGLRSWQKEDEPWFEHAKWSPKCQFVLLAKGPAYV  288

Query  267  SKITGQHVSPPSKE  280
            S++     +  S +
Sbjct  289  SEVLATTAANASSQ  302


 Score = 80.9 bits (198),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 64/235 (27%), Positives = 91/235 (39%), Gaps = 47/235 (20%)

Query  42   VDYHFEAARLQSFENWPVTY-IEPEKLAAAGFYYTGESDKVKCFECQVEICKWVEGDIPM  100
            +    E+ RL +F  WP+   +  E L A GF+ TG   + +C  C V I +W  GD   
Sbjct  4    LGMELESVRLATFGEWPLNAPVSAEDLVANGFFATGNWLEAECHFCHVRIDRWEYGDQVA  63

Query  101  VDHQRWSARCRFIRKLN-CGNVPIGVDPDTVTPPRPRSRDVCSPYGLEYRPTSGPDDHNF  159
              H+R S  C  +   N CGNVP   + D        S + CS                 
Sbjct  64   ERHRRSSPICSMVLAPNHCGNVPRSQESDNEGNSVVDSPESCS-----------------  106

Query  160  SMELQLASTAKLGCLGLGRTKGPVHPEYASYDARLHTFVTWPKSMPQTKEQLADAGFFYT  219
                                     P+      RL TF  WP     T + LA AGF+Y 
Sbjct  107  ------------------------CPDLLLEANRLVTFKDWPNPN-ITPQALAKAGFYYL  141

Query  220  GKGDQTLCYHCGGGLKDWEPEDDPWEQHAKWFSKCCYLLMVQGQDYISKITGQHV  274
             + D   C  C G +  WE  D+ +E+H ++F +C     VQ    I   TG+++
Sbjct  142  NRLDHVKCVWCNGVIAKWEKNDNAFEEHKRFFPQC---PRVQMGPLIEFATGKNL  193


 Score = 71.2 bits (173),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 56/99 (57%), Gaps = 2/99 (2%)

Query  307  TESNPGSSSQNNDIWGIASNTEPIKRSLESEPTENPSNIKTQNTKPTDDARMCKICYNGE  366
             +S P        +  I+  T+ I++   + P  N S ++ +N +   DAR+CK+C + E
Sbjct  401  ADSIPAKPQAAEAVANISKITDEIQKMSVATPNGNLS-LEEEN-RQLKDARLCKVCLDEE  458

Query  367  LGVVFLPCGHMVACVKCAPGMTTCAVCREPVTMTVRAFI  405
            +GVVFLPCGH+  C +CAP +  C +CR  +   VR F+
Sbjct  459  VGVVFLPCGHLATCNQCAPSVANCPMCRADIKGFVRTFL  497


>Q9VEM2_DROME unnamed protein product
Length=153

 Score = 57.4 bits (137),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 43/71 (61%), Gaps = 9/71 (13%)

Query  193  RLHTFVTWPKSMPQTKE----QLADAGFFYTG---KGDQTLCYHCGGGLKDWEPEDDPWE  245
            R+ ++ +WP   P+T      ++A+AGF++TG   + D   C+ CG  L  WEPEDDPW+
Sbjct  31   RVESYKSWP--FPETASCSISKMAEAGFYWTGTKRENDTATCFVCGKTLDGWEPEDDPWK  88

Query  246  QHAKWFSKCCY  256
            +H K   +C +
Sbjct  89   EHVKHAPQCEF  99


 Score = 43.9 bits (102),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 41/79 (52%), Gaps = 7/79 (9%)

Query  46   FEAARLQSFENWP---VTYIEPEKLAAAGFYYTG---ESDKVKCFECQVEICKWVEGDIP  99
             E  R++S+++WP          K+A AGFY+TG   E+D   CF C   +  W   D P
Sbjct  27   LEQHRVESYKSWPFPETASCSISKMAEAGFYWTGTKRENDTATCFVCGKTLDGWEPEDDP  86

Query  100  MVDHQRWSARCRFIRKLNC  118
              +H + + +C F  KL+C
Sbjct  87   WKEHVKHAPQCEFA-KLSC  104


>A0A0B4KGR9_DROME unnamed protein product
Length=4875

 Score = 61.2 bits (147),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 48/90 (53%), Gaps = 6/90 (7%)

Query  42   VDYHFEAARLQSFENWP---VTYIEPEKLAAAGFYYTGES---DKVKCFECQVEICKWVE  95
            V  H EA R Q+FE WP     +  P+++A AGFY+   S   D+  CF C V +  W +
Sbjct  243  VLMHSEAVRRQTFEKWPHMDYKWALPDQMAQAGFYHQPSSSGEDRAMCFTCSVCLVCWEK  302

Query  96   GDIPMVDHQRWSARCRFIRKLNCGNVPIGV  125
             D P  +H+R S  C F++     NVP+ +
Sbjct  303  TDEPWSEHERHSPLCPFVKGEYTQNVPLSI  332


 Score = 42.4 bits (98),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/74 (30%), Positives = 37/74 (50%), Gaps = 11/74 (15%)

Query  192  ARLHTFVTWPK-----SMPQTKEQLADAGFFY---TGKGDQTLCYHCGGGLKDWEPEDDP  243
             R  TF  WP      ++P   +Q+A AGF++   +   D+ +C+ C   L  WE  D+P
Sbjct  250  VRRQTFEKWPHMDYKWALP---DQMAQAGFYHQPSSSGEDRAMCFTCSVCLVCWEKTDEP  306

Query  244  WEQHAKWFSKCCYL  257
            W +H +    C ++
Sbjct  307  WSEHERHSPLCPFV  320


>Q9VH01_DROME unnamed protein product
Length=4876

 Score = 61.2 bits (147),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 48/90 (53%), Gaps = 6/90 (7%)

Query  42   VDYHFEAARLQSFENWP---VTYIEPEKLAAAGFYYTGES---DKVKCFECQVEICKWVE  95
            V  H EA R Q+FE WP     +  P+++A AGFY+   S   D+  CF C V +  W +
Sbjct  243  VLMHSEAVRRQTFEKWPHMDYKWALPDQMAQAGFYHQPSSSGEDRAMCFTCSVCLVCWEK  302

Query  96   GDIPMVDHQRWSARCRFIRKLNCGNVPIGV  125
             D P  +H+R S  C F++     NVP+ +
Sbjct  303  TDEPWSEHERHSPLCPFVKGEYTQNVPLSI  332


 Score = 42.4 bits (98),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/74 (30%), Positives = 37/74 (50%), Gaps = 11/74 (15%)

Query  192  ARLHTFVTWPK-----SMPQTKEQLADAGFFY---TGKGDQTLCYHCGGGLKDWEPEDDP  243
             R  TF  WP      ++P   +Q+A AGF++   +   D+ +C+ C   L  WE  D+P
Sbjct  250  VRRQTFEKWPHMDYKWALP---DQMAQAGFYHQPSSSGEDRAMCFTCSVCLVCWEKTDEP  306

Query  244  WEQHAKWFSKCCYL  257
            W +H +    C ++
Sbjct  307  WSEHERHSPLCPFV  320



Lambda      K        H
   0.318    0.133    0.400 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5924962958


Query= XP_003393062.1 uncharacterized protein LOC100647953 [Bombus
terrestris]

Length=1613
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

XMAS2_DROME  unnamed protein product                                  432     3e-127
Q8I3S3_PLAF7  unnamed protein product                                 32.3    5.1   
Q8MMR8_DICDI  unnamed protein product                                 31.2    9.9   


>XMAS2_DROME unnamed protein product
Length=1370

 Score = 432 bits (1111),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 239/614 (39%), Positives = 362/614 (59%), Gaps = 47/614 (8%)

Query  129  SITCTNVPQSLLTKATAKRYFIQFGSPVKICIRSRKQIITVIYTTKEEANIAYSKSGEYL  188
            ++ C N+P+  L K  A+ +F +FG+ V   +R R+   TV Y +++EA  A      + 
Sbjct  13   TLLCRNIPELFLDKYVARSHFGRFGTLVNFVLRPRRMTCTVSYASEDEAARALLDGASFQ  72

Query  189  GEKFNVEWTKLSLPAKSPTKKKDLQKNKIYNVSQIVSNFFKSSDDEIKSELDAMTNLEYN  248
            G  F++ +        +P +K +                 +  D +I++EL A+ +   N
Sbjct  73   GHLFDISYADNE---TAPAQKTE-----------------EWVDPDIQAELSALQSGWRN  112

Query  249  LHSRNNFDETLAKRHKILQSKSMSKSFTRLEKTSAKAEKLKVESQISDLLPNATIEELQN  308
             +      +            SM  +   +   +A   + +  +Q+ DL         +N
Sbjct  113  EYGSGKPIKKPQNGSSGSGGSSMLPAIP-VGPATAPVSRDRTPAQLRDL---------EN  162

Query  309  IIQQPAYTSEDKYKVLEARDRLIRMRQIKSHTLAAAKVMIGTCPDMCPEKERLMRESKRQ  368
            ++++PA+TSE+K+ VL+ARD+L+R+ + + H L+ A    G C DMCPEKER++RE +RQ
Sbjct  163  MMRRPAHTSEEKFSVLDARDKLLRLNRTQ-HKLSGATQ--GHCADMCPEKERVLREFQRQ  219

Query  369  VALYEQLQINEYRINHMVAVKQYSRSSADQEEPMAHELRPIKSLKMTMSYLLHEIVNLCD  428
            VA YE    ++  I H  A+KQYSRSSADQE P+ HELR   +L MTMSYL+HEI+++ +
Sbjct  220  VAYYELQPGSDELICHERALKQYSRSSADQETPLPHELRNETALHMTMSYLMHEIMDISE  279

Query  429  QQG--TNLGEWYHFLWDRTRGIRKDITQQELCCIDSVELVEQCARFHIVCSERLCAEQPS  486
            +Q   +++G+W+HF+WDRTR IRK+ITQQELC + +V+LVEQCARFHI C+ RL    PS
Sbjct  280  RQDPQSHMGDWFHFVWDRTRSIRKEITQQELCSLGAVKLVEQCARFHIHCAARLVDADPS  339

Query  487  VFDKKINSDNLTKCLQSLKYMYHDLRVKEITCKNEPEFRAYIILLNLNNGNFMWDLQRLP  546
            VFD KIN++NLTKCLQ+LKYMYHDLR+K + C  E EFR YI+LLNL + NF+WD+ +LP
Sbjct  340  VFDSKINAENLTKCLQTLKYMYHDLRIKGVPCPKEAEFRGYIVLLNLADANFLWDIGQLP  399

Query  547  NNIQKSSEVQFALDTYSALESNNYYKFFKLV--QETTYLNACILLRYFYQVRLKALSVLV  604
              +Q   EV+ A+  Y AL+  N+ +FF+L+  ++T+YL+ACIL+ YF ++R+  L  L+
Sbjct  400  AELQSCPEVRQAIQFYLALQDTNFVRFFQLLADKDTSYLSACILVNYFTRLRVLGLHRLI  459

Query  605  KAY---CRTASTAYPLYELIDILGFEDENEAIYFCEQVGLNVSEDGLHVLLNRHNFTMPV  661
            +AY    +   ++ PL  + ++L F  E EA  F +  GL ++E G  VL   H      
Sbjct  460  QAYRSPRKDEVSSLPLSYIAELLSFASEQEAADFVQHYGLQINEAGRVVLSRMHTVET--  517

