BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= XP_037024079.1 uncharacterized protein LOC119065977 [Bradysia
coprophila]

Length=415
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9TVI0_DROME  unnamed protein product                                 53.9    2e-07
Q8MQM7_DROME  unnamed protein product                                 47.0    1e-05
Q0KIF2_DROME  unnamed protein product                                 47.4    2e-05


>Q9TVI0_DROME unnamed protein product
Length=902

 Score = 53.9 bits (128),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 81/361 (22%), Positives = 133/361 (37%), Gaps = 39/361 (11%)

Query  24   GNASFDGIDVRIVKEIAMRMNFTPKFLMPRHDDDRGIIYEN-GSTTGAMDRVVNGEADLT  82
            GN  F G  V ++KE+A ++ F   F      +D G   +   ST+G +  +V G ADL 
Sbjct  443  GNNQFQGYGVDLIKELADKLGFN--FTFRDGGNDYGSFNKTTNSTSGMLKEIVEGRADLA  500

Query  83   IGIYLLTQDRSVWFSPTVAYMQDRIGFAIRVNYITPSSLNHLMGPLNYNAWLLIYTTLCA  142
            I    +T +R      ++ +M   I          P +L   M P +   WL +      
Sbjct  501  ITDLTITSEREEVIDFSIPFMNLGIAILYVKPQKAPPALFSFMDPFSSEVWLYLGIAYLG  560

Query  143  AVVFLLLTKRLGTDQRSVILGGKLY-----------RTPILNALYIAIGGSIGNPRMAYP  191
              +   +  RL     S I     Y           +  I N+L+   G  +       P
Sbjct  561  VSLCFFIIGRL-----SPIEWDNPYPCIEEPEELENQFTINNSLWFTTGALLQQGSEIAP  615

Query  192  QYFGPFARTLTILWILLFMFIRTSYEGALFTFFHRPPVFSKCDSFEKVLAFKCKII--AP  249
            +      RT++ +W    + + +SY   L  F       S  +S + +   K  +   A 
Sbjct  616  KALS--TRTISAIWWFFTLIMVSSYTANLAAFLTIENPTSPINSVKDLADNKDDVQYGAK  673

Query  250  KSGVNHLVGFNASISQFVVCNDSALNCAGELF---------KGKAAIDVAFVHEQTKKYF  300
            ++G      F+ S     +  +  LN   E+          K K+    AF+ E T   F
Sbjct  674  RTGSTRNF-FSTSEEPIYIKMNEYLNAHPEMLMENNQQGVDKVKSGTKYAFLMESTSIEF  732

Query  301  NHLNAPNL--ILDYTKDQVWPIAPVFLFEKNSILRHSFNHFLRLYDQSGLTKNWIDHYTN  358
            N +   NL  + D   ++ + IA V    KN   R  FN  L    + G+     + + N
Sbjct  733  NTVRECNLTKVGDPLDEKGYGIAMV----KNWPYRDKFNKALLELQEQGVLARLKNKWWN  788

Query  359  E  359
            E
Sbjct  789  E  789


>Q8MQM7_DROME unnamed protein product
Length=372

 Score = 47.0 bits (110),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 56/238 (24%), Positives = 94/238 (39%), Gaps = 22/238 (9%)

Query  1    MNKCPVHVAVAEVEPYVIIHRGK---GNASFDGIDVRIVKEIAMRMNFTPKFLMPRHDDD  57
            MN   V + + E  PYV++H GK   GN  F G  V I++ I+  + F   +++    D 
Sbjct  104  MNVTLVVITILET-PYVMMHYGKNFTGNERFYGFCVDILETISREVGF--DYILDLVPDR  160

Query  58   R--GIIYENGSTTGAMDRVVNGEADLTIGIYLLTQDRSVWFSPTVAYMQDRIGFAIRVNY  115
            +      E G   G + +++  +ADL +G   +T  R      T  +M   I    +V  
Sbjct  161  KYGAKDPETGEWNGMVAQLMKYKADLAVGSMTITYARESVIDFTKPFMNLGISILFKVPT  220

Query  116  ITPSSLNHLMGPLNYNAWLLI-----YTTLCAAVVFLLLTKRL----GTDQRSVILGGKL  166
              P+ L   M PL    W+ +       +LC  +V  L           D  ++ +G + 
Sbjct  221  SEPTRLFSFMNPLAIEIWIYVLIAYFLVSLCIYIVGKLSPIEWKCINACDLENISIGNQF  280

Query  167  YRTPILNALYIAIGGSIGNPRMAYPQYFGPFARTLTILWILLFMFIRTSYEGALFTFF  224
              T   ++ +  IG  +      YP+      R ++  W    + I  SY   L  F 
Sbjct  281  SLT---DSFWFTIGTFMQQSPDIYPRAMS--TRIISSTWGFFSLIIVASYTANLAAFL  333


>Q0KIF2_DROME unnamed protein product
Length=899

 Score = 47.4 bits (111),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 56/238 (24%), Positives = 94/238 (39%), Gaps = 22/238 (9%)

Query  1    MNKCPVHVAVAEVEPYVIIHRGK---GNASFDGIDVRIVKEIAMRMNFTPKFLMPRHDDD  57
            MN   V + + E  PYV++H GK   GN  F G  V I++ I+  + F   +++    D 
Sbjct  401  MNVTLVVITILET-PYVMMHYGKNFTGNERFYGFCVDILETISREVGF--DYILDLVPDR  457

Query  58   R--GIIYENGSTTGAMDRVVNGEADLTIGIYLLTQDRSVWFSPTVAYMQDRIGFAIRVNY  115
            +      E G   G + +++  +ADL +G   +T  R      T  +M   I    +V  
Sbjct  458  KYGAKDPETGEWNGMVAQLMKYKADLAVGSMTITYARESVIDFTKPFMNLGISILFKVPT  517

Query  116  ITPSSLNHLMGPLNYNAWLLI-----YTTLCAAVVFLLLTKRL----GTDQRSVILGGKL  166
              P+ L   M PL    W+ +       +LC  +V  L           D  ++ +G + 
Sbjct  518  SEPTRLFSFMNPLAIEIWIYVLIAYFLVSLCIYIVGKLSPIEWKCINACDLENISIGNQF  577

Query  167  YRTPILNALYIAIGGSIGNPRMAYPQYFGPFARTLTILWILLFMFIRTSYEGALFTFF  224
              T   ++ +  IG  +      YP+      R ++  W    + I  SY   L  F 
Sbjct  578  SLT---DSFWFTIGTFMQQSPDIYPRAMS--TRIISSTWGFFSLIIVASYTANLAAFL  630



Lambda      K        H
   0.327    0.141    0.438 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4509870700


Query= XP_037024080.1 uncharacterized protein LOC119065978 [Bradysia
coprophila]

Length=192
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

BARK_DROME  unnamed protein product                                   31.6    0.52 
Q22763_CAEEL  unnamed protein product                                 27.7    6.9  


>BARK_DROME unnamed protein product
Length=3123

 Score = 31.6 bits (70),  Expect = 0.52, Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query  138   FGKADNVSAQEFAFPEIMPAGRYRV--DINVTEGGRKSLLLGATVYFSVS  185
             F +  +V   E    +++PAG Y V  DIN+  GG+  L  G T+ F  S
Sbjct  958   FHEGSDVIGGEVDGQDMVPAGTYTVTKDINIRPGGKLILQPGTTLKFEPS  1007


>Q22763_CAEEL unnamed protein product
Length=798

 Score = 27.7 bits (60),  Expect = 6.9, Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 17/33 (52%), Gaps = 2/33 (6%)

Query  100  NLCDWIDGKRSSFFMDFLKSHILQYSNFNHSCP  132
            N C W+D   SS F+D  +  + Q+S     CP
Sbjct  639  NKCGWMDTNSSSGFIDMAQCVVTQFS--TQCCP  669



Lambda      K        H
   0.327    0.141    0.438 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4509870700


Query= XP_037024081.1 ras-related and estrogen-regulated growth inhibitor
isoform X2 [Bradysia coprophila]

Length=154
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RASS_DICDI  unnamed protein product                                   91.7    1e-23
O17599_CAEEL  unnamed protein product                                 83.6    1e-20
RASD_DICDI  unnamed protein product                                   81.3    8e-20


>RASS_DICDI unnamed protein product
Length=194

 Score = 91.7 bits (226),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 78/134 (58%), Gaps = 10/134 (7%)

Query  2    VDGEPILFEILDTCPKNDDDDDISSVTAEHIQWADGILLVYAITDRNSFNYIRKA-----  56
            VDGE  L +I DT  +    +D S+V  ++++  +G L VY+IT   SF  I +      
Sbjct  46   VDGEECLLDIYDTAGQ----EDFSAVRDQYMRTGEGFLCVYSITYLQSFKEIHRLHNHLL  101

Query  57   KVNLQPDIPLSLVGNKVDMVHLRQVSTEEGEILAKDFECKFCEISAAEHVTQVSEAFHDL  116
            KV     +P  LVGNK D+   R+VST EGE LAK   CKF E SA E +  VSE+F++L
Sbjct  102  KVKDLDSVPFVLVGNKCDLNEYREVSTAEGEELAKKLNCKFLETSAKERIN-VSESFYEL  160

Query  117  CKEVLLARRKSKQS  130
             +EV  AR+ ++ S
Sbjct  161  VREVKKARQSNQHS  174


>O17599_CAEEL unnamed protein product
Length=181

 Score = 83.6 bits (205),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 77/134 (57%), Gaps = 10/134 (7%)

Query  2    VDGEPILFEILDTCPKNDDDDDISSVTAEHIQWADGILLVYAITDRNSFNYIRKAK----  57
            VDG+P + EILDT       +  SS+   +I+   G ++VY+IT + +F+ IR  K    
Sbjct  46   VDGQPSVLEILDTA----GTEQFSSMRDLYIKNGQGFVVVYSITSQQTFHDIRNMKEQIV  101

Query  58   -VNLQPDIPLSLVGNKVDMVHLRQVSTEEGEILAKDFECKFCEISAAEHVTQVSEAFHDL  116
             V    ++P+ LVGNK D+ H RQV +EEG  LA+ + C F E SA  +   V+  F ++
Sbjct  102  RVKGSENVPILLVGNKCDLSHQRQVRSEEGLALAESWSCPFTECSAKNN-QNVNVTFAEI  160

Query  117  CKEVLLARRKSKQS  130
             +E+   + KS+QS
Sbjct  161  VREMNYVQNKSRQS  174


>RASD_DICDI unnamed protein product
Length=187

 Score = 81.3 bits (199),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 73/124 (59%), Gaps = 10/124 (8%)

Query  2    VDGEPILFEILDTCPKNDDDDDISSVTAEHIQWADGILLVYAITDRNSFNYI-----RKA  56
            +D E  L +ILDT  +    ++ S++  ++++   G L VY+IT R+S++ I     +  
Sbjct  46   IDDETCLLDILDTAGQ----EEYSAMRDQYMRTGQGFLCVYSITSRSSYDEIASFREQIL  101

Query  57   KVNLQPDIPLSLVGNKVDMVHLRQVSTEEGEILAKDFECKFCEISAAEHVTQVSEAFHDL  116
            +V  +  +PL LVGNK D+ H RQVS  EG+ LAK F C F E SA   +  V EAF+ L
Sbjct  102  RVKDKDRVPLILVGNKADLDHERQVSVNEGQELAKGFNCPFMESSAKSRIN-VEEAFYSL  160

Query  117  CKEV  120
             +E+
Sbjct  161  VREI  164



Lambda      K        H
   0.327    0.141    0.438 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4509870700


Query= XP_037024082.1 esterase FE4-like [Bradysia coprophila]

Length=566
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

EST6_DROME  unnamed protein product                                   200     4e-57
Q95U30_DROME  unnamed protein product                                 194     6e-55
A0A0B4K6V8_DROME  unnamed protein product                             194     7e-55


>EST6_DROME unnamed protein product
Length=544

 Score = 200 bits (509),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 149/500 (30%), Positives = 229/500 (46%), Gaps = 37/500 (7%)

Query  25   IVYIDDGALEGTVMVSRSGVNFHAFLRIPYAEPPIDNLRFLAPV-RKQAWTGMWNATYWS  83
            +V +  G L G     R   +++++  IPYAEPP  +LRF AP   KQ W+ +++AT   
Sbjct  29   LVQLPQGKLRG-----RDNGSYYSYESIPYAEPPTGDLRFEAPEPYKQKWSDIFDATKTP  83

Query  84   PICVQ---NTPSSADEM-SEDCLYMNVFS--KNLTGSMPVIVYIHGGSFAYGDAKSQAGP  137
              C+Q    TP +   +  EDCL ++V+    +   S PV+ +IHGG+F +G A      
Sbjct  84   VACLQWDQFTPGANKLVGEEDCLTVSVYKPKNSKRNSFPVVAHIHGGAFMFGAAWQNGHE  143

Query  138  QYLMDREVVLVSFNYRLGALGFMAVGTREIPGNAAMKDMALVLQWVNRNIVKFGGNPNKV  197
              + + + +LV  +YRLG LGF++ G R++PGN  +KD  L L+W+ +NI  FGG P  V
Sbjct  144  NVMREGKFILVKISYRLGPLGFVSTGDRDLPGNYGLKDQRLALKWIKQNIASFGGEPQNV  203

Query  198  TLMGWSAGAIAVHALMLSPMVDGLFHRVVAISEALAGLRSLPYEYSSLALRYGERLNCPT  257
             L+G SAG  +VH  ML      L     + S        +       A   G  + C +
Sbjct  204  LLVGHSAGGASVHLQMLREDFGQLARAAFSFSGNALDPWVIQKGARGRAFELGRNVGCES  263

Query  258  SEIDL-LIACLRDKPATDLVSISFRDHPICATTGGTFYLTIEPELGQERFLTDDPPKLFA  316
            +E    L  CL+ KPA++LV+   +           F   +EP    +  +T DP  +  
Sbjct  264  AEDSTSLKKCLKSKPASELVTAVRKFLIFSYVPFAPFSPVLEPSDAPDAIITQDPRDVIK  323

Query  317  NGNFSRVPMIIGRTSEEETITAFELLNSPR----LDDLNDDFNEVGPYCFGYEGGNTPK-  371
            +G F +VP  +   +E+    A  LL   +    +DDLN+ + E+ PY   Y    T K 
Sbjct  324  SGKFGQVPWAVSYVTEDGGYNAALLLKERKSGIVIDDLNERWLELAPYLLFYRDTKTKKD  383

Query  372  ----SRAISAAIKNYLPFDVIDVRSVNALVHLFGDTF--TGFGQHIFVHRINQYIPVYYY  425
                SR I    + Y+     D+ S + L  LF D        + + +HR     P Y Y
Sbjct  384  MDDYSRKIK---QEYIGNQRFDIESYSELQRLFTDILFKNSTQESLDLHRKYGKSPAYAY  440

Query  426  KF---SYVGRFSFCNNPQEKPYGVEHGDDLQYIFHLNFLNNNFPIIEHSAPENFMVERMT  482
             +   +  G      N  +  +G  HGDD   IF  NF+ +    +E    E  +     
Sbjct  441  VYDNPAEKGIAQVLANRTDYDFGTVHGDDYFLIFE-NFVRD----VEMRPDEQIISRNFI  495

Query  483  RMFEHFA--DNGNPNYNDSE  500
             M   FA  DNG+  Y + +
Sbjct  496  NMLADFASSDNGSLKYGECD  515


>Q95U30_DROME unnamed protein product
Length=542

 Score = 194 bits (494),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 158/541 (29%), Positives = 259/541 (48%), Gaps = 47/541 (9%)

Query  23   CEIVYIDDGALEGTVMVSRSGVNFHAFLRIPYAEPPIDNLRFLAPVRKQAWTGMWNATYW  82
            CE+  +  G ++G   +S     + +F +IP+A+PP+  LRF APV    W+G+ + T++
Sbjct  10   CELT-LPVGQIKGVKRLSLYDDPYFSFEKIPFAKPPLGELRFRAPVPADPWSGVLDCTHY  68

Query  83   SPICVQNTPSSAD-EMSEDCLYMNVFSKNLTGS--MPVIVYIHGGSFAYGDAKSQA-GPQ  138
            +    Q    + + E  EDCLY+NV+SK L     +PV+VYI+GG+F  G+A  +  GP 
Sbjct  69   AEKPTQRGLLTREIEGGEDCLYLNVYSKQLKSEKPLPVMVYIYGGAFTVGEATRELYGPD  128

Query  139  YLMDREVVLVSFNYRLGALGFMAVG--TREIPGNAAMKDMALVLQWVNRNIVKFGGNPNK  196
            Y M ++VVLV+ NYR+  LGF+++   + ++PGNA +KD  L L+WV + I  F G+ + 
Sbjct  129  YFMTKDVVLVTLNYRVDCLGFLSLKDPSLKVPGNAGLKDQVLALKWVKQYISNFNGDDSN  188

Query  197  VTLMGWSAGAIAVHALMLSPMVDGLFHRVVAISEALAGL-RSLPYEYSSLALRYGERLNC  255
            +T+ G SAG  + H +M +    GLFH+ + +S  +     + P E    A R  ++ N 
Sbjct  189  ITVFGESAGGCSTHFMMCTEQTRGLFHKAIPMSGTVHNYWANNPAE--DFAFRLAQQ-NG  245

Query  256  PTSEID--LLIACLRDKPATDLVSISFRDHPICATTGGTFYL--TIEPELGQERFLTDDP  311
             T E D   ++  L+  PA DLV+ +    P     G  F    T+E  +G++  +   P
Sbjct  246  FTGENDDAKVLEYLQGVPARDLVNHNLLT-PEHRRNGLLFAFGPTVEAYVGEDCVVPKPP  304

Query  312  PKLFANGNFSRVPMIIGRTSEEETITAFEL-LNSPRLDDLNDDFNEVGPY---CFGYEGG  367
             ++  +   +  P+++G TS E       +  N   LD L+ D   + P        E  
Sbjct  305  VEMARDAWSNNFPVMLGGTSFEGLFMYPAVSANLKALDSLSQDPTRLVPVDVRTVSSEKE  364

Query  368  NTPKSRAISAAIKNYLP------FDVIDVRSVNALVHLFGDTFTGFGQHIFVHRINQYIP  421
            N   S+ +  A   Y P       +++D  S     H F  TF                P
Sbjct  365  NLEYSQRLMKAYFGYSPPSSELLLNMLDFYSYKIFWHGFNRTFNA-------RLTYAKAP  417

Query  422  VYYYKFSYVG------RFSFCNNPQEKPYGVEHGDDLQYIFHLNFLNNNFPIIEHSAPEN  475
             YYY+F +        R  FC +  +   GV H DDL Y+F     N     ++ ++ E 
Sbjct  418  TYYYRFDFDSPNFNFYRAKFCGDKIKT--GVAHADDLSYLFR----NAGSWKLDKTSAEY  471

Query  476  FMVERMTRMFEHFADNGNPNYND-SEVHW-PVHHNETEYYLDIGTHMVEKNGLYLERYTI  533
              +ERM  ++  FA   NPN  +   + W P   N+ +  ++I + +   +    E+  I
Sbjct  472  RTIERMIGIWTAFAATSNPNCPEIGHLEWKPSTKNDPKRVINISSDVTIIDLPEYEKLQI  531

Query  534  W  534
            W
Sbjct  532  W  532


>A0A0B4K6V8_DROME unnamed protein product
Length=543

 Score = 194 bits (493),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 159/545 (29%), Positives = 261/545 (48%), Gaps = 55/545 (10%)

Query  23   CEIVYIDDGALEGTVMVSRSGVNFHAFLRIPYAEPPIDNLRFLAPVRKQAWTGMWNATYW  82
            CE+  +  G ++G   +S     + +F +IP+A+PP+  LRF APV    W+G+ + T++
Sbjct  11   CELT-LPVGQIKGVKRLSLYDDPYFSFEKIPFAKPPLGELRFRAPVPADPWSGVLDCTHY  69

Query  83   SPICVQNTPSSAD-EMSEDCLYMNVFSKNLTGS--MPVIVYIHGGSFAYGDAKSQA-GPQ  138
            +    Q    + + E  EDCLY+NV+SK L     +PV+VYI+GG+F  G+A  +  GP 
Sbjct  70   AEKPTQRGLLTREIEGGEDCLYLNVYSKQLKSEKPLPVMVYIYGGAFTVGEATRELYGPD  129

Query  139  YLMDREVVLVSFNYRLGALGFMAVG--TREIPGNAAMKDMALVLQWVNRNIVKFGGNPNK  196
            Y M ++VVLV+ NYR+  LGF+++   + ++PGNA +KD  L L+WV + I  F G+ + 
Sbjct  130  YFMTKDVVLVTLNYRVDCLGFLSLKDPSLKVPGNAGLKDQVLALKWVKQYISNFNGDDSN  189

Query  197  VTLMGWSAGAIAVHALMLSPMVDGLFHRVVAISEALAGL-RSLPYEYSSLALRYGERLNC  255
            +T+ G SAG  + H +M +    GLFH+ + +S  +     + P E    A R  ++ N 
Sbjct  190  ITVFGESAGGCSTHFMMCTEQTRGLFHKAIPMSGTVHNYWANNPAE--DFAFRLAQQ-NG  246

Query  256  PTSEID--LLIACLRDKPATDLVSISFRDHPICATTGGTFYL--TIEPELGQERFLTDDP  311
             T E D   ++  L+  PA DLV+ +    P     G  F    T+E  +G++  +   P
Sbjct  247  FTGENDDAKVLEYLQGVPARDLVNHNLLT-PEHRRNGLLFAFGPTVEAYVGEDCVVPKPP  305

Query  312  PKLFANGNFSRVPMIIGRTSEE-----ETITAFELLNSPRLDDLNDDFNEVGPY---CFG  363
             ++  +   +  P+++G TS E       ++A    N   LD L+ D   + P       
Sbjct  306  VEMARDAWSNNFPVMLGGTSFEGLFMYPAVSA----NLKALDSLSQDPTRLVPVDVRTVS  361

Query  364  YEGGNTPKSRAISAAIKNYLP------FDVIDVRSVNALVHLFGDTFTGFGQHIFVHRIN  417
             E  N   S+ +  A   Y P       +++D  S     H F  TF             
Sbjct  362  SEKENLEYSQRLMKAYFGYSPPSSELLLNMLDFYSYKIFWHGFNRTFNA-------RLTY  414

Query  418  QYIPVYYYKFSYVG------RFSFCNNPQEKPYGVEHGDDLQYIFHLNFLNNNFPIIEHS  471
               P YYY+F +        R  FC +  +   GV H DDL Y+F     N     ++ +
Sbjct  415  AKAPTYYYRFDFDSPNFNFYRAKFCGDKIKT--GVAHADDLSYLFR----NAGSWKLDKT  468

Query  472  APENFMVERMTRMFEHFADNGNPNYND-SEVHW-PVHHNETEYYLDIGTHMVEKNGLYLE  529
            + E   +ERM  ++  FA   NPN  +   + W P   N+ +  ++I + +   +    E
Sbjct  469  SAEYRTIERMIGIWTAFAATSNPNCPEIGHLEWKPSTKNDPKRVINISSDVTIIDLPEYE  528

Query  530  RYTIW  534
            +  IW
Sbjct  529  KLQIW  533



Lambda      K        H
   0.327    0.141    0.438 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4509870700


Query= XP_037024083.1 uncharacterized protein LOC119065980 [Bradysia
coprophila]

Length=193
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q38BM1_TRYB2  unnamed protein product                                 28.5    4.3  


>Q38BM1_TRYB2 unnamed protein product
Length=1022

 Score = 28.5 bits (62),  Expect = 4.3, Method: Composition-based stats.
 Identities = 21/71 (30%), Positives = 28/71 (39%), Gaps = 2/71 (3%)

Query  122  RKQYGNWYHPCPVSGRRYEIDAPMDSNKIPAVAVNGGYRLDVIGFTFIDGVKKEFRLTHH  181
            RK  GN    CP SGR     A M     PA  ++G      +G T I  +    R+ ++
Sbjct  4    RKDTGN--SNCPRSGRTIIRSAVMSLPATPAPLLDGNGHTSTVGPTSIKTIATRRRVMYN  61

Query  182  FGEYRLKSNRG  192
               Y    N G
Sbjct  62   SPSYAAGDNSG  72



Lambda      K        H
   0.327    0.141    0.438 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4509870700


Query= XP_037024084.1 uncharacterized protein LOC119065981 [Bradysia
coprophila]

Length=277
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O76894_DROME  unnamed protein product                                 40.4    0.002
M9MS86_DROME  unnamed protein product                                 39.7    0.002
M9NG70_DROME  unnamed protein product                                 35.4    0.046


>O76894_DROME unnamed protein product
Length=1795

 Score = 40.4 bits (93),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 28/56 (50%), Gaps = 2/56 (4%)

Query  204  YDPNQGECVF-ECKRPGHFQDPTNCYYYYVCS-ASLGTFKAERIKCPPNYYFDGER  257
            Y P   E  F EC   G F+ PT+C  YY C     GT+   R KCP +  FD ER
Sbjct  209  YIPQNCELKFPECAEEGTFRSPTDCALYYTCRLQESGTYLQTRFKCPGSNSFDLER  264


>M9MS86_DROME unnamed protein product
Length=1144

 Score = 39.7 bits (91),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 40/162 (25%), Positives = 54/162 (33%), Gaps = 47/162 (29%)

Query  98   RCTSPGIFPDPTNCSRYVSCDENSVGGEGVALECAKGFFYNSEINICQMGRLTPHSKVCN  157
            +C   G FP P +C  Y  CD+N    +     C  G  ++     C  G   P +++  
Sbjct  148  QCQKEGRFPHPHDCKVYYRCDKNRT--QPWLFACPAGTIFSPVERKCLPGDQCPSTEI--  203

Query  158  TVDCSQKTNEVVVYRSNPTYYAFCFVDPETSRRETMMFKCDSNDELYDPNQGECVF-ECK  216
                                                     S+   Y P   E  F EC 
Sbjct  204  -----------------------------------------SDSGSYIPQNCELKFPECA  222

Query  217  RPGHFQDPTNCYYYYVCS-ASLGTFKAERIKCPPNYYFDGER  257
              G F+ PT+C  YY C     GT+   R KCP +  FD ER
Sbjct  223  EEGTFRSPTDCALYYTCRLQESGTYLQTRFKCPGSNSFDLER  264


>M9NG70_DROME unnamed protein product
Length=1367

 Score = 35.4 bits (80),  Expect = 0.046, Method: Compositional matrix adjust.
 Identities = 17/61 (28%), Positives = 26/61 (43%), Gaps = 3/61 (5%)

Query  94   ASTFRCTSPGIFPDPTNCSRYVSCDENSVGGEGVALE---CAKGFFYNSEINICQMGRLT  150
             S F+C   G F  P +C +Y  C ++   G G+      C  G ++N   + C   R  
Sbjct  501  GSDFKCEEEGFFQHPRDCKKYYWCLDSGPSGLGIVAHMFTCPSGLYFNPAADSCDFARNV  560

Query  151  P  151
            P
Sbjct  561  P  561


 Score = 33.1 bits (74),  Expect = 0.27, Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 2/48 (4%)

Query  99    CTSPGIFPDPTNCSRYVSCD--ENSVGGEGVALECAKGFFYNSEINIC  144
             C + G FP P NC +++SC   E + G  G    C KG  Y+    +C
Sbjct  1309  CRAQGNFPHPLNCRKFISCARFEETGGIVGWEYTCPKGLTYDGVGGMC  1356


 Score = 30.8 bits (68),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 17/46 (37%), Positives = 22/46 (48%), Gaps = 5/46 (11%)

Query  213  FECKRPGHFQDPTNCYYYYVC----SASLGTFKAERIKCPPNYYFD  254
            F+C+  G FQ P +C  YY C     + LG   A    CP   YF+
Sbjct  504  FKCEEEGFFQHPRDCKKYYWCLDSGPSGLGIV-AHMFTCPSGLYFN  548



Lambda      K        H
   0.327    0.141    0.438 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4509870700


Query= XP_037024085.1 tctex1 domain-containing protein 1-like [Bradysia
coprophila]

Length=125
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q18917_CAEEL  unnamed protein product                                 51.6    2e-09
DYHC_CAEEL  unnamed protein product                                   29.3    1.0  
Q9VUK1_DROME  unnamed protein product                                 28.9    1.0  


>Q18917_CAEEL unnamed protein product
Length=123

 Score = 51.6 bits (122),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 57/116 (49%), Gaps = 5/116 (4%)

Query  13   TYCLEPKVPFDKFE---CERLMETVINEAMLGFQ-FEAEEAEVMSEKLSKEILQKVKSLT  68
             + L P  P  KF       +++ ++ E +     +  +EAE++S+ +S  I +++K L 
Sbjct  8    NFVLRP-TPGQKFRPKAVAGMIQEILGEKLGALTIYNVDEAELVSKDISASIRERLKGLQ  66

Query  69   YDRYKFVCVVTLGEKYMQGYCDIFKCLWDMSKDSFAIYLYDTATLFVSAVLFAVYF  124
              RYK+V    + E+   G     +C+WD   D +    Y T +++   ++FA++ 
Sbjct  67   LPRYKYVIQTMIAEQCGNGATTAVQCVWDEDCDGYLTQRYVTGSIWCEVLVFAIFH  122


>DYHC_CAEEL unnamed protein product
Length=4568

 Score = 29.3 bits (64),  Expect = 1.0, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 21/29 (72%), Gaps = 0/29 (0%)

Query  39    MLGFQFEAEEAEVMSEKLSKEILQKVKSL  67
             MLG Q +AEE +  SE+L KE+ +++K +
Sbjct  3186  MLGDQQKAEEEKKFSEQLQKELAEQLKQM  3214


>Q9VUK1_DROME unnamed protein product
Length=211

 Score = 28.9 bits (63),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 25/44 (57%), Gaps = 0/44 (0%)

Query  29   RLMETVINEAMLGFQFEAEEAEVMSEKLSKEILQKVKSLTYDRY  72
            R+M T+  + + G Q  AEE+  +S++ S EI Q  +    D+Y
Sbjct  90   RIMPTINGQIVEGPQSSAEESHEISQEFSHEISQSDEESGEDQY  133



Lambda      K        H
   0.327    0.141    0.438 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4509870700


Query= XP_037024086.1 facilitated trehalose transporter Tret1-like
[Bradysia coprophila]

Length=466
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TRET1_BOMMO  unnamed protein product                                  262     4e-82
TRE12_DROME  unnamed protein product                                  257     3e-80
Q8IQH6_DROME  unnamed protein product                                 252     2e-78


>TRET1_BOMMO unnamed protein product
Length=505

 Score = 262 bits (670),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 160/470 (34%), Positives = 258/470 (55%), Gaps = 11/470 (2%)

Query  3    KDDPKPIKTADTYFF---QYFVAFSASLLSFSVNVAYGWTSPTLPLLMNPDKSPIPITSD  59
             +D  P K+     F   Q   AF+ S+ S +V  + G+TSP + L MN     + IT +
Sbjct  33   NEDGTPYKSTTQKLFLWTQLLAAFAVSVGSMNVGFSSGYTSPAV-LTMNIT---LDITKE  88

Query  60   EGSWIVAIYVIGTIVITIPVAYSMEKLGRKITLLLGAVPLVIGWILIGVSQSVTVIYIAR  119
            E +W+  +  +  +V  I     +E LGRK T++  AVP  IGW+LI  + +V +++  R
Sbjct  89   EITWVGGLMPLAALVGGIVGGPLIEYLGRKKTIMGTAVPFTIGWMLIANAINVVMVFAGR  148

Query  120  VLCGFTHGLSYSVLPMYLAEIASDKVRGSITIMLTVMAKFGILCSYAIGSYTDYRTTAWI  179
            V+CG   G+     P+Y+ E    +VRG++ ++ T     GIL ++ +GSY D+   A+ 
Sbjct  149  VICGVCVGIVSLAFPVYIGETIQPEVRGALGLLPTAFGNTGILLAFLVGSYLDWSNLAFF  208

Query  180  GMAPPIVFVIFFIWLPDSPYFLIGKNRDKDALISLEKLRGHKDVQSEYEMMHSAVRKSEE  239
            G A P+ F +  I  P++P + + K R ++A  SL  LRG K+V  E EM    + ++E 
Sbjct  209  GAAIPVPFFLLMILTPETPRWYVSKARVQEARKSLRWLRG-KNVNIEKEMRDLTISQTES  267

Query  240  NK---GTFKEIMSWDNLHAIVIILGLAAVQQLCGSQAVISYAQIIFDEVGSDLGGAESTI  296
            ++     FK++ S   L A++I LGL   QQL G  AVI YA  IF   GS +    ++I
Sbjct  268  DRTGGNAFKQLFSKRYLPAVMISLGLMLFQQLTGINAVIFYAASIFQMSGSSVDENLASI  327

Query  297  VLAVVQLAAAALSSVTVDKFGRKPLLMFSVLAPAICNTIVGVYFYLRANGQDVSGLAWLP  356
            ++ VV   +  ++++ +D+ GRK LL  S +A       +G YFYL+ N  DV+   WLP
Sbjct  328  IIGVVNFISTFIATMLIDRLGRKVLLYISSVAMITTLLALGAYFYLKQNHIDVTAYGWLP  387

Query  357  MTAIMIFIVAYSLGLASVAFVVLGEVFPKNLRATAGAVFTIFASAIGFGVAKMFQIVSDD  416
            +  ++I+++ +S+G   + +++LGE+ P  +R TA ++ T F     F V K FQ + D 
Sbjct  388  LACLVIYVLGFSIGFGPIPWLMLGEILPSKIRGTAASLATGFNWTCTFIVTKTFQNIIDA  447

Query  417  IGIYATFWIFAGFSYLFVPFIWFVLPETKGKSLDTILEELRPKKRATKMI  466
            I ++ T W+FA      + F+ F +PETKGKSL+ I  +L    R  + I
Sbjct  448  IYMHGTLWLFAVICIGGLLFVIFFVPETKGKSLEEIEMKLTSGSRRVRNI  497


>TRE12_DROME unnamed protein product
Length=488

 Score = 257 bits (656),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 154/450 (34%), Positives = 249/450 (55%), Gaps = 7/450 (2%)

Query  12   ADTYFFQYFVAFSASLLSFSVNVAYGWTSPTLPLLMNPDKSPIPITSDEGSWIVAIYVIG  71
            A+  F Q   A S SL S  V     +TSP L  + +   +   +T D GSW+  I  + 
Sbjct  22   ANFTFSQVLAALSVSLCSLVVGFVSAYTSPALVSMTDRTITSFEVTKDAGSWVGGIMPLA  81

Query  72   TIVITIPVAYSMEKLGRKITLLLGAVPLVIGWILIGVSQSVTVIYIARVLCGFTHGLSYS  131
             +   I     +E LGR+ T+L  AVP ++  +LI  + +V +I   R L GF  G++  
Sbjct  82   ALAGGITGGPLIEYLGRRSTILATAVPFIVSSLLIACAVNVIMILCGRFLTGFCVGIASL  141

Query  132  VLPMYLAEIASDKVRGSITIMLTVMAKFGILCSYAIGSYTDYRTTAWIGMAPPIVFVIFF  191
             LP+YL E    +VRG++ ++ T +   GIL  Y  GS+ ++   A++G A P+ F+I  
Sbjct  142  SLPVYLGETLQPEVRGTLGLLPTALGNIGILVCYVAGSFMNWSMLAFLGAALPVPFLILM  201

Query  192  IWLPDSPYFLIGKNRDKDALISLEKLRGHK-DVQSEY-EMMHS---AVRKSEENKGTFKE  246
            I +P++P + + + +++ A  +L+ LRG + DV+ E  E+M S   A R++ +N  T  E
Sbjct  202  IIIPETPRWFVNRGQEERARKALKWLRGKEADVEPELKELMQSQADADRQATQN--TCLE  259

Query  247  IMSWDNLHAIVIILGLAAVQQLCGSQAVISYAQIIFDEVGSDLGGAESTIVLAVVQLAAA  306
            +   +NL  + I LGL   QQ  G  AVI Y   IF + GS +    STI++ VV   A 
Sbjct  260  LFKRNNLKPLSISLGLMFFQQFSGINAVIFYTVQIFKDAGSTIDSNLSTIIVGVVNFFAT  319

Query  307  ALSSVTVDKFGRKPLLMFSVLAPAICNTIVGVYFYLRANGQDVSGLAWLPMTAIMIFIVA  366
             +  + +D+ GRK LL  S +A  +  +I+G +FY +A+G DVS L WLP+T  +I+I+ 
Sbjct  320  FMGIILIDRLGRKILLYVSDIAMIVTLSILGGFFYCKAHGPDVSHLGWLPLTCFVIYILG  379

Query  367  YSLGLASVAFVVLGEVFPKNLRATAGAVFTIFASAIGFGVAKMFQIVSDDIGIYATFWIF  426
            +SLG   + ++++GE+ P  +R  A +V T F     F V K FQ ++  +G +  FW+F
Sbjct  380  FSLGFGPIPWLMMGEILPAKIRGPAASVVTAFNWFCTFVVTKTFQDLTVAMGAHGAFWLF  439

Query  427  AGFSYLFVPFIWFVLPETKGKSLDTILEEL  456
                 + + F+   +PET+GKSL+ I  ++
Sbjct  440  GAICIVGLFFVIIFVPETRGKSLEEIERKM  469


>Q8IQH6_DROME unnamed protein product
Length=471

 Score = 252 bits (644),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 142/439 (32%), Positives = 251/439 (57%), Gaps = 14/439 (3%)

Query  37   GWTSPTLPLLMNPDKS-PIPITSDEGSWIVAIYVIGTIVITIPVAYSMEKLGRKITLLLG  95
            GWTSP    +++  +    P+  D+ SW+ +   +G   + IP+ + +  +GRK T+L  
Sbjct  34   GWTSPAETEIVDRGEGYDFPVDKDQFSWVGSAMTLGAACVCIPIGFLINMIGRKWTMLFL  93

Query  96   AVPLVIGWILIGVSQSVTVIYIARVLCGFTHGLSYSVLPMYLAEIASDKVRGSITIMLTV  155
             +P ++GW ++  + +V+++Y +R + G   G      PMY  EIA  ++RG++     +
Sbjct  94   VLPFILGWTMLIWAVNVSMLYASRFILGIAGGAFCVTAPMYTGEIAQKEIRGTLGSFFQL  153

Query  156  MAKFGILCSYAIGSYTDYRTTAWIGMAPPIVFVIFFIWLPDSPYFLIGKNRDKDALISLE  215
            M   GIL  YA+G+       + I    P++F   F ++P+SP +L+ K+R ++A+ S++
Sbjct  154  MITIGILFVYAVGAGVKIFWLSIICGILPLIFGAIFFFMPESPTYLVSKDRSENAIKSIQ  213

Query  216  KLRGHK-DVQSEYEMMHSAVRKSEENKGTFKEIMSWDNLH------AIVIILGLAAVQQL  268
             LRG + D + E   +    R+++ NK     +  W  L+      A+ I +GL   QQ+
Sbjct  214  WLRGKEYDYEPELAELRETDRETKANK-----VNVWAALNRPVTRKALAISMGLMFFQQV  268

Query  269  CGSQAVISYAQIIFDEVGSDLGGAESTIVLAVVQLAAAALSSVTVDKFGRKPLLMFSVLA  328
            CG  AVI YA  IF E  + +    +TI++ ++Q+ A  +S++ VDK GR+ LL+ S ++
Sbjct  269  CGINAVIFYASRIFLEANTGIEAEWATILIGIMQVVATFVSTLVVDKLGRRILLLASGIS  328

Query  329  PAICNTIVGVYFYL-RANGQDVSGLAWLPMTAIMIFIVAYSLGLASVAFVVLGEVFPKNL  387
             AI  T +GVYF+L + +   V  L WLP+ ++ +FI+ +S+G   V ++++GE+F  ++
Sbjct  329  MAISTTAIGVYFFLQKQDAAQVVSLGWLPVASLCLFIIMFSIGYGPVPWLMMGELFATDI  388

Query  388  RATAGAVFTIFASAIGFGVAKMFQIVSDDIGIYATFWIFAGFSYLFVPFIWFVLPETKGK  447
            +  AG++       + F V K F  ++D +GI  TFW+FAG + + V F++F +PETKGK
Sbjct  389  KGFAGSLAGTSNWLLAFVVTKTFVNLNDGLGIGGTFWLFAGLTVVGVIFVYFAVPETKGK  448

Query  448  SLDTILEELRPKKRATKMI  466
            SL+ I +EL   +   + I
Sbjct  449  SLNEIQQELAGNRSTPQAI  467



Lambda      K        H
   0.327    0.141    0.438 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4509870700


Query= XP_037024087.1 uncharacterized protein LOC119065985 [Bradysia
coprophila]

Length=309
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q386Z1_TRYB2  unnamed protein product                                 29.6    3.6  


>Q386Z1_TRYB2 unnamed protein product
Length=831

 Score = 29.6 bits (65),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 24/76 (32%), Positives = 37/76 (49%), Gaps = 13/76 (17%)

Query  62   GNCRLFTKLTIDTGTKQVVPTNP---TAVSSVQVSPKANRRFSSDELREAIDNVDISSDA  118
            GN  +   L  DT +    P  P    AVS  + +P   R      L+EAIDN  + +  
Sbjct  407  GNNEILQLLLSDTAS----PRGPDFFAAVSRTKDTPTKKRALCL--LQEAIDNASVKA--  458

Query  119  VNDQITEIGEIESGTD  134
              D++T +G +ESG++
Sbjct  459  --DKVTLLGLLESGSE  472



Lambda      K        H
   0.327    0.141    0.438 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4509870700


Query= XP_037024088.1 39S ribosomal protein L44, mitochondrial-like
[Bradysia coprophila]

Length=142
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q57UN2_TRYB2  unnamed protein product                                 30.0    0.62 
BALAT_DROME  unnamed protein product                                  29.3    1.3  
Q55AK6_DICDI  unnamed protein product                                 27.3    5.9  


>Q57UN2_TRYB2 unnamed protein product
Length=746

 Score = 30.0 bits (66),  Expect = 0.62, Method: Composition-based stats.
 Identities = 29/110 (26%), Positives = 55/110 (50%), Gaps = 6/110 (5%)

Query  16   VVSDTPNAITISTSYR---RNRNSRLLALKIPSRILRINGVRAVRDYLLSDEVLANVSRH  72
            V+ D    I +S  ++   +  ++R+L      ++ R+ GV AV   L   E   N +R 
Sbjct  499  VLYDGNTTIPMSEDHKPLNKKEHTRILQCGGFVQLGRVCGVLAVSRALGDYEFKFNGNRF  558

Query  73   IGTKDLILTAEFPPDKSTLANTFKAVVGA---LNKSSGNEKSFEFVRDFL  119
            I  ++L+++      +  L ++ K ++ A   L  +  NE++ +FVRDFL
Sbjct  559  ISNRELMVSNVADVRQINLTDSSKFLLLACDGLWDAVQNEEATQFVRDFL  608


>BALAT_DROME unnamed protein product
Length=604

 Score = 29.3 bits (64),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 37/80 (46%), Gaps = 17/80 (21%)

Query  9    MIWFCLIVVSDTPNAITISTSYRRNRNSRLLALKIPSRILRINGVRAVRDYL--------  60
            M++ C  V+ ++P  +      RR       A+KI   + R+NGVR  RD++        
Sbjct  280  MLFSCFFVLPESPRWLMAVGKTRR-------AIKILKVMARVNGVRVNRDFVERLQRKLV  332

Query  61   --LSDEVLANVSRHIGTKDL  78
               + E  ++++ H G  DL
Sbjct  333  ITRAAETKSSMTTHYGILDL  352


>Q55AK6_DICDI unnamed protein product
Length=1618

 Score = 27.3 bits (59),  Expect = 5.9, Method: Compositional matrix adjust.
 Identities = 10/42 (24%), Positives = 25/42 (60%), Gaps = 0/42 (0%)

Query  100  GALNKSSGNEKSFEFVRDFLFTQLNQKDIESMWDIERPIELL  141
            G +   + ++++ E V   +   LN+  +E ++++E+ IE+L
Sbjct  558  GGIKMEANSKENLEIVSAIVMNLLNKSKVEHVYEVEKEIEIL  599



Lambda      K        H
   0.327    0.141    0.438 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4509870700


Query= XP_037024089.1 uncharacterized protein LOC119065988 [Bradysia
coprophila]

Length=1288
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RRP1_DROME  unnamed protein product                                   34.7    0.63 


>RRP1_DROME unnamed protein product
Length=679

 Score = 34.7 bits (78),  Expect = 0.63, Method: Compositional matrix adjust.
 Identities = 33/104 (32%), Positives = 54/104 (52%), Gaps = 8/104 (8%)

Query  240  VEATTKRSTSTKRSKASKRSKAT-KTQQDSADEAGDADEETTKRSTSTKRSKASKRSKVT  298
            +E  TK   + +R+K   +  A  K Q+ SAD+     EE  K ST TK +K  K++ V 
Sbjct  298  LEPKTKAKPTKQRAKKEGKEPAPGKKQKKSADKENGVVEEEAKPSTETKPAKGRKKAPV-  356

Query  299  KTQQDSADEAGDADEATTKRSTSTKRSK-ASKAQQRKDDDENGN  341
                  A++  D +EA  +   +  R K A+KA++   D+E+G+
Sbjct  357  -----KAEDVEDIEEAAEESKPARGRKKAAAKAEEPDVDEESGS  395



Lambda      K        H
   0.327    0.141    0.438 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4509870700


Query= XP_037024090.1 glucose dehydrogenase [FAD, quinone]-like [Bradysia
coprophila]

Length=577
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VY02_DROME  unnamed protein product                                 274     1e-83
Q9VY08_DROME  unnamed protein product                                 245     3e-72
Q6NR10_DROME  unnamed protein product                                 244     4e-72


>Q9VY02_DROME unnamed protein product
Length=633

 Score = 274 bits (700),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 200/607 (33%), Positives = 305/607 (50%), Gaps = 55/607 (9%)

Query  3    QETDFKNTMLELENEHNVPIVKTYDFIVVGGGSAGSVLAGRLSE--RFDVLLLEAGGTPP  60
            Q  D  +    + + H   + ++YDFIV+GGGSAG VLA RLSE   + VLLLEAGG  P
Sbjct  34   QRPDIVDEQHRVRSIHIEDLRESYDFIVIGGGSAGCVLAARLSENPEWSVLLLEAGGDEP  93

Query  61   PAVDVPLFASVISQSPSINYDFTSVPQTNASLCRNGIIRKT---TGKMLGGSGSHNVMIH  117
              +D+P    V  +SP   +D+  + + +   C     ++      K+LGG  S N M++
Sbjct  94   LLIDLPQLYPVFQRSP---WDWKYLTEPSDRYCLAMEDQRCFWPRAKVLGGCSSINAMMY  150

Query  118  SRGSPKDYDNWASLLNDDSFNYTNVLKYFRRMETFIGYKFGDEGDEYYGNDGPIVVDTHI  177
             RG+ +DYD WA+L N   +NY N+L YFR++E      F  E   Y+G+ GPI V+ + 
Sbjct  151  IRGNRRDYDQWAALGNP-GWNYDNILHYFRKLEDMRVPGF--EHSPYHGHGGPISVERYR  207

Query  178  IP--MLDLWLLAGQELG--YPTGDSNGFQRESFAPFNIAVNNGRRSSSYAEYIRPHEELR  233
             P  +LD+++ A Q+LG  +P GD NG  +  FAP + ++ +G R S+   YIR   + R
Sbjct  208  FPSPLLDIFMRAAQQLGMVHPDGDFNGRSQTGFAPPHGSLRDGLRCSANKGYIRRSWQ-R  266

Query  234  STLTVHRYANVSQILLNDK-REAYGVTYIRNRFPQMALARNEIILSAGAFSSPLLLMKSG  292
              L +   A V +I+++ +   A GV +          A+ E+ILSAG+ +SP LLM SG
Sbjct  267  PNLDIVLKAFVERIVIDPQSHRAIGVIFEYGLLKHTVRAKREVILSAGSLASPQLLMVSG  326

Query  293  IGPESILNEAEIPVKVPLEAVGKHLQDH--TMFPLFGFSTNDSSAFQKIDSSEI-EKIMT  349
            +GP   L    IPV   L  VG +LQDH  T   ++ F +  +     I    + E+ + 
Sbjct  327  VGPRDQLEPQGIPVVQHLPGVGGNLQDHISTSGAIYTFDSGQNRHLSFIVPEMMNEQAVE  386

Query  350  DFHNGKGPL--TTTGVGCHSFIVSSKADPH--WPNFRIDLTV-------GMLAQ------  392
            DF  G               F  +   DP   WP+ +I +         GM+ +      
Sbjct  387  DFVQGSDSFFYAMPVSEVMGFFSTRYQDPRLDWPDVQIFMGSYGYGADGGMIGRRGAAIT  446

Query  393  ---LAETKPTV----GFIV--VLSRPKSIGSLTMDTDKYRAGIRDDEQLAIIDYNILTHP  443
                AE    V     F++  +L RP+S G L + +        D +   +I  N    P
Sbjct  447  LDNYAEAFEPVLYQDSFVIAPLLMRPRSRGYLQLRSA-------DPKVHPLIHANYYDDP  499

Query  444  DDIDVILEGIRLVFNIIETQAFRSINVTFIGQPDPACNQFKFLSDDYWKCKIQQDGNSWT  503
             D+ V++EG++L   + +T   +S+N T        C + ++LSD +W+C  +    +  
Sbjct  500  HDMAVMVEGLKLAHRLTQTPVMQSLNATMNIYEWRNCPEVEYLSDAFWECLARFYSQTIY  559

Query  504  HMAGTCSLGPDTGHSNTSVVDTKFRVRGVSNLRVIDASVIPEITNSNVNAPIMMLAEKAA  563
            H  GTC + P +      VVD + RVRG+  LRVIDAS++P I   N NAP +MLAE+ A
Sbjct  560  HPVGTCKMAPAS--DPAGVVDPRLRVRGMRGLRVIDASIMPTIPTGNTNAPTLMLAERGA  617

Query  564  EEIMNSY  570
            + I   +
Sbjct  618  DIIKEDW  624


>Q9VY08_DROME unnamed protein product
Length=703

 Score = 245 bits (625),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 176/576 (31%), Positives = 286/576 (50%), Gaps = 46/576 (8%)

Query  26   YDFIVVGGGSAGSVLAGRLSE--RFDVLLLEAGGTPPPAVDVPLFASVISQSPSINYDFT  83
            YDFIVVG GSAG+V+A RLSE  ++ VLL+EAG       DVP  A+ +  S  +++ + 
Sbjct  57   YDFIVVGSGSAGAVVANRLSEVRKWKVLLIEAGPDENEISDVPSLAAYLQLS-KLDWAYK  115

Query  84   SVPQTNASL-CRNGIIRKTTGKMLGGSGSHNVMIHSRGSPKDYDNWASLLNDDSFNYTNV  142
            + P T A L  +N       G++LGGS   N M++ RG+  DYD+WASL N   ++Y NV
Sbjct  116  TEPSTKACLGMQNNRCNWPRGRVLGGSSVLNYMLYVRGNRHDYDHWASLGNP-GWDYDNV  174

Query  143  LKYFRRMETFIGYKFGDEGDEYYGNDGPIVVDTHII--PMLDLWLLAGQELGYPTGDSNG  200
            L+YF++ E        +  ++Y+G  G + V       P++  ++ AG +LGY   D NG
Sbjct  175  LRYFKKSEDNRNPYLAN--NKYHGRGGLLTVQESPWHSPLVAAFVEAGTQLGYDNRDING  232

Query  201  FQRESFAPFNIAVNNGRRSSSYAEYIRPHEELRSTLTVHRYANVSQILLN-DKREAYGVT  259
             ++  F      +  G R S+   ++RP   +R    +   ++V+++++      A  V 
Sbjct  233  AKQAGFMIAQGTIRRGSRCSTAKAFLRP-IRMRKNFHLSMNSHVTRVIIEPGTMRAQAVE  291

Query  260  YIRNRFPQMALARNEIILSAGAFSSPLLLMKSGIGPESILNEAEIPVKVPLEAVGKHLQD  319
            ++++       AR E+I+SAGA ++P L+M SG+GP   L +  I V   L  VG+++QD
Sbjct  292  FVKHGKVYRIAARREVIISAGAINTPQLMMLSGLGPRKHLEKHGIRVLQDL-PVGENMQD  350

Query  320  HTMFPLFGFSTNDSSAFQKIDSSEIEKIMTDFHNGKGPLTTTG-VGCHSFIVS--SKADP  376
            H       F  +   A  +   +            +GP+TT G V   +F+ +  S    
Sbjct  351  HVGMGGLTFLVDKPVAIVQDRFNPTAVTFQYVLRERGPMTTLGGVEGLAFVHTPYSNRSL  410

Query  377  HWPNF---------------RIDLTVGMLAQLAE-------TKPTVGFIVVLSRPKSIGS  414
             WP+                R+   +G+   + +        K +   + +L RP+S GS
Sbjct  411  DWPDIQFHMAPASINSDNGARVKKVLGLKESVYQEVYHPIANKDSWTIMPLLLRPRSRGS  470

Query  415  LTMDTDKYRAGIRDDEQLAIIDYNILTHPDDIDVILEGIRLVFNIIETQAFRSINVTFIG  474
            + + +        +     +I+ N    P D   ++EG ++   + E Q F+        
Sbjct  471  VKLRSA-------NPFHYPLINANYFDDPLDAKTLVEGAKIALRVAEAQVFKQFGSRLWR  523

Query  475  QPDPACNQFKFLSDDYWKCKIQQDGNSWTHMAGTCSLGPDTGHSNTSVVDTKFRVRGVSN  534
            +P P C Q KFLSD Y +C ++    +  H  GT  +GP       +VVD + RV GV  
Sbjct  524  KPLPNCKQHKFLSDAYLECHVRTISMTIYHPCGTAKMGP--AWDPEAVVDPRLRVYGVRG  581

Query  535  LRVIDASVIPEITNSNVNAPIMMLAEKAAEEIMNSY  570
            LRVIDAS++P I++ N NAP++M+AEK A+ I   +
Sbjct  582  LRVIDASIMPTISSGNTNAPVIMIAEKGADLIKEDW  617


>Q6NR10_DROME unnamed protein product
Length=703

 Score = 244 bits (624),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 176/576 (31%), Positives = 286/576 (50%), Gaps = 46/576 (8%)

Query  26   YDFIVVGGGSAGSVLAGRLSE--RFDVLLLEAGGTPPPAVDVPLFASVISQSPSINYDFT  83
            YDFIVVG GSAG+V+A RLSE  ++ VLL+EAG       DVP  A+ +  S  +++ + 
Sbjct  57   YDFIVVGSGSAGAVVANRLSEVRKWKVLLIEAGPDENEISDVPSLAAYLQLS-KLDWAYK  115

Query  84   SVPQTNASL-CRNGIIRKTTGKMLGGSGSHNVMIHSRGSPKDYDNWASLLNDDSFNYTNV  142
            + P T A L  +N       G++LGGS   N M++ RG+  DYD+WASL N   ++Y NV
Sbjct  116  TEPSTKACLGMQNNRCNWPRGRVLGGSSVLNYMLYVRGNRHDYDHWASLGNP-GWDYDNV  174

Query  143  LKYFRRMETFIGYKFGDEGDEYYGNDGPIVVDTHII--PMLDLWLLAGQELGYPTGDSNG  200
            L+YF++ E        +  ++Y+G  G + V       P++  ++ AG +LGY   D NG
Sbjct  175  LRYFKKSEDNRNPYLAN--NKYHGRGGLLTVQESPWHSPLVAAFVEAGTQLGYDNRDING  232

Query  201  FQRESFAPFNIAVNNGRRSSSYAEYIRPHEELRSTLTVHRYANVSQILLN-DKREAYGVT  259
             ++  F      +  G R S+   ++RP   +R    +   ++V+++++      A  V 
Sbjct  233  AKQAGFMIAQGTIRRGSRCSTAKAFLRP-IRMRKNFHLSMNSHVTRVIIEPGTMRAQAVE  291

Query  260  YIRNRFPQMALARNEIILSAGAFSSPLLLMKSGIGPESILNEAEIPVKVPLEAVGKHLQD  319
            ++++       AR E+I+SAGA ++P L+M SG+GP   L +  I V   L  VG+++QD
Sbjct  292  FVKHGKVYRIAARREVIISAGAINTPQLMMLSGLGPRKHLEKHGIRVLQDL-PVGENMQD  350

Query  320  HTMFPLFGFSTNDSSAFQKIDSSEIEKIMTDFHNGKGPLTTTG-VGCHSFIVS--SKADP  376
            H       F  +   A  +   +            +GP+TT G V   +F+ +  S    
Sbjct  351  HVGMGGLTFLVDKPVAIVQDRFNPTAVTFQYVLRERGPMTTLGGVEGLAFVHTPYSNRSL  410

Query  377  HWPNF---------------RIDLTVGMLAQLAE-------TKPTVGFIVVLSRPKSIGS  414
             WP+                R+   +G+   + +        K +   + +L RP+S GS
Sbjct  411  DWPDIQFHMAPASINSDNGARVKKVLGLKESVYQEVYHPIANKDSWTIMPLLLRPRSRGS  470

Query  415  LTMDTDKYRAGIRDDEQLAIIDYNILTHPDDIDVILEGIRLVFNIIETQAFRSINVTFIG  474
            + + +        +     +I+ N    P D   ++EG ++   + E Q F+        
Sbjct  471  VKLRSA-------NPFHYPLINANYFDDPLDAKTLVEGAKIALRVAEAQVFKQFGSRLWR  523

Query  475  QPDPACNQFKFLSDDYWKCKIQQDGNSWTHMAGTCSLGPDTGHSNTSVVDTKFRVRGVSN  534
            +P P C Q KFLSD Y +C ++    +  H  GT  +GP       +VVD + RV GV  
Sbjct  524  KPLPNCKQHKFLSDAYLECHVRTISMTIYHPCGTAKMGP--AWDPEAVVDPRLRVYGVRG  581

Query  535  LRVIDASVIPEITNSNVNAPIMMLAEKAAEEIMNSY  570
            LRVIDAS++P I++ N NAP++M+AEK A+ I   +
Sbjct  582  LRVIDASIMPTISSGNTNAPVIMIAEKGADLIKEDW  617



Lambda      K        H
   0.327    0.141    0.438 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4509870700


Query= XP_037024091.1 rab5 GDP/GTP exchange factor [Bradysia coprophila]

Length=730
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9W0H9_DROME  unnamed protein product                                 538     0.0  
RME6_CAEEL  unnamed protein product                                   80.9    2e-15
Q55AA6_DICDI  unnamed protein product                                 72.8    5e-13


>Q9W0H9_DROME unnamed protein product
Length=696

 Score = 538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/729 (43%), Positives = 434/729 (60%), Gaps = 63/729 (9%)

Query  3    STKLPGLRI-DRDLKCKNGCGFYGNTQWDGLCSKCYRE-INLRERQAKAKSSSALPQRKE  60
            + + P LR+  +DLKC++GCGFYG  Q +GLCS C+RE  N ++R+ K       P    
Sbjct  4    AARPPSLRLGQQDLKCRSGCGFYGTPQNEGLCSMCFREKFNDKQRKLKQTGGETGPGSS-  62

Query  61   LQAVKAVLQGTTSQHHQQHRQHLQRHTQPDDTQRADSSNRRDDTASPRKDTSTKKRNLFE  120
              +  A L   + QH      HLQ   +    + +D       T   +K T+  ++ L  
Sbjct  63   --SSVATLDRRSPQH-----AHLQGKVEQQVRKPSDKEQDNLGTLQKKKFTAVLQKTL--  113

Query  121  VFKKPSNAKEVEKLRQVERSVHIVDKSELEYLETLKQLKVPDKAKKELKYLIQMLDGVIK  180
                 + A+++ + R      H+ D +E ++L  L+QL++PD  K++LK  IQ LD  I+
Sbjct  114  ----QAGAQKITQQRG-----HVPDPTEGQFLLQLRQLRIPDDGKRKLKLEIQRLDSDIR  164

Query  181  KKYHT---YNITEISECVQSSYVKLVNFMDSNESHLTSVSSEMKEYVIDFFEKVIMTKNH  237
            K  +     NI E+S+ VQ++Y K+ + +  N+      ++E ++  IDFFEKV+MT+NH
Sbjct  165  KYMNGNGGKNINELSDLVQNAYTKVSDIV-HNDPSFEIATNEDRDSAIDFFEKVVMTQNH  223

Query  238  KILFSPPFTNDEERDSEVKRRIQQLSWLNAKHLICSIDEVNSEVRDLVYNSITELVAMDS  297
            K LFSP FT DE+ D +V++RI+QLSW+ AKHL CSIDEVNSE RDLVYN+I+ELV +DS
Sbjct  224  KFLFSPYFTTDEDSDVKVQKRIRQLSWITAKHLDCSIDEVNSEARDLVYNAISELVGIDS  283

Query  298  FPTPQEKLDCIVRCCRSIFTLLKQTAGGPASADEFLPALIFVVLKANPIRLHSNINYITR  357
            + +PQEKL C  RCCR IF LLK+  GGPASAD+FLPALIFVVLKANP+RLHSNIN++TR
Sbjct  284  YYSPQEKLQCTWRCCRHIFELLKRATGGPASADDFLPALIFVVLKANPVRLHSNINFVTR  343

Query  358  FSNATRLMSGEGGYYFTNLCCAISFIEHLTYESLSMPQEEFESMMSGEKVYSSAWETALM  417
            F+NA+RLMSGE GYYFTNLC AI+FIE+L  ESL +  EEFE++MSG++ YS+ WE+AL+
Sbjct  344  FTNASRLMSGESGYYFTNLCSAIAFIENLNGESLGVSSEEFEALMSGQQPYSTPWESALL  403

Query  418  ACESFHSVSENLKTIEMLNERNDKVTTSVDVLNKDFDRLKEELSRKVTEVLNRTPLVLKP  477
            ACES H +SEN+K +EML +RN  +++ +    K+    + E++ +V  V+ + PL L P
Sbjct  404  ACESLHLISENMKRMEMLQKRNALISSGITSFEKELIDFQREVTERVDTVIAKAPLNLLP  463

Query  478  IQTPNSLQSGAMGHRNSLASKVEHPKNLISMAS-EDQPDNASTTSAPATSISNYASTSHF  536
            I+TP  L   A  H  + +    +  N++   S   Q   A+       + S  +  S  
Sbjct  464  IKTPAFLIGQARAHLLNESEAGHYQANMLHGGSLTSQSLTAAGGLVKPAAASKESGLSLK  523

Query  537  LSSSNHCTSVSPI--NTKPDLLNLIDNLIVDQPNASDMITIGDNSATDILSTP-PNLNFD  593
             +S +    +SP+  N +P           D   AS +       A  +L  P P+ N  
Sbjct  524  DTSMSSMGRLSPLQQNVQP----------ADHLFASPIFNYTAFDAVSLLEEPVPDAN--  571

Query  594  SFLDELLTPDEFPSLSLMNGGLTNINYDFDISDASAENSVADDNHKSVSLGLTLDEFDPL  653
               D L+   EF       GGLTNINYDFD+SD S ENS AD++       L LDEFDPL
Sbjct  572  --TDVLMLGSEF------QGGLTNINYDFDLSDQSGENSTADESK------LNLDEFDPL  617

Query  654  LNDSGKSSPVG-------MDAATN-LMDGGDSPTDTLLPSPLKPTVPPYKGFSAFDIPSI  705
                  + P         +D+ T+ L+D     T  LLPSPLKP V  Y+GFS FDIPSI
Sbjct  618  AQKGLVAKPPPPLPETSLLDSTTDSLIDSEVPGTAVLLPSPLKPEVSNYRGFSNFDIPSI  677

Query  706  SCQTGDFGS  714
            SC TGDF S
Sbjct  678  SCNTGDFSS  686


>RME6_CAEEL unnamed protein product
Length=1093

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 59/96 (61%), Gaps = 2/96 (2%)

Query  290   TELVAMDSFPTPQEKLDCIVRCCRSIFTLLKQTA-GGPASADEFLPALIFVVLKANPIRL  348
              EL  +D + T Q+KL+C+VRCC  I  L+  ++    ASAD+  P L+FV++KANP  L
Sbjct  996   AELSMLDIYVTAQDKLNCVVRCCDVINNLVALSSKNAVASADDLTPVLVFVIIKANPRAL  1055

Query  349   HSNINYITRFSNATRLMSGEGGYYFTNLCCAISFIE  384
              SN+ ++  F+   R+ SG   YY+ N   A+ +I+
Sbjct  1056  LSNVQFVETFA-GDRIESGRDAYYWVNFKSAVEYIK  1090


>Q55AA6_DICDI unnamed protein product
Length=715

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 62/103 (60%), Gaps = 2/103 (2%)

Query  291  ELVAMDSFPTPQEKLDCIVRCCRSIFTLLKQTA-GGPASADEFLPALIFVVLKANPIRLH  349
            EL+ +  F +P+EKL CI +  + +F LL +T       AD  LP +IF ++K+N   L 
Sbjct  477  ELLYISIFKSPREKLMCIKKSFKLLFQLLSKTQLPSVVGADLLLPIVIFCLIKSNLPFLW  536

Query  350  SNINYITRFSNATRLMSGEGGYYFTNLCCAISFIEHLTYESLS  392
            SN+ +I+ F + T L+  E  Y+   +  A SFIE++T+ESL+
Sbjct  537  SNLQFISLFRDPT-LIESETNYFLVTMITAASFIENMTFESLT  578



Lambda      K        H
   0.327    0.141    0.438 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4509870700


Query= XP_037024092.1 UDP-glucosyltransferase 2-like [Bradysia coprophila]

Length=478
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VGT3_DROME  unnamed protein product                                 320     4e-104
Q9V9X9_DROME  unnamed protein product                                 280     1e-88 
O17757_CAEEL  unnamed protein product                                 115     1e-27 


>Q9VGT3_DROME unnamed protein product
Length=528

 Score = 320 bits (821),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 180/481 (37%), Positives = 282/481 (59%), Gaps = 17/481 (4%)

Query  9    HEVTFVSPFPLNKPIKNCTEILLEHSWAGYKREVNNV------HFWDSFLNVLDYGTKLT  62
            H+VT +SPF L KPIKN  ++  +      +  + N+            +N  + G ++T
Sbjct  54   HQVTIISPFELKKPIKNIKDVPAKSILTSMQGRIANLLQSSKEPIIKQIINFHEMGIEIT  113

Query  63   GWATTSENLKELIRSDKTFDVIIIELIYGEALLGLGHHFNAPVIATSSFGAYKWTTDVVA  122
                   ++ EL++S++TFD +I E+   EA  G   HF AP+I   +FGA  W TD+V 
Sbjct  114  ELLLKEPSVIELMKSNQTFDAVISEVFLNEAHFGFAEHFKAPLIGLGTFGAISWNTDLVG  173

Query  123  SPVFSSFMPNTNNGYTDRMNFWQRMYNSASYWFDDIVMPLLSTSVQQRYLHDLFPNAKNM  182
            SP   S++P+    ++DRM+  +R+ N A   ++ I +       Q+      FPN  N 
Sbjct  174  SPSPPSYVPSALLKFSDRMSLVERVGNQAFLTYEYIFLNYFYLPRQEVLYRKYFPN--NK  231

Query  183  PTIAELKRNVSLVLLNTHWTVGTARPYPPNMIEVGGMHIDREIQPLPPNIQRFLDDAGRH  242
                ++++N +LVLLN H ++   RPY PNMIEVGGMHI+R+ QPLP +I  F++ A  H
Sbjct  232  QDFYDMRKNTALVLLNQHVSLSFPRPYSPNMIEVGGMHINRKRQPLPKDILEFIEGA-EH  290

Query  243  GAIYLALGSCIEFSKLSNDKKDAIINALAEYPQMRIIIKSEEMITIPSHKPTDILIGPWF  302
            G IY ++GS ++   L  +K+ A+I+  A+  Q R++ K E+   +P  KP ++ I  WF
Sbjct  291  GVIYFSMGSNLKSKTLPLEKRQALIDTFAQLKQ-RVLWKFEDT-DLPG-KPANVFISDWF  347

Query  303  LQQSILAHSSVKLFITHGGMLSTLEAVHYAKPVIGIPIVFDEYLNSAVAQQNRYGISIPF  362
             Q  ILAH +V  FITHGG+LST E++++ KP +GIPI  D++LN A A+QN YG+++ +
Sbjct  348  PQDDILAHDNVLAFITHGGLLSTTESIYHRKPFVGIPIFGDQFLNMARAEQNGYGVTVHY  407

Query  363  EQLTEHRLRTALRDIISNASYTENARIISDRYRDQLRPPLETAIHWVKHIAKNKGAPQMR  422
            E+L+  +L  A++ II+N   T+  R +SDRYRDQ + PLE A++WV+H++++KGA  +R
Sbjct  408  EELSSAKLLAAIQKIINNPEATQRVRDMSDRYRDQQQTPLERAVYWVEHVSRHKGAKYLR  467

Query  423  MVAVDLPFTVLYNLDVWAFILCVIGMGSYLIQCVMRSSFR-----YLSTDRSSGEAKLKR  477
              + DL F   +NLD    +   I    Y I  ++R  +R     ++  D S  + K KR
Sbjct  468  SASQDLNFIQYHNLDAMLILYGGIIFVLYCIFLLIRLVWRLLQELFIKKDTSKPKQKAKR  527

Query  478  N  478
            N
Sbjct  528  N  528


>Q9V9X9_DROME unnamed protein product
Length=521

 Score = 280 bits (717),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 158/490 (32%), Positives = 270/490 (55%), Gaps = 21/490 (4%)

Query  1    MNGLADDGHEVTFVSPFPLNKPIKNCTEILLEHSWAGYKREVNNV-----HFWDSFLNVL  55
            +  LA  GHE+T VSP+P  +P +N  +I +   +  +  EV  +       W S   + 
Sbjct  39   LKSLASLGHEITSVSPYPQREPFRNIHDIPVPEVFENFN-EVLRIASTPRSTWQSSDFIN  97

Query  56   DYGTKLTGWATTSENLKELIRSDKT--FDVIIIELIYGEALLGLGHHFNAPVIATSSFGA  113
            +Y   LT     +E ++  I   +   FD++I++L   + L GL  +F+AP+I  +S+G 
Sbjct  98   EYVLNLTKTVLNNEGVRRDILGPQKPHFDLVIMDLWRMDVLSGLAAYFDAPIIGMASYGT  157

Query  114  YKWTTDVV---ASPVFSSFMPNTNNGYTDRMNFWQRMYNSASYWFDDIVMPLLSTSVQQR  170
              W  D +    SP+  S++ + ++ + D   + +R+ +     F  +         Q+ 
Sbjct  158  -DWKIDELMGNVSPI--SYLQSPSSRFYDLEAYGERLLHLMERTFSYMNYKWRHVRKQET  214

Query  171  YLHDLFPNAKNMPTIAELKRNVSLVLLNTHWTVGTARPYPPNMIEVGGMHIDREIQPLPP  230
                 FP+      ++E+ RN  LVL+N H+T+G  RPY PNMI+VGG+H+D   + L  
Sbjct  215  LYSQFFPSVAERKPLSEISRNFDLVLVNQHFTLGPPRPYVPNMIQVGGLHVDHSTEALSA  274

Query  231  NIQRFLDDAGRHGAIYLALGSCIEFSKLSNDKKDAIINALAEYPQMRIIIKSEEMITIPS  290
             +  F+  AG  G IY +LG+ ++   LS D++  ++   A  PQ RI+ K E+ + +P 
Sbjct  275  ELDHFIQGAGESGVIYFSLGTNVKSKSLSEDRRKVLLETFASLPQ-RIVWKFEDEL-LPG  332

Query  291  HKPTDILIGPWFLQQSILAHSSVKLFITHGGMLSTLEAVHYAKPVIGIPIVFDEYLNSAV  350
             KP ++ I  WF QQ+ILAH +VKLFITHGG+LST+E++H+ KP++G+P +FD++ N   
Sbjct  333  -KPPNVFISKWFPQQAILAHPNVKLFITHGGLLSTIESIHHGKPMLGLPCLFDQFRNMDH  391

Query  351  AQQNRYGISIPFEQLTEHRLRTALRDIISNASYTENARIISDRYRDQLRPPLETAIHWVK  410
             +Q   G+ +  +Q+T    R+ +  +++N S+ E ARI + RYRDQ   P+ETAI W +
Sbjct  392  VRQVGLGLVLNIKQMTSEEFRSTIIRLLTNKSFEETARITAARYRDQPMKPMETAIWWTE  451

Query  411  HIAKNKGAPQMRMVAVDLPFTVLYNLDVWAFI----LCVIGMGSYLIQCVMRSSFRYLST  466
            ++  +KGA  M++   DL F   ++LDV+       L ++G+ +YL+   +R     +  
Sbjct  452  YVLSHKGAAHMQVAGKDLGFVRYHSLDVFGTFLVGALVILGIVTYLLVMTLRKCLFLIKR  511

Query  467  DRSSGEAKLK  476
             +     K++
Sbjct  512  GKCEAIKKIQ  521


>O17757_CAEEL unnamed protein product
Length=542

 Score = 115 bits (289),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 118/492 (24%), Positives = 213/492 (43%), Gaps = 44/492 (9%)

Query  2    NGLADDGHEVTFVSPF---------PLNKPIKNCTEILLEHS----------WAGYKREV  42
            N L D+G+ VT + P          PL + IKN   IL+E S           AG  RE 
Sbjct  48   NILQDEGYNVTLLLPILDEGLRDTTPLVRKIKN--RILVEQSEELIEANAQFRAGGGRE-  104

Query  43   NNVHFWDSFLNVLDYGTKLTGWATTS-------ENLKELIRSDKTFDVIIIELIYGEALL  95
            N        +  L  GTK+      S       E+L   +R D+ FDV I E +Y     
Sbjct  105  NTWVMNSGIIGFLKLGTKVANICKASCKNVFQNEDLINYLR-DQRFDVAISEPLYTCGFA  163

Query  96   GLGHHFNAPVIATSSFGAYKWTTDVVASPVFSSFMPNTNNGYTDRMNFWQRMYNSASYWF  155
               H      I+T S    + +     + + +S++P   +  ++RM    R  N    +F
Sbjct  164  LFDHLGIETTISTDSHLGLEVSKIAHGASISTSYLPAVFSSGSERMTLIGRAKNYVESYF  223

Query  156  DDIVMPLLSTSVQQRYLHDLFPNAKNMPTIAELKRNVSLVLLNTHWTVGTARPYPPNMIE  215
            +       ++ + +  L  +    KN     EL R  + + +N++  +    P     IE
Sbjct  224  N----YYFNSKIYENELAGIEGIYKNGKGWRELSRKNAYMFVNSNPQMDIPSPRTSKFIE  279

Query  216  VGGMHIDREIQP-LPPNIQRFLDDAGRHGAIYLALGSCIEFSKLSNDKKDAIINALAEYP  274
            +GG+      Q  LP    R L  + R   + ++ G+  +   +S+D K+++I      P
Sbjct  280  IGGISSGPVKQERLPEEYDRVL--SLRKKNVLISFGTNAKSMFMSDDMKESLIKTFESMP  337

Query  275  QMRIIIKSE----EMITIPSHKPTDILIGPWFLQQSILAHSSVKLFITHGGMLSTLEAVH  330
                I K E    +++   + +  ++++  W  Q ++LA   + LF+THGG+ ST E   
Sbjct  338  DTTFIWKYENTTVDIVKQYNKRINNVMLTDWMPQTALLADPRLTLFVTHGGLGSTNEVAF  397

Query  331  YAKPVIGIPIVFDEYLNSAVAQQNRYGISIPFEQLTE-HRLRTALRDIISNASYTENARI  389
              KP I +P+  D+  N+ + +++   + +    LT   ++R  +R ++++ SY+  A  
Sbjct  398  SGKPSIMVPVFGDQTRNARMLERHEVALVLTKYDLTNFKKVRGTIRKMLNDKSYSMKAEK  457

Query  390  ISDRYRDQLRPPLETAIHWVKHIAKNKGAPQMRMVAVDLPFTVLYNLDVWAFILCVIGMG  449
            ++   R+Q   P E  I +   +A+      +   A ++ F   Y +D  A IL +  + 
Sbjct  458  LAQMLRNQPESPKEIFIKYFNFVARFGKPHGLDSYAAEMSFIEFYYIDFMA-ILSIFSVA  516

Query  450  SYLI-QCVMRSS  460
             Y+I   V+R+S
Sbjct  517  LYMIVSKVLRAS  528



Lambda      K        H
   0.327    0.141    0.438 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4509870700


Query= XP_037024093.1 uncharacterized protein LOC119065991 [Bradysia
coprophila]

Length=307
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

HIW_DROME  unnamed protein product                                    31.6    0.95 
GPA4_CAEEL  unnamed protein product                                   30.4    1.6  
MTX2_CAEEL  unnamed protein product                                   30.0    1.8  


>HIW_DROME unnamed protein product
Length=5233

 Score = 31.6 bits (70),  Expect = 0.95, Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 23/42 (55%), Gaps = 1/42 (2%)

Query  58    MNWFNRYHEIDGYRVRMRREMHILDLPLFCLKVICKWLLNSI  99
             M +  + HE+D  R  MRR + I    ++ L+ +  WLL S+
Sbjct  4020  MAFITQKHELDRLRAAMRRSLRIAACRIYALQAL-NWLLRSV  4060


>GPA4_CAEEL unnamed protein product
Length=359

 Score = 30.4 bits (67),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 28/51 (55%), Gaps = 6/51 (12%)

Query  167  ILASLKKMSPNNVLKYLNFSNKRNSNGRNHREYVNHFSHLSTAEVEDLFSV  217
            +LA LK M P      LN S    +   + R +++HF H++ AE+ + FS+
Sbjct  80   MLAILKAMQP------LNISFTDAAREEDARMFISHFLHVNNAELSEAFSL  124


>MTX2_CAEEL unnamed protein product
Length=230

 Score = 30.0 bits (66),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 30/101 (30%), Positives = 43/101 (43%), Gaps = 15/101 (15%)

Query  139  ADIRLFQCFLHSITRLEINAEDREHFTYILASLKKMSPNNVLKYLNFSNKRNSNGRN---  195
            AD    Q FL  +T L  N   R +  +I       SP+ V+  L   NK    G N   
Sbjct  43   ADCLAVQTFLR-MTSLPFNVRQRPNVDFI-------SPDGVVPLLKI-NKTLITGFNAIV  93

Query  196  ---HREYVNHFSHLSTAEVEDLFSVFSHLEGISYNTWEFVF  233
               H++ V   SHLS  +V D+ +  S +E +     +FV 
Sbjct  94   DFVHKKGVTLTSHLSETQVADMRANISMIEHLLTTVEKFVL  134



Lambda      K        H
   0.327    0.141    0.438 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4509870700


Query= XP_037024094.1 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial-like
[Bradysia coprophila]

Length=371
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q960K8_DROME  unnamed protein product                                 185     6e-55
Q86BP1_DROME  unnamed protein product                                 185     6e-55
Q381D8_TRYB2  unnamed protein product                                 157     2e-44


>Q960K8_DROME unnamed protein product
Length=385

 Score = 185 bits (470),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 117/347 (34%), Positives = 191/347 (55%), Gaps = 22/347 (6%)

Query  21   SNECITVSRRKDKAVIQFNRPEKRNALTIEMQCTLNTLLRDFENDTGVSAVIIKG-NEAG  79
            S+  +  +   +K +I  NRP+  NA+ +EM   +   L+  E     S VIIKG  +  
Sbjct  42   SSSSVLATESSNKGMIILNRPKALNAINLEMVRKIYKHLKKCEKSK--SLVIIKGTGDKA  99

Query  80   FCAGGDVVQFTQIIKSD--KKFFFDCGIGFYRGLLRLAEYKKPVIVLADKLCIGQGAAVT  137
            FCAGGDV    +   +D  K FF +     Y     +  YK P I + D + +G G  ++
Sbjct  100  FCAGGDVRALVEAGPTDESKSFFRE----EYSTNALIGNYKIPYIAIIDGITMGGGVGLS  155

Query  138  FLSSHPIVTERTLFTMPEVFVGLY-NVGSSYRLARLPNNFGMWIGLTGTRFIGSDIVNLG  196
                + + ++RTLF MPE  +GL+ +VG SY L RL    G+++GLTG R  G+D+   G
Sbjct  156  VHGKYRVASDRTLFAMPETAIGLFPDVGGSYFLPRLQGKLGLYLGLTGYRLRGADVYYSG  215

Query  197  LSKNYVNSTDLDRLEDELINLKKTDFETVSQTIAQFQQKSDK-WSIEP--EKVKQLFNGS  253
            ++ +Y  S+ +  LE  L+N    D + V + + ++    +K +S++P  E++ + F+  
Sbjct  216  IATHYCESSKIPDLETALLNC--PDADDVPELLQKYHSPPEKPFSLQPVLEQINKNFSAD  273

Query  254  SVEEIVENLKEDRTEFSSKILKTLSNVSPTALKLAFHIIREFQL-KQYSKNEALSADFSL  312
            SVE I+ENL+ D +E++ K L+TLS +SPT++K+ F   R+ +L  Q S  + L  ++ L
Sbjct  274  SVEGILENLQNDGSEWAKKTLETLSKMSPTSMKVTF---RQLELGSQLSLAQCLIMEYRL  330

Query  313  YKNFYGDTDSNDFSEGVRSAIIDKTHKPNWIPKTLEEVDDKKVISYF  359
                    + +DF EGVR+ +IDK  KP W P  L +V ++ V  +F
Sbjct  331  AVRHL---ERSDFKEGVRALLIDKDQKPQWQPTKLADVTEEHVQWFF  374


>Q86BP1_DROME unnamed protein product
Length=386

 Score = 185 bits (469),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 117/347 (34%), Positives = 191/347 (55%), Gaps = 22/347 (6%)

Query  21   SNECITVSRRKDKAVIQFNRPEKRNALTIEMQCTLNTLLRDFENDTGVSAVIIKG-NEAG  79
            S+  +  +   +K +I  NRP+  NA+ +EM   +   L+  E     S VIIKG  +  
Sbjct  43   SSSSVLATESSNKGMIILNRPKALNAINLEMVRKIYKHLKKCEKSK--SLVIIKGTGDKA  100

Query  80   FCAGGDVVQFTQIIKSD--KKFFFDCGIGFYRGLLRLAEYKKPVIVLADKLCIGQGAAVT  137
            FCAGGDV    +   +D  K FF +     Y     +  YK P I + D + +G G  ++
Sbjct  101  FCAGGDVRALVEAGPTDESKSFFRE----EYSTNALIGNYKIPYIAIIDGITMGGGVGLS  156

Query  138  FLSSHPIVTERTLFTMPEVFVGLY-NVGSSYRLARLPNNFGMWIGLTGTRFIGSDIVNLG  196
                + + ++RTLF MPE  +GL+ +VG SY L RL    G+++GLTG R  G+D+   G
Sbjct  157  VHGKYRVASDRTLFAMPETAIGLFPDVGGSYFLPRLQGKLGLYLGLTGYRLRGADVYYSG  216

Query  197  LSKNYVNSTDLDRLEDELINLKKTDFETVSQTIAQFQQKSDK-WSIEP--EKVKQLFNGS  253
            ++ +Y  S+ +  LE  L+N    D + V + + ++    +K +S++P  E++ + F+  
Sbjct  217  IATHYCESSKIPDLETALLNC--PDADDVPELLQKYHSPPEKPFSLQPVLEQINKNFSAD  274

Query  254  SVEEIVENLKEDRTEFSSKILKTLSNVSPTALKLAFHIIREFQL-KQYSKNEALSADFSL  312
            SVE I+ENL+ D +E++ K L+TLS +SPT++K+ F   R+ +L  Q S  + L  ++ L
Sbjct  275  SVEGILENLQNDGSEWAKKTLETLSKMSPTSMKVTF---RQLELGSQLSLAQCLIMEYRL  331

Query  313  YKNFYGDTDSNDFSEGVRSAIIDKTHKPNWIPKTLEEVDDKKVISYF  359
                    + +DF EGVR+ +IDK  KP W P  L +V ++ V  +F
Sbjct  332  AVRHL---ERSDFKEGVRALLIDKDQKPQWQPTKLADVTEEHVQWFF  375


>Q381D8_TRYB2 unnamed protein product
Length=362

 Score = 157 bits (397),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 109/347 (31%), Positives = 179/347 (52%), Gaps = 20/347 (6%)

Query  35   VIQFNRPEKRNALTIEMQCTLNTLLRDFENDTGVSAV-IIKG-NEAGFCAGGDVVQFTQI  92
            ++  NR +  NAL +EM   ++       +  G +A+ ++KG  E  FCAGGD+V  T  
Sbjct  22   LVTLNREKALNALNLEMVREMSLAYFHEHHPKGDNALFVVKGMGEKSFCAGGDIVMITTD  81

Query  93   IKSDKKFFFDCGIGFYRGLLRLAEYKKPVIVLADKLCIGQGAAVTFLSSHPIVTERTLFT  152
                 +FF+      Y+   R+     P + L +   +G G  ++    + + +ER +F 
Sbjct  82   NSVVNEFFYR----EYQLNHRILTMPNPQVSLWNGYVMGGGVGISVHGRYRVASERAIFA  137

Query  153  MPEVFVGLY-NVGSSYRLARLP-NNFGMWIGLTGTRFIGSDIVNLGLSKNYVNSTDLDRL  210
            MPE  +GL+ +VG+S+ L RL    FG+++GLTG R  G+D+V+LGL+ +YV +   ++L
Sbjct  138  MPENGIGLFPDVGASWFLPRLKLPGFGLYLGLTGGRVKGADLVHLGLATHYVPAASFEQL  197

Query  211  EDELINLKKTDFETVSQTIAQFQQKS-DKWSIEP-----EKVKQLFNGSSVEEIVENLKE  264
            ED L +++  D   V   + +F  K    +++E      EKV  L + S+VE+++ +L  
Sbjct  198  EDRLCHIE--DSTKVDACLNEFAVKDLPPFTLEEHRPLIEKVFTLKDTSTVEDVMGSLAA  255

Query  265  DRTEFSSKILKTLSNVSPTALKLAFHIIREFQLKQYSKNEALSADFSLYKNFYGDTDSND  324
            D  EF+   + T+  +SPT+LKLA   +++   K     E  S D   Y          D
Sbjct  256  DGGEFARTAISTMEKLSPTSLKLALK-MQQMGAKATDPAEVFSTD---YVGAIRTHACGD  311

Query  325  FSEGVRSAIIDKTHKPNWIPKTLEEVDDKKVISYFTTNVIDIRASSP  371
            F EGVR+ +IDKT  P W P  L +V  + +  +F     D+R   P
Sbjct  312  FPEGVRALLIDKTKDPKWNPGKLSDVTPEHLAKFFEPLGPDMRKWHP  358



Lambda      K        H
   0.327    0.141    0.438 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4509870700


Query= XP_037024095.1 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial-like
[Bradysia coprophila]

Length=326
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q86BP1_DROME  unnamed protein product                                 182     3e-54
Q960K8_DROME  unnamed protein product                                 181     4e-54
Q381D8_TRYB2  unnamed protein product                                 160     4e-46


>Q86BP1_DROME unnamed protein product
Length=386

 Score = 182 bits (461),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 110/304 (36%), Positives = 170/304 (56%), Gaps = 17/304 (6%)

Query  17   ESDSSVSAVIIKGN-EAGFSAGGDVVQFVLSLQND--KKFFYECGIGFYRGLLRLSEYKK  73
            + + S S VIIKG  +  F AGGDV   V +   D  K FF E     Y     +  YK 
Sbjct  83   KCEKSKSLVIIKGTGDKAFCAGGDVRALVEAGPTDESKSFFRE----EYSTNALIGNYKI  138