Query  662  LHVKQKRACNLIDSKRTMQHLSIGESIAGGKMPER-AYKYHKPHNSFDSHGYLMPDSINA  720
               K  R   L++ KR     S+GE ++G  +P R  Y  H+PHNSFD +G L   +  A
Sbjct  518  -EYKLPRQYELVEVKRVK---SVGEVVSGEPLPPRDLYLNHRPHNSFDDYGMLKSIAWTA  573

Query  721  EDQNKSIVSSSTDP  734
            +DQ   +      P
Sbjct  574  KDQLAGMQQEEMQP  587


 Score = 40.4 bits (93),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 46/213 (22%), Positives = 96/213 (45%), Gaps = 26/213 (12%)

Query  1345  PKFIIDLHNEAVSHVIDIILDPESFMYTKFAPEFRKFVKNQYMMPCS-------YEHFDD  1397
             P+  +DL NEAV H + ++   +   + +F  E R FV+    +P          EHF+ 
Sbjct  1110  PQRCVDLFNEAV-HRLQLVAGEDLSDWPQFPEELRVFVQP---LPIESSLNTNRLEHFEP  1165

Query  1398  VWKSEEYKAKLERVMSSFKLPQWKYP-WPINNSIIFR--QYITNYCQEALFTSGSDEISD  1454
              W   E + ++ +++   KLP  K P  P ++S+     Q++ +Y Q +      ++I+ 
Sbjct  1166  GWHLPERRQRIVQLLERCKLP--KMPVLPRSSSLAEAQCQWVLDYAQISQQEDCVEQIAL  1223

Query  1455  NILSNLFLTTGISTVSNFIDVLLYIIKQKI-YLLAKDL----KVIYNKNDMKCFRTLPWW  1509
               +  L   T      ++++ + Y+  +++ Y+L ++      ++YN   +K      W+
Sbjct  1224  QAIKILQYDT-----DDYLNFVEYLAGERMQYILRQERNPPQGIVYNTKTLKRRFLSAWY  1278

Query  1510  LKSNLLTEYKIVPKNINVQETEKENKKTIDINE  1542
              +      Y+ VP   N Q  EK+     ++ +
Sbjct  1279  YEFREPQIYEPVPAEENAQMLEKQPSSQAEVQQ  1311


>Q8I3S3_PLAF7 unnamed protein product
Length=1894

 Score = 32.3 bits (72),  Expect = 5.1, Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 23/31 (74%), Gaps = 2/31 (6%)

Query  1338  LLHALEK--PKFIIDLHNEAVSHVIDIILDP  1366
             L   LEK  PK I +++NEA+ H+I++++DP
Sbjct  841   LQRILEKKNPKHIEEIYNEALDHIIELMVDP  871


>Q8MMR8_DICDI unnamed protein product
Length=637

 Score = 31.2 bits (69),  Expect = 9.9, Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 58/126 (46%), Gaps = 17/126 (13%)

Query  920   LMGKTIPNETSNFFVKRQVPQEEKTGKLKLEEQESIKRMQQINDIAKDILNTLETELVQA  979
             + GK  PNE +NFF++ +   +E++  LK      IK ++  +DI    + + E     +
Sbjct  161   MTGKITPNEIANFFIECKNHSDEQSPPLK----AFIKILE--DDIKSQAMASAERWKSGS  214

Query  980   HCSTI------VKEETDKIYIYNTFSEDISNEIFNEVTSE---ICDNLLQKE--IVNARK  1028
               S I      +K+E D+I  + T       ++F  V +E   +   L Q+   +V    
Sbjct  215   PLSLIDGVPISLKDEIDQIGYHTTCGTTFLEKVFPNVKTEDSGVAKMLRQQGAILVGKNN  274

Query  1029  LHEISV  1034
             +HEI +
Sbjct  275   MHEIGI  280



Lambda      K        H
   0.318    0.133    0.400 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5924962958


Query= XP_003393064.1 protein-serine O-palmitoleoyltransferase porcupine
isoform X1 [Bombus terrestris]

Length=461
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PORCN_DROME  unnamed protein product                                  178     5e-50
PORCN_CAEEL  unnamed protein product                                  127     6e-32
SNF12_DICDI  unnamed protein product                                  33.1    0.54 
Q9VG13_DROME  unnamed protein product                                 29.6    2.2  
P90735_CAEEL  unnamed protein product                                 30.4    3.6  


>PORCN_DROME unnamed protein product
Length=525

 Score = 178 bits (452),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 117/345 (34%), Positives = 181/345 (52%), Gaps = 37/345 (11%)

Query  148  WHKIRSVVMTMAMKTISIAIDRSDTNDL----PNIFAYMGYMFCSVTCLFGPWISFKDYI  203
            W ++R + M + MK IS+  D + +  L    P  FAY+GY++   TC  GPW+SF  Y+
Sbjct  185  WPQLRGIQMVVNMKLISLGFDLTASGQLQARIPGPFAYLGYIYSPATCALGPWVSFGCYM  244

Query  204  SIRYTTHQDKWWV--LYTIQYVFLSFLFLSISNCWAQWVIA--ETSWKWLLAYRDALSFR  259
                   ++ W V     +  V +  L +++SNC A  +      S  +L+ Y DALS R
Sbjct  245  DC--LVPRNSWLVSLRRLLPNVVICVLAVTVSNCVAPALSDFFGDSSHFLVMYWDALSVR  302

Query  260  MSHYFISYIASSLLLLGGFPYALST---------VVKPLKIELPHSLVHVVICWNIPMHF  310
             SHYF+  +A +LL+        +T         + +P +IE P S+  +V  WNIPMH 
Sbjct  303  SSHYFVGMMAQALLVASDQRLDGATKESDMLGPLISQPWRIEWPRSISSLVRSWNIPMHE  362

Query  311  WLKTYIFRP----SIKYLGKFGAVTM-TYLTSALLHGLNFQLAAVLLSLGFYTYVEFQFR  365
            WLK YI+ P    +    G+   V + TYL S+LLHG++ ++  VL+SL F    E   R
Sbjct  363  WLKRYIYAPCKPTASTSRGRILVVVLSTYLVSSLLHGMDLRIYLVLISLAFLAEGESLLR  422

Query  366  YMLANIFDACVASKQCT-KTKCTHAY-------NIHNSWWVLLINMMFSGLSIFHLAYLG  417
              LA++ +AC+ +  C  K +C +++       N  + W   L N+ F+ L+IFHLAYLG
Sbjct  423  RQLASLLNACITANLCPGKERCRYSHCPSKRRLNSLSYWLARLTNLAFTALAIFHLAYLG  482

Query  418  --LMFDTSELQETGYSYIHTIEKWSQLGFASHWVVFATYCIYFLI  460
              L+ D  E+ E G S++     W Q G+ SH++   T+ +Y  I
Sbjct  483  VVLLGDDLEVGEDGDSFLW---HWQQAGYLSHYIGLGTFVLYLFI  524


>PORCN_CAEEL unnamed protein product
Length=442

 Score = 127 bits (318),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 94/330 (28%), Positives = 160/330 (48%), Gaps = 26/330 (8%)

Query  137  TYCEFTMSSIVWHKIRSVVMT--MAMKTISIAIDRSDTNDLP--NIFAYMGYMFCSVTCL  192
             +C    S   +  IR ++M   M + T++  ++++++N        +Y+ Y++     +
Sbjct  115  NFCRHYRSEDYFLSIRGILMIHIMRLTTVAFNLEKANSNKFRFVQFSSYVEYIYFPPFII  174

Query  193  FGPWISFKDYISIRYTTHQDKWWVLYTIQYVFLSFLFLSISNCWAQWVIA-------ETS  245
            FGP++SF+ +  +R     DK W     +  F+    L+I N     +I+       E S
Sbjct  175  FGPYLSFEQFFKMR-----DKKWTGSENELGFIIQSLLAIFNAITLAIISSCHFEFFEPS  229

Query  246  WKWLLAYRDALSFRMSHYFISYIASSLLLLGGFPYALSTVVKPLKIELPHSLVHVVICWN  305
             +++     A+SFR SHYF+     + +L+ G   +   V  PL IE   S +  V  WN
Sbjct  230  SQFMEDALTAMSFRFSHYFVCLSTQAFVLMLG---SDVVVANPLNIEFSRSTLQTVSEWN  286

Query  306  IPMHFWLKTYIFRPSIKYLGKFGAVTMTYLTSALLHGLNFQLAAVLLSLGFYTYVEFQFR  365
             P H +L   IF+  + +      V  T+  S+LLHGL+FQ+   LL+LGF  Y E  FR
Sbjct  287  KPFHTFLHENIFKRRL-FNSTACNVFFTFAVSSLLHGLDFQMTITLLALGFIAYSETVFR  345

Query  366  YMLANIFDACVASKQC----TKTKCTHAYNIHNSWWVLLINMMFSGLSIFHLAYLGLMFD  421
              L+  +  CVA+K C        C H ++ + +   L+IN+ F  LS++HL + G+ F 
Sbjct  346  KRLSARYSMCVAAKACPVRSNSLSCKHRHS-NKTGRALIINLFFLMLSMYHLVFTGMTF-  403

Query  422  TSELQETGYSYIHTIEKWSQLGFASHWVVF  451
            T +    GY + H  + W    ++S  + F
Sbjct  404  TDDYSAIGYPFDHAWKIWGSHYYSSFMISF  433


>SNF12_DICDI unnamed protein product
Length=456

 Score = 33.1 bits (74),  Expect = 0.54, Method: Compositional matrix adjust.
 Identities = 27/94 (29%), Positives = 43/94 (46%), Gaps = 6/94 (6%)

Query  117  HIPKKYCKYMGIFLPSLFIITYCEFTMSSIVWHKIRSVVMTMAMKTISIAIDRSDTNDLP  176
            H+P+KY K +G     L I T  +  +   +WH I+S  + +  +T  I  D     +L 
Sbjct  234  HVPQKY-KVLGGLSQLLNIHTDTKPRIILALWHYIKSNTL-LDAETKKITCDE----NLK  287

Query  177  NIFAYMGYMFCSVTCLFGPWISFKDYISIRYTTH  210
            NIF+     F  +  L    +S  D +  +YT H
Sbjct  288  NIFSLEELQFNQIPQLLREHLSPPDPLEFQYTLH  321


>Q9VG13_DROME unnamed protein product
Length=124

 Score = 29.6 bits (65),  Expect = 2.2, Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 28/53 (53%), Gaps = 1/53 (2%)

Query  1   MDDVEVPIFYDDEVDFVEHEYLQDVEYEYEYENVERETLFELYQYCLRPTIYD  53
           +DD E     DDE DF E+ ++++ E E++   ++R    E+ Q C    I D
Sbjct  18  VDDDESLSDIDDEPDFSEYMWMEN-EEEFDKNELQRLEEEEIMQECFEAMIED  69


>P90735_CAEEL unnamed protein product
Length=996

 Score = 30.4 bits (67),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 22/76 (29%), Positives = 39/76 (51%), Gaps = 8/76 (11%)

Query  93   NIYHYVAECLYTLLILC----TISYITLHIPKKYCKYMGIFLPSLFIIT----YCEFTMS  144
            N++   A  L+   ILC    ++ Y T+  P K   Y+GI L ++ +IT    Y + + S
Sbjct  73   NLFGGFAMLLWVGAILCYIAYSVDYFTMEYPSKDNLYLGIVLMTVVVITGVFQYYQESKS  132

Query  145  SIVWHKIRSVVMTMAM  160
            S +    +++V T A+
Sbjct  133  SKIMDSFKNMVPTFAL  148



Lambda      K        H
   0.318    0.133    0.400 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5924962958


Query= XP_003393067.3 F-box only protein 44 [Bombus terrestris]

Length=286
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q17962_CAEEL  unnamed protein product                                 76.6    1e-15
A8DYA6_DROME  unnamed protein product                                 39.7    0.002
A1Z8M8_DROME  unnamed protein product                                 39.3    0.003
A0A0B4KEK4_DROME  unnamed protein product                             39.3    0.003
Q5BI22_DROME  unnamed protein product                                 39.3    0.003


>Q17962_CAEEL unnamed protein product
Length=384

 Score = 76.6 bits (187),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 74/311 (24%), Positives = 123/311 (40%), Gaps = 59/311 (19%)

Query  18   KSDNGLVLGGKYLPEELLAEIFCYVDYKSLLNCQLVCKLWKILIQT-YVWRKKAEISFGR  76
            K+D  +++  + +P E  + IF  +D KSLLNCQL C  +  LI +   W     I + R
Sbjct  15   KTDVPVIIDAETVPNECFSPIFRRLDKKSLLNCQLACHRFNDLISSDSFW-----IEYAR  69

Query  77   SLLLYKEVPWHVYYLMCKKKPFERNLVKNHSGECGRHKY----WKIISEGGDCWKV----  128
             L +   +P     L  ++   ++  V N   E     +     KI+  G     +    
Sbjct  70   ILNISNVLP----SLEWRRAATQKKFVGNEDNEIDTSSFNFNIKKIVLSGRGYSPITPLF  125

Query  129  --------ENPPVGVTPLPNNELIFEGKQF------------------CFVTSYRSCTKA  162
                    +N   G     +  +   G                     CFV S+   + +
Sbjct  126  ISHFENARDNTISGTLRSDDFSIRANGSGIHMERDGGNGCEPHPDVSKCFVFSFTESSIS  185

Query  163  QIIDLEVEGLTPYMLDELQPIIVVSEWYSCRWDCPALYECVIKL----------LGENNS  212
              IDL   G+ P++LD ++P I +++  + R DC A      +L           G   +
Sbjct  186  VFIDLVNSGIDPWILDHVRPRIRITQKVNHRNDCAARLSFAAQLNYHETQWIERFGHVQT  245

Query  213  VIDLFHFR-DSIEGE----KQNQWHQMSHEFKNYGPGLRKISFYHGGADKLFWAGHYGSK  267
            + +  H R  S+  E        W   + EF +Y  G+R ++  + G D+ FW G YG K
Sbjct  246  MSNTDHKRYKSVNKEWAQWTGQPWEDWTIEFDDYPSGIRHLTILNEGEDRQFWRGFYGPK  305

Query  268  MAGACVYVKIP  278
            +A   V V +P
Sbjct  306  VANIQVEVILP  316


>A8DYA6_DROME unnamed protein product
Length=651

 Score = 39.7 bits (91),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 28/52 (54%), Gaps = 1/52 (2%)

Query  28   KYLPEELLAEIFCYVDYKSLLNCQLVCKLWKIL-IQTYVWRKKAEISFGRSL  78
            K LP+E+L  +F Y+D  SL  C  VCK W +L +    W+K     F R +
Sbjct  241  KQLPKEVLLRVFSYLDVVSLCRCAQVCKYWNVLALDGSSWQKINLFDFQRDI  292


>A1Z8M8_DROME unnamed protein product
Length=464

 Score = 39.3 bits (90),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 28/52 (54%), Gaps = 1/52 (2%)

Query  28   KYLPEELLAEIFCYVDYKSLLNCQLVCKLWKIL-IQTYVWRKKAEISFGRSL  78
            K LP+E+L  +F Y+D  SL  C  VCK W +L +    W+K     F R +
Sbjct  54   KQLPKEVLLRVFSYLDVVSLCRCAQVCKYWNVLALDGSSWQKINLFDFQRDI  105


>A0A0B4KEK4_DROME unnamed protein product
Length=455

 Score = 39.3 bits (90),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 28/52 (54%), Gaps = 1/52 (2%)

Query  28  KYLPEELLAEIFCYVDYKSLLNCQLVCKLWKIL-IQTYVWRKKAEISFGRSL  78
           K LP+E+L  +F Y+D  SL  C  VCK W +L +    W+K     F R +
Sbjct  27  KQLPKEVLLRVFSYLDVVSLCRCAQVCKYWNVLALDGSSWQKINLFDFQRDI  78


>Q5BI22_DROME unnamed protein product
Length=437

 Score = 39.3 bits (90),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 28/52 (54%), Gaps = 1/52 (2%)

Query  28  KYLPEELLAEIFCYVDYKSLLNCQLVCKLWKIL-IQTYVWRKKAEISFGRSL  78
           K LP+E+L  +F Y+D  SL  C  VCK W +L +    W+K     F R +
Sbjct  27  KQLPKEVLLRVFSYLDVVSLCRCAQVCKYWNVLALDGSSWQKINLFDFQRDI  78



Lambda      K        H
   0.318    0.133    0.400 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5924962958


Query= XP_003393068.1 protein disulfide-isomerase A3 [Bombus terrestris]

Length=490
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q3YMU0_DROME  unnamed protein product                                 618     0.0   
G5ED07_CAEEL  unnamed protein product                                 470     6e-163
Q95T75_DROME  unnamed protein product                                 451     4e-157
PDIA4_CAEEL  unnamed protein product                                  315     6e-101
PDI2_DICDI  unnamed protein product                                   233     2e-70 


>Q3YMU0_DROME unnamed protein product
Length=489

 Score = 618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/493 (61%), Positives = 380/493 (77%), Gaps = 7/493 (1%)

Query  1    MLLKYFTFLSLIFVNVLA-EEKDVVELTDDTFSHELERLENTLVMFYAPWCGHCKRLKPE  59
            M+ +    L L F+ + +  E+DV+EL DD F+  L++ E TLVMFYAPWCGHCKRLKPE
Sbjct  1    MMWRLAGVLLLGFIAISSGAEQDVLELGDDDFATTLKQHETTLVMFYAPWCGHCKRLKPE  60

Query  60   YAKAAEMLLGNDPPITLAKVDCTESGKDSCNKYSVSGYPTLKIFSRGDFVSDYNGPREAA  119
            YAKAAE++  +DPPI LAKVDCTE+GK++C+KYSVSGYPTLKIF + +   DYNGPREA+
Sbjct  61   YAKAAEIVKDDDPPIKLAKVDCTEAGKETCSKYSVSGYPTLKIFRQDEVSQDYNGPREAS  120

Query  120  GIAKYMKAQVGPASKELSGEACLKSFLDSDEVSVVGFFEKEDSALATSFHAVSKKLKEKV  179
            GIAKYM+AQVGPASK +   A LK FLD+ + ++ G+F   DS LA  F   + K +EK 
Sbjct  121  GIAKYMRAQVGPASKTVRTVAELKKFLDTKDTTLFGYFSDSDSKLAKIFLKFADKNREKY  180

Query  180  RFAHTTAKSLLEKEGHKNAIVLYRPKILQNKFESNTVEYV-ESMGDIQEFINKNYFGIAG  238
            RF H++ K +L+K+G  + IVL R   L NKFES+++++   S  D+  F+ +N+ G+ G
Sbjct  181  RFGHSSEKEVLDKQGETDKIVLIRAPHLSNKFESSSIKFEGSSESDLSTFVKENFHGLVG  240

Query  239  VRTRDNEREFKNPLVVAYYAVDYVKNPKGTNYWRNRIIKVAKDF-PKLNFAISSKDDFQH  297
             RT+D+ ++F+NPL+ AYY+VDY KNPKGTNYWRNR++KVAK+F  ++NFAI+SKDDFQH
Sbjct  241  HRTQDSVKDFQNPLITAYYSVDYQKNPKGTNYWRNRVLKVAKEFVGQINFAIASKDDFQH  300

Query  298  ELNDFGIDFVKGDKPVVLARNANNQKFVMKDEFSVDTFEAFLKDIEAGTLEPYLKSEPIP  357
            ELN++G DFV GDKPVVLAR+  N K+ +KDEFSV+  + F++ + A  LEPY+KSEPIP
Sbjct  301  ELNEYGYDFV-GDKPVVLARDEKNLKYALKDEFSVENLQDFVEKLLANELEPYIKSEPIP  359

Query  358  EDNTGDVKIGVARNFDEIVTNNNKDTLIEFYAPWCGHCKKLAPIYDELGEKLATEDVEIV  417
            E N   VK+ VA+NFD++V NN KDTLIEFYAPWCGHCKKL+PIY+EL EKL  EDV IV
Sbjct  360  ESNDAPVKVAVAKNFDDLVINNGKDTLIEFYAPWCGHCKKLSPIYEELAEKLQDEDVAIV  419

Query  418  KFDATANDVPAPYEVRGFPTLYWAPKNSKNNPVKYEGGRELDDFIKYIAKHATNELKGFD  477
            K DATANDVP  + VRGFPTL+W PK++KN PV Y GGRE+DDF+KYIAK AT ELKGFD
Sbjct  420  KMDATANDVPPEFNVRGFPTLFWLPKDAKNKPVSYNGGREVDDFLKYIAKEATTELKGFD  479

Query  478  RKGKTVKPKSDEL  490
            R G   KPK  EL
Sbjct  480  RSG---KPKKTEL  489


>G5ED07_CAEEL unnamed protein product
Length=488

 Score = 470 bits (1209),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 239/473 (51%), Positives = 323/473 (68%), Gaps = 11/473 (2%)

Query  23   VVELTDDTFSHELERLENTLVMFYAPWCGHCKRLKPEYAKAAEMLLGNDPPITLAKVDCT  82
            V+E TD  F   ++  +  LV FYAPWCGHCK++ PEY +AA  L  NDPP+ L KVDCT
Sbjct  22   VLEYTDGNFDDLIQTHDIALVKFYAPWCGHCKKIAPEYERAAPKLASNDPPVALVKVDCT  81

Query  83   ESGKDSCNKYSVSGYPTLKIFSRGDFVSDYNGPREAAGIAKYMKAQVGPASKELSGEACL  142
             + K  C+K+ V G+PTLKIF  G    DY+GPR+A GI K+M+ Q GP+SKEL   A  
Sbjct  82   -TEKTVCDKFGVKGFPTLKIFRNGVPAQDYDGPRDADGIVKFMRGQSGPSSKELKTVAEF  140

Query  143  KSFLDSDEVSVVGFFEKEDSALATSFHAVSKKLKEKVRFAHTTAKSLLEKEGHKNAIVLY  202
            + F   DE  V+GFFE E S L  S+  V+   +++  FAHT+ K +++K G+ + +V++
Sbjct  141  EKFTGGDENVVIGFFESE-SKLKDSYLKVADTERDRFSFAHTSNKDIIKKAGYSDDVVVF  199

Query  203  RPKILQNKFESNTVEYVES--MGDIQEFINKNYFGIAGVRTRDNEREF-KNPLVVAYYAV  259
             PK L NKF++N  +Y  +     I+ F+     G AG+RT+ N  +F + P+V+ YY V
Sbjct  200  VPKKLHNKFDTNEFKYDGNYDTDKIKNFLVHETVGFAGIRTQGNLFQFEQKPIVIVYYNV  259