Query  74   PVISLADKLCMGGGAAVTFLSSHPVVTERTMFAMPEVFIGFFPNVGANYFLMQLPNNFGM  133
            P I++ D + MGGG  ++    + V ++RT+FAMPE  IG FP+VG +YFL +L    G+
Sbjct  139  PYIAIIDGITMGGGVGLSVHGKYRVASDRTLFAMPETAIGLFPDVGGSYFLPRLQGKLGL  198

Query  134  WVGLTGARFIGSDIINLGLSKNYVRSTDMDTLEDALINLEQANFETVSQTIAQFQQKCDK  193
            ++GLTG R  G+D+   G++ +Y  S+ +  LE AL+N   A+   V + + ++    +K
Sbjct  199  YLGLTGYRLRGADVYYSGIATHYCESSKIPDLETALLNCPDAD--DVPELLQKYHSPPEK  256

Query  194  -WSIEP--NNVKQLFGGSSVEEIVENLKGDGTEFSSKILKTFSNLSPTALKFTFNLLRES  250
             +S++P    + + F   SVE I+ENL+ DG+E++ K L+T S +SPT++K TF  L   
Sbjct  257  PFSLQPVLEQINKNFSADSVEGILENLQNDGSEWAKKTLETLSKMSPTSMKVTFRQLELG  316

Query  251  HLRQYSKNEAFSADFSLYKNFYGDTDGNDFSEGVRSVLIDKKHKPNWIPKTLEEVDDKKL  310
               Q S  +    ++ L        + +DF EGVR++LIDK  KP W P  L +V ++ +
Sbjct  317  S--QLSLAQCLIMEYRLAVRHL---ERSDFKEGVRALLIDKDQKPQWQPTKLADVTEEHV  371

Query  311  ISYF  314
              +F
Sbjct  372  QWFF  375


>Q960K8_DROME unnamed protein product
Length=385

 Score = 181 bits (460),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 110/304 (36%), Positives = 170/304 (56%), Gaps = 17/304 (6%)

Query  17   ESDSSVSAVIIKGN-EAGFSAGGDVVQFVLSLQND--KKFFYECGIGFYRGLLRLSEYKK  73
            + + S S VIIKG  +  F AGGDV   V +   D  K FF E     Y     +  YK 
Sbjct  82   KCEKSKSLVIIKGTGDKAFCAGGDVRALVEAGPTDESKSFFRE----EYSTNALIGNYKI  137

Query  74   PVISLADKLCMGGGAAVTFLSSHPVVTERTMFAMPEVFIGFFPNVGANYFLMQLPNNFGM  133
            P I++ D + MGGG  ++    + V ++RT+FAMPE  IG FP+VG +YFL +L    G+
Sbjct  138  PYIAIIDGITMGGGVGLSVHGKYRVASDRTLFAMPETAIGLFPDVGGSYFLPRLQGKLGL  197

Query  134  WVGLTGARFIGSDIINLGLSKNYVRSTDMDTLEDALINLEQANFETVSQTIAQFQQKCDK  193
            ++GLTG R  G+D+   G++ +Y  S+ +  LE AL+N   A+   V + + ++    +K
Sbjct  198  YLGLTGYRLRGADVYYSGIATHYCESSKIPDLETALLNCPDAD--DVPELLQKYHSPPEK  255

Query  194  -WSIEP--NNVKQLFGGSSVEEIVENLKGDGTEFSSKILKTFSNLSPTALKFTFNLLRES  250
             +S++P    + + F   SVE I+ENL+ DG+E++ K L+T S +SPT++K TF  L   
Sbjct  256  PFSLQPVLEQINKNFSADSVEGILENLQNDGSEWAKKTLETLSKMSPTSMKVTFRQLELG  315

Query  251  HLRQYSKNEAFSADFSLYKNFYGDTDGNDFSEGVRSVLIDKKHKPNWIPKTLEEVDDKKL  310
               Q S  +    ++ L        + +DF EGVR++LIDK  KP W P  L +V ++ +
Sbjct  316  S--QLSLAQCLIMEYRLAVRHL---ERSDFKEGVRALLIDKDQKPQWQPTKLADVTEEHV  370

Query  311  ISYF  314
              +F
Sbjct  371  QWFF  374


>Q381D8_TRYB2 unnamed protein product
Length=362

 Score = 160 bits (404),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 104/312 (33%), Positives = 168/312 (54%), Gaps = 24/312 (8%)

Query  26   IIKG-NEAGFSAGGDVVQFVLSLQNDKKFFYECGIGFYRGLLRLSEYKKPVISLADKLCM  84
            ++KG  E  F AGGD+V          +FFY      Y+   R+     P +SL +   M
Sbjct  60   VVKGMGEKSFCAGGDIVMITTDNSVVNEFFYR----EYQLNHRILTMPNPQVSLWNGYVM  115

Query  85   GGGAAVTFLSSHPVVTERTMFAMPEVFIGFFPNVGANYFL--MQLPNNFGMWVGLTGARF  142
            GGG  ++    + V +ER +FAMPE  IG FP+VGA++FL  ++LP  FG+++GLTG R 
Sbjct  116  GGGVGISVHGRYRVASERAIFAMPENGIGLFPDVGASWFLPRLKLP-GFGLYLGLTGGRV  174

Query  143  IGSDIINLGLSKNYVRSTDMDTLEDALINLEQANFETVSQTIAQFQQK-CDKWSIEPNN-  200
             G+D+++LGL+ +YV +   + LED L ++E +    V   + +F  K    +++E +  
Sbjct  175  KGADLVHLGLATHYVPAASFEQLEDRLCHIEDST--KVDACLNEFAVKDLPPFTLEEHRP  232

Query  201  -VKQLF---GGSSVEEIVENLKGDGTEFSSKILKTFSNLSPTALKFTFNLLRESHLRQYS  256
             ++++F     S+VE+++ +L  DG EF+   + T   LSPT+LK     +++   +   
Sbjct  233  LIEKVFTLKDTSTVEDVMGSLAADGGEFARTAISTMEKLSPTSLKLALK-MQQMGAKATD  291

Query  257  KNEAFSADF--SLYKNFYGDTDGNDFSEGVRSVLIDKKHKPNWIPKTLEEVDDKKLISYF  314
              E FS D+  ++  +  G     DF EGVR++LIDK   P W P  L +V  + L  +F
Sbjct  292  PAEVFSTDYVGAIRTHACG-----DFPEGVRALLIDKTKDPKWNPGKLSDVTPEHLAKFF  346

Query  315  TTNVIDIRASSP  326
                 D+R   P
Sbjct  347  EPLGPDMRKWHP  358



Lambda      K        H
   0.327    0.141    0.438 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4509870700


Query= XP_037024096.1 uncharacterized protein LOC119065994 [Bradysia
coprophila]

Length=1403
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PSD11_DICDI  unnamed protein product                                  33.9    1.0  
ALS2_DROME  unnamed protein product                                   33.1    2.2  
X2JFK0_DROME  unnamed protein product                                 33.1    2.5  


>PSD11_DICDI unnamed protein product
Length=413

 Score = 33.9 bits (76),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 30/89 (34%), Positives = 40/89 (45%), Gaps = 14/89 (16%)

Query  976   VRLLEFFNKNKKCKELGTQYRDVILVKIREFFDHQSHSKEDEQTFVRKTASGFVHIISTL  1035
             +RL + F K  K  +L T  R V     R FFD  S  K D      K    F+ I ST+
Sbjct  42    LRLAKLFVKIGKGDQLPTLLRSV-----RPFFDKISKPKTD------KIVRNFIDIFSTV  90

Query  1036  NDFDDQLKKVVNIYVENMQNCYDSHSIKL  1064
                 D L  ++    EN+Q C D++ I L
Sbjct  91    ---PDNLTTLIEFVKENIQWCKDTNRIYL  116


>ALS2_DROME unnamed protein product
Length=1486

 Score = 33.1 bits (74),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 56/128 (44%), Gaps = 29/128 (23%)

Query  639  SITSDQIERSIADNTNNFVHSYLQPTEWVLIEQRISNFGK----------HECRSNLNRL  688
            SI+S   ERS+A NT + +H       + L+  ++  FG           H  R+N+ RL
Sbjct  230  SISSGHSERSVAANTRHLLHQ-----GYALLHTQLFTFGASNNGLLGSGDHIRRANVMRL  284

Query  689  YMQKIKSKLVIKRSETVNHQSNETMD-------VANHLLPSTLSGNDDLSELNDILLDET  741
              QK+ S  V   +  + H    T+D       + NH   S L   +D+S   +I + E 
Sbjct  285  --QKLDSMGVCSIAAGLEHTVARTLDGRLYHWGLNNH---SQL--GEDVSSPMEITITEN  337

Query  742  TNQWFIEQ  749
            T    IEQ
Sbjct  338  TAALPIEQ  345


>X2JFK0_DROME unnamed protein product
Length=5145

 Score = 33.1 bits (74),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 55/134 (41%), Gaps = 31/134 (23%)

Query  101   NGVKCRRYVVYKGLITLLQ-----NSSMQSFFKSNSKSFAMLAGASIDYLTKMLESSEVD  155
             NG  CR +V++ GL  +LQ     N  + S   + S++ A +  A    L++  E+  +D
Sbjct  961   NGDHCREFVLHGGLKPILQLLSLPNLPVDSPVSTTSQAVANVCKA---ILSQAQETKVLD  1017

Query  156   SGFERSDPLVREVVQITKNYLKQTPFLNEFRKPFVKHLLIP-----LAELFISLRNDGTI  210
                ++   L   V Q+               KP +KH   P     LAEL    R +   
Sbjct  1018  VALKQ---LADIVAQL---------------KPLIKHFTFPGGSVLLAELVCCQRLEDGF  1059

Query  211   DETDFFSILHEIYF  224
                ++  ILH + F
Sbjct  1060  ANAEYTPILHNMSF  1073



Lambda      K        H
   0.327    0.141    0.438 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4509870700


Query= XP_037024097.1 uncharacterized protein LOC119065995 [Bradysia
coprophila]

Length=554
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q385R6_TRYB2  unnamed protein product                                 32.7    1.0  
Q57VL9_TRYB2  unnamed protein product                                 31.2    3.4  
Q38C92_TRYB2  unnamed protein product                                 30.4    5.5  


>Q385R6_TRYB2 unnamed protein product
Length=1706

 Score = 32.7 bits (73),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 33/68 (49%), Gaps = 8/68 (12%)

Query  223   LIDQHTNYDLVVNASRGYFLENGVVKQLNSELINMVFVDAPAGAIIT--TAND-----MA  275
             L D       VV+A RG  L N V   L S  IN+V  DA AG++++   AN+     M 
Sbjct  1215  LCDTQRAVVAVVSARRGINLHNRVDDTLRSS-INLVLFDAVAGSVVSLKQANEEELSLMT  1273

Query  276   KYIKFHLN  283
             K I F  N
Sbjct  1274  KLIAFTSN  1281


>Q57VL9_TRYB2 unnamed protein product
Length=4224

 Score = 31.2 bits (69),  Expect = 3.4, Method: Compositional matrix adjust.
 Identities = 15/40 (38%), Positives = 20/40 (50%), Gaps = 0/40 (0%)

Query  200   IAGRPYGALLQDFFDQLGMNNSILIDQHTNYDLVVNASRG  239
             + GRPY  LL D F  L  N  I ++Q   +  + N  RG
Sbjct  2550  LLGRPYSQLLCDIFFCLRTNTEISVEQLQEFATLANRLRG  2589


>Q38C92_TRYB2 unnamed protein product
Length=1220

 Score = 30.4 bits (67),  Expect = 5.5, Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 27/58 (47%), Gaps = 3/58 (5%)

Query  49   GVTIVENTGEYIFSKGYGYSDMKRNLTADGNTKFCIASITKTFTATLIMKVLSETFPK  106
            G+  V+N  ++ F +GYG  D    +  DGN  FC+ S+         +  L  T P+
Sbjct  384  GLVSVDNISKF-FPEGYGKDDPALKVAVDGN--FCLTSLRDELRKRDSLWFLHSTLPE  438



Lambda      K        H
   0.327    0.141    0.438 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4509870700


Query= XP_037024098.1 uncharacterized protein LOC119065996 isoform X1
[Bradysia coprophila]

Length=554
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q385R6_TRYB2  unnamed protein product                                 32.0    1.7  
Q8IH18_DROME  unnamed protein product                                 32.0    1.8  
L0MLQ9_DROME  unnamed protein product                                 32.0    1.9  


>Q385R6_TRYB2 unnamed protein product
Length=1706

 Score = 32.0 bits (71),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 18/55 (33%), Positives = 32/55 (58%), Gaps = 7/55 (13%)

Query  220  DSILINRHTNYDLVVNMSRGYFLENGVVKQLNSALI-------NMIFVGAPAGAV  267
            DSI+ +  +NY+ ++  SRG  L++  + + ++AL        +M+ VGAPA A 
Sbjct  167  DSIVTDLISNYEEIIAQSRGKPLQDDTLDRRSNALYSCVCAMGHMLRVGAPASAC  221


>Q8IH18_DROME unnamed protein product
Length=1010

 Score = 32.0 bits (71),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 15/46 (33%), Positives = 22/46 (48%), Gaps = 0/46 (0%)

Query  324  EYAIGSGVYLGVFDGWEFMSHDGLWATFESEMRIYPRLGFGTFSIN  369
            E  IGSG  L   D W++ +   + A+ E+E    P     T S+N
Sbjct  214  ERRIGSGRLLPRSDNWDYKNEKTVEASIENEKETSPNGSGSTSSLN  259


>L0MLQ9_DROME unnamed protein product
Length=979

 Score = 32.0 bits (71),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 15/46 (33%), Positives = 22/46 (48%), Gaps = 0/46 (0%)

Query  324  EYAIGSGVYLGVFDGWEFMSHDGLWATFESEMRIYPRLGFGTFSIN  369
            E  IGSG  L   D W++ +   + A+ E+E    P     T S+N
Sbjct  214  ERRIGSGRLLPRSDNWDYKNEKTVEASIENEKETSPNGSGSTSSLN  259



Lambda      K        H
   0.327    0.141    0.438 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4509870700


Query= XP_037024099.1 uncharacterized protein LOC119065996 isoform X2
[Bradysia coprophila]

Length=429
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8IH18_DROME  unnamed protein product                                 32.0    1.3  
L0MLQ9_DROME  unnamed protein product                                 32.0    1.3  
Q385R6_TRYB2  unnamed protein product                                 32.0    1.4  


>Q8IH18_DROME unnamed protein product
Length=1010

 Score = 32.0 bits (71),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 15/46 (33%), Positives = 22/46 (48%), Gaps = 0/46 (0%)

Query  199  EYAIGSGVYLGVFDGWEFMSHDGLWATFESEMRIYPRLGFGTFSIN  244
            E  IGSG  L   D W++ +   + A+ E+E    P     T S+N
Sbjct  214  ERRIGSGRLLPRSDNWDYKNEKTVEASIENEKETSPNGSGSTSSLN  259


>L0MLQ9_DROME unnamed protein product
Length=979

 Score = 32.0 bits (71),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 15/46 (33%), Positives = 22/46 (48%), Gaps = 0/46 (0%)

Query  199  EYAIGSGVYLGVFDGWEFMSHDGLWATFESEMRIYPRLGFGTFSIN  244
            E  IGSG  L   D W++ +   + A+ E+E    P     T S+N
Sbjct  214  ERRIGSGRLLPRSDNWDYKNEKTVEASIENEKETSPNGSGSTSSLN  259


>Q385R6_TRYB2 unnamed protein product
Length=1706

 Score = 32.0 bits (71),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 18/55 (33%), Positives = 32/55 (58%), Gaps = 7/55 (13%)

Query  95   DSILINRHTNYDLVVNMSRGYFLENGVVKQLNSALI-------NMIFVGAPAGAV  142
            DSI+ +  +NY+ ++  SRG  L++  + + ++AL        +M+ VGAPA A 
Sbjct  167  DSIVTDLISNYEEIIAQSRGKPLQDDTLDRRSNALYSCVCAMGHMLRVGAPASAC  221



Lambda      K        H
   0.327    0.141    0.438 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4509870700


Query= XP_037024100.1 digestive cysteine proteinase 1 [Bradysia coprophila]

Length=551
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CFAD_DICDI  unnamed protein product                                   277     2e-86
CRUST_PANBO  unnamed protein product                                  231     2e-71
CPL1_CAEEL  unnamed protein product                                   221     2e-67


>CFAD_DICDI unnamed protein product
Length=531

 Score = 277 bits (708),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 190/547 (35%), Positives = 275/547 (50%), Gaps = 45/547 (8%)

Query  11   CVLFVGALATKPPKWDETYTVKGTINIPYAEIAEPFYAWYDKPSGRSRIDYYGGMVKTYQ  70
            CVL V  L        + Y +KG+ NIPY  I EP    YD  + R  I  Y GM  T  
Sbjct  15   CVLAVPQLPAA-----QQYYMKGSFNIPYFNIVEPIELIYDSVNNRQYISVYNGMDITIN  69

Query  71   L-NHYGTYGASLKIAPVTTDDSLNKETCLQVNGTADYRIQPQTILPN-CTDFQLAGTDDM  128
              N   TY     + PV  D       C    G          +LP   + +   GT  +
Sbjct  70   FYNQDNTY----NVGPVKYD-----MVCTTTPGNGSLV----NVLPTEPSSWVYNGTSTV  116

Query  129  LGQRCDKFIYEEQIGQKRNT--YTLWVRYEKSPKYPGSRMPIPVRYEMRGFNSLLGSHYD  186
             G +   F Y ++I Q   T  Y  +V              +PV++ M G + + GSH D
Sbjct  117  NGVQV--FGYSQKITQYGRTGFYNFYVDANG----------VPVQFYMDGVDYVFGSHPD  164

Query  187  HYYLDYDSYSHEDIPNEVFEVDAELTCVSF---PGPGNGHYATFNPMKEYMHPHDYSHVD  243
             Y L++D Y+  DI +     D  + C +    P   N     F+ + + +   +     
Sbjct  165  VYVLNFDIYT-TDISSYESYFDIPVLCNNAKEAPAKENQFDGLFSSIGDNLLAKE-EQAS  222

Query  244  HEFRRFIGKHGKQYDTVEEHERRKSTFMQNLRFIHSKNRAKLGYSLGVNHLTDKTKDELK  303
            + F+ +  ++ K+Y + +EH+ R   F    + I + N  +  Y LG+NH  D +  E  
Sbjct  223  NLFKEYKAQYNKEYSSQDEHDERFINFKAARKIIATHNAKESSYKLGMNHYADLSNKEFN  282

Query  304  ALNGFRSSGVYNGGKPFPYNVSSAKFASLPDQYDWRLYGAVTPVKDQSICGSCWSFGTIG  363
             L   + +     G    ++  S +  S+P   DWR    VTPVKDQ ICGSCW+FG+ G
Sbjct  283  TLVKPKVARPSVTGADSVHDDESLR--SIPSTVDWRNQNCVTPVKDQGICGSCWTFGSTG  340

Query  364  AIEGAFFLRNGGNLVRLSQQALIDCSWGYGNNGCDGGEDFRAYQWMLKMGGVPTEEEYGG  423
            ++EG   + NG  LV LS+Q L+DC+   G+ GC GG    A+Q+++++G + TE  Y  
Sbjct  341  SLEGTNCVTNG-ELVSLSEQQLVDCAILTGSQGCGGGFASSAFQYVMEIGSLATESNYP-  398

Query  424  YLGQDGYCHVQNVTLQ-APITGWVNVTAGDANAMKIALLKHGPISVAIDASHKTFSFYSH  482
            YL Q+G C  + VT     ITG+VNVT+G  +A++ A+   GP+++AIDAS   F +Y  
Sbjct  399  YLMQNGLCRDRTVTPSGVSITGYVNVTSGSESALQNAIATTGPVAIAIDASVDDFRYYMS  458

Query  483  GVYYEPKCGNTEEELDHAVLAVGYGTMNGELYWLVKNSWSNYWGNDGYILMSARDNN-CG  541
            GVY  P C N  ++LDH VLA+GYGT  G+ Y+LVKNSWS  WG DGY+ M+  DNN CG
Sbjct  459  GVYNNPACKNGLDDLDHEVLAIGYGTYQGQDYFLVKNSWSTNWGMDGYVYMARNDNNLCG  518

Query  542  VLTTPTY  548
            V +  TY
Sbjct  519  VSSQATY  525


>CRUST_PANBO unnamed protein product
Length=323

 Score = 231 bits (590),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 131/310 (42%), Positives = 176/310 (57%), Gaps = 14/310 (5%)

Query  245  EFRRFIGKHGKQYDTVEEHERRKSTFMQNLRFIHSKN----RAKLGYSLGVNHLTDKTKD  300
            E+  F  K GK+Y   EE   R S FM  L+FI   N    + ++ Y L +N+ +D T +
Sbjct  19   EWENFKTKFGKKYANSEEESHRMSVFMDKLKFIQEHNERYDKGEVTYWLKINNFSDLTHE  78

Query  301  ELKALNGFRSSGVYNGGKPFPYNVSSAKFASLPDQYDWRLYGAVTPVKDQSICGSCWSFG  360
            E+ A      +G+     P      SA    +    DWR  GAVTPVKDQ  CGSCW+F 
Sbjct  79   EVLATK----TGMTRRRHPLSVLPKSAPTTPMAADVDWRNKGAVTPVKDQGQCGSCWAFS  134

Query  361  TIGAIEGAFFLRNGGNLVRLSQQALIDCSWGYGNNGCDGGEDFRAYQWMLKMGGVPTEEE  420
             + A+EGA FL+  G+LV LS+Q L+DCS  YGN GC+GG  ++AYQ+++   G+ TE  
Sbjct  135  AVAALEGAHFLKT-GDLVSLSEQNLVDCSSSYGNQGCNGGWPYQAYQYIIANRGIDTESS  193

Query  421  YGGYLGQDGYCHVQNVTLQAPITGWVNVTAGDANAMKIALLKHGPISVAIDASHKTFSFY  480
            Y  Y   D  C      + A ++ +V   +GD +A++ A+   GP+SV IDA   +F  Y
Sbjct  194  Y-PYKAIDDNCRYDAGNIGATVSSYVEPASGDESALQHAVQNEGPVSVCIDAGQSSFGSY  252

Query  481  SHGVYYEPKCGNTEEELDHAVLAVGYGT-MNGELYWLVKNSWSNYWGNDGYILMSA-RDN  538
              GVYYEP C +     +HAV AVGYGT  NG  YW+VKNSW  +WG  GYI M+  RDN
Sbjct  253  GGGVYYEPNCDSW--YANHAVTAVGYGTDANGGDYWIVKNSWGAWWGESGYIKMARNRDN  310

Query  539  NCGVLTTPTY  548
            NC + T   Y
Sbjct  311  NCAIATYSVY  320


>CPL1_CAEEL unnamed protein product
Length=337

 Score = 221 bits (564),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 131/306 (43%), Positives = 183/306 (60%), Gaps = 24/306 (8%)

Query  255  KQYDTVEEHERRKSTFMQNLRFIHSKNRA-KLG---YSLGVNHLTDKTKDELKALNGFR-  309
            K+Y   EE    ++ F++N+  I + NR  +LG   + +G+NH+ D    + + LNG+R 
Sbjct  41   KEYSESEEQTYMEA-FVKNMIHIENHNRDHRLGRKTFEMGLNHIADLPFSQYRKLNGYRR  99

Query  310  ---SSGVYNGGKPF-PYNVSSAKFASLPDQYDWRLYGAVTPVKDQSICGSCWSFGTIGAI  365
                S + N      P+NV       +PD+ DWR    VT VK+Q +CGSCW+F   GA+
Sbjct  100  LFGDSRIKNSSSFLAPFNVQ------VPDEVDWRDTHLVTDVKNQGMCGSCWAFSATGAL  153

Query  366  EGAFFLRNGGNLVRLSQQALIDCSWGYGNNGCDGGEDFRAYQWMLKMGGVPTEEEYGGYL  425
            EG    R  G LV LS+Q L+DCS  YGN+GC+GG   +A++++    GV TEE Y  Y 
Sbjct  154  EGQH-ARKLGQLVSLSEQNLVDCSTKYGNHGCNGGLMDQAFEYIRDNHGVDTEESYP-YK  211

Query  426  GQDGYCHVQNVTLQAPITGWVNVTAGDANAMKIALLKHGPISVAIDASHKTFSFYSHGVY  485
            G+D  CH    T+ A   G+V+   GD   +KIA+   GPIS+AIDA H++F  Y  GVY
Sbjct  212  GRDMKCHFNKKTVGADDKGYVDTPEGDEEQLKIAVATQGPISIAIDAGHRSFQLYKKGVY  271

Query  486  YEPKCGNTEEELDHAVLAVGYGT--MNGELYWLVKNSWSNYWGNDGYILMSA-RDNNCGV  542
            Y+ +C  + EELDH VL VGYGT   +G+ YW+VKNSW   WG  GYI ++  R+N+CGV
Sbjct  272  YDEEC--SSEELDHGVLLVGYGTDPEHGD-YWIVKNSWGAGWGEKGYIRIARNRNNHCGV  328

Query  543  LTTPTY  548
             T  +Y
Sbjct  329  ATKASY  334



Lambda      K        H
   0.327    0.141    0.438 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4509870700


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jul 7, 2021  1:54 PM
  Number of letters in database: 17,197,330
  Number of sequences in database:  25,232



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= XP_037024101.1 zinc finger protein 567 [Bradysia coprophila]

Length=483
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7KSP5_DROME  unnamed protein product                                 301     1e-97
A0A0B4KGA3_DROME  unnamed protein product                             301     2e-97
E0R905_DROME  unnamed protein product                                 298     1e-96


>Q7KSP5_DROME unnamed protein product
Length=447

 Score = 301 bits (771),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 198/466 (42%), Positives = 242/466 (52%), Gaps = 86/466 (18%)

Query  1    MNFSPFGSPFPGSIPGIHQFAAS------GALTS---------SATSVQDTANRYHSTNV  45
            MNFS FG PF G    IHQFAA       GA  +         +A +   T N       
Sbjct  2    MNFSAFGGPFSG----IHQFAAKFDAQTPGAFGTPPAAAANAAAAAAAAGTDNHVQRYQT  57

Query  46   NMPHFNQTHAPILSKFRSDDSINSNMNKYNGHTNQYTTPYTQQSEDNKRSITTYPQSSVT  105
            N  HFNQ + P +S         +N  +Y       + PY+Q            PQ  + 
Sbjct  58   NGNHFNQ-NVPNVSA--------ANNMQYG---QNISIPYSQ------------PQGDLN  93

Query  106  TTTTAQTTSQP----PEISQDLCNAILQQQNDAKRVLQNVNTGWQSL-----TADYLSHL  156
                A          P+I +D    +L QQ     +LQNVN  WQ+L     T DY SHL
Sbjct  94   FLNAAAAADHKGKIHPKIERDR-EEVLNQQ-----ILQNVNQSWQTLANTANTVDYSSHL  147

Query  157  PASTLPLSLHHFLKYSAESIKKEAQNPLTTIDMSHAQNSSQSLNLNSLSAGLISNANILN  216
             ++TLP+S+ HFLKYS E+IKKE+   +               NL SL+ G ++     N
Sbjct  148  LSATLPISIQHFLKYS-ETIKKESTGDVL----------KNGTNLASLALGGVALTPSNN  196

Query  217  QPQPPQNQHQQNQHQQQHQQNQPQQQQQQ----QQQQQNHQQQQTQPNGISNSATNSTTV  272
                  +          H  N                 N     T  NG + + ++S +V
Sbjct  197  GANGGHHNGLVGMDHGGHMTNMTDANGAALTNGASNGVNGNANGTVTNGGAGAVSSSGSV  256

Query  273  TKKKKKKKPPKEKK-------------PRPKPGEIRLTTALDGSTLFCCPECQMAYPERG  319
                                       PRPKPGEIR T ALDGSTL+CCPECQMAYP+R 
Sbjct  257  GTTNASGGTGTASGKKTKKKKPPKEKKPRPKPGEIRETKALDGSTLYCCPECQMAYPDRS  316

Query  320  LLEQHLVGHNLERRFICDICNAALKRKDHLTRHKQSHNPERPFVCTICLKAFKRKEQLTL  379
            L+EQH++ H +ERRF+CDICNAALKRKDHLTRHK SH P+RP VC IC+K+FKRKEQLTL
Sbjct  317  LIEQHVISHAVERRFVCDICNAALKRKDHLTRHKLSHIPDRPHVCNICMKSFKRKEQLTL  376

Query  380  HFVIHSGEKRHVCNECGKGFYRKDHLRKHTRSHIARRVKAELSQQN  425
            H VIHSGEK+HVC ECGKGFYRKDHLRKHTRSHIARRVK+E+S QN
Sbjct  377  HIVIHSGEKKHVCIECGKGFYRKDHLRKHTRSHIARRVKSEVSAQN  422


>A0A0B4KGA3_DROME unnamed protein product
Length=455

 Score = 301 bits (771),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 198/466 (42%), Positives = 242/466 (52%), Gaps = 86/466 (18%)

Query  1    MNFSPFGSPFPGSIPGIHQFAAS------GALTS---------SATSVQDTANRYHSTNV  45
            MNFS FG PF G    IHQFAA       GA  +         +A +   T N       
Sbjct  2    MNFSAFGGPFSG----IHQFAAKFDAQTPGAFGTPPAAAANAAAAAAAAGTDNHVQRYQT  57

Query  46   NMPHFNQTHAPILSKFRSDDSINSNMNKYNGHTNQYTTPYTQQSEDNKRSITTYPQSSVT  105
            N  HFNQ + P +S         +N  +Y       + PY+Q            PQ  + 
Sbjct  58   NGNHFNQ-NVPNVSA--------ANNMQYG---QNISIPYSQ------------PQGDLN  93

Query  106  TTTTAQTTSQP----PEISQDLCNAILQQQNDAKRVLQNVNTGWQSL-----TADYLSHL  156
                A          P+I +D    +L QQ     +LQNVN  WQ+L     T DY SHL
Sbjct  94   FLNAAAAADHKGKIHPKIERDR-EEVLNQQ-----ILQNVNQSWQTLANTANTVDYSSHL  147

Query  157  PASTLPLSLHHFLKYSAESIKKEAQNPLTTIDMSHAQNSSQSLNLNSLSAGLISNANILN  216
             ++TLP+S+ HFLKYS E+IKKE+   +               NL SL+ G ++     N
Sbjct  148  LSATLPISIQHFLKYS-ETIKKESTGDVL----------KNGTNLASLALGGVALTPSNN  196

Query  217  QPQPPQNQHQQNQHQQQHQQNQPQQQQQQ----QQQQQNHQQQQTQPNGISNSATNSTTV  272
                  +          H  N                 N     T  NG + + ++S +V
Sbjct  197  GANGGHHNGLVGMDHGGHMTNMTDANGAALTNGASNGVNGNANGTVTNGGAGAVSSSGSV  256

Query  273  TKKKKKKKPPKEKK-------------PRPKPGEIRLTTALDGSTLFCCPECQMAYPERG  319
                                       PRPKPGEIR T ALDGSTL+CCPECQMAYP+R 
Sbjct  257  GTTNASGGTGTASGKKTKKKKPPKEKKPRPKPGEIRETKALDGSTLYCCPECQMAYPDRS  316

Query  320  LLEQHLVGHNLERRFICDICNAALKRKDHLTRHKQSHNPERPFVCTICLKAFKRKEQLTL  379
            L+EQH++ H +ERRF+CDICNAALKRKDHLTRHK SH P+RP VC IC+K+FKRKEQLTL
Sbjct  317  LIEQHVISHAVERRFVCDICNAALKRKDHLTRHKLSHIPDRPHVCNICMKSFKRKEQLTL  376

Query  380  HFVIHSGEKRHVCNECGKGFYRKDHLRKHTRSHIARRVKAELSQQN  425
            H VIHSGEK+HVC ECGKGFYRKDHLRKHTRSHIARRVK+E+S QN
Sbjct  377  HIVIHSGEKKHVCIECGKGFYRKDHLRKHTRSHIARRVKSEVSAQN  422


>E0R905_DROME unnamed protein product
Length=434

 Score = 298 bits (763),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 195/462 (42%), Positives = 237/462 (51%), Gaps = 91/462 (20%)

Query  1    MNFSPFGSPFPGSIPGIHQFAAS------GALTS---------SATSVQDTANRYHSTNV  45
            MNFS FG PF G    IHQFAA       GA  +         +A +   T N       
Sbjct  2    MNFSAFGGPFSG----IHQFAAKFDAQTPGAFGTPPAAAANAAAAAAAAGTDNHVQRYQT  57

Query  46   NMPHFNQTHAPILSKFRSDDSINSNMNKYNGHTNQYTTPYTQQSEDNKRSITTYPQSSVT  105
            N  HFNQ + P +S         +N  +Y       + PY+Q            PQ  + 
Sbjct  58   NGNHFNQ-NVPNVSA--------ANNMQYG---QNISIPYSQ------------PQGDLN  93

Query  106  TTTTAQTTSQPPEISQDLCNAILQQQNDAKRVLQNVNTGWQSL-----TADYLSHLPAST  160
                A                +L QQ     +LQNVN  WQ+L     T DY SHL ++T
Sbjct  94   FLNAAAAADHK----------VLNQQ-----ILQNVNQSWQTLANTANTVDYSSHLLSAT  138

Query  161  LPLSLHHFLKYSAESIKKEAQNPLTTIDMSHAQNSSQSLNLNSLSAGLISNANILNQPQP  220
            LP+S+ HFLKYS E+IKKE+   +               NL SL+ G ++     N    
Sbjct  139  LPISIQHFLKYS-ETIKKESTGDVL----------KNGTNLASLALGGVALTPSNNGANG  187

Query  221  PQNQHQQNQHQQQHQQNQPQQQQQQ----QQQQQNHQQQQTQPNGISNSATNSTTVTKKK  276
              +          H  N                 N     T  NG + + ++S +V    
Sbjct  188  GHHNGLVGMDHGGHMTNMTDANGAALTNGASNGVNGNANGTVTNGGAGAVSSSGSVGTTN  247

Query  277  KKKKPPKEKK-------------PRPKPGEIRLTTALDGSTLFCCPECQMAYPERGLLEQ  323
                                   PRPKPGEIR T ALDGSTL+CCPECQMAYP+R L+EQ
Sbjct  248  ASGGTGTASGKKTKKKKPPKEKKPRPKPGEIRETKALDGSTLYCCPECQMAYPDRSLIEQ  307

Query  324  HLVGHNLERRFICDICNAALKRKDHLTRHKQSHNPERPFVCTICLKAFKRKEQLTLHFVI  383
            H++ H +ERRF+CDICNAALKRKDHLTRHK SH P+RP VC IC+K+FKRKEQLTLH VI
Sbjct  308  HVISHAVERRFVCDICNAALKRKDHLTRHKLSHIPDRPHVCNICMKSFKRKEQLTLHIVI  367

Query  384  HSGEKRHVCNECGKGFYRKDHLRKHTRSHIARRVKAELSQQN  425
            HSGEK+HVC ECGKGFYRKDHLRKHTRSHIARRVK+E+S QN
Sbjct  368  HSGEKKHVCIECGKGFYRKDHLRKHTRSHIARRVKSEVSAQN  409



Lambda      K        H
   0.312    0.124    0.361 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5475072226


Query= XP_037024102.1 uncharacterized protein LOC119065997 [Bradysia
coprophila]

Length=453
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

NRDE2_CAEEL  unnamed protein product                                  30.4    3.9  
H2KYA5_CAEEL  unnamed protein product                                 30.0    5.0  
D1MN54_CAEEL  unnamed protein product                                 30.0    5.6  


>NRDE2_CAEEL unnamed protein product
Length=1270

 Score = 30.4 bits (67),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 40/143 (28%), Positives = 59/143 (41%), Gaps = 22/143 (15%)

Query  272   FMQQMTSFSR----CATPSPVPRSGQI--TPTPYNSGDYHDAFGQTSNRLTVDFLSSI--  323
             F+ +M +FSR    C   + + +  Q       +N G Y     Q   +   D L +   
Sbjct  1005  FLDKM-AFSRRAVDCLIANAITKFEQFEAKKNDFNRGTYEKYCDQIDLKFITDTLITFFS  1063

Query  324   -AKAKVPYNNNPGPSSL-SSMSMQDDSQYASMLAELEQS--IIEKKIQAGFSPDDISQST  379
               K +  YN N       +S +   DS+YA ML EL  S  +   K+Q GF        T
Sbjct  1064  HKKHRFIYNENFKKLIFQASQAFPCDSKYAKMLGELHSSGRLQVMKLQ-GF--------T  1114

Query  380   DKYCSSKSSSKDLEFSKELEAAL  402
             D   S  ++ +D +F  ELE  L
Sbjct  1115  DSRNSILNAKRDQQFDPELETRL  1137


>H2KYA5_CAEEL unnamed protein product
Length=1793

 Score = 30.0 bits (66),  Expect = 5.0, Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 41/88 (47%), Gaps = 10/88 (11%)

Query  346   DDSQYASMLAELEQSII--EKKIQAGFSPDDISQSTDKYCSSKSSSKDLEFSKE------  397
             D  + A +  +L+ S I  E+K+  G +P  ISQ +D   + +S+S  +           
Sbjct  1227  DKKEEAQLKEQLKDSEINSERKVTKGAAPSTISQDSDGKDTFESASAYIRRKNRERRQRN  1286

Query  398   --LEAALQLIQELETPSEGPLDHKTLSP  423
               +  A + ++ LE PS  P D +  SP
Sbjct  1287  RTIGTAEEALRALERPSVDPYDDRAFSP  1314


>D1MN54_CAEEL unnamed protein product
Length=1554

 Score = 30.0 bits (66),  Expect = 5.6, Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 41/88 (47%), Gaps = 10/88 (11%)

Query  346   DDSQYASMLAELEQSII--EKKIQAGFSPDDISQSTDKYCSSKSSSKDLEFSKE------  397
             D  + A +  +L+ S I  E+K+  G +P  ISQ +D   + +S+S  +           
Sbjct  988   DKKEEAQLKEQLKDSEINSERKVTKGAAPSTISQDSDGKDTFESASAYIRRKNRERRQRN  1047

Query  398   --LEAALQLIQELETPSEGPLDHKTLSP  423
               +  A + ++ LE PS  P D +  SP
Sbjct  1048  RTIGTAEEALRALERPSVDPYDDRAFSP  1075



Lambda      K        H
   0.312    0.124    0.361 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5475072226


Query= XP_037024103.1 endochitinase 3-like isoform X1 [Bradysia coprophila]

Length=461
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

COIL_DROME  unnamed protein product                                   29.3    9.2  
DCN1_CAEEL  unnamed protein product                                   28.9    9.7  


>COIL_DROME unnamed protein product
Length=634

 Score = 29.3 bits (64),  Expect = 9.2, Method: Compositional matrix adjust.
 Identities = 18/63 (29%), Positives = 31/63 (49%), Gaps = 1/63 (2%)

Query  169  FIDGSGNCHSDAQSGCSSLVTNRDINLPDLAARYGQPQENCCGICSTTQGCKAFSWNAYQ  228
            FID + N   D Q    +L + +DI+L      Y  P+E    + ++ +G KAF + ++ 
Sbjct  24   FIDAAWNNIKDLQDHIQNLFSLKDISLLTSDGCYLPPRE-SIKVLNSAEGLKAFRFASHD  82

Query  229  GGT  231
              T
Sbjct  83   SDT  85


>DCN1_CAEEL unnamed protein product
Length=295

 Score = 28.9 bits (63),  Expect = 9.7, Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 30/62 (48%), Gaps = 2/62 (3%)

Query  225  NAYQGGTCWLKAGAGPLIYKDGVIVGILDANGNDNNGAL-VSFDEFVNAVVNSNGYPRPN  283
            NA Q  + W+      L + D +++   D +  D+ GA  V  D+FV+    +  YP+P 
Sbjct  223  NAKQFKSVWISRDTWNLFW-DFILLSKPDLSDYDDEGAWPVLIDQFVDYCRENLNYPKPG  281

Query  284  EA  285
             A
Sbjct  282  NA  283



Lambda      K        H
   0.312    0.124    0.361 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5475072226


Query= XP_037024104.1 endochitinase 3-like isoform X1 [Bradysia coprophila]

Length=461
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

COIL_DROME  unnamed protein product                                   29.3    9.2  
DCN1_CAEEL  unnamed protein product                                   28.9    9.7  


>COIL_DROME unnamed protein product
Length=634

 Score = 29.3 bits (64),  Expect = 9.2, Method: Compositional matrix adjust.
 Identities = 18/63 (29%), Positives = 31/63 (49%), Gaps = 1/63 (2%)

Query  169  FIDGSGNCHSDAQSGCSSLVTNRDINLPDLAARYGQPQENCCGICSTTQGCKAFSWNAYQ  228
            FID + N   D Q    +L + +DI+L      Y  P+E    + ++ +G KAF + ++ 
Sbjct  24   FIDAAWNNIKDLQDHIQNLFSLKDISLLTSDGCYLPPRE-SIKVLNSAEGLKAFRFASHD  82

Query  229  GGT  231
              T
Sbjct  83   SDT  85


>DCN1_CAEEL unnamed protein product
Length=295

 Score = 28.9 bits (63),  Expect = 9.7, Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 30/62 (48%), Gaps = 2/62 (3%)

Query  225  NAYQGGTCWLKAGAGPLIYKDGVIVGILDANGNDNNGAL-VSFDEFVNAVVNSNGYPRPN  283
            NA Q  + W+      L + D +++   D +  D+ GA  V  D+FV+    +  YP+P 
Sbjct  223  NAKQFKSVWISRDTWNLFW-DFILLSKPDLSDYDDEGAWPVLIDQFVDYCRENLNYPKPG  281

Query  284  EA  285
             A
Sbjct  282  NA  283



Lambda      K        H
   0.312    0.124    0.361 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5475072226


Query= XP_037024105.1 chitinase 4-like isoform X2 [Bradysia coprophila]

Length=459
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DCN1_CAEEL  unnamed protein product                                   28.9    9.7  


>DCN1_CAEEL unnamed protein product
Length=295

 Score = 28.9 bits (63),  Expect = 9.7, Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 30/62 (48%), Gaps = 2/62 (3%)

Query  223  NAYQGGTCWLKAGAGPLIYKDGVIVGILDANGNDNNGAL-VSFDEFVNAVVNSNGYPRPN  281
            NA Q  + W+      L + D +++   D +  D+ GA  V  D+FV+    +  YP+P 
Sbjct  223  NAKQFKSVWISRDTWNLFW-DFILLSKPDLSDYDDEGAWPVLIDQFVDYCRENLNYPKPG  281

Query  282  EA  283
             A
Sbjct  282  NA  283



Lambda      K        H
   0.312    0.124    0.361 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5475072226


Query= XP_037024106.1 chitinase 4-like isoform X3 [Bradysia coprophila]

Length=459
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

COIL_DROME  unnamed protein product                                   29.3    9.1  
DCN1_CAEEL  unnamed protein product                                   28.9    9.7  


>COIL_DROME unnamed protein product
Length=634

 Score = 29.3 bits (64),  Expect = 9.1, Method: Compositional matrix adjust.
 Identities = 18/63 (29%), Positives = 31/63 (49%), Gaps = 1/63 (2%)

Query  167  FIDGSGNCHSDAQSGCSSLVTNRDINLPDLAARYGQPQENCCGICSTTQGCKAFSWNAYQ  226
            FID + N   D Q    +L + +DI+L      Y  P+E    + ++ +G KAF + ++ 
Sbjct  24   FIDAAWNNIKDLQDHIQNLFSLKDISLLTSDGCYLPPRE-SIKVLNSAEGLKAFRFASHD  82

Query  227  GGT  229
              T
Sbjct  83   SDT  85


>DCN1_CAEEL unnamed protein product
Length=295

 Score = 28.9 bits (63),  Expect = 9.7, Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 30/62 (48%), Gaps = 2/62 (3%)

Query  223  NAYQGGTCWLKAGAGPLIYKDGVIVGILDANGNDNNGAL-VSFDEFVNAVVNSNGYPRPN  281
            NA Q  + W+      L + D +++   D +  D+ GA  V  D+FV+    +  YP+P 
Sbjct  223  NAKQFKSVWISRDTWNLFW-DFILLSKPDLSDYDDEGAWPVLIDQFVDYCRENLNYPKPG  281

Query  282  EA  283
             A
Sbjct  282  NA  283



Lambda      K        H
   0.312    0.124    0.361 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5475072226


Query= XP_037024107.1 endochitinase At2g43620-like isoform X4 [Bradysia
coprophila]

Length=457
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DCN1_CAEEL  unnamed protein product                                   28.9    10.0 


>DCN1_CAEEL unnamed protein product
Length=295

 Score = 28.9 bits (63),  Expect = 10.0, Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 30/62 (48%), Gaps = 2/62 (3%)

Query  221  NAYQGGTCWLKAGAGPLIYKDGVIVGILDANGNDNNGAL-VSFDEFVNAVVNSNGYPRPN  279
            NA Q  + W+      L + D +++   D +  D+ GA  V  D+FV+    +  YP+P 
Sbjct  223  NAKQFKSVWISRDTWNLFW-DFILLSKPDLSDYDDEGAWPVLIDQFVDYCRENLNYPKPG  281

Query  280  EA  281
             A
Sbjct  282  NA  283



Lambda      K        H
   0.312    0.124    0.361 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5475072226


Query= XP_037024108.1 endochitinase At2g43620-like isoform X5 [Bradysia
coprophila]

Length=455
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DCN1_CAEEL  unnamed protein product                                   28.9    9.8  


>DCN1_CAEEL unnamed protein product
Length=295

 Score = 28.9 bits (63),  Expect = 9.8, Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 30/62 (48%), Gaps = 2/62 (3%)

Query  219  NAYQGGTCWLKAGAGPLIYKDGVIVGILDANGNDNNGAL-VSFDEFVNAVVNSNGYPRPN  277
            NA Q  + W+      L + D +++   D +  D+ GA  V  D+FV+    +  YP+P 
Sbjct  223  NAKQFKSVWISRDTWNLFW-DFILLSKPDLSDYDDEGAWPVLIDQFVDYCRENLNYPKPG  281

Query  278  EA  279
             A
Sbjct  282  NA  283



Lambda      K        H
   0.312    0.124    0.361 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5475072226


Query= XP_037024109.1 chitinase 4-like isoform X6 [Bradysia coprophila]

Length=455
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

COIL_DROME  unnamed protein product                                   29.3    9.2  


>COIL_DROME unnamed protein product
Length=634

 Score = 29.3 bits (64),  Expect = 9.2, Method: Compositional matrix adjust.
 Identities = 18/63 (29%), Positives = 31/63 (49%), Gaps = 1/63 (2%)

Query  169  FIDGSGNCHSDAQSGCSSLVTNRDINLPDLAARYGQPQENCCGICSTTQGCKAFSWNAYQ  228
            FID + N   D Q    +L + +DI+L      Y  P+E    + ++ +G KAF + ++ 
Sbjct  24   FIDAAWNNIKDLQDHIQNLFSLKDISLLTSDGCYLPPRE-SIKVLNSAEGLKAFRFASHD  82

Query  229  GGT  231
              T
Sbjct  83   SDT  85



Lambda      K        H
   0.312    0.124    0.361 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5475072226


Query= XP_037024110.1 endochitinase At2g43610-like isoform X7 [Bradysia
coprophila]

Length=379


***** No hits found *****



Lambda      K        H
   0.312    0.124    0.361 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5475072226


Query= XP_037024111.1 uncharacterized protein LOC119065997 [Bradysia
coprophila]

Length=453
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

NRDE2_CAEEL  unnamed protein product                                  30.4    3.9  
H2KYA5_CAEEL  unnamed protein product                                 30.0    5.0  
D1MN54_CAEEL  unnamed protein product                                 30.0    5.6  


>NRDE2_CAEEL unnamed protein product
Length=1270

 Score = 30.4 bits (67),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 40/143 (28%), Positives = 59/143 (41%), Gaps = 22/143 (15%)

Query  272   FMQQMTSFSR----CATPSPVPRSGQI--TPTPYNSGDYHDAFGQTSNRLTVDFLSSI--  323
             F+ +M +FSR    C   + + +  Q       +N G Y     Q   +   D L +   
Sbjct  1005  FLDKM-AFSRRAVDCLIANAITKFEQFEAKKNDFNRGTYEKYCDQIDLKFITDTLITFFS  1063

Query  324   -AKAKVPYNNNPGPSSL-SSMSMQDDSQYASMLAELEQS--IIEKKIQAGFSPDDISQST  379
               K +  YN N       +S +   DS+YA ML EL  S  +   K+Q GF        T
Sbjct  1064  HKKHRFIYNENFKKLIFQASQAFPCDSKYAKMLGELHSSGRLQVMKLQ-GF--------T  1114

Query  380   DKYCSSKSSSKDLEFSKELEAAL  402
             D   S  ++ +D +F  ELE  L
Sbjct  1115  DSRNSILNAKRDQQFDPELETRL  1137


>H2KYA5_CAEEL unnamed protein product
Length=1793

 Score = 30.0 bits (66),  Expect = 5.0, Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 41/88 (47%), Gaps = 10/88 (11%)

Query  346   DDSQYASMLAELEQSII--EKKIQAGFSPDDISQSTDKYCSSKSSSKDLEFSKE------  397
             D  + A +  +L+ S I  E+K+  G +P  ISQ +D   + +S+S  +           
Sbjct  1227  DKKEEAQLKEQLKDSEINSERKVTKGAAPSTISQDSDGKDTFESASAYIRRKNRERRQRN  1286

Query  398   --LEAALQLIQELETPSEGPLDHKTLSP  423
               +  A + ++ LE PS  P D +  SP
Sbjct  1287  RTIGTAEEALRALERPSVDPYDDRAFSP  1314


>D1MN54_CAEEL unnamed protein product
Length=1554

 Score = 30.0 bits (66),  Expect = 5.6, Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 41/88 (47%), Gaps = 10/88 (11%)

Query  346   DDSQYASMLAELEQSII--EKKIQAGFSPDDISQSTDKYCSSKSSSKDLEFSKE------  397
             D  + A +  +L+ S I  E+K+  G +P  ISQ +D   + +S+S  +           
Sbjct  988   DKKEEAQLKEQLKDSEINSERKVTKGAAPSTISQDSDGKDTFESASAYIRRKNRERRQRN  1047

Query  398   --LEAALQLIQELETPSEGPLDHKTLSP  423
               +  A + ++ LE PS  P D +  SP
Sbjct  1048  RTIGTAEEALRALERPSVDPYDDRAFSP  1075



Lambda      K        H
   0.312    0.124    0.361 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5475072226


Query= XP_037024112.1 endochitinase At2g43610-like isoform X8 [Bradysia
coprophila]

Length=373


***** No hits found *****



Lambda      K        H
   0.312    0.124    0.361 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5475072226


Query= XP_037024113.1 uncharacterized protein LOC119066001 [Bradysia
coprophila]

Length=412
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8SY21_DROME  unnamed protein product                                 125     6e-32
A0A0B4KG94_DROME  unnamed protein product                             125     6e-32
Q9VGJ6_DROME  unnamed protein product                                 125     1e-31


>Q8SY21_DROME unnamed protein product
Length=415

 Score = 125 bits (314),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 101/403 (25%), Positives = 185/403 (46%), Gaps = 10/403 (2%)

Query  13   WIDMEFVQMLVRKSDCDKNLTVTSFRAEKGVHDGKNFSSSAIRLHVNIFPVNDHSIMSRV  72
            W+D +  + ++ +   D    + SFR E     G+N+++  +R +  +  +ND S  S  
Sbjct  16   WLDQQKFEPILERDFPDLK-KIKSFRLEPTAGKGENYTTLLLRANFEL-ELNDGSEQSIS  73

Query  73   YFLKVCLQTEDFAKACEECLYYEKEIEVYTEIIPAVERLLHSIEAPARFTAKCFYTDAER  132
            Y  K+   + +        ++Y KE   Y + IP  E++         F  + + +  E 
Sbjct  74   YMAKILPNSGNRENVASWKVFY-KERNTYGQYIPEFEQMYKDAGKKISFGPRYYESQIEL  132

Query  133  G--ILAFEDLSVGNFVSVQPADGMDKEHLKLSLSTLAKWHATTAVLLLTRPELFDWTTRV  190
               ++  EDL    F +V   +G+D +H + +L  LA++HA +AV    +    +   + 
Sbjct  133  DDELIVLEDLGKRGFRNVDRKNGLDIQHTEATLEKLAQFHAASAVRFELKGSYPEEYNQN  192

Query  191  MYKNATTVRRFFENIAKTVSMAARNWSGFEKIAEKLINVPSHVYDNIYKEYLPT-ENGFN  249
            +     +++   EN  K    A   +       +  +       D++++ + P  E  F 
Sbjct  193  LCSVVDSLKELRENQLKAYIDAFPLYDASHLTND--VQAYGSQADDMFQSFAPKIEGEFR  250

Query  250  VLLHGDMWSNNIMFHY-ENGRPTDIRIVDFALCKHTNPSYDLSLLLYGSSQSQSIGQADR  308
            VL HGD W NNIM+ Y E G+  ++  VD  + + ++P+ DL L L  SS    I  A  
Sbjct  251  VLNHGDAWCNNIMYQYDEAGKLAEVNFVDLQMSRFSSPAQDL-LYLILSSTELDIKIAKF  309

Query  309  ERLIRFYHTELIKVLEKLQYPKTLPTLIDIQTLVFRFDLYNVLIVLFVIGLRYTDESFDG  368
            + LI+FYH +LI+ L+ L+YPK LP+L  +   +F +  + + IV  ++ L   D   D 
Sbjct  310  DYLIKFYHEKLIESLKLLKYPKPLPSLRSLHQSIFIYGDWILPIVSILLPLVLIDGGDDA  369

Query  369  GFMELSENAQNTNGKATQLYSHPKCIEELQYILEMFDRRGYFD  411
                L +     +     ++ + + I+  + IL    RRG F+
Sbjct  370  NMDSLMDGEGAGDKIRNNMFKNHRVIKHQKEILPWAHRRGAFE  412


>A0A0B4KG94_DROME unnamed protein product
Length=415

 Score = 125 bits (314),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 101/403 (25%), Positives = 185/403 (46%), Gaps = 10/403 (2%)

Query  13   WIDMEFVQMLVRKSDCDKNLTVTSFRAEKGVHDGKNFSSSAIRLHVNIFPVNDHSIMSRV  72
            W+D +  + ++ +   D    + SFR E     G+N+++  +R +  +  +ND S  S  
Sbjct  16   WLDQQKFEPILERDFPDLK-KIKSFRLEPTAGKGENYTTLLLRANFEL-ELNDGSEQSIS  73

Query  73   YFLKVCLQTEDFAKACEECLYYEKEIEVYTEIIPAVERLLHSIEAPARFTAKCFYTDAER  132
            Y  K+   + +        ++Y KE   Y + IP  E++         F  + + +  E 
Sbjct  74   YMAKILPNSGNRENVASWKVFY-KERNTYGQYIPEFEQMYKDAGKKISFGPRYYESQIEL  132

Query  133  G--ILAFEDLSVGNFVSVQPADGMDKEHLKLSLSTLAKWHATTAVLLLTRPELFDWTTRV  190
               ++  EDL    F +V   +G+D +H + +L  LA++HA +AV    +    +   + 
Sbjct  133  DDELIVLEDLGKRGFRNVDRQNGLDIQHTEATLEKLAQFHAASAVRFELKGSYPEEYNQN  192

Query  191  MYKNATTVRRFFENIAKTVSMAARNWSGFEKIAEKLINVPSHVYDNIYKEYLPT-ENGFN  249
            +     +++   EN  K    A   +       +  +       D++++ + P  E  F 
Sbjct  193  LCSVVDSLKELRENQLKAYIDAFPLYDASHLTND--VQAYGSQADDMFQSFAPKIEGEFR  250

Query  250  VLLHGDMWSNNIMFHY-ENGRPTDIRIVDFALCKHTNPSYDLSLLLYGSSQSQSIGQADR  308
            VL HGD W NNIM+ Y E G+  ++  VD  + + ++P+ DL L L  SS    I  A  
Sbjct  251  VLNHGDAWCNNIMYQYDEAGKLAEVNFVDLQMSRFSSPAQDL-LYLILSSTELDIKIAKF  309

Query  309  ERLIRFYHTELIKVLEKLQYPKTLPTLIDIQTLVFRFDLYNVLIVLFVIGLRYTDESFDG  368
            + LI+FYH +LI+ L+ L+YPK LP+L  +   +F +  + + IV  ++ L   D   D 
Sbjct  310  DYLIKFYHEKLIESLKLLKYPKPLPSLRSLHQSIFIYGDWILPIVSILLPLVLIDGGDDA  369

Query  369  GFMELSENAQNTNGKATQLYSHPKCIEELQYILEMFDRRGYFD  411
                L +     +     ++ + + I+  + IL    RRG F+
Sbjct  370  NMDSLMDGEGAGDKIRNNMFKNHRVIKHQKEILPWAHRRGAFE  412


>Q9VGJ6_DROME unnamed protein product
Length=449

 Score = 125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 101/403 (25%), Positives = 185/403 (46%), Gaps = 10/403 (2%)

Query  13   WIDMEFVQMLVRKSDCDKNLTVTSFRAEKGVHDGKNFSSSAIRLHVNIFPVNDHSIMSRV  72
            W+D +  + ++ +   D    + SFR E     G+N+++  +R +  +  +ND S  S  
Sbjct  50   WLDQQKFEPILERDFPDLK-KIKSFRLEPTAGKGENYTTLLLRANFEL-ELNDGSEQSIS  107

Query  73   YFLKVCLQTEDFAKACEECLYYEKEIEVYTEIIPAVERLLHSIEAPARFTAKCFYTDAER  132
            Y  K+   + +        ++Y KE   Y + IP  E++         F  + + +  E 
Sbjct  108  YMAKILPNSGNRENVASWKVFY-KERNTYGQYIPEFEQMYKDAGKKISFGPRYYESQIEL  166

Query  133  G--ILAFEDLSVGNFVSVQPADGMDKEHLKLSLSTLAKWHATTAVLLLTRPELFDWTTRV  190
               ++  EDL    F +V   +G+D +H + +L  LA++HA +AV    +    +   + 
Sbjct  167  DDELIVLEDLGKRGFRNVDRQNGLDIQHTEATLEKLAQFHAASAVRFELKGSYPEEYNQN  226

Query  191  MYKNATTVRRFFENIAKTVSMAARNWSGFEKIAEKLINVPSHVYDNIYKEYLPT-ENGFN  249
            +     +++   EN  K    A   +       +  +       D++++ + P  E  F 
Sbjct  227  LCSVVDSLKELRENQLKAYIDAFPLYDASHLTND--VQAYGSQADDMFQSFAPKIEGEFR  284

Query  250  VLLHGDMWSNNIMFHY-ENGRPTDIRIVDFALCKHTNPSYDLSLLLYGSSQSQSIGQADR  308
            VL HGD W NNIM+ Y E G+  ++  VD  + + ++P+ DL L L  SS    I  A  
Sbjct  285  VLNHGDAWCNNIMYQYDEAGKLAEVNFVDLQMSRFSSPAQDL-LYLILSSTELDIKIAKF  343

Query  309  ERLIRFYHTELIKVLEKLQYPKTLPTLIDIQTLVFRFDLYNVLIVLFVIGLRYTDESFDG  368
            + LI+FYH +LI+ L+ L+YPK LP+L  +   +F +  + + IV  ++ L   D   D 
Sbjct  344  DYLIKFYHEKLIESLKLLKYPKPLPSLRSLHQSIFIYGDWILPIVSILLPLVLIDGGDDA  403

Query  369  GFMELSENAQNTNGKATQLYSHPKCIEELQYILEMFDRRGYFD  411
                L +     +     ++ + + I+  + IL    RRG F+
Sbjct  404  NMDSLMDGEGAGDKIRNNMFKNHRVIKHQKEILPWAHRRGAFE  446



Lambda      K        H
   0.312    0.124    0.361 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5475072226


Query= XP_037024114.1 39S ribosomal protein L39, mitochondrial [Bradysia
coprophila]

Length=329
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q57W54_TRYB2  unnamed protein product                                 90.5    1e-19
SYTC1_DICDI  unnamed protein product                                  88.6    4e-19
Q8IIA4_PLAF7  unnamed protein product                                 84.0    1e-17


>Q57W54_TRYB2 unnamed protein product
Length=799

 Score = 90.5 bits (223),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 67/244 (27%), Positives = 111/244 (45%), Gaps = 25/244 (10%)

Query  58   RYLGQPSDTTLIMNKG--------LSTPFNCAQHLGEMHCNRSALALIDSHTPWDMHRPL  109
            +Y    S  ++ +N G        L+TP + A+ L      R   A ++    WD+ RP 
Sbjct  43   KYKSMQSPISITLNDGKQLPATSWLTTPIDIAKKLSNSLAERVVAARVNEEI-WDLTRPF  101

Query  110  QDSCTLQLLNFMISDPQLVNRVFWRSCSFMLGAVLQGCFKDEAHLHLHSFPSPNVKTGSF  169
            +   TL+LL++  +D      VFW S S +LG  L+  F+    +       P ++ G F
Sbjct  102  EGDATLELLDWDDAD---ARHVFWHSSSHVLGYALERVFQTRLSV------GPALEEGGF  152

Query  170  VHDIFIKEPSWVPNRDELRTIAAEMRKLAAKNLKIERLDVNIDLALEMFKDNPFKNEQLP  229
             ++     P       +  TI   M++L    +  +RL V  + AL +F+   FK++ L 
Sbjct  153  FYEGETNRPV---TEADYTTIETAMQELVKMKVPFQRLTVKKEDALRLFQYTEFKSKILA  209

Query  230  SISSTSSGTVTIYRVGDHVDISRGPMIGSTGLLGKCSIT---SVHRIASESDGALYRVQG  286
            S     +GT T+YR G+ +D  RGP +  TG +   S+T   S +      +  L RV G
Sbjct  210  S-KVPENGTCTVYRCGNLIDPCRGPHLPDTGRVKSFSLTKNSSSYFEGKAENAVLQRVYG  268

Query  287  VALP  290
            ++ P
Sbjct  269  ISFP  272


>SYTC1_DICDI unnamed protein product
Length=710

 Score = 88.6 bits (218),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 59/231 (26%), Positives = 108/231 (47%), Gaps = 17/231 (7%)

Query  63   PSDTTLIMNKGLSTPFNCAQHLGEMHCNRSALALIDSHTPWDMHRPLQDSCTLQLLNFMI  122
            P    +   K  +TP++ A+ +     +    + ++    WD+ RPL+  C LQL  F  
Sbjct  81   PDGKVVAGIKNKTTPYDIAKGISRGLADSIVSSKVNGEQIWDISRPLEADCNLQLCKF--  138

Query  123  SDPQLVNRVFWRSCSFMLGAVLQGCFKDEAHLHLHSFPSPNVKTGSFVHDIFIKEPSWVP  182
             D +   + FW S + +LG  ++  +  +  +       P    G F +D+ + +   + 
Sbjct  139  -DSEEGKKTFWHSSAHILGQAMERIYGGQLCI------GPATSEG-FYYDMAMGDK--IV  188

Query  183  NRDELRTIAAEMRKLAAKNLKIERLDVNIDLALEMFKDNPFKNEQLPSISSTSSGTVTIY  242
            + ++ + I    +K+  +    ERL V  D+AL MFK N +K E +  I      TV++Y
Sbjct  189  SAEDYKLINEVAQKIVQEKQPFERLAVPRDIALTMFKFNKYKTEIISKIPQED--TVSLY  246

Query  243  RVGDHVDISRGPMIGSTGLLGKCSIT---SVHRIASESDGALYRVQGVALP  290
            R G  VD+ RGP + +T  +   ++T   S + +    +  L RV G++ P
Sbjct  247  RCGTLVDLCRGPHVPNTSYIKSFAVTKNSSAYWLGKAENDDLQRVYGISFP  297


>Q8IIA4_PLAF7 unnamed protein product
Length=1013

 Score = 84.0 bits (206),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/190 (28%), Positives = 97/190 (51%), Gaps = 16/190 (8%)

Query  103  WDMHRPLQDSCTLQLLNFMISDPQLVNRVFWRSCSFMLGAVLQGCFKDEAHLHLHSFPSP  162
            WD++ PL  +C ++ +N    + Q   ++FW S + +LG+ L+  F     +       P
Sbjct  334  WDLNVPLLGNCRVEFINIQSEEGQ---KIFWHSSAHILGSSLEKLFGGFLTI------GP  384

Query  163  NVKTGSFVHDIFIKEPSWVPNRDELRTIAAEMRKLAAKNLKIERLDVNIDLALEMFKDNP  222
             +K G F +DIF+   S   N ++ + I  E  KL   N+  E++    + ALE+F  NP
Sbjct  385  ALKEG-FYYDIFLNNFS--INNEDYKRIEDEFNKLVKDNVPFEKVICTKEEALELFDYNP  441

Query  223  FKNEQLPSISSTSSGTVTIYRVGDHVDISRGPMIGSTGLLGKCSI---TSVHRIASESDG  279
            FK E + S    +  T ++YR G+ +D+  GP I +TG +    +   +S + +  + + 
Sbjct  442  FKLELIRSKIPDNKKT-SVYRCGNFIDLCLGPHIKNTGKVKTFKVLKNSSAYWLGQKEND  500

Query  280  ALYRVQGVAL  289
            +L RV G++ 
Sbjct  501  SLQRVYGISF  510



Lambda      K        H
   0.312    0.124    0.361 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5475072226


Query= XP_037024115.1 uncharacterized protein LOC119086012 [Bradysia
coprophila]

Length=360
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q585M5_TRYB2  unnamed protein product                                 32.3    0.61 
Q9VH85_DROME  unnamed protein product                                 30.0    3.7  
Q9VM43_DROME  unnamed protein product                                 29.3    6.2  


>Q585M5_TRYB2 unnamed protein product
Length=342

 Score = 32.3 bits (72),  Expect = 0.61, Method: Compositional matrix adjust.
 Identities = 15/56 (27%), Positives = 30/56 (54%), Gaps = 0/56 (0%)

Query  243  RYGGSPDINSKHEGDYVWLVPVWTTKASKAVTGIQIVVQNEENKNYNDLAQGAKGL  298
            R+ G+  ++ + +   + + P+ T +  KAV  IQ+VV + +NK      Q ++ L
Sbjct  236  RFDGTLQVSKEQQKIKITMPPITTARRQKAVEEIQLVVSSFKNKVKQVRTQASRAL  291


>Q9VH85_DROME unnamed protein product
Length=939

 Score = 30.0 bits (66),  Expect = 3.7, Method: Compositional matrix adjust.
 Identities = 26/84 (31%), Positives = 38/84 (45%), Gaps = 16/84 (19%)

Query  139  VKHSMDLELSASYEKVVETKTESTVTEELTREFNVGANSVGSMYRLNYKGPGVSYATGTI  198
            +  S +LEL  SY + ++    ST+      +F V   S GS+YRLN       YA  T 
Sbjct  566  LPQSFNLELLDSYTQEIKANITSTIP-----KFTVPGLSPGSIYRLNI------YAFNTK  614

Query  199  SSNNSMDLSKVIVNCRVKRLPMLQ  222
              ++       IVN  + R+P  Q
Sbjct  615  GRSD-----PAIVNAAMLRMPEKQ  633


>Q9VM43_DROME unnamed protein product
Length=405

 Score = 29.3 bits (64),  Expect = 6.2, Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 37/100 (37%), Gaps = 18/100 (18%)

Query  1    MKLWLCGLVVAFAIFVHVET---YSTF-----------EGQSEHHIHTRGIDEVNVPFHS  46
            M L +C LV+AF +    +T   YS+F              +     T    + N P   
Sbjct  6    MNLVICNLVLAFIVITFSKTTHAYSSFPTDINSNYFDVRNSTLPMTMTTSHPQTNRPLAR  65

Query  47   YVPGYDATAAISDDESMKDFEPF----DVELEGEYFWELI  82
            YV   +      +DE   D EP+     V+ +  Y   LI
Sbjct  66   YVLPPNELHTADEDEESSDLEPYFEDRAVQRDRSYLIRLI  105



Lambda      K        H
   0.312    0.124    0.361 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5475072226


Query= XP_037024116.1 uncharacterized protein LOC119066004 [Bradysia
coprophila]

Length=318
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TO402_DROME  unnamed protein product                                  34.3    0.11 
PSV_DICDI  unnamed protein product                                    31.6    0.90 
Q38FH3_TRYB2  unnamed protein product                                 31.2    1.2  


>TO402_DROME unnamed protein product
Length=340

 Score = 34.3 bits (77),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 39/80 (49%), Gaps = 10/80 (13%)

Query  194  RRTKDLQAKVKETKLSDKNVLSYLKSK---FNENLFEFFKMQLKNCGRSNHGRRYTDRQK  250
            +  + L+A+ K+ +L++   L  L S+      N FE  K+ + N G SNH       Q 
Sbjct  39   QMVEALKAEAKKPELTNPGTLEELHSRCRDIQANTFEGAKIMV-NKGLSNH------FQV  91

Query  251  SLCLAMYKKGPKSYRFNATW  270
            +  + M   GP  YRF AT+
Sbjct  92   THTINMNSAGPSGYRFGATY  111


>PSV_DICDI unnamed protein product
Length=514

 Score = 31.6 bits (70),  Expect = 0.90, Method: Compositional matrix adjust.
 Identities = 25/97 (26%), Positives = 46/97 (47%), Gaps = 7/97 (7%)

Query  62   AQSDLIVNGKGQVIVKQGSTPSLFLPADFDIPSDVHHIQRSPSKPANPVKQGSTPSLFRP  121
            +Q  ++VNG  Q IV   +  +     +F    + + +QR+    A P +Q  +    +P
Sbjct  249  SQVCIMVNGDAQCIVPPAAAAAEIRINNFRF--NRNSVQRN----AKPAQQQRSAQHAKP  302

Query  122  ADIDIPSDVHHIQRSSSKPANPVKRLQHHRSKKSTEP  158
            A    P+  H  Q+  +KPA   K +QH+  ++  +P
Sbjct  303  AQHGKPAQ-HATQQQHAKPAQNAKPVQHNAQQQHAKP  338


>Q38FH3_TRYB2 unnamed protein product
Length=579

 Score = 31.2 bits (69),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 30/48 (63%), Gaps = 11/48 (23%)

Query  165  EIGVESGCIPKSTKLMNDSRRSNQLSYYKRRTKDLQAKVKETKLSDKN  212
            E+G++ GC+    ++ N+++RS+QLS        +QA  +E KLS+ N
Sbjct  422  EVGMKGGCV----EMSNNTQRSSQLS-------SVQASRREEKLSEDN  458



Lambda      K        H
   0.312    0.124    0.361 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5475072226


Query= XP_037024117.1 neuropeptide SIFamide receptor-like [Bradysia
coprophila]

Length=191
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SIFAR_DROME  unnamed protein product                                  79.3    3e-17
Q9VW75_DROME  unnamed protein product                                 62.0    2e-11
Q8MU51_DROME  unnamed protein product                                 52.8    3e-08


>SIFAR_DROME unnamed protein product
Length=758

 Score = 79.3 bits (194),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/162 (30%), Positives = 85/162 (52%), Gaps = 7/162 (4%)

Query  11   CELTWPSDSLKLAYYGFDGCENC-VIPVCVVLYCYIVIWRKVDQRHIPGEEIGSKRLRQR  69
            C+  WP  +    Y+       C ++P+ ++  CY++IW KV  R IPGE   ++  R +
Sbjct  368  CQEVWPPGTDGNLYFLLANLVACYLLPMSLITLCYVLIWIKVSTRSIPGESKDAQMDRMQ  427

Query  70   REKDAIKVTKIILAITTYFVLSGVPLYVAFFVCEFNKDERNQEQNL--TIHFWLDWLALT  127
             +K  +KV K+++A+   FVLS +PLYV F   +F  D   +E  +   +     WL  +
Sbjct  428  -QKSKVKVIKMLVAVVILFVLSWLPLYVIFARIKFGSDISQEEFEILKKVMPVAQWLGSS  486

Query  128  HLFVNPFLYCMLSTHMRKSFKKLIKCKV--GTVAKNENVSLS  167
            +  +NP LY  ++   R+ F  +IK +   G +   +NV+++
Sbjct  487  NSCINPILYS-VNKKYRRGFAAIIKSRSCCGRLRYYDNVAIA  527


>Q9VW75_DROME unnamed protein product
Length=600

 Score = 62.0 bits (149),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/146 (29%), Positives = 73/146 (50%), Gaps = 6/146 (4%)

Query  11   CELTWPSDSLKLAYYGFDGCENCVIPVCVVLYCYIVIWRKVDQRHIPGEEIGSKRLRQRR  70
            CE  WPS+  +  +         V+P  ++  CY+ I  K++QR        S R R+  
Sbjct  268  CEENWPSEQYRKVFGAITTTLQFVLPFFIISICYVWISVKLNQRARAKPGSKSSR-REEA  326

Query  71   EKDAIKVT-KIILAITTYFVLSGVPLYVAFFVCEFNKDERNQEQNLTIHFWL--DWLALT  127
            ++D  K T ++++A+   F LS +P+ V     +F  D+++ E    I F+     +A++
Sbjct  327  DRDRKKRTNRMLIAMVAVFGLSWLPINVVNIFDDF--DDKSNEWRFYILFFFVAHSIAMS  384

Query  128  HLFVNPFLYCMLSTHMRKSFKKLIKC  153
                NPFLY  L+ + RK FK ++ C
Sbjct  385  STCYNPFLYAWLNENFRKEFKHVLPC  410


>Q8MU51_DROME unnamed protein product
Length=467

 Score = 52.8 bits (125),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 74/152 (49%), Gaps = 16/152 (11%)

Query  10   KCELTWP------SDSLKLAYYGFDGCENCVIPVCVVLYCYIVIWRKVDQRHIPGEEIGS  63
             C + WP      S +  + Y  F G      P+C +L  Y ++ RK+  R + G + G+
Sbjct  211  SCNIMWPDAYKKHSGTTFILYTFFLGFAT---PLCFILSFYYLVIRKL--RSV-GPKPGT  264

Query  64   KRLRQRREKDAIKVTKIILAITTYFVLSGVPLYVA-FFVCEFNKDERNQEQ-NLTIHFWL  121
            K   +RR     KVT+++L + + ++L  +P +++   +   N  +R+  +  + I   L
Sbjct  265  KSKEKRRAHR--KVTRLVLTVISVYILCWLPHWISQVALIHSNPAQRDLSRLEILIFLLL  322

Query  122  DWLALTHLFVNPFLYCMLSTHMRKSFKKLIKC  153
              L  ++  VNP LY  LS + RKSF K   C
Sbjct  323  GALVYSNSAVNPILYAFLSENFRKSFFKAFTC  354



Lambda      K        H
   0.312    0.124    0.361 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5475072226


Query= XP_037024118.1 uncharacterized protein LOC119066006 [Bradysia
coprophila]

Length=1829
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TRXR2_PLAF7  unnamed protein product                                  36.2    0.28 
Q385A7_TRYB2  unnamed protein product                                 34.3    0.96 
G5EBS8_CAEEL  unnamed protein product                                 33.5    1.4  


>TRXR2_PLAF7 unnamed protein product
Length=617

 Score = 36.2 bits (82),  Expect = 0.28, Method: Compositional matrix adjust.
 Identities = 37/134 (28%), Positives = 56/134 (42%), Gaps = 19/134 (14%)

Query  1041  IPKDDIFMLSYVPKEHNKVTKRTVLSELSQLFDPLGFVNPVVVMAKIF--LQEICKLKLQ  1098
             I  DDIF L   P +   V    V  E S   + LG+   V V + +     + C +K  
Sbjct  286   ITSDDIFSLKKDPGKTLVVGASYVALECSGFLNSLGYDVTVAVRSIVLRGFDQQCAVK--  343

Query  1099  WDAAVPMHMNSKWEQYRNQLKKLNKVKLPRRILVDNPSDIQLHLFSDASEEAYGSVAYL-  1157
                 V ++M  +   ++N +      K+  +ILV+         FSD + E Y +V Y  
Sbjct  344   ----VKLYMEEQGVMFKNGILPKKLTKMDDKILVE---------FSDKTSELYDTVLYAI  390

Query  1158  -RSVNSDGERLVSL  1170
              R  + DG  L SL
Sbjct  391   GRKGDIDGLNLESL  404


>Q385A7_TRYB2 unnamed protein product
Length=422

 Score = 34.3 bits (77),  Expect = 0.96, Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 6/57 (11%)

Query  485  KMCWNCLVKGHEIRDCKQKNSCTKCN--RKHHTL---MHSEKMATSLLGTTTKNEHL  536
            K+CW C ++GHE  DC   + C  C+  R+HH +   + +    T   G T   E L
Sbjct  135  KVCWVCGMEGHEKPDC-HNSLCKTCHSVRRHHHICQEVQTSPFVTICSGDTRSKEML  190


>G5EBS8_CAEEL unnamed protein product
Length=264

 Score = 33.5 bits (75),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 38/172 (22%), Positives = 74/172 (43%), Gaps = 16/172 (9%)

Query  971   DDVMTGAENVEQALVLQEQLIQMCKSGHFELHKWCSNHPMLLETIPAKKREVS---LEIN  1027
             D+++ GA         QE++  +  S    LH + + +P  L+T+ A  R +S    +  
Sbjct  3     DNLLNGANGASTVSQFQEKVKDLGVS----LHDFTAYYPSSLDTVSASLRPISDPSSDGA  58

Query  1028  AEKTETKALGVKWIPKDDIFMLSYVP--KEHNKVTKRTVLSELSQLFDPLGFVNPVVVMA  1085
              +K +T+ LG   +    I  ++  P  + H     +  L EL   F    + +   +  
Sbjct  59    FKKIKTEGLGGS-VFGSSIAGVTNTPARRRHRTTFTQEQLQELDAAFQKSHYPD---IYV  114

Query  1086  KIFLQEICKLKLQWDAAVPMHMNSKWEQYRNQLKKLNKVKLPRRILVDNPSD  1137
             +  L  I KL    +A + +   ++  ++R   K+LNK   P    + NP++
Sbjct  115   REELARITKLN---EARIQVWFQNRRAKHRKHEKQLNKAINPPHSFLSNPAN  163



Lambda      K        H
   0.312    0.124    0.361 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5475072226


Query= XP_037024119.1 uncharacterized protein LOC119065997 [Bradysia
coprophila]

Length=453
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

NRDE2_CAEEL  unnamed protein product                                  30.4    3.9  
H2KYA5_CAEEL  unnamed protein product                                 30.0    5.0  
D1MN54_CAEEL  unnamed protein product                                 30.0    5.6  


>NRDE2_CAEEL unnamed protein product
Length=1270

 Score = 30.4 bits (67),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 40/143 (28%), Positives = 59/143 (41%), Gaps = 22/143 (15%)

Query  272   FMQQMTSFSR----CATPSPVPRSGQI--TPTPYNSGDYHDAFGQTSNRLTVDFLSSI--  323
             F+ +M +FSR    C   + + +  Q       +N G Y     Q   +   D L +   
Sbjct  1005  FLDKM-AFSRRAVDCLIANAITKFEQFEAKKNDFNRGTYEKYCDQIDLKFITDTLITFFS  1063

Query  324   -AKAKVPYNNNPGPSSL-SSMSMQDDSQYASMLAELEQS--IIEKKIQAGFSPDDISQST  379
               K +  YN N       +S +   DS+YA ML EL  S  +   K+Q GF        T
Sbjct  1064  HKKHRFIYNENFKKLIFQASQAFPCDSKYAKMLGELHSSGRLQVMKLQ-GF--------T  1114

Query  380   DKYCSSKSSSKDLEFSKELEAAL  402
             D   S  ++ +D +F  ELE  L
Sbjct  1115  DSRNSILNAKRDQQFDPELETRL  1137


>H2KYA5_CAEEL unnamed protein product
Length=1793

 Score = 30.0 bits (66),  Expect = 5.0, Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 41/88 (47%), Gaps = 10/88 (11%)

Query  346   DDSQYASMLAELEQSII--EKKIQAGFSPDDISQSTDKYCSSKSSSKDLEFSKE------  397
             D  + A +  +L+ S I  E+K+  G +P  ISQ +D   + +S+S  +           
Sbjct  1227  DKKEEAQLKEQLKDSEINSERKVTKGAAPSTISQDSDGKDTFESASAYIRRKNRERRQRN  1286

Query  398   --LEAALQLIQELETPSEGPLDHKTLSP  423
               +  A + ++ LE PS  P D +  SP
Sbjct  1287  RTIGTAEEALRALERPSVDPYDDRAFSP  1314


>D1MN54_CAEEL unnamed protein product
Length=1554

 Score = 30.0 bits (66),  Expect = 5.6, Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 41/88 (47%), Gaps = 10/88 (11%)

Query  346   DDSQYASMLAELEQSII--EKKIQAGFSPDDISQSTDKYCSSKSSSKDLEFSKE------  397
             D  + A +  +L+ S I  E+K+  G +P  ISQ +D   + +S+S  +           
Sbjct  988   DKKEEAQLKEQLKDSEINSERKVTKGAAPSTISQDSDGKDTFESASAYIRRKNRERRQRN  1047

Query  398   --LEAALQLIQELETPSEGPLDHKTLSP  423
               +  A + ++ LE PS  P D +  SP
Sbjct  1048  RTIGTAEEALRALERPSVDPYDDRAFSP  1075



Lambda      K        H
   0.312    0.124    0.361 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5475072226


Query= XP_037024120.1 synaptic vesicle glycoprotein 2A-like [Bradysia
coprophila]

Length=309
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

BALAT_DROME  unnamed protein product                                  61.6    2e-10
OCT1_CAEEL  unnamed protein product                                   57.4    5e-09
Q7KWJ5_PLAF7  unnamed protein product                                 48.5    4e-06


>BALAT_DROME unnamed protein product
Length=604

 Score = 61.6 bits (148),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 66/262 (25%), Positives = 113/262 (43%), Gaps = 30/262 (11%)

Query  20   GIIVSSFLWGYLADTKGRQIVMKWSLLLAFIVSVASSFSNDFWSLLILRFLTGFFVSGGY  79
            G ++ ++++GYL D  GR+      LLL  I   AS+F+ ++++ L LRF+ G  V    
Sbjct  164  GGLLGNYVFGYLVDLWGRRPSFYAYLLLEIIACAASAFAWNYYTWLGLRFVVGLTVPAIL  223

Query  80   GPAFAYIGEFHTEKNRSRVILYASIILGLFTLVLPLVAWLVINQDWMFDFPAIQFTYKPW  139
               +    E    + R    + ++I   L  +VL  V ++V                + W
Sbjct  224  ASPYVLAIELVGPERRVFCTIVSNIAYSLGLVVLAGVIYIV----------------RDW  267

Query  140  RLFVVGCSMLSLVAFVILCILPESPKFVLNNGNVEGAIEIIKTVHRWNCGKSADLDHIYG  199
            R   +  SM  L+ F    +LPESP++++  G    AI+I+K + R N G   + D +  
Sbjct  268  RELSLAVSMPLLMLFSCFFVLPESPRWLMAVGKTRRAIKILKVMARVN-GVRVNRDFVER  326

Query  200  LYDETASEHEQDVRKMTLFASIWFQIKPLFLPQHLRTTVLICILKFIEFAGTN---GLYV  256
            L  +       + +      +  + I  LF   ++R   L  I+  I FA T+   GL  
Sbjct  327  LQRKLVITRAAETKSSM---TTHYGILDLFRGPNMRRKTL--IITLIWFANTSVYVGLSY  381

Query  257  WIP-----EVLNRLAKNDVDYP  273
            + P     E+ N      V+ P
Sbjct  382  YAPALGGDEIWNFFLAGAVELP  403


>OCT1_CAEEL unnamed protein product
Length=585

 Score = 57.4 bits (137),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 53/221 (24%), Positives = 86/221 (39%), Gaps = 22/221 (10%)

Query  20   GIIVSSFLWGYLADTKGRQIVMKWSLLLAFIVSVASSFSNDFWSLLILRFLTGFFVSGGY  79
            G  + + L+GY+AD  GR+      L +  +   ASSF+ D  S +ILRF TG      +
Sbjct  164  GSFIGNCLFGYVADKFGRRRSFFVILTVLIVCGTASSFAKDIESFIILRFFTGLAFPALF  223

Query  80   GPAFAYIGEFHTEKNRSRVILYASIILGLFTLVLPLVAWLVINQDWMFDFPAIQFTYKPW  139
               F    EF     R    L  S+  G    +L +VA  +                + W
Sbjct  224  QIPFIICMEFMGNSGRIFSGLMTSLFFGAAMALLGVVAMFI----------------RRW  267

Query  140  RLFVVGCSMLSLVAFVILCILPESPKFVLNNGNVEGAIEIIKTVHRWNCGKSADLDHIYG  199
            R     C+       +    LPESP++ ++ G    A + +K + + N   + D+D +  
Sbjct  268  RQLTFFCNAPFAFYIIYYFFLPESPRWSVSVGKWADAKKQLKKIAKMNGKSNVDVDELVD  327

Query  200  LYDETASEHEQDVRKMTLFASIWFQIKPLFLPQHLRTTVLI  240
                  +  E+   K +        +  LF   +LR   LI
Sbjct  328  SMKNHQNAAEEKETKRS------HNVTDLFKTPNLRRKTLI  362


>Q7KWJ5_PLAF7 unnamed protein product
Length=504

 Score = 48.5 bits (114),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 64/260 (25%), Positives = 111/260 (43%), Gaps = 36/260 (14%)

Query  16   NCRAGIIVSSFLW--------------GYLADTKGRQIVMKWSLLLAFIVSVASSFSNDF  61
            NC    I SSFL               GYL    GR++ +       F+VS+ +S ++ F
Sbjct  69   NCSNNTIQSSFLLASVFIGAVLGCGFSGYLVQF-GRRLSLLIIYNFFFLVSILTSITHHF  127

Query  62   WSLLILRFLTGFFVSGGYGPAFAYIGEF-HTEKNRSRVILYAS-IILGLFTLVLPLVAWL  119
             ++L  R L+GF +         YI E  H +K  +  +++   I  G+F  V+     L
Sbjct  128  HTILFARLLSGFGIGLVTVSVPMYISEMTHKDKKGAYGVMHQLFITFGIFVAVM---LGL  184

Query  120  VINQDWMFDF--PAIQFTYKPWRLFVVGCSMLSLVAFVILCIL--PESPKFVLNNGNVEG  175
             + +    D   P   F    WRL  +  S++SL+  + L +    E+P F+   G +E 
Sbjct  185  AMGEGPKADSTEPLTSFAKLWWRLMFLFPSVISLIGILALVVFFKEETPYFLFEKGRIEE  244

Query  176  AIEIIKTVHRWNCGKSADLDHIYGLYDETASEHEQDVRKMTLFASIWFQIKPLFLPQHLR  235
            +  I+K ++  +     ++D       E A E  +  +K +L       +  L +P +  
Sbjct  245  SKNILKKIYETD-----NVDEPLNAIKE-AVEQNESAKKNSLSL-----LSALKIPSYRY  293

Query  236  TTVLICILKFI-EFAGTNGL  254
              +L C+L  + +F G N L
Sbjct  294  VIILGCLLSGLQQFTGINVL  313



Lambda      K        H
   0.312    0.124    0.361 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5475072226


Query= XP_037024121.1 uncharacterized protein LOC119066008 [Bradysia
coprophila]

Length=115
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VNX2_DROME  unnamed protein product                                 33.5    0.027
Q8INW2_DROME  unnamed protein product                                 28.1    1.8  
B7YZX0_DROME  unnamed protein product                                 28.1    1.8  


>Q9VNX2_DROME unnamed protein product
Length=568

 Score = 33.5 bits (75),  Expect = 0.027, Method: Compositional matrix adjust.
 Identities = 23/90 (26%), Positives = 46/90 (51%), Gaps = 2/90 (2%)

Query  4    EVPMLSAYLYML-QILIGTTDSILNAVIVDLYPTNVRATAMAIGSVAGRLGSVFFAYVIG  62
            + P+L   L+++ ++ I  +  +L     ++YPTN+R + ++  S+ GR GS+  A    
Sbjct  443  DQPVLQLVLFLVGKLTITASFQVLYFFASEIYPTNLRNSLLSFCSMMGRFGSM-LAPQTP  501

Query  63   LLLDYHCSEALVMTFSLYILCAFLVIFIPN  92
            LL  Y+ +   ++     I+   L +F P 
Sbjct  502  LLAKYYANAPAMLFAGAAIVSGLLTLFFPE  531


>Q8INW2_DROME unnamed protein product
Length=1676

 Score = 28.1 bits (61),  Expect = 1.8, Method: Composition-based stats.
 Identities = 21/73 (29%), Positives = 32/73 (44%), Gaps = 3/73 (4%)

Query  11    YLYMLQILIGTTDSILNAVIVDLYPTNVRATAMAIGSVAGRLGSVFFAYVIGLLLDYHCS  70
             Y+   Q +I   D   NA      P  V+A +     ++GR+ SV F Y IG  + + C 
Sbjct  1559  YMMQGQPIIACQD---NARWSGGLPKCVQACSYPGTVISGRMSSVKFYYAIGESITFTCD  1615

Query  71    EALVMTFSLYILC  83
               L +  S  + C
Sbjct  1616  AGLDLRGSKVLKC  1628


>B7YZX0_DROME unnamed protein product
Length=1677

 Score = 28.1 bits (61),  Expect = 1.8, Method: Composition-based stats.
 Identities = 21/73 (29%), Positives = 32/73 (44%), Gaps = 3/73 (4%)

Query  11    YLYMLQILIGTTDSILNAVIVDLYPTNVRATAMAIGSVAGRLGSVFFAYVIGLLLDYHCS  70
             Y+   Q +I   D   NA      P  V+A +     ++GR+ SV F Y IG  + + C 
Sbjct  1560  YMMQGQPIIACQD---NARWSGGLPKCVQACSYPGTVISGRMSSVKFYYAIGESITFTCD  1616

Query  71    EALVMTFSLYILC  83
               L +  S  + C
Sbjct  1617  AGLDLRGSKVLKC  1629



Lambda      K        H
   0.312    0.124    0.361 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5475072226


Query= XP_037024122.1 serine/threonine-protein kinase Doa-like [Bradysia
coprophila]

Length=436
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DOA_DROME  unnamed protein product                                    306     5e-96
Q8IL19_PLAF7  unnamed protein product                                 184     8e-51
Q382U0_TRYB2  unnamed protein product                                 145     9e-39


>DOA_DROME unnamed protein product
Length=832

 Score = 306 bits (784),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 156/349 (45%), Positives = 230/349 (66%), Gaps = 13/349 (4%)

Query  98   KELLTDDT-GHIKWYTGQQIGD-YIVETELGEGTFGRVMKVRDINTGQAAALKVVKNQPG  155
            K ++ DD  GH+ ++TG  +   Y +   LGEGTFGRV+KV+D+      ALK++KN   
Sbjct  456  KPVIQDDADGHLIYHTGDILHHRYKIMATLGEGTFGRVVKVKDMERDYCMALKIIKNVEK  515

Query  156  QRKSVMDEVIALKVIGSRDDMKSCLCVHMISWFSCGGHICIAFPLLGSSVYDFMKDNHFQ  215
             R++   E+ AL+ I  +D     LCV MI WF   GH+CI F +LG SV+DF+++N+++
Sbjct  516  YREAAKLEINALEKIAQKDPHCDHLCVKMIDWFDYHGHMCIVFEMLGLSVFDFLRENNYE  575

Query  216  PFLLDEVQHIGHQLCAAVSFLHENHITHTDLKTENILFVNSSYTTVYCEERNLELKRLRS  275
            P+ LD+V+H+ +QLC +V FLH+N +THTDLK ENILFV+S YT+ Y  + N E++R+++
Sbjct  576  PYPLDQVRHMAYQLCYSVKFLHDNRLTHTDLKPENILFVDSDYTSHYNHKINREVRRVKN  635

Query  276  TNIRLGDFGNVVRDGEYHPEIIGTRYYRSPEVILRLDWNDTCDVWALGCILFELYSGKLL  335
            T++RL DFG+   D E+H  I+ TR+YR+PEVIL L W+  CDVW++GCILFELY G  L
Sbjct  636  TDVRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSQPCDVWSIGCILFELYLGITL  695

Query  336  FPTEYDYEHLALMEAIIGKIPEEMT------NASNTTYFKNGNLDFNWSNAEEHAQYNR-  388
            F T  + EHLA+ME I+G+IP  M       + + T YF +G LD  W       +Y R 
Sbjct  696  FQTHDNREHLAMMERILGQIPYRMARNHTLYSKTKTKYFYHGKLD--WDEKSSAGRYVRD  753

Query  389  --RPLEDFRMDDSQYLDDLFYAMERMLQHEPTRRISSTEALTLPLWNDL  435
              +PL   ++ DS+   +LF  +++ML++EP+ RI+  EAL  P ++ L
Sbjct  754  HCKPLFLCQLSDSEDHCELFSLIKKMLEYEPSSRITLGEALHHPFFDRL  802


>Q8IL19_PLAF7 unnamed protein product
Length=881

 Score = 184 bits (467),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 132/425 (31%), Positives = 220/425 (52%), Gaps = 31/425 (7%)

Query  23   SDCDNSDCDNSAK---KRKTQHLDESDWDSDSENSAKKSKTQDIVEYARESHSSESDWDS  79
            SD + S   N      ++K  H+D+  +D+DS N      + D   Y+R+ ++ + +   
Sbjct  456  SDSNKSGFSNKGSYYMQKKKLHVDK--YDNDSHNRTISRTSSD--NYSRKKYTHKRNRTK  511

Query  80   DCDSDNSAKRLKTQPNEPKELLTDDTGHIKWYTGQQIGD-YIVETELGEGTFGRVMKVRD  138
              D+++  +R K +  +      D+  H  W  G  + + ++V  ++G+GTFGRV+  + 
Sbjct  512  TSDTEDKKERKKKKKKKENNESDDEIVHFSWKKGMLLNNAFLVIRKMGDGTFGRVLLCQH  571

Query  139  INTGQAAALKVVKNQPGQRKSVMDEVIALKVIGSRDDMKSCLCVHMISWFSCGGHICIAF  198
            I+  +  A+KVV+N     +S   E   LK I   DD+ +   V     F    H+C+ F
Sbjct  572  IDNKKYYAVKVVRNIKKYTRSAKIEADILKKI-QNDDINNNNIVKYHGKFMYYDHMCLIF  630

Query  199  PLLGSSVYDFMKDNHFQPFLLDEVQHIGHQLCAAVSFLHENHITHTDLKTENIL----FV  254
              LG S+Y+ +  N++  F +++++    ++  A+++L +  +THTDLK ENIL    + 
Sbjct  631  EPLGPSLYEIITRNNYNGFHIEDIKLYCIEILKALNYLRKMSLTHTDLKPENILLDDPYF  690

Query  255  NSSYTTV--YCEERNLELKRLRSTNIRLGDFGNVVRDGEYHPEIIGTRYYRSPEVILRLD  312
              S  TV    + + +++ R +ST I+L DFG      +YH  II TR YR+PEVIL L 
Sbjct  691  EKSLITVRRVTDGKKIQIYRTKSTGIKLIDFGCATFKSDYHGSIINTRQYRAPEVILNLG  750

Query  313  WNDTCDVWALGCILFELYSGKLLFPTEYDYEHLALMEAIIGKIPEEM----TNASNTTYF  368
            W+ + D+W+ GC+L ELY+G LLF T    EHLA+ME+II  IP+ M    T  + + Y 
Sbjct  751  WDVSSDMWSFGCVLAELYTGSLLFRTHEHMEHLAMMESIIQPIPKNMLYEATKTNGSKYV  810

Query  369  KNGNLDFNWS------NAEEHAQYNRRPLEDFRMDDSQYLDDLFYAMERMLQHEPTRRIS  422
                L   W       N+ +H    ++ L  +++   +   D  Y+   +LQ +PT R S
Sbjct  811  NKDELKLAWPENASSINSIKHV---KKCLPLYKIIKHELFCDFLYS---ILQIDPTLRPS  864

Query  423  STEAL  427
              E L
Sbjct  865  PAELL  869


>Q382U0_TRYB2 unnamed protein product
Length=465

 Score = 145 bits (367),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 104/349 (30%), Positives = 169/349 (48%), Gaps = 26/349 (7%)

Query  21   DNSDCDNSDCDNSAKKRKTQHLDESDWDSDSENSAKKSKTQDIVEYARESHSSESDWDSD  80
            +N   +N  C N   +  T     S    D E       T D  +  R   +++S   + 
Sbjct  28   NNPKINNGACSNMTPRESTNSARRSGSKRDRE-------TADTADDGRNK-NNQSITGTT  79

Query  81   CDSDNSAKRLKTQPNEPKELLT-------DDTGHIKWYTGQQI----GDYIVETELGEGT  129
              + ++AK  + QP   K+ +T        + GH     G+ I    G + + + LGEGT
Sbjct  80   ATTTSTAKHSEMQPPPKKKKVTYALPNQSREEGHFYVVLGEDIDASTGRFKILSLLGEGT  139

Query  130  FGRVMKVRDINTGQAAALKVVKNQPGQRKSVMDEVIALKVIGSRDDMKSCLCVHMISWFS  189
            FG+V++  D    +  A+K+V+N P   +    E+  ++ +   D       + +  +F 
Sbjct  140  FGKVVEAWDRKRKEYCAVKIVRNVPKYTRDAKIEIQFMERVRLSDVEDRFPLMKIQRYFQ  199

Query  190  C-GGHICIAFPLLGSSVYDFMKDNHFQPFLLDEVQHIGHQLCAAVSFLH-ENHITHTDLK  247
               GH+CI  P  G  + D++  +   PF    +  I  Q+ AA+ + H E H+ HTDLK
Sbjct  200  NETGHMCIVMPKYGPCLLDWIMKH--GPFNHRHLAQIIFQVGAALDYFHTELHLMHTDLK  257

Query  248  TENILFVNSSYTTVYCEERNLELKRLRSTNIRLGDFGNVVRDGEYHPEIIGTRYYRSPEV  307
             ENIL  +   +      R L  +  R   +R+ D G    +      I+ TR+YRSPEV
Sbjct  258  PENILMESGDTSVDPMTHRALPPEPCR---VRICDLGGCCDERHSRTAIVSTRHYRSPEV  314

Query  308  ILRLDWNDTCDVWALGCILFELYSGKLLFPTEYDYEHLALMEAIIGKIP  356
            +L L W  + D+W++GCI++ELY+GKLL+ T  + EHL LME  +G++P
Sbjct  315  VLSLGWMYSTDLWSMGCIIYELYTGKLLYDTHDNLEHLHLMEKTLGRLP  363



Lambda      K        H
   0.312    0.124    0.361 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5475072226


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jul 7, 2021  1:54 PM
  Number of letters in database: 17,197,330
  Number of sequences in database:  25,232



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= XP_037024123.1 sericin-2-like [Bradysia coprophila]

Length=357
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q57WE8_TRYB2  unnamed protein product                                 47.4    1e-05


>Q57WE8_TRYB2 unnamed protein product
Length=4334

 Score = 47.4 bits (111),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 60/279 (22%), Positives = 102/279 (37%), Gaps = 5/279 (2%)

Query  63    EEDGQPQDIESVVETMTPTEGARNTESVVETMTVIEKTKSGVEL-GSNE----LDGSMSR  117
             E + Q  ++ +  E +  TEG +  E  V+   + E  +   EL   NE     DG  +R
Sbjct  3202  EMEEQLAELRAENEELRNTEGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKAR  3261

Query  118   KGSTPNENAKVEESTTLTVGTPTIQNNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQ  177
             +    NE     E     +     +  N DG  +R+    NE     E   + +     +
Sbjct  3262  ELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEE  3321

Query  178   NNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQNNNMDGSMSRKGSTPNENAKVEEST  237
               N DG  +R+    NE     E   + +     +  N DG  +R+    NE     E  
Sbjct  3322  LRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQ  3381

Query  238   TSTVGTPTIQNNNMDGSMSRKGSTPNENMKVEESTTVIVGTPTIQNINMDGSMSRKGSTP  297
              + +     +  N DG  +R+    NE +   E     +     +  N DG  +R+    
Sbjct  3382  LAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQ  3441

Query  298   NENMKVEESTTSTVGTPTIQNNNMDGSMSRKASTLNENM  336
             NE +   E   + +     +  N DG  +R+    NE +
Sbjct  3442  NEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKL  3480


 Score = 46.6 bits (109),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 58/266 (22%), Positives = 96/266 (36%), Gaps = 5/266 (2%)

Query  76    ETMTPTEGARNTESVVETMTVIEKTKSGVEL-GSNE----LDGSMSRKGSTPNENAKVEE  130
             E +  TEG +  E  V+   + E  +   EL   NE     DG  +R+    NE     E
Sbjct  2795  EELRNTEGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEME  2854

Query  131   STTLTVGTPTIQNNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQNNNMDGSMSRKGS  190
                  +     +  N DG  +R+    NE     E   + +     +  N DG  +R+  
Sbjct  2855  EQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELD  2914

Query  191   TPNENAKVEESTTSTVGTPTIQNNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQNNN  250
               NE     E   + +     +  N DG  +R+    NE     E   + +     +  N
Sbjct  2915  VQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRN  2974

Query  251   MDGSMSRKGSTPNENMKVEESTTVIVGTPTIQNINMDGSMSRKGSTPNENMKVEESTTST  310
              DG  +R+    NE +   E     +     +  N DG  +R+    NE +   E   + 
Sbjct  2975  TDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAE  3034

Query  311   VGTPTIQNNNMDGSMSRKASTLNENM  336
             +     +  N DG  +R+    NE +
Sbjct  3035  LRAENEELRNTDGDKARELDVQNEKL  3060


 Score = 46.2 bits (108),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 66/333 (20%), Positives = 122/333 (37%), Gaps = 12/333 (4%)

Query  9     DLRNAQKVYKMWKNKNIEMEIRKRIEVRLSSSNVNSNIDESMTSMISTPMNENREEDGQP  68
             ++RN Q +Y       ++ E+ ++I    + +    N +      +     +  E + Q 
Sbjct  2770  EVRNQQLLY-------LQKELEQKINGLRTENEELRNTEGDKARELDVQNEKLHEMEEQL  2822

Query  69    QDIESVVETMTPTEGARNTESVVETMTVIEKTKSGVEL-GSNE----LDGSMSRKGSTPN  123
              ++ +  E +  T+G +  E  V+   + E  +   EL   NE     DG  +R+    N
Sbjct  2823  AELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQN  2882

Query  124   ENAKVEESTTLTVGTPTIQNNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQNNNMDG  183
             E     E     +     +  N DG  +R+    NE     E   + +     +  N DG
Sbjct  2883  EKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDG  2942

Query  184   SMSRKGSTPNENAKVEESTTSTVGTPTIQNNNMDGSMSRKGSTPNENAKVEESTTSTVGT  243
               +R+    NE     E   + +     +  N DG  +R+    NE     E   + +  
Sbjct  2943  DKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRA  3002

Query  244   PTIQNNNMDGSMSRKGSTPNENMKVEESTTVIVGTPTIQNINMDGSMSRKGSTPNENMKV  303
                +  N DG  +R+    NE +   E     +     +  N DG  +R+    NE +  
Sbjct  3003  ENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHE  3062

Query  304   EESTTSTVGTPTIQNNNMDGSMSRKASTLNENM  336
              E   + +     +  N DG  +R+    NE +
Sbjct  3063  MEEQLAELRAENEELRNTDGDKARELDVQNEKL  3095


 Score = 46.2 bits (108),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 59/279 (21%), Positives = 102/279 (37%), Gaps = 5/279 (2%)

Query  63    EEDGQPQDIESVVETMTPTEGARNTESVVETMTVIEKTKSGVEL-GSNE----LDGSMSR  117
             E + Q  ++ +  E +  T+G +  E  V+   + E  +   EL   NE     DG  +R
Sbjct  3237  EMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKAR  3296

Query  118   KGSTPNENAKVEESTTLTVGTPTIQNNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQ  177
             +    NE     E     +     +  N DG  +R+    NE     E   + +     +
Sbjct  3297  ELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEE  3356

Query  178   NNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQNNNMDGSMSRKGSTPNENAKVEEST  237
               N DG  +R+    NE     E   + +     +  N DG  +R+    NE     E  
Sbjct  3357  LRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQ  3416

Query  238   TSTVGTPTIQNNNMDGSMSRKGSTPNENMKVEESTTVIVGTPTIQNINMDGSMSRKGSTP  297
              + +     +  N DG  +R+    NE +   E     +     +  N DG  +R+    
Sbjct  3417  LAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQ  3476

Query  298   NENMKVEESTTSTVGTPTIQNNNMDGSMSRKASTLNENM  336
             NE +   E   + +     +  N DG  +R+    NE +
Sbjct  3477  NEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKL  3515


 Score = 45.8 bits (107),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 59/279 (21%), Positives = 102/279 (37%), Gaps = 5/279 (2%)

Query  63    EEDGQPQDIESVVETMTPTEGARNTESVVETMTVIEKTKSGVEL-GSNE----LDGSMSR  117
             E + Q  ++ +  E +  TEG +  E  V+   + E  +   EL   NE     DG  +R
Sbjct  1414  EMEEQLAELRAENEELRNTEGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKAR  1473

Query  118   KGSTPNENAKVEESTTLTVGTPTIQNNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQ  177
             +    NE     E     +     +  N DG  +R+    NE     E   + +     +
Sbjct  1474  ELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEE  1533

Query  178   NNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQNNNMDGSMSRKGSTPNENAKVEEST  237
               N DG  +R+    NE     E   + +     +  N +G  +R+    NE     E  
Sbjct  1534  LRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTEGDKARELDVQNEKLHEMEEQ  1593

Query  238   TSTVGTPTIQNNNMDGSMSRKGSTPNENMKVEESTTVIVGTPTIQNINMDGSMSRKGSTP  297
              + +     +  N DG  +R+    NE +   E     +     +  N DG  +R+    
Sbjct  1594  LAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQ  1653

Query  298   NENMKVEESTTSTVGTPTIQNNNMDGSMSRKASTLNENM  336
             NE +   E   + +     +  N DG  +R+    NE +
Sbjct  1654  NEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKL  1692


 Score = 45.8 bits (107),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 59/279 (21%), Positives = 102/279 (37%), Gaps = 5/279 (2%)

Query  63    EEDGQPQDIESVVETMTPTEGARNTESVVETMTVIEKTKSGVEL-GSNE----LDGSMSR  117
             E + Q  ++ +  E +  TEG +  E  V+   + E  +   EL   NE     DG  +R
Sbjct  1554  EMEEQLAELRAENEELRNTEGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKAR  1613

Query  118   KGSTPNENAKVEESTTLTVGTPTIQNNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQ  177
             +    NE     E     +     +  N DG  +R+    NE     E   + +     +
Sbjct  1614  ELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEE  1673

Query  178   NNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQNNNMDGSMSRKGSTPNENAKVEEST  237
               N DG  +R+    NE     E   + +     +  N DG  +R+    NE     E  
Sbjct  1674  LRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQ  1733

Query  238   TSTVGTPTIQNNNMDGSMSRKGSTPNENMKVEESTTVIVGTPTIQNINMDGSMSRKGSTP  297
              + +     +  N DG  +R+    NE +   E     +     +  N +G  +R+    
Sbjct  1734  LAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTEGDKARELDVQ  1793

Query  298   NENMKVEESTTSTVGTPTIQNNNMDGSMSRKASTLNENM  336
             NE +   E   + +     +  N DG  +R+    NE +
Sbjct  1794  NEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKL  1832


 Score = 45.8 bits (107),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 59/279 (21%), Positives = 102/279 (37%), Gaps = 5/279 (2%)

Query  63    EEDGQPQDIESVVETMTPTEGARNTESVVETMTVIEKTKSGVEL-GSNE----LDGSMSR  117
             E + Q  ++ +  E +  TEG +  E  V+   + E  +   EL   NE     DG  +R
Sbjct  3097  EMEEQLAELRAENEELRNTEGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKAR  3156

Query  118   KGSTPNENAKVEESTTLTVGTPTIQNNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQ  177
             +    NE     E     +     +  N DG  +R+    NE     E   + +     +
Sbjct  3157  ELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEE  3216

Query  178   NNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQNNNMDGSMSRKGSTPNENAKVEEST  237
               N +G  +R+    NE     E   + +     +  N DG  +R+    NE     E  
Sbjct  3217  LRNTEGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQ  3276

Query  238   TSTVGTPTIQNNNMDGSMSRKGSTPNENMKVEESTTVIVGTPTIQNINMDGSMSRKGSTP  297
              + +     +  N DG  +R+    NE +   E     +     +  N DG  +R+    
Sbjct  3277  LAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQ  3336

Query  298   NENMKVEESTTSTVGTPTIQNNNMDGSMSRKASTLNENM  336
             NE +   E   + +     +  N DG  +R+    NE +
Sbjct  3337  NEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKL  3375


 Score = 44.7 bits (104),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 58/279 (21%), Positives = 102/279 (37%), Gaps = 5/279 (2%)

Query  63    EEDGQPQDIESVVETMTPTEGARNTESVVETMTVIEKTKSGVEL-GSNE----LDGSMSR  117
             E + Q  ++ +  E +  T+G +  E  V+   + E  +   EL   NE     DG  +R
Sbjct  1449  EMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKAR  1508

Query  118   KGSTPNENAKVEESTTLTVGTPTIQNNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQ  177
             +    NE     E     +     +  N DG  +R+    NE     E   + +     +
Sbjct  1509  ELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEE  1568

Query  178   NNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQNNNMDGSMSRKGSTPNENAKVEEST  237
               N +G  +R+    NE     E   + +     +  N DG  +R+    NE     E  
Sbjct  1569  LRNTEGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQ  1628

Query  238   TSTVGTPTIQNNNMDGSMSRKGSTPNENMKVEESTTVIVGTPTIQNINMDGSMSRKGSTP  297
              + +     +  N DG  +R+    NE +   E     +     +  N DG  +R+    
Sbjct  1629  LAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQ  1688

Query  298   NENMKVEESTTSTVGTPTIQNNNMDGSMSRKASTLNENM  336
             NE +   E   + +     +  N DG  +R+    NE +
Sbjct  1689  NEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKL  1727


 Score = 44.7 bits (104),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 58/279 (21%), Positives = 102/279 (37%), Gaps = 5/279 (2%)

Query  63    EEDGQPQDIESVVETMTPTEGARNTESVVETMTVIEKTKSGVEL-GSNE----LDGSMSR  117
             E + Q  ++ +  E +  T+G +  E  V+   + E  +   EL   NE     DG  +R
Sbjct  1484  EMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKAR  1543

Query  118   KGSTPNENAKVEESTTLTVGTPTIQNNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQ  177
             +    NE     E     +     +  N +G  +R+    NE     E   + +     +
Sbjct  1544  ELDVQNEKLHEMEEQLAELRAENEELRNTEGDKARELDVQNEKLHEMEEQLAELRAENEE  1603

Query  178   NNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQNNNMDGSMSRKGSTPNENAKVEEST  237
               N DG  +R+    NE     E   + +     +  N DG  +R+    NE     E  
Sbjct  1604  LRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQ  1663

Query  238   TSTVGTPTIQNNNMDGSMSRKGSTPNENMKVEESTTVIVGTPTIQNINMDGSMSRKGSTP  297
              + +     +  N DG  +R+    NE +   E     +     +  N DG  +R+    
Sbjct  1664  LAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQ  1723

Query  298   NENMKVEESTTSTVGTPTIQNNNMDGSMSRKASTLNENM  336
             NE +   E   + +     +  N DG  +R+    NE +
Sbjct  1724  NEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKL  1762


 Score = 44.7 bits (104),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 58/279 (21%), Positives = 102/279 (37%), Gaps = 5/279 (2%)

Query  63    EEDGQPQDIESVVETMTPTEGARNTESVVETMTVIEKTKSGVEL-GSNE----LDGSMSR  117
             E + Q  ++ +  E +  T+G +  E  V+   + E  +   EL   NE     DG  +R
Sbjct  2852  EMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKAR  2911

Query  118   KGSTPNENAKVEESTTLTVGTPTIQNNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQ  177
             +    NE     E     +     +  N DG  +R+    NE     E   + +     +
Sbjct  2912  ELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEE  2971

Query  178   NNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQNNNMDGSMSRKGSTPNENAKVEEST  237
               N DG  +R+    NE     E   + +     +  N DG  +R+    NE     E  
Sbjct  2972  LRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQ  3031

Query  238   TSTVGTPTIQNNNMDGSMSRKGSTPNENMKVEESTTVIVGTPTIQNINMDGSMSRKGSTP  297
              + +     +  N DG  +R+    NE +   E     +     +  N DG  +R+    
Sbjct  3032  LAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQ  3091

Query  298   NENMKVEESTTSTVGTPTIQNNNMDGSMSRKASTLNENM  336
             NE +   E   + +     +  N +G  +R+    NE +
Sbjct  3092  NEKLHEMEEQLAELRAENEELRNTEGDKARELDVQNEKL  3130


 Score = 44.7 bits (104),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 58/279 (21%), Positives = 102/279 (37%), Gaps = 5/279 (2%)

Query  63    EEDGQPQDIESVVETMTPTEGARNTESVVETMTVIEKTKSGVEL-GSNE----LDGSMSR  117
             E + Q  ++ +  E +  T+G +  E  V+   + E  +   EL   NE     DG  +R
Sbjct  2887  EMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKAR  2946

Query  118   KGSTPNENAKVEESTTLTVGTPTIQNNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQ  177
             +    NE     E     +     +  N DG  +R+    NE     E   + +     +
Sbjct  2947  ELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEE  3006

Query  178   NNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQNNNMDGSMSRKGSTPNENAKVEEST  237
               N DG  +R+    NE     E   + +     +  N DG  +R+    NE     E  
Sbjct  3007  LRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQ  3066

Query  238   TSTVGTPTIQNNNMDGSMSRKGSTPNENMKVEESTTVIVGTPTIQNINMDGSMSRKGSTP  297
              + +     +  N DG  +R+    NE +   E     +     +  N +G  +R+    
Sbjct  3067  LAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTEGDKARELDVQ  3126

Query  298   NENMKVEESTTSTVGTPTIQNNNMDGSMSRKASTLNENM  336
             NE +   E   + +     +  N DG  +R+    NE +
Sbjct  3127  NEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKL  3165


 Score = 44.7 bits (104),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 58/279 (21%), Positives = 102/279 (37%), Gaps = 5/279 (2%)

Query  63    EEDGQPQDIESVVETMTPTEGARNTESVVETMTVIEKTKSGVEL-GSNE----LDGSMSR  117
             E + Q  ++ +  E +  T+G +  E  V+   + E  +   EL   NE     DG  +R
Sbjct  2922  EMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKAR  2981

Query  118   KGSTPNENAKVEESTTLTVGTPTIQNNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQ  177
             +    NE     E     +     +  N DG  +R+    NE     E   + +     +
Sbjct  2982  ELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEE  3041

Query  178   NNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQNNNMDGSMSRKGSTPNENAKVEEST  237
               N DG  +R+    NE     E   + +     +  N DG  +R+    NE     E  
Sbjct  3042  LRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQ  3101

Query  238   TSTVGTPTIQNNNMDGSMSRKGSTPNENMKVEESTTVIVGTPTIQNINMDGSMSRKGSTP  297
              + +     +  N +G  +R+    NE +   E     +     +  N DG  +R+    
Sbjct  3102  LAELRAENEELRNTEGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQ  3161

Query  298   NENMKVEESTTSTVGTPTIQNNNMDGSMSRKASTLNENM  336
             NE +   E   + +     +  N DG  +R+    NE +
Sbjct  3162  NEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKL  3200


 Score = 44.7 bits (104),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 58/279 (21%), Positives = 102/279 (37%), Gaps = 5/279 (2%)

Query  63    EEDGQPQDIESVVETMTPTEGARNTESVVETMTVIEKTKSGVEL-GSNE----LDGSMSR  117
             E + Q  ++ +  E +  T+G +  E  V+   + E  +   EL   NE     DG  +R
Sbjct  3272  EMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKAR  3331

Query  118   KGSTPNENAKVEESTTLTVGTPTIQNNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQ  177
             +    NE     E     +     +  N DG  +R+    NE     E   + +     +
Sbjct  3332  ELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEE  3391

Query  178   NNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQNNNMDGSMSRKGSTPNENAKVEEST  237
               N DG  +R+    NE     E   + +     +  N DG  +R+    NE     E  
Sbjct  3392  LRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQ  3451

Query  238   TSTVGTPTIQNNNMDGSMSRKGSTPNENMKVEESTTVIVGTPTIQNINMDGSMSRKGSTP  297
              + +     +  N DG  +R+    NE +   E     +     +  N DG  +R+    
Sbjct  3452  LAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQ  3511

Query  298   NENMKVEESTTSTVGTPTIQNNNMDGSMSRKASTLNENM  336
             NE +   E   + +     +  N +G  +R+    NE +
Sbjct  3512  NEKLHEMEEQLAELRAENEELRNTEGDKARELDVQNEKL  3550


 Score = 44.7 bits (104),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 58/279 (21%), Positives = 103/279 (37%), Gaps = 5/279 (2%)

Query  63    EEDGQPQDIESVVETMTPTEGARNTESVVETMTVIEKTKSGVEL-GSNE----LDGSMSR  117
             E + Q  ++ +  E +  TEG +  E  V+   + E  +   EL   NE     DG  +R
Sbjct  1274  EMEEQLAELRAENEELRNTEGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKAR  1333

Query  118   KGSTPNENAKVEESTTLTVGTPTIQNNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQ  177
             +    NE     E     +     +  N +G  +R+    NE     E   + + T   +
Sbjct  1334  ELDVQNEKLHEMEEQLAELRAENEELRNTEGDKARELDVQNEKLHEMEEQLAELRTENEE  1393

Query  178   NNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQNNNMDGSMSRKGSTPNENAKVEEST  237
               N +G  +R+    NE     E   + +     +  N +G  +R+    NE     E  
Sbjct  1394  LRNTEGDKARELDVQNEKLHEMEEQLAELRAENEELRNTEGDKARELDVQNEKLHEMEEQ  1453

Query  238   TSTVGTPTIQNNNMDGSMSRKGSTPNENMKVEESTTVIVGTPTIQNINMDGSMSRKGSTP  297
              + +     +  N DG  +R+    NE +   E     +     +  N DG  +R+    
Sbjct  1454  LAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQ  1513

Query  298   NENMKVEESTTSTVGTPTIQNNNMDGSMSRKASTLNENM  336
             NE +   E   + +     +  N DG  +R+    NE +
Sbjct  1514  NEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKL  1552


 Score = 43.5 bits (101),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 57/279 (20%), Positives = 102/279 (37%), Gaps = 5/279 (2%)

Query  63    EEDGQPQDIESVVETMTPTEGARNTESVVETMTVIEKTKSGVEL-GSNE----LDGSMSR  117
             E + Q  ++ +  E +  T+G +  E  V+   + E  +   EL   NE     DG  +R
Sbjct  1589  EMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKAR  1648

Query  118   KGSTPNENAKVEESTTLTVGTPTIQNNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQ  177
             +    NE     E     +     +  N DG  +R+    NE     E   + +     +
Sbjct  1649  ELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEE  1708

Query  178   NNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQNNNMDGSMSRKGSTPNENAKVEEST  237
               N DG  +R+    NE     E   + +     +  N DG  +R+    NE     E  
Sbjct  1709  LRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQ  1768

Query  238   TSTVGTPTIQNNNMDGSMSRKGSTPNENMKVEESTTVIVGTPTIQNINMDGSMSRKGSTP  297
              + +     +  N +G  +R+    NE +   E     +     +  N DG  +R+    
Sbjct  1769  LAELRAENEELRNTEGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQ  1828

Query  298   NENMKVEESTTSTVGTPTIQNNNMDGSMSRKASTLNENM  336
             NE +   E   + +     +  N +G  +R+    NE +
Sbjct  1829  NEKLHEMEEQLAELRAENEELRNTEGDKARELDVQNEKL  1867


 Score = 43.5 bits (101),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 57/279 (20%), Positives = 102/279 (37%), Gaps = 5/279 (2%)

Query  63    EEDGQPQDIESVVETMTPTEGARNTESVVETMTVIEKTKSGVEL-GSNE----LDGSMSR  117
             E + Q  ++ +  E +  T+G +  E  V+   + E  +   EL   NE     DG  +R
Sbjct  1624  EMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKAR  1683

Query  118   KGSTPNENAKVEESTTLTVGTPTIQNNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQ  177
             +    NE     E     +     +  N DG  +R+    NE     E   + +     +
Sbjct  1684  ELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEE  1743

Query  178   NNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQNNNMDGSMSRKGSTPNENAKVEEST  237
               N DG  +R+    NE     E   + +     +  N +G  +R+    NE     E  
Sbjct  1744  LRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTEGDKARELDVQNEKLHEMEEQ  1803

Query  238   TSTVGTPTIQNNNMDGSMSRKGSTPNENMKVEESTTVIVGTPTIQNINMDGSMSRKGSTP  297
              + +     +  N DG  +R+    NE +   E     +     +  N +G  +R+    
Sbjct  1804  LAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTEGDKARELDVQ  1863

Query  298   NENMKVEESTTSTVGTPTIQNNNMDGSMSRKASTLNENM  336
             NE +   E   + +     +  N DG  +R+    NE +
Sbjct  1864  NEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKL  1902


 Score = 43.5 bits (101),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 57/279 (20%), Positives = 102/279 (37%), Gaps = 5/279 (2%)

Query  63    EEDGQPQDIESVVETMTPTEGARNTESVVETMTVIEKTKSGVEL-GSNE----LDGSMSR  117
             E + Q  ++ +  E +  T+G +  E  V+   + E  +   EL   NE     DG  +R
Sbjct  1659  EMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKAR  1718

Query  118   KGSTPNENAKVEESTTLTVGTPTIQNNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQ  177
             +    NE     E     +     +  N DG  +R+    NE     E   + +     +
Sbjct  1719  ELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEE  1778

Query  178   NNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQNNNMDGSMSRKGSTPNENAKVEEST  237
               N +G  +R+    NE     E   + +     +  N DG  +R+    NE     E  
Sbjct  1779  LRNTEGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQ  1838

Query  238   TSTVGTPTIQNNNMDGSMSRKGSTPNENMKVEESTTVIVGTPTIQNINMDGSMSRKGSTP  297
              + +     +  N +G  +R+    NE +   E     +     +  N DG  +R+    
Sbjct  1839  LAELRAENEELRNTEGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQ  1898

Query  298   NENMKVEESTTSTVGTPTIQNNNMDGSMSRKASTLNENM  336
             NE +   E   + +     +  N DG  +R+    NE +
Sbjct  1899  NEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKL  1937


 Score = 43.5 bits (101),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 57/279 (20%), Positives = 102/279 (37%), Gaps = 5/279 (2%)

Query  63    EEDGQPQDIESVVETMTPTEGARNTESVVETMTVIEKTKSGVEL-GSNE----LDGSMSR  117
             E + Q  ++ +  E +  T+G +  E  V+   + E  +   EL   NE     DG  +R
Sbjct  2957  EMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKAR  3016

Query  118   KGSTPNENAKVEESTTLTVGTPTIQNNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQ  177
             +    NE     E     +     +  N DG  +R+    NE     E   + +     +
Sbjct  3017  ELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEE  3076

Query  178   NNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQNNNMDGSMSRKGSTPNENAKVEEST  237
               N DG  +R+    NE     E   + +     +  N +G  +R+    NE     E  
Sbjct  3077  LRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTEGDKARELDVQNEKLHEMEEQ  3136

Query  238   TSTVGTPTIQNNNMDGSMSRKGSTPNENMKVEESTTVIVGTPTIQNINMDGSMSRKGSTP  297
              + +     +  N DG  +R+    NE +   E     +     +  N DG  +R+    
Sbjct  3137  LAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQ  3196

Query  298   NENMKVEESTTSTVGTPTIQNNNMDGSMSRKASTLNENM  336
             NE +   E   + +     +  N +G  +R+    NE +
Sbjct  3197  NEKLHEMEEQLAELRAENEELRNTEGDKARELDVQNEKL  3235


 Score = 43.5 bits (101),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 57/279 (20%), Positives = 102/279 (37%), Gaps = 5/279 (2%)

Query  63    EEDGQPQDIESVVETMTPTEGARNTESVVETMTVIEKTKSGVEL-GSNE----LDGSMSR  117
             E + Q  ++ +  E +  T+G +  E  V+   + E  +   EL   NE     DG  +R
Sbjct  2992  EMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKAR  3051

Query  118   KGSTPNENAKVEESTTLTVGTPTIQNNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQ  177
             +    NE     E     +     +  N DG  +R+    NE     E   + +     +
Sbjct  3052  ELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEE  3111

Query  178   NNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQNNNMDGSMSRKGSTPNENAKVEEST  237
               N +G  +R+    NE     E   + +     +  N DG  +R+    NE     E  
Sbjct  3112  LRNTEGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQ  3171

Query  238   TSTVGTPTIQNNNMDGSMSRKGSTPNENMKVEESTTVIVGTPTIQNINMDGSMSRKGSTP  297
              + +     +  N DG  +R+    NE +   E     +     +  N +G  +R+    
Sbjct  3172  LAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTEGDKARELDVQ  3231

Query  298   NENMKVEESTTSTVGTPTIQNNNMDGSMSRKASTLNENM  336
             NE +   E   + +     +  N DG  +R+    NE +
Sbjct  3232  NEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKL  3270


 Score = 43.1 bits (100),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 57/279 (20%), Positives = 103/279 (37%), Gaps = 5/279 (2%)

Query  63    EEDGQPQDIESVVETMTPTEGARNTESVVETMTVIEKTKSGVEL-GSNE----LDGSMSR  117
             E + Q  ++ +  E +  TEG +  E  V+   + E  +   EL   NE     +G  +R
Sbjct  1134  EMEEQLAELRAENEELRNTEGDKARELDVQNEKLHEMEEQLAELRAENEELRNTEGDKAR  1193

Query  118   KGSTPNENAKVEESTTLTVGTPTIQNNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQ  177
             +    NE     E     +     +  N DG  +R+    NE     E   + +     +
Sbjct  1194  ELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEE  1253

Query  178   NNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQNNNMDGSMSRKGSTPNENAKVEEST  237
               N DG  +R+    NE     E   + +     +  N +G  +R+    NE     E  
Sbjct  1254  LRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTEGDKARELDVQNEKLHEMEEQ  1313

Query  238   TSTVGTPTIQNNNMDGSMSRKGSTPNENMKVEESTTVIVGTPTIQNINMDGSMSRKGSTP  297
              + +     +  N DG  +R+    NE +   E     +     +  N +G  +R+    
Sbjct  1314  LAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTEGDKARELDVQ  1373

Query  298   NENMKVEESTTSTVGTPTIQNNNMDGSMSRKASTLNENM  336
             NE +   E   + + T   +  N +G  +R+    NE +
Sbjct  1374  NEKLHEMEEQLAELRTENEELRNTEGDKARELDVQNEKL  1412


 Score = 43.1 bits (100),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 57/279 (20%), Positives = 103/279 (37%), Gaps = 5/279 (2%)

Query  63    EEDGQPQDIESVVETMTPTEGARNTESVVETMTVIEKTKSGVEL-GSNE----LDGSMSR  117
             E + Q  ++ +  E +  TEG +  E  V+   + E  +   EL   NE     DG  +R
Sbjct  1169  EMEEQLAELRAENEELRNTEGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKAR  1228

Query  118   KGSTPNENAKVEESTTLTVGTPTIQNNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQ  177
             +    NE     E     +     +  N DG  +R+    NE     E   + +     +
Sbjct  1229  ELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEE  1288

Query  178   NNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQNNNMDGSMSRKGSTPNENAKVEEST  237
               N +G  +R+    NE     E   + +     +  N DG  +R+    NE     E  
Sbjct  1289  LRNTEGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQ  1348

Query  238   TSTVGTPTIQNNNMDGSMSRKGSTPNENMKVEESTTVIVGTPTIQNINMDGSMSRKGSTP  297
              + +     +  N +G  +R+    NE +   E     + T   +  N +G  +R+    
Sbjct  1349  LAELRAENEELRNTEGDKARELDVQNEKLHEMEEQLAELRTENEELRNTEGDKARELDVQ  1408

Query  298   NENMKVEESTTSTVGTPTIQNNNMDGSMSRKASTLNENM  336
             NE +   E   + +     +  N +G  +R+    NE +
Sbjct  1409  NEKLHEMEEQLAELRAENEELRNTEGDKARELDVQNEKL  1447


 Score = 43.1 bits (100),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 55/279 (20%), Positives = 101/279 (36%), Gaps = 5/279 (2%)

Query  63    EEDGQPQDIESVVETMTPTEGARNTESVVETMTVIEKTKSGVELGSNE-----LDGSMSR  117
             E + Q  ++ +  E +  TEG +  E  V+   + E  +   EL +        +G  +R
Sbjct  1344  EMEEQLAELRAENEELRNTEGDKARELDVQNEKLHEMEEQLAELRTENEELRNTEGDKAR  1403

Query  118   KGSTPNENAKVEESTTLTVGTPTIQNNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQ  177
             +    NE     E     +     +  N +G  +R+    NE     E   + +     +
Sbjct  1404  ELDVQNEKLHEMEEQLAELRAENEELRNTEGDKARELDVQNEKLHEMEEQLAELRAENEE  1463

Query  178   NNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQNNNMDGSMSRKGSTPNENAKVEEST  237
               N DG  +R+    NE     E   + +     +  N DG  +R+    NE     E  
Sbjct  1464  LRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQ  1523

Query  238   TSTVGTPTIQNNNMDGSMSRKGSTPNENMKVEESTTVIVGTPTIQNINMDGSMSRKGSTP  297
              + +     +  N DG  +R+    NE +   E     +     +  N +G  +R+    
Sbjct  1524  LAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTEGDKARELDVQ  1583

Query  298   NENMKVEESTTSTVGTPTIQNNNMDGSMSRKASTLNENM  336
             NE +   E   + +     +  N DG  +R+    NE +
Sbjct  1584  NEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKL  1622


 Score = 42.4 bits (98),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 57/279 (20%), Positives = 101/279 (36%), Gaps = 5/279 (2%)

Query  63    EEDGQPQDIESVVETMTPTEGARNTESVVETMTVIEKTKSGVEL-GSNE----LDGSMSR  117
             E + Q  ++ +  E +  T+G +  E  V+   + E  +   EL   NE     DG  +R
Sbjct  1694  EMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKAR  1753

Query  118   KGSTPNENAKVEESTTLTVGTPTIQNNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQ  177
             +    NE     E     +     +  N +G  +R+    NE     E   + +     +
Sbjct  1754  ELDVQNEKLHEMEEQLAELRAENEELRNTEGDKARELDVQNEKLHEMEEQLAELRAENEE  1813

Query  178   NNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQNNNMDGSMSRKGSTPNENAKVEEST  237
               N DG  +R+    NE     E   + +     +  N +G  +R+    NE     E  
Sbjct  1814  LRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTEGDKARELDVQNEKLHEMEEQ  1873

Query  238   TSTVGTPTIQNNNMDGSMSRKGSTPNENMKVEESTTVIVGTPTIQNINMDGSMSRKGSTP  297
              + +     +  N DG  +R+    NE +   E     +     +  N DG  +R+    
Sbjct  1874  LAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQ  1933

Query  298   NENMKVEESTTSTVGTPTIQNNNMDGSMSRKASTLNENM  336
             NE +   E     +     +  N DG  +R+    NE +
Sbjct  1934  NEKLHEMERHLQQLKEENEELRNTDGDKARELDVQNEKL  1972


 Score = 42.4 bits (98),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 57/279 (20%), Positives = 102/279 (37%), Gaps = 5/279 (2%)

Query  63    EEDGQPQDIESVVETMTPTEGARNTESVVETMTVIEKTKSGVEL-GSNE----LDGSMSR  117
             E + Q  ++ +  E +  T+G +  E  V+   + E  +   EL   NE     +G  +R
Sbjct  1729  EMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTEGDKAR  1788

Query  118   KGSTPNENAKVEESTTLTVGTPTIQNNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQ  177
             +    NE     E     +     +  N DG  +R+    NE     E   + +     +
Sbjct  1789  ELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEE  1848

Query  178   NNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQNNNMDGSMSRKGSTPNENAKVEEST  237
               N +G  +R+    NE     E   + +     +  N DG  +R+    NE     E  
Sbjct  1849  LRNTEGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQ  1908

Query  238   TSTVGTPTIQNNNMDGSMSRKGSTPNENMKVEESTTVIVGTPTIQNINMDGSMSRKGSTP  297
              + +     +  N DG  +R+    NE +   E     +     +  N DG  +R+    
Sbjct  1909  LAELRAENEELRNTDGDKARELDVQNEKLHEMERHLQQLKEENEELRNTDGDKARELDVQ  1968

Query  298   NENMKVEESTTSTVGTPTIQNNNMDGSMSRKASTLNENM  336
             NE +   E   + +     +  N DG  +R+    NE +
Sbjct  1969  NEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKL  2007


 Score = 42.0 bits (97),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 56/279 (20%), Positives = 103/279 (37%), Gaps = 5/279 (2%)

Query  63    EEDGQPQDIESVVETMTPTEGARNTESVVETMTVIEKTKSGVEL-GSNE----LDGSMSR  117
             E + Q  ++ +  E +  T+G +  E  V+   + E  +   EL   NE     +G  +R
Sbjct  1309  EMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTEGDKAR  1368

Query  118   KGSTPNENAKVEESTTLTVGTPTIQNNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQ  177
             +    NE     E     + T   +  N +G  +R+    NE     E   + +     +
Sbjct  1369  ELDVQNEKLHEMEEQLAELRTENEELRNTEGDKARELDVQNEKLHEMEEQLAELRAENEE  1428

Query  178   NNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQNNNMDGSMSRKGSTPNENAKVEEST  237
               N +G  +R+    NE     E   + +     +  N DG  +R+    NE     E  
Sbjct  1429  LRNTEGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQ  1488

Query  238   TSTVGTPTIQNNNMDGSMSRKGSTPNENMKVEESTTVIVGTPTIQNINMDGSMSRKGSTP  297
              + +     +  N DG  +R+    NE +   E     +     +  N DG  +R+    
Sbjct  1489  LAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQ  1548

Query  298   NENMKVEESTTSTVGTPTIQNNNMDGSMSRKASTLNENM  336
             NE +   E   + +     +  N +G  +R+    NE +
Sbjct  1549  NEKLHEMEEQLAELRAENEELRNTEGDKARELDVQNEKL  1587


 Score = 41.6 bits (96),  Expect = 0.001, Method: Composition-based stats.
 Identities = 56/279 (20%), Positives = 102/279 (37%), Gaps = 5/279 (2%)

Query  63    EEDGQPQDIESVVETMTPTEGARNTESVVETMTVIEKTKSGVEL-GSNE----LDGSMSR  117
             E + Q  ++ +  E +  TEG +  E  V+   + E  +   EL   NE     +G  +R
Sbjct  1064  EMEEQLAELRAENEELRNTEGDKARELDVQNEKLHEMEEQLAELRAENEELRNTEGDKAR  1123

Query  118   KGSTPNENAKVEESTTLTVGTPTIQNNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQ  177
             +    NE     E     +     +  N +G  +R+    NE     E   + +     +
Sbjct  1124  ELDVQNEKLHEMEEQLAELRAENEELRNTEGDKARELDVQNEKLHEMEEQLAELRAENEE  1183

Query  178   NNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQNNNMDGSMSRKGSTPNENAKVEEST  237
               N +G  +R+    NE     E   + +     +  N DG  +R+    NE     E  
Sbjct  1184  LRNTEGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQ  1243

Query  238   TSTVGTPTIQNNNMDGSMSRKGSTPNENMKVEESTTVIVGTPTIQNINMDGSMSRKGSTP  297
              + +     +  N DG  +R+    NE +   E     +     +  N +G  +R+    
Sbjct  1244  LAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTEGDKARELDVQ  1303

Query  298   NENMKVEESTTSTVGTPTIQNNNMDGSMSRKASTLNENM  336
             NE +   E   + +     +  N DG  +R+    NE +
Sbjct  1304  NEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKL  1342


 Score = 39.7 bits (91),  Expect = 0.004, Method: Composition-based stats.
 Identities = 58/277 (21%), Positives = 99/277 (36%), Gaps = 5/277 (2%)

Query  63    EEDGQPQDIESVVETMTPTEGARNTESVVETMTVIEKTKSGVEL-GSNE----LDGSMSR  117
             E + Q  ++ +  E +  TEG +  E  V+   + E  +   EL   NE     DG  +R
Sbjct  1764  EMEEQLAELRAENEELRNTEGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKAR  1823

Query  118   KGSTPNENAKVEESTTLTVGTPTIQNNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQ  177
             +    NE     E     +     +  N +G  +R+    NE     E   + +     +
Sbjct  1824  ELDVQNEKLHEMEEQLAELRAENEELRNTEGDKARELDVQNEKLHEMEEQLAELRAENEE  1883

Query  178   NNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQNNNMDGSMSRKGSTPNENAKVEEST  237
               N DG  +R+    NE     E   + +     +  N DG  +R+    NE     E  
Sbjct  1884  LRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMERH  1943

Query  238   TSTVGTPTIQNNNMDGSMSRKGSTPNENMKVEESTTVIVGTPTIQNINMDGSMSRKGSTP  297
                +     +  N DG  +R+    NE +   E     +     +  N DG  +R+    
Sbjct  1944  LQQLKEENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQ  2003

Query  298   NENMKVEESTTSTVGTPTIQNNNMDGSMSRKASTLNE  334
             NE +   E     +     Q    D   +++  +LNE
Sbjct  2004  NEKLHEMERHLQQLKEENEQLRLTDFDNAKEIESLNE  2040


 Score = 38.9 bits (89),  Expect = 0.007, Method: Composition-based stats.
 Identities = 54/279 (19%), Positives = 102/279 (37%), Gaps = 5/279 (2%)

Query  63    EEDGQPQDIESVVETMTPTEGARNTESVVETMTVIEKTKSGVEL-GSNE----LDGSMSR  117
             E + Q  ++ +  E +  T+G +  E  V+   + E  +   EL   NE     DG  +R
Sbjct  959   EMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKAR  1018

Query  118   KGSTPNENAKVEESTTLTVGTPTIQNNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQ  177
             +    NE     E     +     +  N +G  +R+    NE     E   + +     +
Sbjct  1019  ELDVQNEKLHEMEEQLAELRAENEELRNTEGDKARELDVQNEKLHEMEEQLAELRAENEE  1078

Query  178   NNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQNNNMDGSMSRKGSTPNENAKVEEST  237
               N +G  +R+    NE     E   + +     +  N +G  +R+    NE     E  
Sbjct  1079  LRNTEGDKARELDVQNEKLHEMEEQLAELRAENEELRNTEGDKARELDVQNEKLHEMEEQ  1138

Query  238   TSTVGTPTIQNNNMDGSMSRKGSTPNENMKVEESTTVIVGTPTIQNINMDGSMSRKGSTP  297
              + +     +  N +G  +R+    NE +   E     +     +  N +G  +R+    
Sbjct  1139  LAELRAENEELRNTEGDKARELDVQNEKLHEMEEQLAELRAENEELRNTEGDKARELDVQ  1198

Query  298   NENMKVEESTTSTVGTPTIQNNNMDGSMSRKASTLNENM  336
             NE +   E   + +     +  N DG  +R+    NE +
Sbjct  1199  NEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKL  1237


 Score = 38.9 bits (89),  Expect = 0.007, Method: Composition-based stats.
 Identities = 54/279 (19%), Positives = 102/279 (37%), Gaps = 5/279 (2%)

Query  63    EEDGQPQDIESVVETMTPTEGARNTESVVETMTVIEKTKSGVEL-GSNE----LDGSMSR  117
             E + Q  ++ +  E +  T+G +  E  V+   + E  +   EL   NE     +G  +R
Sbjct  994   EMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTEGDKAR  1053

Query  118   KGSTPNENAKVEESTTLTVGTPTIQNNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQ  177
             +    NE     E     +     +  N +G  +R+    NE     E   + +     +
Sbjct  1054  ELDVQNEKLHEMEEQLAELRAENEELRNTEGDKARELDVQNEKLHEMEEQLAELRAENEE  1113

Query  178   NNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQNNNMDGSMSRKGSTPNENAKVEEST  237
               N +G  +R+    NE     E   + +     +  N +G  +R+    NE     E  
Sbjct  1114  LRNTEGDKARELDVQNEKLHEMEEQLAELRAENEELRNTEGDKARELDVQNEKLHEMEEQ  1173

Query  238   TSTVGTPTIQNNNMDGSMSRKGSTPNENMKVEESTTVIVGTPTIQNINMDGSMSRKGSTP  297
              + +     +  N +G  +R+    NE +   E     +     +  N DG  +R+    
Sbjct  1174  LAELRAENEELRNTEGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQ  1233

Query  298   NENMKVEESTTSTVGTPTIQNNNMDGSMSRKASTLNENM  336
             NE +   E   + +     +  N DG  +R+    NE +
Sbjct  1234  NEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKL  1272


 Score = 38.1 bits (87),  Expect = 0.013, Method: Composition-based stats.
 Identities = 53/256 (21%), Positives = 93/256 (36%), Gaps = 5/256 (2%)

Query  63    EEDGQPQDIESVVETMTPTEGARNTESVVETMTVIEKTKSGVEL-GSNE----LDGSMSR  117
             E + Q  ++ +  E +  T+G +  E  V+   + E  +   EL   NE     DG  +R
Sbjct  3307  EMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKAR  3366

Query  118   KGSTPNENAKVEESTTLTVGTPTIQNNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQ  177
             +    NE     E     +     +  N DG  +R+    NE     E   + +     +
Sbjct  3367  ELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEE  3426

Query  178   NNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQNNNMDGSMSRKGSTPNENAKVEEST  237
               N DG  +R+    NE     E   + +     +  N DG  +R+    NE     E  
Sbjct  3427  LRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQ  3486

Query  238   TSTVGTPTIQNNNMDGSMSRKGSTPNENMKVEESTTVIVGTPTIQNINMDGSMSRKGSTP  297
              + +     +  N DG  +R+    NE +   E     +     +  N +G  +R+    
Sbjct  3487  LAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTEGDKARELDVQ  3546

Query  298   NENMKVEESTTSTVGT  313
             NE +   E   + + T
Sbjct  3547  NEKLHEMEEQLAELRT  3562


 Score = 33.9 bits (76),  Expect = 0.27, Method: Composition-based stats.
 Identities = 57/299 (19%), Positives = 106/299 (35%), Gaps = 20/299 (7%)

Query  63    EEDGQPQDIESVVETMTPTEGARNTESVVETMTVIEKTKSGVEL-GSNE----LDGSMSR  117
             E + Q  ++ +  E +  T+G +  E  V+   + E  +   EL   NE     DG  +R
Sbjct  1204  EMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKAR  1263

Query  118   KGSTPNENAKVEESTTLTVGTPTIQNNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQ  177
             +    NE     E     +     +  N +G  +R+    NE     E   + +     +
Sbjct  1264  ELDVQNEKLHEMEEQLAELRAENEELRNTEGDKARELDVQNEKLHEMEEQLAELRAENEE  1323

Query  178   NNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQNNNMDGSMSRKGSTPNENAKVEEST  237
               N DG  +R+    NE     E   + +     +  N +G  +R+    NE     E  
Sbjct  1324  LRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTEGDKARELDVQNEKLHEMEEQ  1383

Query  238   TSTVGTPTIQNNNMDGSMSRKGSTPNENMKVEESTTVIVGTPTIQNINMDGSMSRKGSTP  297
              + + T   +  N +G  +R+    NE +   E     +     +  N +G  +R+    
Sbjct  1384  LAELRTENEELRNTEGDKARELDVQNEKLHEMEEQLAELRAENEELRNTEGDKARELDVQ  1443

Query  298   NENMKVEESTTSTVGTPTIQNNNMDGSMSRKASTLNE---------------NMKIEES  341
             NE +   E   + +     +  N DG  +R+    NE               N ++  +
Sbjct  1444  NEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNT  1502


 Score = 33.9 bits (76),  Expect = 0.27, Method: Composition-based stats.
 Identities = 57/299 (19%), Positives = 106/299 (35%), Gaps = 20/299 (7%)

Query  63    EEDGQPQDIESVVETMTPTEGARNTESVVETMTVIEKTKSGVEL-GSNE----LDGSMSR  117
             E + Q  ++ +  E +  T+G +  E  V+   + E  +   EL   NE     +G  +R
Sbjct  1239  EMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTEGDKAR  1298

Query  118   KGSTPNENAKVEESTTLTVGTPTIQNNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQ  177
             +    NE     E     +     +  N DG  +R+    NE     E   + +     +
Sbjct  1299  ELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEE  1358

Query  178   NNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQNNNMDGSMSRKGSTPNENAKVEEST  237
               N +G  +R+    NE     E   + + T   +  N +G  +R+    NE     E  
Sbjct  1359  LRNTEGDKARELDVQNEKLHEMEEQLAELRTENEELRNTEGDKARELDVQNEKLHEMEEQ  1418

Query  238   TSTVGTPTIQNNNMDGSMSRKGSTPNENMKVEESTTVIVGTPTIQNINMDGSMSRKGSTP  297
              + +     +  N +G  +R+    NE +   E     +     +  N DG  +R+    
Sbjct  1419  LAELRAENEELRNTEGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQ  1478

Query  298   NENMKVEESTTSTVGTPTIQNNNMDGSMSRKASTLNE---------------NMKIEES  341
             NE +   E   + +     +  N DG  +R+    NE               N ++  +
Sbjct  1479  NEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNT  1537


 Score = 33.5 bits (75),  Expect = 0.37, Method: Composition-based stats.
 Identities = 57/299 (19%), Positives = 105/299 (35%), Gaps = 20/299 (7%)

Query  63    EEDGQPQDIESVVETMTPTEGARNTESVVETMTVIEKTKSGVEL-GSNE----LDGSMSR  117
             E + Q  ++ +  E +  TEG +  E  V+   + E  +   EL   NE     +G  +R
Sbjct  1099  EMEEQLAELRAENEELRNTEGDKARELDVQNEKLHEMEEQLAELRAENEELRNTEGDKAR  1158

Query  118   KGSTPNENAKVEESTTLTVGTPTIQNNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQ  177
             +    NE     E     +     +  N +G  +R+    NE     E   + +     +
Sbjct  1159  ELDVQNEKLHEMEEQLAELRAENEELRNTEGDKARELDVQNEKLHEMEEQLAELRAENEE  1218

Query  178   NNNMDGSMSRKGSTPNENAKVEESTTSTVGTPTIQNNNMDGSMSRKGSTPNENAKVEEST  237
               N DG  +R+    NE     E   + +     +  N DG  +R+    NE     E  
Sbjct  1219  LRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQ  1278

Query  238   TSTVGTPTIQNNNMDGSMSRKGSTPNENMKVEESTTVIVGTPTIQNINMDGSMSRKGSTP  297
              + +     +  N +G  +R+    NE +   E     +     +  N DG  +R+    
Sbjct  1279  LAELRAENEELRNTEGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQ  1338

Query  298   NENMKVEESTTSTVGTPTIQNNNMDGSMSRKASTLNE---------------NMKIEES  341
             NE +   E   + +     +  N +G  +R+    NE               N ++  +
Sbjct  1339  NEKLHEMEEQLAELRAENEELRNTEGDKARELDVQNEKLHEMEEQLAELRTENEELRNT  1397



Lambda      K        H
   0.298    0.115    0.302 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3687020106


Query= XP_037024124.1 SID1 transmembrane family member 1-like [Bradysia
coprophila]

Length=227
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9GYF0_CAEEL  unnamed protein product                                 87.8    8e-20
H2L0H7_CAEEL  unnamed protein product                                 64.3    7e-12
H2L0H8_CAEEL  unnamed protein product                                 62.8    2e-11


>Q9GYF0_CAEEL unnamed protein product
Length=756

 Score = 87.8 bits (216),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 50/152 (33%), Positives = 83/152 (55%), Gaps = 14/152 (9%)

Query  24   IGIFYCIPTIQLLYTYHKISEFTGETDLCYRNYLCSHRLMGWDDFNHIYSNIVYVILAFA  83
            IGIFY I  +QL+ +       +G+ D C  N+ C+  L  +  FN++ SN  YV   F 
Sbjct  381  IGIFYNITVLQLIISKAGSLRQSGDLDECTFNFQCARPLWYFVAFNNVVSNGGYVY--FG  438

Query  84   FCIFVIDYQQKQGLGN------------GVVHQFGIFYALGVSIGLEGIFSALYHVCPTA  131
              I V++Y +++                G+    G+  A+G+++ +EGI SA YHVCP  
Sbjct  439  TLIIVMNYCRERSFRRLFAVQPTLAERYGLPQHSGLMTAIGLAVIMEGISSATYHVCPNN  498

Query  132  LHFQYDTSFMLILSILTTIKIYQFRHPDPLCS  163
            +++Q+DT+ M ++ +L  +KI+  RHPD + S
Sbjct  499  INYQFDTALMYVIGMLGKLKIWSLRHPDMVVS  530


 Score = 59.3 bits (142),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 35/61 (57%), Gaps = 0/61 (0%)

Query  167  DTNLSPAESRAKNAPCIVKGFYDTHDLWHFLSAGAIFFFYMALLTLDDGILHKRREEIVG  226
            D +  PA SR  N PCI   FYD HDLWH  SA AIFF + A+  +DD ++   R  I  
Sbjct  696  DWSKMPAISRELNKPCIFLNFYDNHDLWHLSSAFAIFFSFTAINVIDDDLMFVMRNTIRV  755

Query  227  F  227
            F
Sbjct  756  F  756


>H2L0H7_CAEEL unnamed protein product
Length=523

 Score = 64.3 bits (155),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 67/128 (52%), Gaps = 14/128 (11%)

Query  24   IGIFYCIPTIQLLYTYHKISEFTGETDLCYRNYLCSHRLMGWDDFNHIYSNIVYVILAFA  83
            IGIFY I  +QL+ +       +G+ D C  N+ C+  L  +  FN++ SN  YV   F 
Sbjct  381  IGIFYNITVLQLIISKAGSLRQSGDLDECTFNFQCARPLWYFVAFNNVVSNGGYVY--FG  438

Query  84   FCIFVIDYQQKQGLGN------------GVVHQFGIFYALGVSIGLEGIFSALYHVCPTA  131
              I V++Y +++                G+    G+  A+G+++ +EGI SA YHVCP  
Sbjct  439  TLIIVMNYCRERSFRRLFAVQPTLAERYGLPQHSGLMTAIGLAVIMEGISSATYHVCPNN  498

Query  132  LHFQYDTS  139
            +++Q++ +
Sbjct  499  INYQFENA  506


>H2L0H8_CAEEL unnamed protein product
Length=504

 Score = 62.8 bits (151),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 65/125 (52%), Gaps = 14/125 (11%)

Query  24   IGIFYCIPTIQLLYTYHKISEFTGETDLCYRNYLCSHRLMGWDDFNHIYSNIVYVILAFA  83
            IGIFY I  +QL+ +       +G+ D C  N+ C+  L  +  FN++ SN  YV   F 
Sbjct  381  IGIFYNITVLQLIISKAGSLRQSGDLDECTFNFQCARPLWYFVAFNNVVSNGGYVY--FG  438

Query  84   FCIFVIDYQQKQGLGN------------GVVHQFGIFYALGVSIGLEGIFSALYHVCPTA  131
              I V++Y +++                G+    G+  A+G+++ +EGI SA YHVCP  
Sbjct  439  TLIIVMNYCRERSFRRLFAVQPTLAERYGLPQHSGLMTAIGLAVIMEGISSATYHVCPNN  498

Query  132  LHFQY  136
            +++Q+
Sbjct  499  INYQF  503



Lambda      K        H
   0.298    0.115    0.302 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3687020106


Query= XP_037024125.1 uncharacterized protein LOC119066013 [Bradysia
coprophila]

Length=550
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

NRT_DROME  unnamed protein product                                    30.4    4.7  


>NRT_DROME unnamed protein product
Length=846

 Score = 30.4 bits (67),  Expect = 4.7, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 31/63 (49%), Gaps = 4/63 (6%)

Query  177  KTQQTDSPPKNQRLCEIEARKKSAEK-KAQQAKLEAEAKANQIECINDQDEVEDEGDEPR  235
            K +Q   P   +RL    ARK SAEK K Q    +A+AK+   E   +    ED  D P 
Sbjct  164  KDEQKSRPGLGERLRSFFARKPSAEKEKKQLVNGDADAKS---EATAEATPAEDASDAPP  220

Query  236  RRG  238
            +RG
Sbjct  221  KRG  223



Lambda      K        H
   0.298    0.115    0.302 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3687020106


Query= XP_037024126.1 uncharacterized protein LOC119066014 [Bradysia
coprophila]

Length=2003
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

EGG1_CAEBR  unnamed protein product                                   35.8    0.40 
ILF2_DROME  unnamed protein product                                   34.7    0.83 
O96936_DROME  unnamed protein product                                 34.3    1.4  


>EGG1_CAEBR unnamed protein product
Length=636

 Score = 35.8 bits (81),  Expect = 0.40, Method: Composition-based stats.
 Identities = 40/147 (27%), Positives = 58/147 (39%), Gaps = 22/147 (15%)

Query  592  ATKTKGFVNTVAK-YVEPKSSAGNCRICSGSCQK-----PWQCAVLLNKNIEQRWNLIKE  645
            ATK K    +  K Y E ++ +G    C GSC K      + C    N   +     IK 
Sbjct  424  ATKVKRVTCSDGKDYTESEACSGVEESCGGSCSKCHPKLTFTCPAAGNAQKK----CIKR  479

Query  646  KKLC---FSCLMTGHNANNCTRLYQCGIDG-----CQR---NHNKVLHNKMKVEGKVEQQ  694
             K+C   F C   G +  NCT + +CGID      C R   + ++        E K ++Q
Sbjct  480  SKVCDGIFDC-DDGADEKNCTPVKECGIDNASQFTCDRKCVDASRRCDGVWDCEDKSDEQ  538

Query  695  NNITLATVQSSHRTNLRILPVIVCFNG  721
            N    A+       + + LP     NG
Sbjct  539  NCSQCASGSIKCSADKKCLPAYTRCNG  565


>ILF2_DROME unnamed protein product
Length=396

 Score = 34.7 bits (78),  Expect = 0.83, Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query  1133  EAVNAIINKHYMDDYLDSKFSVEEAVKVIKEVIFIHEQGSFEICNWVSSSKEVMAAIPEN  1192
             EAV+A+  K   D  L +    E   K  +  + IHE+G F+I N  +  + ++A +P+N
Sbjct  134   EAVDALAKKVEAD--LKASMKTEVLTKGDQHTVQIHERG-FDIANVHAKVRILIATLPQN  190

Query  1193  LRRKENSV  1200
             LR+ E  +
Sbjct  191   LRKLEPEI  198


>O96936_DROME unnamed protein product
Length=4151

 Score = 34.3 bits (77),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 47/121 (39%), Gaps = 20/121 (17%)

Query  342   QNRPTLGSTFTQSTP--------YNSNPRQRL---------TSSNCALPSPTSNVGQPLS  384
             Q +P+ GST + +TP          + P  RL         T+S  A P+PTSN G   S
Sbjct  4031  QRKPSTGSTASGTTPRPARLSVTTTTTPGSRLNGTSTITRKTASGSASPAPTSNGGMSRS  4090

Query  385   QQPSNSTDIMTRLIARQVIGKELPNFYGDPQDWLL---FRSQYERTTATCLYTGEENIFR  441
                   T    + I R + G   P+    P+       F S   RT+     T +   FR
Sbjct  4091  SSIPALTGFGFKPIRRNISGSSTPSGMQTPRKSSAEPTFSSTMRRTSRGTTPTEKREPFR  4150

Query  442   L  442
             L
Sbjct  4151  L  4151



Lambda      K        H
   0.298    0.115    0.302 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3687020106


Query= XP_037024127.1 catalase-like [Bradysia coprophila]

Length=510
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CATA2_CAEEL  unnamed protein product                                  335     1e-109
CATA_DROME  unnamed protein product                                   323     6e-105
CATA1_CAEEL  unnamed protein product                                  313     4e-101


>CATA2_CAEEL unnamed protein product
Length=497

 Score = 335 bits (858),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 188/497 (38%), Positives = 282/497 (57%), Gaps = 31/497 (6%)

Query  36   DSPSIHQLAIYAATHPNSTAFAENAVGIVYPTLTASQAIGSRGPILLQDFFLIEKLQAFN  95
            + PS +QL  Y  T+P       +    +Y + TA    G RGP+L+QD   ++++  F+
Sbjct  3    NDPSDNQLKTYKETYPKPQVITTSNGAPIY-SKTAVLTAGRRGPMLMQDVVYMDEMAHFD  61

Query  96   RE--PELCMQKEQAA-------------------FLQPGKRTKVVARLSGANADAGAPDT  134
            RE  PE  +  + A                    F + GK+T ++ R S    ++G+ DT
Sbjct  62   RERIPERVVHAKGAGAHGYFEVTHDITKYCKADMFNKVGKQTPLLVRFSTVAGESGSADT  121

Query  135  FLNDFKGFAVKFYTEEGIHDLLSLNVRNFFLRDAVLFDAMNRAFKRNPQTHLFDPSALMD  194
             + D +GF++KFYTEEG  DL+  N   FF+RDA+ F     A KRNPQTH+ DP+AL D
Sbjct  122  -VRDPRGFSLKFYTEEGNWDLVGNNTPIFFIRDAIHFPNFIHALKRNPQTHMRDPNALFD  180

Query  195  MISERPEMTTFLLLIMSDAIVPKSYRSVRAFALNTYKMVNSHGEAVYVKFHWVPHTKEEF  254
                RPE    ++ + SD  +P  +R +  +  +T+KMVN  G  +Y KFH+ P    + 
Sbjct  181  FWMNRPESIHQVMFLYSDRGIPDGFRFMNGYGAHTFKMVNKEGNPIYCKFHFKPAQGSKN  240

Query  255  FTLEDAVKMYVL-PNVLIQDLYDNIAKKNFASWTLSIQVMTFDQAEKHPENPFDPTKNWK  313
                DA K+    P+  I+DL++ I  +NF  W + IQVMTF+QAEK   NPFD TK W 
Sbjct  241  LDPTDAGKLASSDPDYAIRDLFNAIESRNFPEWKMFIQVMTFEQAEKWEFNPFDVTKVWP  300

Query  314  TDEYPLIPVGTLTLNENHKNYFINVEQIAFSPSNMVRGIESSPDRVLQARLFTYPDAQLY  373
              +YPLI VG + LN N KNYF  VEQ AF P+++V GIE SPD++LQ R+F+Y D   +
Sbjct  301  HGDYPLIEVGKMVLNRNVKNYFAEVEQAAFCPAHIVPGIEFSPDKMLQGRIFSYTDTHYH  360

Query  374  RLGTNFAQIPVNACPFEVK--TYRVNGPMNVGRNGEDAPDYYPNTFHGINSNDNRSFKQN  431
            RLG N+ Q+PVN CP+  +  T + +G M     G DAP+Y+PN+F G  + D+   K++
Sbjct  361  RLGPNYIQLPVN-CPYRSRAHTTQRDGAMAYESQG-DAPNYFPNSFRGYRTRDD--VKES  416

Query  432  VFYVSGDVDRVDTGNDDNFTPAKYHWEHEICADERKSIISNLITNLSPVEKRIQKKVLQR  491
             F  +GDVDR +TG+D N+   +  WE  +  +ER  ++ NL ++L    + IQ  ++ +
Sbjct  417  TFQTTGDVDRYETGDDHNYEQPRQFWEKVLKEEERDRLVGNLASDLGGCLEEIQNGMV-K  475

Query  492  NLYTVNKELGDKVKAGL  508
                V+ + G+ ++  L
Sbjct  476  EFTKVHPDFGNALRHQL  492


>CATA_DROME unnamed protein product
Length=506

 Score = 323 bits (828),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 180/466 (39%), Positives = 268/466 (58%), Gaps = 28/466 (6%)

Query  70   ASQAIGSRGPILLQDFFLIEKLQAFNRE--PELCMQKEQAA-------------------  108
            ASQ +G RGPILLQD   ++++  F+RE  PE  +  + A                    
Sbjct  38   ASQTVGPRGPILLQDVNFLDEMSHFDRERIPERVVHAKGAGAFGYFEVTHDITQYCAAKI  97

Query  109  FLQPGKRTKVVARLSGANADAGAPDTFLNDFKGFAVKFYTEEGIHDLLSLNVRNFFLRDA  168
            F +  KRT +  R S    ++G+ DT   D +GFAVKFYTE+G+ DL+  N   FF+RD 
Sbjct  98   FDKVKKRTPLAVRFSTVGGESGSADT-ARDPRGFAVKFYTEDGVWDLVGNNTPVFFIRDP  156

Query  169  VLFDAMNRAFKRNPQTHLFDPSALMDMISERPEMTTFLLLIMSDAIVPKSYRSVRAFALN  228
            +LF +     KRNPQTHL DP    D ++ RPE    + ++ SD   P  Y  +  +  +
Sbjct  157  ILFPSFIHTQKRNPQTHLKDPDMFWDFLTLRPESAHQVCILFSDRGTPDGYCHMNGYGSH  216

Query  229  TYKMVNSHGEAVYVKFHWVPHTKEEFFTLEDAVKMYVL-PNVLIQDLYDNIAKKNFASWT  287
            T+K++N+ GE +Y KFH+      +   ++ A ++    P+  I+DLY+ I    F SWT
Sbjct  217  TFKLINAKGEPIYAKFHFKTDQGIKNLDVKTADQLASTDPDYSIRDLYNRIKTCKFPSWT  276

Query  288  LSIQVMTFDQAEKHPENPFDPTKNWKTDEYPLIPVGTLTLNENHKNYFINVEQIAFSPSN  347
            + IQVMT++QA+K   NPFD TK W   EYPLIPVG + L+ N KNYF  VEQIAFSP++
Sbjct  277  MYIQVMTYEQAKKFKYNPFDVTKVWSQKEYPLIPVGKMVLDRNPKNYFAEVEQIAFSPAH  336

Query  348  MVRGIESSPDRVLQARLFTYPDAQLYRLGTNFAQIPVNACPFEVK--TYRVNGPMNVGRN  405
            +V G+E SPD++L  RLF+Y D   +RLG N+ QIPVN CP++VK   ++ +G MNV  N
Sbjct  337  LVPGVEPSPDKMLHGRLFSYSDTHRHRLGPNYLQIPVN-CPYKVKIENFQRDGAMNVTDN  395

Query  406  GEDAPDYYPNTFHGINSNDNRSFKQNVFYVSGDVDRVDTGN-DDNFTPAKYHWEHEICAD  464
             + AP+Y+PN+F+G           +   V+GDV R  +G+ +DNF      W H +   
Sbjct  396  QDGAPNYFPNSFNGPQECPRARALSSCCPVTGDVYRYSSGDTEDNFGQVTDFWVHVLDKC  455

Query  465  ERKSIISNLITNLSPVEKRIQKKVLQRNLYTVNKELGDKVKAGLHL  510
             +K ++ N+  +LS   + +Q++ + +N   V+ + G  +   L+L
Sbjct  456  AKKRLVQNIAGHLSNASQFLQERAV-KNFTQVHADFGRMLTEELNL  500


>CATA1_CAEEL unnamed protein product
Length=500

 Score = 313 bits (802),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 184/496 (37%), Positives = 273/496 (55%), Gaps = 33/496 (7%)

Query  36   DSPSIHQLAIYAATHPNSTAFAENAVGIVYPTLTASQAIGSRGPILLQDFFLIEKLQAFN  95
            + PS +QL  Y  T+P       +    +Y + TA    G RGP+L+QD   ++++  F+
Sbjct  3    NDPSDNQLKTYKETYPKPQVITTSNGAPIY-SKTAVLTAGRRGPMLMQDVVYMDEMAHFD  61

Query  96   RE--PELCMQKEQAA-------------------FLQPGKRTKVVARLSGANADAGAPDT  134
            RE  PE  +  + A                    F + GK+T ++ R S    ++G+ DT
Sbjct  62   RERIPERVVHAKGAGAHGYFEVTHDISKYCKADIFNKVGKQTPLLIRFSTVGGESGSADT  121

Query  135  FLNDFKGFAVKFYTEEGIHDLLSLNVRNFFLRDAVLFDAMNRAFKRNPQTHLFDPSALMD  194
               D +GFA+KFYTEEG  DL+  N   FF+RD + F       KRNPQTHL DP+ + D
Sbjct  122  -ARDPRGFAIKFYTEEGNWDLVGNNTPIFFIRDPIHFPNFIHTQKRNPQTHLKDPNMIFD  180

Query  195  MISERPEMTTFLLLIMSDAIVPKSYRSVRAFALNTYKMVNSHGEAVYVKFHWVPHTKEEF  254
                RPE    ++ + SD  +P  YR +  +  +T+KMVN  G+A+YVKFH+ P    + 
Sbjct  181  FWLHRPEALHQVMFLFSDRGLPDGYRHMNGYGSHTFKMVNKDGKAIYVKFHFKPTQGVKN  240

Query  255  FTLEDAVKMYVL-PNVLIQDLYDNIAKKNFASWTLSIQVMTFDQAEKHPENPFDPTKNWK  313
             T+E A ++    P+  I+DL++ I K +F  W + IQVMTF+QAEK   NPFD TK W 
Sbjct  241  LTVEKAGQLASSDPDYSIRDLFNAIEKGDFPVWKMFIQVMTFEQAEKWEFNPFDVTKVWP  300

Query  314  TDEYPLIPVGTLTLNENHKNYFINVEQIAFSPSNMVRGIESSPDRVLQARLFTYPDAQLY  373
              +YPLI VG + LN N +NYF  VEQ AF P+++V GIE SPD++LQ R+F+Y D   +
Sbjct  301  HGDYPLIEVGKMVLNRNPRNYFAEVEQSAFCPAHIVPGIEFSPDKMLQGRIFSYTDTHFH  360

Query  374  RLGTNFAQIPVNACPFEVKTYRV--NGPMNVGRNGEDAPDYYPNTFHGINSNDNR-SFKQ  430
            RLG N+ Q+PVN CP+  + +    +G M    N + AP+++PN+F   N    R   K 
Sbjct  361  RLGPNYIQLPVN-CPYRSRAHNTQRDGAMAYD-NQQHAPNFFPNSF---NYGKTRPDVKD  415

Query  431  NVFYVSGDVDRVDTGNDDNFTPAKYHWEHEICADERKSIISNLITNLSPVEKRIQKKVLQ  490
              F  +GDVDR ++G+D+N+   +  WE  +    R+ +  N    L      I K ++ 
Sbjct  416  TTFPATGDVDRYESGDDNNYDQPRQFWEKVLDTGARERMCQNFAGPLGECHDFIIKGMID  475

Query  491  RNLYTVNKELGDKVKA  506
             +   V+ + G +VKA
Sbjct  476  -HFSKVHPDFGARVKA  490



Lambda      K        H
   0.298    0.115    0.302 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3687020106


Query= XP_037024128.1 rab-like protein 3 [Bradysia coprophila]

Length=242
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

C0H516_PLAF7  unnamed protein product                                 70.5    1e-14
RABF1_DICDI  unnamed protein product                                  65.5    8e-13
Q7K6A8_PLAF7  unnamed protein product                                 65.1    9e-13


>C0H516_PLAF7 unnamed protein product
Length=206

 Score = 70.5 bits (171),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/206 (27%), Positives = 93/206 (45%), Gaps = 35/206 (17%)

Query  1    MSNIDK--VRIIVVGDSGVGKTSLVHLIANNEALTSPGWTIGCAVEVKLHEYKEGTPSQS  58
            MSN  +  +++I++GDSGVGKTSL++   N +       TIG     K     E      
Sbjct  1    MSNKKRTILKVIILGDSGVGKTSLMNQYVNKKFTNQYKATIGADFLTK-----ETIVDNE  55

Query  59   QYFIELWDIGGSISHMNTRGVFYNPVHGVILVYDLSNRKSHENLQRWIFEILNKEGKDVA  118
            Q  +++WD  G     +    FY      +LV+DL+N K++E+L+ W  E L +      
Sbjct  56   QITMQIWDTAGQERFQSLGVAFYRGADCCVLVFDLTNYKTYESLESWKDEFLIQASPK--  113

Query  119  KGGGGEMEFDPEQFLGSTQIPILVIGTKADMVDDNQKKKNSKKILSVAEQCGAEEICLNC  178
                     DPE F      P ++IG K D  + N++K  S K+L         + C + 
Sbjct  114  ---------DPENF------PFVIIGNKVD--ETNKRKVQSLKVL---------QWCKSN  147

Query  179  HDPKSLAAGLSDSVKLSRFFDKVIEK  204
            ++         +++ + + FD++  K
Sbjct  148  NNIPYFETSAKNAINVDQAFDEIARK  173


>RABF1_DICDI unnamed protein product
Length=190

 Score = 65.5 bits (158),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 47/152 (31%), Positives = 73/152 (48%), Gaps = 17/152 (11%)

Query  8    RIIVVGDSGVGKTSLVHLIANNEALTSPGWTIGCAVEVKLHEYKEGTPSQSQYFIELWDI  67
            + ++ GDSGVGKTS++  I + +  T    TIG   ++K   Y EG P + Q    +WD 
Sbjct  10   KFVLAGDSGVGKTSILFRITD-DTFTETHITIGIEFKIKT-VYIEGKPIKLQ----IWDT  63

Query  68   GGSISHMNTRGVFYNPVHGVILVYDLSNRKSHENLQRWIFEILNKEGKDVAK---GGGGE  124
             G           Y   HGVI+VYD+++++S EN+  WI +I     ++V K   G   +
Sbjct  64   AGE-KRFRVHNSHYRGCHGVIIVYDVTDQRSFENVPSWIEDIRRYANENVIKIIIGNKND  122

Query  125  M-------EFDPEQFLGSTQIPILVIGTKADM  149
            +        F  ++F  S  IP   I  K  +
Sbjct  123  LVSQKVVDPFLAQEFADSLDIPFKEISAKQSI  154


>Q7K6A8_PLAF7 unnamed protein product
Length=200

 Score = 65.1 bits (157),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 59/112 (53%), Gaps = 5/112 (4%)

Query  8    RIIVVGDSGVGKTSLVHLIANNEALTSPGWTIGCAVEVKLHEYKEGTPSQSQYFIELWDI  67
            +I+++GDSGVGK+ L+   A++    S   TIG   ++K  E ++         +++WD 
Sbjct  10   KILLIGDSGVGKSCLLLRFADDTYTDSYISTIGVDFKIKTIEIEDKIIK-----LQIWDT  64

Query  68   GGSISHMNTRGVFYNPVHGVILVYDLSNRKSHENLQRWIFEILNKEGKDVAK  119
             G          +Y    G+I+VYD+++R S  N++ WI EI     +DV K
Sbjct  65   AGQERFRTITSSYYRGAQGIIIVYDVTDRDSFNNVKNWIIEIEKYASEDVQK  116



Lambda      K        H
   0.298    0.115    0.302 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3687020106


Query= XP_037024129.1 uncharacterized protein LOC119066016 [Bradysia
coprophila]

Length=865
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q5BI50_DROME  unnamed protein product                                 32.0    2.5  
Q961E0_DROME  unnamed protein product                                 31.6    3.8  
Q8MR70_DROME  unnamed protein product                                 31.2    5.5  


>Q5BI50_DROME unnamed protein product
Length=821

 Score = 32.0 bits (71),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 66/155 (43%), Gaps = 29/155 (19%)

Query  26   DPEFVGRMVLDEVPLIDGHNDLPYNLY----RIEGNMLENFDFDSDLRQNPKWQVSSSHT  81
            DPE    MV D +   D  + +    +    +   ++ E F+F  + R N   ++ + + 
Sbjct  415  DPEKDKSMVQDLLDFKDKMDVIVRTCFEHNEKFTNSLREAFEFFINQRANKPAELIAKYV  474

Query  82   DLPRLRQGKVGGQFWVAYVGCETNHKDAVERTLEQIDVIKRLVAKYNESMELVTEADGIM  141
            D+ +LR G  G               + +E+TL++I V+ R +               + 
Sbjct  475  DM-KLRSGNKG------------TTDEELEKTLDKIMVLFRFI-----------HGKDVF  510

Query  142  EAFNQQKIASIICVEGGHSIDSRMSVL-RLFYELG  175
            EAF ++ +A  + V    S+DS  S+L +L  E G
Sbjct  511  EAFYKKDLAKRLLVGKSASVDSEKSMLSKLKQECG  545


>Q961E0_DROME unnamed protein product
Length=601

 Score = 31.6 bits (70),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 66/155 (43%), Gaps = 29/155 (19%)

Query  26   DPEFVGRMVLDEVPLIDGHNDLPYNLY----RIEGNMLENFDFDSDLRQNPKWQVSSSHT  81
            DPE    MV D +   D  + +    +    +   ++ E F+F  + R N   ++ + + 
Sbjct  195  DPEKDKSMVQDLLDFKDKMDVIVRTCFEHNEKFTNSLREAFEFFINQRANKPAELIAKYV  254

Query  82   DLPRLRQGKVGGQFWVAYVGCETNHKDAVERTLEQIDVIKRLVAKYNESMELVTEADGIM  141
            D+ +LR G  G               + +E+TL++I V+ R +               + 
Sbjct  255  DM-KLRSGNKG------------TTDEELEKTLDKIMVLFRFI-----------HGKDVF  290

Query  142  EAFNQQKIASIICVEGGHSIDSRMSVL-RLFYELG  175
            EAF ++ +A  + V    S+DS  S+L +L  E G
Sbjct  291  EAFYKKDLAKRLLVGKSASVDSEKSMLSKLKQECG  325


>Q8MR70_DROME unnamed protein product
Length=1529

 Score = 31.2 bits (69),  Expect = 5.5, Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 34/63 (54%), Gaps = 4/63 (6%)

Query  787   DYDGLSEVPDGLEDVSKYPSLFDKLAETYDYHRGWTREELSKLASGNLLRVMTAVEQYRD  846
             DY+ L ++ DG   V  +PS  DKLA+T   +   TRE + K A     +++ + E Y+ 
Sbjct  1410  DYNQLLQLLDG---VQTWPSKLDKLADTLAGYTQQTREVIKKAACMFKQKLLLS-ESYKG  1465

Query  847   EKK  849
              K+
Sbjct  1466  AKQ  1468



Lambda      K        H
   0.298    0.115    0.302 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3687020106


Query= XP_037024130.1 uncharacterized protein LOC119066017 [Bradysia
coprophila]

Length=342
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A1Z768_DROME  unnamed protein product                                 39.3    0.003
Q7JY33_DROME  unnamed protein product                                 39.3    0.003
O44114_DROME  unnamed protein product                                 39.3    0.003


>A1Z768_DROME unnamed protein product
Length=314

 Score = 39.3 bits (90),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 66/147 (45%), Gaps = 26/147 (18%)

Query  130  VLYTDGSVIKDN-----AGAGMYCSK-LNIEMQIPLGEFSSIFLVELRAILAAGHSLVDD  183
            ++YTDGS I +      AG G+Y  K   +    P+    +  + E++A + A  + +D 
Sbjct  164  IVYTDGSCIGNGRAGACAGYGVYFGKNHQLNAAKPVEGRVTNNVGEIQAAIHAIKTALDL  223

Query  184  NSIRQSIYICSDSQAALKALKSYTQSSALSLECWHLVN--------------QIAQVNNL  229
                Q + I +DSQ  + ++  +   +      W L N              ++ Q NN+
Sbjct  224  GI--QKLCISTDSQFLINSITLWV--AGWKKRDWKLKNNQPVKNVVDFKELDKLLQENNI  279

Query  230  KLVW--VPAHSGFEGNEKADTLAKAAA  254
             + W  V AH G EGNE AD LA+  +
Sbjct  280  TVKWNYVEAHKGIEGNEMADKLARQGS  306