Query  260  DYVKNPKGTNYWRNRIIKVAKDFP-KLNFAISSKDDFQHELNDFGIDFVK-GDKPVVLAR  317
            DYVK+PKG+NYWRNR++KVA+++  K+ FA+S+K++F  E+   G+   K  DKP+V A 
Sbjct  260  DYVKDPKGSNYWRNRVLKVAQNYKRKVQFAVSNKEEFSSEIETNGLGERKDSDKPIV-AI  318

Query  318  NANNQKFVMKDEFSVDTFEAFLKDIEAGTLEPYLKSEPIPEDNTGDVKIGVARNFDEIVT  377
              N  K+ M  EFSVD  + F+ ++ AG  EPY+KSEPIP D  GDVK+ V +NF E++ 
Sbjct  319  LTNEGKYPMDQEFSVDNLQQFVDEVLAGNAEPYMKSEPIP-DEQGDVKVAVGKNFKELIM  377

Query  378  NNNKDTLIEFYAPWCGHCKKLAPIYDELGEKLATEDVEIVKFDATANDVPAPYEVRGFPT  437
            + +KD LIEFYAPWCGHCK LAP Y+EL EKL  EDV I K DATANDVP  +EVRGFPT
Sbjct  378  DADKDVLIEFYAPWCGHCKSLAPKYEELAEKLNKEDVIIAKMDATANDVPPMFEVRGFPT  437

Query  438  LYWAPKNSKNNPVKYEGGRELDDFIKYIAKHATNELKGFDRKGKTVKPKSDEL  490
            L+W PKN+K+NP+ Y GGRE+ DF+ +I+KH+T+ LKGF R GK  K K  EL
Sbjct  438  LFWLPKNAKSNPIPYNGGREVKDFVSFISKHSTDGLKGFSRDGK--KKKKTEL  488


>Q95T75_DROME unnamed protein product
Length=364

 Score = 451 bits (1159),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 219/368 (60%), Positives = 280/368 (76%), Gaps = 6/368 (2%)

Query  125  MKAQVGPASKELSGEACLKSFLDSDEVSVVGFFEKEDSALATSFHAVSKKLKEKVRFAHT  184
            M+AQVGPASK +   A LK FLD+ + ++ G+F   DS LA  F   + K +EK RF H+
Sbjct  1    MRAQVGPASKTVRTVAELKKFLDTKDTTLFGYFSDSDSKLAKIFLKFADKNREKYRFGHS  60

Query  185  TAKSLLEKEGHKNAIVLYRPKILQNKFESNTVEYV-ESMGDIQEFINKNYFGIAGVRTRD  243
            + K +L+K+G  + IVL R   L NKFES+++++   S  D+  F+ +N+ G+ G RT+D
Sbjct  61   SEKEVLDKQGETDKIVLIRAPHLSNKFESSSIKFEGSSESDLSTFVKENFHGLVGHRTQD  120

Query  244  NEREFKNPLVVAYYAVDYVKNPKGTNYWRNRIIKVAKDF-PKLNFAISSKDDFQHELNDF  302
            + ++F+NPL+ AYY+VDY KNPKGTNYWRNR++KVAK+F  ++NFAI+SKDDFQHELN++
Sbjct  121  SVKDFQNPLITAYYSVDYQKNPKGTNYWRNRVLKVAKEFVGQINFAIASKDDFQHELNEY  180

Query  303  GIDFVKGDKPVVLARNANNQKFVMKDEFSVDTFEAFLKDIEAGTLEPYLKSEPIPEDNTG  362
            G DFV GDKPVVLAR+  N K+ +KDEFSV+  + F++ + A  LEPY+KSEPIPE N  
Sbjct  181  GYDFV-GDKPVVLARDEKNLKYALKDEFSVENLQDFVEKLLANELEPYIKSEPIPESNDA  239

Query  363  DVKIGVARNFDEIVTNNNKDTLIEFYAPWCGHCKKLAPIYDELGEKLATEDVEIVKFDAT  422
             VK+ VA+NFD++V NN KDTLIEFYAPWCGHCKKL+PIY+EL EKL  EDV IVK DAT
Sbjct  240  PVKVAVAKNFDDLVINNGKDTLIEFYAPWCGHCKKLSPIYEELAEKLQDEDVAIVKMDAT  299

Query  423  ANDVPAPYEVRGFPTLYWAPKNSKNNPVKYEGGRELDDFIKYIAKHATNELKGFDRKGKT  482
            ANDVP  + VRGFPTL+W PK++KN PV Y GGRE+DDF+KYIAK AT ELKGFDR G  
Sbjct  300  ANDVPPEFNVRGFPTLFWLPKDAKNKPVSYNGGREVDDFLKYIAKEATTELKGFDRSG--  357

Query  483  VKPKSDEL  490
             KPK  EL
Sbjct  358  -KPKKTEL  364


 Score = 67.0 bits (162),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 58/103 (56%), Gaps = 11/103 (11%)

Query  39   ENTLVMFYAPWCGHCKRLKPEYAKAAEMLLGNDPPITLAKVDCTESGKDSCNKYSVSGYP  98
            ++TL+ FYAPWCGHCK+L P Y + AE L   D  + + K+D T    D   +++V G+P
Sbjct  258  KDTLIEFYAPWCGHCKKLSPIYEELAEKL--QDEDVAIVKMDAT--ANDVPPEFNVRGFP  313

Query  99   TLKIF---SRGDFVSDYNGPREAAGIAKYMKAQVGPASKELSG  138
            TL      ++   VS YNG RE     KY+  +   A+ EL G
Sbjct  314  TLFWLPKDAKNKPVS-YNGGREVDDFLKYIAKE---ATTELKG  352


>PDIA4_CAEEL unnamed protein product
Length=618

 Score = 315 bits (808),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 189/478 (40%), Positives = 278/478 (58%), Gaps = 28/478 (6%)

Query  21   KDVVELTDDTFSHELERLENTLVMFYAPWCGHCKRLKPEYAKAAEMLLGNDPPITLAKVD  80
            ++VV LT + F   +   E  LV FYAPWCGHCK+L PEY KAA+ L      + L KVD
Sbjct  147  EEVVTLTTENFDDFISNNELVLVEFYAPWCGHCKKLAPEYEKAAQKLKAQGSKVKLGKVD  206

Query  81   CTESGKDSCNKYSVSGYPTLKIFSRGDFVSDYNGPREAAGIAKYMKAQVGPASKELSGEA  140
             T   KD   KY VSGYPT+KI   G    DYNGPREAAGI KYM  Q  PA+K+L    
Sbjct  207  ATIE-KDLGTKYGVSGYPTMKIIRNGRRF-DYNGPREAAGIIKYMTDQSKPAAKKLPKLK  264

Query  141  CLKSFLDSDEVSVVGFFEKEDSALATSFHAVSKKLKEKVR-FAHTTAKSLLEK-EGHKNA  198
             ++ F+  D+V+++GFF  EDS    +F   ++ L+E+ +   HT+  +  +K +   N 
Sbjct  265  DVERFMSKDDVTIIGFFATEDSTAFEAFSDSAEMLREEFKTMGHTSDPAAFKKWDAKPND  324

Query  199  IVLYRPKILQNKFESNTVEYVESMG---DIQEFINKNYFGIAGVRTRDNE--REFKNPLV  253
            I+++ P +  +KFE  +  Y ++     D+  F  ++   + G  T+ N   R  K PLV
Sbjct  325  IIIFYPSLFHSKFEPKSRTYNKAAATSEDLLAFFREHSAPLVGKMTKKNAATRYTKKPLV  384

Query  254  VAYYAVDY-VKNPKGTNYWRNRIIKVAKDFPK--LNFAISSKDDFQHELNDFGIDFVKGD  310
            V YY  D+ V+  +G+ YWR++++ +A+ + K    FA++ +++F  EL + G+    GD
Sbjct  385  VVYYNADFSVQYREGSEYWRSKVLNIAQKYQKDKYKFAVADEEEFAKELEELGL----GD  440

Query  311  KPV---VLARNANNQKFVMK-DEFSVD---TFEAFLKDIEAGTLEPYLKSEPIPEDNTGD  363
              +   V+    + +K+ M  DEF  +     EAF+K I +G  + ++KS P P+D+ G 
Sbjct  441  SGLEHNVVVFGYDGKKYPMNPDEFDGELDENLEAFMKQISSGKAKAHVKSAPAPKDDKGP  500

Query  364  VKIGVARNFDEIVTNNNKDTLIEFYAPWCGHCKKLAPIYDELGEKL--ATEDVEIVKFDA  421
            VK  V  NFD+IV + +KD LIEFYAPWCGHCK     Y EL + L     +V + K DA
Sbjct  501  VKTVVGSNFDKIVNDESKDVLIEFYAPWCGHCKSFESKYVELAQALKKTQPNVVLAKMDA  560

Query  422  TANDVPAPYEVRGFPTLYWAPKNSKNNPVKYEGGRELDDFIKYIAKHATNELKGFDRK  479
            T ND P+ + V GFPT+Y+AP   K+ P+KY G R+L+D  K++ KH    +K F +K
Sbjct  561  TINDAPSQFAVEGFPTIYFAPAGKKSEPIKYSGNRDLEDLKKFMTKHG---VKSFQKK  615


 Score = 96.3 bits (238),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 77/236 (33%), Positives = 117/236 (50%), Gaps = 41/236 (17%)

Query  4    KYFTFLSLIFVNVLAEEKD-------------VVELTDDTFSHELERLENTLVMFYAPWC  50
            ++F  + L+ V+ +   +D             VV LTD  F   L++  + LV FYAPWC
Sbjct  6    RFFALVVLLCVSAVRSTEDASDDELNYEMDEGVVVLTDKNFDAFLKKNPSVLVKFYAPWC  65

Query  51   GHCKRLKPEYAKAAEMLLGNDPPITLAKVDC---TESGKDSCNKYSVSGYPTLKIFSRGD  107
            GHCK L PEY KA+  +      I LAKVD    TE GK    ++ + GYPTLK +  G 
Sbjct  66   GHCKHLAPEYEKASSKV-----SIPLAKVDATVETELGK----RFEIQGYPTLKFWKDGK  116

Query  108  FVSDYNGPREAAGIAKYMKAQVGPASKELSGEAC------LKSFLDSDEVSVVGFFEK--  159
              +DY+G R+ AGI ++++++V P  K    E           F+ ++E+ +V F+    
Sbjct  117  GPNDYDGGRDEAGIVEWVESRVDPNYKPPPEEVVTLTTENFDDFISNNELVLVEFYAPWC  176

Query  160  -EDSALATSFHAVSKKLK---EKVRFAHTTAKSLLEKE-GHKNAIVLYRP-KILQN  209
                 LA  +   ++KLK    KV+     A   +EK+ G K  +  Y   KI++N
Sbjct  177  GHCKKLAPEYEKAAQKLKAQGSKVKLGKVDA--TIEKDLGTKYGVSGYPTMKIIRN  230


 Score = 70.1 bits (170),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 61/98 (62%), Gaps = 9/98 (9%)

Query  370  RNFDEIVTNNNKDTLIEFYAPWCGHCKKLAPIYDELGEKLATEDVEIVKFDATA-NDVPA  428
            +NFD  +   N   L++FYAPWCGHCK LAP Y++   K++   + + K DAT   ++  
Sbjct  44   KNFDAFL-KKNPSVLVKFYAPWCGHCKHLAPEYEKASSKVS---IPLAKVDATVETELGK  99

Query  429  PYEVRGFPTL-YWAPKNSKNNPVKYEGGRELDDFIKYI  465
             +E++G+PTL +W  K+ K  P  Y+GGR+    ++++
Sbjct  100  RFEIQGYPTLKFW--KDGK-GPNDYDGGRDEAGIVEWV  134


>PDI2_DICDI unnamed protein product
Length=513

 Score = 233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 154/456 (34%), Positives = 229/456 (50%), Gaps = 18/456 (4%)

Query  26   LTDDTFSHELERLENTLVMFYAPWCGHCKRLKPEYAKAAEMLLGNDPPITLAKVDCTESG  85
            L  D F + +   + TLVMFYAPWCGHCK LKP Y +AA+ L  N   I +AKVDCT+  
Sbjct  46   LDSDNFHNSVSEHDVTLVMFYAPWCGHCKTLKPLYEEAAKQLSAN-KKIAIAKVDCTQH-  103

Query  86   KDSCNKYSVSGYPTLKIFSRGDFVSDYNGPREAAGIAKYMKAQVGPASKELSGEACLKSF  145
            +  C +  V GYPTL +F  G     Y G R    I + ++ ++ P    L     ++ F
Sbjct  104  EQLCKQNKVQGYPTLVVFKNGK-AEPYEGDRTTKSIVQTLEEELKPTISTLESNEDIEEF  162

Query  146  LDSDEVSVVGFFEKEDSALATSFHAVSKKLKEKVRFAHTTAKSLLEKEGHKNA-IVLYRP  204
                 +SVVGFF+ +       F  ++   K+  +FA    K   ++       +VL+R 
Sbjct  163  KKQHPISVVGFFDNDHDDRFKLFSELAGNNKKSAKFAVVIDKDFSKEHVESTPNVVLFR-  221

Query  205  KILQNKFESNTVEYVESMGD--IQEFINKNYFGIAGVRTRDNEREFKNPLV-VAYYAVDY  261
                  F+  TV +        + +FI  N   + G   R+  +++++  V +AY  +D 
Sbjct  222  -----SFDEPTVAHKGEFDSESLIKFIKGNSVPLLGEINRNTYKKYESIAVPLAYLFIDS  276

Query  262  VKNPKGTNYWRNRIIKVAKDFPKLNFAISSKDDFQHELNDFGIDF-VKGDKPVVLARNAN  320
             ++         +I    K      F       F  +    G+   V     V    N  
Sbjct  277  TQDNTQVLEDVKKIATSQKG--NAVFCWVDMKKFPQQATHMGLSGKVVPAISVDSVANKA  334

Query  321  NQKFVMKDEFSVDTFEAFLKDIEAGTLEPYLKSEPIPEDNTGDVKIGVARNFDEIVTNNN  380
               F  K+ FS DT   +++D+  G + P++KS+P PE N   VK+ V   F ++V ++ 
Sbjct  335  RYNFDEKETFSFDTVSKWIQDVIGGKVSPFVKSQPEPESNDAPVKVAVGTTFKKLVLDSP  394

Query  381  KDTLIEFYAPWCGHCKKLAPIYDELGEKLA-TEDVEIVKFDATANDVPAPYEVRGFPTLY  439
            KD L+EFYAPWCGHCK LAPIYD+LGE L   E V IVK DA +NDVP+  E+RG+PT+ 
Sbjct  395  KDVLVEFYAPWCGHCKNLAPIYDKLGEYLKDVESVSIVKIDADSNDVPSDIEIRGYPTIM  454

Query  440  WAPKNSKNNPVKYEGGR-ELDDFIKYIAKHATNELK  474
                + K NP+ YEG R +  +F+++I  +A  E K
Sbjct  455  LFKADDKENPISYEGQRNDHMNFVEFIQDNAAIEFK  490



Lambda      K        H
   0.318    0.133    0.400 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5924962958


Query= XP_003393069.2 5-aminolevulinate synthase, erythroid-specific,
mitochondrial [Bombus terrestris]

Length=532
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8T4G6_DROME  unnamed protein product                                 642     0.0  
O18680_DROME  unnamed protein product                                 642     0.0  
Q8I4X1_PLAF7  unnamed protein product                                 286     4e-89
Q57YK7_TRYB2  unnamed protein product                                 184     1e-52
Q8ILT9_PLAF7  unnamed protein product                                 144     9e-37


>Q8T4G6_DROME unnamed protein product
Length=539

 Score = 642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/505 (63%), Positives = 380/505 (75%), Gaps = 21/505 (4%)

Query  26   MPCPFLTHLSANYIRNYGASVIMNYRQLCPVMSQ----------FFSTQVNNTESEQIEK  75
            M CPFL   +A++IRNY  ++  +Y   CPV+ +            +  V  + S     
Sbjct  1    MQCPFLNRFTASFIRNYAETLCQSYGSHCPVVGKTLVSGEKKLLLVAASVTRSHSTGANA  60

Query  76   AINSQCPFLAKEQNAVKVASPMVEEDIINVSPLESKEKGSFPYEEFFHEQIMKKKKDHSY  135
              N+  P  A   NA    S     D     P ++  K +FPYE FF+EQIMKKK+DHSY
Sbjct  61   HANAGGPATA---NATAPVSAPASAD-----PGKASAKETFPYERFFNEQIMKKKRDHSY  112

Query  136  RVFKKVNRLAES--FPIGIEYS-WGEKPITVWCSNDYLGMSRHPAVTNSVREALNKFGAG  192
            RVFKKVNRLA    FP  +EYS   EKPITVWCSNDYLGMS HP V  +V++ALN+ G+G
Sbjct  113  RVFKKVNRLAGDGLFPHALEYSERTEKPITVWCSNDYLGMSAHPGVKRAVQDALNRHGSG  172

Query  193  AGGTRNISGNSVGHEILEKRLASLHQKEAGLLFTSCFVANDSTLYTLAKLLPHCHIFSDA  252
            AGGTRNISGNS+ HE LE +LA LHQKEA LLFTSCFVANDSTL+TLAKLLP C IFSDA
Sbjct  173  AGGTRNISGNSLHHERLESKLAELHQKEAALLFTSCFVANDSTLFTLAKLLPGCEIFSDA  232

Query  253  GNHASMIQGIRNSGVPKHIFRHNDVKHLEELLSKVDKTVPKIVAFETVHSMTGDICPLED  312
            GNHASMI GIRNSGVPKHIFRHNDV HL +LL + DK+VPKIVAFETVHSMTG ICPLE+
Sbjct  233  GNHASMIMGIRNSGVPKHIFRHNDVDHLHQLLKQTDKSVPKIVAFETVHSMTGAICPLEE  292

Query  313  LCDIAHKYNALTFVDEVHAVGLYGYSGAGIGERDRVLHKMDIISGTLGKAFGNMGGYIVG  372
            L D+AH++ A+TF+DEVHAVGLYG  GAG+GERD VLHKMDIISGTLGKAFGN+GGYI G
Sbjct  293  LLDVAHEHGAITFIDEVHAVGLYGDHGAGVGERDGVLHKMDIISGTLGKAFGNIGGYIAG  352

Query  373  STKLIDMIRSYAAGFIFTTSLPPTVLYGTLTAVEILTSDEGRSLRASHQKNVAYMKSILT  432
            +  L+DMIRSYAAGFIFTTSLPPTVL G L AV IL S+EGR LR  HQ+NV+Y+KS+L 
Sbjct  353  THNLVDMIRSYAAGFIFTTSLPPTVLCGALEAVNILASEEGRQLRHLHQRNVSYLKSLLK  412

Query  433  AAGLPLEQSPSHIIPIKIGDPLLCSQLADLLIKDKGHYVQAINYPTVPKGEEKLRLAPTP  492
              G P+E++PSHIIPIKIGDPL  SQ++++LI+  GHY+Q+INYPTV +G+EKLRLAPTP
Sbjct  413  REGFPVEETPSHIIPIKIGDPLKSSQISNVLIEQFGHYLQSINYPTVARGQEKLRLAPTP  472

Query  493  KHTLSMMDQFVKDILHVFHRLNIPT  517
             HT  MM+  V D+  V+  +++ T
Sbjct  473  FHTFEMMNALVTDLKKVWEMVDLST  497


>O18680_DROME unnamed protein product
Length=539

 Score = 642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/505 (63%), Positives = 380/505 (75%), Gaps = 21/505 (4%)

Query  26   MPCPFLTHLSANYIRNYGASVIMNYRQLCPVMSQ----------FFSTQVNNTESEQIEK  75
            M CPFL   +A++IRNY  ++  +Y   CPV+ +            +  V  + S     
Sbjct  1    MQCPFLNRFTASFIRNYAETLCQSYGSHCPVVGKTLVSGEKKLSLVAASVTRSHSTGANA  60

Query  76   AINSQCPFLAKEQNAVKVASPMVEEDIINVSPLESKEKGSFPYEEFFHEQIMKKKKDHSY  135
              N+  P  A   NA    S     D     P ++  K +FPYE FF+EQIMKKK+DHSY
Sbjct  61   HANAGGPATA---NATAPVSAPASAD-----PGKASAKETFPYERFFNEQIMKKKRDHSY  112

Query  136  RVFKKVNRLAES--FPIGIEYS-WGEKPITVWCSNDYLGMSRHPAVTNSVREALNKFGAG  192
            RVFKKVNRLA    FP  +EYS   EKPITVWCSNDYLGMS HP V  +V++ALN+ G+G
Sbjct  113  RVFKKVNRLAGDGLFPHALEYSERTEKPITVWCSNDYLGMSAHPGVKRAVQDALNRHGSG  172

Query  193  AGGTRNISGNSVGHEILEKRLASLHQKEAGLLFTSCFVANDSTLYTLAKLLPHCHIFSDA  252
            AGGTRNISGNS+ HE LE +LA LHQKEA LLFTSCFVANDSTL+TLAKLLP C IFSDA
Sbjct  173  AGGTRNISGNSLHHERLESKLAELHQKEAALLFTSCFVANDSTLFTLAKLLPGCEIFSDA  232

Query  253  GNHASMIQGIRNSGVPKHIFRHNDVKHLEELLSKVDKTVPKIVAFETVHSMTGDICPLED  312
            GNHASMI GIRNSGVPKHIFRHNDV HL +LL + DK+VPKIVAFETVHSMTG ICPLE+
Sbjct  233  GNHASMIMGIRNSGVPKHIFRHNDVDHLHQLLKQTDKSVPKIVAFETVHSMTGAICPLEE  292

Query  313  LCDIAHKYNALTFVDEVHAVGLYGYSGAGIGERDRVLHKMDIISGTLGKAFGNMGGYIVG  372
            L D+AH++ A+TF+DEVHAVGLYG  GAG+GERD VLHKMDIISGTLGKAFGN+GGYI G
Sbjct  293  LLDVAHEHGAITFIDEVHAVGLYGDHGAGVGERDGVLHKMDIISGTLGKAFGNIGGYIAG  352

Query  373  STKLIDMIRSYAAGFIFTTSLPPTVLYGTLTAVEILTSDEGRSLRASHQKNVAYMKSILT  432
            +  L+DMIRSYAAGFIFTTSLPPTVL G L AV IL S+EGR LR  HQ+NV+Y+KS+L 
Sbjct  353  THNLVDMIRSYAAGFIFTTSLPPTVLCGALEAVNILASEEGRQLRHLHQRNVSYLKSLLK  412