>Q7JY33_DROME unnamed protein product
Length=333

 Score = 39.3 bits (90),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 66/147 (45%), Gaps = 26/147 (18%)

Query  130  VLYTDGSVIKDN-----AGAGMYCSK-LNIEMQIPLGEFSSIFLVELRAILAAGHSLVDD  183
            ++YTDGS I +      AG G+Y  K   +    P+    +  + E++A + A  + +D 
Sbjct  183  IVYTDGSCIGNGRAGACAGYGVYFGKNHQLNAAKPVEGRVTNNVGEIQAAIHAIKTALDL  242

Query  184  NSIRQSIYICSDSQAALKALKSYTQSSALSLECWHLVN--------------QIAQVNNL  229
                Q + I +DSQ  + ++  +   +      W L N              ++ Q NN+
Sbjct  243  GI--QKLCISTDSQFLINSITLWV--AGWKKRDWKLKNNQPVKNVVDFKELDKLLQENNI  298

Query  230  KLVW--VPAHSGFEGNEKADTLAKAAA  254
             + W  V AH G EGNE AD LA+  +
Sbjct  299  TVKWNYVEAHKGIEGNEMADKLARQGS  325


>O44114_DROME unnamed protein product
Length=333

 Score = 39.3 bits (90),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 66/147 (45%), Gaps = 26/147 (18%)

Query  130  VLYTDGSVIKDN-----AGAGMYCSK-LNIEMQIPLGEFSSIFLVELRAILAAGHSLVDD  183
            ++YTDGS I +      AG G+Y  K   +    P+    +  + E++A + A  + +D 
Sbjct  183  IVYTDGSCIGNGRTGACAGYGVYFGKNHQLNAAKPVEGRVTNNVGEIQAAIHAIKTALDL  242

Query  184  NSIRQSIYICSDSQAALKALKSYTQSSALSLECWHLVN--------------QIAQVNNL  229
                Q + I +DSQ  + ++  +   +      W L N              ++ Q NN+
Sbjct  243  GI--QKLCISTDSQFLINSITLWV--AGWKKRDWKLKNNQPVKNVVDFKELDKLLQDNNI  298

Query  230  KLVW--VPAHSGFEGNEKADTLAKAAA  254
             + W  V AH G EGNE AD LA+  +
Sbjct  299  TVKWNYVEAHKGIEGNEMADKLARQGS  325



Lambda      K        H
   0.298    0.115    0.302 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3687020106


Query= XP_037024131.1 uncharacterized FAD-linked oxidoreductase YvdP-like
[Bradysia coprophila]

Length=516
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7YWB6_LEIMA  unnamed protein product                                 40.8    0.003
Q585R0_TRYB2  unnamed protein product                                 34.7    0.23 
GST6_CAEEL  unnamed protein product                                   30.0    3.6  


>Q7YWB6_LEIMA unnamed protein product
Length=621

 Score = 40.8 bits (94),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 78/169 (46%), Gaps = 17/169 (10%)

Query  113  NGFGDSRSLI-VDLAKMNH-ISVDPKQMTSEIGAGAKLAQVSFTLWKNGKFLIPGGICPI  170
            + F  +R +I VD+ +MN  IS+D +   +    G     +   L+++G  L   G  P 
Sbjct  179  DPFERARMIISVDMRRMNRMISIDRESRLATFETGVLGPDLDAQLFRHGFML---GHDPD  235

Query  171  VGIAGLTLGG-----GYGRFTTVFGLTSDSVVEMEMVDARGQLLVINNSTNSDLFWALRG  225
              I   TLGG     G G  +  +G   D VV +++    G  ++   +T+      L G
Sbjct  236  SYIYS-TLGGWIGARGSGAMSNQYGDIEDMVVAVKVATPTG--IIETPTTSRTCGVDLNG  292

Query  226  ---GGGGNFGIVTKFKFKIYKAPRSIVYIEHYY-SFETAFTQFYSAFQK  270
               G  G+FGI+T+   K+   P + +Y  + + +FE  F+ FY+   K
Sbjct  293  LFIGSEGSFGIITEATIKLETIPETKLYEGYLFPTFEAGFSAFYTCTAK  341


>Q585R0_TRYB2 unnamed protein product
Length=613

 Score = 34.7 bits (78),  Expect = 0.23, Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 48/102 (47%), Gaps = 9/102 (9%)

Query  177  TLGG-----GYGRFTTVFGLTSDSVVEMEMVDARG--QLLVINNSTNSDLFWALRGGGGG  229
            TLGG     G G  +  +G   + ++ M +V   G  +  + +     DL  A+  G  G
Sbjct  234  TLGGWIAARGSGAMSNKYGDIENMILAMRVVTPVGVVETPLTSRPCGVDLN-AMFVGSEG  292

Query  230  NFGIVTKFKFKIYKAPRSIVYIEHYY-SFETAFTQFYSAFQK  270
             FG+VT+   KI + P    Y    + SFE AFT F++  +K
Sbjct  293  AFGLVTEAVVKIERIPEVKRYEGWLFPSFEVAFTAFHTCTRK  334


>GST6_CAEEL unnamed protein product
Length=206

 Score = 30.0 bits (66),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 30/72 (42%), Gaps = 3/72 (4%)

Query  136  KQMTSEIGAGAKLAQVSFTLWKNGKFLIPGGICPIVGIAGLTLGGGY--GRF-TTVFGLT  192
            +Q+ +  G       +SF  W   K   P G  PI+ + G  LG  Y   R+    FG+ 
Sbjct  19   RQIFAYAGQDYSEENLSFEQWPARKNNTPFGQLPILEVDGKPLGQSYAIARYLAREFGIA  78

Query  193  SDSVVEMEMVDA  204
              +  E   VDA
Sbjct  79   GQNDTEAAEVDA  90



Lambda      K        H
   0.298    0.115    0.302 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3687020106


Query= XP_037024132.1 uncharacterized FAD-linked oxidoreductase YvdP-like
[Bradysia coprophila]

Length=501
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7YWB6_LEIMA  unnamed protein product                                 37.0    0.041
Q8IBE8_PLAF7  unnamed protein product                                 32.0    1.4  
Q8ILT0_PLAF7  unnamed protein product                                 32.0    1.5  


>Q7YWB6_LEIMA unnamed protein product
Length=621

 Score = 37.0 bits (84),  Expect = 0.041, Method: Compositional matrix adjust.
 Identities = 96/429 (22%), Positives = 168/429 (39%), Gaps = 59/429 (14%)

Query  101  FGDSRSLI-VDLAKMNH-ISVDPKQMTSEIGAGAKVALVSYTLWKNGKFLIPGGICPIVG  158
            F  +R +I VD+ +MN  IS+D +   +    G     +   L+++G  L   G  P   
Sbjct  181  FERARMIISVDMRRMNRMISIDRESRLATFETGVLGPDLDAQLFRHGFML---GHDPDSY  237

Query  159  IAGLTLGG-----GYGRFTTVFGLTSDSVVEMEMVDARGQLLVINNSTNSDLFWALRG--  211
            I   TLGG     G G  +  +G   D VV +++    G  ++   +T+      L G  
Sbjct  238  IYS-TLGGWIGARGSGAMSNQYGDIEDMVVAVKVATPTG--IIETPTTSRTCGVDLNGLF  294

Query  212  -GGGGNFGIVTKFKFKIYKAPRSVVYVRNEFSFENFSQFYRAWQTLMNFGV-PRHFSL-D  268
             G  G+FGI+T+   K+   P + +Y    + F  F   + A+ T    G+ P    L D
Sbjct  295  IGSEGSFGIITEATIKLETIPETKLY--EGYLFPTFEAGFSAFYTCTAKGIHPCTMRLYD  352

Query  269  FKIFDSHILMEVFGFNFQYQNEIMESVTNFLSSFSFPNATSSSSKVMSYE------EFMV  322
               F   + M     +F +Q  +   V +FL  +   N    S  ++ +E      +F  
Sbjct  353  EDDFRMSMAMSTTKHSF-FQRLVSMGVKSFLERYRGWNLRRISLVIVGFEGTPDRVKFQR  411

Query  323  ADATA-FSSVMIQTVSQLENMTKYDAVVEWKKVKSMFVDQILNESQIYALKDLFSEYLPY  381
            ++  A F       V +    T  D   +   ++  F   + + + ++    L+S+ +P 
Sbjct  412  SETAAVFKQYGGVGVGRSAGATWQDKKYDLPYIRD-FALSLSHWADVFETSVLYSQAIPC  470

Query  382  LDLTAEPNNAAVNSILPSDSAFVHRG------TNLFD----LQFRASSVPPKQPDFQADR  431
                     AAV  +        HRG       + +     L F  +S      D +   
Sbjct  471  WRAV----KAAVRQVWKEHG---HRGWIGCHTAHQYKYGCCLYFTFASAQKDDMDMKIFL  523

Query  432  AIR------MLFEKSKSVFHHRESYQNYMDQDLTDYLVRYYGSN-LDRLVSIKSRYDPGN  484
            AI+      ML        HH   Y++        ++ RY G + LD L ++K + DP N
Sbjct  524  AIKKRATEAMLAHTGNLTHHHGIGYEH------VPWMSRYMGPDALDLLFAVKQKVDPKN  577

Query  485  MFHHPQSIP  493
            + +  + +P
Sbjct  578  ICNPGKLLP  586


>Q8IBE8_PLAF7 unnamed protein product
Length=1502

 Score = 32.0 bits (71),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 17/70 (24%), Positives = 33/70 (47%), Gaps = 9/70 (13%)

Query  217  FGIVTKFKFKIYKAPRSVVYVRNEFSFENFSQFYRAWQTLMNFGVPRHFSLDFKIFDSHI  276
            +G V K   KI+       ++ N+    N S+F + W++   +G P +   +  + + H 
Sbjct  49   YGNVQKTDKKIF------TFIENKLDILNNSKFNKRWKS---YGTPDNIDKNMSLINKHN  99

Query  277  LMEVFGFNFQ  286
              E+F  N+Q
Sbjct  100  NEEMFNNNYQ  109


>Q8ILT0_PLAF7 unnamed protein product
Length=470

 Score = 32.0 bits (71),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 29/59 (49%), Gaps = 3/59 (5%)

Query  368  IYALKDLFSE---YLPYLDLTAEPNNAAVNSILPSDSAFVHRGTNLFDLQFRASSVPPK  423
            +Y+LK LF E   YLP ++  +EP  A    +   D   V R    F +Q+ ++  P K
Sbjct  54   LYSLKPLFMEEPKYLPIIETLSEPERAIQFRVCWLDDNGVQRKNRCFRVQYNSALGPYK  112



Lambda      K        H
   0.298    0.115    0.302 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3687020106


Query= XP_037024133.1 uncharacterized protein LOC119066020 [Bradysia
coprophila]

Length=200
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8I1T1_PLAF7  unnamed protein product                                 27.7    5.2  
Q7K1V0_DROME  unnamed protein product                                 28.5    5.3  
G5EE12_CAEEL  unnamed protein product                                 27.3    9.9  


>Q8I1T1_PLAF7 unnamed protein product
Length=229

 Score = 27.7 bits (60),  Expect = 5.2, Method: Compositional matrix adjust.
 Identities = 14/57 (25%), Positives = 27/57 (47%), Gaps = 0/57 (0%)

Query  128  SSLCRKCDRENETISHVSGSCPSSSLLITARHHSVKHTIADMLREKGFECFDEVYAI  184
            ++L ++ D   + I+H   S  S  + I     + K+ + D    +G   FD+ Y+I
Sbjct  162  TNLIKRKDDNEDIINHRLNSYESDYIPIIQFFKNEKYNLIDFPLRRGIRDFDDFYSI  218


>Q7K1V0_DROME unnamed protein product
Length=985

 Score = 28.5 bits (62),  Expect = 5.3, Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 29/57 (51%), Gaps = 1/57 (2%)

Query  144  VSGSCPSSSLLITARHHSVKHTIADMLREK-GFECFDEVYAIDTDGKTRFSIEKRLH  199
            + GSCP   L  +      KH+ A ++++K GF  + E+ +++     RF+   + H
Sbjct  394  IYGSCPECKLTFSNILQYNKHSCAHVIKKKRGFRSYCEMCSLEFPSWKRFNFHSQFH  450


>G5EE12_CAEEL unnamed protein product
Length=678

 Score = 27.3 bits (59),  Expect = 9.9, Method: Compositional matrix adjust.
 Identities = 14/43 (33%), Positives = 20/43 (47%), Gaps = 6/43 (14%)

Query  65   NEAYDRWCNLSYQGSGVIHFSQHTASNDFVYNKNSLSSSEWVA  107
            ++A D      Y  SG++HF QH       + KN L  + W A
Sbjct  13   DKAKDETTRPQYTMSGILHFIQHE------WTKNELDRTRWEA  49



Lambda      K        H
   0.298    0.115    0.302 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3687020106


Query= XP_037024134.1 chitooligosaccharide oxidase-like [Bradysia
coprophila]

Length=501
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7YWB6_LEIMA  unnamed protein product                                 36.6    0.054
Q57ZU1_TRYB2  unnamed protein product                                 33.9    0.32 
Q8ILT0_PLAF7  unnamed protein product                                 32.0    1.3  


>Q7YWB6_LEIMA unnamed protein product
Length=621

 Score = 36.6 bits (83),  Expect = 0.054, Method: Compositional matrix adjust.
 Identities = 90/430 (21%), Positives = 167/430 (39%), Gaps = 61/430 (14%)

Query  101  FGDSRSLI-VDLAKMNH-ISVDPKDMTSEIGAGAKVALVSFTLWKNGKFL---IPSGICP  155
            F  +R +I VD+ +MN  IS+D +   +    G     +   L+++G  L     S I  
Sbjct  181  FERARMIISVDMRRMNRMISIDRESRLATFETGVLGPDLDAQLFRHGFMLGHDPDSYIYS  240

Query  156  TVGIAGLTMGGGYGRFTTVFGLTSDSVVEMEMVDARGQLLVINNSTNSDLFWALRG---G  212
            T+G  G     G G  +  +G   D VV +++    G  ++   +T+      L G   G
Sbjct  241  TLG--GWIGARGSGAMSNQYGDIEDMVVAVKVATPTG--IIETPTTSRTCGVDLNGLFIG  296

Query  213  GGGNFGIVTKFKFKIYKAPRSVVYVRNEFSFENFSQFYRAWQTLINFGVPRHFSLVFKIF  272
              G+FGI+T+   K+   P + +Y    + F  F   + A+ T    G+        +++
Sbjct  297  SEGSFGIITEATIKLETIPETKLY--EGYLFPTFEAGFSAFYTCTAKGI---HPCTMRLY  351

Query  273  DSH-----IVMEVFGYNFEYQNETVESITNFLNSFSFPNATSSSSKVMSYE------EFM  321
            D       + M    ++F +Q      + +FL  +   N    S  ++ +E      +F 
Sbjct  352  DEDDFRMSMAMSTTKHSF-FQRLVSMGVKSFLERYRGWNLRRISLVIVGFEGTPDRVKFQ  410

Query  322  VADATA-FSSVMIQTVSQLENMTKYDAVVEWKKVKSMFVDQILNESQIYALKDLFSEYLP  380
             ++  A F       V +    T  D   +   ++  F   + + + ++    L+S+ +P
Sbjct  411  RSETAAVFKQYGGVGVGRSAGATWQDKKYDLPYIRD-FALSLSHWADVFETSVLYSQAIP  469

Query  381  YLDLTAEPNNAAVNSILPSDSAFVHRG------TNLFD----LQFRASSVPPKQPDFQAD  430
                      AAV  +        HRG       + +     L F  +S      D +  
Sbjct  470  CWRAV----KAAVRQVWKEHG---HRGWIGCHTAHQYKYGCCLYFTFASAQKDDMDMKIF  522

Query  431  RAIR------MLFEKSKSVFHHRESYQNYMDQDLTDYLVRYYGSN-LDRLVSIKSRYDPG  483
             AI+      ML        HH   Y++        ++ RY G + LD L ++K + DP 
Sbjct  523  LAIKKRATEAMLAHTGNLTHHHGIGYEH------VPWMSRYMGPDALDLLFAVKQKVDPK  576

Query  484  NMFHHPQSIP  493
            N+ +  + +P
Sbjct  577  NICNPGKLLP  586


>Q57ZU1_TRYB2 unnamed protein product
Length=520

 Score = 33.9 bits (76),  Expect = 0.32, Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 71/165 (43%), Gaps = 17/165 (10%)

Query  70   VSDVQKAVTCCGLTKVRIVARSGGHSYIKTGFGDSRSLIVDLAKMNHI-SVDPKDMTSEI  128
            VS + K +   G  + R+V   GG S     F +    ++ + ++N I S+D K MT   
Sbjct  34   VSSIIKVINSAG-ERCRVVG--GGKSPNSCTFTNGH--LIHMDRLNRITSIDEKSMTIVC  88

Query  129  GAGAKVALVSFTLWKNGKFL--IPSGICPTVG--IAGLTMGGGYGRFTTVFGLTSDSVVE  184
              GA ++ V   L  +   L  +PS +  TVG  IA  T               SD VV 
Sbjct  89   EGGALISDVFERLSAHDLMLRCVPSFVQTTVGGVIATATH-----SSGIRSRSISDCVVR  143

Query  185  MEMVDARGQLLVINNSTNSDLFWALRGGGGGNFGIVTKFKFKIYK  229
            +++VD RG L   + ST  +L  +L     G  G+V     +  K
Sbjct  144  LQLVDGRGILHTFDASTPKEL--SLSACHLGMLGVVVSVTLQAEK  186


>Q8ILT0_PLAF7 unnamed protein product
Length=470

 Score = 32.0 bits (71),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 29/59 (49%), Gaps = 3/59 (5%)

Query  368  IYALKDLFSE---YLPYLDLTAEPNNAAVNSILPSDSAFVHRGTNLFDLQFRASSVPPK  423
            +Y+LK LF E   YLP ++  +EP  A    +   D   V R    F +Q+ ++  P K
Sbjct  54   LYSLKPLFMEEPKYLPIIETLSEPERAIQFRVCWLDDNGVQRKNRCFRVQYNSALGPYK  112



Lambda      K        H
   0.298    0.115    0.302 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3687020106


Query= XP_037024135.1 chitooligosaccharide oxidase-like [Bradysia
coprophila]

Length=501
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7YWB6_LEIMA  unnamed protein product                                 37.0    0.038
ACBP3_CAEEL  unnamed protein product                                  33.1    0.13 
Q8ILT0_PLAF7  unnamed protein product                                 32.7    0.79 


>Q7YWB6_LEIMA unnamed protein product
Length=621

 Score = 37.0 bits (84),  Expect = 0.038, Method: Compositional matrix adjust.
 Identities = 58/232 (25%), Positives = 97/232 (42%), Gaps = 25/232 (11%)

Query  101  FGDSRSLI-VDLAKMNH-ISVDPKDMISEIGAGAKVAVVSFTLWKNGKFLIPSGICPTVG  158
            F  +R +I VD+ +MN  IS+D +  ++    G     +   L+++G  L   G  P   
Sbjct  181  FERARMIISVDMRRMNRMISIDRESRLATFETGVLGPDLDAQLFRHGFML---GHDPDSY  237

Query  159  IAGLTLGG-----GYGRFTTVFGLTSDSVVEMEMVDAIGQLLVINNSTNSDLFWALRG--  211
            I   TLGG     G G  +  +G   D VV +++    G  ++   +T+      L G  
Sbjct  238  IYS-TLGGWIGARGSGAMSNQYGDIEDMVVAVKVATPTG--IIETPTTSRTCGVDLNGLF  294

Query  212  -GGGGNFGIVTKFKFKIYKAPRSVVYVRNEFGFENFLQFYRAWQTLMNVGVPRHFSLLFR  270
             G  G+FGI+T+   K+   P + +Y    + F  F   + A+ T    G+      L+ 
Sbjct  295  IGSEGSFGIITEATIKLETIPETKLY--EGYLFPTFEAGFSAFYTCTAKGIHPCTMRLYD  352

Query  271  IFDNHISMG----SHGFNFQYQNETVESVTNFLSSFSFPNATSSSSKVMSYE  318
              D  +SM      H F   +Q      V +FL  +   N    S  ++ +E
Sbjct  353  EDDFRMSMAMSTTKHSF---FQRLVSMGVKSFLERYRGWNLRRISLVIVGFE  401


>ACBP3_CAEEL unnamed protein product
Length=116

 Score = 33.1 bits (74),  Expect = 0.13, Method: Composition-based stats.
 Identities = 27/82 (33%), Positives = 41/82 (50%), Gaps = 5/82 (6%)

Query  305  PNATSSSSKVMSYEEFMVADASAFSSAMIQTVSQLENMTKYDAVVEWKKVKSMFVDQILN  364
            P ATS+  K+  Y  F  A     ++      S +E   K+D+   WK+++ +  D+   
Sbjct  22   PVATSNDQKLTFYSLFKQASIGDVNTDRPGIFSIIER-KKWDS---WKELEGVSQDEA-K  76

Query  365  ERQIYALKDLFIEYMPYLDVAA  386
            ER I AL D+F +    LDVAA
Sbjct  77   ERYIKALNDMFDKIAEELDVAA  98


>Q8ILT0_PLAF7 unnamed protein product
Length=470

 Score = 32.7 bits (73),  Expect = 0.79, Method: Compositional matrix adjust.
 Identities = 18/59 (31%), Positives = 31/59 (53%), Gaps = 3/59 (5%)

Query  368  IYALKDLFIE---YMPYLDVAAEPNNAVVNSLPPSDTAFVHRGTNLFDLQFRASSVPPK  423
            +Y+LK LF+E   Y+P ++  +EP  A+   +   D   V R    F +Q+ ++  P K
Sbjct  54   LYSLKPLFMEEPKYLPIIETLSEPERAIQFRVCWLDDNGVQRKNRCFRVQYNSALGPYK  112



Lambda      K        H
   0.298    0.115    0.302 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3687020106


Query= XP_037024136.1 uncharacterized protein LOC119066024 [Bradysia
coprophila]

Length=683
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q382T0_TRYB2  unnamed protein product                                 31.2    3.8  
Q8SXY1_DROME  unnamed protein product                                 30.4    4.8  
A8JR58_DROME  unnamed protein product                                 30.4    5.1  


>Q382T0_TRYB2 unnamed protein product
Length=835

 Score = 31.2 bits (69),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 28/59 (47%), Gaps = 8/59 (14%)

Query  64   TAVDVVDSTCAD--NETNVDSTG------NVCEEEPVTAPEANQILNAHIKKRRIVAAE  114
            TA DV++  C D  N  N  +          CE+ P   P + Q+L AH K  R++A +
Sbjct  511  TAEDVINLGCTDFHNTDNYKTYAMKRRILEECEDAPYKIPSSRQVLFAHKKAERLLAED  569


>Q8SXY1_DROME unnamed protein product
Length=377

 Score = 30.4 bits (67),  Expect = 4.8, Method: Compositional matrix adjust.
 Identities = 21/85 (25%), Positives = 37/85 (44%), Gaps = 15/85 (18%)

Query  590  MPPSVHKVLIHGADIINSLVL---PIGVYSE------------EASESRNKDFKNIREHH  634
            +PP    V IH   I+N ++    P+ +Y E            E + S +K  K  R HH
Sbjct  45   IPPDADNVEIHKVKIVNGVMQEDHPVIMYKEDFVSEDYDPTKSETNPSHHKKHKRTRLHH  104

Query  635  TRKMSRVLTNEDLIHGLLVSSDPLI  659
             ++++     ED I   ++   P++
Sbjct  105  AKQVTGTEKKEDQILFDILPDKPIV  129


>A8JR58_DROME unnamed protein product
Length=445

 Score = 30.4 bits (67),  Expect = 5.1, Method: Compositional matrix adjust.
 Identities = 21/85 (25%), Positives = 37/85 (44%), Gaps = 15/85 (18%)

Query  590  MPPSVHKVLIHGADIINSLVL---PIGVYSE------------EASESRNKDFKNIREHH  634
            +PP    V IH   I+N ++    P+ +Y E            E + S +K  K  R HH
Sbjct  45   IPPDADNVEIHKVKIVNGVMQEDHPVIMYKEDFVSEDYDPTKSETNPSHHKKHKRTRLHH  104

Query  635  TRKMSRVLTNEDLIHGLLVSSDPLI  659
             ++++     ED I   ++   P++
Sbjct  105  AKQVTGTEKKEDQILFDILPDKPIV  129



Lambda      K        H
   0.298    0.115    0.302 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3687020106


Query= XP_037024137.1 uncharacterized protein LOC119066021 [Bradysia
coprophila]

Length=147
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

BL1S6_DROME  unnamed protein product                                  68.9    3e-15
RBP1_PLAVB  unnamed protein product                                   35.4    0.013
DMDD_DROME  unnamed protein product                                   30.8    0.43 


>BL1S6_DROME unnamed protein product
Length=167

 Score = 68.9 bits (167),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/110 (32%), Positives = 64/110 (58%), Gaps = 0/110 (0%)

Query  18   LAKGFVDLYRPSLEKIESDLKELTNKQEKIHDDLTVEMEKISDDKLADIQSMIMKMKTYK  77
            L+ G + +  P L  + + L+EL  +Q K + DL+ E  K+   ++A +  M+  +K YK
Sbjct  56   LSAGVLQIAEPPLNHVRTQLRELIGRQNKTYIDLSKEKYKLDCSEVARLNDMMSDVKRYK  115

Query  78   EKLVAIKRQMVHIHHRTRNLKRRSITLQSFKQAEVDAKIQKRHREEHLIA  127
            +KL  IK++M  ++ RT+ LK+R+  + + KQ +   K+++   EE LI 
Sbjct  116  DKLTKIKKEMQGVYQRTKELKKRAANVAACKQRDYQRKLERLQHEESLIG  165


>RBP1_PLAVB unnamed protein product
Length=2833

 Score = 35.4 bits (80),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 20/67 (30%), Positives = 41/67 (61%), Gaps = 3/67 (4%)

Query  31   EKIESDLKELTNKQEKIHDDLTVEMEKISDDKLADIQSMIMKMKTYKEKLVAIKRQMVHI  90
            EK++ D +++  K E+I+ ++    ++  DDK+ D+Q +I +MK YK+++V        I
Sbjct  481  EKVKDDAEDICEKNEQIYYEIPESEDETIDDKINDLQDLIDQMKEYKDEIV---NNSEFI  537

Query  91   HHRTRNL  97
             +R +N+
Sbjct  538  SNRYKNI  544


>DMDD_DROME unnamed protein product
Length=1854

 Score = 30.8 bits (68),  Expect = 0.43, Method: Compositional matrix adjust.
 Identities = 17/70 (24%), Positives = 40/70 (57%), Gaps = 2/70 (3%)

Query  39   ELTNKQEKIHDDLTVEME--KISDDKLADIQSMIMKMKTYKEKLVAIKRQMVHIHHRTRN  96
            ++ + Q+++  DL  E+E  ++  D+L      ++   T +E  V ++R++  ++ R  N
Sbjct  860  DIIDSQDRLSQDLQSEIETHRVVYDRLDGTGRKLLGSLTSQEDAVMLQRRLDEMNQRWNN  919

Query  97   LKRRSITLQS  106
            LK +SI +++
Sbjct  920  LKSKSIAIRN  929



Lambda      K        H
   0.298    0.115    0.302 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3687020106


Query= XP_037024138.1 uncharacterized protein LOC119066025 [Bradysia
coprophila]

Length=509
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VCH8_DROME  unnamed protein product                                 33.9    0.41 
Q9BI21_DROME  unnamed protein product                                 33.9    0.41 
Q388G6_TRYB2  unnamed protein product                                 31.2    1.9  


>Q9VCH8_DROME unnamed protein product
Length=1197

 Score = 33.9 bits (76),  Expect = 0.41, Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 58/126 (46%), Gaps = 18/126 (14%)

Query  2     QLNFSWI-----IKLWNQTKTDKTPASNSIALLDLNEHCLRHIGRFLSMEDAYSFGHTCT  56
             QLN S+I     IK  N +K     A + +A+L+  +H LR +G FL   +   F     
Sbjct  919   QLNESYIDNPDNIKYVNLSKEIIVNADSEVAMLNYVDHLLRKVGEFLPHTNIAGFEQEFA  978

Query  57    QLFE-IMSKLRVPVTIRDSNDFRYLTFFKAAASDLTV-----------DTTAEGRKSTDL  104
             +++E  M ++ +   +R  N  R LT +    + L V           + T +G+ + ++
Sbjct  979   KVYERRMLEIHIE-ELRFKNSARNLTLYPDYCNKLKVLRALKYIDELDEVTLKGKVACEM  1037

Query  105   NQRKLL  110
              Q +LL
Sbjct  1038  GQNELL  1043


>Q9BI21_DROME unnamed protein product
Length=1197

 Score = 33.9 bits (76),  Expect = 0.41, Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 58/126 (46%), Gaps = 18/126 (14%)

Query  2     QLNFSWI-----IKLWNQTKTDKTPASNSIALLDLNEHCLRHIGRFLSMEDAYSFGHTCT  56
             QLN S+I     IK  N +K     A + +A+L+  +H LR +G FL   +   F     
Sbjct  919   QLNESYIDNPDNIKYVNLSKEIIVNADSEVAMLNYVDHLLRKVGEFLPHTNIAGFEQEFA  978

Query  57    QLFE-IMSKLRVPVTIRDSNDFRYLTFFKAAASDLTV-----------DTTAEGRKSTDL  104
             +++E  M ++ +   +R  N  R LT +    + L V           + T +G+ + ++
Sbjct  979   KVYERRMLEIHIE-ELRFKNSARNLTLYPDYCNKLKVLRALKYIDELDEVTLKGKVACEM  1037

Query  105   NQRKLL  110
              Q +LL
Sbjct  1038  GQNELL  1043


>Q388G6_TRYB2 unnamed protein product
Length=325

 Score = 31.2 bits (69),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 30/57 (53%), Gaps = 3/57 (5%)

Query  371  KKLTKLDLSH-VITIIVTNNDLTEFIKFIINCPKIELIEFDRCFPIDRFYKQLLKYE  426
            KKL  L + H  ITI   N  L  F+ F+  CP ++L+ + R   +DR   + ++ E
Sbjct  136  KKLEILSIEHNPITISEDNARLRAFVVFL--CPTLKLVNYQRVTQVDRQNVETMRKE  190



Lambda      K        H
   0.298    0.115    0.302 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3687020106


Query= XP_037024139.1 DNA replication ATP-dependent helicase/nuclease
DNA2-like [Bradysia coprophila]

Length=172
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9U3F2_CAEEL  unnamed protein product                                 45.1    1e-05
Q7JMR0_CAEEL  unnamed protein product                                 28.9    2.7  
TF2H1_DROME  unnamed protein product                                  28.9    2.7  


>Q9U3F2_CAEEL unnamed protein product
Length=1069

 Score = 45.1 bits (105),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 43/156 (28%), Positives = 78/156 (50%), Gaps = 9/156 (6%)

Query  19   TFKRKSGGDLVSDHTLTGMNTGEYYRVSTLKRIAIAAGRVIGIT--KTTIKMSLERDLTK  76
            +F RK    L S +T T    G+   +S  K IAI    +  ++  +  +K+S ++ +  
Sbjct  525  SFSRKF---LKSSNTPT-FRPGDVCLLSNKKHIAIGFALIDEVSDDQQIVKISTDKTIKS  580

Query  77   RYKDESFILDRNDSQTFTKFNLATIGALLDDRDSTRRLRSIIIDRMQPTF--SKTLPKII  134
            RY +  F LD+  S +     L  +  LL + +  +RLR+I++D + P    +       
Sbjct  581  RY-EAPFHLDKYTSMSTHSTTLGNLVYLLQNDEIGKRLRNILVDLLPPIIMDATGFNLTP  639

Query  135  ATDGKRVLQKLNIIQQEAVLKALTVNEYLLLKGLPG  170
            A     +  KLN  Q++AV+ AL   ++++++GLPG
Sbjct  640  AIKKIIIKAKLNNEQRKAVVHALATEDFMMVEGLPG  675


>Q7JMR0_CAEEL unnamed protein product
Length=574

 Score = 28.9 bits (63),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 37/88 (42%), Gaps = 13/88 (15%)

Query  89   DSQTFTKFNLATIGALLDDRDSTRRLRSIIIDRMQPTFSKTLPKIIATDGK---------  139
            ++  FT   L +  A+ D   S      I +DRM+P   + +PK I   GK         
Sbjct  217  ETMWFTAVGLNS--AMADKLISIEMYTQICVDRMRPFVHRFMPKNIVNQGKVDDLLHITF  274

Query  140  -RVLQKLNIIQQEAVLKALTVNEYLLLK  166
             R L  L +     +  A+ V+EY  +K
Sbjct  275  GREL-PLALYSHWDLFSAMMVSEYFSIK  301


>TF2H1_DROME unnamed protein product
Length=585

 Score = 28.9 bits (63),  Expect = 2.7, Method: Composition-based stats.
 Identities = 19/82 (23%), Positives = 39/82 (48%), Gaps = 7/82 (9%)

Query  84   ILDRNDSQTFTKFNLATIGALLDDRDSTRRLRSIIIDRMQPTFSKTLPKIIATDGKRVLQ  143
            +L   ++ TF   N     A+L DRD  + L    + ++ P F + + K +    + +++
Sbjct  68   VLHDGNTSTFHFVNRQGQAAMLADRDKVKEL----LQQLLPNFKRKVDKDLEDKNRILVE  123

Query  144  KLNIIQ---QEAVLKALTVNEY  162
              N++Q      + K LT +E+
Sbjct  124  NPNLLQLYKDLVITKVLTSDEF  145



Lambda      K        H
   0.298    0.115    0.302 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3687020106


Query= XP_037024140.1 uncharacterized protein LOC119066027 [Bradysia
coprophila]

Length=497
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9PC48_DROME  unnamed protein product                                 36.6    0.056


>M9PC48_DROME unnamed protein product
Length=18095

 Score = 36.6 bits (83),  Expect = 0.056, Method: Composition-based stats.
 Identities = 54/218 (25%), Positives = 80/218 (37%), Gaps = 26/218 (12%)

Query  287    PPSNTTSDSLFVPPQQAGIQSTTKQSKVHSSTVQGISPNTSQQQNVVPTTHSNPGVNQLI  346
              P S  TS  + +P Q +   S      V+  ++   +P     Q   P   + P V Q I
Sbjct  14436  PVSTPTSGVINIPSQASPPISVPTPGIVNIPSIPQPTP-----QRPSPGIINVPSVPQPI  14490

Query  347    PSSNQILAGQQTSQININHLPPTIDPPINPRSNMINSTLNVPASAAVTASGNINQANTTA  406
              P++             I ++P    P  +P   +IN          V   G IN  +   
Sbjct  14491  PTA---------PSPGIINIPSVPQPLPSPTPGVINIPQQPTPPPLVQQPGIINIPSVQQ  14541

Query  407    APTLNTSHP----QHIPSNLQP-PSIGQIPNQSIGQIPNQ--SYQQTMTHQLYHQPISSV  459
                T  T HP    Q+     QP P +  IP+ S    P Q  SYQ T    +  +P  S 
Sbjct  14542  PSTPTTQHPIQDVQYETQRPQPTPGVINIPSVSQPTYPTQKPSYQDTSYPTVQPKPPVSG  14601

Query  460    TRSLFGYPNPIPNY-----QLHQQPPGSIPMSSFGYQN  492
                ++   P P+P+       L  +P  S P+   G  N
Sbjct  14602  IINIPSVPQPVPSLTPGVINLPSEPSYSAPIPKPGIIN  14639



Lambda      K        H
   0.298    0.115    0.302 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3687020106


Query= XP_037024141.1 uncharacterized protein LOC119066028 [Bradysia
coprophila]

Length=1820
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q388I3_TRYB2  unnamed protein product                                 34.7    0.86 
A0A0U1QT59_DROME  unnamed protein product                             33.1    3.0  
M9NDN5_DROME  unnamed protein product                                 33.1    3.2  


>Q388I3_TRYB2 unnamed protein product
Length=460

 Score = 34.7 bits (78),  Expect = 0.86, Method: Compositional matrix adjust.
 Identities = 14/47 (30%), Positives = 23/47 (49%), Gaps = 0/47 (0%)

Query  979   ITQPNFKKWTEWIKTLHEVENIQIPRLYSPKLSPNEPKSIQIHTFVD  1025
             I +P  K+  EW   LH++E   +P+       PN  K +++H   D
Sbjct  106   IARPGIKRRDEWSTALHDIEPFVLPQQLLCGSPPNRQKHVRVHYIAD  152


>A0A0U1QT59_DROME unnamed protein product
Length=2036

 Score = 33.1 bits (74),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 54/118 (46%), Gaps = 19/118 (16%)

Query  844  HTIDAAEKRIREVKFIHKEGGFEIRNFLSNSKELLRRIGET----GEQSTKNM---NISF  896
            + I++ EK ++ +K  ++    E++N LS S E LR +  T    GE ++  +   + S 
Sbjct  620  YKINSKEKPLQMLKLENETNTMELKNLLS-SIEALRAMTPTTSLYGESTSDGLFDDSTST  678

Query  897  ELGTERVLGMFWNTGT-----------DCFTFSLKYTKVNEQILSGKHHPTKREVLRV  943
                E   G+F  T              C+  ++K +K+   I+SGKH  T   VL +
Sbjct  679  ATWGEDGGGLFSTTAAAALISTTVQRLKCYNMTVKCSKLRRNIISGKHLATTLMVLNL  736


>M9NDN5_DROME unnamed protein product
Length=1932

 Score = 33.1 bits (74),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 55/123 (45%), Gaps = 19/123 (15%)

Query  839  MLDSEHTIDAAEKRIREVKFIHKEGGFEIRNFLSNSKELLRRIGET----GEQSTKNM--  892
            M    + I++ EK ++ +K  ++    E++N LS S E LR +  T    GE ++  +  
Sbjct  511  MFSFIYKINSKEKPLQMLKLENETNTMELKNLLS-SIEALRAMTPTTSLYGESTSDGLFD  569

Query  893  -NISFELGTERVLGMFWNTGT-----------DCFTFSLKYTKVNEQILSGKHHPTKREV  940
             + S     E   G+F  T              C+  ++K +K+   I+SGKH  T   V
Sbjct  570  DSTSTATWGEDGGGLFSTTAAAALISTTVQRLKCYNMTVKCSKLRRNIISGKHLATTLMV  629

Query  941  LRV  943
            L +
Sbjct  630  LNL  632



Lambda      K        H
   0.298    0.115    0.302 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3687020106


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jul 7, 2021  1:54 PM
  Number of letters in database: 17,197,330
  Number of sequences in database:  25,232



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= XP_037024142.1 uncharacterized protein LOC119066029 [Bradysia
coprophila]

Length=416
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q38A60_TRYB2  unnamed protein product                                 30.4    3.5  


>Q38A60_TRYB2 unnamed protein product
Length=644

 Score = 30.4 bits (67),  Expect = 3.5, Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 40/84 (48%), Gaps = 9/84 (11%)

Query  269  RVIETFPGQDKLIRSVKIRLIRNGKIVEIDRPIQRLYMLESSTD-----NVKDLVEDDGQ  323
            R+++TF   +  I    I+L R   + +  R I   Y L+ S D     N +  VE    
Sbjct  563  RLLQTFAPWEHYINQQAIKLSRRDNVPDWLRTIVYYYFLDESDDLEMLKNKQKYVEG---  619

Query  324  IKKPMTKHMEGNEPSSSEGNEPSS  347
            I++   +  EGNE S+S G  PSS
Sbjct  620  IRRIREQFEEGNETSAS-GATPSS  642



Lambda      K        H
   0.316    0.134    0.388 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4524418670


Query= XP_037024143.1 E3 ubiquitin-protein ligase NRDP1-like [Bradysia
coprophila]

Length=349
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VUV7_DROME  unnamed protein product                                 133     3e-36
Q9W0D7_DROME  unnamed protein product                                 46.2    2e-05
Q9UAC4_DROME  unnamed protein product                                 46.2    3e-05


>Q9VUV7_DROME unnamed protein product
Length=315

 Score = 133 bits (335),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 94/161 (58%), Gaps = 3/161 (2%)

Query  1    MGYDVERFVGEVVDNELLCQICASVLQDAVETP-CEHFFCMECIKNWLLLKKDCPIDRQP  59
            MGYDV RF GEV D EL C IC+ VL+D ++   CEH FC  CI  WL  +  CP+DR  
Sbjct  1    MGYDVNRFQGEV-DEELTCPICSGVLEDPLQAVMCEHAFCRGCINEWLTRQPTCPVDRNS  59

Query  60   LRKAQLRKPSRLLRNLLGRLEIKCDFEEYGCNMAVKLENLDNHRSICNNNPDTEITCNKG  119
            L  A LR   R+LRNLL RL I CD   YGC   +KL+  ++H   C +NP     C KG
Sbjct  60   LTTANLRAVPRILRNLLSRLSITCDNAPYGCTAVLKLDAYNSHLDECIHNPKRPFPCEKG  119

Query  120  CDLPIRRRDLAN-NCLVHLKNRIHGQDEKISHLSTTVSEQR  159
            C   I + +L + NC+  L+  I  Q EK+  L + +++Q+
Sbjct  120  CGFDIPKDELKDHNCVRELRTLIVKQTEKMGELKSELTDQQ  160


>Q9W0D7_DROME unnamed protein product
Length=299

 Score = 46.2 bits (108),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 28/47 (60%), Gaps = 0/47 (0%)

Query  19   CQICASVLQDAVETPCEHFFCMECIKNWLLLKKDCPIDRQPLRKAQL  65
            C +C     D+  TPC H FC  C+  WL  + +CP+ R+ L+K+Q+
Sbjct  246  CILCLEPRSDSSLTPCGHIFCWSCLLEWLEERDECPLCRESLKKSQV  292


>Q9UAC4_DROME unnamed protein product
Length=475

 Score = 46.2 bits (108),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/97 (28%), Positives = 40/97 (41%), Gaps = 1/97 (1%)

Query  11   EVVDNELLCQICASVLQDAVETPCEHFFCMECIKNWLLLKKD-CPIDRQPLRKAQLRKPS  69
            E++D+   C IC   L + V T C H FC  C+  W+      CP+D + L       P 
Sbjct  96   ELLDSRYECAICIDWLNEPVLTSCGHRFCRSCLTAWMQKNNQCCPMDNKRLSAEHDIFPD  155

Query  70   RLLRNLLGRLEIKCDFEEYGCNMAVKLENLDNHRSIC  106
               R  + +L+  C     GC++      L  H   C
Sbjct  156  NYTRREIEQLKRDCPNSSLGCSVVASPIELHRHLPSC  192



Lambda      K        H
   0.316    0.134    0.388 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4524418670


Query= XP_037024144.1 E3 ubiquitin-protein ligase NRDP1-like [Bradysia
coprophila]

Length=355
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VUV7_DROME  unnamed protein product                                 131     3e-35
Q9W0D7_DROME  unnamed protein product                                 45.4    3e-05
Q9UAC4_DROME  unnamed protein product                                 45.8    3e-05


>Q9VUV7_DROME unnamed protein product
Length=315

 Score = 131 bits (329),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 93/161 (58%), Gaps = 3/161 (2%)

Query  1    MGYDVERFVGEVVDNELLCQICASVLQDAVETP-CEHFFCMECIKNWLLLKKDCPIDRQP  59
            MGYDV RF GEV D EL C IC+ VL+D ++   CEH FC  CI  WL  +  CP+DR  
Sbjct  1    MGYDVNRFQGEV-DEELTCPICSGVLEDPLQAVMCEHAFCRGCINEWLTRQPTCPVDRNS  59

Query  60   LRKPQLRKPSRLLRNLLGRLEIKCDFEEYGCNMAVKLENLDNHRSICNNNPDTEITCNKG  119
            L    LR   R+LRNLL RL I CD   YGC   +KL+  ++H   C +NP     C KG
Sbjct  60   LTTANLRAVPRILRNLLSRLSITCDNAPYGCTAVLKLDAYNSHLDECIHNPKRPFPCEKG  119

Query  120  CDLPIRRRDLAN-NCLVHLKNRIHGQDEKISHLSTTVSEQR  159
            C   I + +L + NC+  L+  I  Q EK+  L + +++Q+
Sbjct  120  CGFDIPKDELKDHNCVRELRTLIVKQTEKMGELKSELTDQQ  160


>Q9W0D7_DROME unnamed protein product
Length=299

 Score = 45.4 bits (106),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 27/47 (57%), Gaps = 0/47 (0%)

Query  19   CQICASVLQDAVETPCEHFFCMECIKNWLLLKKDCPIDRQPLRKPQL  65
            C +C     D+  TPC H FC  C+  WL  + +CP+ R+ L+K Q+
Sbjct  246  CILCLEPRSDSSLTPCGHIFCWSCLLEWLEERDECPLCRESLKKSQV  292


>Q9UAC4_DROME unnamed protein product
Length=475

 Score = 45.8 bits (107),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/97 (28%), Positives = 40/97 (41%), Gaps = 1/97 (1%)

Query  11   EVVDNELLCQICASVLQDAVETPCEHFFCMECIKNWLLLKKD-CPIDRQPLRKPQLRKPS  69
            E++D+   C IC   L + V T C H FC  C+  W+      CP+D + L       P 
Sbjct  96   ELLDSRYECAICIDWLNEPVLTSCGHRFCRSCLTAWMQKNNQCCPMDNKRLSAEHDIFPD  155

Query  70   RLLRNLLGRLEIKCDFEEYGCNMAVKLENLDNHRSIC  106
               R  + +L+  C     GC++      L  H   C
Sbjct  156  NYTRREIEQLKRDCPNSSLGCSVVASPIELHRHLPSC  192



Lambda      K        H
   0.316    0.134    0.388 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4524418670


Query= XP_037024145.1 endoglucanase-like isoform X1 [Bradysia coprophila]

Length=214
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O77375_PLAF7  unnamed protein product                                 47.0    5e-06
Q9W4M4_DROME  unnamed protein product                                 43.9    6e-05
Q54LJ4_DICDI  unnamed protein product                                 34.7    0.054


>O77375_PLAF7 unnamed protein product
Length=2457

 Score = 47.0 bits (110),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 24/86 (28%), Positives = 36/86 (42%), Gaps = 5/86 (6%)

Query  101   TPTPCPPTPTDFPVTPTRDPVTPTRDPVTPTRDPVTPTRDPVTPTRDPITPTRDPVTPTP  160
             +P   P +P   P +P   P +P   P +P   P +P   P +P   P +P     +PT 
Sbjct  2292  SPKYSPTSPKYSPTSPKYSPTSPKYSPTSPKYSPTSPKYSPTSPKYSPTSPK---YSPTS  2348

Query  161   PNGTTTPCVGCEYGQPKTTLPPFIIT  186
             P  + T  V      P  +  P+ IT
Sbjct  2349  PKYSPTSPVAQNIASPNYS--PYSIT  2372


 Score = 46.2 bits (108),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 21/75 (28%), Positives = 32/75 (43%), Gaps = 3/75 (4%)

Query  87    TPCPPATTTKCPCPTPTPCPPTPTDFPVTPTRDPVTPTRDPVTPTRDPVTPTRDPVTPTR  146
             +P    T+ K    +P   P +P   P +P   P +P   P +P   P +P   P +P  
Sbjct  2285  SPVYSVTSPKYSPTSPKYSPTSPKYSPTSPKYSPTSPKYSPTSPKYSPTSPKYSPTSPKY  2344

Query  147   DPITPTRDPVTPTPP  161
              P +P     +PT P
Sbjct  2345  SPTSPK---YSPTSP  2356


 Score = 37.0 bits (84),  Expect = 0.012, Method: Composition-based stats.
 Identities = 16/59 (27%), Positives = 25/59 (42%), Gaps = 3/59 (5%)

Query  108   TPTDFPVTPTRDPVTPTRDPVTPTRDPVTPTRDPVTPTRDPITPTRDPVTPTPPNGTTT  166
             +P     +P   P +P   P +P   P +P   P +P   P +P     +PT P  + T
Sbjct  2285  SPVYSVTSPKYSPTSPKYSPTSPKYSPTSPKYSPTSPKYSPTSPK---YSPTSPKYSPT  2340


 Score = 33.5 bits (75),  Expect = 0.12, Method: Composition-based stats.
 Identities = 20/76 (26%), Positives = 33/76 (43%), Gaps = 5/76 (7%)

Query  87    TPCPPATTTKCPCPTPTPCPPTPTDFPVTPTRDPVTPTRDPVTPTRDPVTP-TRDPVTPT  145
             +P  P  +   P  +PT    +PT    +PT    +PT    +P   P +P  ++  +P 
Sbjct  2310  SPTSPKYSPTSPKYSPTSPKYSPTSPKYSPTSPKYSPT----SPKYSPTSPVAQNIASPN  2365

Query  146   RDPITPTRDPVTPTPP  161
               P + T    +PT P
Sbjct  2366  YSPYSITSPKFSPTSP  2381


>Q9W4M4_DROME unnamed protein product
Length=1357

 Score = 43.9 bits (102),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 45/120 (38%), Positives = 51/120 (43%), Gaps = 27/120 (23%)

Query  84    KFTTPCPPATTTKCPCPTPTPCPP-TPTDFPV-TPTRDPVTPTRDPVT---PTRDPVT--  136
             K TT  P  + T+ P  +PT  P  +PT  P  TPT  P  PT +P T   PT  P T  
Sbjct  1218  KTTTVAPTQSPTESPTESPTGSPTDSPTQSPTETPTYGP--PTNEPPTNQPPTNQPPTVQ  1275

Query  137   -PTRDPVT---PTRDPIT---PTRDPVTPTPPNGTTTPCVGCEYGQPKTTLPPFIITPAP  189
              PT  P T   PT  P T   PT  P T  PP             QP T  PP    P+P
Sbjct  1276  PPTNQPPTNQPPTNQPPTNQPPTNQPPTNQPPT-----------NQPPTNEPPTNRPPSP  1324


 Score = 43.1 bits (100),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 42/108 (39%), Positives = 47/108 (44%), Gaps = 13/108 (12%)

Query  89    CPPATTTKCPCPTPTPCPP-TPTDFPV-TPTRDPV-TPTRDPVTPTRDPVTPTRDPVTPT  145
             C   TTT  P  +PT  P  +PT  P  +PT+ P  TPT  P  PT +P  PT  P  PT
Sbjct  1215  CSGKTTTVAPTQSPTESPTESPTGSPTDSPTQSPTETPTYGP--PTNEP--PTNQP--PT  1268

Query  146   RDPIT---PTRDPVTPTPPNGTTTPCVGCEYGQPKTTLPPFIITPAPE  190
               P T   PT  P T  PP     P       QP T  PP    P  E
Sbjct  1269  NQPPTVQPPTNQPPTNQPPT-NQPPTNQPPTNQPPTNQPPTNQPPTNE  1315


 Score = 42.0 bits (97),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 45/97 (46%), Gaps = 19/97 (20%)

Query  87    TPCPPATTTKCPCPTPTPCPPT---PTDFPVTPTRDPVT---PTRDPVT---PTRDPVT-  136
             T  P  + T+ P  TPT  PPT   PT+ P  PT  P T   PT  P T   PT  P T 
Sbjct  1237  TGSPTDSPTQSPTETPTYGPPTNEPPTNQP--PTNQPPTVQPPTNQPPTNQPPTNQPPTN  1294

Query  137   --PTRDPVT---PTRDPITPTRDPVTPTPPNGTTTPC  168
               PT  P T   PT  P  PT +P T  PP+ +   C
Sbjct  1295  QPPTNQPPTNQPPTNQP--PTNEPPTNRPPSPSPNNC  1329


>Q54LJ4_DICDI unnamed protein product
Length=2563

 Score = 34.7 bits (78),  Expect = 0.054, Method: Composition-based stats.
 Identities = 12/37 (32%), Positives = 21/37 (57%), Gaps = 0/37 (0%)

Query  113   PVTPTRDPVTPTRDPVTPTRDPVTPTRDPVTPTRDPI  149
             PV+P+  P +    P  P+  PV+P+  P  P++ P+
Sbjct  1903  PVSPSYTPTSLLYAPTIPSYSPVSPSYAPTKPSKLPV  1939


 Score = 30.8 bits (68),  Expect = 1.1, Method: Composition-based stats.
 Identities = 14/45 (31%), Positives = 25/45 (56%), Gaps = 1/45 (2%)

Query  92    ATTTKCPCP-TPTPCPPTPTDFPVTPTRDPVTPTRDPVTPTRDPV  135
             A+T++   P +P+  P +    P  P+  PV+P+  P  P++ PV
Sbjct  1895  ASTSQSYSPVSPSYTPTSLLYAPTIPSYSPVSPSYAPTKPSKLPV  1939



Lambda      K        H
   0.316    0.134    0.388 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4524418670


Query= XP_037024146.1 uncharacterized protein K02A2.6-like [Bradysia
coprophila]

Length=1384
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q580M0_TRYB2  unnamed protein product                                 37.0    0.15 
Q19370_CAEEL  unnamed protein product                                 33.5    1.6  
Q9XWG9_CAEEL  unnamed protein product                                 33.1    1.9  


>Q580M0_TRYB2 unnamed protein product
Length=866

 Score = 37.0 bits (84),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 25/90 (28%), Positives = 35/90 (39%), Gaps = 2/90 (2%)

Query  248  KSAKPVEQSNSHRINNQNSTKKVPYRPCWLCGEKHFVKECTYTKHLCRDCNKTGHKEGFC  307
            +  +PV  S S   N+  ++     R CW+C E     E   T  LCR     G     C
Sbjct  65   RGIEPVGPSGSQ--NDSTTSVVADARECWICREASDTPENRLTSGLCRCRGSIGLVHTGC  122

Query  308  NSAQPKKQNSSQTNSSDKRTKVIAVSKVDF  337
             +     Q   +  S +    VI+VS  DF
Sbjct  123  LNYWVFSQRRVRCPSCNATYNVISVSSEDF  152


>Q19370_CAEEL unnamed protein product
Length=1059

 Score = 33.5 bits (75),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 37/77 (48%), Gaps = 7/77 (9%)

Query  139  CMKLVKKSSDDFIAFASIVNKECERFEFANLTSDQFKCL-----IFICGLTSCEKEFRTR  193
            C + V+K S      A + + EC   EF    SDQ KCL     + +  L+  +  FR R
Sbjct  31   CSQDVRKHSQHKQEKAIVHDLECAAKEFRTKMSDQLKCLGDRTDVQMSSLSELQDYFRKR  90

Query  194  LLMKVESEAALTLDTLT  210
               ++ESE A  L+ L+
Sbjct  91   --GEIESEYACKLEKLS  105


>Q9XWG9_CAEEL unnamed protein product
Length=621

 Score = 33.1 bits (74),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 32/63 (51%), Gaps = 8/63 (13%)

Query  871  GAKKGIPVHSSSRLQRWAISLMSYDFVVEHKNTENFGHADALSRLIANHQ----SPLEPI  926
            G++KG PV   SRL R  + + S D  VE  N       +AL RL+A+      SP  P 
Sbjct  532  GSRKGHPVTIGSRLSRLELQMSSLDRKVESSNRT----LNALYRLMADRNSLTISPSPPA  587

Query  927  IIS  929
            +IS
Sbjct  588  LIS  590



Lambda      K        H
   0.316    0.134    0.388 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4524418670


Query= XP_037024147.1 arrestin domain-containing protein 17-like [Bradysia
coprophila]

Length=389
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ARD17_CAEEL  unnamed protein product                                  104     1e-24
Q9XXI4_CAEEL  unnamed protein product                                 103     2e-24
Q9VGU4_DROME  unnamed protein product                                 86.7    3e-18


>ARD17_CAEEL unnamed protein product
Length=426

 Score = 104 bits (260),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 92/315 (29%), Positives = 145/315 (46%), Gaps = 24/315 (8%)

Query  7    EISFPNNPSGVFYSGQMLNGLVALNLIKPKTVKGIYVKIIGRAYCRWTSGSGH------H  60
            EI F NNP   +++GQ ++G V +   +PK V  I +++ GRA   WT  SG       H
Sbjct  8    EILF-NNPEQAYFAGQEISGKVIIENKEPKKVNEILLELKGRARTYWTKHSGKSRKHCSH  66

Query  61   CKSHFGEEFYLNEKTYFVGDDDVLHLIVGEVILAPNQYNYTFSCVLPISLPTSVEGNIGY  120
             + +F E+F       F    D       E IL    +   FS  LP SLP+S EG  G+
Sbjct  67   SEPYFLEQFNPGYTHKFTVVKDGKE---KERILPAGIHQVPFSYTLPKSLPSSFEGEFGH  123

Query  121  IRYSVAVHIDKPLWPHQRFQECFTVIKALNLNDEIMLRCPLVKEERNTFFTCCSIFCCKS  180
            IRY+     ++P       ++ FTV+   ++N +  L  P    E N   T    FCC+S
Sbjct  124  IRYTCKAICERPWDFDIVSRKAFTVVGIEDINSDPKLNEPATCVESNHAVT----FCCRS  179

Query  181  -GSLVLRGSVPVRGYVPGQTIDILLEINNRSAQSVHNFFIQFVKYIQY--YTHANSTNTK  237
             GS+     +   GY PG+ ID+  ++ N S+++     ++FV+   Y   T A   + K
Sbjct  180  AGSVTGEIRISKCGYTPGEKIDVSFKVINLSSKT-RTTALRFVQQTTYKAKTFAGHEHIK  238

Query  238  CDKTIIKSTTCSGCPRNQTKTYV-LSITVPSVPPTESTSNIVRVSYRLQIQGSVGCFHED  296
                +I        P   T  +   SIT+PS+PP      I+ V+Y ++++       + 
Sbjct  239  NVVRVISKIDKGEVPGGSTTEWQEESITIPSLPPKLGKCKILSVTYSVELE-----VEQT  293

Query  297  PVLVFPLKIGTYPIL  311
              +  P+ IG+ P L
Sbjct  294  LTVPCPIVIGSIPQL  308


>Q9XXI4_CAEEL unnamed protein product
Length=419

 Score = 103 bits (258),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 100/395 (25%), Positives = 170/395 (43%), Gaps = 34/395 (9%)

Query  14   PSGVFYSGQMLNGLVALNLIKPKTVKGIYVKIIGRAYCRWTSGSGHHCKSHFGEEFYLNE  73
            P+ V++ GQ + G V +   +    + + + I G A+  W+     +  +  GE     E
Sbjct  11   PNDVYFPGQAVTGKVIIQNREWIKARFLKICIHGGAHTHWSESRSTYRTNTRGERERFTE  70

Query  74   K-------TYFVGDDDVLHLIVGEVILAPNQYNYTFSCVLPISLPTSVEGNIGYIRYSVA  126
                     Y  G+        G   L      + F+  LPI+   S EG  G+IRY V 
Sbjct  71   NVNYNATINYLTGESIAWQSRDGTDRLPAGTNVFPFAFNLPINCAPSFEGCHGHIRYDVH  130

Query  127  VHIDKPLWPHQRFQECFTVIKALNLNDEIMLRCPLVK-EERNTFFTCCSIFCCKSGSLVL  185
            V +D+P   +++ ++CF+VI   +LN       P+V    +NT          K G + +
Sbjct  131  VELDRPWKFNKKSRKCFSVIPVFDLNITPTAINPMVNTASKNTG------LILKKGLVTI  184

Query  186  RGSVPVRGYVPGQTIDILLEINNRSAQSVHNFFIQFVKYIQYY-THAN-------STNTK  237
              ++P RGYV G+ + I + I+N S  +V     +  +   ++ +H N       + N  
Sbjct  185  TVNLPKRGYVAGEIMPITVNIDNGSKVAVSEVSAKMTQLSHFHASHGNMIGVTAHTHNRN  244

Query  238  CDKTIIKSTTCSGCPRNQTKTYVLSITVPSVPPTESTSNIVRVSYRLQIQGSV-GCFHED  296
             +K + +S   +  P       VLS+ +P++ P+ +   I+ V Y L ++ S    F   
Sbjct  245  DEKLVAESRRVADVPAKSRGQMVLSMKIPAIVPSFNCP-IIAVDYCLTVKVSTQQIFGGG  303

Query  297  PVLVFPLKIGTYPILLCDSSQPPTESTTENYANQFESTTLLKSAA------SPNVPTENI  350
                FPL IGT PI   + + P    T  + +          SA+      +P+ P  + 
Sbjct  304  LKCEFPLIIGTIPIRQMNQAAPGAMPTMPSVSAPPYPVVAGASASQAVYPTAPSAPPASP  363

Query  351  DSIDPPTYEEAI--SGSVET--GFRPSYPVFRRSP  381
                PP+YEE++  +G VE    F P YPV+   P
Sbjct  364  GGEAPPSYEESVHGAGKVEDAEAFAPRYPVYNNLP  398


>Q9VGU4_DROME unnamed protein product
Length=520

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 65/313 (21%), Positives = 141/313 (45%), Gaps = 18/313 (6%)

Query  1    MKSTSCEISFPNNPSGVFYSGQMLNGLVALNLIKPKTVKGIYVKIIGRAYCRW------T  54
            M+S    I+  ++   V+++G ++ G + +N+ K   ++ I V++ G+  C+W       
Sbjct  1    MESERLRITL-DSADRVYFAGDIIRGEIWMNVNKRTKIRAIKVQVTGKGKCKWMEILRKN  59

Query  55   SGSGHHCKSHFGEEFYLNEKTYFVGDDDVLHLIVGEVILAPNQYNYTFSCVLPISLPTSV  114
            S +  + +S F    Y +++ Y   +  +       + L+  ++ + F   L   LP+S 
Sbjct  60   SNNNEYSRSLF----YTSKEVYEHSETPLPDFEPRGLELSAGEHTFIFEVALGRQLPSSF  115

Query  115  EGNIGYIRYSVAVHIDKPLWPHQRFQECFTVIKALNLNDEIMLRCPLVKEERNTFFTCCS  174
            +G+ G I+Y + V I +P    +R    FTV+K + L   +    P   E++ T     S
Sbjct  116  KGSYGAIKYKMRVLIQRPWTFDERHTIPFTVVKNMPLQP-MQRSIPSSLEKQVT--KTIS  172

Query  175  IFCCKSGSLVLRGSVPVRGYVPGQTIDILLEINNRSAQSVHNFFIQFVKYIQYYTHANST  234
            +F  +   + L   +P    V G+ + I   + N S  +V       ++Y+ YY+H    
Sbjct  173  LFGTR--PITLLALLPEDFAVRGEPLRICATVINNSTTAVEKLRFTVLQYVTYYSHVPLR  230

Query  235  NTKCDKTIIKSTTCSGCPRNQTKTYVLSITVP--SVPPTESTSNIVRVSYRLQIQGSVGC  292
              K +   + +       +   +++   + +P  + P  E  S ++ + Y L+++  +  
Sbjct  231  VQKVECIAVATKETGSVQKKTERSFAHELLLPDGAQPTDEQMSGVITIVYELRVEAVLRG  290

Query  293  FHEDPVLVFPLKI  305
            F ++ +L  P K+
Sbjct  291  FFKNLILNLPFKV  303



Lambda      K        H
   0.316    0.134    0.388 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4524418670


Query= XP_037024148.1 uncharacterized protein LOC119066035 [Bradysia
coprophila]

Length=444
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

G5EDD3_CAEEL  unnamed protein product                                 32.0    1.4  
G5EFM4_CAEEL  unnamed protein product                                 32.0    1.4  
Q585K9_TRYB2  unnamed protein product                                 30.4    3.2  


>G5EDD3_CAEEL unnamed protein product
Length=4955

 Score = 32.0 bits (71),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 25/42 (60%), Gaps = 2/42 (5%)

Query  81    AYSRKDVVSAHNAPALLRHFGQLAESVELRLVGNQQRGDEIF  122
             A  RKD+VS   A  L++ FG   +++E RL G+Q   DE+ 
Sbjct  2440  ARDRKDLVS--KAGDLVKQFGDQVQALEQRLQGDQAELDELL  2479


>G5EFM4_CAEEL unnamed protein product
Length=4944

 Score = 32.0 bits (71),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 25/42 (60%), Gaps = 2/42 (5%)

Query  81    AYSRKDVVSAHNAPALLRHFGQLAESVELRLVGNQQRGDEIF  122
             A  RKD+VS   A  L++ FG   +++E RL G+Q   DE+ 
Sbjct  2440  ARDRKDLVS--KAGDLVKQFGDQVQALEQRLQGDQAELDELL  2479


>Q585K9_TRYB2 unnamed protein product
Length=776

 Score = 30.4 bits (67),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 1/41 (2%)

Query  193  PWFVRNYPHLESVYLNTTEICYDTLTVFLAFNQQLPELDVH  233
            P+  RN  H  SV+L+  ++C+ T    +A  Q  PE DVH
Sbjct  640  PYEFRNGSHTRSVFLSLGDLCHITALDLVA-QQLTPEADVH  679



Lambda      K        H
   0.316    0.134    0.388 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4524418670


Query= XP_037024149.1 odorant receptor 33a-like [Bradysia coprophila]

Length=220
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

OR94B_DROME  unnamed protein product                                  49.3    6e-07
OR33A_DROME  unnamed protein product                                  48.5    1e-06
OR59A_DROME  unnamed protein product                                  47.4    3e-06


>OR94B_DROME unnamed protein product
Length=383

 Score = 49.3 bits (116),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 35/168 (21%), Positives = 70/168 (42%), Gaps = 3/168 (2%)

Query  47   DANRPDETEWSKVKERDVSKLSYTFLSAGHVADTLACFKPFSRTNPEMPLVCWYPLDWEN  106
            +    +E ++ +  +R+  ++ Y ++        +     F + + E+P   + P +W  
Sbjct  111  NLRNSEEIKFWQQNQRNFKRIFYWYIWGSLFVAVMGYISVFFQEDYELPFGYYVPFEWRT  170

Query  107  DATSFWIVYPYSVICAFVIMELNITLDCFSYYLMNTLATEVLIIGRRLEELGTNAIGDDI  166
                F+  + Y+V+   +    NI LD    Y M  +A+   ++G RLE L   A  ++ 
Sbjct  171  RERYFY-AWGYNVVAMTLCCLSNILLDTLGCYFMFHIASLFRLLGMRLEALKNAA--EEK  227

Query  167  ELEKLVACIKRHQHAMDLIHEMENFLSIQFFAQICLSGTVFCTGVYQL  214
               +L    + H     L  E E  +S    +Q+  S  + C   Y+L
Sbjct  228  ARPELRRIFQLHTKVRRLTRECEVLVSPYVLSQVVFSAFIICFSAYRL  275


>OR33A_DROME unnamed protein product
Length=378

 Score = 48.5 bits (114),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/166 (22%), Positives = 71/166 (43%), Gaps = 6/166 (4%)

Query  45   LQDANRPDETE-----WSKVKERDVSKLSYTFLSAGHVADTLACFKPFSRTNPEMPLVCW  99
            LQD +   E+E     +++   R    LS ++L A   A   A       T   +  + W
Sbjct  97   LQDLDSRVESEEERNYFNQNPSRVARMLSKSYLVAAISAIITATVAGLFSTGRNLMYLGW  156

Query  100  YPLDWENDATSFWIVYPYSVICAFVIMELNITLDCFSYYLMNTLATEVLIIGRRLEELGT  159
            +P D++  A  +WI + Y  I + +++  N+  D +       ++  V ++  RL  +G 
Sbjct  157  FPYDFQATAAIYWISFSYQAIGSSLLILENLANDSYPPITFCVVSGHVRLLIMRLSRIGH  216

Query  160  NA-IGDDIELEKLVACIKRHQHAMDLIHEMENFLSIQFFAQICLSG  204
            +  +       KL+  I+ H+  M +I  + + L +    Q   SG
Sbjct  217  DVKLSSSENTRKLIEGIQDHRKLMKIIRLLRSTLHLSQLGQFLSSG  262


>OR59A_DROME unnamed protein product
Length=397

 Score = 47.4 bits (111),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/134 (22%), Positives = 57/134 (43%), Gaps = 20/134 (15%)

Query  99   WYPLDWENDATSFWIVYPYSVICAFVIMELNITLDCFSYYLMNTLATEVLIIGRRLEELG  158
            W+P DW +   +++I   Y ++     +  N   DCF   ++  +++ + ++  R EE+G
Sbjct  160  WFPFDWLHSTRNYYIANAYQIVGISFQLLQNYVSDCFPAVVLCLISSHIKMLYNRFEEVG  219

Query  159  TNAIGDDIELEKLVACIKRHQHAMD------------------LIHEMENFLSIQFFAQI  200
             +   D    + L ACI  H+H ++                  L   +E F+S+    Q 
Sbjct  220  LDPARD--AEKDLEACITDHKHILEWAGGSLVRVLFTFQLFSRLFRRIEAFISLPMLIQF  277

Query  201  CLSGTVFCTGVYQL  214
             ++    C G+  L
Sbjct  278  TVTALNVCIGLAAL  291



Lambda      K        H
   0.316    0.134    0.388 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4524418670


Query= XP_037024150.1 gustatory receptor for sugar taste 64a-like [Bradysia
coprophila]

Length=436
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GR64A_DROME  unnamed protein product                                  286     4e-92
GR61A_DROME  unnamed protein product                                  234     2e-72
GR64F_DROME  unnamed protein product                                  218     9e-66


>GR64A_DROME unnamed protein product
Length=456

 Score = 286 bits (731),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 154/393 (39%), Positives = 244/393 (62%), Gaps = 21/393 (5%)

Query  51   FFKSVWPAVIYFAQFMGFMPVQGIRTGDPFKFEFRWKTFRVMITMLYVVLGVSLGTMYLR  110
            F ++V+P  ++ AQ +  MP+ GIR  +P +  F +K+  + +T+++++    L      
Sbjct  59   FHRAVFP-FMFLAQCVAIMPLVGIRESNPRRVRFAYKSIPMFVTLIFMIATSILFLSMFT  117

Query  111  RIARIGINAKNIAGFVFYSVCVSIGLLFLILAQKWKNLAMKWHQREKIFLNLPYKECGWS  170
             + +IGI AKN  G VF+   +S  ++F+ LA+KW  +   W + E  F   PY+    +
Sbjct  118  HLLKIGITAKNFVGLVFFGCVLSAYVVFIRLAKKWPAVVRIWTRTEIPFTKPPYEIPKRN  177

Query  171  LSTKIRITAGVILFLAI-----------------VRTCEANVD--DAWKYFFLNEHPHVF  211
            LS ++++ A  I+ L++                 ++ C AN+    ++  +    + +VF
Sbjct  178  LSRRVQLAALAIIGLSLGEHALYQVSAILSYTRRIQMC-ANITTVPSFNNYMQTNYDYVF  236

Query  212  MVVPYHFLLTILIEWAIISFTFGWNYIDTFIMITSIALATRFKQINQRLEEIKNEPMVES  271
             ++PY  ++ +LI     + TF WNY+D FIM+ S  L+ RF+QI  R+ ++++E + ES
Sbjct  237  QLLPYSPIIAVLILLINGACTFVWNYMDLFIMMISKGLSYRFEQITTRIRKLEHEEVCES  296

Query  272  SWAEIRHHHVLLCELVETVDNYLVVIIILCYANDLYYVCFELLNIFNKLPHFINFIYFWY  331
             + +IR H+V +CEL+E VD+ +  +I+L   N+LY+VC++LLN+FNKL   IN+IYFWY
Sbjct  297  VFIQIREHYVKMCELLEFVDSAMSSLILLSCVNNLYFVCYQLLNVFNKLRWPINYIYFWY  356

Query  332  SFLYLVGRTTGVFLIAASINDAATYPIKFVRRRHTTEWCAELERFGDQISTRAVALSGLK  391
            S LYL+GRT  VFL AA IN+ +   +  +RR  +  WC E+ER   Q++T+ VALSG K
Sbjct  357  SLLYLIGRTAFVFLTAADINEESKRGLGVLRRVSSRSWCVEVERLIFQMTTQTVALSGKK  416

Query  392  FFFITRSLLFGMAGTIVTYELVLLQFDESSEKK  424
            F+F+TR LLFGMAGTIVTYELVLLQFDE + +K
Sbjct  417  FYFLTRRLLFGMAGTIVTYELVLLQFDEPNRRK  449


>GR61A_DROME unnamed protein product
Length=436

 Score = 234 bits (598),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 131/393 (33%), Positives = 217/393 (55%), Gaps = 19/393 (5%)

Query  49   ESFFKSVWPAVIYFAQFMGFMPVQGIRTGDPFKFEFRWKTFRVMITMLYVVLGVSLGTMY  108
            ++F+ ++ P +   AQF G MP+  IR+ DP   +F+ ++  + +T L+++LG     + 
Sbjct  40   DTFYGAIRPYLC-VAQFFGIMPLSNIRSRDPQDVKFKVRSIGLAVTGLFLLLGGMKTLVG  98

Query  109  LRRIARIGINAKNIAGFVFYSVCVSIGLLFLILAQKWKNLAMKWHQREKIFLNLPYKECG  168
               +   G+NAKNI G VF  V +   L F+  A+ W ++ + W   + + L  PYK   
Sbjct  99   ANILFTEGLNAKNIVGLVFLIVGMVNWLNFVGFARSWSHIMLPWSSVDILMLFPPYKRGK  158

Query  169  WSLSTKIRITAGVILFLAI-----------------VRTCEANVDD-AWKYFFLNEHPHV  210
             SL +K+ + A  ++ LA+                 +  C  N     +  +   E   +
Sbjct  159  RSLRSKVNVLALSVVVLAVGDHMLYYASGYCSYSMHILQCHTNHSRITFGLYLEKEFSDI  218

Query  211  FMVVPYHFLLTILIEWAIISFTFGWNYIDTFIMITSIALATRFKQINQRLEEIKNEPMVE  270
              ++P++        W   +FTF WN++D FI++TSI LA RF+Q   R+  ++   + E
Sbjct  219  MFIMPFNIFSMCYGFWLNGAFTFLWNFMDIFIVMTSIGLAQRFQQFAARVGALEGRHVPE  278

Query  271  SSWAEIRHHHVLLCELVETVDNYLVVIIILCYANDLYYVCFELLNIFNKLPHFINFIYFW  330
            + W +IR  H+ LCEL   V+  +  I+ +  AN++Y +C + L IF KL H IN++YFW
Sbjct  279  ALWYDIRRDHIRLCELASLVEASMSNIVFVSCANNVYVICNQALAIFTKLRHPINYVYFW  338

Query  331  YSFLYLVGRTTGVFLIAASINDAATYPIKFVRRRHTTEWCAELERFGDQISTRAVALSGL  390
            YS ++L+ RT+ VF+ A+ I+DA+  P++ +    +  W  E++RF DQ+++  V LSG 
Sbjct  339  YSLIFLLARTSLVFMTASKIHDASLLPLRSLYLVPSDGWTQEVQRFADQLTSEFVGLSGY  398

Query  391  KFFFITRSLLFGMAGTIVTYELVLLQFDESSEK  423
            + F +TR  LFGM  T+VTYEL+LLQ D  S K
Sbjct  399  RLFCLTRKSLFGMLATLVTYELMLLQIDAKSHK  431


>GR64F_DROME unnamed protein product
Length=469

 Score = 218 bits (555),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 120/390 (31%), Positives = 213/390 (55%), Gaps = 15/390 (4%)

Query  46   MRNESFFKSVWPAVIYFAQFMGFMPVQGIRTGDPFKFEFRWKTFRVMITMLYVVLGVSLG  105
            + + SF ++V   V+  A+F   MPV+G+    P    F W+  R   ++L++   ++  
Sbjct  72   LSDGSFHQAV-GRVLLVAEFFAMMPVKGVTGKHPSDLSFSWRNIRTCFSLLFIASSLANF  130

Query  106  TMYLRRIARIGINAKNIAGFVFYSVCVSIGLLFLILAQKWKNLAMKWHQREKIFLNLPYK  165
             + L ++    I+  +I   +F    + + ++ L LA++W  L M WH  EK       +
Sbjct  131  GLSLFKVLNNPISFNSIKPIIFRGSVLLVLIVALNLARQWPQLMMYWHTVEKDLPQYKTQ  190

Query  166  ECGWSLSTKIRITA--GVIL-----FLAIVRT------CEANVDDAWKYFFLNEHPHVFM  212
               W +   I +    G++L      L++V        C    D    YF L  +  +F 
Sbjct  191  LTKWKMGHTISMVMLLGMMLSFAEHILSMVSAINYASFCNRTADPIQNYF-LRTNDEIFF  249

Query  213  VVPYHFLLTILIEWAIISFTFGWNYIDTFIMITSIALATRFKQINQRLEEIKNEPMVESS  272
            V  Y   L +  ++  +  TF WNY+D F+MI SI LA++F+Q+N  L   K   M  S 
Sbjct  250  VTSYSTTLALWGKFQNVFSTFIWNYMDLFVMIVSIGLASKFRQLNDDLRNFKGMNMAPSY  309

Query  273  WAEIRHHHVLLCELVETVDNYLVVIIILCYANDLYYVCFELLNIFNKLPHFINFIYFWYS  332
            W+E R  +  +C L + +D+ + +I ++ ++N+LY++C +LL   N +P   + +YF++S
Sbjct  310  WSERRIQYRNICILCDKMDDAISLITMVSFSNNLYFICVQLLRSLNTMPSVAHAVYFYFS  369

Query  333  FLYLVGRTTGVFLIAASINDAATYPIKFVRRRHTTEWCAELERFGDQISTRAVALSGLKF  392
             ++L+GRT  V L ++S++D +   ++++R      WC E++RF +++ +  VAL+G+KF
Sbjct  370  LIFLIGRTLAVSLYSSSVHDESRLTLRYLRCVPKESWCPEVKRFTEEVISDEVALTGMKF  429

Query  393  FFITRSLLFGMAGTIVTYELVLLQFDESSE  422
            F +TR L+  +AGTIVTYELVL+QF E ++
Sbjct  430  FHLTRKLVLSVAGTIVTYELVLIQFHEDND  459



Lambda      K        H
   0.316    0.134    0.388 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4524418670


Query= XP_037024151.1 histone H2A-beta, sperm-like [Bradysia coprophila]

Length=145
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

C6KT18_PLAF7  unnamed protein product                                 117     2e-34
H2A_DROME  unnamed protein product                                    110     4e-32
H2A_PENVA  unnamed protein product                                    109     1e-31


>C6KT18_PLAF7 unnamed protein product
Length=132

 Score = 117 bits (292),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 75/115 (65%), Gaps = 0/115 (0%)

Query  14   KPKEKRVTQSERAVLAFPVGRINRKLSDGNFAKRIGKGSAVYLTAVCEYLVAELLDVAID  73
            K   K  + S +A L FPVGRI R L  G +AKR+G G+ VYL AV EYL AE+L++A +
Sbjct  10   KKASKGTSNSAKAGLQFPVGRIGRYLKKGKYAKRVGAGAPVYLAAVLEYLCAEILELAGN  69

Query  74   EARKKKRMRINPRHITLGVRNDAELSQLLKYVTFSEGGVQPFVHEDLKHRISPLR  128
             AR  K+ RI PRHI L VRND EL++ L  VTF+ GGV P +H  L  + S L+
Sbjct  70   AARDNKKSRITPRHIQLAVRNDEELNKFLAGVTFASGGVLPNIHNVLLPKKSQLK  124


>H2A_DROME unnamed protein product
Length=124

 Score = 110 bits (276),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 79/117 (68%), Gaps = 8/117 (7%)

Query  21   TQSERAVLAFPVGRINRKLSDGNFAKRIGKGSAVYLTAVCEYLVAELLDVAIDEARKKKR  80
            ++S RA L FPVGRI+R L  GN+A+R+G G+ VYL AV EYL AE+L++A + AR  K+
Sbjct  16   SRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKK  75

Query  81   MRINPRHITLGVRNDAELSQLLKYVTFSEGGVQPFVHEDLKHRISPLRLSKKSLKKS  137
             RI PRH+ L +RND EL++LL  VT ++GGV P +   L        L KK+ KK+
Sbjct  76   TRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVL--------LPKKTEKKA  124


>H2A_PENVA unnamed protein product
Length=123

 Score = 109 bits (273),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 71/99 (72%), Gaps = 0/99 (0%)

Query  22   QSERAVLAFPVGRINRKLSDGNFAKRIGKGSAVYLTAVCEYLVAELLDVAIDEARKKKRM  81
            +S RA L FPVGRI+R L  GN+A+R+G G+ VYL AV EYL AE+L++A + AR  K+ 
Sbjct  17   RSSRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKT  76

Query  82   RINPRHITLGVRNDAELSQLLKYVTFSEGGVQPFVHEDL  120
            RI PRH+ L +RND EL++LL  VT ++GGV P +   L
Sbjct  77   RIVPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVL  115



Lambda      K        H
   0.316    0.134    0.388 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4524418670


Query= XP_037024152.1 protein outspread isoform X1 [Bradysia coprophila]

Length=2061
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VXU2_DROME  unnamed protein product                                 32.0    7.1  


>Q9VXU2_DROME unnamed protein product
Length=1398

 Score = 32.0 bits (71),  Expect = 7.1, Method: Compositional matrix adjust.
 Identities = 98/385 (25%), Positives = 168/385 (44%), Gaps = 65/385 (17%)

Query  1635  EEELNEITKKLE------KQEIECHL--------RDDENFELVETLEEE----RQRTAIA  1676
             E +L E  +KLE      +Q++E HL         D E    +E  E+E    +++ A A
Sbjct  608   EAQLEEARQKLELASLSSQQQMETHLISSPEKTPVDSELLAKMEQKEQEYLQLQEQLAFA  667

Query  1677  T---DESKKLLEQNKAQTDAYNALLQERDYVLDQLEKERERVRKLEKRLELLQEEQSQQI  1733
                 D+  KLLE+N  Q        Q     L++L + RE +++ ++ L+ L+E+ S   
Sbjct  668   KTELDKRNKLLERNGEQLTKQQQQNQADQKKLEELSQLRETLQRRDEDLKELEEQLSAVR  727

Query  1734  ESLHAAYREQQMSMDNVNHEKDEEASFKLRYQTEIEQLRTLC--------EKGLVAMESS  1785
             + L     + ++S D     K + A+ + + Q + E+LR L         +K L+ ++ +
Sbjct  728   QDLDEKSIQMKISQD---QHKLQLANLQNQLQADQEKLRELLQLQDKLEQQKELMEVDQN  784

Query  1786  HRRII--NDLEEKHRQ--EIQRLLCEKEQALAEETQATLAALDAMRKAHQNEVQREIARF  1841
              +  I   +L E   Q  E Q  L  KE  LAE  Q               EV  E  R 
Sbjct  785   QQITIIKKELAETTNQLSECQERLTVKEAQLAEIQQQL------------QEVNEERTRL  832

Query  1842  KAEFVRQFQKGGQPSEAYKGNEEELDEVREEILSLSEKYSIKCVEAASLEEKCRLATHQL  1901
             + + + + Q+ G  SE  K N+    E+ +++L+  ++  +   E   L+E  R+   QL
Sbjct  833   QEQLLTKEQESGLDSELAKRNQ----ELEDQLLAKEQQLQLNQAELEKLQETLRVNEEQL  888

Query  1902  --KHFQQHVQ--QLETRNKQLRAHLASEESDYSH------GPSSKESTPSCKQEHVDDAQ  1951
               K  Q H +  QL++   QL+  LA++ES          G    E     +Q+H ++ Q
Sbjct  889   LAKEEQLHAKESQLQSLESQLQGQLAADESQQLQQTIDGLGQEKNELIKVLQQKHQENTQ  948

Query  1952  TSFEIEETSKENSFSQHSKKEIHPR  1976
                EI+   +   F Q  K+ +  R
Sbjct  949   YYAEIQ---RLQPFEQQVKELVKER  970



Lambda      K        H
   0.316    0.134    0.388 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4524418670


Query= XP_037024153.1 endoglucanase-like isoform X2 [Bradysia coprophila]

Length=212
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O77375_PLAF7  unnamed protein product                                 47.4    4e-06
Q9W4M4_DROME  unnamed protein product                                 43.9    5e-05
Q54LJ4_DICDI  unnamed protein product                                 34.7    0.053


>O77375_PLAF7 unnamed protein product
Length=2457

 Score = 47.4 bits (111),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/86 (28%), Positives = 36/86 (42%), Gaps = 5/86 (6%)

Query  99    TPTPCPPTPTDFPVTPTRDPVTPTRDPVTPTRDPVTPTRDPVTPTRDPITPTRDPVTPTP  158
             +P   P +P   P +P   P +P   P +P   P +P   P +P   P +P     +PT 
Sbjct  2292  SPKYSPTSPKYSPTSPKYSPTSPKYSPTSPKYSPTSPKYSPTSPKYSPTSPK---YSPTS  2348

Query  159   PNGTTTPCVGCEYGQPKTTLPPFIIT  184
             P  + T  V      P  +  P+ IT
Sbjct  2349  PKYSPTSPVAQNIASPNYS--PYSIT  2372


 Score = 46.6 bits (109),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 21/75 (28%), Positives = 32/75 (43%), Gaps = 3/75 (4%)

Query  85    TPCPPATTTKCPCPTPTPCPPTPTDFPVTPTRDPVTPTRDPVTPTRDPVTPTRDPVTPTR  144
             +P    T+ K    +P   P +P   P +P   P +P   P +P   P +P   P +P  
Sbjct  2285  SPVYSVTSPKYSPTSPKYSPTSPKYSPTSPKYSPTSPKYSPTSPKYSPTSPKYSPTSPKY  2344

Query  145   DPITPTRDPVTPTPP  159
              P +P     +PT P
Sbjct  2345  SPTSPK---YSPTSP  2356


 Score = 37.0 bits (84),  Expect = 0.011, Method: Composition-based stats.
 Identities = 16/59 (27%), Positives = 25/59 (42%), Gaps = 3/59 (5%)

Query  106   TPTDFPVTPTRDPVTPTRDPVTPTRDPVTPTRDPVTPTRDPITPTRDPVTPTPPNGTTT  164
             +P     +P   P +P   P +P   P +P   P +P   P +P     +PT P  + T
Sbjct  2285  SPVYSVTSPKYSPTSPKYSPTSPKYSPTSPKYSPTSPKYSPTSPK---YSPTSPKYSPT  2340


 Score = 33.9 bits (76),  Expect = 0.11, Method: Composition-based stats.
 Identities = 20/76 (26%), Positives = 33/76 (43%), Gaps = 5/76 (7%)

Query  85    TPCPPATTTKCPCPTPTPCPPTPTDFPVTPTRDPVTPTRDPVTPTRDPVTP-TRDPVTPT  143
             +P  P  +   P  +PT    +PT    +PT    +PT    +P   P +P  ++  +P 
Sbjct  2310  SPTSPKYSPTSPKYSPTSPKYSPTSPKYSPTSPKYSPT----SPKYSPTSPVAQNIASPN  2365

Query  144   RDPITPTRDPVTPTPP  159
               P + T    +PT P
Sbjct  2366  YSPYSITSPKFSPTSP  2381


>Q9W4M4_DROME unnamed protein product
Length=1357

 Score = 43.9 bits (102),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 45/120 (38%), Positives = 51/120 (43%), Gaps = 27/120 (23%)

Query  82    KFTTPCPPATTTKCPCPTPTPCPP-TPTDFPV-TPTRDPVTPTRDPVT---PTRDPVT--  134
             K TT  P  + T+ P  +PT  P  +PT  P  TPT  P  PT +P T   PT  P T  
Sbjct  1218  KTTTVAPTQSPTESPTESPTGSPTDSPTQSPTETPTYGP--PTNEPPTNQPPTNQPPTVQ  1275

Query  135   -PTRDPVT---PTRDPIT---PTRDPVTPTPPNGTTTPCVGCEYGQPKTTLPPFIITPAP  187
              PT  P T   PT  P T   PT  P T  PP             QP T  PP    P+P
Sbjct  1276  PPTNQPPTNQPPTNQPPTNQPPTNQPPTNQPPT-----------NQPPTNEPPTNRPPSP  1324


 Score = 43.1 bits (100),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 42/108 (39%), Positives = 47/108 (44%), Gaps = 13/108 (12%)

Query  87    CPPATTTKCPCPTPTPCPP-TPTDFPV-TPTRDPV-TPTRDPVTPTRDPVTPTRDPVTPT  143
             C   TTT  P  +PT  P  +PT  P  +PT+ P  TPT  P  PT +P  PT  P  PT
Sbjct  1215  CSGKTTTVAPTQSPTESPTESPTGSPTDSPTQSPTETPTYGP--PTNEP--PTNQP--PT  1268

Query  144   RDPIT---PTRDPVTPTPPNGTTTPCVGCEYGQPKTTLPPFIITPAPE  188
               P T   PT  P T  PP     P       QP T  PP    P  E
Sbjct  1269  NQPPTVQPPTNQPPTNQPPT-NQPPTNQPPTNQPPTNQPPTNQPPTNE  1315


 Score = 42.0 bits (97),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 45/97 (46%), Gaps = 19/97 (20%)

Query  85    TPCPPATTTKCPCPTPTPCPPT---PTDFPVTPTRDPVT---PTRDPVT---PTRDPVT-  134
             T  P  + T+ P  TPT  PPT   PT+ P  PT  P T   PT  P T   PT  P T 
Sbjct  1237  TGSPTDSPTQSPTETPTYGPPTNEPPTNQP--PTNQPPTVQPPTNQPPTNQPPTNQPPTN  1294

Query  135   --PTRDPVT---PTRDPITPTRDPVTPTPPNGTTTPC  166
               PT  P T   PT  P  PT +P T  PP+ +   C
Sbjct  1295  QPPTNQPPTNQPPTNQP--PTNEPPTNRPPSPSPNNC  1329


>Q54LJ4_DICDI unnamed protein product
Length=2563

 Score = 34.7 bits (78),  Expect = 0.053, Method: Composition-based stats.
 Identities = 12/37 (32%), Positives = 21/37 (57%), Gaps = 0/37 (0%)

Query  111   PVTPTRDPVTPTRDPVTPTRDPVTPTRDPVTPTRDPI  147
             PV+P+  P +    P  P+  PV+P+  P  P++ P+
Sbjct  1903  PVSPSYTPTSLLYAPTIPSYSPVSPSYAPTKPSKLPV  1939


 Score = 30.8 bits (68),  Expect = 1.1, Method: Composition-based stats.
 Identities = 14/45 (31%), Positives = 25/45 (56%), Gaps = 1/45 (2%)

Query  90    ATTTKCPCP-TPTPCPPTPTDFPVTPTRDPVTPTRDPVTPTRDPV  133
             A+T++   P +P+  P +    P  P+  PV+P+  P  P++ PV
Sbjct  1895  ASTSQSYSPVSPSYTPTSLLYAPTIPSYSPVSPSYAPTKPSKLPV  1939



Lambda      K        H
   0.316    0.134    0.388 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4524418670


Query= XP_037024154.1 protein outspread isoform X2 [Bradysia coprophila]

Length=2042
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VXU2_DROME  unnamed protein product                                 32.0    7.7  


>Q9VXU2_DROME unnamed protein product
Length=1398

 Score = 32.0 bits (71),  Expect = 7.7, Method: Compositional matrix adjust.
 Identities = 97/385 (25%), Positives = 169/385 (44%), Gaps = 65/385 (17%)

Query  1616  EEELNEITKKLE------KQEIECHL-----RDDENFELVETLEEERQ-------RTAIA  1657
             E +L E  +KLE      +Q++E HL     +   + EL+  +E++ Q       + A A
Sbjct  608   EAQLEEARQKLELASLSSQQQMETHLISSPEKTPVDSELLAKMEQKEQEYLQLQEQLAFA  667

Query  1658  T---DESKKLLEQNKAQTDAYNALLQERDYVLDQLEKERERVRKLEKRLELLQEEQSQQI  1714
                 D+  KLLE+N  Q        Q     L++L + RE +++ ++ L+ L+E+ S   
Sbjct  668   KTELDKRNKLLERNGEQLTKQQQQNQADQKKLEELSQLRETLQRRDEDLKELEEQLSAVR  727

Query  1715  ESLHAAYREQQMSMDNVNHEKDEEASFKLRYQTEIEQLRTLC--------EKGLVAMESS  1766
             + L     + ++S D     K + A+ + + Q + E+LR L         +K L+ ++ +
Sbjct  728   QDLDEKSIQMKISQD---QHKLQLANLQNQLQADQEKLRELLQLQDKLEQQKELMEVDQN  784

Query  1767  HRRII--NDLEEKHRQ--EIQRLLCEKEQALAEETQATLAALDAMRKAHQNEVQREIARF  1822
              +  I   +L E   Q  E Q  L  KE  LAE  Q               EV  E  R 
Sbjct  785   QQITIIKKELAETTNQLSECQERLTVKEAQLAEIQQQL------------QEVNEERTRL  832

Query  1823  KAEFVRQFQKGGQPSEAYKGNEEELDEVREEILSLSEKYSIKCVEAASLEEKCRLATHQL  1882
             + + + + Q+ G  SE  K N+    E+ +++L+  ++  +   E   L+E  R+   QL
Sbjct  833   QEQLLTKEQESGLDSELAKRNQ----ELEDQLLAKEQQLQLNQAELEKLQETLRVNEEQL  888

Query  1883  --KHFQQHVQ--QLETRNKQLRAHLASEESDYSH------GPSSKESTPSCKQEHVDDAQ  1932
               K  Q H +  QL++   QL+  LA++ES          G    E     +Q+H ++ Q
Sbjct  889   LAKEEQLHAKESQLQSLESQLQGQLAADESQQLQQTIDGLGQEKNELIKVLQQKHQENTQ  948

Query  1933  TSFEIEETSKENSFSQHSKKEIHPR  1957
                EI+   +   F Q  K+ +  R
Sbjct  949   YYAEIQ---RLQPFEQQVKELVKER  970



Lambda      K        H
   0.316    0.134    0.388 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4524418670


Query= XP_037024155.1 protein outspread isoform X3 [Bradysia coprophila]

Length=2021
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VXU2_DROME  unnamed protein product                                 31.6    9.1  


>Q9VXU2_DROME unnamed protein product
Length=1398

 Score = 31.6 bits (70),  Expect = 9.1, Method: Compositional matrix adjust.
 Identities = 98/385 (25%), Positives = 168/385 (44%), Gaps = 65/385 (17%)

Query  1595  EEELNEITKKLE------KQEIECHL--------RDDENFELVETLEEE----RQRTAIA  1636
             E +L E  +KLE      +Q++E HL         D E    +E  E+E    +++ A A
Sbjct  608   EAQLEEARQKLELASLSSQQQMETHLISSPEKTPVDSELLAKMEQKEQEYLQLQEQLAFA  667

Query  1637  T---DESKKLLEQNKAQTDAYNALLQERDYVLDQLEKERERVRKLEKRLELLQEEQSQQI  1693
                 D+  KLLE+N  Q        Q     L++L + RE +++ ++ L+ L+E+ S   
Sbjct  668   KTELDKRNKLLERNGEQLTKQQQQNQADQKKLEELSQLRETLQRRDEDLKELEEQLSAVR  727

Query  1694  ESLHAAYREQQMSMDNVNHEKDEEASFKLRYQTEIEQLRTLC--------EKGLVAMESS  1745
             + L     + ++S D     K + A+ + + Q + E+LR L         +K L+ ++ +
Sbjct  728   QDLDEKSIQMKISQD---QHKLQLANLQNQLQADQEKLRELLQLQDKLEQQKELMEVDQN  784

Query  1746  HRRII--NDLEEKHRQ--EIQRLLCEKEQALAEETQATLAALDAMRKAHQNEVQREIARF  1801
              +  I   +L E   Q  E Q  L  KE  LAE  Q               EV  E  R 
Sbjct  785   QQITIIKKELAETTNQLSECQERLTVKEAQLAEIQQQL------------QEVNEERTRL  832

Query  1802  KAEFVRQFQKGGQPSEAYKGNEEELDEVREEILSLSEKYSIKCVEAASLEEKCRLATHQL  1861
             + + + + Q+ G  SE  K N+    E+ +++L+  ++  +   E   L+E  R+   QL
Sbjct  833   QEQLLTKEQESGLDSELAKRNQ----ELEDQLLAKEQQLQLNQAELEKLQETLRVNEEQL  888

Query  1862  --KHFQQHVQ--QLETRNKQLRAHLASEESDYSH------GPSSKESTPSCKQEHVDDAQ  1911
               K  Q H +  QL++   QL+  LA++ES          G    E     +Q+H ++ Q
Sbjct  889   LAKEEQLHAKESQLQSLESQLQGQLAADESQQLQQTIDGLGQEKNELIKVLQQKHQENTQ  948

Query  1912  TSFEIEETSKENSFSQHSKKEIHPR  1936
                EI+   +   F Q  K+ +  R
Sbjct  949   YYAEIQ---RLQPFEQQVKELVKER  970



Lambda      K        H
   0.316    0.134    0.388 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4524418670


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jul 7, 2021  1:54 PM
  Number of letters in database: 17,197,330
  Number of sequences in database:  25,232



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= XP_037024156.1 protein outspread isoform X4 [Bradysia coprophila]

Length=1946


***** No hits found *****



Lambda      K        H
   0.312    0.126    0.348 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 26054445194


Query= XP_037024157.1 apoptosis-resistant E3 ubiquitin protein ligase 1
isoform X1 [Bradysia coprophila]

Length=962
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8T3L0_DROME  unnamed protein product                                 226     3e-61
Q9GUP2_CAEEL  unnamed protein product                                 228     4e-61
U4PBY0_CAEEL  unnamed protein product                                 227     1e-60


>Q8T3L0_DROME unnamed protein product
Length=964

 Score = 226 bits (576),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 134/395 (34%), Positives = 214/395 (54%), Gaps = 26/395 (7%)

Query  576  FKDKQDFFYHEVRKFHSNYYHEKLSLKVNREKILESSMKATKGFSVSDWCGNFEVTFQGE  635
            F  K+ +F  E+ +       E+ ++ V R  + E S +        +W   F + F+ E
Sbjct  584  FDVKRKYFQTELERLDEGIRREEHTVSVRRVTVFEDSFRVLYRLGPEEWKNRFYIVFEDE  643

Query  636  QGIDWGGLRREWFELICSSLFDPRGGLFC-TFHDKRSALVHPNPNRSPNLKLKYFEFAGK  694
            +G D GGL REW+ +I   +F+P   LFC +  D+ + +++P+ + +PN  L YF+F G+
Sbjct  644  EGQDAGGLLREWYVIISREIFNPMYALFCVSPGDRVTYMINPSSHANPN-HLSYFKFVGR  702

Query  695  IVAKCLYESALGGSYRQLVRARFSRSFLAQLIGLRVHYKYFEQDDPDLYLSKIKYILDTD  754
            ++AK ++++ L   Y       F+RSF   ++G +V +   E  D + Y   + Y++  D
Sbjct  703  VIAKAVHDNKLLECY-------FTRSFYKHILGKQVKHTDMESQDYEFY-KGLDYLMKND  754

Query  755  LDTSDSMELYFVEEVYDNLGQLVKTIELIPNGAKTRVTNATKNQYLDALAQQRLCNNVRD  814
            + T    EL F  EV +  G + +  +L PNG  T VT   K +Y+  + Q ++  ++R 
Sbjct  755  ISTL-GYELTFSTEVQE-FG-VTQIRDLKPNGRDTAVTEENKFEYVQLVCQLKMSGSIRQ  811

Query  815  EVDSFLKGLNGIIPDNLLSIFDENELELLLCGTGEYSITDFKT---HHIVNGNSQEFRRV  871
            ++D+FL+G   IIP +L+SIF+E ELELL+ G  +  I D K    +H     S + +  
Sbjct  812  QLDAFLEGFYDIIPKHLISIFNEQELELLISGLPDIDIEDLKANTEYHKYTSKSAQIQ--  869

Query  872  LAWFWAGVSNFSQTEMARLLQFTTGCSQLPPGGFQELN-----PRFQITAAP-TFGNLPT  925
              WFW  + +F Q + A+ LQF TG S++P  GF  L       +FQI     +   LP 
Sbjct  870  --WFWRALRSFDQADRAKFLQFVTGTSKVPLQGFGSLEGMNGIQKFQIHRDDRSTDRLPC  927

Query  926  AHTCFNQLCLPDYESFEQFEKALLIAISEGTEGFG  960
            AHTCFNQL LP Y+S+++    LL AI E +EGFG
Sbjct  928  AHTCFNQLDLPMYKSYDKLRSCLLKAIHECSEGFG  962


>Q9GUP2_CAEEL unnamed protein product
Length=4177

 Score = 228 bits (582),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 136/402 (34%), Positives = 218/402 (54%), Gaps = 37/402 (9%)

Query  576   FKDKQDFFYHEVRKFHSN---YYHEKLSLKVNREKILESSMKATKGFSVSDWCGNFEVTF  632
             F  K+ +F  E+ K   +   Y    +S++V+R ++   S +       S+W   F + F
Sbjct  3794  FDVKRKYFRKELTKLEPSMPRYRRNDVSVQVSRNRVFSDSFRELFRLRPSEWKNRFYIIF  3853

Query  633   QGEQGIDWGGLRREWFELICSSLFDPRGGLF-------CTFHDKRSALVHPNPNRSPNLK  685
             QGE+G D GGL REWF +I   +F+P   LF        T+   +++ ++P         
Sbjct  3854  QGEEGQDAGGLLREWFSVITREIFNPNYALFITAPGDMVTYMINKASYINPE-------H  3906

Query  686   LKYFEFAGKIVAKCLYESALGGSYRQLVRARFSRSFLAQLIGLRVHYKYFEQDDPDLYLS  745
             L YF+F G+++AK ++E      Y       F+R+F   ++ L V Y+  E +DP  + S
Sbjct  3907  LDYFKFVGRLIAKSVFEHKYLDCY-------FTRAFYKHILNLPVRYQDLESEDPAFFKS  3959

Query  746   KIKYILDTDLDTSDSMELYFVEEVYDNLGQLVKTI-ELIPNGAKTRVTNATKNQYLDALA  804
              + ++L   +D   +++L F  EV +  G  V+++ +L PNG K  V +A K++Y+  + 
Sbjct  3960  -LDFLLQNPIDDL-ALDLTFSTEV-EEFG--VRSVRDLKPNGRKIEVNDANKDEYVKLVC  4014

Query  805   QQRLCNNVRDEVDSFLKGLNGIIPDNLLSIFDENELELLLCGTGEYSITDFKTHHIVNGN  864
             Q ++  ++R ++D+FL G   IIP +L+S+F+E ELELL+ G     I D   +    G 
Sbjct  4015  QMKMTGSIRKQLDAFLTGFYEIIPKDLISMFNEQELELLISGLPTVDIDDMAANTDYKG-  4073

Query  865   SQEFRRVLAWFWAGVSNFSQTEMARLLQFTTGCSQLPPGGFQELN-----PRFQITAAPT  919
              Q+    + WFW  + +F + + A+ LQF TG S++P  GF  L       +F I     
Sbjct  4074  FQKTSTHIQWFWRALRSFEKEDKAKFLQFVTGTSKVPLQGFASLEGMNGVQKFSIHMDSR  4133

Query  920   FGN-LPTAHTCFNQLCLPDYESFEQFEKALLIAISEGTEGFG  960
              G+ LP AHTCFNQL LP YES+E+  ++LL+AI E TEGFG
Sbjct  4134  GGDRLPAAHTCFNQLDLPQYESYEKLRQSLLLAIRECTEGFG  4175


>U4PBY0_CAEEL unnamed protein product
Length=4185

 Score = 227 bits (579),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 136/405 (34%), Positives = 218/405 (54%), Gaps = 40/405 (10%)

Query  576   FKDKQDFFYHEVRKFHSN------YYHEKLSLKVNREKILESSMKATKGFSVSDWCGNFE  629
             F  K+ +F  E+ K   +      Y    +S++V+R ++   S +       S+W   F 
Sbjct  3799  FDVKRKYFRKELTKLEPSNSRMPRYRRNDVSVQVSRNRVFSDSFRELFRLRPSEWKNRFY  3858

Query  630   VTFQGEQGIDWGGLRREWFELICSSLFDPRGGLF-------CTFHDKRSALVHPNPNRSP  682
             + FQGE+G D GGL REWF +I   +F+P   LF        T+   +++ ++P      
Sbjct  3859  IIFQGEEGQDAGGLLREWFSVITREIFNPNYALFITAPGDMVTYMINKASYINPE-----  3913

Query  683   NLKLKYFEFAGKIVAKCLYESALGGSYRQLVRARFSRSFLAQLIGLRVHYKYFEQDDPDL  742
                L YF+F G+++AK ++E      Y       F+R+F   ++ L V Y+  E +DP  
Sbjct  3914  --HLDYFKFVGRLIAKSVFEHKYLDCY-------FTRAFYKHILNLPVRYQDLESEDPAF  3964

Query  743   YLSKIKYILDTDLDTSDSMELYFVEEVYDNLGQLVKTI-ELIPNGAKTRVTNATKNQYLD  801
             + S + ++L   +D   +++L F  EV +  G  V+++ +L PNG K  V +A K++Y+ 
Sbjct  3965  FKS-LDFLLQNPIDDL-ALDLTFSTEV-EEFG--VRSVRDLKPNGRKIEVNDANKDEYVK  4019

Query  802   ALAQQRLCNNVRDEVDSFLKGLNGIIPDNLLSIFDENELELLLCGTGEYSITDFKTHHIV  861
              + Q ++  ++R ++D+FL G   IIP +L+S+F+E ELELL+ G     I D   +   
Sbjct  4020  LVCQMKMTGSIRKQLDAFLTGFYEIIPKDLISMFNEQELELLISGLPTVDIDDMAANTDY  4079

Query  862   NGNSQEFRRVLAWFWAGVSNFSQTEMARLLQFTTGCSQLPPGGFQELN-----PRFQITA  916
              G  Q+    + WFW  + +F + + A+ LQF TG S++P  GF  L       +F I  
Sbjct  4080  KG-FQKTSTHIQWFWRALRSFEKEDKAKFLQFVTGTSKVPLQGFASLEGMNGVQKFSIHM  4138

Query  917   APTFGN-LPTAHTCFNQLCLPDYESFEQFEKALLIAISEGTEGFG  960
                 G+ LP AHTCFNQL LP YES+E+  ++LL+AI E TEGFG
Sbjct  4139  DSRGGDRLPAAHTCFNQLDLPQYESYEKLRQSLLLAIRECTEGFG  4183



Lambda      K        H
   0.312    0.126    0.348 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 26054445194


Query= XP_037024158.1 apoptosis-resistant E3 ubiquitin protein ligase 1
isoform X2 [Bradysia coprophila]

Length=956
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8T3L0_DROME  unnamed protein product                                 226     2e-61
Q9GUP2_CAEEL  unnamed protein product                                 229     3e-61
U4PBY0_CAEEL  unnamed protein product                                 228     6e-61


>Q8T3L0_DROME unnamed protein product
Length=964

 Score = 226 bits (576),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 134/396 (34%), Positives = 215/396 (54%), Gaps = 28/396 (7%)

Query  570  FKDKQDFFYHEVRKFHSNYYHEKLSLKVNREKILESSMKATKGFSVSDWCGNFEVTFQGE  629
            F  K+ +F  E+ +       E+ ++ V R  + E S +        +W   F + F+ E
Sbjct  584  FDVKRKYFQTELERLDEGIRREEHTVSVRRVTVFEDSFRVLYRLGPEEWKNRFYIVFEDE  643

Query  630  QGIDWGGLRREWFELICSSLFDPRGGLFC-TFHDKRSALVHPNPNRSPNLKLKYFEFAGK  688
            +G D GGL REW+ +I   +F+P   LFC +  D+ + +++P+ + +PN  L YF+F G+
Sbjct  644  EGQDAGGLLREWYVIISREIFNPMYALFCVSPGDRVTYMINPSSHANPN-HLSYFKFVGR  702

Query  689  IVAKCLYESALGGSYRQLVRARFSRSFLAQLIGLRVHYKYFEQDDPDLYLSKIKYILDTD  748
            ++AK ++++ L   Y       F+RSF   ++G +V +   E  D + Y   + Y++  D
Sbjct  703  VIAKAVHDNKLLECY-------FTRSFYKHILGKQVKHTDMESQDYEFY-KGLDYLMKND  754

Query  749  LDTSDSMELYFVEEVYDNLGQLVKTIELIPNGAKTRVTNATKNQYLDALAQQRLCNNVRD  808
            + T    EL F  EV +  G + +  +L PNG  T VT   K +Y+  + Q ++  ++R 
Sbjct  755  ISTL-GYELTFSTEVQE-FG-VTQIRDLKPNGRDTAVTEENKFEYVQLVCQLKMSGSIRQ  811

Query  809  EVDSFLKGLNGIIPDNLLSIFDENELELLLCGTGEYSITDFKT----HHIVNGNSQEFRR  864
            ++D+FL+G   IIP +L+SIF+E ELELL+ G  +  I D K     H   + ++Q    
Sbjct  812  QLDAFLEGFYDIIPKHLISIFNEQELELLISGLPDIDIEDLKANTEYHKYTSKSAQ----  867

Query  865  VLAWFWAGVSNFSQTEMARLLQFTTGCSQLPPGGFQELN-----PRFQITAAP-TFGNLP  918
             + WFW  + +F Q + A+ LQF TG S++P  GF  L       +FQI     +   LP
Sbjct  868  -IQWFWRALRSFDQADRAKFLQFVTGTSKVPLQGFGSLEGMNGIQKFQIHRDDRSTDRLP  926

Query  919  TAHTCFNQLCLPDYESFEQFEKALLIAISEGTEGFG  954
             AHTCFNQL LP Y+S+++    LL AI E +EGFG
Sbjct  927  CAHTCFNQLDLPMYKSYDKLRSCLLKAIHECSEGFG  962


>Q9GUP2_CAEEL unnamed protein product
Length=4177

 Score = 229 bits (583),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 136/402 (34%), Positives = 218/402 (54%), Gaps = 37/402 (9%)

Query  570   FKDKQDFFYHEVRKFHSN---YYHEKLSLKVNREKILESSMKATKGFSVSDWCGNFEVTF  626
             F  K+ +F  E+ K   +   Y    +S++V+R ++   S +       S+W   F + F
Sbjct  3794  FDVKRKYFRKELTKLEPSMPRYRRNDVSVQVSRNRVFSDSFRELFRLRPSEWKNRFYIIF  3853

Query  627   QGEQGIDWGGLRREWFELICSSLFDPRGGLF-------CTFHDKRSALVHPNPNRSPNLK  679
             QGE+G D GGL REWF +I   +F+P   LF        T+   +++ ++P         
Sbjct  3854  QGEEGQDAGGLLREWFSVITREIFNPNYALFITAPGDMVTYMINKASYINPE-------H  3906

Query  680   LKYFEFAGKIVAKCLYESALGGSYRQLVRARFSRSFLAQLIGLRVHYKYFEQDDPDLYLS  739
             L YF+F G+++AK ++E      Y       F+R+F   ++ L V Y+  E +DP  + S
Sbjct  3907  LDYFKFVGRLIAKSVFEHKYLDCY-------FTRAFYKHILNLPVRYQDLESEDPAFFKS  3959

Query  740   KIKYILDTDLDTSDSMELYFVEEVYDNLGQLVKTI-ELIPNGAKTRVTNATKNQYLDALA  798
              + ++L   +D   +++L F  EV +  G  V+++ +L PNG K  V +A K++Y+  + 
Sbjct  3960  -LDFLLQNPIDDL-ALDLTFSTEV-EEFG--VRSVRDLKPNGRKIEVNDANKDEYVKLVC  4014

Query  799   QQRLCNNVRDEVDSFLKGLNGIIPDNLLSIFDENELELLLCGTGEYSITDFKTHHIVNGN  858
             Q ++  ++R ++D+FL G   IIP +L+S+F+E ELELL+ G     I D   +    G 
Sbjct  4015  QMKMTGSIRKQLDAFLTGFYEIIPKDLISMFNEQELELLISGLPTVDIDDMAANTDYKG-  4073

Query  859   SQEFRRVLAWFWAGVSNFSQTEMARLLQFTTGCSQLPPGGFQELN-----PRFQITAAPT  913
              Q+    + WFW  + +F + + A+ LQF TG S++P  GF  L       +F I     
Sbjct  4074  FQKTSTHIQWFWRALRSFEKEDKAKFLQFVTGTSKVPLQGFASLEGMNGVQKFSIHMDSR  4133

Query  914   FGN-LPTAHTCFNQLCLPDYESFEQFEKALLIAISEGTEGFG  954
              G+ LP AHTCFNQL LP YES+E+  ++LL+AI E TEGFG
Sbjct  4134  GGDRLPAAHTCFNQLDLPQYESYEKLRQSLLLAIRECTEGFG  4175


>U4PBY0_CAEEL unnamed protein product
Length=4185

 Score = 228 bits (580),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 136/405 (34%), Positives = 218/405 (54%), Gaps = 40/405 (10%)

Query  570   FKDKQDFFYHEVRKFHSN------YYHEKLSLKVNREKILESSMKATKGFSVSDWCGNFE  623
             F  K+ +F  E+ K   +      Y    +S++V+R ++   S +       S+W   F 
Sbjct  3799  FDVKRKYFRKELTKLEPSNSRMPRYRRNDVSVQVSRNRVFSDSFRELFRLRPSEWKNRFY  3858

Query  624   VTFQGEQGIDWGGLRREWFELICSSLFDPRGGLF-------CTFHDKRSALVHPNPNRSP  676
             + FQGE+G D GGL REWF +I   +F+P   LF        T+   +++ ++P      
Sbjct  3859  IIFQGEEGQDAGGLLREWFSVITREIFNPNYALFITAPGDMVTYMINKASYINPE-----  3913

Query  677   NLKLKYFEFAGKIVAKCLYESALGGSYRQLVRARFSRSFLAQLIGLRVHYKYFEQDDPDL  736
                L YF+F G+++AK ++E      Y       F+R+F   ++ L V Y+  E +DP  
Sbjct  3914  --HLDYFKFVGRLIAKSVFEHKYLDCY-------FTRAFYKHILNLPVRYQDLESEDPAF  3964

Query  737   YLSKIKYILDTDLDTSDSMELYFVEEVYDNLGQLVKTI-ELIPNGAKTRVTNATKNQYLD  795
             + S + ++L   +D   +++L F  EV +  G  V+++ +L PNG K  V +A K++Y+ 
Sbjct  3965  FKS-LDFLLQNPIDDL-ALDLTFSTEV-EEFG--VRSVRDLKPNGRKIEVNDANKDEYVK  4019

Query  796   ALAQQRLCNNVRDEVDSFLKGLNGIIPDNLLSIFDENELELLLCGTGEYSITDFKTHHIV  855
              + Q ++  ++R ++D+FL G   IIP +L+S+F+E ELELL+ G     I D   +   
Sbjct  4020  LVCQMKMTGSIRKQLDAFLTGFYEIIPKDLISMFNEQELELLISGLPTVDIDDMAANTDY  4079

Query  856   NGNSQEFRRVLAWFWAGVSNFSQTEMARLLQFTTGCSQLPPGGFQELN-----PRFQITA  910
              G  Q+    + WFW  + +F + + A+ LQF TG S++P  GF  L       +F I  
Sbjct  4080  KG-FQKTSTHIQWFWRALRSFEKEDKAKFLQFVTGTSKVPLQGFASLEGMNGVQKFSIHM  4138

Query  911   APTFGN-LPTAHTCFNQLCLPDYESFEQFEKALLIAISEGTEGFG  954
                 G+ LP AHTCFNQL LP YES+E+  ++LL+AI E TEGFG
Sbjct  4139  DSRGGDRLPAAHTCFNQLDLPQYESYEKLRQSLLLAIRECTEGFG  4183



Lambda      K        H
   0.312    0.126    0.348 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 26054445194


Query= XP_037024159.1 apoptosis-resistant E3 ubiquitin protein ligase 1
isoform X3 [Bradysia coprophila]

Length=924
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9GUP2_CAEEL  unnamed protein product                                 230     7e-62
Q8T3L0_DROME  unnamed protein product                                 227     8e-62
U4PBY0_CAEEL  unnamed protein product                                 228     2e-61


>Q9GUP2_CAEEL unnamed protein product
Length=4177

 Score = 230 bits (586),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 136/402 (34%), Positives = 218/402 (54%), Gaps = 37/402 (9%)

Query  538   FKDKQDFFYHEVRKFHSN---YYHEKLSLKVNREKILESSMKATKGFSVSDWCGNFEVTF  594
             F  K+ +F  E+ K   +   Y    +S++V+R ++   S +       S+W   F + F
Sbjct  3794  FDVKRKYFRKELTKLEPSMPRYRRNDVSVQVSRNRVFSDSFRELFRLRPSEWKNRFYIIF  3853

Query  595   QGEQGIDWGGLRREWFELICSSLFDPRGGLF-------CTFHDKRSALVHPNPNRSPNLK  647
             QGE+G D GGL REWF +I   +F+P   LF        T+   +++ ++P         
Sbjct  3854  QGEEGQDAGGLLREWFSVITREIFNPNYALFITAPGDMVTYMINKASYINPE-------H  3906

Query  648   LKYFEFAGKIVAKCLYESALGGSYRQLVRARFSRSFLAQLIGLRVHYKYFEQDDPDLYLS  707
             L YF+F G+++AK ++E      Y       F+R+F   ++ L V Y+  E +DP  + S
Sbjct  3907  LDYFKFVGRLIAKSVFEHKYLDCY-------FTRAFYKHILNLPVRYQDLESEDPAFFKS  3959

Query  708   KIKYILDTDLDTSDSMELYFVEEVYDNLGQLVKTI-ELIPNGAKTRVTNATKNQYLDALA  766
              + ++L   +D   +++L F  EV +  G  V+++ +L PNG K  V +A K++Y+  + 
Sbjct  3960  -LDFLLQNPIDDL-ALDLTFSTEV-EEFG--VRSVRDLKPNGRKIEVNDANKDEYVKLVC  4014

Query  767   QQRLCNNVRDEVDSFLKGLNGIIPDNLLSIFDENELELLLCGTGEYSITDFKTHHIVNGN  826
             Q ++  ++R ++D+FL G   IIP +L+S+F+E ELELL+ G     I D   +    G 
Sbjct  4015  QMKMTGSIRKQLDAFLTGFYEIIPKDLISMFNEQELELLISGLPTVDIDDMAANTDYKG-  4073

Query  827   SQEFRRVLAWFWAGVSNFSQTEMARLLQFTTGCSQLPPGGFQELN-----PRFQITAAPT  881
              Q+    + WFW  + +F + + A+ LQF TG S++P  GF  L       +F I     
Sbjct  4074  FQKTSTHIQWFWRALRSFEKEDKAKFLQFVTGTSKVPLQGFASLEGMNGVQKFSIHMDSR  4133

Query  882   FGN-LPTAHTCFNQLCLPDYESFEQFEKALLIAISEGTEGFG  922
              G+ LP AHTCFNQL LP YES+E+  ++LL+AI E TEGFG
Sbjct  4134  GGDRLPAAHTCFNQLDLPQYESYEKLRQSLLLAIRECTEGFG  4175


>Q8T3L0_DROME unnamed protein product
Length=964

 Score = 227 bits (579),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 134/395 (34%), Positives = 214/395 (54%), Gaps = 26/395 (7%)

Query  538  FKDKQDFFYHEVRKFHSNYYHEKLSLKVNREKILESSMKATKGFSVSDWCGNFEVTFQGE  597
            F  K+ +F  E+ +       E+ ++ V R  + E S +        +W   F + F+ E
Sbjct  584  FDVKRKYFQTELERLDEGIRREEHTVSVRRVTVFEDSFRVLYRLGPEEWKNRFYIVFEDE  643

Query  598  QGIDWGGLRREWFELICSSLFDPRGGLFC-TFHDKRSALVHPNPNRSPNLKLKYFEFAGK  656
            +G D GGL REW+ +I   +F+P   LFC +  D+ + +++P+ + +PN  L YF+F G+
Sbjct  644  EGQDAGGLLREWYVIISREIFNPMYALFCVSPGDRVTYMINPSSHANPN-HLSYFKFVGR  702

Query  657  IVAKCLYESALGGSYRQLVRARFSRSFLAQLIGLRVHYKYFEQDDPDLYLSKIKYILDTD  716
            ++AK ++++ L   Y       F+RSF   ++G +V +   E  D + Y   + Y++  D
Sbjct  703  VIAKAVHDNKLLECY-------FTRSFYKHILGKQVKHTDMESQDYEFY-KGLDYLMKND  754

Query  717  LDTSDSMELYFVEEVYDNLGQLVKTIELIPNGAKTRVTNATKNQYLDALAQQRLCNNVRD  776
            + T    EL F  EV +  G + +  +L PNG  T VT   K +Y+  + Q ++  ++R 
Sbjct  755  ISTL-GYELTFSTEVQE-FG-VTQIRDLKPNGRDTAVTEENKFEYVQLVCQLKMSGSIRQ  811

Query  777  EVDSFLKGLNGIIPDNLLSIFDENELELLLCGTGEYSITDFKT---HHIVNGNSQEFRRV  833
            ++D+FL+G   IIP +L+SIF+E ELELL+ G  +  I D K    +H     S + +  
Sbjct  812  QLDAFLEGFYDIIPKHLISIFNEQELELLISGLPDIDIEDLKANTEYHKYTSKSAQIQ--  869

Query  834  LAWFWAGVSNFSQTEMARLLQFTTGCSQLPPGGFQELN-----PRFQITAAP-TFGNLPT  887
              WFW  + +F Q + A+ LQF TG S++P  GF  L       +FQI     +   LP 
Sbjct  870  --WFWRALRSFDQADRAKFLQFVTGTSKVPLQGFGSLEGMNGIQKFQIHRDDRSTDRLPC  927

Query  888  AHTCFNQLCLPDYESFEQFEKALLIAISEGTEGFG  922
            AHTCFNQL LP Y+S+++    LL AI E +EGFG
Sbjct  928  AHTCFNQLDLPMYKSYDKLRSCLLKAIHECSEGFG  962


>U4PBY0_CAEEL unnamed protein product
Length=4185

 Score = 228 bits (582),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 136/405 (34%), Positives = 218/405 (54%), Gaps = 40/405 (10%)

Query  538   FKDKQDFFYHEVRKFHSN------YYHEKLSLKVNREKILESSMKATKGFSVSDWCGNFE  591
             F  K+ +F  E+ K   +      Y    +S++V+R ++   S +       S+W   F 
Sbjct  3799  FDVKRKYFRKELTKLEPSNSRMPRYRRNDVSVQVSRNRVFSDSFRELFRLRPSEWKNRFY  3858

Query  592   VTFQGEQGIDWGGLRREWFELICSSLFDPRGGLF-------CTFHDKRSALVHPNPNRSP  644
             + FQGE+G D GGL REWF +I   +F+P   LF        T+   +++ ++P      
Sbjct  3859  IIFQGEEGQDAGGLLREWFSVITREIFNPNYALFITAPGDMVTYMINKASYINPE-----  3913

Query  645   NLKLKYFEFAGKIVAKCLYESALGGSYRQLVRARFSRSFLAQLIGLRVHYKYFEQDDPDL  704
                L YF+F G+++AK ++E      Y       F+R+F   ++ L V Y+  E +DP  
Sbjct  3914  --HLDYFKFVGRLIAKSVFEHKYLDCY-------FTRAFYKHILNLPVRYQDLESEDPAF  3964

Query  705   YLSKIKYILDTDLDTSDSMELYFVEEVYDNLGQLVKTI-ELIPNGAKTRVTNATKNQYLD  763
             + S + ++L   +D   +++L F  EV +  G  V+++ +L PNG K  V +A K++Y+ 
Sbjct  3965  FKS-LDFLLQNPIDDL-ALDLTFSTEV-EEFG--VRSVRDLKPNGRKIEVNDANKDEYVK  4019

Query  764   ALAQQRLCNNVRDEVDSFLKGLNGIIPDNLLSIFDENELELLLCGTGEYSITDFKTHHIV  823
              + Q ++  ++R ++D+FL G   IIP +L+S+F+E ELELL+ G     I D   +   
Sbjct  4020  LVCQMKMTGSIRKQLDAFLTGFYEIIPKDLISMFNEQELELLISGLPTVDIDDMAANTDY  4079

Query  824   NGNSQEFRRVLAWFWAGVSNFSQTEMARLLQFTTGCSQLPPGGFQELN-----PRFQITA  878
              G  Q+    + WFW  + +F + + A+ LQF TG S++P  GF  L       +F I  
Sbjct  4080  KG-FQKTSTHIQWFWRALRSFEKEDKAKFLQFVTGTSKVPLQGFASLEGMNGVQKFSIHM  4138

Query  879   APTFGN-LPTAHTCFNQLCLPDYESFEQFEKALLIAISEGTEGFG  922
                 G+ LP AHTCFNQL LP YES+E+  ++LL+AI E TEGFG
Sbjct  4139  DSRGGDRLPAAHTCFNQLDLPQYESYEKLRQSLLLAIRECTEGFG  4183



Lambda      K        H
   0.312    0.126    0.348 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 26054445194


Query= XP_037024160.1 procathepsin L-like [Bradysia coprophila]

Length=340
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CATL_DROME  unnamed protein product                                   362     2e-124
CRUST_PANBO  unnamed protein product                                  318     5e-108
CPL1_CAEEL  unnamed protein product                                   305     8e-103


>CATL_DROME unnamed protein product
Length=371

 Score = 362 bits (928),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 179/323 (55%), Positives = 225/323 (70%), Gaps = 4/323 (1%)

Query  21   AFDDILGEEWQLFKLRFAKVYQTKLEELHRNKIFLRNKLEIIQHNNLYELGQVSFQLGLN  80
            +F D++ EEW  FKL   K YQ + EE  R KIF  NK +I +HN  +  G+VSF+L +N
Sbjct  50   SFADVVMEEWHTFKLEHRKNYQDETEERFRLKIFNENKHKIAKHNQRFAEGKVSFKLAVN  109

Query  81   EYSDLEYSEFITRMNGGKNT--SIINIHQFQYEAATFIKP-DIDVPASVDWSKKGAVTAV  137
            +Y+DL + EF   MNG   T    +      ++  TFI P  + +P SVDW  KGAVTAV
Sbjct  110  KYADLLHHEFRQLMNGFNYTLHKQLRAADESFKGVTFISPAHVTLPKSVDWRTKGAVTAV  169

Query  138  KNQAQCGSCWAFSSTGALEGQYFRKTGKLISLSEQNLVDCTRNYGNNGCGGGWMGSAFKY  197
            K+Q  CGSCWAFSSTGALEGQ+FRK+G L+SLSEQNLVDC+  YGNNGC GG M +AF+Y
Sbjct  170  KDQGHCGSCWAFSSTGALEGQHFRKSGVLVSLSEQNLVDCSTKYGNNGCNGGLMDNAFRY  229

Query  198  IMNNGGIETEQSYPYEAKDANCRYDSRYNSGATVKGSVGIQQGDENALKMAVAANGPIAV  257
            I +NGGI+TE+SYPYEA D +C ++ +   GAT +G   I QGDE  +  AVA  GP++V
Sbjct  230  IKDNGGIDTEKSYPYEAIDDSCHFN-KGTVGATDRGFTDIPQGDEKKMAEAVATVGPVSV  288

Query  258  AIDASVSTFGHYSEGVYFASQCDPAKLTHAVLVVGYDTTANGQDYWIVKNSWGTSWGQAG  317
            AIDAS  +F  YSEGVY   QCD   L H VLVVG+ T  +G+DYW+VKNSWGT+WG  G
Sbjct  289  AIDASHESFQFYSEGVYNEPQCDAQNLDHGVLVVGFGTDESGEDYWLVKNSWGTTWGDKG  348

Query  318  YIFMARNKGNNCGIATAAIFPLV  340
            +I M RNK N CGIA+A+ +PLV
Sbjct  349  FIKMLRNKENQCGIASASSYPLV  371


>CRUST_PANBO unnamed protein product
Length=323

 Score = 318 bits (815),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 162/315 (51%), Positives = 207/315 (66%), Gaps = 13/315 (4%)

Query  29   EWQLFKLRFAKVYQTKLEELHRNKIFLRNKLEIIQ-HNNLYELGQVSFQLGLNEYSDLEY  87
            EW+ FK +F K Y    EE HR  +F+ +KL+ IQ HN  Y+ G+V++ L +N +SDL +
Sbjct  19   EWENFKTKFGKKYANSEEESHRMSVFM-DKLKFIQEHNERYDKGEVTYWLKINNFSDLTH  77

Query  88   SEFITRMNGGKNTSIINIHQFQYEAATFIK--PDIDVPASVDWSKKGAVTAVKNQAQCGS  145
             E +    G        + + ++  +   K  P   + A VDW  KGAVT VK+Q QCGS
Sbjct  78   EEVLATKTG--------MTRRRHPLSVLPKSAPTTPMAADVDWRNKGAVTPVKDQGQCGS  129

Query  146  CWAFSSTGALEGQYFRKTGKLISLSEQNLVDCTRNYGNNGCGGGWMGSAFKYIMNNGGIE  205
            CWAFS+  ALEG +F KTG L+SLSEQNLVDC+ +YGN GC GGW   A++YI+ N GI+
Sbjct  130  CWAFSAVAALEGAHFLKTGDLVSLSEQNLVDCSSSYGNQGCNGGWPYQAYQYIIANRGID  189

Query  206  TEQSYPYEAKDANCRYDSRYNSGATVKGSVGIQQGDENALKMAVAANGPIAVAIDASVST  265
            TE SYPY+A D NCRYD+  N GATV   V    GDE+AL+ AV   GP++V IDA  S+
Sbjct  190  TESSYPYKAIDDNCRYDAG-NIGATVSSYVEPASGDESALQHAVQNEGPVSVCIDAGQSS  248

Query  266  FGHYSEGVYFASQCDPAKLTHAVLVVGYDTTANGQDYWIVKNSWGTSWGQAGYIFMARNK  325
            FG Y  GVY+   CD     HAV  VGY T ANG DYWIVKNSWG  WG++GYI MARN+
Sbjct  249  FGSYGGGVYYEPNCDSWYANHAVTAVGYGTDANGGDYWIVKNSWGAWWGESGYIKMARNR  308

Query  326  GNNCGIATAAIFPLV  340
             NNC IAT +++P+V
Sbjct  309  DNNCAIATYSVYPVV  323


>CPL1_CAEEL unnamed protein product
Length=337

 Score = 305 bits (782),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 150/318 (47%), Positives = 210/318 (66%), Gaps = 15/318 (5%)

Query  28   EEWQLFKLRFAKVYQTKLEELHRNKIFLRNKLEIIQHNNLYELGQVSFQLGLNEYSDLEY  87
            E+W  +K  F K Y    E+ +  + F++N + I  HN  + LG+ +F++GLN  +DL +
Sbjct  30   EKWDDYKEDFDKEYSESEEQTYM-EAFVKNMIHIENHNRDHRLGRKTFEMGLNHIADLPF  88

Query  88   SEFITRMNGGK----NTSIINIHQFQYEAATFIKP-DIDVPASVDWSKKGAVTAVKNQAQ  142
            S++  ++NG +    ++ I N       +++F+ P ++ VP  VDW     VT VKNQ  
Sbjct  89   SQY-RKLNGYRRLFGDSRIKN-------SSSFLAPFNVQVPDEVDWRDTHLVTDVKNQGM  140

Query  143  CGSCWAFSSTGALEGQYFRKTGKLISLSEQNLVDCTRNYGNNGCGGGWMGSAFKYIMNNG  202
            CGSCWAFS+TGALEGQ+ RK G+L+SLSEQNLVDC+  YGN+GC GG M  AF+YI +N 
Sbjct  141  CGSCWAFSATGALEGQHARKLGQLVSLSEQNLVDCSTKYGNHGCNGGLMDQAFEYIRDNH  200

Query  203  GIETEQSYPYEAKDANCRYDSRYNSGATVKGSVGIQQGDENALKMAVAANGPIAVAIDAS  262
            G++TE+SYPY+ +D  C ++ +   GA  KG V   +GDE  LK+AVA  GPI++AIDA 
Sbjct  201  GVDTEESYPYKGRDMKCHFNKK-TVGADDKGYVDTPEGDEEQLKIAVATQGPISIAIDAG  259

Query  263  VSTFGHYSEGVYFASQCDPAKLTHAVLVVGYDTTANGQDYWIVKNSWGTSWGQAGYIFMA  322
              +F  Y +GVY+  +C   +L H VL+VGY T     DYWIVKNSWG  WG+ GYI +A
Sbjct  260  HRSFQLYKKGVYYDEECSSEELDHGVLLVGYGTDPEHGDYWIVKNSWGAGWGEKGYIRIA  319

Query  323  RNKGNNCGIATAAIFPLV  340
            RN+ N+CG+AT A +PLV
Sbjct  320  RNRNNHCGVATKASYPLV  337



Lambda      K        H
   0.312    0.126    0.348 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 26054445194


Query= XP_037024161.1 dynein light chain 1, axonemal-like [Bradysia
coprophila]

Length=184
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8IB59_PLAF7  unnamed protein product                                 120     1e-34
Q385K0_TRYB2  unnamed protein product                                 105     2e-28
C6S3E1_PLAF7  unnamed protein product                                 62.0    1e-11


>Q8IB59_PLAF7 unnamed protein product
Length=199

 Score = 120 bits (302),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 113/176 (64%), Gaps = 2/176 (1%)

Query  4    TSIKKALQLWQQDNPEFDLCSAVDVQLQFRWPPIEKMDDNLSVLVKCEKLSLSTNMIKRI  63
             +    ++ W+Q N +  +C   +V      P IEK+D++++ L KC++LSLSTN I+++
Sbjct  9    ATFSNCIKNWEQKNGK-KICDEEEVSFICNIPLIEKLDNSINTLEKCKRLSLSTNRIEKL  67

Query  64   VGLSQLKSLKILALGRNQIRYVDGIESVAESLEQLWISYNLIAKLGSLGSMKKLKVLYIG  123
            + +S LK+++IL+LGRN I+ +  +E ++ +L+QLW+SYN I KL +L S+KKL+VLYI 
Sbjct  68   IPMSGLKNIEILSLGRNCIKKIQYLEDISGTLKQLWLSYNYIDKLDNLQSLKKLQVLYIF  127

Query  124  NNLINDWNELDELGKLKDTLEQLVLGGNPLAAAMHRDDYRKEIKKKLPFLHFLDGQ  179
            +N I    E+D+L  L + +E L L GNP+      +  +  I KKLP L  +D +
Sbjct  128  HNKIKSIEEIDKLNTLPELVE-LGLKGNPIYEGKTNEYMKLLILKKLPQLKIVDNE  182


>Q385K0_TRYB2 unnamed protein product
Length=210

 Score = 105 bits (262),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 70/148 (47%), Positives = 95/148 (64%), Gaps = 4/148 (3%)

Query  35   PPIEKMDDNLSVLVKCEKLSLSTNMIKRI-VGLSQLKSLKILALGRNQIRYVDGIESVAE  93
            PPI KMD +++ LV CE L+LSTN I++I  GL +LK LK+L+LGRN IR ++ ++    
Sbjct  52   PPIVKMDKDITTLVNCEHLALSTNAIEKIGPGLKELKKLKVLSLGRNAIRKIEQLD--IP  109

Query  94   SLEQLWISYNLIAKLGSLGSMKKLKVLYIGNNLINDWNELDELGKLKDTLEQLVLGGNPL  153
             LEQLW+SYN I KL  L  +K LKVLY+ NNLI+ W E+D L      L +++   NP+
Sbjct  110  HLEQLWLSYNKIDKLTGLDKLKSLKVLYMSNNLISSWTEIDRLANQCPELIEVLFKNNPI  169

Query  154  A-AAMHRDDYRKEIKKKLPFLHFLDGQP  180
               A    +YR  I ++LP L  LDG P
Sbjct  170  HNNAPSEKEYRCMILQRLPRLTKLDGVP  197


>C6S3E1_PLAF7 unnamed protein product
Length=309

 Score = 62.0 bits (149),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 74/117 (63%), Gaps = 6/117 (5%)

Query  37   IEKMDDNLSVLVKCEKLSLSTNMIKRIVGLSQLKSLKILALGRNQIRYVDGIESVAESLE  96
            IEK++ NL   V+ E L L  NMIK+I  +S L +LK+L L  N+I+ ++ +E++  +LE
Sbjct  49   IEKLE-NLENNVQLEHLELYENMIKKIENISMLINLKVLDLSFNKIKIIENLETLV-NLE  106

Query  97   QLWISYNLIAKLGSLGSMKKLKVLYIGNNLINDWNELDELGKLKDTLEQLVLGGNPL  153
            +L++S N I+K+ +L + KKL++L +G N I     ++ L      LE+L LG N +
Sbjct  107  ELYLSSNKISKIENLQNCKKLRLLELGYNKIRMIENIEHLT----NLEELWLGKNKI  159


 Score = 55.8 bits (133),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 56/91 (62%), Gaps = 2/91 (2%)

Query  39   KMDDNLSVLVKCEKLSLSTNMIKRIVGLSQLKSLKILALGRNQIRYVDGIESVAESLEQL  98
            K+ +NL  LV  E+L LS+N I +I  L   K L++L LG N+IR ++ IE +  +LE+L
Sbjct  94   KIIENLETLVNLEELYLSSNKISKIENLQNCKKLRLLELGYNKIRMIENIEHLT-NLEEL  152

Query  99   WISYNLIAKLGSLGSMKKLKVLYIGNNLIND  129
            W+  N I ++  L  + KLK L + +N + D
Sbjct  153  WLGKNKIEQIN-LPYLPKLKKLSVQHNRLTD  182


 Score = 38.5 bits (88),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 71/143 (50%), Gaps = 4/143 (3%)

Query  43   NLSVLVKCEKLSLSTNMIKRIV--GLSQLKSLKILALGRNQIRYVDGIESVAESLEQLWI  100
            NL  L K +KLS+  N +  I    +  +  ++ L +  N+I ++       + L+   +
Sbjct  163  NLPYLPKLKKLSVQHNRLTDICEKSIKNILCVEELYISYNKINHIIDTFKDLKHLKVFDL  222

Query  101  SYNLIAKLGSLGSMKKLKVLYIGNNLINDWNELDELGKLKDTLEQLVLGGNPLAAAMHRD  160
            SYN I  +     +K L+ L++ NN I++   + +L  +++ L+ L L  N +   + ++
Sbjct  223  SYNEINNISICSYLKSLEELWLNNNNIDNLEMIKKLSTIEN-LKTLYLEKNKIQDNL-KE  280

Query  161  DYRKEIKKKLPFLHFLDGQPTVS  183
            +YRK I   LP L  LD  P  S
Sbjct  281  NYRKTIIHILPQLKQLDALPIPS  303



Lambda      K        H
   0.312    0.126    0.348 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 26054445194


Query= XP_037024162.1 uncharacterized protein LOC119066044 [Bradysia
coprophila]

Length=359
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

OXDD_DICDI  unnamed protein product                                   30.8    1.6  
A0A0B4KF97_DROME  unnamed protein product                             29.6    4.7  
S35B3_CAEEL  unnamed protein product                                  28.5    9.7  


>OXDD_DICDI unnamed protein product
Length=346

 Score = 30.8 bits (68),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 24/90 (27%), Positives = 41/90 (46%), Gaps = 12/90 (13%)

Query  36   VDDLFLMVPKQSVDYILSVFNSININIQFTHVVEQNNELAFLDTTVIRDAVGAISFLWFS  95
            +DD F+M     +DY++  F S+   I+  H+V+     AF+D  V+ +  G        
Sbjct  139  IDDGFVMDTDMYMDYLVDQFKSLGGIIEQRHLVDIRE--AFVDHDVVVNCTG--------  188

Query  96   KPTCSNRLLNYRSNHPMNQKLNVVDNLIKR  125
                S  L N R+ +P   ++ V+ N   R
Sbjct  189  --LGSRELFNDRTIYPGRGQIIVIKNSTDR  216


>A0A0B4KF97_DROME unnamed protein product
Length=874

 Score = 29.6 bits (65),  Expect = 4.7, Method: Compositional matrix adjust.
 Identities = 25/112 (22%), Positives = 49/112 (44%), Gaps = 7/112 (6%)

Query  159  RIKKHINSRENQQVSPPQVDTNVSSSDVQNEIMYRGLHFHSSCSQNIGKILCEDSENLRL  218
            RI+K +   + +  +PP   T+  ++D+ + I+     +H + S+N+G++       L +
Sbjct  530  RIRKALLQGKARIAAPPTAPTSAPAADILSSILDLQDRWHDA-SRNLGEVHIRADGTLNI  588

Query  219  GFKPTYTN------RAIFSKLKQKTLEEDLYNVVYNIPCFGDGINAQCELSY  264
              +P  T       +A  SK ++   +  LY      P +  G  A    SY
Sbjct  589  PQRPAPTATEAPLPKAGTSKTEKHLTQAPLYQQGGGGPNYNRGGGAGSSDSY  640


>S35B3_CAEEL unnamed protein product
Length=364

 Score = 28.5 bits (62),  Expect = 9.7, Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 2/48 (4%)

Query  51   ILSVFNSININIQFTHVVEQNNELAFLDTTVIRDAVGAI-SFLWFSKP  97
            ILS    + +N+  TH+ +    L  +  T +R A+  I SF+ FSKP
Sbjct  263  ILSCLGYLGVNVVLTHI-KVFGALVAVTVTTLRKALTIILSFMLFSKP  309



Lambda      K        H
   0.312    0.126    0.348 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 26054445194


Query= XP_037024163.1 uncharacterized protein LOC119066045 [Bradysia
coprophila]

Length=684
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q383R3_TRYB2  unnamed protein product                                 43.5    6e-05
Q389Z6_TRYB2  unnamed protein product                                 42.0    2e-04
Q9W1T1_DROME  unnamed protein product                                 40.0    0.004


>Q383R3_TRYB2 unnamed protein product
Length=130

 Score = 43.5 bits (101),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/94 (32%), Positives = 55/94 (59%), Gaps = 8/94 (9%)

Query  588  FQIDCT--AAVDLSVDELV----EFLKSNLKIEGQKKNL-SDVAIEGRNANVNILAKVMV  640
            F+IDC+  A+  +  D+++    ++ + N+K+ G+K  L S V +  R   ++I   +  
Sbjct  26   FKIDCSIPASDGIFSDDILSNFQQYFQDNVKLNGRKGKLTSKVRVNMRENTLSITTTMAY  85

Query  641  KKKYLKLLSKKFLYKKKMFNY-RLATKNKRAYKI  673
            +KKY K L+KKFL KK + ++ R+  K K  Y++
Sbjct  86   RKKYFKYLTKKFLKKKDLRDWIRILAKGKDTYQL  119


>Q389Z6_TRYB2 unnamed protein product
Length=130

 Score = 42.0 bits (97),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/94 (32%), Positives = 55/94 (59%), Gaps = 8/94 (9%)

Query  588  FQIDCT--AAVDLSVDELV----EFLKSNLKIEGQKKNL-SDVAIEGRNANVNILAKVMV  640
            F+IDC+  A+  +  D+++    ++ + N+K+ G+K  L S V +  R   ++I   +  
Sbjct  26   FKIDCSIPASDGIFSDDILSNFQQYFQDNVKLNGRKGKLTSKVRVNMRENILSITTTMAY  85

Query  641  KKKYLKLLSKKFLYKKKMFNY-RLATKNKRAYKI  673
            +KKY K L+KKFL KK + ++ R+  K K  Y++
Sbjct  86   RKKYFKYLTKKFLKKKDLRDWIRILAKGKDTYQL  119


>Q9W1T1_DROME unnamed protein product
Length=312

 Score = 40.0 bits (92),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 62/122 (51%), Gaps = 17/122 (14%)

Query  555  ATTLTTVQQSAGSPSTASIKSKSRKSKNFIRF----------RFQIDCTAAVDLSVDELV  604
            A    +V++S  +P  A+ K K +++KN +R           RF IDC    +  + +L 
Sbjct  153  AAKAKSVKKSLATP--ANPKPKPKRTKNVLRGKRLAKKKAWQRFVIDCACVAEDMILDLA  210

Query  605  EF---LKSNLKIEGQKKNLSDVAIEGRNANVNIL--AKVMVKKKYLKLLSKKFLYKKKMF  659
            +F   LK+++KI+ +   L D     R  N +++  + V   K+Y K L+K++L K  + 
Sbjct  211  DFEQYLKTHIKIKNKLNQLKDQVTFERTKNFSLIIHSGVHFSKRYFKYLTKRYLKKVSLR  270

Query  660  NY  661
            ++
Sbjct  271  DW  272



Lambda      K        H
   0.312    0.126    0.348 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 26054445194


Query= XP_037024164.1 keratin-associated protein 19-2-like [Bradysia
coprophila]

Length=149
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9U617_DROME  unnamed protein product                                 38.1    0.002
Q9VTR6_DROME  unnamed protein product                                 37.7    0.002
Q7YU48_DROME  unnamed protein product                                 31.6    0.21 


>Q9U617_DROME unnamed protein product
Length=1729

 Score = 38.1 bits (87),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 41/67 (61%), Gaps = 5/67 (7%)

Query  21    AESAVGGKVAC--EGYGAASY--GASGYGQAGYGSQPAYGGQAGYGGQYGYSGAYGYGSP  76
             +++ VGG++     GYG+     G +G GQ GYG+QP +GGQ GYG Q G  G  G G P
Sbjct  1015  SQTGVGGQIGAGQPGYGSQPGIGGQTGAGQPGYGAQPGFGGQPGYGNQPGVGGQTGAGQP  1074

Query  77    YGYGSKA  83
              GYGS+ 
Sbjct  1075  -GYGSQP  1080


 Score = 31.2 bits (69),  Expect = 0.37, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 28/49 (57%), Gaps = 6/49 (12%)

Query  40   GASGYGQAGYGSQPAYGGQA-----GYGGQYGYSGAYGYGSPYGYGSKA  83
            G +G GQ GYGSQP  GGQ      GYG Q G  G  G G P GYGS+ 
Sbjct  204  GQTGAGQPGYGSQPGIGGQTGAGQPGYGSQPGIGGQTGAGQP-GYGSQP  251


 Score = 30.4 bits (67),  Expect = 0.63, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 28/49 (57%), Gaps = 6/49 (12%)

Query  40   GASGYGQAGYGSQPAYGGQA-----GYGGQYGYSGAYGYGSPYGYGSKA  83
            G +G GQ GYGSQP  GGQ      GYG Q G  G  G G P GYG++ 
Sbjct  306  GQTGAGQPGYGSQPGIGGQTGAGQPGYGSQPGIGGQTGAGQP-GYGTQP  353


 Score = 29.6 bits (65),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 27/49 (55%), Gaps = 6/49 (12%)

Query  40    GASGYGQAGYGSQPAYGGQA-----GYGGQYGYSGAYGYGSPYGYGSKA  83
             G +  GQ GYGSQP  GGQ      GYG Q G  G  G G P GYGS+ 
Sbjct  987   GQTAAGQPGYGSQPGIGGQTGAGQPGYGSQTGVGGQIGAGQP-GYGSQP  1034


 Score = 29.3 bits (64),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 57/118 (48%), Gaps = 13/118 (11%)

Query  40   GASGYGQAGYGSQPAYGGQAGYGGQYGYSGAYGYGSPYGYGSKAYSPQ-------GYGQQ  92
            G +G GQ GYGSQP  GGQ G  GQ GY    G G+  G G   Y  Q       G GQ 
Sbjct  510  GQTGAGQPGYGSQPGIGGQTGA-GQPGYGTQPGIGAQTGAGQPGYGSQPGIGGQTGAGQP  568

Query  93   GY-SYPSGYGTAGYGGASYGSGYGQGYAYPSGYGSAGYGSGYG-GASYGSGYGSGYGS  148
            GY S P   G  G G   YG+  G G    +G G  GYGS  G G   G+G   GYGS
Sbjct  569  GYGSQPGIGGQTGAGQPGYGTQPGVGAQ--TGTGQPGYGSQPGVGTQIGAGQ-PGYGS  623


 Score = 28.5 bits (62),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 57/111 (51%), Gaps = 16/111 (14%)

Query  40   GASGYGQAGYGSQPAYGGQAGYGGQYGYSGAYGYGSPYGYGSKAYSPQGYGQQGY-SYPS  98
            G +G GQ GYG+QP  GGQ G       +G  GYG+  G G++     G GQ GY + P 
Sbjct  408  GQTGAGQPGYGTQPGIGGQTG-------AGQPGYGTQPGIGAQT----GAGQPGYGTQPG  456

Query  99   GYGTAGYGGASYGSGYGQGYAYPSGYGSAGYGSGYG-GASYGSGYGSGYGS  148
              G  G G   YG+  G G    +G G  GYGS  G GA  G+G   GYGS
Sbjct  457  IGGQTGAGQPGYGTQPGIGVQ--TGAGQPGYGSQPGIGAQTGAGQ-PGYGS  504


 Score = 26.9 bits (58),  Expect = 9.1, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 36/68 (53%), Gaps = 10/68 (15%)

Query  40   GASGYGQAGYGSQPAYGGQAG-----YGGQYGYSGAYGYGSPYGYGSKAYSPQGYGQQGY  94
            G +G GQ GYGSQP  GGQ G     YG Q G  G  G G P GYGS+     G G Q  
Sbjct  221  GQTGAGQPGYGSQPGIGGQTGAGQPGYGSQPGIGGQTGAGQP-GYGSQP----GIGGQTG  275

Query  95   SYPSGYGT  102
            +   GYG+
Sbjct  276  AGQPGYGS  283


>Q9VTR6_DROME unnamed protein product
Length=1713

 Score = 37.7 bits (86),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 41/67 (61%), Gaps = 5/67 (7%)

Query  21    AESAVGGKVAC--EGYGAASY--GASGYGQAGYGSQPAYGGQAGYGGQYGYSGAYGYGSP  76
             +++ VGG++     GYG+     G +G GQ GYG+QP +GGQ GYG Q G  G  G G P
Sbjct  936   SQTGVGGQIGAGQPGYGSQPGIGGQTGAGQPGYGAQPGFGGQPGYGNQPGVGGQTGAGQP  995

Query  77    YGYGSKA  83
              GYGS+ 
Sbjct  996   -GYGSQP  1001


 Score = 31.6 bits (70),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 35/67 (52%), Gaps = 8/67 (12%)

Query  43   GYGQAGYGSQPAYGGQA-----GYGGQYGYSGAYGYGSPYGYGSKAY--SPQGYGQQGYS  95
            G GQ GYGSQP  GGQ      GYG Q G  G  G G P GYGS+    +  G GQ GY 
Sbjct  173  GVGQPGYGSQPGIGGQTGAGQPGYGSQPGIGGQTGAGQP-GYGSQPVVGAQTGTGQPGYG  231

Query  96   YPSGYGT  102
               G GT
Sbjct  232  AQPGVGT  238


 Score = 30.8 bits (68),  Expect = 0.44, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 39/79 (49%), Gaps = 8/79 (10%)

Query  42   SGYGQAGYGSQPAYGGQAGYGGQYGYSGAYGYGSPYGYGSKAYSPQ-------GYGQQGY  94
            +G GQ GYGSQP  GGQ G G Q GY    G G+  G G   Y  Q       G GQ GY
Sbjct  563  TGAGQPGYGSQPGIGGQTGAG-QPGYGTQPGVGAQTGTGQPGYGAQPGVGTQTGAGQPGY  621

Query  95   SYPSGYGTAGYGGASYGSG  113
                GYGT    GA  G+G
Sbjct  622  GSQPGYGTQPGVGAQTGTG  640


 Score = 30.4 bits (67),  Expect = 0.67, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 33/60 (55%), Gaps = 5/60 (8%)

Query  42   SGYGQAGYGSQPAYGGQAGYGGQYGYSGAYGYGSPYGYGSKAYSPQGYGQQGYSYPSGYG  101
            +G GQ GYGSQP YG Q G G Q G +G  GYG+  G G +     G GQ GY    G G
Sbjct  614  TGAGQPGYGSQPGYGTQPGVGAQTG-TGQPGYGAQPGVGGQT----GAGQPGYGTQPGIG  668


 Score = 28.5 bits (62),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 52/102 (51%), Gaps = 15/102 (15%)

Query  42   SGYGQAGYGSQPAYGGQAGYGGQYGYSGAYGYGSPYGYGSKAYSPQGYGQQGYSYPSGYG  101
            +G GQ GYGSQP  GGQ G       +G  GYG+  G G++     G GQ GY    G G
Sbjct  512  TGAGQPGYGSQPGIGGQTG-------AGQPGYGTQPGVGAQT----GTGQPGYGAQPGVG  560

Query  102  T-AGYGGASYGSGYGQGYAYPSGYGSAGYGSGYG-GASYGSG  141
            T  G G   YGS  G G    +G G  GYG+  G GA  G+G
Sbjct  561  TQTGAGQPGYGSQPGIGGQ--TGAGQPGYGTQPGVGAQTGTG  600


 Score = 28.1 bits (61),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 61/121 (50%), Gaps = 19/121 (16%)

Query  40   GASGYGQAGYGSQPAYGGQA-----GYGGQYGY-----SGAYGYGSPYGYGSKAYSPQGY  89
            G +G GQ GYGSQP  GGQ      GYG Q G      +G  GYG+  G G++     G 
Sbjct  408  GQTGAGQPGYGSQPGIGGQTGARQPGYGSQPGVGAQTGAGQPGYGAQPGVGAQT----GA  463

Query  90   GQQGY-SYPSGYGTAGYGGASYGSGYGQGYAYPSGYGSAGYGSGYG-GASYGSGYGSGYG  147
            GQ GY S P   G  G G   YGS  G G    +G G  GYG+  G GA  G+G   GYG
Sbjct  464  GQPGYGSQPGIGGQTGAGQPGYGSQPGVGAQ--TGAGQPGYGAQPGVGAQTGAGQ-PGYG  520

Query  148  S  148
            S
Sbjct  521  S  521


 Score = 28.1 bits (61),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 27/49 (55%), Gaps = 6/49 (12%)

Query  40   GASGYGQAGYGSQPAYG-----GQAGYGGQYGYSGAYGYGSPYGYGSKA  83
            G +G GQ GYG+QP  G     GQ GYG Q G     G G P GYGS+ 
Sbjct  306  GQTGAGQPGYGTQPGVGAQTGTGQPGYGAQPGVGTQTGAGQP-GYGSQP  353


 Score = 27.3 bits (59),  Expect = 7.1, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 24/43 (56%), Gaps = 1/43 (2%)

Query  42   SGYGQAGYGSQPAYGGQAGYGGQYGYSGAYGYGSPYGYGSKAY  84
            +G GQ GYGSQP  GGQ G  GQ GY    G G+  G G   Y
Sbjct  342  TGAGQPGYGSQPGIGGQTGA-GQPGYGTQPGVGAQTGAGQPGY  383


>Q7YU48_DROME unnamed protein product
Length=1071

 Score = 31.6 bits (70),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 35/68 (51%), Gaps = 8/68 (12%)

Query  42   SGYGQAGYGSQPAYGGQA-----GYGGQYGYSGAYGYGSPYGYGSKAY--SPQGYGQQGY  94
             G GQ GYGSQP  GGQ      GYG Q G  G  G G P GYGS+    +  G GQ GY
Sbjct  172  PGVGQPGYGSQPGIGGQTGAGQPGYGSQPGIGGQTGAGQP-GYGSQPVVGAQTGTGQPGY  230

Query  95   SYPSGYGT  102
                G GT
Sbjct  231  GAQPGVGT  238


 Score = 30.8 bits (68),  Expect = 0.42, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 39/79 (49%), Gaps = 8/79 (10%)

Query  42   SGYGQAGYGSQPAYGGQAGYGGQYGYSGAYGYGSPYGYGSKAYSPQ-------GYGQQGY  94
            +G GQ GYGSQP  GGQ G G Q GY    G G+  G G   Y  Q       G GQ GY
Sbjct  563  TGAGQPGYGSQPGIGGQTGAG-QPGYGTQPGVGAQTGTGQPGYGAQPGVGTQTGAGQPGY  621

Query  95   SYPSGYGTAGYGGASYGSG  113
                GYGT    GA  G+G
Sbjct  622  GSQPGYGTQPGVGAQTGTG  640


 Score = 30.4 bits (67),  Expect = 0.66, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 33/60 (55%), Gaps = 5/60 (8%)

Query  42   SGYGQAGYGSQPAYGGQAGYGGQYGYSGAYGYGSPYGYGSKAYSPQGYGQQGYSYPSGYG  101
            +G GQ GYGSQP YG Q G G Q G +G  GYG+  G G +     G GQ GY    G G
Sbjct  614  TGAGQPGYGSQPGYGTQPGVGAQTG-TGQPGYGAQPGVGGQT----GAGQPGYGTQPGIG  668


 Score = 28.9 bits (63),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 52/102 (51%), Gaps = 15/102 (15%)

Query  42   SGYGQAGYGSQPAYGGQAGYGGQYGYSGAYGYGSPYGYGSKAYSPQGYGQQGYSYPSGYG  101
            +G GQ GYGSQP  GGQ G       +G  GYG+  G G++     G GQ GY    G G
Sbjct  512  TGAGQPGYGSQPGIGGQTG-------AGQPGYGTQPGVGAQT----GTGQPGYGAQPGVG  560

Query  102  T-AGYGGASYGSGYGQGYAYPSGYGSAGYGSGYG-GASYGSG  141
            T  G G   YGS  G G    +G G  GYG+  G GA  G+G
Sbjct  561  TQTGAGQPGYGSQPGIGGQ--TGAGQPGYGTQPGVGAQTGTG  600


 Score = 28.1 bits (61),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 61/121 (50%), Gaps = 19/121 (16%)

Query  40   GASGYGQAGYGSQPAYGGQA-----GYGGQYGY-----SGAYGYGSPYGYGSKAYSPQGY  89
            G +G GQ GYGSQP  GGQ      GYG Q G      +G  GYG+  G G++     G 
Sbjct  408  GQTGAGQPGYGSQPGIGGQTGARQPGYGSQPGVGAQTGAGQPGYGAQPGVGAQT----GA  463

Query  90   GQQGY-SYPSGYGTAGYGGASYGSGYGQGYAYPSGYGSAGYGSGYG-GASYGSGYGSGYG  147
            GQ GY S P   G  G G   YGS  G G    +G G  GYG+  G GA  G+G   GYG
Sbjct  464  GQPGYGSQPGIGGQTGAGQPGYGSQPGVGAQ--TGAGQPGYGAQPGVGAQTGAGQ-PGYG  520

Query  148  S  148
            S
Sbjct  521  S  521


 Score = 28.1 bits (61),  Expect = 3.7, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 27/49 (55%), Gaps = 6/49 (12%)

Query  40   GASGYGQAGYGSQPAYG-----GQAGYGGQYGYSGAYGYGSPYGYGSKA  83
            G +G GQ GYG+QP  G     GQ GYG Q G     G G P GYGS+ 
Sbjct  306  GQTGAGQPGYGTQPGVGAQTGTGQPGYGAQPGVGTQTGAGQP-GYGSQP  353


 Score = 27.3 bits (59),  Expect = 6.2, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 24/43 (56%), Gaps = 1/43 (2%)

Query  42   SGYGQAGYGSQPAYGGQAGYGGQYGYSGAYGYGSPYGYGSKAY  84
            +G GQ GYGSQP  GGQ G  GQ GY    G G+  G G   Y
Sbjct  342  TGAGQPGYGSQPGIGGQTGA-GQPGYGTQPGVGAQTGAGQPGY  383



Lambda      K        H
   0.312    0.126    0.348 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 26054445194


Query= XP_037024165.1 uncharacterized protein DDB_G0287625-like isoform X1
[Bradysia coprophila]

Length=1133
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8T3I6_DROME  unnamed protein product                                 147     2e-35
Q9W0D6_DROME  unnamed protein product                                 147     2e-35
Q9VGH5_DROME  unnamed protein product                                 50.4    7e-06


>Q8T3I6_DROME unnamed protein product
Length=984

 Score = 147 bits (370),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 76/88 (86%), Gaps = 0/88 (0%)

Query  1   MSVIIRLQNLPWSANASDVRGFFRGLGIPDGGVHIVGGENGDAFIAFSTDEDARQAMMLN  60
           MSVIIRLQNLPW+ANA D+R FF GL IP+GGVHI+GGE GDAFIAFSTDEDAR AM+ +
Sbjct  1   MSVIIRLQNLPWTANARDIRNFFSGLSIPEGGVHIIGGEMGDAFIAFSTDEDARCAMLKD  60

Query  61  GSKLKETQVHLLLSSRAEMQKVIETARQ  88
             KL E QV LLLSSRAEMQKVIETAR+
Sbjct  61  REKLMEIQVRLLLSSRAEMQKVIETARK  88


 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 56/81 (69%), Gaps = 0/81 (0%)

Query  1052  NLEGCIVGLSNVPFAATPRDIADFFGEYNLTPNDIIRRYNDDGSLTGEARVRFLTPMDAS  1111
             N  GC+V + NVPF A  +DI  FF +Y L+P+DIIRR+ND+G  TG+ RV F +P +A 
Sbjct  904   NRPGCVVAMRNVPFKAELKDIMRFFSDYKLSPDDIIRRFNDEGKPTGDTRVAFESPSEAR  963

Query  1112  KAIDRHQRERIGNRVIHLRLV  1132
              A +  ++++I NR ++L ++
Sbjct  964   SAFESRRKKQIFNRTVYLDII  984


 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 63/111 (57%), Gaps = 4/111 (4%)

Query  576  PVGLTLLIEDLPPFAKEQDIIKMFS-DFTLMDIMLT---KVNKAFLAYVKFHNQTDAEAA  631
            PV   L IEDLP    EQDI+KMFS  +T++DI+L+   K  +  +A+V F  + +A++A
Sbjct  473  PVTNVLYIEDLPQTTTEQDIMKMFSASYTVVDILLSPSPKNRRESVAFVLFAREAEADSA  532

Query  632  LKQTHLHRIDFKTVFVSPCSDETYERAKQEYDGIGDACGKPEVNTADEPTK  682
            L+ T  H I F+ + V   S+E  + AK++     +   K E +  +E  K
Sbjct  533  LQDTSKHYIGFRQLRVRSSSEEDMQNAKEKQRRANEQLLKEEADQREELLK  583


 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 48/83 (58%), Gaps = 2/83 (2%)

Query  397  SC-IRITNMNNRTHYAAIRKFFYGLQIPNDGIKLLNDENGKRTNDVVIRFARPDIARDAL  455
            +C IR++ M   T Y+ IRK+F G+ IP++GIK++   NG RT    + F+R   A+ A+
Sbjct  353  TCYIRMSGMCQNTSYSDIRKYFQGMYIPHNGIKIMM-VNGSRTGVAYVEFSRVSSAQKAV  411

Query  456  ALDGKLLNGNTVRITSITDGEYE  478
              +  +     ++I  + D E+E
Sbjct  412  QRNNTMFRDRLIQIVPVGDDEFE  434


 Score = 45.1 bits (105),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 44/84 (52%), Gaps = 4/84 (5%)

Query  811  VIFIGNVEYNTTEGDIVGFFADIGPPPEGVFFVKNARGQPCGDCYVKFRSADDATRALIK  870
            +I + N+ +     DI  FF+ +  P  GV  +    G   GD ++ F + +DA  A++K
Sbjct  4    IIRLQNLPWTANARDIRNFFSGLSIPEGGVHII----GGEMGDAFIAFSTDEDARCAMLK  59

Query  871  NRFRFRSRVIRVTLAEEAEAEKLL  894
            +R +     +R+ L+  AE +K++
Sbjct  60   DREKLMEIQVRLLLSSRAEMQKVI  83


 Score = 42.7 bits (99),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 47/91 (52%), Gaps = 3/91 (3%)

Query  2    SVIIRLQNLPWSANASDVRGFFRGLGIPDGGVHIV---GGENGDAFIAFSTDEDARQAMM  58
            +  IR+  +  + + SD+R +F+G+ IP  G+ I+   G   G A++ FS    A++A+ 
Sbjct  353  TCYIRMSGMCQNTSYSDIRKYFQGMYIPHNGIKIMMVNGSRTGVAYVEFSRVSSAQKAVQ  412

Query  59   LNGSKLKETQVHLLLSSRAEMQKVIETARQQ  89
             N +  ++  + ++     E +   E A +Q
Sbjct  413  RNNTMFRDRLIQIVPVGDDEFEMAEERASRQ  443


 Score = 40.0 bits (92),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 48/100 (48%), Gaps = 9/100 (9%)

Query  393  MSIGSCIRITNMNNRTHYAAIRKFFYGLQIPNDGIKLLNDENGKRTNDVVIRFARPDIAR  452
            MS+   IR+ N+    +   IR FF GL IP  G+ ++  E G    D  I F+  + AR
Sbjct  1    MSV--IIRLQNLPWTANARDIRNFFSGLSIPEGGVHIIGGEMG----DAFIAFSTDEDAR  54

Query  453  DALALDGKLLNGNTVRITSITDGEYENEVDSFQPPRKNAS  492
             A+  D + L    VR+   +  E +  +++    RK AS
Sbjct  55   CAMLKDREKLMEIQVRLLLSSRAEMQKVIET---ARKAAS  91


 Score = 36.2 bits (82),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 26/88 (30%), Positives = 39/88 (44%), Gaps = 8/88 (9%)

Query  785  QGRIDPRLQRNSSLPLPNLTN----NTNTKVIFIGNVEYNTTEGDIVGFFADIGPPPEGV  840
            QG++ P     S +P+P        N    V+ + NV +     DI+ FF+D    P+ +
Sbjct  883  QGQVKP----TSPVPVPTSIIPDKFNRPGCVVAMRNVPFKAELKDIMRFFSDYKLSPDDI  938

Query  841  FFVKNARGQPCGDCYVKFRSADDATRAL  868
                N  G+P GD  V F S  +A  A 
Sbjct  939  IRRFNDEGKPTGDTRVAFESPSEARSAF  966


 Score = 33.1 bits (74),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 36/77 (47%), Gaps = 1/77 (1%)

Query  807  TNTKVIFIGNVEYNTTEGDIVGFFADIGPPPEGVFFVKNARGQPCGDCYVKFRSADDATR  866
             +T  I +  +  NT+  DI  +F  +  P  G+  +    G   G  YV+F     A +
Sbjct  351  ADTCYIRMSGMCQNTSYSDIRKYFQGMYIPHNGIKIMM-VNGSRTGVAYVEFSRVSSAQK  409

Query  867  ALIKNRFRFRSRVIRVT  883
            A+ +N   FR R+I++ 
Sbjct  410  AVQRNNTMFRDRLIQIV  426


 Score = 32.3 bits (72),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 20/61 (33%), Positives = 30/61 (49%), Gaps = 2/61 (3%)

Query  396  GSCIRITNMNNRTHYAAIRKFFYGLQI-PNDGIKLLNDENGKRTNDVVIRFARPDIARDA  454
            G  + + N+  +     I +FF   ++ P+D I+  NDE GK T D  + F  P  AR A
Sbjct  907  GCVVAMRNVPFKAELKDIMRFFSDYKLSPDDIIRRFNDE-GKPTGDTRVAFESPSEARSA  965

Query  455  L  455
             
Sbjct  966  F  966


>Q9W0D6_DROME unnamed protein product
Length=985

 Score = 147 bits (370),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 76/88 (86%), Gaps = 0/88 (0%)

Query  1   MSVIIRLQNLPWSANASDVRGFFRGLGIPDGGVHIVGGENGDAFIAFSTDEDARQAMMLN  60
           MSVIIRLQNLPW+ANA D+R FF GL IP+GGVHI+GGE GDAFIAFSTDEDAR AM+ +
Sbjct  1   MSVIIRLQNLPWTANARDIRNFFSGLSIPEGGVHIIGGEMGDAFIAFSTDEDARCAMLKD  60

Query  61  GSKLKETQVHLLLSSRAEMQKVIETARQ  88
             KL E QV LLLSSRAEMQKVIETAR+
Sbjct  61  REKLMEIQVRLLLSSRAEMQKVIETARK  88


 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 56/81 (69%), Gaps = 0/81 (0%)

Query  1052  NLEGCIVGLSNVPFAATPRDIADFFGEYNLTPNDIIRRYNDDGSLTGEARVRFLTPMDAS  1111
             N  GC+V + NVPF A  +DI  FF +Y L+P+DIIRR+ND+G  TG+ RV F +P +A 
Sbjct  905   NRPGCVVAMRNVPFKAELKDIMRFFSDYKLSPDDIIRRFNDEGKPTGDTRVAFESPSEAR  964

Query  1112  KAIDRHQRERIGNRVIHLRLV  1132
              A +  ++++I NR ++L ++
Sbjct  965   SAFESRRKKQIFNRTVYLDII  985


 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 63/111 (57%), Gaps = 4/111 (4%)

Query  576  PVGLTLLIEDLPPFAKEQDIIKMFS-DFTLMDIMLT---KVNKAFLAYVKFHNQTDAEAA  631
            PV   L IEDLP    EQDI+KMFS  +T++DI+L+   K  +  +A+V F  + +A++A
Sbjct  473  PVTNVLYIEDLPQTTTEQDIMKMFSASYTVVDILLSPSPKNRRESVAFVLFAREAEADSA  532

Query  632  LKQTHLHRIDFKTVFVSPCSDETYERAKQEYDGIGDACGKPEVNTADEPTK  682
            L+ T  H I F+ + V   S+E  + AK++     +   K E +  +E  K
Sbjct  533  LQDTSKHYIGFRQLRVRSSSEEDMQNAKEKQRRANEQLLKEEADQREELLK  583


 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 48/83 (58%), Gaps = 2/83 (2%)

Query  397  SC-IRITNMNNRTHYAAIRKFFYGLQIPNDGIKLLNDENGKRTNDVVIRFARPDIARDAL  455
            +C IR++ M   T Y+ IRK+F G+ IP++GIK++   NG RT    + F+R   A+ A+
Sbjct  353  TCYIRMSGMCQNTSYSDIRKYFQGMYIPHNGIKIMM-VNGSRTGVAYVEFSRVSSAQKAV  411

Query  456  ALDGKLLNGNTVRITSITDGEYE  478
              +  +     ++I  + D E+E
Sbjct  412  QRNNTMFRDRLIQIVPVGDDEFE  434


 Score = 45.1 bits (105),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 44/84 (52%), Gaps = 4/84 (5%)

Query  811  VIFIGNVEYNTTEGDIVGFFADIGPPPEGVFFVKNARGQPCGDCYVKFRSADDATRALIK  870
            +I + N+ +     DI  FF+ +  P  GV  +    G   GD ++ F + +DA  A++K
Sbjct  4    IIRLQNLPWTANARDIRNFFSGLSIPEGGVHII----GGEMGDAFIAFSTDEDARCAMLK  59

Query  871  NRFRFRSRVIRVTLAEEAEAEKLL  894
            +R +     +R+ L+  AE +K++
Sbjct  60   DREKLMEIQVRLLLSSRAEMQKVI  83


 Score = 42.4 bits (98),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 47/91 (52%), Gaps = 3/91 (3%)

Query  2    SVIIRLQNLPWSANASDVRGFFRGLGIPDGGVHIV---GGENGDAFIAFSTDEDARQAMM  58
            +  IR+  +  + + SD+R +F+G+ IP  G+ I+   G   G A++ FS    A++A+ 
Sbjct  353  TCYIRMSGMCQNTSYSDIRKYFQGMYIPHNGIKIMMVNGSRTGVAYVEFSRVSSAQKAVQ  412

Query  59   LNGSKLKETQVHLLLSSRAEMQKVIETARQQ  89
             N +  ++  + ++     E +   E A +Q
Sbjct  413  RNNTMFRDRLIQIVPVGDDEFEMAEERASRQ  443


 Score = 40.0 bits (92),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 48/100 (48%), Gaps = 9/100 (9%)

Query  393  MSIGSCIRITNMNNRTHYAAIRKFFYGLQIPNDGIKLLNDENGKRTNDVVIRFARPDIAR  452
            MS+   IR+ N+    +   IR FF GL IP  G+ ++  E G    D  I F+  + AR
Sbjct  1    MSV--IIRLQNLPWTANARDIRNFFSGLSIPEGGVHIIGGEMG----DAFIAFSTDEDAR  54

Query  453  DALALDGKLLNGNTVRITSITDGEYENEVDSFQPPRKNAS  492
             A+  D + L    VR+   +  E +  +++    RK AS
Sbjct  55   CAMLKDREKLMEIQVRLLLSSRAEMQKVIET---ARKAAS  91


 Score = 36.2 bits (82),  Expect = 0.19, Method: Compositional matrix adjust.
 Identities = 26/88 (30%), Positives = 39/88 (44%), Gaps = 8/88 (9%)

Query  785  QGRIDPRLQRNSSLPLPNLTN----NTNTKVIFIGNVEYNTTEGDIVGFFADIGPPPEGV  840
            QG++ P     S +P+P        N    V+ + NV +     DI+ FF+D    P+ +
Sbjct  884  QGQVKP----TSPVPVPTSIIPDKFNRPGCVVAMRNVPFKAELKDIMRFFSDYKLSPDDI  939

Query  841  FFVKNARGQPCGDCYVKFRSADDATRAL  868
                N  G+P GD  V F S  +A  A 
Sbjct  940  IRRFNDEGKPTGDTRVAFESPSEARSAF  967


 Score = 33.1 bits (74),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 39/85 (46%), Gaps = 1/85 (1%)

Query  807  TNTKVIFIGNVEYNTTEGDIVGFFADIGPPPEGVFFVKNARGQPCGDCYVKFRSADDATR  866
             +T  I +  +  NT+  DI  +F  +  P  G+  +    G   G  YV+F     A +
Sbjct  351  ADTCYIRMSGMCQNTSYSDIRKYFQGMYIPHNGIK-IMMVNGSRTGVAYVEFSRVSSAQK  409

Query  867  ALIKNRFRFRSRVIRVTLAEEAEAE  891
            A+ +N   FR R+I++    + E E
Sbjct  410  AVQRNNTMFRDRLIQIVPVGDDEFE  434


 Score = 32.3 bits (72),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 20/61 (33%), Positives = 30/61 (49%), Gaps = 2/61 (3%)

Query  396  GSCIRITNMNNRTHYAAIRKFFYGLQI-PNDGIKLLNDENGKRTNDVVIRFARPDIARDA  454
            G  + + N+  +     I +FF   ++ P+D I+  NDE GK T D  + F  P  AR A
Sbjct  908  GCVVAMRNVPFKAELKDIMRFFSDYKLSPDDIIRRFNDE-GKPTGDTRVAFESPSEARSA  966

Query  455  L  455
             
Sbjct  967  F  967


>Q9VGH5_DROME unnamed protein product
Length=586

 Score = 50.4 bits (119),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 48/93 (52%), Gaps = 2/93 (2%)

Query  799  PLPNLTNNTNTKVIFIGNVEYNTTEGDIVGFFA--DIGPPPEGVFFVKNARGQPCGDCYV  856
             +  ++ +    V+ +  + Y  TE  I  FF+  DI    EG+ FV + RG+  G+ +V
Sbjct  135  AMRKISGHGTAFVVKLRGLPYAVTEQQIEEFFSGLDIKTDREGILFVMDRRGRATGEAFV  194

Query  857  KFRSADDATRALIKNRFRFRSRVIRVTLAEEAE  889
            +F S DD  +AL +NR +   R I +  +  AE
Sbjct  195  QFESQDDTEQALGRNREKIGHRYIEIFRSSIAE  227


 Score = 47.8 bits (112),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/98 (22%), Positives = 48/98 (49%), Gaps = 7/98 (7%)

Query  4    IIRLQNLPWSANASDVRGFFRGLGIPDG--GVHIV-----GGENGDAFIAFSTDEDARQA  56
             +RL+ LPWSA   ++  F   + + +G  G+H+V     G   G+A++  ++ ED  +A
Sbjct  50   FVRLRGLPWSATHKEILDFLENVNVTNGSAGIHLVTSRVDGKNTGEAYVEVASQEDVEEA  109