Query  433  AAGLPLEQSPSHIIPIKIGDPLLCSQLADLLIKDKGHYVQAINYPTVPKGEEKLRLAPTP  492
              G P+E++PSHIIPIKIGDPL  SQ++++LI+  GHY+Q+INYPTV +G+EKLRLAPTP
Sbjct  413  REGFPVEETPSHIIPIKIGDPLKSSQISNVLIEQFGHYLQSINYPTVARGQEKLRLAPTP  472

Query  493  KHTLSMMDQFVKDILHVFHRLNIPT  517
             HT  MM+  V D+  V+  +++ T
Sbjct  473  FHTFEMMNALVTDLKKVWEMVDLST  497


>Q8I4X1_PLAF7 unnamed protein product
Length=630

 Score = 286 bits (732),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 160/387 (41%), Positives = 231/387 (60%), Gaps = 9/387 (2%)

Query  140  KVNRLAESFPIGIEYSWGEKPITVWCSNDYLGMSRHPAVTNSVREALNKFGAGAGGTRNI  199
            K N L   + + I+    EK + VWCSNDYL +S +  +     E L K G  +GGTRNI
Sbjct  240  KENYLFNFWNLHIDNVSNEKTV-VWCSNDYLCLSNNEKIIEVGIETLKKIGNSSGGTRNI  298

Query  200  SGNSVGHEILEKRLASLHQKEAGLLFTSCFVANDSTLYTLAKLLPHCHIFSDAGNHASMI  259
            SG+ + H  LE  +A  + KE+ LLFTS ++AN   L TL KLL   +I SD  NHAS+I
Sbjct  299  SGSLLNHTHLEYIIAKWYNKESSLLFTSGYIANVGALETLGKLLNLIYI-SDEMNHASII  357

Query  260  QGIRNSGVPKHIFRHNDVKHLEELLS--KVDKTVPK---IVAFETVHSMTGDICPLEDLC  314
             GIR S   K IF+HND+  LE +L   +++K       ++ FE+++SM+G I  +E + 
Sbjct  358  NGIRESRCEKFIFKHNDMNDLERILYNLRINKQYENRKIMIVFESIYSMSGHISNIEYIV  417

Query  315  DIAHKYNALTFVDEVHAVGLYGYSGAGIGERDRVLHKMDIISGTLGKAFGNMGGYIVGST  374
             +A KYNALT+VDEVHAVGLYG  G+G  E   + + +DII+GTL KA G++GG+I  + 
Sbjct  418  QLAKKYNALTYVDEVHAVGLYGNKGSGYLEELHLCNHIDIINGTLSKAIGSLGGFICANK  477

Query  375  KLIDMIRSYAAGFIFTTSLPPTVLYGTLTAVEILTSDEGRSLRASHQKNVAYMKSILTAA  434
              ID+IRSY++ FIFTTSL P  +  +  A+ I+ +D   SLR    + V   K  L   
Sbjct  478  YYIDVIRSYSSHFIFTTSLTPVNINTSAEAIHIIQND--MSLRKKLTQVVNKTKQKLQER  535

Query  435  GLPLEQSPSHIIPIKIGDPLLCSQLADLLIKDKGHYVQAINYPTVPKGEEKLRLAPTPKH  494
            G+ +  + SHI+ + I     C Q+ D L+K+   Y+Q INYPTVP G E++R+ P+P H
Sbjct  536  GIQVLHNNSHIVVLMINSAEKCKQICDDLLKEYNIYIQPINYPTVPMGMERIRITPSPFH  595

Query  495  TLSMMDQFVKDILHVFHRLNIPTVEHK  521
            T   + + V  +  +F +  +   + K
Sbjct  596  TDEQIFKLVNSLYTLFKKYQVNMFDKK  622


>Q57YK7_TRYB2 unnamed protein product
Length=404

 Score = 184 bits (467),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 118/368 (32%), Positives = 187/368 (51%), Gaps = 11/368 (3%)

Query  152  IEYSWGEKPITVWCSNDYLGMSRHPAVTNSVREALNKFGAGAGGTRNISGNSVGHEILEK  211
            I  S    P+  +C+N+YLG++ HP V  + ++AL+  G G    R I G +  H+ LE+
Sbjct  44   INVSTAATPVLNFCANNYLGLADHPEVIQAAKDALDSHGYGLASVRFICGTTDIHKKLEQ  103

Query  212  RLASLHQKEAGLLFTSCFVANDSTLYTLAKLLPHCHIFSDAGNHASMIQGIRNSGVPKHI  271
             +      E  +L+ SCF AN      L  L     I SDA NHAS+I G+R     +H 
Sbjct  104  TMTEFLGMEDTILYPSCFDANAGVFEAL--LTSEDAIISDALNHASIIDGVRLCKAERHR  161

Query  272  FRHNDVKHLEELLSKVDKTVPKIVAFETVHSMTGDICPLEDLCDIAHKYNALTFVDEVHA  331
            + H D+K LE  L K      +++  + V SM GD+ PL+ +  +A KYNA   VD+ HA
Sbjct  162  YAHLDMKELETALQKTQHNRIRLIVTDGVFSMDGDVAPLDKIVQLAEKYNANVMVDDSHA  221

Query  332  VGLYGYSGAGIGERDRVLHKMDIISGTLGKAFGNMGGYIVGSTK-LIDMIRSYAAGFIFT  390
             G  G  G G      V+ K+DI++ TLGKA G   G +    K ++D+ R     ++F+
Sbjct  222  SGFMGPGGRGTPALFGVIDKVDILNTTLGKALGGASGGLSSGCKEIVDLQRQKGRPYLFS  281

Query  391  TSLPPTVLYGTLTAVEILTSDEGRSLRASHQKNVAYMKSILTAAGLPL---EQSPSHIIP  447
             ++ P  + GTL  +E+L +    S R   Q N    ++ +  AG  L   E+ P  I P
Sbjct  282  NTIAPAAVGGTLKVMELLQTTS--SARKQLQDNTHLFRTEMKKAGFTLSGHEECP--IAP  337

Query  448  IKIGDPLLCSQLADLLIKDKGHYVQAINYPTVPKGEEKLRLAPTPKHTLSMMDQFVKDIL  507
            + + +  + ++ A  ++ + G YV A +YP VPKG+ ++R+  +  HT   +   V    
Sbjct  338  VMLYEARIAAEFAAKMMAE-GIYVTAFSYPVVPKGQARIRVQLSAAHTTEDVKLAVDAFT  396

Query  508  HVFHRLNI  515
             +   LN+
Sbjct  397  KIKKELNV  404


>Q8ILT9_PLAF7 unnamed protein product
Length=572

 Score = 144 bits (362),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 111/370 (30%), Positives = 175/370 (47%), Gaps = 23/370 (6%)

Query  159  KPITVWCSNDYLGMSRHPAVTNSVREALNKFGAGAGGTRNISGNSVGHEILEKRLASLHQ  218
            +PI+   S  YL   R P V N+  +A  ++  G  G R + GNS     LEK + +   
Sbjct  200  RPIS---SYSYLDFIREPLVQNNAIQAAMEWSTGNHGPRMLGGNSQILRDLEKVVGNFFG  256

Query  219  KEAGLLFTSCFVANDSTLYTLAKLLPHCHIFSDAGNHASMIQGIRNSGVPKHIFRHNDVK  278
            +   +L    F+A  S +  +A       I  D+  HA +  GI+  G   + F+HND  
Sbjct  257  RNDSILAVCGFLACMSGIVAVAT--HEDIILYDSRTHACVKMGIQICGAKAYSFKHNDYN  314

Query  279  HLEELLSKVD-KTVPKIVAFETVHSMTGDICPLEDLCDIAHKYNALTFVDEVHAVGLYGY  337
            HLE LL K   K     V  E+V+SM GDI  L     +  ++ A  +VDE H +G+ G 
Sbjct  315  HLEVLLIKYRYKYRNCWVCIESVYSMDGDIPHLPTFKKLCIQHKAKLYVDEAHGLGVLGK  374

Query  338  SGAGIGERDRVLHKMDIISGTLGKAFGNMGGYIVGSTKLIDMIRSYAAGFIFTTSLPPTV  397
            +G GI E   +    DII GT  K+ G +GGYIV S ++I+ +  +  G +F+  LP   
Sbjct  375  TGRGIEEHFNMPGTADIIVGTFSKSIGGVGGYIVASDEVIEFLDFHCIGNVFSAPLPAYC  434

Query  398  LYGTLTAVEILTSDEGRSLRASHQKNVAYMKSIL-TAAG-LPLEQSPSH-----------  444
              G L A E++ +   R  +     N  Y+++ L T  G  P +   S+           
Sbjct  435  AGGALKAFELIDTQPWRIQKLKF--NTKYLRNGLKTGMGHWPKDYPESYKYIIEGDDATS  492

Query  445  IIPIKI-GDPLLCSQLADLLIKDKGHYVQAINYPTVPKGEEKLRLAPTPKHTLSMMDQFV  503
            +IP+    DP    ++ +LL+K     + A+ YP  P    + R+  T  +T+  M++F+
Sbjct  493  VIPVIFPNDPDRLFKICNLLLK-MNWMISAVVYPACPLKYPRFRVTATSAYTIEYMNEFI  551

Query  504  KDILHVFHRL  513
             DI+    R+
Sbjct  552  SDIVRATVRV  561



Lambda      K        H
   0.318    0.133    0.400 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5924962958


Query= XP_003393070.1 60S ribosomal protein L18a [Bombus terrestris]

Length=177
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q382C4_TRYB2  unnamed protein product                                 122     2e-35
INA1_CAEEL  unnamed protein product                                   30.0    1.3  


>Q382C4_TRYB2 unnamed protein product
Length=179

 Score = 122 bits (305),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 58/153 (38%), Positives = 97/153 (63%), Gaps = 2/153 (1%)

Query  6    ELKEFEVIGRKLPTEKETTTPLYKMRIFAPDAIVAKSRFWYFLRQLKKFKKSTGEIVSLK  65
             L+ + V+GR+ P+EK     +YK  +FAP+ +VAKSRFW  +R+  K K + G+++S K
Sbjct  5    HLRHYCVVGRETPSEKNPQPTVYKFEVFAPNFVVAKSRFWRMMREKNKVKSTHGDVLSCK  64

Query  66   QIPEKSPVKIKNFGIWLRYDS-RSGTHNMYREYRDLSVSGAVTQCYRDMGARHRARAHSI  124
             + ++  +  +N+ + + Y S R G  +M +E+RD+  +GAV+Q Y D+ +RHRAR H+I
Sbjct  65   VVKDRK-LAARNYSVDIAYYSQRCGYTHMVKEFRDVCKAGAVSQAYNDLASRHRARYHNI  123

Query  125  QIIKVEVVKAANCRRPQVKQFHDSKIKFPLPKR  157
            +++ V+ +     RR  V QFH   + FPL +R
Sbjct  124  EVLGVKSIPNHEVRRLNVAQFHPHNLSFPLLQR  156


>INA1_CAEEL unnamed protein product
Length=1139

 Score = 30.0 bits (66),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 35/154 (23%), Positives = 61/154 (40%), Gaps = 26/154 (17%)

Query  16   KLPTEKETTTPLYKMRIFAPDAIVAKSRFWYFL--RQLKKFKKSTGEIVSLKQIPEKSPV  73
            KL       + L    + AP A       + +L  + ++KF+K   +++    +P   P 
Sbjct  398  KLGNVDGDKSKLNDFAVGAPFAFDGAGAVYIYLGTKNIEKFRKKPAQVIKGNDLPNLPPG  457