Query  57   MMLNGSKLKETQVHLLLSSRAEMQKVIETARQQTMSFM  94
              LN + +    + +  ++  E ++ +        +F+
Sbjct  110  RKLNKASMGHRYIEVFTATPKEAKEAMRKISGHGTAFV  147


 Score = 46.2 bits (108),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 45/85 (53%), Gaps = 6/85 (7%)

Query  2    SVIIRLQNLPWSANASDVRGFFRGLGIP---DGGVHIV---GGENGDAFIAFSTDEDARQ  55
            + +++L+ LP++     +  FF GL I    +G + ++   G   G+AF+ F + +D  Q
Sbjct  145  AFVVKLRGLPYAVTEQQIEEFFSGLDIKTDREGILFVMDRRGRATGEAFVQFESQDDTEQ  204

Query  56   AMMLNGSKLKETQVHLLLSSRAEMQ  80
            A+  N  K+    + +  SS AEM+
Sbjct  205  ALGRNREKIGHRYIEIFRSSIAEMK  229


 Score = 41.6 bits (96),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 25/76 (33%), Positives = 43/76 (57%), Gaps = 3/76 (4%)

Query  1056  CIVGLSNVPFAATPRDIADFFGEYNLTPN--DIIRRYNDDGSLTGEARVRFLTPMDASKA  1113
              +V L  +P+A T + I +FF   ++  +   I+   +  G  TGEA V+F +  D  +A
Sbjct  146   FVVKLRGLPYAVTEQQIEEFFSGLDIKTDREGILFVMDRRGRATGEAFVQFESQDDTEQA  205

Query  1114  IDRHQRERIGNRVIHL  1129
             + R+ RE+IG+R I +
Sbjct  206   LGRN-REKIGHRYIEI  220


 Score = 33.9 bits (76),  Expect = 0.92, Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 51/119 (43%), Gaps = 4/119 (3%)

Query  1018  GMRGNNYNRNNNSNNNSNSSNNSNNNSNNNNNQRNLEGCIVGLSNVPFAATPRDIADFFG  1077
             G +GN  N N++SN   +  +  N +              V L  +P++AT ++I DF  
Sbjct  11    GQQGNGDNFNDDSNQQQDEDDQYNEDGGGKIENVGESPKFVRLRGLPWSATHKEILDFLE  70

Query  1078  EYNLTPNDI---IRRYNDDGSLTGEARVRFLTPMDASKAIDRHQRERIGNRVIHLRLVT  1133
               N+T       +     DG  TGEA V   +  D  +A  +  +  +G+R I +   T
Sbjct  71    NVNVTNGSAGIHLVTSRVDGKNTGEAYVEVASQEDVEEA-RKLNKASMGHRYIEVFTAT  128



Lambda      K        H
   0.312    0.126    0.348 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 26054445194


Query= XP_037024166.1 gigasin-6-like [Bradysia coprophila]

Length=528
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RPB7_DICDI  unnamed protein product                                   29.3    5.5  
ERO1_CAEEL  unnamed protein product                                   29.3    9.5  


>RPB7_DICDI unnamed protein product
Length=172

 Score = 29.3 bits (64),  Expect = 5.5, Method: Composition-based stats.
 Identities = 26/89 (29%), Positives = 37/89 (42%), Gaps = 21/89 (24%)

Query  3    FSIFTLISIYLIASNFAFDAETERSIDNFVENVFMRNNEIPGVGLSVVRNGTVLISKGYG  62
             SIF  +S  LI S+  FDA++                    V   V  +G+  ISK   
Sbjct  104  LSIF--VSTQLIPSDMIFDAQS-------------------AVPCFVSEDGSSKISKDDE  142

Query  63   MRNITAGLTVDQNTLFAIGSTTKSFTAVL  91
            +R    G  VD   +FAIGS  + +  V+
Sbjct  143  VRLQIKGTRVDATEIFAIGSIREDYLGVI  171


>ERO1_CAEEL unnamed protein product
Length=478

 Score = 29.3 bits (64),  Expect = 9.5, Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 34/68 (50%), Gaps = 7/68 (10%)

Query  389  TNRSLEEIESKNRKFDNHFIEEHLFDG----HKANRVSTVLHY---SRIRNKVELNALQL  441
            T +++E++  + R + NHF E  +F G     +A R     H+   SRI + VE +  +L
Sbjct  333  TRKAVEDLLEEIRAYPNHFDESEMFTGVESHARALREEFRSHFVNISRIMDCVECDKCRL  392

Query  442  YFSEWAHG  449
            +     HG
Sbjct  393  WGKVQTHG  400



Lambda      K        H
   0.312    0.126    0.348 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 26054445194


Query= XP_037024167.1 keratin-associated protein 6-2-like [Bradysia
coprophila]

Length=135
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VTR6_DROME  unnamed protein product                                 42.0    5e-05
Q9U617_DROME  unnamed protein product                                 38.5    7e-04
Q7YU48_DROME  unnamed protein product                                 37.7    0.002


>Q9VTR6_DROME unnamed protein product
Length=1713

 Score = 42.0 bits (97),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 52/96 (54%), Gaps = 6/96 (6%)

Query  40    GASGYGSQPAYGGQAGYSGQAAYGGQYGYGSPYGYGSQYGYGSSPSRGYGQQGYGYPSGY  99
             G  GYG+QP +GGQ GY  Q   GGQ G G P GYGSQ G G     G GQ GYG   G+
Sbjct  964   GQPGYGAQPGFGGQPGYGNQPGVGGQTGAGQP-GYGSQPGIGG--QTGAGQPGYGAQPGF  1020

Query  100   --ASGYGSGYGS-GSYGYGQQGYGYPSGYGSGYGSG  132
                 GYG+  G  G  G GQ GYG   G G   G+G
Sbjct  1021  GGQLGYGNQPGVGGQTGAGQPGYGSQPGVGGQTGAG  1056


 Score = 38.1 bits (87),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 55/106 (52%), Gaps = 20/106 (19%)

Query  21    AESAVGGKVACEGYGAASYGASGYGSQPAYGGQAGYSGQAAYGGQYGYGSPYGYGSQYGY  80
             +++ VGG++          G  GYGSQP  GGQ G        GQ GYG+  G+G Q GY
Sbjct  936   SQTGVGGQIGA--------GQPGYGSQPGIGGQTGA-------GQPGYGAQPGFGGQPGY  980

Query  81    GSSPSRGYGQQGYGYPSGYASGYGSGYGSGSYGYGQQGYGYPSGYG  126
             G+ P  G GQ G G P GY S  G G   G  G GQ GYG   G+G
Sbjct  981   GNQPGVG-GQTGAGQP-GYGSQPGIG---GQTGAGQPGYGAQPGFG  1021


 Score = 37.4 bits (85),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 52/100 (52%), Gaps = 13/100 (13%)

Query  39   YGASGYGSQPAYG-----GQAGYSGQAAYGGQYGYGSPYGYGSQYGYGSSPSRGYGQQGY  93
             G  GYG+QP  G     GQ GY  Q   GGQ G G P GYG+Q G G+    G GQ GY
Sbjct  548  TGQPGYGAQPGVGTQTGAGQPGYGSQPGIGGQTGAGQP-GYGTQPGVGA--QTGTGQPGY  604

Query  94   GYPSGYASGYGSGYGSGSYGYG-QQGYGYPSGYGSGYGSG  132
                G   G G+  G+G  GYG Q GYG   G G+  G+G
Sbjct  605  ----GAQPGVGTQTGAGQPGYGSQPGYGTQPGVGAQTGTG  640


 Score = 36.6 bits (83),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 54/106 (51%), Gaps = 16/106 (15%)

Query  40   GASGYGSQPAYG-----GQAGYSGQAAYGGQYGYGSPYGYGSQYGYGSSPSRGYGQQGYG  94
            G  GYG+QP  G     GQ GY  Q   GGQ G G P GYGSQ G G+    G GQ GYG
Sbjct  447  GQPGYGAQPGVGAQTGAGQPGYGSQPGIGGQTGAGQP-GYGSQPGVGA--QTGAGQPGYG  503

Query  95   YPSGYASGYGS---GYGS-----GSYGYGQQGYGYPSGYGSGYGSG  132
               G  +  G+   GYGS     G  G GQ GYG   G G+  G+G
Sbjct  504  AQPGVGAQTGAGQPGYGSQPGIGGQTGAGQPGYGTQPGVGAQTGTG  549


 Score = 34.7 bits (78),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 57/117 (49%), Gaps = 17/117 (15%)

Query  30   ACEGYGAAS-YGASGYGSQPAYGGQAG-----YSGQAAYGGQYGYGSPYGYGSQYGYGSS  83
            A  G GA +  G  GYGSQP  GGQ G     Y  Q   G Q G G P GYG+Q G G+ 
Sbjct  504  AQPGVGAQTGAGQPGYGSQPGIGGQTGAGQPGYGTQPGVGAQTGTGQP-GYGAQPGVGT-  561

Query  84   PSRGYGQQGYGYPSGY-------ASGYGSGYGSGS-YGYGQQGYGYPSGYGSGYGSG  132
               G GQ GYG   G          GYG+  G G+  G GQ GYG   G G+  G+G
Sbjct  562  -QTGAGQPGYGSQPGIGGQTGAGQPGYGTQPGVGAQTGTGQPGYGAQPGVGTQTGAG  617


 Score = 33.9 bits (76),  Expect = 0.035, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 50/101 (50%), Gaps = 16/101 (16%)

Query  39   YGASGYGSQPAYG-----GQAGYSGQAAYGGQYGYGSPYGYGSQYGYGSSPSRGYGQQGY  93
             G  GYG+QP  G     GQ GY  Q   GGQ G G P GYG+Q G G+    G GQ GY
Sbjct  327  TGQPGYGAQPGVGTQTGAGQPGYGSQPGIGGQTGAGQP-GYGTQPGVGA--QTGAGQPGY  383

Query  94   GYPSGYASGYGS---GYGS-----GSYGYGQQGYGYPSGYG  126
            G   G  +  G+   GYGS     G  G GQ GYG   G G
Sbjct  384  GAQPGVGAQTGAGQPGYGSQPGIGGQTGAGQPGYGSQPGIG  424


 Score = 32.7 bits (73),  Expect = 0.078, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 49/102 (48%), Gaps = 19/102 (19%)

Query  37   ASYGASGYGSQPAYG-----GQAGYSGQAAYGGQYGYGSPYGYGSQYGYGSSPSRGYGQQ  91
            A  G  GYG QP  G     GQ GY  Q   GGQ G G P GYGSQ G G       GQ 
Sbjct  155  AGAGQPGYGDQPGVGTQPGVGQPGYGSQPGIGGQTGAGQP-GYGSQPGIG-------GQT  206

Query  92   GYGYPSGYASGYGSGYGSGS-YGYGQQGYGYPSGYGSGYGSG  132
            G G P     GYGS    G+  G GQ GYG   G G+  G+G
Sbjct  207  GAGQP-----GYGSQPVVGAQTGTGQPGYGAQPGVGTQTGAG  243


 Score = 32.0 bits (71),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 56/121 (46%), Gaps = 29/121 (24%)

Query  40   GASGYGSQPAYG-----GQAGYSGQAAYGGQYGYGSPYGYGSQY-----------GYGSS  83
            G  GYG+QP  G     GQ GY  Q   GGQ G G P GYGSQ            GYGS 
Sbjct  379  GQPGYGAQPGVGAQTGAGQPGYGSQPGIGGQTGAGQP-GYGSQPGIGGQTGARQPGYGSQ  437

Query  84   P----SRGYGQQGYGYPSGYASGYGS---GYGS-----GSYGYGQQGYGYPSGYGSGYGS  131
            P      G GQ GYG   G  +  G+   GYGS     G  G GQ GYG   G G+  G+
Sbjct  438  PGVGAQTGAGQPGYGAQPGVGAQTGAGQPGYGSQPGIGGQTGAGQPGYGSQPGVGAQTGA  497

Query  132  G  132
            G
Sbjct  498  G  498


 Score = 30.8 bits (68),  Expect = 0.35, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 33/66 (50%), Gaps = 14/66 (21%)

Query  40   GASGYGSQPAYG-----------GQAGYSGQAAYGGQYGYGSPYGYGSQYGYGSSPSRGY  88
            G  GYGSQP YG           GQ GY  Q   GGQ G G P GYG+Q G G     G 
Sbjct  617  GQPGYGSQPGYGTQPGVGAQTGTGQPGYGAQPGVGGQTGAGQP-GYGTQPGIGGQ--TGA  673

Query  89   GQQGYG  94
            GQ GYG
Sbjct  674  GQPGYG  679


 Score = 30.8 bits (68),  Expect = 0.36, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 51/107 (48%), Gaps = 16/107 (15%)

Query  39   YGASGYGSQPAYG-----GQAGYSGQAAYGGQYGYGSPYGYGSQYGYGSSPSRGYGQQGY  93
             G  GYG+QP  G     GQ GY  Q   GGQ G   P GY +Q G G+    G GQ GY
Sbjct  225  TGQPGYGAQPGVGTQTGAGQPGYGSQPGIGGQTGARQP-GYVTQPGVGA--QTGIGQPGY  281

Query  94   GYPSGYASGYGS---GYGS-----GSYGYGQQGYGYPSGYGSGYGSG  132
            G   G     G+   GYGS     G  G GQ GYG   G G+  G+G
Sbjct  282  GAQPGILGQTGAGQPGYGSQPGIGGQTGAGQPGYGTQPGVGAQTGTG  328


 Score = 28.9 bits (63),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 50/116 (43%), Gaps = 31/116 (27%)

Query  40   GASGYGSQPAYGGQAG-----YSGQAAYGGQYGYGSP----------------YGYGSQY  78
            G  GYGSQP  GGQ G     Y  Q   G Q G G P                 GYGSQ 
Sbjct  243  GQPGYGSQPGIGGQTGARQPGYVTQPGVGAQTGIGQPGYGAQPGILGQTGAGQPGYGSQP  302

Query  79   GYGSSPSRGYGQQGYGYPS-GYASGYGSGYGSGSYGYG-QQGYGYPSGYG-SGYGS  131
            G G       GQ G G P  G   G G+  G+G  GYG Q G G  +G G  GYGS
Sbjct  303  GIG-------GQTGAGQPGYGTQPGVGAQTGTGQPGYGAQPGVGTQTGAGQPGYGS  351


 Score = 28.1 bits (61),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 43/91 (47%), Gaps = 19/91 (21%)

Query  43   GYGSQPAYGGQAGYSG-------QAAYGGQYGYGSPYGYGSQYGYGSSPSRGYGQQGYGY  95
            G+  QP  GGQ G SG       Q   GGQ   G P GYGSQ G G       GQ G G 
Sbjct  897  GFIGQPGIGGQTGTSGRQPGYGTQPGIGGQTAAGQP-GYGSQTGVG-------GQIGAGQ  948

Query  96   PSGYASGYGSGYGSGSYGYGQQGYGYPSGYG  126
            P GY S  G G   G  G GQ GYG   G+G
Sbjct  949  P-GYGSQPGIG---GQTGAGQPGYGAQPGFG  975


>Q9U617_DROME unnamed protein product
Length=1729

 Score = 38.5 bits (88),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 33/56 (59%), Gaps = 3/56 (5%)

Query  40    GASGYGSQPAYGGQAGYSGQAAYGGQYGYGSPYGYGSQYGYGSSPSRGYGQQGYGY  95
             G  GYG+QP +GGQ GY  Q   GGQ G G P GYGSQ G G     G GQ GYG 
Sbjct  1043  GQPGYGAQPGFGGQPGYGNQPGVGGQTGAGQP-GYGSQPGVGG--QTGAGQPGYGV  1095


 Score = 36.2 bits (82),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 44/101 (44%), Positives = 52/101 (51%), Gaps = 20/101 (20%)

Query  21    AESAVGGKVACEGYGAASYGASGYGSQPAYGGQAGYSGQAAYGGQYGYGSPYGYGSQYGY  80
             +++ VGG++          G  GYGSQP  GGQ G        GQ GYG+  G+G Q GY
Sbjct  1015  SQTGVGGQIGA--------GQPGYGSQPGIGGQTGA-------GQPGYGAQPGFGGQPGY  1059

Query  81    GSSPSRGYGQQGYGYPSGYASGYGSGYGSGSYGYGQQGYGY  121
             G+ P  G GQ G G P GY S  G G   G  G GQ GYG 
Sbjct  1060  GNQPGVG-GQTGAGQP-GYGSQPGVG---GQTGAGQPGYGV  1095


 Score = 36.2 bits (82),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 50/100 (50%), Gaps = 16/100 (16%)

Query  40   GASGYGSQPAYGGQAG-----YSGQAAYGGQYGYGSPYGYGSQYGYGSSPSRGYGQQGYG  94
            G  GYGSQP  GGQ G     Y  Q   GGQ G G P GYG+Q G G+    G GQ GYG
Sbjct  549  GQPGYGSQPGIGGQTGAGQPGYGSQPGIGGQTGAGQP-GYGTQPGVGA--QTGTGQPGYG  605

Query  95   YPSGYASGYGS---GYGS-----GSYGYGQQGYGYPSGYG  126
               G  +  G+   GYGS     G  G GQ GYG   G G
Sbjct  606  SQPGVGTQIGAGQPGYGSQPGIGGQTGAGQPGYGSQPGIG  645


 Score = 35.8 bits (81),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 52/106 (49%), Gaps = 16/106 (15%)

Query  40   GASGYGSQPAYG-----GQAGYSGQAAYGGQYGYGSPYGYGSQYGYGSSPSRGYGQQGYG  94
            G  GYGSQP  G     GQ GY  Q   GGQ G G P GYGSQ G G     G GQ GYG
Sbjct  481  GQPGYGSQPGIGAQTGAGQPGYGSQPGIGGQTGAGQP-GYGSQPGIGG--QTGAGQPGYG  537

Query  95   YPSGYASGYGS---GYGS-----GSYGYGQQGYGYPSGYGSGYGSG  132
               G  +  G+   GYGS     G  G GQ GYG   G G   G+G
Sbjct  538  TQPGIGAQTGAGQPGYGSQPGIGGQTGAGQPGYGSQPGIGGQTGAG  583


 Score = 34.7 bits (78),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 51/106 (48%), Gaps = 16/106 (15%)

Query  40   GASGYGSQPAYGGQAG-----YSGQAAYGGQYGYGSPYGYGSQYGYGSSPSRGYGQQGYG  94
            G  GYGSQP  GGQ G     Y  Q   GGQ G G P GYGSQ G G     G GQ GYG
Sbjct  243  GQPGYGSQPGIGGQTGAGQPGYGSQPGIGGQTGAGQP-GYGSQPGIGG--QTGAGQPGYG  299

Query  95   YPSGYASGYGS---GYGS-----GSYGYGQQGYGYPSGYGSGYGSG  132
               G     G+   GYGS     G  G GQ GYG   G G   G+G
Sbjct  300  TQPGIGGQTGAGQPGYGSQPGIGGQTGAGQPGYGSQPGIGGQTGAG  345


 Score = 34.3 bits (77),  Expect = 0.025, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 51/106 (48%), Gaps = 16/106 (15%)

Query  40   GASGYGSQPAYGGQAG-----YSGQAAYGGQYGYGSPYGYGSQYGYGSSPSRGYGQQGYG  94
            G  GYGSQP  GGQ G     Y  Q   GGQ G G P GYG+Q G G     G GQ GYG
Sbjct  260  GQPGYGSQPGIGGQTGAGQPGYGSQPGIGGQTGAGQP-GYGTQPGIGG--QTGAGQPGYG  316

Query  95   YPSGYASGYGS---GYGS-----GSYGYGQQGYGYPSGYGSGYGSG  132
               G     G+   GYGS     G  G GQ GYG   G G   G+G
Sbjct  317  SQPGIGGQTGAGQPGYGSQPGIGGQTGAGQPGYGTQPGIGGQTGAG  362


 Score = 33.9 bits (76),  Expect = 0.030, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 52/106 (49%), Gaps = 16/106 (15%)

Query  40   GASGYGSQPAYG-----GQAGYSGQAAYGGQYGYGSPYGYGSQYGYGSSPSRGYGQQGYG  94
            G  GYG+QP  G     GQ GY  Q   GGQ G G P GYG+Q G G     G GQ GYG
Sbjct  430  GQPGYGTQPGIGAQTGAGQPGYGTQPGIGGQTGAGQP-GYGTQPGIGV--QTGAGQPGYG  486

Query  95   YPSGYASGYGS---GYGS-----GSYGYGQQGYGYPSGYGSGYGSG  132
               G  +  G+   GYGS     G  G GQ GYG   G G   G+G
Sbjct  487  SQPGIGAQTGAGQPGYGSQPGIGGQTGAGQPGYGSQPGIGGQTGAG  532


 Score = 33.5 bits (75),  Expect = 0.036, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 60/126 (48%), Gaps = 26/126 (21%)

Query  21   AESAVGGKVAC--EGYGA-------ASYGASGYGSQPAYG-----GQAGYSGQAAYGGQY  66
            ++  +GG+ A    GYG+       A  G  GYG+QP  G     GQ GY  Q   GGQ 
Sbjct  147  SQPGIGGQTATGQPGYGSQLGVGAQAGAGQPGYGAQPGVGAQTGAGQPGYGSQTGIGGQT  206

Query  67   GYGSPYGYGSQYGYGSSPSRGYGQQGYGYPSGYASGYGSGYGSGSYGYGQQGYGYPSGYG  126
            G G P GYGSQ G G       GQ G G P GY S  G G   G  G GQ GYG   G G
Sbjct  207  GAGQP-GYGSQPGIG-------GQTGAGQP-GYGSQPGIG---GQTGAGQPGYGSQPGIG  254

Query  127  SGYGSG  132
               G+G
Sbjct  255  GQTGAG  260


 Score = 33.5 bits (75),  Expect = 0.036, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 41/83 (49%), Gaps = 12/83 (14%)

Query  40   GASGYGSQPAYGGQAG-----YSGQAAYGGQYGYGSPYGYGSQYGYGSSPSRGYGQQGYG  94
            G  GYG+QP  GGQ G     Y  Q   GGQ G G P GYGSQ G G     G GQ GY 
Sbjct  294  GQPGYGTQPGIGGQTGAGQPGYGSQPGIGGQTGAGQP-GYGSQPGIGGQ--TGAGQPGY-  349

Query  95   YPSGYASGYGSGYGSGSYGYGQQ  117
               G   G G   G+G  GYG Q
Sbjct  350  ---GTQPGIGGQTGAGQPGYGTQ  369


 Score = 33.1 bits (74),  Expect = 0.054, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 49/95 (52%), Gaps = 14/95 (15%)

Query  44   YGSQPAYGGQAG-----YSGQAAYGGQYGYGSPYGYGSQYGYGSSPSRGYGQQGYGYPSG  98
            YGSQP  GGQ G     Y  Q   GGQ G G P GYG+Q G G+    G GQ GY    G
Sbjct  400  YGSQPGIGGQTGAGQPGYGTQPGIGGQTGAGQP-GYGTQPGIGA--QTGAGQPGY----G  452

Query  99   YASGYGSGYGSGSYGYGQQ-GYGYPSGYG-SGYGS  131
               G G   G+G  GYG Q G G  +G G  GYGS
Sbjct  453  TQPGIGGQTGAGQPGYGTQPGIGVQTGAGQPGYGS  487


 Score = 33.1 bits (74),  Expect = 0.056, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 41/85 (48%), Gaps = 14/85 (16%)

Query  39   YGASGYGSQPAYG-----GQAGYSGQAAYGGQYGYGSPYGYGSQYGYGSSPSRGYGQQGY  93
             G  GYGSQP  G     GQ GY  Q   GGQ G G P GYGSQ G G       GQ G 
Sbjct  599  TGQPGYGSQPGVGTQIGAGQPGYGSQPGIGGQTGAGQP-GYGSQPGIG-------GQTGA  650

Query  94   GYPS-GYASGYGSGYGSGSYGYGQQ  117
              P  G   G G+  G+G  GYG Q
Sbjct  651  AQPGYGTQPGVGAQTGTGQPGYGAQ  675


 Score = 31.2 bits (69),  Expect = 0.23, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 50/106 (47%), Gaps = 16/106 (15%)

Query  40   GASGYGSQPAYGGQAG-----YSGQAAYGGQYGYGSPYGYGSQYGYGSSPSRGYGQQGYG  94
            G  GYG+QP  GGQ G     Y  Q   G Q G G P GYG+Q G G     G GQ GYG
Sbjct  413  GQPGYGTQPGIGGQTGAGQPGYGTQPGIGAQTGAGQP-GYGTQPGIGG--QTGAGQPGYG  469

Query  95   YPSGY-------ASGYGSGYGSGS-YGYGQQGYGYPSGYGSGYGSG  132
               G          GYGS  G G+  G GQ GYG   G G   G+G
Sbjct  470  TQPGIGVQTGAGQPGYGSQPGIGAQTGAGQPGYGSQPGIGGQTGAG  515


 Score = 29.3 bits (64),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 46/91 (51%), Gaps = 7/91 (8%)

Query  43    GYGSQPAYGGQAGYSG-QAAYGGQYGYGSPYGYGSQYGYGSSPSRGYGQQGYGYPSGYAS  101
             G+  QP  GGQ G SG Q  YG Q G G     G Q GYGS P  G GQ G G P GY S
Sbjct  959   GFIGQPGIGGQTGTSGRQPGYGTQPGIGGQTAAG-QPGYGSQPGIG-GQTGAGQP-GYGS  1015

Query  102   GYGSGYGSGSYGYGQQGYGYPSGYGSGYGSG  132
               G G   G  G GQ GYG   G G   G+G
Sbjct  1016  QTGVG---GQIGAGQPGYGSQPGIGGQTGAG  1043


 Score = 28.5 bits (62),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 25/46 (54%), Gaps = 6/46 (13%)

Query  40   GASGYGSQPAYGGQAG-----YSGQAAYGGQYGYGSPYGYGSQYGY  80
            G  GYGSQP  GGQ G     Y  Q   GGQ G G P GYG+Q G 
Sbjct  328  GQPGYGSQPGIGGQTGAGQPGYGTQPGIGGQTGAGQP-GYGTQPGI  372


>Q7YU48_DROME unnamed protein product
Length=1071

 Score = 37.7 bits (86),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 52/100 (52%), Gaps = 13/100 (13%)

Query  39   YGASGYGSQPAYG-----GQAGYSGQAAYGGQYGYGSPYGYGSQYGYGSSPSRGYGQQGY  93
             G  GYG+QP  G     GQ GY  Q   GGQ G G P GYG+Q G G+    G GQ GY
Sbjct  548  TGQPGYGAQPGVGTQTGAGQPGYGSQPGIGGQTGAGQP-GYGTQPGVGA--QTGTGQPGY  604

Query  94   GYPSGYASGYGSGYGSGSYGYG-QQGYGYPSGYGSGYGSG  132
                G   G G+  G+G  GYG Q GYG   G G+  G+G
Sbjct  605  ----GAQPGVGTQTGAGQPGYGSQPGYGTQPGVGAQTGTG  640


 Score = 36.6 bits (83),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 54/106 (51%), Gaps = 16/106 (15%)

Query  40   GASGYGSQPAYG-----GQAGYSGQAAYGGQYGYGSPYGYGSQYGYGSSPSRGYGQQGYG  94
            G  GYG+QP  G     GQ GY  Q   GGQ G G P GYGSQ G G+    G GQ GYG
Sbjct  447  GQPGYGAQPGVGAQTGAGQPGYGSQPGIGGQTGAGQP-GYGSQPGVGA--QTGAGQPGYG  503

Query  95   YPSGYASGYGS---GYGS-----GSYGYGQQGYGYPSGYGSGYGSG  132
               G  +  G+   GYGS     G  G GQ GYG   G G+  G+G
Sbjct  504  AQPGVGAQTGAGQPGYGSQPGIGGQTGAGQPGYGTQPGVGAQTGTG  549


 Score = 34.7 bits (78),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 57/117 (49%), Gaps = 17/117 (15%)

Query  30   ACEGYGAAS-YGASGYGSQPAYGGQAG-----YSGQAAYGGQYGYGSPYGYGSQYGYGSS  83
            A  G GA +  G  GYGSQP  GGQ G     Y  Q   G Q G G P GYG+Q G G+ 
Sbjct  504  AQPGVGAQTGAGQPGYGSQPGIGGQTGAGQPGYGTQPGVGAQTGTGQP-GYGAQPGVGT-  561

Query  84   PSRGYGQQGYGYPSGY-------ASGYGSGYGSGS-YGYGQQGYGYPSGYGSGYGSG  132
               G GQ GYG   G          GYG+  G G+  G GQ GYG   G G+  G+G
Sbjct  562  -QTGAGQPGYGSQPGIGGQTGAGQPGYGTQPGVGAQTGTGQPGYGAQPGVGTQTGAG  617


 Score = 33.5 bits (75),  Expect = 0.035, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 50/101 (50%), Gaps = 16/101 (16%)

Query  39   YGASGYGSQPAYG-----GQAGYSGQAAYGGQYGYGSPYGYGSQYGYGSSPSRGYGQQGY  93
             G  GYG+QP  G     GQ GY  Q   GGQ G G P GYG+Q G G+    G GQ GY
Sbjct  327  TGQPGYGAQPGVGTQTGAGQPGYGSQPGIGGQTGAGQP-GYGTQPGVGA--QTGAGQPGY  383

Query  94   GYPSGYASGYGS---GYGS-----GSYGYGQQGYGYPSGYG  126
            G   G  +  G+   GYGS     G  G GQ GYG   G G
Sbjct  384  GAQPGVGAQTGAGQPGYGSQPGIGGQTGAGQPGYGSQPGIG  424


 Score = 32.3 bits (72),  Expect = 0.089, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 49/102 (48%), Gaps = 19/102 (19%)

Query  37   ASYGASGYGSQPAYG-----GQAGYSGQAAYGGQYGYGSPYGYGSQYGYGSSPSRGYGQQ  91
            A  G  GYG QP  G     GQ GY  Q   GGQ G G P GYGSQ G G       GQ 
Sbjct  155  AGAGQPGYGDQPGVGTQPGVGQPGYGSQPGIGGQTGAGQP-GYGSQPGIG-------GQT  206

Query  92   GYGYPSGYASGYGSGYGSGS-YGYGQQGYGYPSGYGSGYGSG  132
            G G P     GYGS    G+  G GQ GYG   G G+  G+G
Sbjct  207  GAGQP-----GYGSQPVVGAQTGTGQPGYGAQPGVGTQTGAG  243


 Score = 32.0 bits (71),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 56/121 (46%), Gaps = 29/121 (24%)

Query  40   GASGYGSQPAYG-----GQAGYSGQAAYGGQYGYGSPYGYGSQY-----------GYGSS  83
            G  GYG+QP  G     GQ GY  Q   GGQ G G P GYGSQ            GYGS 
Sbjct  379  GQPGYGAQPGVGAQTGAGQPGYGSQPGIGGQTGAGQP-GYGSQPGIGGQTGARQPGYGSQ  437

Query  84   P----SRGYGQQGYGYPSGYASGYGS---GYGS-----GSYGYGQQGYGYPSGYGSGYGS  131
            P      G GQ GYG   G  +  G+   GYGS     G  G GQ GYG   G G+  G+
Sbjct  438  PGVGAQTGAGQPGYGAQPGVGAQTGAGQPGYGSQPGIGGQTGAGQPGYGSQPGVGAQTGA  497

Query  132  G  132
            G
Sbjct  498  G  498


 Score = 30.8 bits (68),  Expect = 0.31, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 33/66 (50%), Gaps = 14/66 (21%)

Query  40   GASGYGSQPAYG-----------GQAGYSGQAAYGGQYGYGSPYGYGSQYGYGSSPSRGY  88
            G  GYGSQP YG           GQ GY  Q   GGQ G G P GYG+Q G G     G 
Sbjct  617  GQPGYGSQPGYGTQPGVGAQTGTGQPGYGAQPGVGGQTGAGQP-GYGTQPGIGGQ--TGA  673

Query  89   GQQGYG  94
            GQ GYG
Sbjct  674  GQPGYG  679


 Score = 30.4 bits (67),  Expect = 0.39, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 51/107 (48%), Gaps = 16/107 (15%)

Query  39   YGASGYGSQPAYG-----GQAGYSGQAAYGGQYGYGSPYGYGSQYGYGSSPSRGYGQQGY  93
             G  GYG+QP  G     GQ GY  Q   GGQ G   P GY +Q G G+    G GQ GY
Sbjct  225  TGQPGYGAQPGVGTQTGAGQPGYGSQPGIGGQTGARQP-GYVTQPGVGA--QTGIGQPGY  281

Query  94   GYPSGYASGYGS---GYGS-----GSYGYGQQGYGYPSGYGSGYGSG  132
            G   G     G+   GYGS     G  G GQ GYG   G G+  G+G
Sbjct  282  GAQPGILGQTGAGQPGYGSQPGIGGQTGAGQPGYGTQPGVGAQTGTG  328


 Score = 28.9 bits (63),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 47/115 (41%), Positives = 50/115 (43%), Gaps = 29/115 (25%)

Query  40   GASGYGSQPAYGGQAG-----YSGQAAYGGQYGYGSP----------------YGYGSQY  78
            G  GYGSQP  GGQ G     Y  Q   G Q G G P                 GYGSQ 
Sbjct  243  GQPGYGSQPGIGGQTGARQPGYVTQPGVGAQTGIGQPGYGAQPGILGQTGAGQPGYGSQP  302

Query  79   GYGSSPSRGYGQQGYGYPSGYASGYGSGYGSGSYGYG-QQGYGYPSGYG-SGYGS  131
            G G     G GQ GY    G   G G+  G+G  GYG Q G G  +G G  GYGS
Sbjct  303  GIGG--QTGAGQPGY----GTQPGVGAQTGTGQPGYGAQPGVGTQTGAGQPGYGS  351



Lambda      K        H
   0.312    0.126    0.348 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 26054445194


Query= XP_037024168.1 keratin, type II cytoskeletal 3-like [Bradysia
coprophila]

Length=133
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8IBZ6_PLAF7  unnamed protein product                                 34.3    0.021
Q383G9_TRYB2  unnamed protein product                                 29.6    0.84 


>Q8IBZ6_PLAF7 unnamed protein product
Length=2729

 Score = 34.3 bits (77),  Expect = 0.021, Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 0/55 (0%)

Query  32   ESYGGASGYGSPSGYSSPSSYGSPSSFGSPSSFGSPAGFDGPPTFGNPASFGGPG  86
            +SYG    YG    Y S  SYGS  S+G   S+GS   +    ++GN  S+G   
Sbjct  327  KSYGSNKSYGINKSYGSNKSYGSNKSYGINKSYGSNKSYGSNKSYGNNKSYGNNN  381


 Score = 31.2 bits (69),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 0/57 (0%)

Query  32   ESYGGASGYGSPSGYSSPSSYGSPSSFGSPSSFGSPAGFDGPPTFGNPASFGGPGGF  88
            +SYG    YGS   Y    SYGS  S+GS  S+G    +    ++G+  S+G    +
Sbjct  321  KSYGINKSYGSNKSYGINKSYGSNKSYGSNKSYGINKSYGSNKSYGSNKSYGNNKSY  377


 Score = 30.0 bits (66),  Expect = 0.57, Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 0/57 (0%)

Query  32   ESYGGASGYGSPSGYSSPSSYGSPSSFGSPSSFGSPAGFDGPPTFGNPASFGGPGGF  88
            +SYG    YG    Y S  SYG   S+GS  S+GS   +    ++G+  S+G    +
Sbjct  315  KSYGINKSYGINKSYGSNKSYGINKSYGSNKSYGSNKSYGINKSYGSNKSYGSNKSY  371


 Score = 28.5 bits (62),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 22/82 (27%), Positives = 38/82 (46%), Gaps = 1/82 (1%)

Query  22   ESAIGGKVACESYGGASG-YGSPSGYSSPSSYGSPSSFGSPSSFGSPAGFDGPPTFGNPA  80
            +  +  K++ E Y G++  YG    Y    SYGS  S+G   S+GS   +    ++G   
Sbjct  298  DQHVYDKMSDEKYNGSNKSYGINKSYGINKSYGSNKSYGINKSYGSNKSYGSNKSYGINK  357

Query  81   SFGGPGGFCGPPNFGGQYGYGS  102
            S+G    +    ++G    YG+
Sbjct  358  SYGSNKSYGSNKSYGNNKSYGN  379


>Q383G9_TRYB2 unnamed protein product
Length=1464

 Score = 29.6 bits (65),  Expect = 0.84, Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 36/81 (44%), Gaps = 6/81 (7%)

Query  47   SSPSSYGSPSSFGSPSSFGSPAGFDGPPTFGN------PASFGGPGGFCGPPNFGGQYGY  100
              P ++G  ++   P +FG  A  D PP FG       P +FG       PP FG     
Sbjct  336  DKPPAFGQGAAADKPLAFGQGATADKPPAFGQGVTADKPPAFGQGAAADKPPAFGQGVTA  395

Query  101  GSTPSRGPGYSSGFGSGFGSG  121
            G+TP+ G G ++     FG G
Sbjct  396  GTTPAFGQGVTADKPPAFGQG  416


 Score = 29.3 bits (64),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 26/85 (31%), Positives = 39/85 (46%), Gaps = 6/85 (7%)

Query  47   SSPSSYGSPSSFGSPSSFGSPAGFDGPPTFGN------PASFGGPGGFCGPPNFGGQYGY  100
              P ++G  ++ G+  +FG     D PP FG       P +FG       PP FG     
Sbjct  660  DKPPAFGQGAAAGTTPAFGQGVNADKPPAFGQGAAADKPPAFGQGAAADKPPAFGQGAAA  719

Query  101  GSTPSRGPGYSSGFGSGFGSGSGSG  125
            G+TP+ G G ++     FG G+ +G
Sbjct  720  GTTPAFGQGVNADKPPAFGQGAAAG  744


 Score = 28.5 bits (62),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 36/81 (44%), Gaps = 6/81 (7%)

Query  47   SSPSSYGSPSSFGSPSSFGSPAGFDGPPTFGNPASFGGPGGF------CGPPNFGGQYGY  100
              P ++G  ++   P +FG  A  D PP FG  A+ G    F        PP FG     
Sbjct  684  DKPPAFGQGAAADKPPAFGQGAAADKPPAFGQGAAAGTTPAFGQGVNADKPPAFGQGAAA  743

Query  101  GSTPSRGPGYSSGFGSGFGSG  121
            G+TP+ G G ++     FG G
Sbjct  744  GTTPAFGQGVTADKTPAFGQG  764


 Score = 27.3 bits (59),  Expect = 4.5, Method: Compositional matrix adjust.
 Identities = 29/104 (28%), Positives = 41/104 (39%), Gaps = 18/104 (17%)

Query  40   YGSPSGYSSPSSYGSPSSFGSPSSFGSPAGFDGPPTFGN------------------PAS  81
            +G  +    P ++G   +   P +FG  A  D PP FG                   P +
Sbjct  353  FGQGATADKPPAFGQGVTADKPPAFGQGAAADKPPAFGQGVTAGTTPAFGQGVTADKPPA  412

Query  82   FGGPGGFCGPPNFGGQYGYGSTPSRGPGYSSGFGSGFGSGSGSG  125
            FG       PP FG     G+TP+ G G ++G    FG G  +G
Sbjct  413  FGQGVNADKPPAFGQGVNAGTTPAFGQGVTAGTTPAFGQGVTAG  456


 Score = 27.3 bits (59),  Expect = 5.3, Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 32/71 (45%), Gaps = 6/71 (8%)

Query  51   SYGSPSSFGSPSSFGSPAGFDGPPTFGNPASFGGPGGFCGPPNFGGQYGYGSTPSRGPGY  110
            ++G   +   P +FG  A  D PP FG   +         PP FG     G+TP+ G G 
Sbjct  208  AFGQAITEDKPLAFGQGATADKPPAFGQGVTAD------KPPAFGQGAAAGTTPAFGQGV  261

Query  111  SSGFGSGFGSG  121
            ++G    FG G
Sbjct  262  TAGTTPAFGQG  272


 Score = 26.9 bits (58),  Expect = 5.8, Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 42/86 (49%), Gaps = 6/86 (7%)

Query  40    YGSPSGYSSPSSYGSPSSFGSPSSFGSPAGFDGPPTFGNPASFGGPGGFCGPPNFGGQYG  99
             +G  +  +  S +G  ++ G+  +FG  A  D PP FG  A+ G        P FG    
Sbjct  1181  FGQGAAANKASVFGQGAAAGTTPAFGQGAAADKPPAFGQGAAAGTT------PAFGQGVT  1234

Query  100   YGSTPSRGPGYSSGFGSGFGSGSGSG  125
              G+TP+ G G ++   S FG G+ +G
Sbjct  1235  AGTTPAFGQGAAANKASVFGQGAAAG  1260


 Score = 26.6 bits (57),  Expect = 7.9, Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 41/89 (46%), Gaps = 6/89 (7%)

Query  40    YGSPSGYSSPSSYGSPSSFGSPSSFGSPAGFDGPPTFGNPASFGGPGGFCGPPNFGGQYG  99
             +G  +  +  S++G   + G+  +FG     D PP FG  A+ G        P FG    
Sbjct  965   FGQGAAANKASAFGQGVTAGTTPAFGQGVAADKPPAFGQGAAAGTT------PAFGQGVT  1018

Query  100   YGSTPSRGPGYSSGFGSGFGSGSGSGDGS  128
              G+TP+ G G ++G    FG G+ +   S
Sbjct  1019  AGTTPAFGQGVTAGTTPAFGQGAAANKAS  1047



Lambda      K        H
   0.312    0.126    0.348 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 26054445194


Query= XP_037024169.1 lipase member H-like, partial [Bradysia coprophila]

Length=237
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q0E8T1_DROME  unnamed protein product                                 107     2e-27
Q7K3Z8_DROME  unnamed protein product                                 90.1    4e-21
Q9VX69_DROME  unnamed protein product                                 84.0    1e-18


>Q0E8T1_DROME unnamed protein product
Length=338

 Score = 107 bits (268),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 74/234 (32%), Positives = 112/234 (48%), Gaps = 15/234 (6%)

Query  9    ASIRNAFIQRSDFNVFTVDWSVGAVTPNIAIARGHINAVGQVVAQFIDWLNVHGL-PFSN  67
              +R  F+ + D+N+ ++D+   A  P    A  +   V +  AQ +  L   GL    +
Sbjct  86   TQLRPLFLTQ-DYNLISLDYPKLAYEPCYTEAVHNAKYVARCTAQLLRVLLESGLVKIED  144

Query  68   ISVIGHSLGAHAAGATGKRTTRGKLATIVGLDPAISFFSIDDPANRLHYSDADYVEAIFT  127
            + +IG  LGAH AG  G+     KL  I  LDPA  F+ + DPA +L  +DA +V+ + T
Sbjct  145  LHLIGLGLGAHVAGFIGQFLPEHKLEHITALDPAKPFYMVKDPALKLDPTDAKFVDVVHT  204

Query  128  DVGQSGFELPLGHANFYPNWGTAQPGCGIDINGL----CSHVIVTEFYAESINPGNVFGA  183
            DV   G    +GH +FY N G +QP CG  IN +    C H    ++YAESI+  + F  
Sbjct  205  DVTMLGLLDAVGHVDFYLNMGVSQPNCG-PINKMETHFCYHNRAADYYAESISSPSGFYG  263

Query  184  TRCRDFNDIRTRNCVSSGAGRRLGG--EPVNDGPSNPDSVFFLSTHAARPFAQG  235
              C +F       C+       +G   +P   G       +FL T+   P+A+G
Sbjct  264  FYCPNFKSFAKGICIPDKNIELMGFHVDPKARGR------YFLDTNNGPPYAKG  311


>Q7K3Z8_DROME unnamed protein product
Length=340

 Score = 90.1 bits (222),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 69/239 (29%), Positives = 110/239 (46%), Gaps = 21/239 (9%)

Query  11   IRNAFIQRSDFNVFTVDWSVGAVTPNIAIARGHINAVGQVVAQFIDWLNVHGLPFSNISV  70
            I  A+++R D N+  +DW   A    +  A  ++  +G  +A+ +  +  HGL      +
Sbjct  80   IAEAYLERKDTNLIVLDWGELADGNYMFDAFPNLKQLGPELAKVLLKMFDHGLDIEKFHI  139

Query  71   IGHSLGAHAAGATGKRTTRG-----KLATIVGLDPAISFFSIDDPANRLHYSDADYVEAI  125
            +GHS+G   AG  G+  T+      K+  I  LDPA   F    P   L  +DA++V+ I
Sbjct  140  VGHSMGGQLAGLLGREITKRTKGVRKIKRISALDPAFPLFY---PGTHLSANDAEFVDVI  196

Query  126  FTDVGQSGFELPLGHANFYPNWG-TAQPGC------GIDINGLCSHVIVTEFYAESINPG  178
             TD    G     G A+F+PN G + QPGC       +  N L SH     F+AES++  
Sbjct  197  HTDAWLYGAPTSTGTADFWPNGGYSLQPGCPKRNYKMLSDNDLSSHRRSWWFWAESVSDR  256

Query  179  NV--FGATRCRDFNDIRTRNCVSSGAGRRLGGEPVNDGPSNPDSVFFLSTHAARPFAQG  235
                F A   + ++D +    V +     +G    +  P+     F+L T+   PFA+G
Sbjct  257  YPIGFDAVPAKKWSDFKQNKIVENCPPVVMG----HHCPTTIHGDFYLQTNGHTPFARG  311


>Q9VX69_DROME unnamed protein product
Length=411

 Score = 84.0 bits (206),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 71/238 (30%), Positives = 111/238 (47%), Gaps = 23/238 (10%)

Query  4    GANTGASIRNAFIQRSDFNVFTVDWSVGAVTPNIAIARGHINAVGQVVAQ-FIDWLNVHG  62
            G++T      A+  R D N   VD +   V      +  +   +G+ +A   +  L++  
Sbjct  146  GSDTIEVFSKAYNCRGDVNFVAVD-AARFVDTLYTWSAFNTEEIGENIALGLVKLLDL--  202

Query  63   LPFSNISVIGHSLGAHAAGATGKRT---TRGKLATIVGLDPAISFFSIDDPANRLHYSDA  119
            +P  NI +IGHSLGAH  G+ G+     T   +  I GLDPA   F+  +  + L   DA
Sbjct  203  VPVENIHLIGHSLGAHIVGSAGRHLQHLTNQTIPRITGLDPAKPCFNEGEALSGLMRGDA  262

Query  120  DYVEAIFTDVGQSGFELPLGHANFYPNWGTAQPGCGIDINGLCSHVIVTEFYAESINPGN  179
             +V+ I ++ G  G   P+G  +FYP  G   P      +  C+H    E++AE++ PGN
Sbjct  263  HFVDVIHSNPGVLGKRDPVGDVDFYP--GGMSPLAAGCFSVTCAHARSWEYFAETVFPGN  320

Query  180  V--FGATRCRDFNDIRTRNCVSSGAGRRLGGEPVNDGPSNPDSV---FFLSTHAARPF  232
               F ATRC   + +R   C          G+ V  G + P ++   +FL   A+ PF
Sbjct  321  ERNFMATRCNSISKLRDFRC---------PGDEVPMGYAVPQNIKGNYFLEVSASAPF  369



Lambda      K        H
   0.312    0.126    0.348 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 26054445194


Query= XP_037024170.1 zinc finger protein 62 homolog [Bradysia coprophila]

Length=855
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9PF60_DROME  unnamed protein product                                 118     2e-27
Q9VR05_DROME  unnamed protein product                                 114     3e-27
O96395_DROME  unnamed protein product                                 117     6e-27


>M9PF60_DROME unnamed protein product
Length=571

 Score = 118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 105/425 (25%), Positives = 165/425 (39%), Gaps = 39/425 (9%)

Query  12   FSKMCRCCASPSDELSPMIQCGNTD----EDIPSMFKECFNLEIDCSNLLPVSICATCYK  67
              K CR CA  S  L  +     +D    E + S+  E   ++ D    +P  IC TC  
Sbjct  17   MGKNCRACAEHSSILVDLFSKEISDPPIWEMLNSILPEICRVKRD---EMPQKICPTCLV  73

Query  68   KLRYSVQFRELCVSSFTFLTEFLEKQSITLIKNENFEDDAYTFASCLVSHCKKPYTLIQK  127
              + +  FR  C  SF F ++ L+        N N             SHC++       
Sbjct  74   AAQNAFHFRHKCEQSFQFFSQLLQLDK----SNSNLS----------RSHCRRGTMNPLI  119

Query  128  VFLTFLLNQNDDTTDETIEETKPSVQSHVEERVEPP---------KEKLRKKLHRTKLGA  178
             F         DT    ++  +P V++ ++E  +           K +    +  T   A
Sbjct  120  PFEIVGCEDPLDTNVTKLDANRPDVKTDIDEPTDGKATNVTMNDIKTEDEVSIQETFEDA  179

Query  179  KSGKKNSTNKNPSIDEEEKETDLTVEDSSSNVESTKNSKTKGKKEKVGKMCQICGQIF--  236
               + ++ N +   ++ ++ T  + ED           +          +C  CG  +  
Sbjct  180  FDEENDNNNTDSEREDSDQWTVGSTEDQDEPWIPGGGGRQTVGGNNQSLLCTECGVSYST  239

Query  237  -KSLQAHLYVH----DIFPKFECNICHKKFRHKANVLSHMKIHTNQRDFKCHQCPYKTQF  291
             K+L  H+  H    D      C+ C + FR  A + +H + HT +R FKC  CP     
Sbjct  240  QKALARHVAKHKEQGDTQKPHLCDFCGRGFRTNAQLTTHRRRHTGERPFKCPLCPKAYTH  299

Query  292  RTSYLRHLQTHTNERNYKCTICEKLFTRKMTLDRHKLTHDLPR-VPCPHCDKMFTTKKGL  350
              +   H+ TH  E+ +KC  C+K F  +  L  H   H   R   CP C + F    GL
Sbjct  300  GPTLKSHMHTHDEEKGHKCPQCDKTFYTRGNLRAHIQRHTGERPYKCPDCPQTFAKNSGL  359

Query  351  VNHIGIHTGERPFKCKICGMGFVATSSLSVHRRIHKKEDDLLRCKECGLVLTNLQMLYNH  410
              H  +H  ERPFKC++CG GFV    L  H R+H   D   +C +C         +  H
Sbjct  360  KLHSRLHKEERPFKCELCGKGFVQNQHLITHLRVHNG-DRQFKCPDCDKSFFEKSNMMKH  418

Query  411  MKDHN  415
             + H+
Sbjct  419  QRTHS  423


 Score = 116 bits (291),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 66/204 (32%), Positives = 100/204 (49%), Gaps = 8/204 (4%)

Query  649  KKEKRVPKPHALEMCQICGQLFRC---IKTHMFVHDTNPQFECHHCGRKFKHKPNLICHV  705
            K++    KPH   +C  CG+ FR    + TH   H     F+C  C + + H P L  H+
Sbjct  251  KEQGDTQKPH---LCDFCGRGFRTNAQLTTHRRRHTGERPFKCPLCPKAYTHGPTLKSHM  307

Query  706  KNHQNVRKFQCPHCPFKFQYSTNFKRHIRTHTGEKIFTCDICQKRFSRSGGLQRHKLTHD  765
              H   +  +CP C   F    N + HI+ HTGE+ + C  C + F+++ GL+ H   H 
Sbjct  308  HTHDEEKGHKCPQCDKTFYTRGNLRAHIQRHTGERPYKCPDCPQTFAKNSGLKLHSRLHK  367

Query  766  IPR-VPCPYCEKMFTTTKGLVNHVGIHTGERPFKCKICGAAFVASSSLCVHSRIHKKENP  824
              R   C  C K F   + L+ H+ +H G+R FKC  C  +F   S++  H R H    P
Sbjct  368  EERPFKCELCGKGFVQNQHLITHLRVHNGDRQFKCPDCDKSFFEKSNMMKHQRTHSGIKP  427

Query  825  IIQCKECGLVVTDNVMLSNHMKDH  848
              +C+ECG   + N  L +H++ H
Sbjct  428  -FKCEECGQAFSHNHHLKSHLRIH  450


 Score = 111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 64/190 (34%), Positives = 94/190 (49%), Gaps = 5/190 (3%)

Query  663  CQICGQLFR---CIKTHMFVHDTNPQFECHHCGRKFKHKPNLICHVKNHQNVRKFQCPHC  719
            C +C + +     +K+HM  HD     +C  C + F  + NL  H++ H   R ++CP C
Sbjct  290  CPLCPKAYTHGPTLKSHMHTHDEEKGHKCPQCDKTFYTRGNLRAHIQRHTGERPYKCPDC  349

Query  720  PFKFQYSTNFKRHIRTHTGEKIFTCDICQKRFSRSGGLQRHKLTHDIPR-VPCPYCEKMF  778
            P  F  ++  K H R H  E+ F C++C K F ++  L  H   H+  R   CP C+K F
Sbjct  350  PQTFAKNSGLKLHSRLHKEERPFKCELCGKGFVQNQHLITHLRVHNGDRQFKCPDCDKSF  409

Query  779  TTTKGLVNHVGIHTGERPFKCKICGAAFVASSSLCVHSRIHKKENPIIQCKECGLVVTDN  838
                 ++ H   H+G +PFKC+ CG AF  +  L  H RIH  E P  +C +CG   + N
Sbjct  410  FEKSNMMKHQRTHSGIKPFKCEECGQAFSHNHHLKSHLRIHTGEKP-YKCDQCGKGFSAN  468

Query  839  VMLSNHMKDH  848
              L  H   H
Sbjct  469  QSLMKHTLWH  478


 Score = 106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/190 (33%), Positives = 92/190 (48%), Gaps = 5/190 (3%)

Query  229  CQICGQIFK---SLQAHLYVHDIFPKFECNICHKKFRHKANVLSHMKIHTNQRDFKCHQC  285
            C +C + +    +L++H++ HD     +C  C K F  + N+ +H++ HT +R +KC  C
Sbjct  290  CPLCPKAYTHGPTLKSHMHTHDEEKGHKCPQCDKTFYTRGNLRAHIQRHTGERPYKCPDC  349

Query  286  PYKTQFRTSYLRHLQTHTNERNYKCTICEKLFTRKMTLDRHKLTHDLPR-VPCPHCDKMF  344
            P      +    H + H  ER +KC +C K F +   L  H   H+  R   CP CDK F
Sbjct  350  PQTFAKNSGLKLHSRLHKEERPFKCELCGKGFVQNQHLITHLRVHNGDRQFKCPDCDKSF  409

Query  345  TTKKGLVNHIGIHTGERPFKCKICGMGFVATSSLSVHRRIHKKEDDLLRCKECGLVLTNL  404
              K  ++ H   H+G +PFKC+ CG  F     L  H RIH  E    +C +CG   +  
Sbjct  410  FEKSNMMKHQRTHSGIKPFKCEECGQAFSHNHHLKSHLRIHTGEKP-YKCDQCGKGFSAN  468

Query  405  QMLYNHMKDH  414
            Q L  H   H
Sbjct  469  QSLMKHTLWH  478


 Score = 104 bits (259),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 63/200 (32%), Positives = 94/200 (47%), Gaps = 5/200 (3%)

Query  223  EKVGKMCQICGQIF---KSLQAHLYVHDIFPKFECNICHKKFRHKANVLSHMKIHTNQRD  279
            E+ G  C  C + F    +L+AH+  H     ++C  C + F   + +  H ++H  +R 
Sbjct  312  EEKGHKCPQCDKTFYTRGNLRAHIQRHTGERPYKCPDCPQTFAKNSGLKLHSRLHKEERP  371

Query  280  FKCHQCPYKTQFRTSYLRHLQTHTNERNYKCTICEKLFTRKMTLDRHKLTHD-LPRVPCP  338
            FKC  C          + HL+ H  +R +KC  C+K F  K  + +H+ TH  +    C 
Sbjct  372  FKCELCGKGFVQNQHLITHLRVHNGDRQFKCPDCDKSFFEKSNMMKHQRTHSGIKPFKCE  431

Query  339  HCDKMFTTKKGLVNHIGIHTGERPFKCKICGMGFVATSSLSVHRRIHKKEDDL-LRCKEC  397
             C + F+    L +H+ IHTGE+P+KC  CG GF A  SL  H   H   +D   +C +C
Sbjct  432  ECGQAFSHNHHLKSHLRIHTGEKPYKCDQCGKGFSANQSLMKHTLWHVDNNDRPFKCSQC  491

Query  398  GLVLTNLQMLYNHMKDHNVP  417
                   Q L  H K H  P
Sbjct  492  PKAYDTQQSLRGHEKTHKNP  511


 Score = 94.4 bits (233),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 63/214 (29%), Positives = 96/214 (45%), Gaps = 35/214 (16%)

Query  644  KGQEVKKEKRVPKPHALEMCQICGQLF---RCIKTHMFVHDTNPQFECHHCGRKFKHKPN  700
            K   +K   R+ K      C++CG+ F   + + TH+ VH+ + QF+C  C + F  K N
Sbjct  355  KNSGLKLHSRLHKEERPFKCELCGKGFVQNQHLITHLRVHNGDRQFKCPDCDKSFFEKSN  414

Query  701  LICHVKNHQNVRKFQCPHCPFKFQYSTNFKRHIRTHTGEKIFTCDICQKRFSRSGGLQRH  760
            ++ H + H  ++ F+C  C   F ++ + K H+R HTGEK + CD C K FS +  L +H
Sbjct  415  MMKHQRTHSGIKPFKCEECGQAFSHNHHLKSHLRIHTGEKPYKCDQCGKGFSANQSLMKH  474

Query  761  KLTHDIPRVPCPYCEKMFTTTKGLVNHVGIHTGERPFKCKICGAAFVASSSLCVHSRIHK  820
             L H                         +   +RPFKC  C  A+    SL  H + HK
Sbjct  475  TLWH-------------------------VDNNDRPFKCSQCPKAYDTQQSLRGHEKTHK  509

Query  821  KENP-----IIQCKECGLVVTDNVMLSNHMKDHQ  849
              NP     + QC  C +       L  H+  H+
Sbjct  510  --NPDEPKTLHQCPHCDVRFALKKTLDKHITSHK  541


 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 65/202 (32%), Positives = 87/202 (43%), Gaps = 39/202 (19%)

Query  222  KEKVGKMCQICGQIF---KSLQAHLYVHDIFPKFECNICHKKFRHKANVLSHMKIHTNQR  278
            KE+    C++CG+ F   + L  HL VH+   +F+C  C K F  K+N++ H + H+  +
Sbjct  367  KEERPFKCELCGKGFVQNQHLITHLRVHNGDRQFKCPDCDKSFFEKSNMMKHQRTHSGIK  426

Query  279  DFKCHQCPYKTQFRTSYLRHLQTHTNERNYKCTICEKLFTRKMTLDRHKL----------  328
             FKC +C            HL+ HT E+ YKC  C K F+   +L +H L          
Sbjct  427  PFKCEECGQAFSHNHHLKSHLRIHTGEKPYKCDQCGKGFSANQSLMKHTLWHVDNNDRPF  486

Query  329  --------------------THDLPRVP-----CPHCDKMFTTKKGLVNHIGIHTGERPF  363
                                TH  P  P     CPHCD  F  KK L  HI  H   RP 
Sbjct  487  KCSQCPKAYDTQQSLRGHEKTHKNPDEPKTLHQCPHCDVRFALKKTLDKHITSHKI-RPH  545

Query  364  KCKICGMGFVATSSLSVHRRIH  385
             C  C  GF +  SL  H R+H
Sbjct  546  PCPQCPEGFFSQKSLKKHLRLH  567


 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/138 (30%), Positives = 65/138 (47%), Gaps = 9/138 (7%)

Query  663  CQICGQLF---RCIKTHMFVHDTNPQFECHHCGRKFKHKPNLICHVKNH--QNVRKFQCP  717
            C+ CGQ F     +K+H+ +H     ++C  CG+ F    +L+ H   H   N R F+C 
Sbjct  430  CEECGQAFSHNHHLKSHLRIHTGEKPYKCDQCGKGFSANQSLMKHTLWHVDNNDRPFKCS  489

Query  718  HCPFKFQYSTNFKRHIRTHTG----EKIFTCDICQKRFSRSGGLQRHKLTHDIPRVPCPY  773
             CP  +    + + H +TH      + +  C  C  RF+    L +H  +H I   PCP 
Sbjct  490  QCPKAYDTQQSLRGHEKTHKNPDEPKTLHQCPHCDVRFALKKTLDKHITSHKIRPHPCPQ  549

Query  774  CEKMFTTTKGLVNHVGIH  791
            C + F + K L  H+ +H
Sbjct  550  CPEGFFSQKSLKKHLRLH  567


 Score = 36.2 bits (82),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 22/67 (33%), Positives = 33/67 (49%), Gaps = 1/67 (1%)

Query  674  KTHMFVHDTNPQFECHHCGRKFKHKPNLICHVKNHQNVRKFQCPHCPFKFQYSTNFKRHI  733
            KTH    +     +C HC  +F  K  L  H+ +H+ +R   CP CP  F    + K+H+
Sbjct  506  KTHKNPDEPKTLHQCPHCDVRFALKKTLDKHITSHK-IRPHPCPQCPEGFFSQKSLKKHL  564

Query  734  RTHTGEK  740
            R H  +K
Sbjct  565  RLHNLKK  571


>Q9VR05_DROME unnamed protein product
Length=346

 Score = 114 bits (285),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 69/188 (37%), Positives = 101/188 (54%), Gaps = 7/188 (4%)

Query  229  CQICGQIFK---SLQAHLYVHDIFPKFECNICHKKFRHKANVLSHMKIHTNQRDFKCHQC  285
            C  C + F+   +L+AH+  H+    +EC+ C K F  ++ + SH + HT +R FKC QC
Sbjct  156  CPYCKRNFRLRVTLKAHMKTHNAAKPYECSHCAKTFAQQSTLQSHERTHTGERPFKCSQC  215

Query  286  PYKTQFRTSYL-RHLQTHTNERNYKCTICEKLFTRKMTLDRHKLTHDLPR-VPCPHCDKM  343
              KT  ++S L RH++TH +ER +KC+ C K FTRK  LD H  +H   R   C HC K 
Sbjct  216  S-KTFIKSSDLRRHIRTHGSERPFKCSKCTKTFTRKFHLDNHFRSHTGERPFKCSHCPKA  274

Query  344  FTTKKGLVNHIGIHTGERPFKCKICGMGFVATSSLSVHRRIHKKEDDLLRCKECGLVLTN  403
            F  K+ L  H  +H  +RPF+C  C   F  +S+L  H+ +H  E    +C  C      
Sbjct  275  FAMKQHLKQHSRLHLPDRPFRCSHCPKTFRLSSTLKEHKLVHNAE-RTFKCPHCASFYKQ  333

Query  404  LQMLYNHM  411
             + L  H+
Sbjct  334  RKTLARHI  341


 Score = 112 bits (280),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 69/186 (37%), Positives = 91/186 (49%), Gaps = 10/186 (5%)

Query  667  GQLFRCIKTHMFVHDTNPQFECHHCGRKFKHKPNLICHVKNHQNVRKFQCPHCPFKFQYS  726
            G   R ++THM        F C +C R F+ +  L  H+K H   + ++C HC   F   
Sbjct  139  GTFLRHMRTHM----DGQSFPCPYCKRNFRLRVTLKAHMKTHNAAKPYECSHCAKTFAQQ  194

Query  727  TNFKRHIRTHTGEKIFTCDICQKRFSRSGGLQRHKLTHDIPR-VPCPYCEKMFTTTKGLV  785
            +  + H RTHTGE+ F C  C K F +S  L+RH  TH   R   C  C K FT    L 
Sbjct  195  STLQSHERTHTGERPFKCSQCSKTFIKSSDLRRHIRTHGSERPFKCSKCTKTFTRKFHLD  254

Query  786  NHVGIHTGERPFKCKICGAAFVASSSLCVHSRIHKKENPIIQCKECGLVVTDNVMLSNHM  845
            NH   HTGERPFKC  C  AF     L  HSR+H  + P  +C  C         LS+ +
Sbjct  255  NHFRSHTGERPFKCSHCPKAFAMKQHLKQHSRLHLPDRP-FRCSHC----PKTFRLSSTL  309

Query  846  KDHQEI  851
            K+H+ +
Sbjct  310  KEHKLV  315


 Score = 108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 74/231 (32%), Positives = 105/231 (45%), Gaps = 8/231 (3%)

Query  195  EEKETDLTVEDSSSNVESTKNSKTKGKKE--KVGKMCQICGQIFK---SLQAHLYVHDIF  249
            EE++ +++ ED  + ++S   +   GK +  KV   C+ C + ++   +   H+  H   
Sbjct  93   EEEDWEIS-EDEDARIDSASAADDDGKSDSKKVAFECRECHKKYQRKGTFLRHMRTHMDG  151

Query  250  PKFECNICHKKFRHKANVLSHMKIHTNQRDFKCHQCPYKTQFRTSYLRHLQTHTNERNYK  309
              F C  C + FR +  + +HMK H   + ++C  C      +++   H +THT ER +K
Sbjct  152  QSFPCPYCKRNFRLRVTLKAHMKTHNAAKPYECSHCAKTFAQQSTLQSHERTHTGERPFK  211

Query  310  CTICEKLFTRKMTLDRHKLTHDLPR-VPCPHCDKMFTTKKGLVNHIGIHTGERPFKCKIC  368
            C+ C K F +   L RH  TH   R   C  C K FT K  L NH   HTGERPFKC  C
Sbjct  212  CSQCSKTFIKSSDLRRHIRTHGSERPFKCSKCTKTFTRKFHLDNHFRSHTGERPFKCSHC  271

Query  369  GMGFVATSSLSVHRRIHKKEDDLLRCKECGLVLTNLQMLYNHMKDHNVPST  419
               F     L  H R+H   D   RC  C         L  H   HN   T
Sbjct  272  PKAFAMKQHLKQHSRLH-LPDRPFRCSHCPKTFRLSSTLKEHKLVHNAERT  321


 Score = 107 bits (268),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 98/389 (25%), Positives = 153/389 (39%), Gaps = 55/389 (14%)

Query  461  ICRFCAKPNNDLKPIFKSDDCTDTSSTGENLSFPYMFQNTLNLDVIIDERLPLLICTRCS  520
            ICR C   +  L  IF +   T        +S   M       +V   +    +IC +C 
Sbjct  4    ICRVCMDISGKLVNIFDARRRT-------RVSIAEMIAQCTGFEVKRGDLFSEMICPQCY  56

Query  521  KKLTNANDFRKQCLKSYQSLIEIYESEAKRKSPETTEVPSPPECVHVKTSDDEEPTIAPF  580
            + + +A   R+ C +S+Q    + +           E      C  ++  D E       
Sbjct  57   EDVKSAYGIRQTCEESHQFYCRVRD-----------EGIEDALCALLEEEDWE-------  98

Query  581  VVLIKDEHENFNERPSSNDGSVKDGDSNMEDPCFQSSSPGSVVKSENTNEVKETKYKGRG  640
              + +DE    +   +++D    DG S+ +   F               E +E   K + 
Sbjct  99   --ISEDEDARIDSASAADD----DGKSDSKKVAF---------------ECRECHKKYQ-  136

Query  641  RPRKGQEVKKEKRVPKPHALEMCQICGQLFRC---IKTHMFVHDTNPQFECHHCGRKFKH  697
              RKG  ++  +      +   C  C + FR    +K HM  H+    +EC HC + F  
Sbjct  137  --RKGTFLRHMRTHMDGQSFP-CPYCKRNFRLRVTLKAHMKTHNAAKPYECSHCAKTFAQ  193

Query  698  KPNLICHVKNHQNVRKFQCPHCPFKFQYSTNFKRHIRTHTGEKIFTCDICQKRFSRSGGL  757
            +  L  H + H   R F+C  C   F  S++ +RHIRTH  E+ F C  C K F+R   L
Sbjct  194  QSTLQSHERTHTGERPFKCSQCSKTFIKSSDLRRHIRTHGSERPFKCSKCTKTFTRKFHL  253

Query  758  QRHKLTHDIPR-VPCPYCEKMFTTTKGLVNHVGIHTGERPFKCKICGAAFVASSSLCVHS  816
              H  +H   R   C +C K F   + L  H  +H  +RPF+C  C   F  SS+L  H 
Sbjct  254  DNHFRSHTGERPFKCSHCPKAFAMKQHLKQHSRLHLPDRPFRCSHCPKTFRLSSTLKEHK  313

Query  817  RIHKKENPIIQCKECGLVVTDNVMLSNHM  845
             +H  E    +C  C         L+ H+
Sbjct  314  LVHNAER-TFKCPHCASFYKQRKTLARHI  341


 Score = 60.5 bits (145),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 72/351 (21%), Positives = 136/351 (39%), Gaps = 43/351 (12%)

Query  12   FSKMCRCCASPSDELSPMIQCGN-TDEDIPSMFKECFNLEIDCSNLLPVSICATCYKKLR  70
             +++CR C   S +L  +      T   I  M  +C   E+   +L    IC  CY+ ++
Sbjct  1    MAEICRVCMDISGKLVNIFDARRRTRVSIAEMIAQCTGFEVKRGDLFSEMICPQCYEDVK  60

Query  71   YSVQFRELCVSSFTFL----TEFLEKQSITLIKNENFE----------------DDAYTF  110
             +   R+ C  S  F      E +E     L++ E++E                DD  + 
Sbjct  61   SAYGIRQTCEESHQFYCRVRDEGIEDALCALLEEEDWEISEDEDARIDSASAADDDGKSD  120

Query  111  ASCLVSHCKKPYTLIQKVFLTFLLNQNDDTTDETIE--------ETKPSVQSHVE--ERV  160
            +  +   C++ +   Q+   TFL +       ++            + ++++H++     
Sbjct  121  SKKVAFECRECHKKYQRK-GTFLRHMRTHMDGQSFPCPYCKRNFRLRVTLKAHMKTHNAA  179

Query  161  EPPKEKLRKKLHRTKLGAKSGKKNSTNKNPSIDEEEKETDLTVEDSSSNVESTKNSKTKG  220
            +P +     K    +   +S ++  T + P    +  +T +   D   ++      +T G
Sbjct  180  KPYECSHCAKTFAQQSTLQSHERTHTGERPFKCSQCSKTFIKSSDLRRHI------RTHG  233

Query  221  KKEKVGKMCQICGQIFKS---LQAHLYVHDIFPKFECNICHKKFRHKANVLSHMKIHTNQ  277
             +      C  C + F     L  H   H     F+C+ C K F  K ++  H ++H   
Sbjct  234  SERPFK--CSKCTKTFTRKFHLDNHFRSHTGERPFKCSHCPKAFAMKQHLKQHSRLHLPD  291

Query  278  RDFKCHQCPYKTQFRTSYLRHLQTHTNERNYKCTICEKLFTRKMTLDRHKL  328
            R F+C  CP   +  ++   H   H  ER +KC  C   + ++ TL RH L
Sbjct  292  RPFRCSHCPKTFRLSSTLKEHKLVHNAERTFKCPHCASFYKQRKTLARHIL  342


 Score = 54.3 bits (129),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 41/90 (46%), Gaps = 0/90 (0%)

Query  673  IKTHMFVHDTNPQFECHHCGRKFKHKPNLICHVKNHQNVRKFQCPHCPFKFQYSTNFKRH  732
            +  H   H     F+C HC + F  K +L  H + H   R F+C HCP  F+ S+  K H
Sbjct  253  LDNHFRSHTGERPFKCSHCPKAFAMKQHLKQHSRLHLPDRPFRCSHCPKTFRLSSTLKEH  312

Query  733  IRTHTGEKIFTCDICQKRFSRSGGLQRHKL  762
               H  E+ F C  C   + +   L RH L
Sbjct  313  KLVHNAERTFKCPHCASFYKQRKTLARHIL  342


>O96395_DROME unnamed protein product
Length=583

 Score = 117 bits (292),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 66/204 (32%), Positives = 100/204 (49%), Gaps = 8/204 (4%)

Query  649  KKEKRVPKPHALEMCQICGQLFRC---IKTHMFVHDTNPQFECHHCGRKFKHKPNLICHV  705
            K++    KPH   +C  CG+ FR    + TH   H     F+C  C + + H P L  H+
Sbjct  263  KEQGDTQKPH---LCDFCGRGFRTNAQLTTHRRRHTGERPFKCPLCPKAYTHGPTLKSHM  319

Query  706  KNHQNVRKFQCPHCPFKFQYSTNFKRHIRTHTGEKIFTCDICQKRFSRSGGLQRHKLTHD  765
              H   +  +CP C   F    N + HI+ HTGE+ + C  C + F+++ GL+ H   H 
Sbjct  320  HTHDEEKGHKCPQCDKTFYTRGNLRAHIQRHTGERPYKCPDCPQTFAKNSGLKLHSRLHK  379

Query  766  IPR-VPCPYCEKMFTTTKGLVNHVGIHTGERPFKCKICGAAFVASSSLCVHSRIHKKENP  824
              R   C  C K F   + L+ H+ +H G+R FKC  C  +F   S++  H R H    P
Sbjct  380  EERPFKCELCGKGFVQNQHLITHLRVHNGDRQFKCPDCDKSFFEKSNMMKHQRTHSGIKP  439

Query  825  IIQCKECGLVVTDNVMLSNHMKDH  848
              +C+ECG   + N  L +H++ H
Sbjct  440  -FKCEECGQAFSHNHHLKSHLRIH  462


 Score = 112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 64/190 (34%), Positives = 94/190 (49%), Gaps = 5/190 (3%)

Query  663  CQICGQLFR---CIKTHMFVHDTNPQFECHHCGRKFKHKPNLICHVKNHQNVRKFQCPHC  719
            C +C + +     +K+HM  HD     +C  C + F  + NL  H++ H   R ++CP C
Sbjct  302  CPLCPKAYTHGPTLKSHMHTHDEEKGHKCPQCDKTFYTRGNLRAHIQRHTGERPYKCPDC  361

Query  720  PFKFQYSTNFKRHIRTHTGEKIFTCDICQKRFSRSGGLQRHKLTHDIPR-VPCPYCEKMF  778
            P  F  ++  K H R H  E+ F C++C K F ++  L  H   H+  R   CP C+K F
Sbjct  362  PQTFAKNSGLKLHSRLHKEERPFKCELCGKGFVQNQHLITHLRVHNGDRQFKCPDCDKSF  421

Query  779  TTTKGLVNHVGIHTGERPFKCKICGAAFVASSSLCVHSRIHKKENPIIQCKECGLVVTDN  838
                 ++ H   H+G +PFKC+ CG AF  +  L  H RIH  E P  +C +CG   + N
Sbjct  422  FEKSNMMKHQRTHSGIKPFKCEECGQAFSHNHHLKSHLRIHTGEKP-YKCDQCGKGFSAN  480

Query  839  VMLSNHMKDH  848
              L  H   H
Sbjct  481  QSLMKHTLWH  490


 Score = 108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 110/464 (24%), Positives = 173/464 (37%), Gaps = 79/464 (17%)

Query  12   FSKMCRCCASPSDELSPMIQCGNTD----EDIPSMFKECFNLEIDCSNLLPVSICATCYK  67
              K CR CA  S  L  +     +D    E + S+  E   ++ D    +P  IC TC  
Sbjct  17   MGKNCRACAEHSSILVDLFSKEISDPPIWEMLNSILPEICRVKRD---EMPQKICPTCLV  73

Query  68   KLRYSVQFRELCVSSFTFLTEFLEKQSITLIKNENFEDDAYTFASCLVSHCKKPYTLIQK  127
              + +  FR  C  SF F ++ L+        N N             SHC++       
Sbjct  74   AAQNAFHFRHKCEQSFQFFSQLLQLDK----SNSNLS----------RSHCRRGTMNPLI  119

Query  128  VFLTFLLNQNDDTTDETIEETKPSVQSHVEE----------RVEPPKEKLRKKLHRTKLG  177
             F         DT    ++  +P V++ ++E            EP +E     ++  K  
Sbjct  120  PFEIVGCEDPLDTNVTKLDANRPDVKTDIDEPTDGKATNGQESEPLQEVFEITMNDIKTE  179

Query  178  AKSGKK-------NSTNKNPSIDEEEKETDLTVEDSSSNVE-------------------  211
             +   +       +  N N + D E +++D     S+ + +                   
Sbjct  180  DEVSIQETFEDAFDEENDNNNTDSEREDSDQWTVGSTEDQDEPWIPGGGGRQTVGGNNQS  239

Query  212  ------STKNSKTKGKKEKVGK-----------MCQICGQIFKS---LQAHLYVHDIFPK  251
                      S  K     V K           +C  CG+ F++   L  H   H     
Sbjct  240  LLCTECGVSYSTQKALARHVAKHKEQGDTQKPHLCDFCGRGFRTNAQLTTHRRRHTGERP  299

Query  252  FECNICHKKFRHKANVLSHMKIHTNQRDFKCHQCPYKTQFRTSYLRHLQTHTNERNYKCT  311
            F+C +C K + H   + SHM  H  ++  KC QC      R +   H+Q HT ER YKC 
Sbjct  300  FKCPLCPKAYTHGPTLKSHMHTHDEEKGHKCPQCDKTFYTRGNLRAHIQRHTGERPYKCP  359

Query  312  ICEKLFTRKMTLDRHKLTHDLPR-VPCPHCDKMFTTKKGLVNHIGIHTGERPFKCKICGM  370
             C + F +   L  H   H   R   C  C K F   + L+ H+ +H G+R FKC  C  
Sbjct  360  DCPQTFAKNSGLKLHSRLHKEERPFKCELCGKGFVQNQHLITHLRVHNGDRQFKCPDCDK  419

Query  371  GFVATSSLSVHRRIHKKEDDLLRCKECGLVLTNLQMLYNHMKDH  414
             F   S++  H+R H       +C+ECG   ++   L +H++ H
Sbjct  420  SFFEKSNMMKHQRTHSGIKP-FKCEECGQAFSHNHHLKSHLRIH  462


 Score = 106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/190 (33%), Positives = 92/190 (48%), Gaps = 5/190 (3%)

Query  229  CQICGQIFK---SLQAHLYVHDIFPKFECNICHKKFRHKANVLSHMKIHTNQRDFKCHQC  285
            C +C + +    +L++H++ HD     +C  C K F  + N+ +H++ HT +R +KC  C
Sbjct  302  CPLCPKAYTHGPTLKSHMHTHDEEKGHKCPQCDKTFYTRGNLRAHIQRHTGERPYKCPDC  361

Query  286  PYKTQFRTSYLRHLQTHTNERNYKCTICEKLFTRKMTLDRHKLTHDLPR-VPCPHCDKMF  344
            P      +    H + H  ER +KC +C K F +   L  H   H+  R   CP CDK F
Sbjct  362  PQTFAKNSGLKLHSRLHKEERPFKCELCGKGFVQNQHLITHLRVHNGDRQFKCPDCDKSF  421

Query  345  TTKKGLVNHIGIHTGERPFKCKICGMGFVATSSLSVHRRIHKKEDDLLRCKECGLVLTNL  404
              K  ++ H   H+G +PFKC+ CG  F     L  H RIH  E    +C +CG   +  
Sbjct  422  FEKSNMMKHQRTHSGIKPFKCEECGQAFSHNHHLKSHLRIHTGEKP-YKCDQCGKGFSAN  480

Query  405  QMLYNHMKDH  414
            Q L  H   H
Sbjct  481  QSLMKHTLWH  490


 Score = 104 bits (260),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 63/200 (32%), Positives = 94/200 (47%), Gaps = 5/200 (3%)

Query  223  EKVGKMCQICGQIF---KSLQAHLYVHDIFPKFECNICHKKFRHKANVLSHMKIHTNQRD  279
            E+ G  C  C + F    +L+AH+  H     ++C  C + F   + +  H ++H  +R 
Sbjct  324  EEKGHKCPQCDKTFYTRGNLRAHIQRHTGERPYKCPDCPQTFAKNSGLKLHSRLHKEERP  383

Query  280  FKCHQCPYKTQFRTSYLRHLQTHTNERNYKCTICEKLFTRKMTLDRHKLTHD-LPRVPCP  338
            FKC  C          + HL+ H  +R +KC  C+K F  K  + +H+ TH  +    C 
Sbjct  384  FKCELCGKGFVQNQHLITHLRVHNGDRQFKCPDCDKSFFEKSNMMKHQRTHSGIKPFKCE  443

Query  339  HCDKMFTTKKGLVNHIGIHTGERPFKCKICGMGFVATSSLSVHRRIHKKEDDL-LRCKEC  397
             C + F+    L +H+ IHTGE+P+KC  CG GF A  SL  H   H   +D   +C +C
Sbjct  444  ECGQAFSHNHHLKSHLRIHTGEKPYKCDQCGKGFSANQSLMKHTLWHVDNNDRPFKCSQC  503

Query  398  GLVLTNLQMLYNHMKDHNVP  417
                   Q L  H K H  P
Sbjct  504  PKAYDTQQSLRGHEKTHKNP  523


 Score = 94.7 bits (234),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 90/195 (46%), Gaps = 35/195 (18%)

Query  663  CQICGQLF---RCIKTHMFVHDTNPQFECHHCGRKFKHKPNLICHVKNHQNVRKFQCPHC  719
            C++CG+ F   + + TH+ VH+ + QF+C  C + F  K N++ H + H  ++ F+C  C
Sbjct  386  CELCGKGFVQNQHLITHLRVHNGDRQFKCPDCDKSFFEKSNMMKHQRTHSGIKPFKCEEC  445

Query  720  PFKFQYSTNFKRHIRTHTGEKIFTCDICQKRFSRSGGLQRHKLTHDIPRVPCPYCEKMFT  779
               F ++ + K H+R HTGEK + CD C K FS +  L +H L H               
Sbjct  446  GQAFSHNHHLKSHLRIHTGEKPYKCDQCGKGFSANQSLMKHTLWH---------------  490

Query  780  TTKGLVNHVGIHTGERPFKCKICGAAFVASSSLCVHSRIHKKENP-----IIQCKECGLV  834
                      +   +RPFKC  C  A+    SL  H + HK  NP     + QC  C + 
Sbjct  491  ----------VDNNDRPFKCSQCPKAYDTQQSLRGHEKTHK--NPDEPKTLHQCPHCDVR  538

Query  835  VTDNVMLSNHMKDHQ  849
                  L  H+  H+
Sbjct  539  FALKKTLDKHITSHK  553


 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 65/202 (32%), Positives = 87/202 (43%), Gaps = 39/202 (19%)

Query  222  KEKVGKMCQICGQIF---KSLQAHLYVHDIFPKFECNICHKKFRHKANVLSHMKIHTNQR  278
            KE+    C++CG+ F   + L  HL VH+   +F+C  C K F  K+N++ H + H+  +
Sbjct  379  KEERPFKCELCGKGFVQNQHLITHLRVHNGDRQFKCPDCDKSFFEKSNMMKHQRTHSGIK  438

Query  279  DFKCHQCPYKTQFRTSYLRHLQTHTNERNYKCTICEKLFTRKMTLDRHKL----------  328
             FKC +C            HL+ HT E+ YKC  C K F+   +L +H L          
Sbjct  439  PFKCEECGQAFSHNHHLKSHLRIHTGEKPYKCDQCGKGFSANQSLMKHTLWHVDNNDRPF  498

Query  329  --------------------THDLPRVP-----CPHCDKMFTTKKGLVNHIGIHTGERPF  363
                                TH  P  P     CPHCD  F  KK L  HI  H   RP 
Sbjct  499  KCSQCPKAYDTQQSLRGHEKTHKNPDEPKTLHQCPHCDVRFALKKTLDKHITSHKI-RPH  557

Query  364  KCKICGMGFVATSSLSVHRRIH  385
             C  C  GF +  SL  H R+H
Sbjct  558  PCPQCPEGFFSQKSLKKHLRLH  579


 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/138 (30%), Positives = 65/138 (47%), Gaps = 9/138 (7%)

Query  663  CQICGQLF---RCIKTHMFVHDTNPQFECHHCGRKFKHKPNLICHVKNH--QNVRKFQCP  717
            C+ CGQ F     +K+H+ +H     ++C  CG+ F    +L+ H   H   N R F+C 
Sbjct  442  CEECGQAFSHNHHLKSHLRIHTGEKPYKCDQCGKGFSANQSLMKHTLWHVDNNDRPFKCS  501

Query  718  HCPFKFQYSTNFKRHIRTHTG----EKIFTCDICQKRFSRSGGLQRHKLTHDIPRVPCPY  773
             CP  +    + + H +TH      + +  C  C  RF+    L +H  +H I   PCP 
Sbjct  502  QCPKAYDTQQSLRGHEKTHKNPDEPKTLHQCPHCDVRFALKKTLDKHITSHKIRPHPCPQ  561

Query  774  CEKMFTTTKGLVNHVGIH  791
            C + F + K L  H+ +H
Sbjct  562  CPEGFFSQKSLKKHLRLH  579


 Score = 36.2 bits (82),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 22/67 (33%), Positives = 33/67 (49%), Gaps = 1/67 (1%)

Query  674  KTHMFVHDTNPQFECHHCGRKFKHKPNLICHVKNHQNVRKFQCPHCPFKFQYSTNFKRHI  733
            KTH    +     +C HC  +F  K  L  H+ +H+ +R   CP CP  F    + K+H+
Sbjct  518  KTHKNPDEPKTLHQCPHCDVRFALKKTLDKHITSHK-IRPHPCPQCPEGFFSQKSLKKHL  576

Query  734  RTHTGEK  740
            R H  +K
Sbjct  577  RLHNLKK  583



Lambda      K        H
   0.312    0.126    0.348 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 26054445194


Query= XP_037024171.1 uncharacterized protein LOC119066052 [Bradysia
coprophila]

Length=269
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VQG0_DROME  unnamed protein product                                 33.1    0.28 
Q584H3_TRYB2  unnamed protein product                                 31.6    0.71 
MUP4_CAEEL  unnamed protein product                                   30.8    1.3  


>Q9VQG0_DROME unnamed protein product
Length=932

 Score = 33.1 bits (74),  Expect = 0.28, Method: Composition-based stats.
 Identities = 30/124 (24%), Positives = 55/124 (44%), Gaps = 21/124 (17%)

Query  6    YELKEDSADRRQNAENVM------SLLKYMHRSEISQFEQDYNGGYDSEDVAFPFLEDND  59
            Y+L ED   R ++   V+       L+  + R   SQ E D++G           +E+N+
Sbjct  352  YKLSEDLFQRNEDKLTVLFRPHIERLISALFRH--SQMESDHDG----------LIEENN  399

Query  60   QIPDKRKRVSDISLRVLILLTESSFFTSLQHYRQQKMSKIETDN---FLMNSFSKEYKQI  116
               D R++VSD+   V  ++   + F  + H  Q   +  E+     F+M + +K     
Sbjct  400  NFFDFRRKVSDLIKDVAFIVGSGACFKQMFHILQAPETTWESTEAALFIMQNVAKNILPD  459

Query  117  EDQV  120
            E++V
Sbjct  460  ENEV  463


>Q584H3_TRYB2 unnamed protein product
Length=1000

 Score = 31.6 bits (70),  Expect = 0.71, Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 40/72 (56%), Gaps = 6/72 (8%)

Query  61   IPDKRKRVSDISLRVLILLTESSFFTSLQHYRQQKMSKIETDNFLMNSFSKEYKQIEDQ-  119
            + D RKR+SD+ LR+  ++     F S++H R  K ++I+     M   +++   +E++ 
Sbjct  472  VSDARKRLSDLELRLDSII---DTFQSIKHERTHKAAQIQAITQKMTEMTEKKAILENEL  528

Query  120  --VCKEMGLNDS  129
              +C+E  + ++
Sbjct  529  VVLCRESAVKEA  540


>MUP4_CAEEL unnamed protein product
Length=2104

 Score = 30.8 bits (68),  Expect = 1.3, Method: Composition-based stats.
 Identities = 35/132 (27%), Positives = 54/132 (41%), Gaps = 23/132 (17%)

Query  30    HRSEISQFEQDYNGGYDSEDV--AFPFLEDND-QIPDKRKRVSDISLRVLILLTE-----  81
             H+  +S+FE      YD   +  AF   E N+ + P+ RK+  D    +L   T      
Sbjct  1527  HKDLVSRFESGVAQSYDKTPLKGAFVTAEVNEIENPESRKKSWDTG--ILYNFTSHFVKG  1584

Query  82    -----SSFFTSLQHYRQQK------MSKIETDNFLMNSFSKEYKQI--EDQVCKEMGLND  128
                  +S FT L  Y Q++       SK+      +N FS  Y      D +CKE+G   
Sbjct  1585  SVAEPASVFTDLIDYIQKRNDFEVGKSKLFISPEQLNPFSNCYHSDCHPDAICKEVGKGY  1644

Query  129   SNSCTEDLHSFN  140
             + +C +     N
Sbjct  1645  TCTCPDGFRDLN  1656



Lambda      K        H
   0.312    0.126    0.348 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 26054445194


Query= XP_037024172.1 methyltransferase N6AMT1-like isoform X2 [Bradysia
coprophila]

Length=234
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q389Z0_TRYB2  unnamed protein product                                 32.7    0.24 
Q4GZF2_TRYB2  unnamed protein product                                 30.4    1.2  
Q9VND9_DROME  unnamed protein product                                 30.0    1.7  


>Q389Z0_TRYB2 unnamed protein product
Length=420

 Score = 32.7 bits (73),  Expect = 0.24, Method: Compositional matrix adjust.
 Identities = 33/129 (26%), Positives = 59/129 (46%), Gaps = 31/129 (24%)

Query  42   TFFLIDVIESELPHIRKRNPSVCLEIGTGSGVVITALSKTLQSSVVCFGVDINEHACRIS  101
            T +L+    S++P   +  P   L++  G+G V  A++K + S+ V   VDI + A   S
Sbjct  194  THWLVRTWLSKIPETTQ--PLRVLDMCCGTGCVGIAIAKHVPSAQVT-AVDILDEAIGAS  250

Query  102  KQTSLKN---ATNVEMCRSDLLDAF-----------------KRK--------SIDILLF  133
            ++ +  N   A+     +SD+ ++F                 K+K        S DI++ 
Sbjct  251  EENAKLNGLEASRFCTLKSDMFESFLVSNSGSLTGEDTKLDLKKKEPAAEHAGSFDIIVS  310

Query  134  NPPYVVTEN  142
            NPPYV+ + 
Sbjct  311  NPPYVLPDQ  319


>Q4GZF2_TRYB2 unnamed protein product
Length=275

 Score = 30.4 bits (67),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 25/39 (64%), Gaps = 2/39 (5%)

Query  66   EIGTGSGVVITALSKTLQSSVVCFGVDINEHACRISKQT  104
            ++G G+G V+  ++  L +   C GV+INEH  +++K+ 
Sbjct  117  DLGCGNGSVLFHVA--LATGASCVGVEINEHNAKVAKEA  153


>Q9VND9_DROME unnamed protein product
Length=332

 Score = 30.0 bits (66),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 29/118 (25%), Positives = 51/118 (43%), Gaps = 17/118 (14%)

Query  19   METPTTSHITFDDYKHVYEPA--EDTFFLIDVI-----ESELPHIRK----RNPSVCLEI  67
            M+ P    +  DD+ H  + A    T  +ID +     ES +    K     +P VC + 
Sbjct  83   MQLPFGGAVAVDDFYHGTKAAVAGGTTMIIDFVLPNKHESMIEAYDKWRSWADPKVCCDY  142

Query  68   GTGSGVVITALSKTLQSSVVCFGVDINEHACRISKQTSLKNATNVEMCRSDLLDAFKR  125
            G   G+   + S + +  ++C  + +N      S +T +      ++  SDLLD F+R
Sbjct  143  GLHVGITWWSKSVSEEIGILCKELGVN------SFKTFMAYKGLYQLNDSDLLDVFER  194



Lambda      K        H
   0.312    0.126    0.348 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 26054445194


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jul 7, 2021  1:54 PM
  Number of letters in database: 17,197,330
  Number of sequences in database:  25,232



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= XP_037024173.1 mucin-5AC-like [Bradysia coprophila]

Length=437


***** No hits found *****



Lambda      K        H
   0.317    0.130    0.375 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4829926040


Query= XP_037024174.1 beta-alanine transporter [Bradysia coprophila]

Length=585
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

BALAT_DROME  unnamed protein product                                  731     0.0   
CART_DROME  unnamed protein product                                   415     2e-137
OCT1_CAEEL  unnamed protein product                                   343     1e-110


>BALAT_DROME unnamed protein product
Length=604

 Score = 731 bits (1888),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/554 (65%), Positives = 438/554 (79%), Gaps = 13/554 (2%)

Query  1    MDFDAVLPDVGSFGIYQKLII-TMLLPAVLPCAFHAYSQLFIASRQAHWCRQPDLEPWAN  59
            MDFD VL +VGSFG+YQK+II ++LLPA LPCAFHAYSQLFIA+   H+CR P+LEPW  
Sbjct  1    MDFDEVLREVGSFGLYQKVIICSVLLPAALPCAFHAYSQLFIAATPQHFCRVPELEPWTQ  60

Query  60   DYPEIVKNLSIPKELRDGDFKYSECKMFDRNYSDIVRYLNSKSPADLAQYGFQYDEDVDT  119
            DY ++VKNLSIP+  R+G   Y+EC M+ RNY+DIVRYL  + P DL +   Q  ED+  
Sbjct  61   DYVQLVKNLSIPRN-RNG--AYAECSMYSRNYTDIVRYLEYRPPPDLLR---QQAEDLLK  114

Query  120  I--NESHLIECTSGWNYDRNMFPNTIVMEWDLVCSKDFYTTFALVLFGVGGLIGNYVFGY  177
            +  + + ++ C  GW+YD++++ +T+V EW+LVC + F  T ALV+FGVGGL+GNYVFGY
Sbjct  115  LQPDTTQVVPCQHGWHYDKSIYSSTVVQEWNLVCDRSFLVTLALVVFGVGGLLGNYVFGY  174

Query  178  LQDYWGRRPSFFVYLFLEIVACVLSSFAWNFPSWMVFRFIVGITVPAILASPYVLAIELV  237
            L D WGRRPSF+ YL LEI+AC  S+FAWN+ +W+  RF+VG+TVPAILASPYVLAIELV
Sbjct  175  LVDLWGRRPSFYAYLLLEIIACAASAFAWNYYTWLGLRFVVGLTVPAILASPYVLAIELV  234

Query  238  GPNHRVFCTIVLNIAYSLGLVLLSGVVYLVRDWRFLSLAVSVPLLLLFSCFFVLPESPRW  297
            GP  RVFCTIV NIAYSLGLV+L+GV+Y+VRDWR LSLAVS+PLL+LFSCFFVLPESPRW
Sbjct  235  GPERRVFCTIVSNIAYSLGLVVLAGVIYIVRDWRELSLAVSMPLLMLFSCFFVLPESPRW  294

Query  298  LVATGNYKKAAKVMKTIAKFNRKTIPDDYEEVLRSKMKSNSAIGTITPETVQSIGILDLF  357
            L+A G  ++A K++K +A+ N   +  D+ E L+ K+    A  T +  T    GILDLF
Sbjct  295  LMAVGKTRRAIKILKVMARVNGVRVNRDFVERLQRKLVITRAAETKSSMTTH-YGILDLF  353

Query  358  KTYNMRAKTLIITFIWFSNTCVYVGLSYYAPALGGDEIWNFFLAGAVEFPTYVFLWPGLI  417
            +  NMR KTLIIT IWF+NT VYVGLSYYAPALGGDEIWNFFLAGAVE PTY+ LWPGL 
Sbjct  354  RGPNMRRKTLIITLIWFANTSVYVGLSYYAPALGGDEIWNFFLAGAVELPTYLLLWPGLS  413

Query  418  YIGRRWILCTSMIVGGVACILTFLVQHNQTIMLILYCIGKMGISSAFVVLPLAASELYPT  477
            Y GRRWIL  SM+VGGVAC+ TFL      I L+LYC+GKMGISS+FVVLPL ASELYPT
Sbjct  414  YFGRRWILFISMLVGGVACVATFLYPD---ITLLLYCVGKMGISSSFVVLPLMASELYPT  470

Query  478  VVRGLGMSVSSVIGMIGPIVIPLVNHMGSNMLVLPLIIMGSLLTIGGMASLFLPETMGKP  537
            VVRGLGMS SSVI M+GPIVIP++NHMG  MLVLPLI+MG+LL +GG ASL LPET  + 
Sbjct  471  VVRGLGMSFSSVISMVGPIVIPMINHMGQQMLVLPLIVMGALLILGGFASLLLPETRNRN  530

Query  538  LPQTIADGENVPLT  551
            LPQT+ +GE VPL+
Sbjct  531  LPQTLEEGEAVPLS  544


>CART_DROME unnamed protein product
Length=674

 Score = 415 bits (1066),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 228/566 (40%), Positives = 344/566 (61%), Gaps = 21/566 (4%)

Query  2    DFDAVLPDVGSFGIYQKLII-TMLLPAVLPCAFHAYSQLFIA-SRQAHWCRQPDLEPWAN  59
            D D +LP +G FG YQKL++  + LPA +PC F A++QLF+A +   +WCR P+L     
Sbjct  35   DLDDLLPTIGEFGKYQKLLVFGICLPACIPCGFCAFNQLFMADTPDDYWCRIPELL----  90

Query  60   DYP-EIVKNLSIPKELRDGDFKYSECKMFDRNYSDIVRYLNSKSPADLAQYGFQYDEDVD  118
            D P E  K+LSIPKEL + +  YS+C  +  N++ +   L S    DL          ++
Sbjct  91   DLPLEQRKSLSIPKELDNDELVYSKCYTYGVNWTQL---LESGEEDDLTT--------ME  139

Query  119  TINESHLIECTSGWNYDRNMFPNTIVMEWDLVCSKDFYTTFALVLFGVGGLIGNYVFGYL  178
                  LI+C  GW Y+ ++  ++IV+++DLVC +D Y T  L     GG +G Y+FG L
Sbjct  140  PNASWPLIKCPQGWEYNTSVVWSSIVIDFDLVCDQDIYPTIGLAALNTGGPVGVYLFGLL  199

Query  179  QDYWGRRPSFFVYLFLEIVACVLSSFAWNFPSWMVFRFIVGITVPAILASPYVLAIELVG  238
             D  GRR S+FV L   +   +++S + +F +W   R IVG+T+PA+   P+++++ELVG
Sbjct  200  NDRGGRRLSYFVCLATLLAGSLMTSLSKDFWTWAGSRVIVGLTIPAVYQIPFIISLELVG  259

Query  239  PNHRVFCTIVLNIAYSLGLVLLSGVVYLVRDWRFLSLAVSVPLLLLFSCFFVLPESPRWL  298
             N+R F T++    Y+ G++LLSGV YL RDW  LS   S+P    F   FV+PESPRWL
Sbjct  260  ENYRSFVTVMTCTFYTSGIMLLSGVTYLERDWVRLSYITSLPFYAYFLYMFVMPESPRWL  319

Query  299  VATGNYKKAAKVMKTIAKFNRKTIPDDYEEVLRSKMKSNSAIGTITPETVQSIGILDLFK  358
            +  G  ++A K+++ +AK N +  P+     L ++++ +          + ++G+ DL +
Sbjct  320  LMRGRLEEALKILERMAKVNGREFPEAVHLKLEAQIRRDKLKKQKK--KMANVGLADLCR  377

Query  359  TYNMRAKTLIITFIWFSNTCVYVGLSYYAPALGGDEIWNFFLAGAVEFPTYVFLWPGLIY  418
            T NMR KT++IT  WF+N  VY+GLSYY PALG ++  +FFL+  VE P+Y+  W  +  
Sbjct  378  TPNMRLKTILITLSWFANETVYLGLSYYGPALGTNQYVSFFLSAVVELPSYLCCWYFMDT  437

Query  419  IGRRWILCTSMIVGGVACILTFLVQHNQT-IMLILYCIGKMGISSAFVVLPLAASELYPT  477
             GRRW L  SMI+GGVAC++T ++  +     L+LY + K  +S++F+++   A ELYPT
Sbjct  438  WGRRWPLSLSMILGGVACVITVMLPDDAVDETLVLYLVSKALLSASFLIIYPFAGELYPT  497

Query  478  VVRGLGMSVSSVIGMIGPIVIPLVNHMGSNMLVLPLIIMGSLLTIGGMASLFLPETMGKP  537
             VRG+G+  SS IG +G I IP + ++G + L LPL+IMG L  +GGM  L LPET+   
Sbjct  498  QVRGIGIGASSYIGGLGLIGIPFITYLGKDNLKLPLVIMGFLSMLGGMTGLRLPETLHHR  557

Query  538  LPQTIADGENVPLTNPFADLFKCNKR  563
            LPQTI +GE       F D  +C ++
Sbjct  558  LPQTIEEGEEFGKNWQFKDCCRCAQK  583


>OCT1_CAEEL unnamed protein product
Length=585

 Score = 343 bits (879),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 198/548 (36%), Positives = 298/548 (54%), Gaps = 32/548 (6%)

Query  2    DFDAVLPDVGSFGIYQKLIITML-LPAVLPCAFHAYSQLFIASRQAHWCRQPDLEPWAND  60
            DFD VL  VG++G YQ +   ++ LP  LP AF A++  F+     H C  P+      +
Sbjct  25   DFDFVLEQVGNYGTYQIVFFFIICLPTSLPSAFSAFNIPFVVGNPPHTCHIPE----GKE  80

Query  61   YPEIVKNLSIPKELRDGDFKYSECKMFDRNYSDIVRYLNSKSPADLAQYGFQYDEDVDTI  120
            Y   + N          D +   CK ++    ++ R   S +P D       Y + +   
Sbjct  81   YLRPLTN----------DTQILSCKQYNETQINVFRAFTS-APVD------TYSDRIS--  121

Query  121  NESHLIECTSGWNYDRNMFPNTIVMEWDLVCSKDFYTTFALVLFGVGGLIGNYVFGYLQD  180
                L+ C +GW+YD + + +++V E++LVC +  +   +   F VG  IGN +FGY+ D
Sbjct  122  ----LVPCQNGWDYDNSTYLDSLVTEFNLVCDQQAWIEISTTSFYVGSFIGNCLFGYVAD  177

Query  181  YWGRRPSFFVYLFLEIVACVLSSFAWNFPSWMVFRFIVGITVPAILASPYVLAIELVGPN  240
             +GRR SFFV L + IV    SSFA +  S+++ RF  G+  PA+   P+++ +E +G +
Sbjct  178  KFGRRRSFFVILTVLIVCGTASSFAKDIESFIILRFFTGLAFPALFQIPFIICMEFMGNS  237

Query  241  HRVFCTIVLNIAYSLGLVLLSGVVYLVRDWRFLSLAVSVPLLLLFSCFFVLPESPRWLVA  300
             R+F  ++ ++ +   + LL  V   +R WR L+   + P       +F LPESPRW V+
Sbjct  238  GRIFSGLMTSLFFGAAMALLGVVAMFIRRWRQLTFFCNAPFAFYIIYYFFLPESPRWSVS  297

Query  301  TGNYKKAAKVMKTIAKFNRKTIPDDYEEVLRSKMKSNSAIGTITPETVQSIGILDLFKTY  360
             G +  A K +K IAK N K+  D  E V   K   N+A      ET +S  + DLFKT 
Sbjct  298  VGKWADAKKQLKKIAKMNGKSNVDVDELVDSMKNHQNAA---EEKETKRSHNVTDLFKTP  354

Query  361  NMRAKTLIITFIWFSNTCVYVGLSYYAPALGGDEIWNFFLAGAVEFPTYVFLWPGLIYIG  420
            N+R KTLI+T+IW  N  +Y GL+     L  D+ W+F + GAVE P Y  +WP L   G
Sbjct  355  NLRRKTLIVTYIWVMNAIIYNGLTLNVSNLPVDDYWSFIINGAVELPGYFVVWPLLQCAG  414

Query  421  RRWILCTSMIVGGVACI-LTFLVQHNQTIMLILYCIGKMGISSAFVVLPLAASELYPTVV  479
            RRW L  +MIV G+ C+   F+      ++     IGK G+ S F V+ + A ELYPTVV
Sbjct  415  RRWTLAATMIVCGIGCVSAMFMPDGYPWLVASASFIGKFGVGSGFAVIYIFAGELYPTVV  474

Query  480  RGLGMSVSSVIGMIGPIVIPLVNHMGSNMLVLPLIIMGSLLTIGGMASLFLPETMGKPLP  539
            R +GM +SS++   G ++ P + ++G  + +LPL+IMG +    G+ + FLPET+G PLP
Sbjct  475  RAIGMGMSSMVAGSGLLLAPHIVNLGKIVKILPLLIMGLMALSAGILTFFLPETLGAPLP  534

Query  540  QTIADGEN  547
             TI D EN
Sbjct  535  MTIEDAEN  542



Lambda      K        H
   0.317    0.130    0.375 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4829926040


Query= XP_037024175.1 LOW QUALITY PROTEIN: histone acetyltransferase
KAT2B-like [Bradysia coprophila]

Length=279
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VTZ1_DROME  unnamed protein product                                 375     5e-125
O76216_DROME  unnamed protein product                                 374     9e-125
Q8IB67_PLAF7  unnamed protein product                                 164     1e-45 


>Q9VTZ1_DROME unnamed protein product
Length=813

 Score = 375 bits (962),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 177/252 (70%), Positives = 199/252 (79%), Gaps = 13/252 (5%)

Query  41   ATHMMNHLKDYSTQRGIKHFLTYADEFAIGXFRKQGFSDDIKVVRPVYAGYIKEYEGATL  100
             TH+MNHLKDYS QRGIKH LT+AD  AIG F+KQGFS DIK+ RPVYAGYIKEY+ ATL
Sbjct  562  GTHLMNHLKDYSIQRGIKHLLTFADCDAIGYFKKQGFSKDIKLARPVYAGYIKEYDSATL  621

Query  101  MHYELHPSLVYTQFSSVIRKQKEIVKELISQRQQDVQKVHPGLICCKETVRSIPVDSIPG  160
            MH ELHPS+V TQF +VIR Q EI+KELI+QR  +VQKV PGL C KE +  IPV+SIPG
Sbjct  622  MHCELHPSIVNTQFIAVIRSQSEILKELIAQRHNEVQKVRPGLTCFKEGLPVIPVESIPG  681

Query  161  LREIGWKPQ-------------ADPDKLMITFNTILGTVRTHPNAWPFLKAVSAVTVPDY  207
            LREIGWKPQ              DP+KL  +F ++L +VR H  AWPFL+ V+A  VPDY
Sbjct  682  LREIGWKPQNRPARSSRPLEESTDPEKLATSFASVLQSVRQHTTAWPFLRPVTAAEVPDY  741

Query  208  YDLIKYSMDLKTMGDRLKKGYYVTRRLFMADMARIFSNCRLYNSPETEYIRCANILERYF  267
            YD IKY MDLKTMG+RLKKGYY TRRLFMADMARIFSNCR YNSP+TEY RCAN LERYF
Sbjct  742  YDHIKYPMDLKTMGERLKKGYYQTRRLFMADMARIFSNCRFYNSPDTEYYRCANSLERYF  801

Query  268  QTKMKEFGLWDK  279
            QTKM+E GLWDK
Sbjct  802  QTKMRELGLWDK  813


>O76216_DROME unnamed protein product
Length=813

 Score = 374 bits (961),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 176/252 (70%), Positives = 199/252 (79%), Gaps = 13/252 (5%)

Query  41   ATHMMNHLKDYSTQRGIKHFLTYADEFAIGXFRKQGFSDDIKVVRPVYAGYIKEYEGATL  100
             TH+MNHLKDYS QRGIKH LT+AD  AIG F+KQGFS D+K+ RPVYAGYIKEY+ ATL
Sbjct  562  GTHLMNHLKDYSIQRGIKHLLTFADCDAIGYFKKQGFSKDVKLARPVYAGYIKEYDSATL  621

Query  101  MHYELHPSLVYTQFSSVIRKQKEIVKELISQRQQDVQKVHPGLICCKETVRSIPVDSIPG  160
            MH ELHPS+V TQF +VIR Q EI+KELI+QR  +VQKV PGL C KE +  IPV+SIPG
Sbjct  622  MHCELHPSIVNTQFIAVIRSQSEILKELIAQRHNEVQKVRPGLTCFKEGLPVIPVESIPG  681

Query  161  LREIGWKPQ-------------ADPDKLMITFNTILGTVRTHPNAWPFLKAVSAVTVPDY  207
            LREIGWKPQ              DP+KL  +F ++L +VR H  AWPFL+ V+A  VPDY
Sbjct  682  LREIGWKPQNRPARSSRPLEESTDPEKLATSFASVLQSVRQHTTAWPFLRPVTAAEVPDY  741

Query  208  YDLIKYSMDLKTMGDRLKKGYYVTRRLFMADMARIFSNCRLYNSPETEYIRCANILERYF  267
            YD IKY MDLKTMG+RLKKGYY TRRLFMADMARIFSNCR YNSP+TEY RCAN LERYF
Sbjct  742  YDHIKYPMDLKTMGERLKKGYYQTRRLFMADMARIFSNCRFYNSPDTEYYRCANSLERYF  801

Query  268  QTKMKEFGLWDK  279
            QTKM+E GLWDK
Sbjct  802  QTKMRELGLWDK  813


>Q8IB67_PLAF7 unnamed protein product
Length=1465

 Score = 164 bits (415),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 93/234 (40%), Positives = 137/234 (59%), Gaps = 12/234 (5%)

Query  41    ATHMMNHLKDYSTQRGIKHFLTYADEFAIGXFRKQGFSDDIKVVRPVYAGYIKEYEGATL  100
              T +MNHLK++  + GI++FLTYAD FAIG FRKQGFS  I + +  + GYIK+Y+G TL
Sbjct  1219  GTRLMNHLKEHVKKFGIEYFLTYADNFAIGYFRKQGFSQKISMPKERWFGYIKDYDGGTL  1278

Query  101   MHYELHPSLVYTQFSSVIRKQKEIVKELISQRQQDVQKVHPGL-ICCKETVRSIPVDSIP  159
             M   + P++ Y + S ++ +QK+ VK+ I   +  V  ++ G+         ++   +IP
Sbjct  1279  MECYIFPNINYLRLSEMLYEQKKAVKKAIHFIKPQV--IYKGINYFADNKGAALHPSTIP  1336

Query  160   GLREIGWKPQADP------DKLMITFNTILGT---VRTHPNAWPFLKAVSAVTVPDYYDL  210
             GL E+GWK +          K +   + ILG    +    +AWPFLK VS    PDYYD+
Sbjct  1337  GLLEVGWKKETREITKKVQHKEVQLKDQILGVLDYLEKQQSAWPFLKPVSLSEAPDYYDI  1396

Query  211   IKYSMDLKTMGDRLKKGYYVTRRLFMADMARIFSNCRLYNSPETEYIRCANILE  264
             IK   D+ TM  + + G Y T+  F  ++ R+F NCRLYN+P T Y + AN L+
Sbjct  1397  IKEPTDILTMRRKARHGDYKTKEDFGIELKRMFDNCRLYNAPTTIYFKYANELQ  1450



Lambda      K        H
   0.317    0.130    0.375 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4829926040


Query= XP_037024176.1 uncharacterized protein LOC119066056 [Bradysia
coprophila]

Length=648
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q6AWJ8_DROME  unnamed protein product                                 33.1    0.82 
Q95V09_DROME  unnamed protein product                                 33.1    1.0  
A1Z9D7_DROME  unnamed protein product                                 33.1    1.0  


>Q6AWJ8_DROME unnamed protein product
Length=1246

 Score = 33.1 bits (74),  Expect = 0.82, Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 32/69 (46%), Gaps = 9/69 (13%)

Query  169  CTIQSPTYKISQMLAKVFGDMTIESPYHVKDSWQFANDIKNVKIPSGYKLISLDATSLFT  228
            CT  +      QML    G + I   + + +SWQ+    KNV +PS   LI+    S F 
Sbjct  33   CTKSNSGVGWRQML---IGFLLI--CFGISNSWQY----KNVHMPSSSSLIASPPASAFV  83

Query  229  NIPTSLCVT  237
            N P +L  T
Sbjct  84   NTPATLLFT  92


>Q95V09_DROME unnamed protein product
Length=1678

 Score = 33.1 bits (74),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 4/43 (9%)

Query  195  YHVKDSWQFANDIKNVKIPSGYKLISLDATSLFTNIPTSLCVT  237
            + + +SWQ+    KNV +PS   LI+    S F N P +L  T
Sbjct  54   FGISNSWQY----KNVHMPSSSSLIASPPASAFVNTPATLLFT  92


>A1Z9D7_DROME unnamed protein product
Length=1678

 Score = 33.1 bits (74),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 4/43 (9%)

Query  195  YHVKDSWQFANDIKNVKIPSGYKLISLDATSLFTNIPTSLCVT  237
            + + +SWQ+    KNV +PS   LI+    S F N P +L  T
Sbjct  54   FGISNSWQY----KNVHMPSSSSLIASPPASAFVNTPATLLFT  92



Lambda      K        H
   0.317    0.130    0.375 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4829926040


Query= XP_037024177.1 zinc finger protein 493-like [Bradysia coprophila]

Length=1152
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9PF60_DROME  unnamed protein product                                 142     4e-35
O96395_DROME  unnamed protein product                                 142     8e-35
O61360_DROME  unnamed protein product                                 133     3e-31


>M9PF60_DROME unnamed protein product
Length=571

 Score = 142 bits (358),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 141/585 (24%), Positives = 229/585 (39%), Gaps = 109/585 (19%)

Query  653   ELKMDNPFSNRCRACA------VLLMSSEKIISLLEDNLLVMFTYCTSLEVSSNDSLPNC  706
             E  +D      CRACA      V L S E     + + L  +      ++    D +P  
Sbjct  10    ERSVDASMGKNCRACAEHSSILVDLFSKEISDPPIWEMLNSILPEICRVK---RDEMPQK  66

Query  707   ICPECFRQLSDFSAFRRNCAESDAYFREQI-LTKSIKT----------------------  743
             ICP C     +   FR  C +S  +F + + L KS                         
Sbjct  67    ICPTCLVAAQNAFHFRHKCEQSFQFFSQLLQLDKSNSNLSRSHCRRGTMNPLIPFEIVGC  126

Query  744   -EQLDQTVVKSEENEPNQEIKFE-----------FNEIDCSGENFTQ------YDTESIV  785
              + LD  V K + N P+ +   +            N+I    E   Q      +D E+  
Sbjct  127   EDPLDTNVTKLDANRPDVKTDIDEPTDGKATNVTMNDIKTEDEVSIQETFEDAFDEENDN  186

Query  786   HSPAASTDVSNPIIPNSTTSEDPP----------------KYFCDYCGKGFRQKSYLGSH  829
             ++  +  + S+     ST  +D P                   C  CG  +  +  L  H
Sbjct  187   NNTDSEREDSDQWTVGSTEDQDEPWIPGGGGRQTVGGNNQSLLCTECGVSYSTQKALARH  246

Query  830   MTAHRKKMERKPKTYHCTTDDCSKVFKTKKSFDEHRINIHKLKP---------QSPDPT-  879
             +  H+++ + + K + C  D C + F+T      HR      +P          +  PT 
Sbjct  247   VAKHKEQGDTQ-KPHLC--DFCGRGFRTNAQLTTHRRRHTGERPFKCPLCPKAYTHGPTL  303

Query  880   -------KTKVKFCCPKCPKWFTEQYKLDGHVRSKHEGLKPYKCPECVKEFCRYGAFEYH  932
                      +    CP+C K F  +  L  H++ +H G +PYKCP+C + F +    + H
Sbjct  304   KSHMHTHDEEKGHKCPQCDKTFYTRGNLRAHIQ-RHTGERPYKCPDCPQTFAKNSGLKLH  362

Query  933   LRAAHQKFLNTTTICEFRCYYDGCDREYGLMDSLNAHIKRAHLGIIPVRRDQKLICDQCG  992
              R   ++         F+C    C + +     L  H+ R H G      D++  C  C 
Sbjct  363   SRLHKEER-------PFKCEL--CGKGFVQNQHLITHL-RVHNG------DRQFKCPDCD  406

Query  993   KSFVDGYTLKKHIYTHSGKLPHACKICPKAFATNVELKIHTMRHMNVKPFECPTCGARKT  1052
             KSF +   + KH  THSG  P  C+ C +AF+ N  LK H   H   KP++C  CG   +
Sbjct  407   KSFFEKSNMMKHQRTHSGIKPFKCEECGQAFSHNHHLKSHLRIHTGEKPYKCDQCGKGFS  466

Query  1053  TNKELQAHLNFHSKEISYP--CKECPRVFTSYGAVTRHVRIHHRNHKP---YICPHCQRA  1107
              N+ L  H  +H      P  C +CP+ + +  ++  H + H    +P   + CPHC   
Sbjct  467   ANQSLMKHTLWHVDNNDRPFKCSQCPKAYDTQQSLRGHEKTHKNPDEPKTLHQCPHCDVR  526

Query  1108  FAKAETMKNHVMTHTGEKPFACPVCDHRFIQAVAMRTHMKVHAKK  1152
             FA  +T+  H+ +H   +P  CP C   F    +++ H+++H  K
Sbjct  527   FALKKTLDKHITSHKI-RPHPCPQCPEGFFSQKSLKKHLRLHNLK  570


 Score = 142 bits (358),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 105/376 (28%), Positives = 162/376 (43%), Gaps = 41/376 (11%)

Query  154  DQKLICDQCGKSFVDGYTLKKHIYTH----SGKHPHACKICPKTFPTNAELKIHTMRHLK  209
            +Q L+C +CG S+     L +H+  H      + PH C  C + F TNA+L  H  RH  
Sbjct  225  NQSLLCTECGVSYSTQKALARHVAKHKEQGDTQKPHLCDFCGRGFRTNAQLTTHRRRHTG  284

Query  210  VKPFECPTCGARKTTRKELNTHLSVHSTEITYPCKECPRVFPSTSAVSRHVRIHHRNHRP  269
             +PF+CP C    T    L +H+  H  E  + C +C + F +   +  H++  H   RP
Sbjct  285  ERPFKCPLCPKAYTHGPTLKSHMHTHDEEKGHKCPQCDKTFYTRGNLRAHIQ-RHTGERP  343

Query  270  YICPHCERAFAKSETMKNHVMTHTGEKPFACSVCGHRFIQSVALRTHMKVHEKRVKIITA  329
            Y CP C + FAK+  +K H   H  E+PF C +CG  F+Q+  L TH++VH    +    
Sbjct  344  YKCPDCPQTFAKNSGLKLHSRLHKEERPFKCELCGKGFVQNQHLITHLRVHNGDRQFKC-  402

Query  330  PIKEEPPIDVNMELEENPAEAEDIESEF--FKIEYIDAKFEQYHYVSTAQNDVTSPVDTH  387
                 P  D +   + N  + +   S    FK E     F   H++            +H
Sbjct  403  -----PDCDKSFFEKSNMMKHQRTHSGIKPFKCEECGQAFSHNHHLK-----------SH  446

Query  388  SNSMSSEK-YICHYCDRVFNKKTSIGAHMARHRNGPEKNKFPCTIEGCSRVYKTRELYNR  446
                + EK Y C  C + F+   S+  H   H +    N  P     C + Y T++    
Sbjct  447  LRIHTGEKPYKCDQCGKGFSANQSLMKHTLWHVDN---NDRPFKCSQCPKAYDTQQ----  499

Query  447  HRWNSHKLRAEPRPEITPDGEKIIKLICQQCPKWFTIQLKLDAHIRSYHQGLKGYRCEHC  506
                   LR   +    PD  K +   C  C   F ++  LD HI S+   ++ + C  C
Sbjct  500  ------SLRGHEKTHKNPDEPKTLHQ-CPHCDVRFALKKTLDKHITSH--KIRPHPCPQC  550

Query  507  EKEFCKYRSYNRHLRV  522
             + F   +S  +HLR+
Sbjct  551  PEGFFSQKSLKKHLRL  566


 Score = 120 bits (300),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 81/268 (30%), Positives = 128/268 (48%), Gaps = 20/268 (7%)

Query  56   FCCPKCPKWFTEQYKLDGHV---RSTHEGLKPYQCPECEKEFCRYGAFEFHLRTTHKMVL  112
              C +C   ++ Q  L  HV   +   +  KP+ C     +FC  G       TTH+   
Sbjct  228  LLCTECGVSYSTQKALARHVAKHKEQGDTQKPHLC-----DFCGRGFRTNAQLTTHRRRH  282

Query  113  TTTKVKEFRCYYDGCDRKYGLMDSLNAHIKRAHLGIIPVRRDQKLICDQCGKSFVDGYTL  172
            T  +   F+C    C + Y    +L +H+            ++   C QC K+F     L
Sbjct  283  TGER--PFKCPL--CPKAYTHGPTLKSHMHTH-------DEEKGHKCPQCDKTFYTRGNL  331

Query  173  KKHIYTHSGKHPHACKICPKTFPTNAELKIHTMRHLKVKPFECPTCGARKTTRKELNTHL  232
            + HI  H+G+ P+ C  CP+TF  N+ LK+H+  H + +PF+C  CG      + L THL
Sbjct  332  RAHIQRHTGERPYKCPDCPQTFAKNSGLKLHSRLHKEERPFKCELCGKGFVQNQHLITHL  391

Query  233  SVHSTEITYPCKECPRVFPSTSAVSRHVRIHHRNHRPYICPHCERAFAKSETMKNHVMTH  292
             VH+ +  + C +C + F   S + +H R  H   +P+ C  C +AF+ +  +K+H+  H
Sbjct  392  RVHNGDRQFKCPDCDKSFFEKSNMMKHQRT-HSGIKPFKCEECGQAFSHNHHLKSHLRIH  450

Query  293  TGEKPFACSVCGHRFIQSVALRTHMKVH  320
            TGEKP+ C  CG  F  + +L  H   H
Sbjct  451  TGEKPYKCDQCGKGFSANQSLMKHTLWH  478


 Score = 104 bits (260),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 71/266 (27%), Positives = 121/266 (45%), Gaps = 39/266 (15%)

Query  58   CPKCPKWFTEQYKLDGHVRSTHEGLKPYQCPECEKEFCRYGAFEFHLR------------  105
            CP+C K F  +  L  H++  H G +PY+CP+C + F +    + H R            
Sbjct  318  CPQCDKTFYTRGNLRAHIQR-HTGERPYKCPDCPQTFAKNSGLKLHSRLHKEERPFKCEL  376

Query  106  -----TTHKMVLTTTKV----KEFRCYYDGCDRKYGLMDSLNAHIKRAHLGIIPVRRDQK  156
                   ++ ++T  +V    ++F+C    CD+ +    ++  H +R H GI P +    
Sbjct  377  CGKGFVQNQHLITHLRVHNGDRQFKC--PDCDKSFFEKSNMMKH-QRTHSGIKPFK----  429

Query  157  LICDQCGKSFVDGYTLKKHIYTHSGKHPHACKICPKTFPTNAELKIHTMRHL--KVKPFE  214
              C++CG++F   + LK H+  H+G+ P+ C  C K F  N  L  HT+ H+    +PF+
Sbjct  430  --CEECGQAFSHNHHLKSHLRIHTGEKPYKCDQCGKGFSANQSLMKHTLWHVDNNDRPFK  487

Query  215  CPTCGARKTTRKELNTHLSVHST----EITYPCKECPRVFPSTSAVSRHVRIHHRNHRPY  270
            C  C     T++ L  H   H      +  + C  C   F     + +H+  H    RP+
Sbjct  488  CSQCPKAYDTQQSLRGHEKTHKNPDEPKTLHQCPHCDVRFALKKTLDKHITSH--KIRPH  545

Query  271  ICPHCERAFAKSETMKNHVMTHTGEK  296
             CP C   F   +++K H+  H  +K
Sbjct  546  PCPQCPEGFFSQKSLKKHLRLHNLKK  571


 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 78/334 (23%), Positives = 123/334 (37%), Gaps = 85/334 (25%)

Query  266  NHRPYICPHCERAFAKSETMKNHVMTH----TGEKPFACSVCGHRFIQSVALRTHMKVH-  320
            N++  +C  C  +++  + +  HV  H      +KP  C  CG  F  +  L TH + H 
Sbjct  224  NNQSLLCTECGVSYSTQKALARHVAKHKEQGDTQKPHLCDFCGRGFRTNAQLTTHRRRHT  283

Query  321  -EKRVKIITAPIKEEPPIDVNMELEENPAEAEDIESEFFKIEYIDAKFEQYHYVSTAQND  379
             E+  K    P                                     + Y +  T    
Sbjct  284  GERPFKCPLCP-------------------------------------KAYTHGPT----  302

Query  380  VTSPVDTHSNSMSSEK-YICHYCDRVFNKKTSIGAHMARHRNGPEKNKFPCTIEGCSRVY  438
                + +H ++   EK + C  CD+ F  + ++ AH+ RH  G    K P     C + +
Sbjct  303  ----LKSHMHTHDEEKGHKCPQCDKTFYTRGNLRAHIQRH-TGERPYKCP----DCPQTF  353

Query  439  KTRELYNRHRWNSHKLRAEPRPEITPDGEKIIKLICQQCPKWFTIQLKLDAHIRSYHQGL  498
                    H     +L  E RP             C+ C K F     L  H+R  H G 
Sbjct  354  AKNSGLKLHS----RLHKEERP-----------FKCELCGKGFVQNQHLITHLR-VHNGD  397

Query  499  KGYRCEHCEKEFCKYRSYNRHLRVRHGTDETEKHYCTYDGCDREYGALDSLKNHIKRIHL  558
            + ++C  C+K F +  +  +H R   G    +      + C + +     LK+H+ RIH 
Sbjct  398  RQFKCPDCDKSFFEKSNMMKHQRTHSGIKPFK-----CEECGQAFSHNHHLKSHL-RIHT  451

Query  559  GIVRATRKP-TCGQCGQVFKTRYSLKKHSLKHSE  591
            G      KP  C QCG+ F    SL KH+L H +
Sbjct  452  G-----EKPYKCDQCGKGFSANQSLMKHTLWHVD  480


 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 70/310 (23%), Positives = 114/310 (37%), Gaps = 44/310 (14%)

Query  322  KRVKIITAPIKEEPPIDVNMELEENPAEAEDIESEFFKIEYIDAKFEQYHYVSTAQND--  379
            K   +    IK E  + +    E+    A D E++    +      +Q+   ST   D  
Sbjct  155  KATNVTMNDIKTEDEVSIQETFED----AFDEENDNNNTDSEREDSDQWTVGSTEDQDEP  210

Query  380  -VTSPVDTHSNSMSSEKYICHYCDRVFNKKTSIGAHMARHRNGPEKNKFPCTIEGCSRVY  438
             +       +   +++  +C  C   ++ + ++  H+A+H+   +  K P   + C R +
Sbjct  211  WIPGGGGRQTVGGNNQSLLCTECGVSYSTQKALARHVAKHKEQGDTQK-PHLCDFCGRGF  269

Query  439  KTRELYNRHRWNSHKLRAEPRPEITP-------------------DGEKIIKLICQQCPK  479
            +T      HR    +     RP   P                   D EK  K  C QC K
Sbjct  270  RTNAQLTTHR----RRHTGERPFKCPLCPKAYTHGPTLKSHMHTHDEEKGHK--CPQCDK  323

Query  480  WFTIQLKLDAHIRSYHQGLKGYRCEHCEKEFCKYRSYNRHLRVRHGTDETEKHYCTYDGC  539
             F  +  L AHI+  H G + Y+C  C + F K      H R+     E     C    C
Sbjct  324  TFYTRGNLRAHIQR-HTGERPYKCPDCPQTFAKNSGLKLHSRLH---KEERPFKCEL--C  377

Query  540  DREYGALDSLKNHIKRIHLGIVRATRKPTCGQCGQVFKTRYSLKKHSLKHSEISPSACKA  599
             + +     L  H+ R+H G     R+  C  C + F  + ++ KH   HS I P  C+ 
Sbjct  378  GKGFVQNQHLITHL-RVHNG----DRQFKCPDCDKSFFEKSNMMKHQRTHSGIKPFKCEE  432

Query  600  ESIGMYRTHH  609
                    HH
Sbjct  433  CGQAFSHNHH  442


>O96395_DROME unnamed protein product
Length=583

 Score = 142 bits (357),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 105/376 (28%), Positives = 162/376 (43%), Gaps = 41/376 (11%)

Query  154  DQKLICDQCGKSFVDGYTLKKHIYTH----SGKHPHACKICPKTFPTNAELKIHTMRHLK  209
            +Q L+C +CG S+     L +H+  H      + PH C  C + F TNA+L  H  RH  
Sbjct  237  NQSLLCTECGVSYSTQKALARHVAKHKEQGDTQKPHLCDFCGRGFRTNAQLTTHRRRHTG  296

Query  210  VKPFECPTCGARKTTRKELNTHLSVHSTEITYPCKECPRVFPSTSAVSRHVRIHHRNHRP  269
             +PF+CP C    T    L +H+  H  E  + C +C + F +   +  H++  H   RP
Sbjct  297  ERPFKCPLCPKAYTHGPTLKSHMHTHDEEKGHKCPQCDKTFYTRGNLRAHIQ-RHTGERP  355

Query  270  YICPHCERAFAKSETMKNHVMTHTGEKPFACSVCGHRFIQSVALRTHMKVHEKRVKIITA  329
            Y CP C + FAK+  +K H   H  E+PF C +CG  F+Q+  L TH++VH    +    
Sbjct  356  YKCPDCPQTFAKNSGLKLHSRLHKEERPFKCELCGKGFVQNQHLITHLRVHNGDRQFKC-  414

Query  330  PIKEEPPIDVNMELEENPAEAEDIESEF--FKIEYIDAKFEQYHYVSTAQNDVTSPVDTH  387
                 P  D +   + N  + +   S    FK E     F   H++            +H
Sbjct  415  -----PDCDKSFFEKSNMMKHQRTHSGIKPFKCEECGQAFSHNHHLK-----------SH  458

Query  388  SNSMSSEK-YICHYCDRVFNKKTSIGAHMARHRNGPEKNKFPCTIEGCSRVYKTRELYNR  446
                + EK Y C  C + F+   S+  H   H +    N  P     C + Y T++    
Sbjct  459  LRIHTGEKPYKCDQCGKGFSANQSLMKHTLWHVDN---NDRPFKCSQCPKAYDTQQ----  511

Query  447  HRWNSHKLRAEPRPEITPDGEKIIKLICQQCPKWFTIQLKLDAHIRSYHQGLKGYRCEHC  506
                   LR   +    PD  K +   C  C   F ++  LD HI S+   ++ + C  C
Sbjct  512  ------SLRGHEKTHKNPDEPKTLHQ-CPHCDVRFALKKTLDKHITSH--KIRPHPCPQC  562

Query  507  EKEFCKYRSYNRHLRV  522
             + F   +S  +HLR+
Sbjct  563  PEGFFSQKSLKKHLRL  578


 Score = 140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 144/597 (24%), Positives = 232/597 (39%), Gaps = 121/597 (20%)

Query  653   ELKMDNPFSNRCRACA------VLLMSSEKIISLLEDNLLVMFTYCTSLEVSSNDSLPNC  706
             E  +D      CRACA      V L S E     + + L  +      ++    D +P  
Sbjct  10    ERSVDASMGKNCRACAEHSSILVDLFSKEISDPPIWEMLNSILPEICRVK---RDEMPQK  66

Query  707   ICPECFRQLSDFSAFRRNCAESDAYFREQI-LTKS-------------------------  740
             ICP C     +   FR  C +S  +F + + L KS                         
Sbjct  67    ICPTCLVAAQNAFHFRHKCEQSFQFFSQLLQLDKSNSNLSRSHCRRGTMNPLIPFEIVGC  126

Query  741   -----------------IKT---EQLDQTVVKSEENEPNQEI-KFEFNEIDCSGENFTQ-  778
                              +KT   E  D      +E+EP QE+ +   N+I    E   Q 
Sbjct  127   EDPLDTNVTKLDANRPDVKTDIDEPTDGKATNGQESEPLQEVFEITMNDIKTEDEVSIQE  186

Query  779   -----YDTESIVHSPAASTDVSNPIIPNSTTSEDPP----------------KYFCDYCG  817
                  +D E+  ++  +  + S+     ST  +D P                   C  CG
Sbjct  187   TFEDAFDEENDNNNTDSEREDSDQWTVGSTEDQDEPWIPGGGGRQTVGGNNQSLLCTECG  246

Query  818   KGFRQKSYLGSHMTAHRKKMERKPKTYHCTTDDCSKVFKTKKSFDEHRINIHKLKP----  873
               +  +  L  H+  H+++ + + K + C  D C + F+T      HR      +P    
Sbjct  247   VSYSTQKALARHVAKHKEQGDTQ-KPHLC--DFCGRGFRTNAQLTTHRRRHTGERPFKCP  303

Query  874   -----QSPDPT--------KTKVKFCCPKCPKWFTEQYKLDGHVRSKHEGLKPYKCPECV  920
                   +  PT          +    CP+C K F  +  L  H++ +H G +PYKCP+C 
Sbjct  304   LCPKAYTHGPTLKSHMHTHDEEKGHKCPQCDKTFYTRGNLRAHIQ-RHTGERPYKCPDCP  362

Query  921   KEFCRYGAFEYHLRAAHQKFLNTTTICEFRCYYDGCDREYGLMDSLNAHIKRAHLGIIPV  980
             + F +    + H R   ++         F+C    C + +     L  H+ R H G    
Sbjct  363   QTFAKNSGLKLHSRLHKEER-------PFKCEL--CGKGFVQNQHLITHL-RVHNG----  408

Query  981   RRDQKLICDQCGKSFVDGYTLKKHIYTHSGKLPHACKICPKAFATNVELKIHTMRHMNVK  1040
               D++  C  C KSF +   + KH  THSG  P  C+ C +AF+ N  LK H   H   K
Sbjct  409   --DRQFKCPDCDKSFFEKSNMMKHQRTHSGIKPFKCEECGQAFSHNHHLKSHLRIHTGEK  466

Query  1041  PFECPTCGARKTTNKELQAHLNFHSKEISYP--CKECPRVFTSYGAVTRHVRIHHRNHKP  1098
             P++C  CG   + N+ L  H  +H      P  C +CP+ + +  ++  H + H    +P
Sbjct  467   PYKCDQCGKGFSANQSLMKHTLWHVDNNDRPFKCSQCPKAYDTQQSLRGHEKTHKNPDEP  526

Query  1099  ---YICPHCQRAFAKAETMKNHVMTHTGEKPFACPVCDHRFIQAVAMRTHMKVHAKK  1152
                + CPHC   FA  +T+  H+ +H   +P  CP C   F    +++ H+++H  K
Sbjct  527   KTLHQCPHCDVRFALKKTLDKHITSHKI-RPHPCPQCPEGFFSQKSLKKHLRLHNLK  582


 Score = 119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 81/268 (30%), Positives = 128/268 (48%), Gaps = 20/268 (7%)

Query  56   FCCPKCPKWFTEQYKLDGHV---RSTHEGLKPYQCPECEKEFCRYGAFEFHLRTTHKMVL  112
              C +C   ++ Q  L  HV   +   +  KP+ C     +FC  G       TTH+   
Sbjct  240  LLCTECGVSYSTQKALARHVAKHKEQGDTQKPHLC-----DFCGRGFRTNAQLTTHRR--  292

Query  113  TTTKVKEFRCYYDGCDRKYGLMDSLNAHIKRAHLGIIPVRRDQKLICDQCGKSFVDGYTL  172
              T  + F+C    C + Y    +L +H+            ++   C QC K+F     L
Sbjct  293  RHTGERPFKCPL--CPKAYTHGPTLKSHMHTH-------DEEKGHKCPQCDKTFYTRGNL  343

Query  173  KKHIYTHSGKHPHACKICPKTFPTNAELKIHTMRHLKVKPFECPTCGARKTTRKELNTHL  232
            + HI  H+G+ P+ C  CP+TF  N+ LK+H+  H + +PF+C  CG      + L THL
Sbjct  344  RAHIQRHTGERPYKCPDCPQTFAKNSGLKLHSRLHKEERPFKCELCGKGFVQNQHLITHL  403

Query  233  SVHSTEITYPCKECPRVFPSTSAVSRHVRIHHRNHRPYICPHCERAFAKSETMKNHVMTH  292
             VH+ +  + C +C + F   S + +H R  H   +P+ C  C +AF+ +  +K+H+  H
Sbjct  404  RVHNGDRQFKCPDCDKSFFEKSNMMKHQRT-HSGIKPFKCEECGQAFSHNHHLKSHLRIH  462

Query  293  TGEKPFACSVCGHRFIQSVALRTHMKVH  320
            TGEKP+ C  CG  F  + +L  H   H
Sbjct  463  TGEKPYKCDQCGKGFSANQSLMKHTLWH  490


 Score = 104 bits (260),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 71/266 (27%), Positives = 121/266 (45%), Gaps = 39/266 (15%)

Query  58   CPKCPKWFTEQYKLDGHVRSTHEGLKPYQCPECEKEFCRYGAFEFHLR------------  105
            CP+C K F  +  L  H++  H G +PY+CP+C + F +    + H R            
Sbjct  330  CPQCDKTFYTRGNLRAHIQR-HTGERPYKCPDCPQTFAKNSGLKLHSRLHKEERPFKCEL  388

Query  106  -----TTHKMVLTTTKV----KEFRCYYDGCDRKYGLMDSLNAHIKRAHLGIIPVRRDQK  156
                   ++ ++T  +V    ++F+C    CD+ +    ++  H +R H GI P +    
Sbjct  389  CGKGFVQNQHLITHLRVHNGDRQFKC--PDCDKSFFEKSNMMKH-QRTHSGIKPFK----  441

Query  157  LICDQCGKSFVDGYTLKKHIYTHSGKHPHACKICPKTFPTNAELKIHTMRHL--KVKPFE  214
              C++CG++F   + LK H+  H+G+ P+ C  C K F  N  L  HT+ H+    +PF+
Sbjct  442  --CEECGQAFSHNHHLKSHLRIHTGEKPYKCDQCGKGFSANQSLMKHTLWHVDNNDRPFK  499

Query  215  CPTCGARKTTRKELNTHLSVHST----EITYPCKECPRVFPSTSAVSRHVRIHHRNHRPY  270
            C  C     T++ L  H   H      +  + C  C   F     + +H+  H    RP+
Sbjct  500  CSQCPKAYDTQQSLRGHEKTHKNPDEPKTLHQCPHCDVRFALKKTLDKHITSH--KIRPH  557

Query  271  ICPHCERAFAKSETMKNHVMTHTGEK  296
             CP C   F   +++K H+  H  +K
Sbjct  558  PCPQCPEGFFSQKSLKKHLRLHNLKK  583


 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 78/334 (23%), Positives = 123/334 (37%), Gaps = 85/334 (25%)

Query  266  NHRPYICPHCERAFAKSETMKNHVMTH----TGEKPFACSVCGHRFIQSVALRTHMKVH-  320
            N++  +C  C  +++  + +  HV  H      +KP  C  CG  F  +  L TH + H 
Sbjct  236  NNQSLLCTECGVSYSTQKALARHVAKHKEQGDTQKPHLCDFCGRGFRTNAQLTTHRRRHT  295

Query  321  -EKRVKIITAPIKEEPPIDVNMELEENPAEAEDIESEFFKIEYIDAKFEQYHYVSTAQND  379
             E+  K    P                                     + Y +  T    
Sbjct  296  GERPFKCPLCP-------------------------------------KAYTHGPT----  314

Query  380  VTSPVDTHSNSMSSEK-YICHYCDRVFNKKTSIGAHMARHRNGPEKNKFPCTIEGCSRVY  438
                + +H ++   EK + C  CD+ F  + ++ AH+ RH  G    K P     C + +
Sbjct  315  ----LKSHMHTHDEEKGHKCPQCDKTFYTRGNLRAHIQRH-TGERPYKCP----DCPQTF  365

Query  439  KTRELYNRHRWNSHKLRAEPRPEITPDGEKIIKLICQQCPKWFTIQLKLDAHIRSYHQGL  498
                    H     +L  E RP             C+ C K F     L  H+R  H G 
Sbjct  366  AKNSGLKLHS----RLHKEERP-----------FKCELCGKGFVQNQHLITHLR-VHNGD  409

Query  499  KGYRCEHCEKEFCKYRSYNRHLRVRHGTDETEKHYCTYDGCDREYGALDSLKNHIKRIHL  558
            + ++C  C+K F +  +  +H R   G    +      + C + +     LK+H+ RIH 
Sbjct  410  RQFKCPDCDKSFFEKSNMMKHQRTHSGIKPFK-----CEECGQAFSHNHHLKSHL-RIHT  463

Query  559  GIVRATRKP-TCGQCGQVFKTRYSLKKHSLKHSE  591
            G      KP  C QCG+ F    SL KH+L H +
Sbjct  464  G-----EKPYKCDQCGKGFSANQSLMKHTLWHVD  492


 Score = 50.4 bits (119),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 70/307 (23%), Positives = 114/307 (37%), Gaps = 44/307 (14%)

Query  325  KIITAPIKEEPPIDVNMELEENPAEAEDIESEFFKIEYIDAKFEQYHYVSTAQND---VT  381
            +I    IK E  + +    E+    A D E++    +      +Q+   ST   D   + 
Sbjct  170  EITMNDIKTEDEVSIQETFED----AFDEENDNNNTDSEREDSDQWTVGSTEDQDEPWIP  225

Query  382  SPVDTHSNSMSSEKYICHYCDRVFNKKTSIGAHMARHRNGPEKNKFPCTIEGCSRVYKTR  441
                  +   +++  +C  C   ++ + ++  H+A+H+   +  K P   + C R ++T 
Sbjct  226  GGGGRQTVGGNNQSLLCTECGVSYSTQKALARHVAKHKEQGDTQK-PHLCDFCGRGFRTN  284

Query  442  ELYNRHRWNSHKLRAEPRPEITP-------------------DGEKIIKLICQQCPKWFT  482
                 HR    +     RP   P                   D EK  K  C QC K F 
Sbjct  285  AQLTTHR----RRHTGERPFKCPLCPKAYTHGPTLKSHMHTHDEEKGHK--CPQCDKTFY  338

Query  483  IQLKLDAHIRSYHQGLKGYRCEHCEKEFCKYRSYNRHLRVRHGTDETEKHYCTYDGCDRE  542
             +  L AHI+  H G + Y+C  C + F K      H R+     E     C    C + 
Sbjct  339  TRGNLRAHIQR-HTGERPYKCPDCPQTFAKNSGLKLHSRLH---KEERPFKCEL--CGKG  392

Query  543  YGALDSLKNHIKRIHLGIVRATRKPTCGQCGQVFKTRYSLKKHSLKHSEISPSACKAESI  602
            +     L  H+ R+H G     R+  C  C + F  + ++ KH   HS I P  C+    
Sbjct  393  FVQNQHLITHL-RVHNG----DRQFKCPDCDKSFFEKSNMMKHQRTHSGIKPFKCEECGQ  447

Query  603  GMYRTHH  609
                 HH
Sbjct  448  AFSHNHH  454


>O61360_DROME unnamed protein product
Length=962

 Score = 133 bits (334),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 134/546 (25%), Positives = 211/546 (39%), Gaps = 85/546 (16%)

Query  20   DGCSKVFKTKKSFDEHRINIHNIKPESPVPTEKKLKFCCPKCPKWFTEQYKLDGHVRSTH  79
            D C K+F+ +     HR      KP           F C  C + FT    L  H +  H
Sbjct  224  DICGKMFQFRYQLIVHRRYHSERKP-----------FMCQVCGQGFTTSQDLTRHGK-IH  271

Query  80   EGLKPYQCPECEKEFCRYGAFEFHLRTTHKMVLTTTKVKEFRCYYDGCDRKYGLMDSLNA  139
             G   + C  C   F    + E H++         +  K F C    C + +   + L+ 
Sbjct  272  IGGPMFTCIVCFNVFANNTSLERHMKRH-------STDKPFACTI--CQKTFARKEHLDN  322

Query  140  HIKRAHLGIIPVRRDQKLICDQCGKSFVDGYTLKKHIYTHSGKHPHACKICPKTFPTNAE  199
            H  R+H G  P R      C  C K+F     +  H+  H+G+ PH C IC K+F     
Sbjct  323  HF-RSHTGETPFR------CQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEH  375

Query  200  LKIHTMRHLKVKPFECPTCGARKTTRKELNTHLSVHSTEITYPCKECPRVFPSTSAVSRH  259
               H M H    P +C  CG + T ++ L  H+  H+ E  + C+ C + F      + H
Sbjct  376  YVNHYMWHTGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNH  435

Query  260  VRIHHRNHRPYICPHCERAFAKSETMKNHVMTHTGEKPFACSVCGHRFIQSVALRTHMKV  319
            + + H    P+ C  C + F + E + NHV  HTGE P  CS C   F +   L  H++ 
Sbjct  436  I-LWHTGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQ  494

Query  320  HEKRVKI-----ITAPIKEEPPID-VNMELEENPAEAEDIESEFFKIEYIDAKFEQYHYV  373
            H             A  +++  ++ V     E+P +       F + E++     Q+   
Sbjct  495  HTGETPFKCTYCTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQHTGD  554

Query  374  S-----------TAQNDVTSPVDTHSNSMSSEKYICHYCDRVFNKKTSIGAHMARHR---  419
            S           T +  +T+ V  H+       + C YC + F +K  +  HM +H    
Sbjct  555  SPHRCSYCKKTFTRKEHLTNHVRLHT---GDSPHKCEYCQKTFTRKEHLNNHMRQHSSDN  611

Query  420  -------NGPEKNK--------------FPCTIEGCSRVYKTRELYNRHRWNSHKLRAEP  458
                   N P   K               P T E C + +  +     H+ +  K +   
Sbjct  612  PHCCNVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQEME  671

Query  459  RPEITPDGEKIIKLICQQCPKWFTIQLKLDAHIRSYHQGLKGYRCEHCEKEFCKYRSYNR  518
            RP             C++CPK F  +  L +H+RS H G K + C  C K F +  +  R
Sbjct  672  RP-----------FACEKCPKNFICKGHLVSHMRS-HSGEKPHACTLCSKAFVERGNLKR  719

Query  519  HLRVRH  524
            H+++ H
Sbjct  720  HMKMNH  725


 Score = 131 bits (329),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 102/340 (30%), Positives = 141/340 (41%), Gaps = 36/340 (11%)

Query  811   YFCDYCGKGFRQKSYLGSHMTAHRKKMERKPKTYHCTTDDCSKVFKTKKSFDEHRINIHK  870
             + CD CGK F+ +  L  H   H    ERKP  + C    C + F T +    H   IH 
Sbjct  221   HVCDICGKMFQFRYQLIVHRRYHS---ERKP--FMCQV--CGQGFTTSQDLTRHG-KIHI  272

Query  871   LKPQSPDPTKTKVKFCCPKCPKWFTEQYKLDGHVRSKHEGLKPYKCPECVKEFCRYGAFE  930
               P           F C  C   F     L+ H++ +H   KP+ C  C K F R    +
Sbjct  273   GGPM----------FTCIVCFNVFANNTSLERHMK-RHSTDKPFACTICQKTFARKEHLD  321

Query  931   YHLRAAHQKFLNTTTICEFRCYYDGCDREYGLMDSLNAHIKRAHLGIIPVRRDQKLICDQ  990
              H R+        T    FRC Y  C + +   + +  H+ R H G  P R      CD 
Sbjct  322   NHFRSH-------TGETPFRCQY--CAKTFTRKEHMVNHV-RKHTGETPHR------CDI  365

Query  991   CGKSFVDGYTLKKHIYTHSGKLPHACKICPKAFATNVELKIHTMRHMNVKPFECPTCGAR  1050
             C KSF        H   H+G+ PH C +C K +     L  H   H N  PF C  CG  
Sbjct  366   CKKSFTRKEHYVNHYMWHTGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKS  425

Query  1051  KTTNKELQAHLNFHSKEISYPCKECPRVFTSYGAVTRHVRIHHRNHKPYICPHCQRAFAK  1110
              +  +    H+ +H+ E  + C  C + FT    +  HVR  H    P+ C +C + F +
Sbjct  426   FSRKEHFTNHILWHTGETPHRCDFCSKTFTRKEHLLNHVR-QHTGESPHRCSYCMKTFTR  484

Query  1111  AETMKNHVMTHTGEKPFACPVCDHRFIQAVAMRTHMKVHA  1150
              E + NH+  HTGE PF C  C   F +   M  H++ H 
Sbjct  485   KEHLVNHIRQHTGETPFKCTYCTKAFTRKDHMVNHVRQHT  524


 Score = 121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 123/479 (26%), Positives = 192/479 (40%), Gaps = 79/479 (16%)

Query  158  ICDQCGKSFVDGYTLKKHIYTHSGKHPHACKICPKTFPT---------------------  196
            +CD CGK F   Y L  H   HS + P  C++C + F T                     
Sbjct  222  VCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTCIV  281

Query  197  -------NAELKIHTMRHLKVKPFECPTCGARKTTRKELNTHLSVHSTEITYPCKECPRV  249
                   N  L+ H  RH   KPF C  C      ++ L+ H   H+ E  + C+ C + 
Sbjct  282  CFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYCAKT  341

Query  250  FPSTSAVSRHVRIHHRNHRPYICPHCERAFAKSETMKNHVMTHTGEKPFACSVCGHRFIQ  309
            F     +  HVR  H    P+ C  C+++F + E   NH M HTG+ P  C VCG ++ +
Sbjct  342  FTRKEHMVNHVRK-HTGETPHRCDICKKSFTRKEHYVNHYMWHTGQTPHQCDVCGKKYTR  400

Query  310  SVALRTHMKVHEK----RVKIITAPI--KEEPPIDVNMELEENPAEAEDIESEFFKIEYI  363
               L  HM+ H      R +I       KE     +     E P   +     F + E++
Sbjct  401  KEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTFTRKEHL  460

Query  364  DAKFEQYHYVS-----------TAQNDVTSPVDTHSNSMSSEKYICHYCDRVFNKKTSIG  412
                 Q+   S           T +  + + +  H+       + C YC + F +K  + 
Sbjct  461  LNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGETP---FKCTYCTKAFTRKDHMV  517

Query  413  AHMARHRNGPEKNKFPCTIEGCSRVYKTRELYNRHRWNSHKLRAEPRPEITPDGEKIIKL  472
             H+ +H  G   +K  CT   C++ +  +E    H    H   +  R             
Sbjct  518  NHVRQH-TGESPHK--CTY--CTKTFTRKEHLTNH-VRQHTGDSPHR-------------  558

Query  473  ICQQCPKWFTIQLKLDAHIRSYHQGLKGYRCEHCEKEFCKYRSYNRHLRVRHGTDETEKH  532
             C  C K FT +  L  H+R  H G   ++CE+C+K F +    N H+R +H +D    H
Sbjct  559  -CSYCKKTFTRKEHLTNHVR-LHTGDSPHKCEYCQKTFTRKEHLNNHMR-QHSSD--NPH  613

Query  533  YCTYDGCDREYGALDSLKNHIKRIHLGIVRATRKPTCGQCGQVFKTRYSLKKHSLKHSE  591
             C  + C++ +   + L NH+ R H G     R  TC  CG+ F  + +L  H   H++
Sbjct  614  CC--NVCNKPFTRKEHLINHMSRCHTG----DRPFTCETCGKSFPLKGNLLFHQRSHTK  666


 Score = 119 bits (297),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 101/351 (29%), Positives = 153/351 (44%), Gaps = 41/351 (12%)

Query  802   STTSEDPPKYFCDYCGKGFRQKSYLGSHMTAHRKKMERKPKTYHCTTDDCSKVFKTKKSF  861
             S T+E P  + C+ CGK F +K +  +H+  H  +   +        D CSK F  K   
Sbjct  410   SHTNETP--FRCEICGKSFSRKEHFTNHILWHTGETPHR-------CDFCSKTFTRK---  457

Query  862   DEHRINIHKLKPQSPDPTKTKVKFCCPKCPKWFTEQYKLDGHVRSKHEGLKPYKCPECVK  921
              EH +N H  +     P +      C  C K FT +  L  H+R +H G  P+KC  C K
Sbjct  458   -EHLLN-HVRQHTGESPHR------CSYCMKTFTRKEHLVNHIR-QHTGETPFKCTYCTK  508

Query  922   EFCRYGAFEYHLRAAHQKFLNTTTICEFRCYYDGCDREYGLMDSLNAHIKRAHLGIIPVR  981
              F R      H+R         T     +C Y  C + +   + L  H+ R H G  P R
Sbjct  509   AFTRKDHMVNHVRQH-------TGESPHKCTY--CTKTFTRKEHLTNHV-RQHTGDSPHR  558

Query  982   RDQKLICDQCGKSFVDGYTLKKHIYTHSGKLPHACKICPKAFATNVELKIHTMRHMNVKP  1041
                   C  C K+F     L  H+  H+G  PH C+ C K F     L  H  +H +  P
Sbjct  559   ------CSYCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNP  612

Query  1042  FECPTCGARKTTNKELQAHLNF-HSKEISYPCKECPRVFTSYGAVTRHVRIHHRNH---K  1097
               C  C    T  + L  H++  H+ +  + C+ C + F   G +  H R H +     +
Sbjct  613   HCCNVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMER  672

Query  1098  PYICPHCQRAFAKAETMKNHVMTHTGEKPFACPVCDHRFIQAVAMRTHMKV  1148
             P+ C  C + F     + +H+ +H+GEKP AC +C   F++   ++ HMK+
Sbjct  673   PFACEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSKAFVERGNLKRHMKM  723


 Score = 118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 122/490 (25%), Positives = 188/490 (38%), Gaps = 83/490 (17%)

Query  157  LICDQCGKSFVDGYTLKKHIYTHSGKHPHACKICPKTFPTNAELKIHTMRHLKVKPFECP  216
             +C  CG+ F     L +H   H G     C +C   F  N  L+ H  RH   KPF C 
Sbjct  249  FMCQVCGQGFTTSQDLTRHGKIHIGGPMFTCIVCFNVFANNTSLERHMKRHSTDKPFACT  308

Query  217  TCGARKTTRKELNTHLSVHSTEITYPCKECPRVFPSTSAVSRHVRIHHRNHRPYICPHCE  276
             C      ++ L+ H   H+ E  + C+ C + F     +  HVR H     P+ C  C+
Sbjct  309  ICQKTFARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEHMVNHVRKH-TGETPHRCDICK  367

Query  277  RAFAKSETMKNHVMTHTGEKPFACSVCGHRFIQSVALRTHMKVHEK----RVKIITAPI-  331
            ++F + E   NH M HTG+ P  C VCG ++ +   L  HM+ H      R +I      
Sbjct  368  KSFTRKEHYVNHYMWHTGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFS  427

Query  332  -KEEPPIDVNMELEENPAEAEDIESEFFKIEYIDAKFEQYHYVS-----------TAQND  379
             KE     +     E P   +     F + E++     Q+   S           T +  
Sbjct  428  RKEHFTNHILWHTGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEH  487

Query  380  VTSPVDTHSNSMSSEKYICHYCDRVFNKKTSIGAHMARHRNGPEKNKFPCTIEGCSRVYK  439
            + + +  H+       + C YC + F +K  +  H+ +H  G   +K  CT   C++ + 
Sbjct  488  LVNHIRQHTGETP---FKCTYCTKAFTRKDHMVNHVRQH-TGESPHK--CTY--CTKTFT  539

Query  440  TRELYNRHRWNSHKLRAEPRPEITPDGEKIIKLICQQCPKWFTIQLKLDAHIRSYHQGLK  499
             +E    H    H   +  R              C  C K FT +  L  H+R  H G  
Sbjct  540  RKEHLTNH-VRQHTGDSPHR--------------CSYCKKTFTRKEHLTNHVR-LHTGDS  583

Query  500  GYRCEHCEKEFCKYRSYNRHLRVRHGTDETEKHYCTYDGCDREYGALDSLKNHIKRIHLG  559
             ++CE+C+K F +    N H+R +H +D    H C  + C++ +   + L NH+ R H G
Sbjct  584  PHKCEYCQKTFTRKEHLNNHMR-QHSSDN--PHCC--NVCNKPFTRKEHLINHMSRCHTG  638

Query  560  IVRATRKPTCGQCGQVFKTRYSL--------------------------------KKHSL  587
                 R  TC  CG+ F  + +L                                  H  
Sbjct  639  ----DRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMR  694

Query  588  KHSEISPSAC  597
             HS   P AC
Sbjct  695  SHSGEKPHAC  704


 Score = 115 bits (288),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 97/342 (28%), Positives = 141/342 (41%), Gaps = 39/342 (11%)

Query  813   CDYCGKGFRQKSYLGSHMTAHRKKMERKPKTYHCTTDDCSKVFKTKKSFDEHRINIHKLK  872
             CD CGK + +K +L +HM +H  +       + C  + C K F  K+ F  H +      
Sbjct  391   CDVCGKKYTRKEHLANHMRSHTNETP-----FRC--EICGKSFSRKEHFTNHILWHTGET  443

Query  873   PQSPDPTKTKVKFCCPKCPKWFTEQYKLDGHVRSKHEGLKPYKCPECVKEFCRYGAFEYH  932
             P             C  C K FT +  L  HVR +H G  P++C  C+K F R      H
Sbjct  444   PHR-----------CDFCSKTFTRKEHLLNHVR-QHTGESPHRCSYCMKTFTRKEHLVNH  491

Query  933   LRAAHQKFLNTTTICEFRCYYDGCDREYGLMDSLNAHIKRAHLGIIPVRRDQKLICDQCG  992
             +R         T    F+C Y  C + +   D +  H+ R H G  P +      C  C 
Sbjct  492   IRQH-------TGETPFKCTY--CTKAFTRKDHMVNHV-RQHTGESPHK------CTYCT  535

Query  993   KSFVDGYTLKKHIYTHSGKLPHACKICPKAFATNVELKIHTMRHMNVKPFECPTCGARKT  1052
             K+F     L  H+  H+G  PH C  C K F     L  H   H    P +C  C    T
Sbjct  536   KTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFT  595

Query  1053  TNKELQAHLNFHSKEISYPCKECPRVFTSYGAVTRHVRIHHRNHKPYICPHCQRAFAKAE  1112
               + L  H+  HS +  + C  C + FT    +  H+   H   +P+ C  C ++F    
Sbjct  596   RKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKG  655

Query  1113  TMKNHVMTHTG----EKPFACPVCDHRFIQAVAMRTHMKVHA  1150
              +  H  +HT     E+PFAC  C   FI    + +HM+ H+
Sbjct  656   NLLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHS  697


 Score = 111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 105/414 (25%), Positives = 165/414 (40%), Gaps = 76/414 (18%)

Query  185  HACKICPKTFPTNAELKIHTMRHLKVKPFECPTCGARKTTRKELNTHLSVHSTEITYPCK  244
            H C IC K F    +L +H   H + KPF C  CG   TT ++L  H  +H     + C 
Sbjct  221  HVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTCI  280

Query  245  ECPRVFPSTSAVSRHVRIHHRNHRPYICPHCERAFAKSETMKNHVMTHTGEKPFACSVCG  304
             C  VF + +++ RH++ H  + +P+ C  C++ FA+ E + NH  +HTGE PF C  C 
Sbjct  281  VCFNVFANNTSLERHMKRHSTD-KPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYCA  339

Query  305  HRFIQSVALRTHMKVHEKRVKIITAPIKEEPPIDVNMELEENPAEAEDIESEFFKIEYID  364
              F +   +  H++ H                        E P   +  +  F + E+  
Sbjct  340  KTFTRKEHMVNHVRKHTG----------------------ETPHRCDICKKSFTRKEH--  375

Query  365  AKFEQYHYVSTAQNDVTSPVDTHSNSMSSEKYICHYCDRVFNKKTSIGAHMARHRNGPEK  424
              +  ++   T Q                  + C  C + + +K  +  HM  H N   +
Sbjct  376  --YVNHYMWHTGQTP----------------HQCDVCGKKYTRKEHLANHMRSHTN---E  414

Query  425  NKFPCTIEGCSRVYKTRELYNRH-RWNSHKLRAEPRPEITPDGEKIIKLICQQCPKWFTI  483
              F C I  C + +  +E +  H  W++              GE   +  C  C K FT 
Sbjct  415  TPFRCEI--CGKSFSRKEHFTNHILWHT--------------GETPHR--CDFCSKTFTR  456

Query  484  QLKLDAHIRSYHQGLKGYRCEHCEKEFCKYRSYNRHLRVRHGTDETEKHYCTYDGCDREY  543
            +  L  H+R  H G   +RC +C K F +      H+R   G    +   CTY  C + +
Sbjct  457  KEHLLNHVRQ-HTGESPHRCSYCMKTFTRKEHLVNHIRQHTGETPFK---CTY--CTKAF  510

Query  544  GALDSLKNHIKRIHLGIVRATRKPTCGQCGQVFKTRYSLKKHSLKHSEISPSAC  597
               D + NH+ R H G         C  C + F  +  L  H  +H+  SP  C
Sbjct  511  TRKDHMVNHV-RQHTG----ESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPHRC  559


 Score = 108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 104/379 (27%), Positives = 149/379 (39%), Gaps = 67/379 (18%)

Query  802   STTSEDPPKYFCDYCGKGFRQKSYLGSHMTAHRKKMERKPKTYHCTTDDCSKVFKTKKSF  861
             S T E P  + C YC K F +K ++ +H+  H  +   +        D C K F  K   
Sbjct  326   SHTGETP--FRCQYCAKTFTRKEHMVNHVRKHTGETPHR-------CDICKKSFTRK---  373

Query  862   DEHRINIHKLKPQSPDPTKTKVKFCCPKCPKWFTEQYKLDGHVRSKHEGLKPYKCPECVK  921
              EH +N H +      P +      C  C K +T +  L  H+RS H    P++C  C K
Sbjct  374   -EHYVN-HYMWHTGQTPHQ------CDVCGKKYTRKEHLANHMRS-HTNETPFRCEICGK  424

Query  922   EFCRYGAFEYHLRAAHQKFLNTTTICEFRCYYDGCDREYGLMDSLNAHIKRAHLGIIPVR  981
              F R   F  H+       L  T     RC  D C + +   + L  H+ R H G  P R
Sbjct  425   SFSRKEHFTNHI-------LWHTGETPHRC--DFCSKTFTRKEHLLNHV-RQHTGESPHR  474

Query  982   RDQKLICDQCGKSFVDGYTLKKHIYTHSGKLPHACKICPKAFATNVELKIHTMRHMNVKP  1041
                   C  C K+F     L  HI  H+G+ P  C  C KAF     +  H  +H    P
Sbjct  475   ------CSYCMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTRKDHMVNHVRQHTGESP  528

Query  1042  FECPTCGARKTTNKELQAHLNFHSKEISYPCKECPRVFTSYGAVTRHVRIHHRNHKPYIC  1101
              +C  C    T  + L  H+  H+ +  + C  C + FT    +T HVR+H     P+ C
Sbjct  529   HKCTYCTKTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRLH-TGDSPHKC  587

Query  1102  PHCQRAFAKAETMKNHVMTH-----------------------------TGEKPFACPVC  1132
              +CQ+ F + E + NH+  H                             TG++PF C  C
Sbjct  588   EYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGDRPFTCETC  647

Query  1133  DHRFIQAVAMRTHMKVHAK  1151
                F     +  H + H K
Sbjct  648   GKSFPLKGNLLFHQRSHTK  666


 Score = 105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 91/310 (29%), Positives = 126/310 (41%), Gaps = 34/310 (11%)

Query  15   YRCTTDGCSKVFKTKKSFDEHRINIHNIKPESPVPTEKKLKFCCPKCPKWFTEQYKLDGH  74
            +RC  + C K F  K+ F  H +      P             C  C K FT +  L  H
Sbjct  417  FRC--EICGKSFSRKEHFTNHILWHTGETPHR-----------CDFCSKTFTRKEHLLNH  463

Query  75   VRSTHEGLKPYQCPECEKEFCRYGAFEFHLRTTHKMVLTTTKVKEFRCYYDGCDRKYGLM  134
            VR  H G  P++C  C K F R      H+R         T    F+C Y  C + +   
Sbjct  464  VRQ-HTGESPHRCSYCMKTFTRKEHLVNHIRQH-------TGETPFKCTY--CTKAFTRK  513

Query  135  DSLNAHIKRAHLGIIPVRRDQKLICDQCGKSFVDGYTLKKHIYTHSGKHPHACKICPKTF  194
            D +  H+ R H G  P +      C  C K+F     L  H+  H+G  PH C  C KTF
Sbjct  514  DHMVNHV-RQHTGESPHK------CTYCTKTFTRKEHLTNHVRQHTGDSPHRCSYCKKTF  566

Query  195  PTNAELKIHTMRHLKVKPFECPTCGARKTTRKELNTHLSVHSTEITYPCKECPRVFPSTS  254
                 L  H   H    P +C  C    T ++ LN H+  HS++  + C  C + F    
Sbjct  567  TRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKE  626

Query  255  AVSRHVRIHHRNHRPYICPHCERAFAKSETMKNHVMTHTG----EKPFACSVCGHRFIQS  310
             +  H+   H   RP+ C  C ++F     +  H  +HT     E+PFAC  C   FI  
Sbjct  627  HLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNFICK  686

Query  311  VALRTHMKVH  320
              L +HM+ H
Sbjct  687  GHLVSHMRSH  696


 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 75/167 (45%), Gaps = 1/167 (1%)

Query  986   LICDQCGKSFVDGYTLKKHIYTHSGKLPHACKICPKAFATNVELKIHTMRHMNVKPFECP  1045
              +C  CG+ F     L +H   H G     C +C   FA N  L+ H  RH   KPF C 
Sbjct  249   FMCQVCGQGFTTSQDLTRHGKIHIGGPMFTCIVCFNVFANNTSLERHMKRHSTDKPFACT  308

Query  1046  TCGARKTTNKELQAHLNFHSKEISYPCKECPRVFTSYGAVTRHVRIHHRNHKPYICPHCQ  1105
              C       + L  H   H+ E  + C+ C + FT    +  HVR H     P+ C  C+
Sbjct  309   ICQKTFARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEHMVNHVRKH-TGETPHRCDICK  367

Query  1106  RAFAKAETMKNHVMTHTGEKPFACPVCDHRFIQAVAMRTHMKVHAKK  1152
             ++F + E   NH M HTG+ P  C VC  ++ +   +  HM+ H  +
Sbjct  368   KSFTRKEHYVNHYMWHTGQTPHQCDVCGKKYTRKEHLANHMRSHTNE  414


 Score = 86.7 bits (213),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 89/324 (27%), Positives = 128/324 (40%), Gaps = 72/324 (22%)

Query  804   TSEDPPKYFCDYCGKGFRQKSYLGSHMTAHRKKMERKPKTYHCTTDDCSKVFKTKKSFDE  863
             T E P +  CD+C K F +K +L +H+  H  +   +          C K F  K    E
Sbjct  440   TGETPHR--CDFCSKTFTRKEHLLNHVRQHTGESPHR-------CSYCMKTFTRK----E  486

Query  864   HRIN-IHKLKPQSPDPTKTKVKFCCPKCPKWFTEQYKLDGHVRSKHEGLKPYKCPECVKE  922
             H +N I +   ++P        F C  C K FT +  +  HVR +H G  P+KC  C K 
Sbjct  487   HLVNHIRQHTGETP--------FKCTYCTKAFTRKDHMVNHVR-QHTGESPHKCTYCTKT  537

Query  923   FCRYGAFEYHLRAAHQKFLNTTTICEFRCYYDGCDREYGLMDSLNAHIKRAHLGIIPVRR  982
             F R      H+R         T     RC Y  C + +   + L  H+ R H G  P + 
Sbjct  538   FTRKEHLTNHVRQH-------TGDSPHRCSY--CKKTFTRKEHLTNHV-RLHTGDSPHK-  586

Query  983   DQKLICDQCGKSFVDGYTLKKHIYTHSGKLPHACKICPKAFATNVELKIHTMR-HMNVKP  1041
                  C+ C K+F     L  H+  HS   PH C +C K F     L  H  R H   +P
Sbjct  587   -----CEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGDRP  641

Query  1042  FECPTCGAR-------------KTTNKELQ-------------------AHLNFHSKEIS  1069
             F C TCG                T  +E++                   +H+  HS E  
Sbjct  642   FTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSGEKP  701

Query  1070  YPCKECPRVFTSYGAVTRHVRIHH  1093
             + C  C + F   G + RH++++H
Sbjct  702   HACTLCSKAFVERGNLKRHMKMNH  725


 Score = 41.6 bits (96),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 39/82 (48%), Gaps = 1/82 (1%)

Query  1069  SYPCKECPRVFTSYGAVTRHVRIHHRNHKPYICPHCQRAFAKAETMKNHVMTHTGEKPFA  1128
             ++ C  C ++F     +  H R +H   KP++C  C + F  ++ +  H   H G   F 
Sbjct  220   THVCDICGKMFQFRYQLIVHRR-YHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFT  278

Query  1129  CPVCDHRFIQAVAMRTHMKVHA  1150
             C VC + F    ++  HMK H+
Sbjct  279   CIVCFNVFANNTSLERHMKRHS  300


 Score = 30.8 bits (68),  Expect = 8.9, Method: Compositional matrix adjust.
 Identities = 34/138 (25%), Positives = 50/138 (36%), Gaps = 17/138 (12%)

Query  559  GIVRATRKPTCGQCGQVFKTRYSLKKHSLKHSEISPSACKAESIGMYRTHHRNQVCVGRI  618
            G   AT    C  CG++F+ RY L  H   HSE  P  C+    G   +    +     I
Sbjct  213  GTPIATGTHVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHI  272

Query  619  KSSFSTYI--FEV--------RNDERQCEDTPVLNNFSFSLRNKELKMDNPFSN------  662
                 T I  F V        R+ +R   D P           ++  +DN F +      
Sbjct  273  GGPMFTCIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETP  332

Query  663  -RCRACAVLLMSSEKIIS  679
             RC+ CA      E +++
Sbjct  333  FRCQYCAKTFTRKEHMVN  350



Lambda      K        H
   0.317    0.130    0.375 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4829926040


Query= XP_037024178.1 uncharacterized protein LOC119066058 [Bradysia
coprophila]

Length=2032
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TRXR2_PLAF7  unnamed protein product                                  36.2    0.36 
Q38AZ9_TRYB2  unnamed protein product                                 33.9    0.45 
Q9GRG8_9TRYP  unnamed protein product                                 33.9    0.45 


>TRXR2_PLAF7 unnamed protein product
Length=617

 Score = 36.2 bits (82),  Expect = 0.36, Method: Compositional matrix adjust.
 Identities = 37/134 (28%), Positives = 56/134 (42%), Gaps = 19/134 (14%)

Query  1041  IPKDDIFMLSYVPKEHNKVTKRTVLSELSQLFDPLGFVNPVVVMAKIF--LQEICKLKLQ  1098
             I  DDIF L   P +   V    V  E S   + LG+   V V + +     + C +K  
Sbjct  286   ITSDDIFSLKKDPGKTLVVGASYVALECSGFLNSLGYDVTVAVRSIVLRGFDQQCAVK--  343

Query  1099  WDAAVPMHMNSKWEQYRNQLKKLNKVKLPRRILVDNPSDIQLHLFSDASEEAYGSVAYL-  1157
                 V ++M  +   ++N +      K+  +ILV+         FSD + E Y +V Y  
Sbjct  344   ----VKLYMEEQGVMFKNGILPKKLTKMDDKILVE---------FSDKTSELYDTVLYAI  390

Query  1158  -RSVNSDGERLVSL  1170
              R  + DG  L SL
Sbjct  391   GRKGDIDGLNLESL  404


>Q38AZ9_TRYB2 unnamed protein product
Length=140

 Score = 33.9 bits (76),  Expect = 0.45, Method: Composition-based stats.
 Identities = 21/70 (30%), Positives = 31/70 (44%), Gaps = 18/70 (26%)

Query  456  DCKEPHYISK-CP-VFAALNLKGKVEKLRNWKMCWNCLVKGHDTRDCKNKNS--------  505
            +C +P +IS+ CP      N+ G        + C+NC   GH +RDC N  S        
Sbjct  43   NCGQPDHISRDCPNARTGGNMGGG-------RSCYNCGRPGHISRDCPNARSGGNMGGGR  95

Query  506  -CTKCSRKHH  514
             C  C ++ H
Sbjct  96   ACYHCQQEGH  105


 Score = 32.7 bits (73),  Expect = 1.3, Method: Composition-based stats.
 Identities = 22/76 (29%), Positives = 32/76 (42%), Gaps = 18/76 (24%)

Query  450  NANKKCDCKEPHYISK-CP-VFAALNLKGKVEKLRNWKMCWNCLVKGHDTRDCKNK----  503
            NA    +C +P ++S+ CP   +  N+ G        + C+NC    H +RDC N     
Sbjct  9    NARTCYNCGQPGHMSRECPNARSGGNMGGG-------RSCYNCGQPDHISRDCPNARTGG  61

Query  504  -----NSCTKCSRKHH  514
                  SC  C R  H
Sbjct  62   NMGGGRSCYNCGRPGH  77


 Score = 31.6 bits (70),  Expect = 3.3, Method: Composition-based stats.
 Identities = 24/97 (25%), Positives = 39/97 (40%), Gaps = 25/97 (26%)

Query  428  SQDTPNQKTSLVATPSTSPNIFNANKKCDCKEPHYISK-CP-VFAALNLKGKVEKLRNWK  485
            S+D PN +T          N+       +C  P +IS+ CP   +  N+ G        +
Sbjct  51   SRDCPNARTG--------GNMGGGRSCYNCGRPGHISRDCPNARSGGNMGGG-------R  95

Query  486  MCWNCLVKGHDTRDCKNK--------NSCTKCSRKHH  514
             C++C  +GH  R+C N          +C  C +  H
Sbjct  96   ACYHCQQEGHIARECPNAPADAAAGGRACFNCGQPGH  132


 Score = 30.8 bits (68),  Expect = 4.9, Method: Composition-based stats.
 Identities = 13/44 (30%), Positives = 20/44 (45%), Gaps = 9/44 (20%)

Query  480  KLRNWKMCWNCLVKGHDTRDCKNK---------NSCTKCSRKHH  514
            ++ N + C+NC   GH +R+C N           SC  C +  H
Sbjct  6    QMSNARTCYNCGQPGHMSRECPNARSGGNMGGGRSCYNCGQPDH  49


>Q9GRG8_9TRYP unnamed protein product
Length=140

 Score = 33.9 bits (76),  Expect = 0.45, Method: Composition-based stats.
 Identities = 21/70 (30%), Positives = 31/70 (44%), Gaps = 18/70 (26%)

Query  456  DCKEPHYISK-CP-VFAALNLKGKVEKLRNWKMCWNCLVKGHDTRDCKNKNS--------  505
            +C +P +IS+ CP      N+ G        + C+NC   GH +RDC N  S        
Sbjct  43   NCGQPDHISRDCPNARTGGNMGGG-------RSCYNCGRPGHISRDCPNARSGGNMGGGR  95

Query  506  -CTKCSRKHH  514
             C  C ++ H
Sbjct  96   ACYHCQQEGH  105


 Score = 31.6 bits (70),  Expect = 3.3, Method: Composition-based stats.
 Identities = 24/97 (25%), Positives = 39/97 (40%), Gaps = 25/97 (26%)

Query  428  SQDTPNQKTSLVATPSTSPNIFNANKKCDCKEPHYISK-CP-VFAALNLKGKVEKLRNWK  485
            S+D PN +T          N+       +C  P +IS+ CP   +  N+ G        +
Sbjct  51   SRDCPNARTG--------GNMGGGRSCYNCGRPGHISRDCPNARSGGNMGGG-------R  95