Query  74   KIKNFGIWLRYDSRSGTHNMYRE-YRDLSVSGAVTQCYRDMGARHRARA-------HSIQ  125
             +++FG      S SG  +M    Y DL +        ++  A  R+R        H ++
Sbjct  458  GMRSFGF-----SLSGGSDMDENGYPDLLIGSPS----KNFVALLRSRPVISIETKHKME  508

Query  126  IIKVEVVKAANCRRPQVKQFHDSKIKFPLPKRIH  159
               V++ K  NC R        +K  FPL   I+
Sbjct  509  KRMVDIDKGVNCPR-------GAKTCFPLDMVIY  535



Lambda      K        H
   0.318    0.133    0.400 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5924962958


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Aug 1, 2023  12:07 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_003393071.1 small glutamine-rich tetratricopeptide
repeat-containing protein alpha [Bombus terrestris]

Length=299
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q21746_CAEEL  unnamed protein product                                 221     2e-70
Q9VJD4_DROME  unnamed protein product                                 162     1e-47
SGT_DICDI  unnamed protein product                                    142     6e-40
Q585Z8_TRYB2  unnamed protein product                                 131     4e-35
Q57ZX0_TRYB2  unnamed protein product                                 76.6    2e-15


>Q21746_CAEEL unnamed protein product
Length=337

 Score = 221 bits (563),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 136/327 (42%), Positives = 198/327 (61%), Gaps = 50/327 (15%)

Query  6    LVAAIVQFLTQQLEEGDITADSRESLEVAIQCLESAYNVQASDTPTNFN----LYEIYKS  61
            LV + +QF+ Q++ +   TA+  E+LEVAIQCLE ++ +   D    F     + E++KS
Sbjct  26   LVVSFLQFIRQKVSQNQATAEQAEALEVAIQCLEHSFGL--DDASYAFQPSRPILELFKS  83

Query  62   SI-----ENAKPNLAPEATP-EAKI-EAERLKNEGNALMKAEKHHEALTNYTKAIQLDGR  114
            +      E+A P      TP ++ I +A +LK EGN LMKA +   A+  Y  AI+L+ R
Sbjct  84   AEGLPEGESALP------TPSDSDISQANKLKEEGNDLMKASQFEAAVQKYNAAIKLN-R  136

Query  115  NAVYYCNRAAAHSKIGNYQQAIKDCHTALSIDPSYSKAYGRLGLAYSSLQRHKEAKESYQ  174
            + VY+CNRAAA+ ++  Y  AI+DC TAL++DPSYSKA+GR+GLAYS   R++ A E+Y+
Sbjct  137  DPVYFCNRAAAYCRLEQYDLAIQDCRTALALDPSYSKAWGRMGLAYSCQNRYEHAAEAYK  196

Query  175  KALEMEPDNESYKNNLQVAEEKLAQPSMNNMGLSGGTLP--------------------G  214
            KALE+EP+ ESYKNNL++AE+KL +  + +   + G  P                     
Sbjct  197  KALELEPNQESYKNNLKIAEDKLKE--LESSRPAPGANPLAGLLGAMGGGPGGMPAMPGM  254

Query  215  MDLSSLLSNPALMNMARQMLSNPALQNMVSNFMSGQVEQGGHMDALIEAGQHFAQQLQNA  274
             ++ +L++ P LM  A QM+S+PAL +M +N MSG     G +  L+ AGQ  A ++Q  
Sbjct  255  PNMQNLMNEPGLMQAASQMMSDPALSDMFNNMMSG----NGSIADLMAAGQQMAARMQET  310

Query  275  NPELIESLRRQMG----GNPNDPDPPQ  297
            NPELIE+LRRQ G    G    P+PPQ
Sbjct  311  NPELIENLRRQFGPGADGGAPPPNPPQ  337


>Q9VJD4_DROME unnamed protein product
Length=331

 Score = 162 bits (410),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 99/290 (34%), Positives = 154/290 (53%), Gaps = 71/290 (24%)

Query  4    KGLVAAIVQFLTQQLEEGDI-TADSRESLEVAIQCLESAYNV------------------  44
            +  V + + +L +Q   GD+ + D  ES+EVAIQCL++A+++                  
Sbjct  7    QSFVRSFIDYLKKQ---GDVMSPDQTESIEVAIQCLQAAFDLGDDVEAAPAAAGEEQATT  63

Query  45   QASDT-----------------------PTNFNLYEIYKSSIENAKPNLAPEATPEAKIE  81
            Q+S T                       P N +++E+++S        L  E  PE+   
Sbjct  64   QSSSTASAPDDDAVASGSAGIGAAAAAVPNNIDMFELFQS--------LYTERNPESLAL  115

Query  82   AERLKNEGNALMKAEKHHEALTNYTKAIQLDGRNAVYYCNRAAAHSKIGNYQQAIKDCHT  141
            AE +KNEGN LMK  K++EAL  Y +AI  D +N ++YCNRAAAH ++G  ++A+ DC +
Sbjct  116  AESIKNEGNRLMKENKYNEALLQYNRAIAFDPKNPIFYCNRAAAHIRLGENERAVTDCKS  175

Query  142  ALSIDPSYSKAYGRLGLAYSSLQRHKEAKESYQKALEMEPDNESYKNNLQVAEEK-----  196
            AL  + +YSKAY RLG+AYS++   ++A+++Y KA+E+EPDNE YK+NL+ A        
Sbjct  176  ALVYNNNYSKAYCRLGVAYSNMGNFEKAEQAYAKAIELEPDNEVYKSNLEAARNARNQPP  235

Query  197  ------------LAQPSMNNMGLSGGTLPGMDLSSLLSNPALMNMARQML  234
                        L+QP + N+  +   +    L S+L NP +MN  RQ  
Sbjct  236  QTGRLREDLINMLSQPMVRNL-FNNAEIDVEQLLSMLQNPMIMNTIRQQF  284


>SGT_DICDI unnamed protein product
Length=334

 Score = 142 bits (358),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 78/180 (43%), Positives = 114/180 (63%), Gaps = 18/180 (10%)

Query  77   EAKIEAERLKNEGNALMKAEKHHEALTNYTKAIQLDGRNAVYYCNRAAAHSKIGNYQQAI  136
            E K  AE+LKNEGNA +   KH EAL+ Y KAI  D  NA+Y+ NRAA +S + N++++I
Sbjct  140  EVKAIAEKLKNEGNAKLNEGKHQEALSCYNKAILYDNTNAIYFANRAATYSALQNFEKSI  199

Query  137  KDCHTALSIDPSYSKAYGRLGLAYSSLQRHKEAKESYQKALEMEPDNESYKNNLQVAEEK  196
            +DC  A+  +P+Y KAY R+G AY+SL +  EA E+Y KA+E+EP+NE++K +L  AE  
Sbjct  200  EDCLEAIKRNPNYGKAYTRMGSAYTSLGKFSEAMEAYNKAIELEPNNETFKASLANAERL  259

Query  197  LAQ-----------PSMNNMGLSGGTLPGMDLSSLLSNPALMNMARQMLSNPALQNMVSN  245
             A            P M ++G       G+D  SLLSNPA+  +A  ++S+P ++ M+ N
Sbjct  260  AAAANNQAPAMPNIPGMPDLG-------GLDFGSLLSNPAIRGLANNLMSDPKMKEMMDN  312


>Q585Z8_TRYB2 unnamed protein product
Length=416

 Score = 131 bits (329),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 69/194 (36%), Positives = 111/194 (57%), Gaps = 8/194 (4%)

Query  57   EIYKSSIENAKPNLAPEATPEAKIEAERLKNEGNALMKAEKHHEALTNYTKAIQLDGRNA  116
            E Y S +E A+        P   + AE +KN+GN LM    + +A+  YTKAI+++  N 
Sbjct  113  EEYNSRLEKAREKFEKRNNPYEGMTAEEIKNKGNELMGLANYKQAVAYYTKAIEMEPENH  172

Query  117  VYYCNRAAAHSKIGNYQQAIKDCHTALSIDPSYSKAYGRLGLAYSSLQRHKEAKESYQKA  176
            V++ NRAAAH+ + +Y+ AI DC  ++SI P+Y+KAY RLG      + ++ A +++ KA
Sbjct  173  VFFANRAAAHTHLKDYRSAIIDCERSISICPTYAKAYSRLGTTLFYQENYQRAVDAFSKA  232

Query  177  LEMEPDNESYKNNLQVAEEKLAQPSMNNMGLSGGTLPGMD-------LSSLLSNPALMNM  229
             E++P NE Y+ +L+  EEK  Q +    G+ GGT  G D       ++ ++ NP  +  
Sbjct  233  CELDPTNERYREDLKQVEEKAKQSNSATAGM-GGTPFGADGMFNFSQVAEVMKNPQFVET  291

Query  230  ARQMLSNPALQNMV  243
            A +++SNP     V
Sbjct  292  ATRLMSNPQFNQAV  305


>Q57ZX0_TRYB2 unnamed protein product
Length=550

 Score = 76.6 bits (187),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/192 (28%), Positives = 89/192 (46%), Gaps = 13/192 (7%)

Query  80   IEAERLKNEGNALMKAEKHHEALTNYTKAIQLDGRNAVYYCNRAAAHSKIGNYQQAIKDC  139
            ++A  LKN+GN    + ++ EA   +++AI LD  N V Y NR+A  + +  Y QA+ D 
Sbjct  1    MDATELKNKGNQEFSSGRYREAAEFFSQAINLDPSNHVLYSNRSACFASLHQYAQALSDA  60

Query  140  HTALSIDPSYSKAYGRLGLAYSSLQRHKEAKESYQKALEMEPDNESYKNNLQVAEEKLAQ  199
               +S+ P + K Y R G A   L+R+ EA   Y+K L ++P + +    +   E+  A 
Sbjct  61   EKCVSLKPDWVKGYVRHGAALHGLRRYDEAAAVYKKGLTVDPSSTACSEGIASVEKDKAA  120

Query  200  PSMNNMGLSGGTLPGM-------DLSSLLSNPALMNMARQMLSNPALQNMVSNFMSGQVE  252
             +M N      T   +        LS  +  P  + M  +++ +P      SN      +
Sbjct  121  SAMQNPFAKLFTPEAVKKIQSHRKLSLFMMQPDYVRMIDEVIKDP------SNIQRYLED  174

Query  253  QGGHMDALIEAG  264
            Q   M  L+ +G
Sbjct  175  QRFMMTCLVLSG  186


 Score = 70.5 bits (171),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 64/107 (60%), Gaps = 0/107 (0%)

Query  82   AERLKNEGNALMKAEKHHEALTNYTKAIQLDGRNAVYYCNRAAAHSKIGNYQQAIKDCHT  141
            A+  K+EGN+L K +K  EA+  YT++I+ +      Y NRAAA+ K+G Y +A+ D   
Sbjct  362  AQEKKDEGNSLFKQDKFPEAVAAYTESIKRNPMEHTTYSNRAAAYLKLGAYNEALADAEK  421

Query  142  ALSIDPSYSKAYGRLGLAYSSLQRHKEAKESYQKALEMEPDNESYKN  188
             + I P + KA+ R G A+   +++ +A ++Y + L+ + +N   K+
Sbjct  422  CIEIKPDFVKAHARRGHAFFWTKQYNKAMQAYDEGLKYDKENAECKD  468


 Score = 55.8 bits (133),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 57/121 (47%), Gaps = 8/121 (7%)

Query  64   ENAKPNLAPEATPEAKIEAERLKNEGNALMKAEKHHEALTNYTKAIQLDGRNAVYYCNRA  123
            E  K   A E + EAK EA R K EGNAL K  K  EAL  Y +A  LD  N VY  N  
Sbjct  210  EEPKKAAAVELSAEAK-EALRAKEEGNALYKQRKFDEALAKYDEASSLDPTNTVYLLNIT  268

Query  124  AAHSKIGNYQQAIKDCHTAL------SIDPSY-SKAYGRLGLAYSSLQRHKEAKESYQKA  176
            A   + G Y+  ++ C  AL        D +  +K   R  L    L+R  EA   ++KA
Sbjct  269  AVFYEKGEYELCMEKCENALEHGRENKCDYTVIAKLMTRQALCLQKLKRFDEAIALFKKA  328

Query  177  L  177
            L
Sbjct  329  L  329



Lambda      K        H
   0.310    0.125    0.345 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2878653044


Query= XP_003393073.1 guanine nucleotide-binding protein G(i) subunit alpha
[Bombus terrestris]

Length=356
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GNAI_DROME  unnamed protein product                                   627     0.0   
GNAO_CAEEL  unnamed protein product                                   477     6e-170
GPA16_CAEEL  unnamed protein product                                  474     8e-169
GNAO_DROME  unnamed protein product                                   466     1e-165
GPA4_CAEEL  unnamed protein product                                   458     2e-162


>GNAI_DROME unnamed protein product
Length=355

 Score = 627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/355 (84%), Positives = 323/355 (91%), Gaps = 0/355 (0%)

Query  1    MGCAVSTIGEKEAAERSKKIDKDLRADGERAASEVKLLLLGAGESGKSTIVKQMKIIHET  60
            MGCAVST  +KEA ERSK ID+ LRA+GERAASEVKLLLLGAGESGKSTIVKQMKIIH+T
Sbjct  1    MGCAVSTARDKEAIERSKNIDRALRAEGERAASEVKLLLLGAGESGKSTIVKQMKIIHDT  60

Query  61   GYSNEECEQYKPVVCSNTVQSLMTIIRAMGQLRIDFADPNKADIARQFFTLASAAEEGEL  120
            GYS EECE+Y+ VV SNTVQSLM IIRAMG+L+I+FADP++ DIARQFFT ASAA+EG L
Sbjct  61   GYSQEECEEYRRVVFSNTVQSLMVIIRAMGRLKIEFADPSRTDIARQFFTHASAADEGIL  120

Query  121  TGELALLMKRLWQDAGVQLCFTRSREYQLNDSAAYYLNALDRIAQPNYIPTQQDVLRTRV  180
              E+ LLMK+LW D GVQ  F RSREYQLNDSA YYLN+LDRIAQPNYIPTQQDVLRTRV
Sbjct  121  LPEIVLLMKKLWADGGVQQSFARSREYQLNDSAGYYLNSLDRIAQPNYIPTQQDVLRTRV  180

Query  181  KTTGIVETHFSFKGLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSGYDLVLAEDEE  240
            KTTGI+ETHFS K LHFK+FDVGGQRSERKKWIHCFEGVTAIIFCVALSGYDLVLAEDEE
Sbjct  181  KTTGIIETHFSCKQLHFKLFDVGGQRSERKKWIHCFEGVTAIIFCVALSGYDLVLAEDEE  240

Query  241  MNRMIESMKLFDSICNSKWFVETSIILFLNKKDLFEEKITRSPLTICFPEYKGANTYEEC  300
            MNRMIES+KLFDSICNSKWFVETSIILFLNKKDLFEEKI RSPLTICFPEY G NT+EE 
Sbjct  241  MNRMIESLKLFDSICNSKWFVETSIILFLNKKDLFEEKIKRSPLTICFPEYTGTNTFEEA  300

Query  301  ASYIQMKFENLNKRKDQKQIYTHFTCATDTSNIQFVFDAVTDVIIKNNLSNCGLL  355
            A+YI+MKFENLNKRKDQK+IYTH TCATDT+N++FVFDAVTDVIIKNNL   GL 
Sbjct  301  ANYIRMKFENLNKRKDQKEIYTHLTCATDTNNVKFVFDAVTDVIIKNNLKQIGLF  355


>GNAO_CAEEL unnamed protein product
Length=354

 Score = 477 bits (1228),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 234/355 (66%), Positives = 280/355 (79%), Gaps = 3/355 (1%)

Query  1    MGCAVSTIGEKEAAERSKKIDKDLRADGERAASEVKLLLLGAGESGKSTIVKQMKIIHET  60
            MGC +S   E+ A ERS+ I+K+L+ DG +AA ++KLLLLGAGESGKSTIVKQMKIIHE+
Sbjct  1    MGCTMSQ-EERAALERSRMIEKNLKEDGMQAAKDIKLLLLGAGESGKSTIVKQMKIIHES  59

Query  61   GYSNEECEQYKPVVCSNTVQSLMTIIRAMGQLRIDFADPNKADIARQFFTLASAAEEGE-  119
            G++ E+ +QYKPVV SNTVQSL+ I+RAM  L + F   ++   A+    + +  E+ E 
Sbjct  60   GFTAEDYKQYKPVVYSNTVQSLVAILRAMSNLGVSFGSADREVDAKLVMDVVARMEDTEP  119

Query  120  LTGELALLMKRLWQDAGVQLCFTRSREYQLNDSAAYYLNALDRIAQPNYIPTQQDVLRTR  179
             + EL   MKRLW DAGVQ CF+RS EYQLNDSA Y+L+ L+R+ +  Y PT+QD+LRTR
Sbjct  120  FSEELLSSMKRLWGDAGVQDCFSRSNEYQLNDSAKYFLDDLERLGEAIYQPTEQDILRTR  179

Query  180  VKTTGIVETHFSFKGLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSGYDLVLAEDE  239
            VKTTGIVE HF+FK L+FK+FDVGGQRSERKKWIHCFE VTAIIFCVA+S YD VL EDE
Sbjct  180  VKTTGIVEVHFTFKNLNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDE  239

Query  240  EMNRMIESMKLFDSICNSKWFVETSIILFLNKKDLFEEKITRSPLTICFPEYKGANTYEE  299
              NRM ES+KLFDSICN+KWF +TSIILFLNKKDLFEEKI +SPLTICFPEY G   Y E
Sbjct  240  TTNRMHESLKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICFPEYSGRQDYHE  299

Query  300  CASYIQMKFENLNKRKDQKQIYTHFTCATDTSNIQFVFDAVTDVIIKNNLSNCGL  354
             ++YIQ +FE  NK  + K+IY H TCATDT+NIQFVFDAVTDVII NNL  CGL
Sbjct  300  ASAYIQAQFEAKNKSAN-KEIYCHMTCATDTTNIQFVFDAVTDVIIANNLRGCGL  353


>GPA16_CAEEL unnamed protein product
Length=357

 Score = 474 bits (1221),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 232/358 (65%), Positives = 278/358 (78%), Gaps = 6/358 (2%)

Query  1    MGCAVSTIGEKEAAER-SKKIDKDLRADGERAASEVKLLLLGAGESGKSTIVKQMKIIHE  59
            MGC +S   E EAA+R SKKID+ L+ DGE +   +KLLLLGAGESGKSTI+KQM+IIH+
Sbjct  1    MGCIMSQ--EDEAAKRRSKKIDRLLKEDGENSMRTIKLLLLGAGESGKSTILKQMRIIHD  58

Query  60   TGYSNEECEQYKPVVCSNTVQSLMTIIRAMGQLRIDFADPNKADIARQFFTLASAAEEGE  119
             GY+ EE + ++ VV  N + SL  II AM QL+I F   +    AR+    ++  EE E
Sbjct  59   VGYTTEERKVFRGVVYGNIILSLNAIIHAMEQLKISFTTLDHESDARKLLMFSTTGEEDE  118

Query  120  LTGELALLMKRLWQDAGVQLCFTRSREYQLNDSAAYYLNALDRIAQPNYIPTQQDVLRTR  179
            L  EL +LMK +W D+G+Q    RSREYQLNDSA YYL+ LDRI  PNYIPTQ D+LRTR
Sbjct  119  LPEELVVLMKSVWSDSGIQKALERSREYQLNDSAGYYLSQLDRICAPNYIPTQDDILRTR  178

Query  180  VKTTGIVETHFSFKGLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSGYDLVLAEDE  239
            +KTTGIVET F +K   F +FDVGGQRSERKKWIHCFE VTA+IFCVALS YD+VL ED 
Sbjct  179  IKTTGIVETQFVYKDRLFLVFDVGGQRSERKKWIHCFEDVTALIFCVALSEYDMVLVEDC  238

Query  240  EMNRMIESMKLFDSICNSKWFVETSIILFLNKKDLFEEKITRSPLTICFPEYKGANTYEE  299
            + NRM ES+KLFDSICN+KWFVETSIILFLNKKDLFEEKI RSPLT CFPEY GAN YEE
Sbjct  239  QTNRMRESLKLFDSICNNKWFVETSIILFLNKKDLFEEKIVRSPLTHCFPEYTGANNYEE  298

Query  300  CASYIQMKFENLNKR---KDQKQIYTHFTCATDTSNIQFVFDAVTDVIIKNNLSNCGL  354
             ++YIQ +FE++NKR   +  ++IYT FTCATDT+NI+FVFDAVTD+II++NL  CGL
Sbjct  299  ASAYIQQQFEDMNKRTTGEKNQEIYTQFTCATDTNNIRFVFDAVTDIIIRDNLRTCGL  356


>GNAO_DROME unnamed protein product
Length=354

 Score = 466 bits (1200),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 235/355 (66%), Positives = 280/355 (79%), Gaps = 3/355 (1%)

Query  1    MGCAVSTIGEKEAAERSKKIDKDLRADGERAASEVKLLLLGAGESGKSTIVKQMKIIHET  60
            MGCA  +  E+ AA RS+ I+++L+ DG +AA ++KLLLLGAGESGKSTIVKQMKIIHE+
Sbjct  1    MGCA-QSAEERAAAARSRLIERNLKEDGIQAAKDIKLLLLGAGESGKSTIVKQMKIIHES  59

Query  61   GYSNEECEQYKPVVCSNTVQSLMTIIRAMGQLRIDFADPNKADIARQFFTLASAAEEGE-  119
            G++ E+ +QY+PVV SNT+QSL+ I+RAM  L I +++  +   A+  F +     + E 
Sbjct  60   GFTAEDFKQYRPVVYSNTIQSLVAILRAMPTLSIQYSNNERESDAKMVFDVCQRMHDTEP  119

Query  120  LTGELALLMKRLWQDAGVQLCFTRSREYQLNDSAAYYLNALDRIAQPNYIPTQQDVLRTR  179
             + EL   MKRLWQDAGVQ CF+RS EYQLNDSA Y+L+ LDR+   +Y PT+QD+LRTR
Sbjct  120  FSEELLAAMKRLWQDAGVQECFSRSNEYQLNDSAKYFLDDLDRLGAKDYQPTEQDILRTR  179

Query  180  VKTTGIVETHFSFKGLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSGYDLVLAEDE  239
            VKTTGIVE HFSFK L+FK+FDVGGQRSERKKWIHCFE VTAIIFCVA+S YD VL EDE
Sbjct  180  VKTTGIVEVHFSFKNLNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDE  239

Query  240  EMNRMIESMKLFDSICNSKWFVETSIILFLNKKDLFEEKITRSPLTICFPEYKGANTYEE  299
              NRM ES+