Query  486  MCWNCLVKGHDTRDCKNK--------NSCTKCSRKHH  514
             C++C  +GH  R+C N          +C  C +  H
Sbjct  96   ACYHCQQEGHIARECPNAPLDAAAGGRACFNCGQPGH  132


 Score = 30.8 bits (68),  Expect = 6.1, Method: Composition-based stats.
 Identities = 13/44 (30%), Positives = 20/44 (45%), Gaps = 9/44 (20%)

Query  480  KLRNWKMCWNCLVKGHDTRDCKNK---------NSCTKCSRKHH  514
            ++ N + C+NC   GH +R+C N           SC  C +  H
Sbjct  6    QMSNARTCYNCGHAGHMSRECPNARSGGNMGGGRSCYNCGQPDH  49



Lambda      K        H
   0.317    0.130    0.375 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4829926040


Query= XP_037024179.1 PE-PGRS family protein PE_PGRS30-like [Bradysia
coprophila]

Length=486
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8I398_PLAF7  unnamed protein product                                 30.8    3.0  


>Q8I398_PLAF7 unnamed protein product
Length=2112

 Score = 30.8 bits (68),  Expect = 3.0, Method: Composition-based stats.
 Identities = 33/121 (27%), Positives = 43/121 (36%), Gaps = 14/121 (12%)

Query  27   GGGGGGGGGGSGGLLGGLLGGGGGGGGGGLLGGLLGGGGGGGSGGGLLGGL-------LG  79
            GG G      +GG L G  G       GG+ GGL        S   + GGL         
Sbjct  222  GGLGTSTNQSTGGGLFGNTGATSQNKTGGIFGGLSSTNQASTSSTSMFGGLSSNQAKPTN  281

Query  80   GVLGG--DGGLIGTVTGVVGNLVPTLVG-----TLGSTLSSLDVTGQLTVVIDVLVGAVG  132
             + GG   G    T T   GNL  +  G     T+G    +L  T Q +     + G + 
Sbjct  282  SLFGGLSSGATSNTGTQQSGNLFGSASGIGQSKTVGGIFGNLSSTNQASTSSSNMFGGLS  341

Query  133  S  133
            S
Sbjct  342  S  342



Lambda      K        H
   0.317    0.130    0.375 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4829926040


Query= XP_037024180.1 PE-PGRS family protein PE_PGRS30-like isoform X1
[Bradysia coprophila]

Length=482


***** No hits found *****



Lambda      K        H
   0.317    0.130    0.375 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4829926040


Query= XP_037024181.1 glycine, alanine and asparagine-rich protein-like
isoform X2 [Bradysia coprophila]

Length=471


***** No hits found *****



Lambda      K        H
   0.317    0.130    0.375 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4829926040


Query= XP_037024182.1 keratin, type I cytoskeletal 9-like isoform X3
[Bradysia coprophila]

Length=467


***** No hits found *****



Lambda      K        H
   0.317    0.130    0.375 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4829926040


Query= XP_037024183.1 keratin, type I cytoskeletal 9-like [Bradysia
coprophila]

Length=478
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8I398_PLAF7  unnamed protein product                                 29.6    8.3  


>Q8I398_PLAF7 unnamed protein product
Length=2112

 Score = 29.6 bits (65),  Expect = 8.3, Method: Composition-based stats.
 Identities = 30/109 (28%), Positives = 42/109 (39%), Gaps = 16/109 (15%)

Query  29   GGGSGGGGGGLLGGLLGGFLGGVGCGGGSGSGSGGGSGGGSG------GGLLGGLLGGVL  82
            GGG  G  G       GG  GG+     + + S    GG S         L GGL  G  
Sbjct  233  GGGLFGNTGATSQNKTGGIFGGLSSTNQASTSSTSMFGGLSSNQAKPTNSLFGGLSSGAT  292

Query  83   GG-----DGGLIGTVTGV-----VGNLVPTLVGTLGSTLSSLDVTGQLT  121
                    G L G+ +G+     VG +   L  T  ++ SS ++ G L+
Sbjct  293  SNTGTQQSGNLFGSASGIGQSKTVGGIFGNLSSTNQASTSSSNMFGGLS  341



Lambda      K        H
   0.317    0.130    0.375 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4829926040


Query= XP_037024184.1 uncharacterized protein LOC119066060 [Bradysia
coprophila]

Length=520
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

B7YZG4_DROME  unnamed protein product                                 38.9    0.014
A0A0B4K7Y9_DROME  unnamed protein product                             38.9    0.014
E1JH62_DROME  unnamed protein product                                 38.5    0.014


>B7YZG4_DROME unnamed protein product
Length=5368

 Score = 38.9 bits (89),  Expect = 0.014, Method: Composition-based stats.
 Identities = 34/103 (33%), Positives = 46/103 (45%), Gaps = 10/103 (10%)

Query  332   SKRPYLSPSLKKTYNSPSQPSPSPTKITTTTTPSKGLLFFSTTQK------AYVAPKKSK  385
             S+ P   PS   T  S + P P+   +TTTTTP   L   ST  +      A  AP +  
Sbjct  5266  SRIPQRKPSTGST-ASGTTPRPARLSVTTTTTPGSRLNGTSTITRKTASGSASPAPTRRN  5324

Query  386   LSENSNPDSSFAKPSTEKIQQPMFSMQLKTDNREQVP-EKRNP  427
             +S +S P S    P      +P FS  ++  +R   P EKR P
Sbjct  5325  ISGSSTP-SGMQTPRKSS-AEPTFSSTMRRTSRGTTPTEKREP  5365


>A0A0B4K7Y9_DROME unnamed protein product
Length=5408

 Score = 38.9 bits (89),  Expect = 0.014, Method: Composition-based stats.
 Identities = 34/103 (33%), Positives = 46/103 (45%), Gaps = 10/103 (10%)

Query  332   SKRPYLSPSLKKTYNSPSQPSPSPTKITTTTTPSKGLLFFSTTQK------AYVAPKKSK  385
             S+ P   PS   T  S + P P+   +TTTTTP   L   ST  +      A  AP +  
Sbjct  5306  SRIPQRKPSTGST-ASGTTPRPARLSVTTTTTPGSRLNGTSTITRKTASGSASPAPTRRN  5364

Query  386   LSENSNPDSSFAKPSTEKIQQPMFSMQLKTDNREQVP-EKRNP  427
             +S +S P S    P      +P FS  ++  +R   P EKR P
Sbjct  5365  ISGSSTP-SGMQTPRKSS-AEPTFSSTMRRTSRGTTPTEKREP  5405


>E1JH62_DROME unnamed protein product
Length=5388

 Score = 38.5 bits (88),  Expect = 0.014, Method: Composition-based stats.
 Identities = 34/103 (33%), Positives = 46/103 (45%), Gaps = 10/103 (10%)

Query  332   SKRPYLSPSLKKTYNSPSQPSPSPTKITTTTTPSKGLLFFSTTQK------AYVAPKKSK  385
             S+ P   PS   T  S + P P+   +TTTTTP   L   ST  +      A  AP +  
Sbjct  5286  SRIPQRKPSTGST-ASGTTPRPARLSVTTTTTPGSRLNGTSTITRKTASGSASPAPTRRN  5344

Query  386   LSENSNPDSSFAKPSTEKIQQPMFSMQLKTDNREQVP-EKRNP  427
             +S +S P S    P      +P FS  ++  +R   P EKR P
Sbjct  5345  ISGSSTP-SGMQTPRKSS-AEPTFSSTMRRTSRGTTPTEKREP  5385



Lambda      K        H
   0.317    0.130    0.375 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4829926040


Query= XP_037024185.1 vacuolar protein sorting-associated protein 13D
isoform X1 [Bradysia coprophila]

Length=4202
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

VP13D_DROME  unnamed protein product                                  2940    0.0  
VPS13_DROME  unnamed protein product                                  145     9e-34
VP13C_DICDI  unnamed protein product                                  144     2e-33


>VP13D_DROME unnamed protein product
Length=3919

 Score = 2940 bits (7621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1723/4243 (41%), Positives = 2523/4243 (59%), Gaps = 374/4243 (9%)

Query  1     MLRELIAWVLNTYLGKYVENLNTAQLTVALLSGEVELENLPLRRDALRNLGLPLQALSGT  60
             MLR+LI WVLNTYLGKY+ENLN+AQL+VALLSGEVELEN+P+R+DALR+  LP++  +G+
Sbjct  1     MLRDLITWVLNTYLGKYLENLNSAQLSVALLSGEVELENIPIRKDALRSFNLPVEVTAGS  60

Query  61    VGKIKLQIPVRQFRTAPWCILIENVYVVVGPVNLDEWDAEAEEQADLDFKLSRLDGLEAK  120
             + KIKLQIPVRQFRT+PWCI IE ++ ++ P NLD WD E E+  DL++KL+ LD  EA 
Sbjct  61    IRKIKLQIPVRQFRTSPWCISIEGLFCIICPKNLDNWDYEKEKLQDLEYKLAVLDTAEAG  120

Query  121   WRASSEASLEGGYYASSYSGWLSYGTSLMTNIVENLELKIKNVHIRYEDSITIPDQRFAF  180
             WR+     +E  YY SSY+ WL YGT++ TNI++N+ELKI +VH R+ED +     +   
Sbjct  121   WRSEKGKQMES-YYFSSYNNWLKYGTNMATNIIDNIELKISDVHFRFEDIVDTGKSKICT  179

Query  181   GINIESLSARSCDENWTPGYTTAWINNSASFKLVELEAMSFYWDPLHNNEIFGDISSNEL  240
             GI I SL+A+SCD +WT G +    NN  ++KLVEL+ +S YWD LH +      S+ E+
Sbjct  180   GIKIGSLTAQSCDCDWTNG-SYKMNNNEMNYKLVELKELSVYWDLLHEDIKCQSYSNQEI  238

Query  241   AEAISKSK--FTHQFIVSPVCAQAHLKRDRSETPLRTRSRPRLVCDLILNEVQLTLNDWQ  298
              E +  +    +H FI+ P+CA A  KRD+ +  +RT+ +PR+ C+L++ EV + ++  Q
Sbjct  239   LEKMHSTCELRSHNFIIKPICATARWKRDKCQQVIRTKDKPRVSCELLVPEVVIDISKVQ  298

Query  299   YSQMVGCVRGLDDIAKYRRFKLLRPLHSVHQGPRAWWLYAAQCHGFRRISADRRFKIAKD  358
               QM+  +  +  + + R+++L RP  +V   P AWW YA  CHGF     + ++ + K+
Sbjct  299   RLQMLDKLSEIRQVKEVRQYRLKRPTCTVESNPIAWWKYATICHGFDFKKNEEKWLMLKE  358

Query  359   NLEYIEIYSKIIKNPNEVLTTKLKEHKDAVEKERSYDELKLLREICMLRMPTPE-GLSNE  417
             NL Y+ +Y  II NPNE L+   KE K  +E +R   +L ++R IC  ++ T      ++
Sbjct  359   NLRYMLLYKSIILNPNENLSAADKEFKAYIESDRKISDLTIMRRICFEKVFTKGFAFESQ  418

Query  418   TNQGRSMLVQWFPQWWGWYGSPAQTSSSQQQSSSLIALDATTPKDQHQLEDELLDALADS  477
               QG++ML  WFP W GWY +   T +++Q  S               LED++L AL +S
Sbjct  419   NEQGKNMLFHWFPNWMGWYANSPSTPNNEQDES------------LKHLEDDILVALENS  466

Query  478   VESNSILKRDAVFGKFDFTLRKG-----TLDICSGSANKLMLQLQFENLILSVESRPRSA  532
             ++++S LK DAVFG F   L KG     T D  +   NK M ++QF N    ++  P+  
Sbjct  467   LQNSSDLKSDAVFGHFSIKLLKGLVILQTEDKLNDGRNKSM-EMQFNNFSAYLQLSPQLT  525

Query  533   SHFVGLSLGSVLLKDHITNNSEFPDLIKPQVKDESITHSRLHTQRANSRNSGLLNNTEPL  592
             S+ VG+SL  V L D  ++++    LIKPQ  + +  +  +       +N+ L    + L
Sbjct  526   SYTVGISLQEVYLIDKTSSDTMHNYLIKPQTGNTATPNQLV-------KNAAL--QEDIL  576

Query  593   FQMNYERKPLSHNTDYRLLIKSQSLDVVYNMDVIKWIVDFVMKPHQV-IGTRKKIEAMKN  651
             FQ+ YE     ++  ++L IKS+ LD++YN D I+W++DF+   +      R ++     
Sbjct  577   FQLQYEN---CNHLRFQLNIKSKGLDLIYNEDAIQWLLDFLADSNSFKYSPRNRVAK---  630

Query  652   KTKMEIIKNWENILEGDLSDRKTWTLEIDISAPQIIFAENFCVKGGTLVVVDFGRLQLSN  711
               K + +KNW  +  G+  +RK W  EI+I AP+IIF EN+ V    +V++DFG+L++  
Sbjct  631   --KTDFMKNWNEMFSGNEVNRKIWMFEIEIFAPRIIFLENYKVSNSLMVLLDFGKLEMRK  688

Query  712   NQPESSKPEAPQEQFRKDSEEEDAFMTPCSTPPGSEASTSDSPTLCTALSDGFERNIDSS  771
              + +   P          S++++ ++TPCSTPP SE S S+SPTL          N +  
Sbjct  689   MEVKRVIPVIESAVTENTSDDDETYLTPCSTPPASEKSGSESPTLLENPKTESFLNKNVQ  748

Query  772   LNEKSLHQKLYDSFKLNLTDLQVLVCKSKERWAFASSKGSSSLHVLDRFNISLQMERRVV  831
             L E  LH K+YD + +N T+LQVLVCK +ERW  A  K SS+ H++D+FNI+L +E+R +
Sbjct  749   L-EYVLHNKIYDKYLINFTNLQVLVCKYEERWQ-ACLKTSSNFHLIDKFNINLTLEQRNI  806

Query  832   YTLDPQFPSLTMSGSLPKLVVHVNEHKIAALIQMLNVLSSSTLHSPHRSPIIDAVEEISE  891
             +T+DP++PS  + G+ P +++H NE  I     ++              PII A +E+  
Sbjct  807   FTVDPEYPSFMLFGTCPTILIHGNEELINNCCNIM-------------KPIIKASKEMEN  853

Query  892   KMQENVPFNDDEEQPVWQRDGSKLVILQFSVDQMSLEVQSRGRSIAELQVTGVKAGFSRR  951
               +        E       D    V+++F +DQ+ +E+QS  RSIAELQ+ G +AG ++ 
Sbjct  854   IYRGGNTIYASERIKNLAEDDRSRVVIEFVMDQLVIEMQSTERSIAELQIIGARAGLTKE  913

Query  952   PEDTNLTLSVHGLLLVDAMQSYGQDFELLIASHRHVGIDSVSGSLKQSEPCSPQSPGSPD  1011
             P +TN+++SVHGLLLVDA+QS+G DFELL+ASHRHVG+DS+SGSLK S   SP SPGSP+
Sbjct  914   PHETNISMSVHGLLLVDAIQSFGPDFELLVASHRHVGMDSLSGSLKHSAIVSPTSPGSPN  973

Query  1012  PTLHYDRRPTSPHTISKALSNLQRTNSAT-WSAAGDTDALITVEVLFVTPEPGSGGEQLQ  1070
                 +  R TSPH I+KA+ N++  + +T +    D+ ALI+V++  V P   S   QL 
Sbjct  974   ----FFDRATSPHMITKAVQNIKMGDRSTEFCDDEDSTALISVDIKIVPPNE-SNSMQLH  1028

Query  1071  IANIQFNNLDIIANQETIVELMDFTKRVFPNRKATVNLSAQPNTDTTDHPSSPEPIVPSP  1130
               +I FN+LDIIANQ+TI+E+++F KR          L AQ N   ++ P SP+    +P
Sbjct  1029  TTSITFNSLDIIANQDTIIEILNFAKRT---------LLAQ-NIFPSESPESPKEATEAP  1078

Query  1131  I----------RTEITFDFHRLNVLILRALMRDNFMVGRKVGTFTMSEARIHATLGTSIT  1180
             +            EI FDF RLN+L+L  + RD F VGRKVGT T++EA+I+A+  + ++
Sbjct  1079  VDVVDQVDHKSHNEIFFDFFRLNILLLYTIKRDKFNVGRKVGTVTLTEAKINASFQSDLS  1138

Query  1181  VEGSLGGLQVLDLTPEGIAHQRILSVGKDPLTEPPHV-EQDLLSSLTQEIYAMGTSKDEI  1239
             + GSLGG+QV+D+T E   H RILSVG+D +       +Q +LS L+ EIY+     +E 
Sbjct  1139  IIGSLGGIQVIDITSEAFCHPRILSVGRDQILRASDTNKQTVLSQLSNEIYS-NNYNEET  1197

Query  1240  VLVERQALSFRVTRDLNACVNIKIRMASVWYTHVARFIQELNWCATEFKHYLKNLAKSIR  1299
                E  A+SF+           ++RMAS  YTH  RF++++N C T FK  L+  A SI 
Sbjct  1198  KSDESDAISFQSHWSDKTTCTFQMRMASASYTHCPRFLRDVNACITYFKRSLREFATSIG  1257

Query  1300  EKATDMAMGLVQPRSDVITTPRSNEVYSPRHSLRRKRLTSLSNQQNCIDVKLELDVVLDT  1359
              KATDMA   VQ         R+ E   P +  R +       Q N       LD+++ +
Sbjct  1258  NKATDMAKEFVQ-------QVRAVEQIGPVYPQRNR-------QDNW------LDIIISS  1297

Query  1360  PVLVLPRSSCSSQVFVAHLGKISVTNIRSDKCDDDTKQFQPDKPINRIFTIDEEPFMSEC  1419
             P+++LP S+ S+ V +A+LGKIS +N  + KCD D  +F                     
Sbjct  1298  PIIILPISNTSTNVLIANLGKISCSN--AVKCDSD--EFN--------------------  1333

Query  1420  FAEDFELDDPIKEDLDTSTICAEDRESDLETYVMDVRNMNLYSLDTMTRKGFRMSALPRA  1479
                                          E+Y ++++N  +YSL+ +    +  +  P  
Sbjct  1334  -----------------------------ESYTIEIKNTYVYSLN-IDEGEYSFNVHPAK  1363

Query  1480  EEFYSCQTDAVPVLHDTAIQLDMVRIV--DNTTVHEVYDTKETLQITGSVVKPLNLSLSR  1537
              +      DA+P+LHDTAI L +      DN    ++        I GS+V+ L +SL+R
Sbjct  1364  NK------DAIPILHDTAITLQLYAGYSDDNDEDKQL----NRFSIKGSMVEALKVSLNR  1413

Query  1538  MQYEQLIETIENLFKIPDDLVRPPSEVPQHSQPDLSEFIDQPTISSFDIKDNKVRRKLFA  1597
              QYE L+E+I       ++++    E+ Q+   + +  ID  +I S  I+          
Sbjct  1414  KQYELLLESIRYATNFSNEVLNESDELDQNGDIEPTANIDAESIISTTIQ----------  1463

Query  1598  GPSFNEHKSYVEPKVLFELPSFIIQLKNEVNNPLIEISFRDLKVNYDRCNLYETNVQVSL  1657
                             F +P F I L+NE +N LI ++F++  V +     ++ +V+V L
Sbjct  1464  ----------------FSVPVFQINLQNEYHNDLINLTFKNFNVKHISKG-FDKDVEVVL  1506

Query  1658  RSLLMEDLLQPPDSKHRSMVISSSPETQNLRPGTSFSSRSCPNLIGLHMPDECMTGSLPE  1717
             +S+LMEDL     S  R+MV S   E Q ++     +S SCP+L       +  + S+P 
Sbjct  1507  KSVLMEDLKSDLTSPFRNMVTSVDLE-QKIKKN-EMTSSSCPDLPSYCNSLKNRSSSVPS  1564

Query  1718  NLENTHHLNEEQQPINKTTCPDTPPPSPQPRERQDNLVLYTSLLIDPECPNFDSHYNSMR  1777
                N  H+  +    ++           + +E Q  LV+Y S           +    + 
Sbjct  1565  CFYN--HMQVKVFGGDQKYTSSNKNELGKKKESQ-TLVIYKSH------TGRSAQNGKLE  1615

Query  1778  QSSSIDFNSLDLIISVQSWFVLLNFFGLLSDDHDDVTSSREIPTTSVETVHKKGNSDLDI  1837
             Q+SSI FN L+L I V+ W+ + +FFGL+S D+ +     E+    VE    K  S L +
Sbjct  1616  QTSSIQFNCLNLAICVERWYTIFDFFGLVSVDNVNEKYPEEMKL--VEKHIDKVCSKLKV  1673

Query  1838  SVRSLTLVFIRTDYEIAKANVSNAHFVISKYGQSKTVEGKLGSISLMDLTLHGAIYRERF  1897
             S+RS     IR +  +++ NVSNA F+I +   SK VEG LGS+S+ DLT +G IY+++F
Sbjct  1674  SIRSFNFTLIRNESLLSRVNVSNAVFMILQDPYSKIVEGCLGSVSVNDLTKYGNIYKQKF  1733

Query  1898  LTSGYEALNFFYRQDGPKLNS-RSMNCDAKLKIQMSSVKYVHTKRFVAEIQAFFKEFQQL  1956
             LTSG EALNF Y++    L +  +++ D+ L+I MS+V Y+HTKRF  E+  F K+  QL
Sbjct  1734  LTSGTEALNFVYKKKLVDLEALNTLDTDSTLRINMSAVHYIHTKRFSTELHVFVKDLLQL  1793

Query  1957  QTPVLRKIKPSESRHSLHQRPLQLGLEINAGSPIILLPLSSRSEKVIVADLGEFSLQNNF  2016
             QTPV+RK+K   S  ++  RP ++ L I A SP+I+LP S    +VI+A LG+FSL+N+F
Sbjct  1794  QTPVIRKLKKHGSEQNM--RPSKMKLVIQADSPVIVLPSSYNRNEVIIAYLGQFSLKNSF  1851

Query  2017  HLASERGIISIKVDDTGPDEILDVMQVHLVNTDLFAGIRI---GKSDFVAGKLDICMDMN  2073
             H AS+  IIS        DEILDVM++ LVN +LF+G R     K+D    ++ I  DMN
Sbjct  1852  HFASDNNIISKMSATPSKDEILDVMRIDLVNINLFSGERSSMKAKADQEKDRI-IIADMN  1910

Query  2074  GYAILKQGSNLLNSKCHLKLIVERNMDSWKSQNVPDISVHGTLSRLEAVLDLQQYQLVRG  2133
                 L+ G    N  C L L +ERN+ +   +  PDISV GT S+L  ++++QQY+L+R 
Sbjct  1911  ---FLRLGQPFFNESCFLHLQLERNLSADAHRVCPDISVQGTFSKLSGIINIQQYKLIRS  1967

Query  2134  FLSYNLGECIDDLVVEPTYNSDSRSNLLTDV----AKTTDKRVWTNLSITLDLQDVSVRL  2189
             FL+ N+GE  DD+ +    NS +    L+ +         K V   +SI + L+DVS+ L
Sbjct  1968  FLNNNIGEQTDDIYMNYHNNSCTSIERLSTINLMPKNEVSKIVSILISIRILLEDVSLLL  2027

Query  2190  NTPTNTHYIIDDPSSHNHPSLARIKFIKSSLKIDSFSDGSQDIDLVSQEILVIDSRYANT  2249
                T+    I+         LA I F+KS+L+ID FSDGSQDIDL+S  IL++D R  N 
Sbjct  2028  ALNTSQSAAIE--------PLACIHFLKSTLEIDLFSDGSQDIDLISSNILIVDER--NE  2077

Query  2250  HTDQPKNVFTNILQPINSNPG-NDSVQAEVHSRRRNDSSKFTILLNNMRVMAILDWLEMC  2308
                  +NVF NIL+P        +SVQ EVH R++   SK+TI+LNNMRV A+L +L+  
Sbjct  2078  SDKSNENVFKNILEPSKKEVRIENSVQVEVHCRKKATFSKYTIMLNNMRVFALLSFLDQL  2137

Query  2309  RDFLSQNAEKPKDLIAIQKVNENLQTPVPEEPM--ELVLNITDSELVFVETPDQWDTNAV  2366
             + +L +++  P   +     N+  Q P  +  +  E V+NITDSE++F E   + D+NA+
Sbjct  2138  KSYLQEDSPAP---VVNNAANQIAQKPQIDTSISTEYVVNITDSEIIFAEECSRLDSNAI  2194

Query  2367  ILKSTTILSYRPIEVDKVMSINLNHLEVFSCVLGFEEETALSIIDPVTINMDLKKNVLDI  2426
             ILKSTT++ Y+P      +S+++NHLE+FSC L  EEE+ALSIIDP T+ ++L+ N L+I
Sbjct  2195  ILKSTTVICYKPNSNIVPLSLDINHLEIFSCTLDAEEESALSIIDPFTLIIELRSNCLNI  2254

Query  2427  QLAKRLSIRLSYNDVKMFSQMLQSLPRQTKNAKSKDHVTGDRSVDVQLISKLSALGFNSD  2486
              + K L+IRLSY DVK+FS+M + LP QT   K   +V      D++  + L A+GF   
Sbjct  2255  LIQKHLNIRLSYVDVKLFSRMARLLPTQTSRPK---NVISKADSDLEKAAPLVAMGFEIS  2311

Query  2487  DCVNALEICNNELDEAALWLTQHAEPTKHSHTIVHPLEIKSIAVQANCISICVIDDCKDA  2546
             DC+ A++I N  +++AA+WL+Q  + T  +      LE+K+  V A+ IS+ +IDDC DA
Sbjct  2312  DCLYAMQINNWRINDAAIWLSQQKQNTYRNPA----LEMKTAVVDASLISVFIIDDCMDA  2367

Query  2547  DVPLLELSLSQLEFDQELSSSTELMRRSNADLSADKLCFKTGSLKGTFASDYYNRGLSGW  2606
             DVPLLE+SLS+   +    +     + +N         +  G++    + +YYNR LSGW
Sbjct  2368  DVPLLEVSLSKFLLNFTFQTQDPNPKETNIRH------YSLGNIDTEVSVNYYNRRLSGW  2421

Query  2607  EPLIEPWKCDATWSYSLGSGMQRNRLHLKVNSEDMVKLNVTSTSIELYRIVHDDWTQDYY  2666
             EP+ E W+ +  W Y+ G    + R  + ++S+ M+KLNVTST IEL+ +V  +WT D+ 
Sbjct  2422  EPVAETWESNLNWKYTKGHLDNKKRFEIGISSKQMLKLNVTSTFIELFHMVLKNWTNDFN  2481

Query  2667  SQPASISNNKKSIQMSPNNYRRRNPFVPFAIRNETGVRLWFT--------VSRSESSMTS  2718
                A              N+R+R+PF+PFA++N +G  L F         ++RS+     
Sbjct  2482  DNGAK-------------NFRQRSPFIPFALQNLSGTPLLFKPIYAPLGDLTRSDLQQVE  2528

Query  2719  SETRWTPVEPNAVTSFSFGPQSKQRHNDTHKLNIHQVGVRVEGWSEVGPVSVDKVGVFFR  2778
                 W  V+PN   +F F  +SK RH  +H+LN+HQ+ V++ GW+ +GP+SVDKVG+FFR
Sbjct  2529  LIKNWYSVQPNETKTFDFSQKSKLRHVHSHQLNLHQIFVQIHGWTLIGPISVDKVGMFFR  2588

Query  2779  HARYEAVEFVSMPRARIVFSVTLEGSAHKLITVRSALRLINKLDRPILLRMEHDFRYLSN  2838
               + ++ +F++  ++RIVF ++L GSA KLI V+S+L +INKLDR + L+M     + S+
Sbjct  2589  TTKLDS-QFLT--KSRIVFDISLIGSAQKLIKVKSSLGVINKLDRNVFLKMTLKGTH-SD  2644

Query  2839  PLWPAVFSSIVPSSEVYSIPLNRVHSLLSVRPLPTEIDLEATQKELQMQRADEGTAFREV  2898
              L  +  S I P+ E+ S+PL  + + L V                      E  A+ + 
Sbjct  2645  GL--SSISVIKPNDEL-SVPLKFIDASLYV-----------------AHNTSESDAYEDT  2684

Query  2899  KFNSKEYWNKYESAAQRSTNSFQFCKDTLNWKEMDEGSELQQELRTCLSNRDKFRFVAAI  2958
              F+++E                      + WK   +  + +Q L    +N+        I
Sbjct  2685  GFSNEE----------------------ILWKACGK-DDTRQLLAGYDTNKSILYTFVNI  2721

Query  2959  RREGYPTKDAIGIPGHSITLWPPLRLNNLLPCDLLYKLLSGTQGRIASSESASVYEVDLE  3018
              RE Y  K+   +PGH ITL PPL++NN+L CDL++K+     GRI SSES ++Y V++ 
Sbjct  2722  SREIYHCKEQ-NLPGHKITLLPPLKINNMLCCDLMFKIHEHATGRINSSESVNIYNVNIC  2780

Query  3019  RELKITLTLDGYPGAGTLCIPVG-LGNVETTLRLSDMKQRVLNLRASITMIKGCGMQISI  3077
             + L +++TLD +  +G L IPV   G +E  L+L D+++R L++R SI  + G GM++ I
Sbjct  2781  QPLNLSITLDNFQLSGQLKIPVSHRGVIEPKLKLIDIQKRELHVRVSIQSVPGKGMELYI  2840

Query  3078  SAPYWLVNRTGLPLVFRQEGVPHESAGQFQENEQGRLVSPLMYSISDPDASPALTVRLGK  3137
             SAP W++N+TGLPL+++QEG  H +AGQF+E+E  R V+PLM+S SD + SPAL +RLGK
Sbjct  2841  SAPVWIINKTGLPLIYKQEGTSHTAAGQFEEHETARQVAPLMFSFSDQEGSPALVLRLGK  2900

Query  3138  RFGQNPPWCQPFQLHKDILNRQLKSGSSNETFVLGIEVRRGRGRYIKTSVVTFSPRFQLY  3197
              +G N  WC+ F  HKD+ +R L++ ++  ++ +GI VRRGRG Y  T+ VT SPRF L+
Sbjct  2901  AYGSNNMWCKSFSTHKDLADRDLRAENTKGSYAIGISVRRGRGLYACTTFVTLSPRFHLH  2960

Query  3198  NRSSYKLQFAQKYYATTLTDQLAKATFIEAVPGCHLPFHWPRLDKDQQLCIRLPDVENCL  3257
             NRS YKL+F Q        D+      I A   C+  FHWP  D++Q +C+R+P++E C 
Sbjct  2961  NRSGYKLEFMQLCDIVNY-DRPDPRKIISAPVDCNFAFHWPNWDQEQIICVRIPEIECCC  3019

Query  3258  WSGGIPIHETQSLYINIRNINGDMHFIRVEIVLQGATYFLLFGDAQALPPPIRIDNYSEV  3317
             WS GIPI + QSLYIN+RN  G+M F+R+EI+ + AT+ LLF DA+ LPPPIRIDN SEV
Sbjct  3020  WSKGIPIKDVQSLYINVRNEWGEMFFLRLEIISKDATFILLFTDARTLPPPIRIDNCSEV  3079

Query  3318  PLKFYQTDCKNQWQTVVRPHSSIAYALDEPMGAQSLYIEAPGGVSHVYSLRDLG-MSHNL  3376
              + F Q   K  W T VRP SS++Y +D+P+G Q L +EAPGG    + + +   +   L
Sbjct  3080  VINFSQLRSKPVWITPVRPQSSLSYVMDDPLGQQILLMEAPGGNMIEFPINNKNNIKKTL  3139

Query  3377  TYENFIYIAFSETFKNVSNIGNNSFDYDIESQQLVLTVVDGRVFLARRQPGDRSQLWRMN  3436
             TY NFIYIAF  TF+  SN   N+       +QLVL V   +V +  +  GDRSQLW MN
Sbjct  3140  TYTNFIYIAFQGTFER-SNEEENT------HRQLVLGVRGKKVVIVEKNSGDRSQLWLMN  3192

Query  3437  KEKQLEHEGSSPPTEPGRKSSSASPRYVLDLERAPQPQKFTSLVVRPANRQRKSTQTWYF  3496
                QLEHEGS+PP +    + + + R VLDLE+AP P +FT+LVVR  N+QR +TQTW F
Sbjct  3193  SNGQLEHEGSTPPIQT---NDANAVRLVLDLEKAPNPMEFTNLVVRTPNKQRVTTQTWRF  3249

Query  3497  TEEGRLMCEHANMCVQSRDGFFNLRPGSDAVLGMIVSPTPTYMYTESLVPVEQAIERQKL  3556
              E GRLMC HANMCVQSR G   L+P  +AV+G     T     +   +P+ Q I  QKL
Sbjct  3250  -ENGRLMC-HANMCVQSRFGESGLKPNYEAVVGR----TENRASSSKQIPIGQHIVAQKL  3303

Query  3557  RPGSGFLSVVVSMDGPIKTIQIKDIK-SLASASLSLDPTWKHVSHLLPHISETPNNNNDD  3615
             RPGSG L +   MDGPI TI+I DIK    S  L+ D  W H S          N    D
Sbjct  3304  RPGSGQLELSTKMDGPISTIEICDIKIKQNSVFLTPDLLWMHAS--------LNNRQITD  3355

Query  3616  SPSTSVVTKSLSELHVNLKLTKGLGLSLVSKRPCEELAFVTLEFITLEVIATPAVRSLDL  3675
                 S V + L    +N++L KG+G+S+++++PCEE+ F++L+ I  +++ +    SLDL
Sbjct  3356  KGKVSFVHEYL----INVELVKGIGISIIARKPCEEIMFISLDHINCDIVQSALENSLDL  3411

Query  3676  SVGDMQIDNQLFETPCPVMLFTNRNVEMVSLP-ATHLNIKLLPSPNKNAIIFEHFILSLR  3734
             ++  +QIDNQL +   P+ L T  + ++     A  L +K+LPSPNKNAIIF++  L L+
Sbjct  3412  NIAYIQIDNQLLDAVSPIALHTQTSNDLEETQNAVVLKLKMLPSPNKNAIIFKYLTLDLK  3471

Query  3735  PITIYLEERLMLRMACFIGLGQSQPDPAALPDECDYEAQRVATKILAANAKRFYFGDLQI  3794
             P T  LEE+L+L++A F+G G+      ++     Y+ +    K    + KR+YF +L I
Sbjct  3472  PSTASLEEKLILKVASFLGYGKINRQNLSV----QYQFENTDDKPFLQDMKRYYFENLSI  3527

Query  3795  VPSNIRLSVITASKLSPQLSEMKKRLGLTLIKFEDASIDFEKFKDKHHFETLEVYVRAIK  3854
               + +RLS  T+SKL  +L E KK LGLTLIKFEDA I+ +++ DK HFET++VY + +K
Sbjct  3528  GATQVRLSAFTSSKLPVELHETKKALGLTLIKFEDALIELDRYSDKLHFETMDVYRKELK  3587

Query  3855  SHYKQELKWQAAKILGSVDFLGNPTGFFGDLNEGMHGLFYEGSVTSLVKNVTHGLSNSTA  3914
              HY  ++KW AA ILGSVDFLGNP GF  DL+EG+ GL +EGSV SLVKNVTHG+SNSTA
Sbjct  3588  KHYINQVKWHAAAILGSVDFLGNPLGFANDLSEGVSGLIFEGSVKSLVKNVTHGISNSTA  3647

Query  3915  KLTESISDGLGRVVLDEQDTETRQKILEVSSGANSTGDHLKAGFMGLGFGLLGGVTSIVK  3974
             KLTE++SD LG+VVLD+ D ETRQ+ILE+ S  N++G HL AG  GLGFGLLGGVTSIV+
Sbjct  3648  KLTETLSDSLGKVVLDDHDNETRQRILELQS--NTSGGHLAAGLKGLGFGLLGGVTSIVR  3705

Query  3975  HTYAGAQTDGLHGFISGLGKGIVGTVTKPMIGVLDLASETANAVRERSKSSNRTLPERKR  4034
             HTY GA +DG+ GF+SGLGKG+VGTVTKP+IGVLDLASETA+AVRE S+ S+R  PERKR
Sbjct  3706  HTYDGATSDGVPGFLSGLGKGLVGTVTKPIIGVLDLASETASAVRETSRDSHRNAPERKR  3765

Query  4035  PPRCVTGAPGGLIPPFSLVQSKGQQHLFLINKRNFNEQFMAYEPCLLERRDSKLRLLVSS  4094
              PRCVTGAPGGL+P +S  QSKGQQ+L+LIN++NF+E+ ++YEP L   ++++LRLLVS+
Sbjct  3766  LPRCVTGAPGGLLPLYSNRQSKGQQYLYLINQKNFSEKIISYEPNLWSDKEARLRLLVST  3825

Query  4095  ENIWVFSRSEESTTTVLTHHLSELISCYPVSVNVA---PTGHKTKYQFYIELCLSLTSKS  4151
             E + +FS S+ + T +   H+SE++SC+PV  N      T  +     YIE+  +L    
Sbjct  3826  EYVRIFSLSDANPTIMFECHVSEILSCHPVVTNAGTTPTTSSRASASHYIEISTNLPK--  3883

Query  4152  LNYAGQEVVKRPRVRCQSEEMSQRAAHHINYAKSVYDEREHTL  4194
                     + RPR+RC+SEE ++ A+  INYAKSV+DEREH +
Sbjct  3884  --------ITRPRIRCRSEECAEAASRCINYAKSVFDEREHAV  3918


>VPS13_DROME unnamed protein product
Length=3321

 Score = 145 bits (365),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 97/349 (28%), Positives = 181/349 (52%), Gaps = 28/349 (8%)

Query  1    MLRELIAWVLNTYLGKYVENLNTAQLTVALLSGEVELENLPLRRDALRNLGLPLQALSGT  60
            +   ++A VLN  LG Y+ENL+  QL + +  G+V L+NL +R +AL  L LP+Q + G 
Sbjct  2    VFEAVVADVLNKVLGDYIENLDRNQLKIGIWGGDVVLQNLKIRENALDELDLPVQLIYGY  61

Query  61   VGKIKLQIPVRQFRTAPWCILIENVYVVVGPVNLDEWDAEAEEQADLDFKLSRLDGLEAK  120
            +GK+ L+IP +   + P  + IE++YV+V P N  +++AE E + ++D K + LD LEA 
Sbjct  62   LGKLVLKIPWKNLYSQPVIVNIEDLYVLVSPNNNVQYNAEKEAKYEMDLKKAALDALEAA  121

Query  121  WRASSEASLEGGYYASSYSGWLSYGTSLMTNIVENLELKIKNVHIRYEDSITIPDQRFAF  180
             +   E          + +G   +   L   IV NL+++I NVH+RYED+ T     F+F
Sbjct  122  RKKELEMD-----QPKADAG---FAEKLTAQIVNNLQVQITNVHLRYEDTTTT-GSPFSF  172

Query  181  GINIESLSARSCDENWTPGYTTAWINNSASFKLVELEAMSFYWDPLHNNEIFGDISSNEL  240
            GI++  L   + D +W   Y       S  FK+  L  +S Y +     +++ + + ++L
Sbjct  173  GISLHELELYTTDCDWEKCYMAQ--QASQVFKIANLSCLSAYLNC--GGQLYAN-NKSDL  227

Query  241  AE------AISKSKFTHQFIVSPVCAQAHLKRDRS----ETPLRTRSRPRLVCDLILNEV  290
            ++      A  ++K  + +++ P+   A LK + +    + P     +P++   L + ++
Sbjct  228  SQQFKTNIACKETKPNYNYVLGPISCNAKLKLNMNPELDDPPFE---KPKIDLTLEMEKL  284

Query  291  QLTLNDWQYSQMVGCVRGLDDIAKYRRFKLLRPLHSVHQG-PRAWWLYA  338
             + L + Q+  ++     ++       ++  RP +  ++G  R WW +A
Sbjct  285  NVGLTNTQFDNLMKLGDAMNRQQLGIPYRKYRPYNIPYKGHARDWWHFA  333


 Score = 115 bits (288),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 84/307 (27%), Positives = 142/307 (46%), Gaps = 29/307 (9%)

Query  3785  KRFYFGDLQIVPSNIRLSVITASK----LSPQLSEMKKRLGLTLIKFEDASIDFEKFKDK  3840
             ++ ++ +L + P  I +S   A      L   L  + + +G+TL    D       F+ +
Sbjct  2903  QKSFYDNLHLGPLKIHVSFSMAGSDTKALPGFLGSLVQGVGVTLTDVNDVVFRLAFFERE  2962

Query  3841  HHFETLEVYVRAIKSHYK-QELKWQAAKILGSVDFLGNPTGFFGDLNEGMHGLFYEG---  3896
             + F + +  +  I SHY  Q LK     +LG +D LGNP G    L +G+  LFYE    
Sbjct  2963  YQFFSQKQLINEITSHYTGQALKQLYVLVLG-LDVLGNPYGLVVGLKKGVEDLFYEPFQG  3021

Query  3897  --------------SVTSLVKNVTHGLSNSTAKLTESISDGLGRVVLDEQDTETRQKILE  3942
                            V SL  +   G + + +K+T ++  GL  +  DE   + R++   
Sbjct  3022  AIQGPGEFAEGLVLGVKSLFGHTVGGAAGAVSKITGAMGKGLAALTFDEDYQKKRRQ--G  3079

Query  3943  VSSGANSTGDHLKAGFMGLGFGLLGGVTSIVKHTYAGAQTDGLHGFISGLGKGIVGTVTK  4002
             + +   +  + L     GL  G + GVT +V     GA+ +G+ GF  GLGKG +G V +
Sbjct  3080  IQNKPKNFHEGLARSSKGLVMGFVDGVTGVVTKPVTGARDNGVEGFFKGLGKGAIGLVAR  3139

Query  4003  PMIGVLDLASETANAVRERSKSSNRTLPERKRPPRCVTGAPGGLIPPFSLVQSKGQQHLF  4062
             P  GV+D AS +  AV+  + +S     +R RPPR        ++ P+ L+++ G + + 
Sbjct  3140  PTAGVVDFASGSFEAVKRAADASEDV--KRMRPPRF--QHYDFVLRPYCLMEATGNKIMK  3195

Query  4063  LINKRNF  4069
               +K  F
Sbjct  3196  ETDKGKF  3202


 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 89/455 (20%), Positives = 181/455 (40%), Gaps = 79/455 (17%)

Query  1744  SPQPRERQDNLVLYTSLLIDPECPNFDSHYNSMRQSSSIDFNSLDLII---SVQSWFVLL  1800
             +P+     + L   +  + D   P F + YNS  Q    +F  L +++    +Q    ++
Sbjct  973   TPKQENSSNYLFTVSCTIADKSSPEFSTKYNSTEQLVVANFEVLQIVLHQECLQRIMEVV  1032

Query  1801  NFF------------------------------GLLSDDHDDVTSSREIP-------TTS  1823
             N F                               ++ +D +++ ++ ++        T  
Sbjct  1033  NNFQRNLDLVLSSTRPRDRMGSIGGGDGIKRTLNVILEDTEEIMTTDQMKRRKKTRRTHV  1092

Query  1824  VETVHKKGNSDLDISVRSLTLVFIRTDYEIAKANVSNAHFVISKYGQSKTVEGKLG--SI  1881
             VETV  +  ++LD     + LV       IA+ NV    FV S   +S   E  +G   I
Sbjct  1093  VETVKVRVIANLD----QVGLVLTGRKRPIAEMNVKK--FVSSLIIKSSYTEVNIGLKDI  1146

Query  1882  SLMDLTLHGAIYRERFLTSGYEALN----FFYRQDGPKLNSRSMNCDAKLKIQMSSVKYV  1937
              ++DL  +  I++      G +A N     + +++    NS  M    K+ + +  +K +
Sbjct  1147  QVLDLNPY-TIHKNILSIVGKDAFNCQIVIYNKEETQDYNSDDM----KITVDIGCMKII  1201

Query  1938  HTKRFVAEIQAFFKEFQQLQTPVLRKIKPS-----ESRHSLHQRPLQLGLEINAGSPIIL  1992
                 FVA +  F   F   Q  + +    +     +     ++   ++ L I   +PII+
Sbjct  1202  FLNWFVAGVMNFLNNFTAAQATISQAGAAAAESARQKAMDAYETATRMKLNIRIKAPIII  1261

Query  1993  LPLSSRSEKVIVADLGEFSLQNNFHLASERGIISIKVDDTGPDEILDVMQVHLVNTDLFA  2052
             +P+ S+    ++ DLG   L NN         + + V +     ++D +++ + +     
Sbjct  1262  VPIGSQDRNALLLDLGLLELTNN--------TVEVAVAEEERLAVIDEIKLQICD-----  1308

Query  2053  GIRIGKSDFVAGKLDICMDMNGYAILKQGSNLLNS-KCHLKLIVERNMDSWKSQNVPDIS  2111
              ++I K   + G      +++         N++N   C L   + RN+     ++VP+++
Sbjct  1309  -VKISKIVLLDGNESTVDEVDAEVGFLSKFNMMNPMSCTLS--ITRNLSYTWYRDVPELN  1365

Query  2112  VHGTLSRLEAVLDLQQYQLVRGFLSYNLGECIDDL  2146
             + G L  +E  L    Y LV   L+ NL E +++ 
Sbjct  1366  LSGRLKSIELTLFADDYALVMLVLNRNLNEGLEEF  1400


 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 65/279 (23%), Positives = 121/279 (43%), Gaps = 50/279 (18%)

Query  592  LFQMNYERKPLSHNTDYRLLIKSQSLDVVYNMDVIKWIVDFVMKPHQVIGTRKKIEAMKN  651
            L ++ +E  PL    D R+ + ++ L + Y+   I  +++    P  V  T  K E   +
Sbjct  569  LLEVFFETNPLDKLCDQRVKVVARPLQITYDAPTILALINAFQTPGDV--TLSKFEDAAS  626

Query  652  KTKMEIIKNWENILEGDLSDRKTWTLEIDIS-APQIIFAENFCVKGG---TLVVVDFGRL  707
             TK+   K         + D+K   L++DI   P I+   +  V      +L+VV  G++
Sbjct  627  -TKISNFKERSATGMQYMIDKKA-VLDVDILLMPNILVVPHKGVYDAGNVSLLVVSMGQV  684

Query  708  QLSNNQPESSKPEAPQEQFRKDSEEEDAFMTPCSTPPGSEASTSDSPTLCTALSDGFERN  767
             LS+ QP            R++S +                           L   F   
Sbjct  685  HLSS-QP------------RRESNK---------------------------LQHLFSAG  704

Query  768  IDSSLNEKSLHQKLYDSFKLNLTDLQVLVCKSKERWAFASSKGSSS-LHVLDRFNISLQM  826
             D     K++ +  YD F + + D+Q+LV ++ E W  A ++ +S+ +HVL   ++ +  
Sbjct  705  EDKDEILKTVMENAYDRFTVAVDDVQMLVVRAGEPWQNALAEANSTEMHVLRPVSLKVTA  764

Query  827  ERRVVYTLDPQFPSLTMSGSLPKLVVHVNEHKIAALIQM  865
               VV   DP+ P++ +   LP ++V+V+E +I   I++
Sbjct  765  ALCVVDN-DPRLPNIKVDIDLPAILVNVSEDRIFLAIKV  802


 Score = 46.2 bits (108),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 74/421 (18%), Positives = 165/421 (39%), Gaps = 76/421 (18%)

Query  2336  VPEEPMELVLNITDSELVFVETPDQWDTNAVILKSTTILSYRPIEVDKVMSINLNHLEVF  2395
             VP   M L+L+I + +++ VE  +  +T+ +I  +   L+YR I   ++++  ++ L+++
Sbjct  1622  VPNRKMNLILHIDEPDIILVENLEDLNTSCIIFNAQVHLNYRSINDKQIVNGQIDALKMY  1681

Query  2396  SCVLGFE--EETALSIIDPVTINMDLKKNVLDIQLAKRLSIRLSYNDVKMFSQMLQSLPR  2453
              C    E  E T   I+ P  I++   +     +    +S++LS                
Sbjct  1682  MCAFLPERREMTRHYILHPCVISL---QGSTPEEEGMHISLKLS----------------  1722

Query  2454  QTKNAKSKDHVTGDRSVDVQLISKLSALGFNSDDCVNALEICNNELDEAALWLTQHAEPT  2513
                     D +       ++L++K  A+   S   +    I     + + LW   H    
Sbjct  1723  --------DIIINVSPATIELLNK--AMLSVSSGTMTKCAIAEESRNYSNLWHQHHFHSR  1772

Query  2514  KHSHTIVHPLEIKSIAVQANCISICVIDDCKDADVPLLELSLSQLEFDQELSSSTELMRR  2573
              +  T V   E    A++A   S+   ++ +  +  ++E+    L  +  +   T+ +  
Sbjct  1773  TYWFTKV---EQGVDALEAEQRSVSTDNEKQKTEKCVIEIPSITLVIESGVGYYTKPLIS  1829

Query  2574  SNADLSA-----DKLCFKTGSLKGTFASDYYNRGLSGWEPLIE--------------PWK  2614
              +  ++A      +     GSL  T   +YYN+ L+ WEP+IE              PW+
Sbjct  1830  LDTRITAVFNNWSRSLTAHGSL--TLNMNYYNQALAEWEPIIELNEVIGRNGVREYTPWE  1887

Query  2615  CDATWSY-----SLGSGMQRNRLHLKVNSEDMVKLNVTSTSIELYRIVHDDWTQDYYSQP  2669
                          L    ++  +H+ ++S + +++ ++ T + L   + + ++Q      
Sbjct  1888  LKFEMGMEKVQSELEDDAEQQAMHMNIHSAETLEITLSKTCLGLLSELAEAFSQ------  1941

Query  2670  ASISNNKKSIQMSPNNYRRRNPFVPFAIRNETGVRLWFTVSRSESSMTSSETRWTPVEPN  2729
                        +  N   + +   P+ + N+TG  +   + +   ++       TPV  N
Sbjct  1942  ----------AIDQNGLTKPDIVAPYVLENDTGFDVNLNLRKGIFTLHEVHRGGTPVGAN  1991

Query  2730  A  2730
             +
Sbjct  1992  S  1992


 Score = 42.0 bits (97),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 53/291 (18%), Positives = 117/291 (40%), Gaps = 47/291 (16%)

Query  3073  MQISISAPYWLVNRTGLPLVFRQEGVPHESAGQFQENEQGRLVSPLMYSISDP---DASP  3129
             + +++ +P+W++N+TG+ L ++ E    E      E        P++++  D    D   
Sbjct  2349  LMLTLFSPFWMINKTGMMLTYKSETTSVEVLYHPPEYS-----GPILFTFRDKLFFDKKK  2403

Query  3130  ALTVRLGKRFGQNPPWCQPFQLHKDILNRQLKSGSSNETFVLGIEVRRGRGRYIKTSVVT  3189
             A ++R+      N  W +   L       ++   ++N+ + +G+     +    K   +T
Sbjct  2404  A-SIRI-----DNGQWSEKIPLDVAGSVGEVICFANNQKYPVGVHNHLTQNSLTKQ--IT  2455

Query  3190  FSPRFQLYNRSSYKLQFAQKYYATTLTDQLAKATFIEAVPGCHLPFH-----WPRLDKDQ  3244
             F P + + N+  + ++  ++                 A P  HL  +     WPR D   
Sbjct  2456  FIPFYIVCNKCHFDIELQEQSRP--------------ADPWLHLEPNEMEPLWPRNDTKN  2501

Query  3245  QLCIRLPDVENCLWSGGI-PIHETQSLYINIRNINGDMH-FIRVEIVLQGATYFLLFGDA  3302
              L +R+         G I P  +   +   +  +    +  I V++       ++ F D 
Sbjct  2502  NLVVRV--------DGKITPAFDFTEVICTLLKLEDSKYGGINVDVQTTEGGVYITFTDY  2553

Query  3303  QALPPPIRIDNYSEVPLKFYQTDCKNQWQTVVRPHSSIAYALDEPMGAQSL  3353
             +    P  + N++   + +++   KN  + ++   S+I YA D+P G + L
Sbjct  2554  KPADAPGLLINHTGKQIVYHEKGTKN--EHILNAKSTIMYAWDDPTGPKML  2602


>VP13C_DICDI unnamed protein product
Length=3848

 Score = 144 bits (362),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 124/470 (26%), Positives = 209/470 (44%), Gaps = 76/470 (16%)

Query  3638  GLGLSLVSKRPC-EELAFVTLEFITLEVIATPAVRSLDLSVGDMQIDNQLFETPCPVMLF  3696
              +G+S+++K P  EE+ +++++ + LEV  +   + +   V D+QID+Q + T  PV L 
Sbjct  3242  NIGISIINKIPTREEIVYLSIDGLKLEVKQSKLDQYIQFKVDDLQIDDQRYSTNFPVFLC  3301

Query  3697  TNRNV---------EMVSLPATHLNI-----------------KLLPS---------PNK  3721
              ++ +         +  S P +                     KL P             
Sbjct  3302  QSKKINHSINQQPNQQSSSPQSTNTTTTTTTNTTTTNNTTQQQKLKPFLQFSATRTLKYS  3361

Query  3722  NAIIFEHFILSLRPITIYLEERLMLRMACFIGLGQSQPDPAALPDECDYEAQRVATKILA  3781
             N + F +F + ++   I L+E  +L    FI +  +  +          + + + TK  A
Sbjct  3362  NIMFFRYFSILIQEFDINLDEASILNALSFININLNSLNEHFTLHPTITQEEILETK-NA  3420

Query  3782  ANAKR--FYFGDLQIVPSNIRLSVITASKLSPQLSEM---KKRLGLTLIKF---------  3827
             +N +    YF  L I P  + LS I+    SP+ ++     + L   LI F         
Sbjct  3421  SNIENHMVYFEMLHINPVKMNLSFISCK--SPKETQAILGARSLAELLIGFKSNSPFLNI  3478

Query  3828  EDASIDFEKFKDKHHFETLEVYVRAIKSHYKQELKWQAAKILGSVDFLGNPTGFFGDLNE  3887
             E A I F  F  +H F +    +  I  H+  ++  QA KI GS DF+GNP      L  
Sbjct  3479  ERAPIKFNGFIWEHPFLSTRQVIDEISLHFSYQMMSQAHKIFGSFDFIGNPIRLAESLGS  3538

Query  3888  GMHGLFYEGSV-----------------TSLVKNVTHGLSNSTAKLTESISDGLGRVVLD  3930
             G    F+E ++                 +SL+ N   G ++ST+K+T +IS GL ++ LD
Sbjct  3539  GFKDFFHEPALGLVKSPQDFAAGLSKGTSSLINNSVFGFADSTSKITGTISKGLVQLSLD  3598

Query  3931  EQDTETRQKILEVSSGANSTGDHLKAGFMGLGFGLLGGVTSIVKHTYAGA-QTDGLHGFI  3989
             +   + RQ+            + L+ GF   G G++ G+T I+   Y GA Q     GF 
Sbjct  3599  DSYIKERQE--SNKQKPKGVKEGLEFGFRDFGEGVIKGITGIIDEPYKGATQEKSWEGFF  3656

Query  3990  SGLGKGIVGTVTKPMIGVLDLASETANAVRERSKSSNRTLPE--RKRPPR  4037
              G+GKG++G   KP +GV DL S+T+  ++  S +  ++L +  R+R PR
Sbjct  3657  KGIGKGVLGVAVKPTVGVFDLVSKTSEGIK-NSTTVAKSLSQIKRRRIPR  3705


 Score = 136 bits (342),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 201/883 (23%), Positives = 370/883 (42%), Gaps = 191/883 (22%)

Query  1    MLRELIAWVLNTYLGKYVENLNTAQLTVALLSGEVELENLPLRRDALRNLGLPLQALSGT  60
            M+  + A VL  YLG YV++LN   + ++ LSGE  L++L +++  L++    +      
Sbjct  1    MVSHIAASVLTKYLGDYVDDLNKDNIKLSFLSGEAVLQDLKIKKTVLQSFLPNVIVKQAI  60

Query  61   VGKIKLQIPVRQFRTAPWCILIENVYVVV-GPVNLDEW----DAEAEEQADLDFK-LSRL  114
            + K+ L +P +  +  P  I IE +YV+    V  DE       + E+QA L  + + RL
Sbjct  61   IKKLSLHVPWKDLKGKPAIIKIEGIYVLAETSVEFDEQYYKKKFQDEKQAKLHIQEVLRL  120

Query  115  DGLEAKWRASSEASLEGGYYASSYSGWLSYGTSLMTNIVENLELKIKNVHIRYEDSITIP  174
            +  + K   +   S       S  S   ++G+ L+  +V+NL+L I +VHIR+EDS+   
Sbjct  121  NKQQLK---NPHQSTTTTTTTSDESN--TFGSKLLQTVVDNLQLYIDSVHIRFEDSVN--  173

Query  175  DQRFAFGINIESLSARSCDENWTPGYTTAWINNSASF--KLVELEAMSFYWDPLHNNEIF  232
             + F+FG+ + SL A S D+ W P +    I N ++   KL+ L  +S YW+       +
Sbjct  174  RRSFSFGVTLNSLVAESTDQTWNPTF----IKNESTIIHKLINLNQLSIYWNSNSPKLKY  229

Query  233  GDIS--SNELAEAISKS------------------------------KFTHQFIVSPVCA  260
             +I   S +L   I K                                   Q+I+ P+ A
Sbjct  230  TNIDDLSQKLKSMIKKEDSGKQQQQQQQQQGEEQDDEIEEDYFLSTESRKQQYIIDPISA  289

Query  261  QAHLKRDRSETPLRTRSRPRLVCDLILNEVQLTLNDWQYSQMVGCVRGLDDIAKYRRFKL  320
            +  +  ++S  P  +   P+   +   ++  ++L+D+QY  + G +       K   F+ 
Sbjct  290  KLKVVINKSIIP--SEVIPKYNLNFEFDKTDISLSDYQYKDITGILESFKLFEKSIEFRS  347

Query  321  LRPLHS-VHQGPRAWWLYAAQC-----HGFRRISADRRFK-IAKDNLEYIEIYSKIIKNP  373
             RP+++ + Q PR WW YA QC     H  R   +    K    D  +YIE++ K+ K  
Sbjct  348  ARPINTTIKQSPRKWWNYAIQCVLQKVHQKRYTQSWSYIKEFLSDKRDYIELFKKLKKKT  407

Query  374  -NEVLTTKLKEHKDAVEKERSYDELKLLREICML------------------------RM  408
             ++   T+L    D++E +  +D++   R +                            +
Sbjct  408  IHQTEQTRL----DSLEWKLPFDQILFFRNLSFKIIEKEEKLEKERLKLQQQQQQQQQNL  463

Query  409  PTPEGLSNETNQGRSMLVQWFPQWWGWYGSPAQTSSSQQQSSSLIALDATTPK-------  461
                  +  T    +    W   WW    + +   ++   +++    D+T  K       
Sbjct  464  NKISPTTTTTPSTSTGGGGWLSSWWKPIVNTSVPITAATTTTTATNTDSTITKLKDIKLS  523

Query  462  --DQHQLEDEL-LDALADSVESN-SILKRDAVFGK---------FDFTLRKGTLDICSGS  508
              D +++ D +  D   D + SN + L++   FGK          +F L +G L +    
Sbjct  524  KDDWNEIYDTIGYDENDDIINSNVASLQQPKQFGKDFSNIIKTVINFRLVQGGLKLKKKR  583

Query  509  ANKLMLQLQFENLILSVESRPRSASHFVGLSLGSVLLKDHITNNSEFPDLIKPQVKDESI  568
                +LQL   ++ LS++S+  S+  F G +L  + L D  T N++FP LI P +K  S 
Sbjct  584  RTIALLQLN--DISLSLKSKINSSFVFNG-NLKGLELIDQSTFNTQFPKLISPLLKRNS-  639

Query  569  THSRLHTQRANSRNSGLLNNTEPLFQMNYERKPLSH------------------------  604
              S + T+         + +  P+F +  E   LS                         
Sbjct  640  --SSIPTK---------IISQPPIFNITLESHSLSSTITSSTTTATTTQSTSTNSNNNNN  688

Query  605  -NTDYRLLIKSQSLDVVYNMDVIKWIVDFVMKPH-------QVIGTRKK-----IEAMKN  651
               +Y L I+S+ L +VY    I  + DF  K          V+   +K     IE++K 
Sbjct  689  IKVNYSLSIQSKPLTIVYYPKFISTVNDFFFKKEDDQDVQDMVLEDLEKKAQETIESIKA  748

Query  652  KTKMEIIKNWENILEGDLSDRKTWTLEIDISAPQIIFAENFCVKGGTLVVVDFGRLQLSN  711
            +T+ +++          +S++ T+++++D+ AP I+  E+   K   L+++D G+L + N
Sbjct  749  QTRDKLLL--------AISNKTTFSIDMDLEAPIILVPESITNKNTNLLILDLGKLLI-N  799

Query  712  NQPESSKPEAPQEQFRK---------------------DSEEE  733
            + P+  + +   +Q ++                     D +EE
Sbjct  800  HYPKQQQLQQQLQQLQQEQGQEQEQEQKQEQKQEQEQKDWKEE  842


 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 51/218 (23%), Positives = 85/218 (39%), Gaps = 59/218 (27%)

Query  1853  IAKANVSNAHFVISKYGQSKTVEGKLGSISLMDLTLHGAIY------RERFLTS------  1900
             + KA+ +  +    +Y     + GKLGS+ + D+T  G  Y      RER L +      
Sbjct  1278  LIKASFTGFNCTTDQYNYKTIMNGKLGSLKIYDMTTEGRNYRTILTTRERKLNNKTSPTT  1337

Query  1901  -----------------------------------------GYEALNFFYRQDGPKLNSR  1919
                                                      G E  +  Y Q      SR
Sbjct  1338  PSSSGVSTGTTFDIDIDNFDTVSSSSSSSLLSSSSLLISPPGGEQSSLVYFQ----FESR  1393

Query  1920  SMNCDAKLKIQMSSVKYVHTKRFVAEIQAFFKEFQQLQTPVLRKIKPSESRHSLHQRPLQ  1979
             + N    LKI +SS++++  KRF  E++ F      ++  +   I  + +   + Q    
Sbjct  1394  NDNNSQMLKINLSSIRFIFLKRFTEELRLFLNNVNMMREYLKSSIYSAAT--VISQNRST  1451

Query  1980  LGLEINAGSPIILLPLSSRSEKVIVADLGEFSLQNNFH  2017
             L  EI   +P I++PLSS S K+ + DLG+ +++N F 
Sbjct  1452  LFYEIEIQNPYIVIPLSSLSNKIFIVDLGKINIKNQFE  1489


 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 78/385 (20%), Positives = 141/385 (37%), Gaps = 99/385 (26%)

Query  2952  FRFVAAIRREGYPTKDAIGIPGHSITLWPPLRLNNLLPCDLLYKLLSGTQGRIASSESAS  3011
             F F+++I +    TK+ I      I++   + + N+L CDL Y+L  G   +I  S   S
Sbjct  2572  FVFLSSIEKNSLETKNTI-----EISINTAIMIENVLACDLQYRLYHGKNKKIIGSAFFS  2626

Query  3012  ----------VYEVDLERELKITLTLDGYPGAGTLCI---PVGLGNVETTLRLSDMKQRV  3058
                       V   D  +++ +   +  +  +  LC+    VGL  V   +++ D   + 
Sbjct  2627  GVIPMGKKLPVLVYDSLQDIYMEFQIYDFQWS-PLCLIDSMVGLA-VTDKVKIEDRLHQP  2684

Query  3059  LNLRASITMIKGCGMQISISAPYWLVNRTGLPLVFR-----------------QEGVPHE  3101
             L +     +       +++   YWL+N+TGLPL FR                 Q    HE
Sbjct  2685  LLISFDNRIQPNGSRFVTLYCEYWLINQTGLPLYFRHHIGAQTIDPAGQTPTKQIETIHE  2744

Query  3102  SAG-------QFQENEQGRLVSPLMYSISDPDASPALTVRLGKRFG---QNPPWCQPFQL  3151
             S          +   E      P M++ SD          +G +F     +  W  PF L
Sbjct  2745  STSMKPTDSRNWYTKEWNHPSQPFMFAYSDNSI-------VGGKFSLKIYDSNWSSPFSL  2797

Query  3152  H-----------------------KDILNRQLKSGSSNETFVLGIEVRRGRGRYIKTSVV  3188
                                     K+++    K       + L + +     ++ +T VV
Sbjct  2798  ISSQSSSNSNIEISEDRTDEEKEIKNVIGTITKRQPLKTNYNLSVSILPSNSKFWRTKVV  2857

Query  3189  TFSPRFQLYNRSSYKLQFAQKYYATTLTDQLAKATFIEAVPGCHLPFHWPRLDKDQQLCI  3248
             TFSP + + N + +++ + Q++   + T  +        +    LPF +P    ++ + I
Sbjct  2858  TFSPMYLMVNSTRFRILY-QQFDCDSNTQSI--------IQDQSLPFQFPSSRHEKLIRI  2908

Query  3249  RL-------------PDVENCLWSG  3260
              +              DV N  WSG
Sbjct  2909  GILDTSAISNNPYNANDVSNIKWSG  2933


 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 58/129 (45%), Gaps = 22/129 (17%)

Query  2551  LELSLSQLEF----DQELSSSTELMRRSNADLSADKLCFKTG-----SLKGTFASDYYNR  2601
             L +SL + EF    D ++SS  +L+      L ++   F        SL     + Y+N+
Sbjct  2058  LSISLEKGEFILNDDHKISSPIKLLSIGVDGLKSNIFSFPQKNQIALSLDANMKAGYFNK  2117

Query  2602  GLSGWEPLIEPWKCDATWSYSLGSGMQRNRLHLKVNSEDMVKLNVTS----TSIELYRIV  2657
              +  WEPLIE W    T + S+  G   N      NS+  + +N+T     TSI  Y+I 
Sbjct  2118  NIGIWEPLIENWGFSFTSNNSIEGGWMVN-----FNSKIPLYINITKIFIDTSISTYQI-  2171

Query  2658  HDDWTQDYY  2666
                W  DYY
Sbjct  2172  ---WADDYY  2177


 Score = 46.6 bits (109),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 33/107 (31%), Positives = 50/107 (47%), Gaps = 10/107 (9%)

Query  3264  IHETQSLYINIRNINGDMHFIRVEIVLQGATYFLLFGDAQALPPPIRIDNYSEVPLKFYQ  3323
             I E   ++IN+         IRV+      T  ++  +     PP RI+N +  PL   Q
Sbjct  3051  IFEDLRVFINVT--------IRVKSSKSLTTTMIILNEQNPELPPYRINNKTRFPLWIRQ  3102

Query  3324  TDCKNQWQTVVRPHSSIAYALDEPMGAQSLYIEAPGGVSHVYSLRDL  3370
                K +    V+P +SI YA D P+  + L IE P G++  Y L +L
Sbjct  3103  K--KTEIWDKVQPKTSIPYAWDHPILPKKLIIEFPTGLTKTYRLGNL  3147


 Score = 37.7 bits (86),  Expect = 0.29, Method: Compositional matrix adjust.
 Identities = 49/233 (21%), Positives = 85/233 (36%), Gaps = 73/233 (31%)

Query  1181  VEGSLGGLQVLDLTPEGIAHQRILSVGKDPL---TEPPHVEQDLLSSLT-----------  1226
             + G LG L++ D+T EG  ++ IL+  +  L   T P       +S+ T           
Sbjct  1299  MNGKLGSLKIYDMTTEGRNYRTILTTRERKLNNKTSPTTPSSSGVSTGTTFDIDIDNFDT  1358

Query  1227  --------------QEIYAMGTSKDEIVLVERQALSFRVTRDLNACVNIKIRMASVWYTH  1272
                             I   G  +  +V  + ++      R+ N    +KI ++S+ +  
Sbjct  1359  VSSSSSSSLLSSSSLLISPPGGEQSSLVYFQFES------RNDNNSQMLKINLSSIRFIF  1412

Query  1273  VARFIQELNWCATEFKHYLKNLAKSIREKATDMAMGLVQPRSDVITTPRSNEVYSPRHSL  1332
             + RF +EL           + L  SI   AT            VI+  RS   Y      
Sbjct  1413  LKRFTEELRLFLNNVNMMREYLKSSIYSAAT------------VISQNRSTLFY------  1454

Query  1333  RRKRLTSLSNQQNCIDVKLELDVVLDTPVLVLPRSSCSSQVFVAHLGKISVTN  1385
                                  ++ +  P +V+P SS S+++F+  LGKI++ N
Sbjct  1455  ---------------------EIEIQNPYIVIPLSSLSNKIFIVDLGKINIKN  1486



Lambda      K        H
   0.317    0.130    0.375 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4829926040


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jul 7, 2021  1:54 PM
  Number of letters in database: 17,197,330
  Number of sequences in database:  25,232



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= XP_037024186.1 vacuolar protein sorting-associated protein 13D
isoform X2 [Bradysia coprophila]

Length=4190
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

VP13D_DROME  unnamed protein product                                  2932    0.0  
VPS13_DROME  unnamed protein product                                  145     8e-34
VP13C_DICDI  unnamed protein product                                  144     2e-33


>VP13D_DROME unnamed protein product
Length=3919

 Score = 2932 bits (7602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1721/4243 (41%), Positives = 2517/4243 (59%), Gaps = 386/4243 (9%)

Query  1     MLRELIAWVLNTYLGKYVENLNTAQLTVALLSGEVELENLPLRRDALRNLGLPLQALSGT  60
             MLR+LI WVLNTYLGKY+ENLN+AQL+VALLSGEVELEN+P+R+DALR+  LP++  +G+
Sbjct  1     MLRDLITWVLNTYLGKYLENLNSAQLSVALLSGEVELENIPIRKDALRSFNLPVEVTAGS  60

Query  61    VGKIKLQIPVRQFRTAPWCILIENVYVVVGPVNLDEWDAEAEEQADLDFKLSRLDGLEAK  120
             + KIKLQIPVRQFRT+PWCI IE ++ ++ P NLD WD E E+  DL++KL+ LD  EA 
Sbjct  61    IRKIKLQIPVRQFRTSPWCISIEGLFCIICPKNLDNWDYEKEKLQDLEYKLAVLDTAEAG  120

Query  121   WRASSEASLEGGYYASSYSGWLSYGTSLMTNIVENLELKIKNVHIRYEDSITIPDQRFAF  180
             WR+     +E  YY SSY+ WL YGT++ TNI++N+ELKI +VH R+ED +     +   
Sbjct  121   WRSEKGKQMES-YYFSSYNNWLKYGTNMATNIIDNIELKISDVHFRFEDIVDTGKSKICT  179

Query  181   GINIESLSARSCDENWTPGYTTAWINNSASFKLVELEAMSFYWDPLHNNEIFGDISSNEL  240
             GI I SL+A+SCD +WT G +    NN  ++KLVEL+ +S YWD LH +      S+ E+
Sbjct  180   GIKIGSLTAQSCDCDWTNG-SYKMNNNEMNYKLVELKELSVYWDLLHEDIKCQSYSNQEI  238

Query  241   AEAISKSK--FTHQFIVSPVCAQAHLKRDRSETPLRTRSRPRLVCDLILNEVQLTLNDWQ  298
              E +  +    +H FI+ P+CA A  KRD+ +  +RT+ +PR+ C+L++ EV + ++  Q
Sbjct  239   LEKMHSTCELRSHNFIIKPICATARWKRDKCQQVIRTKDKPRVSCELLVPEVVIDISKVQ  298

Query  299   YSQMVGCVRGLDDIAKYRRFKLLRPLHSVHQGPRAWWLYAAQCHGFRRISADRRFKIAKD  358
               QM+  +  +  + + R+++L RP  +V   P AWW YA  CHGF     + ++ + K+
Sbjct  299   RLQMLDKLSEIRQVKEVRQYRLKRPTCTVESNPIAWWKYATICHGFDFKKNEEKWLMLKE  358

Query  359   NLEYIEIYSKIIKNPNEVLTTKLKEHKDAVEKERSYDELKLLREICMLRMPTPE-GLSNE  417
             NL Y+ +Y  II NPNE L+   KE K  +E +R   +L ++R IC  ++ T      ++
Sbjct  359   NLRYMLLYKSIILNPNENLSAADKEFKAYIESDRKISDLTIMRRICFEKVFTKGFAFESQ  418

Query  418   TNQGRSMLVQWFPQWWGWYGSPAQTSSSQQQSSSLIALDATTPKDQHQLEDELLDALADS  477
               QG++ML  WFP W GWY +   T +++Q  S               LED++L AL +S
Sbjct  419   NEQGKNMLFHWFPNWMGWYANSPSTPNNEQDES------------LKHLEDDILVALENS  466

Query  478   VESNSILKRDAVFGKFDFTLRKG-----TLDICSGSANKLMLQLQFENLILSVESRPRSA  532
             ++++S LK DAVFG F   L KG     T D  +   NK M ++QF N    ++  P+  
Sbjct  467   LQNSSDLKSDAVFGHFSIKLLKGLVILQTEDKLNDGRNKSM-EMQFNNFSAYLQLSPQLT  525

Query  533   SHFVGLSLGSVLLKDHITNNSEFPDLIKPQVKDESITHSRLHTQRANSRNSGLLNNTEPL  592
             S+ VG+SL  V L D  ++++    LIKPQ  + +  +  +       +N+ L    + L
Sbjct  526   SYTVGISLQEVYLIDKTSSDTMHNYLIKPQTGNTATPNQLV-------KNAAL--QEDIL  576

Query  593   FQMNYERKPLSHNTDYRLLIKSQSLDVVYNMDVIKWIVDFVMKPHQV-IGTRKKIEAMKN  651
             FQ+ YE     ++  ++L IKS+ LD++YN D I+W++DF+   +      R ++     
Sbjct  577   FQLQYEN---CNHLRFQLNIKSKGLDLIYNEDAIQWLLDFLADSNSFKYSPRNRVAK---  630

Query  652   KTKMEIIKNWENILEGDLSDRKTWTLEIDISAPQIIFAENFCVKGGTLVVVDFGRLQLSN  711
               K + +KNW  +  G+  +RK W  EI+I AP+IIF EN+ V    +V++DFG+L++  
Sbjct  631   --KTDFMKNWNEMFSGNEVNRKIWMFEIEIFAPRIIFLENYKVSNSLMVLLDFGKLEMRK  688

Query  712   NQPESSKPEAPQEQFRKDSEEEDAFMTPCSTPPGSEASTSDSPTLCTALSDGFERNIDSS  771
              + +   P          S++++ ++TPCSTPP SE S S+SPTL          N +  
Sbjct  689   MEVKRVIPVIESAVTENTSDDDETYLTPCSTPPASEKSGSESPTLLENPKTESFLNKNVQ  748

Query  772   LNEKSLHQKLYDSFKLNLTDLQVLVCKSKERWAFASSKGSSSLHVLDRFNISLQMERRVV  831
             L E  LH K+YD + +N T+LQVLVCK +ERW  A  K SS+ H++D+FNI+L +E+R +
Sbjct  749   L-EYVLHNKIYDKYLINFTNLQVLVCKYEERWQ-ACLKTSSNFHLIDKFNINLTLEQRNI  806

Query  832   YTLDPQFPSLTMSGSLPKLVVHVNEHKIAALIQMLNVLSSSTLHSPHRSPIIDAVEEISE  891
             +T+DP++PS  + G+ P +++H NE  I     ++              PII A +E+  
Sbjct  807   FTVDPEYPSFMLFGTCPTILIHGNEELINNCCNIM-------------KPIIKASKEMEN  853

Query  892   KMQENVPFNDDEEQPVWQRDGSKLVILQFSVDQMSLEVQSRGRSIAELQVTGVKAGFSRR  951
               +        E       D    V+++F +DQ+ +E+QS  RSIAELQ+ G +AG ++ 
Sbjct  854   IYRGGNTIYASERIKNLAEDDRSRVVIEFVMDQLVIEMQSTERSIAELQIIGARAGLTKE  913

Query  952   PEDTNLTLSVHGLLLVDAMQSYGQDFELLIASHRHVGIDSVSGSLKQSEPCSPQSPGSPD  1011
             P +TN+++SVHGLLLVDA+QS+G DFELL+ASHRHVG+DS+SGSLK S   SP SPGSP+
Sbjct  914   PHETNISMSVHGLLLVDAIQSFGPDFELLVASHRHVGMDSLSGSLKHSAIVSPTSPGSPN  973

Query  1012  PTLHYDRRPTSPHTISKALSNLQ-------------RNALITVEVLFVTPEPGSGGEQLQ  1058
                 +  R TSPH I+KA+ N++               ALI+V++  V P   S   QL 
Sbjct  974   ----FFDRATSPHMITKAVQNIKMGDRSTEFCDDEDSTALISVDIKIVPPNE-SNSMQLH  1028

Query  1059  IANIQFNNLDIIANQETIVELMDFTKRVFPNRKATVNLSAQPNTDTTDHPSSPEPIVPSP  1118
               +I FN+LDIIANQ+TI+E+++F KR          L AQ N   ++ P SP+    +P
Sbjct  1029  TTSITFNSLDIIANQDTIIEILNFAKRT---------LLAQ-NIFPSESPESPKEATEAP  1078

Query  1119  I----------RTEITFDFHRLNVLILRALMRDNFMVGRKVGTFTMSEARIHATLGTSIT  1168
             +            EI FDF RLN+L+L  + RD F VGRKVGT T++EA+I+A+  + ++
Sbjct  1079  VDVVDQVDHKSHNEIFFDFFRLNILLLYTIKRDKFNVGRKVGTVTLTEAKINASFQSDLS  1138

Query  1169  VEGSLGGLQVLDLTPEGIAHQRILSVGKDPLTEPPHV-EQDLLSSLTQEIYAMGTSKDEI  1227
             + GSLGG+QV+D+T E   H RILSVG+D +       +Q +LS L+ EIY+     +E 
Sbjct  1139  IIGSLGGIQVIDITSEAFCHPRILSVGRDQILRASDTNKQTVLSQLSNEIYS-NNYNEET  1197

Query  1228  VLVERQALSFRVTRDLNACVNIKIRMASVWYTHVARFIQELNWCATEFKHYLKNLAKSIR  1287
                E  A+SF+           ++RMAS  YTH  RF++++N C T FK  L+  A SI 
Sbjct  1198  KSDESDAISFQSHWSDKTTCTFQMRMASASYTHCPRFLRDVNACITYFKRSLREFATSIG  1257

Query  1288  EKATDMAMGLVQPRSDVITTPRSNEVYSPRHSLRRKRLTSLSNQQNCIDVKLELDVVLDT  1347
              KATDMA   VQ         R+ E   P +  R +       Q N       LD+++ +
Sbjct  1258  NKATDMAKEFVQ-------QVRAVEQIGPVYPQRNR-------QDNW------LDIIISS  1297

Query  1348  PVLVLPRSSCSSQVFVAHLGKISVTNIRSDKCDDDTKQFQPDKPINRIFTIDEEPFMSEC  1407
             P+++LP S+ S+ V +A+LGKIS +N  + KCD D  +F                     
Sbjct  1298  PIIILPISNTSTNVLIANLGKISCSN--AVKCDSD--EFN--------------------  1333

Query  1408  FAEDFELDDPIKEDLDTSTICAEDRESDLETYVMDVRNMNLYSLDTMTRKGFRMSALPRA  1467
                                          E+Y ++++N  +YSL+ +    +  +  P  
Sbjct  1334  -----------------------------ESYTIEIKNTYVYSLN-IDEGEYSFNVHPAK  1363

Query  1468  EEFYSCQTDAVPVLHDTAIQLDMVRIV--DNTTVHEVYDTKETLQITGSVVKPLNLSLSR  1525
              +      DA+P+LHDTAI L +      DN    ++        I GS+V+ L +SL+R
Sbjct  1364  NK------DAIPILHDTAITLQLYAGYSDDNDEDKQL----NRFSIKGSMVEALKVSLNR  1413

Query  1526  MQYEQLIETIENLFKIPDDLVRPPSEVPQHSQPDLSEFIDQPTISSFDIKDNKVRRKLFA  1585
              QYE L+E+I       ++++    E+ Q+   + +  ID  +I S  I+          
Sbjct  1414  KQYELLLESIRYATNFSNEVLNESDELDQNGDIEPTANIDAESIISTTIQ----------  1463

Query  1586  GPSFNEHKSYVEPKVLFELPSFIIQLKNEVNNPLIEISFRDLKVNYDRCNLYETNVQVSL  1645
                             F +P F I L+NE +N LI ++F++  V +     ++ +V+V L
Sbjct  1464  ----------------FSVPVFQINLQNEYHNDLINLTFKNFNVKHISKG-FDKDVEVVL  1506

Query  1646  RSLLMEDLLQPPDSKHRSMVISSSPETQNLRPGTSFSSRSCPNLIGLHMPDECMTGSLPE  1705
             +S+LMEDL     S  R+MV S   E Q ++     +S SCP+L       +  + S+P 
Sbjct  1507  KSVLMEDLKSDLTSPFRNMVTSVDLE-QKIKKN-EMTSSSCPDLPSYCNSLKNRSSSVPS  1564

Query  1706  NLENTHHLNEEQQPINKTTCPDTPPPSPQPRERQDNLVLYTSLLIDPECPNFDSHYNSMR  1765
                N  H+  +    ++           + +E Q  LV+Y S           +    + 
Sbjct  1565  CFYN--HMQVKVFGGDQKYTSSNKNELGKKKESQ-TLVIYKSH------TGRSAQNGKLE  1615

Query  1766  QSSSIDFNSLDLIISVQSWFVLLNFFGLLSDDHDDVTSSREIPTTSVETVHKKGNSDLDI  1825
             Q+SSI FN L+L I V+ W+ + +FFGL+S D+ +     E+    VE    K  S L +
Sbjct  1616  QTSSIQFNCLNLAICVERWYTIFDFFGLVSVDNVNEKYPEEMKL--VEKHIDKVCSKLKV  1673

Query  1826  SVRSLTLVFIRTDYEIAKANVSNAHFVISKYGQSKTVEGKLGSISLMDLTLHGAIYRERF  1885
             S+RS     IR +  +++ NVSNA F+I +   SK VEG LGS+S+ DLT +G IY+++F
Sbjct  1674  SIRSFNFTLIRNESLLSRVNVSNAVFMILQDPYSKIVEGCLGSVSVNDLTKYGNIYKQKF  1733

Query  1886  LTSGYEALNFFYRQDGPKLNS-RSMNCDAKLKIQMSSVKYVHTKRFVAEIQAFFKEFQQL  1944
             LTSG EALNF Y++    L +  +++ D+ L+I MS+V Y+HTKRF  E+  F K+  QL
Sbjct  1734  LTSGTEALNFVYKKKLVDLEALNTLDTDSTLRINMSAVHYIHTKRFSTELHVFVKDLLQL  1793

Query  1945  QTPVLRKIKPSESRHSLHQRPLQLGLEINAGSPIILLPLSSRSEKVIVADLGEFSLQNNF  2004
             QTPV+RK+K   S  ++  RP ++ L I A SP+I+LP S    +VI+A LG+FSL+N+F
Sbjct  1794  QTPVIRKLKKHGSEQNM--RPSKMKLVIQADSPVIVLPSSYNRNEVIIAYLGQFSLKNSF  1851

Query  2005  HLASERGIISIKVDDTGPDEILDVMQVHLVNTDLFAGIRI---GKSDFVAGKLDICMDMN  2061
             H AS+  IIS        DEILDVM++ LVN +LF+G R     K+D    ++ I  DMN
Sbjct  1852  HFASDNNIISKMSATPSKDEILDVMRIDLVNINLFSGERSSMKAKADQEKDRI-IIADMN  1910

Query  2062  GYAILKQGSNLLNSKCHLKLIVERNMDSWKSQNVPDISVHGTLSRLEAVLDLQQYQLVRG  2121
                 L+ G    N  C L L +ERN+ +   +  PDISV GT S+L  ++++QQY+L+R 
Sbjct  1911  ---FLRLGQPFFNESCFLHLQLERNLSADAHRVCPDISVQGTFSKLSGIINIQQYKLIRS  1967

Query  2122  FLSYNLGECIDDLVVEPTYNSDSRSNLLTDV----AKTTDKRVWTNLSITLDLQDVSVRL  2177
             FL+ N+GE  DD+ +    NS +    L+ +         K V   +SI + L+DVS+ L
Sbjct  1968  FLNNNIGEQTDDIYMNYHNNSCTSIERLSTINLMPKNEVSKIVSILISIRILLEDVSLLL  2027

Query  2178  NTPTNTHYIIDDPSSHNHPSLARIKFIKSSLKIDSFSDGSQDIDLVSQEILVIDSRYANT  2237
                T+    I+         LA I F+KS+L+ID FSDGSQDIDL+S  IL++D R  N 
Sbjct  2028  ALNTSQSAAIE--------PLACIHFLKSTLEIDLFSDGSQDIDLISSNILIVDER--NE  2077

Query  2238  HTDQPKNVFTNILQPINSNPG-NDSVQAEVHSRRRNDSSKFTILLNNMRVMAILDWLEMC  2296
                  +NVF NIL+P        +SVQ EVH R++   SK+TI+LNNMRV A+L +L+  
Sbjct  2078  SDKSNENVFKNILEPSKKEVRIENSVQVEVHCRKKATFSKYTIMLNNMRVFALLSFLDQL  2137

Query  2297  RDFLSQNAEKPKDLIAIQKVNENLQTPVPEEPM--ELVLNITDSELVFVETPDQWDTNAV  2354
             + +L +++  P   +     N+  Q P  +  +  E V+NITDSE++F E   + D+NA+
Sbjct  2138  KSYLQEDSPAP---VVNNAANQIAQKPQIDTSISTEYVVNITDSEIIFAEECSRLDSNAI  2194

Query  2355  ILKSTTILSYRPIEVDKVMSINLNHLEVFSCVLGFEEETALSIIDPVTINMDLKKNVLDI  2414
             ILKSTT++ Y+P      +S+++NHLE+FSC L  EEE+ALSIIDP T+ ++L+ N L+I
Sbjct  2195  ILKSTTVICYKPNSNIVPLSLDINHLEIFSCTLDAEEESALSIIDPFTLIIELRSNCLNI  2254

Query  2415  QLAKRLSIRLSYNDVKMFSQMLQSLPRQTKNAKSKDHVTGDRSVDVQLISKLSALGFNSD  2474
              + K L+IRLSY DVK+FS+M + LP QT   K   +V      D++  + L A+GF   
Sbjct  2255  LIQKHLNIRLSYVDVKLFSRMARLLPTQTSRPK---NVISKADSDLEKAAPLVAMGFEIS  2311

Query  2475  DCVNALEICNNELDEAALWLTQHAEPTKHSHTIVHPLEIKSIAVQANCISICVIDDCKDA  2534
             DC+ A++I N  +++AA+WL+Q  + T  +      LE+K+  V A+ IS+ +IDDC DA
Sbjct  2312  DCLYAMQINNWRINDAAIWLSQQKQNTYRNPA----LEMKTAVVDASLISVFIIDDCMDA  2367

Query  2535  DVPLLELSLSQLEFDQELSSSTELMRRSNADLSADKLCFKTGSLKGTFASDYYNRGLSGW  2594
             DVPLLE+SLS+   +    +     + +N         +  G++    + +YYNR LSGW
Sbjct  2368  DVPLLEVSLSKFLLNFTFQTQDPNPKETNIRH------YSLGNIDTEVSVNYYNRRLSGW  2421

Query  2595  EPLIEPWKCDATWSYSLGSGMQRNRLHLKVNSEDMVKLNVTSTSIELYRIVHDDWTQDYY  2654
             EP+ E W+ +  W Y+ G    + R  + ++S+ M+KLNVTST IEL+ +V  +WT D+ 
Sbjct  2422  EPVAETWESNLNWKYTKGHLDNKKRFEIGISSKQMLKLNVTSTFIELFHMVLKNWTNDFN  2481

Query  2655  SQPASISNNKKSIQMSPNNYRRRNPFVPFAIRNETGVRLWFT--------VSRSESSMTS  2706
                A              N+R+R+PF+PFA++N +G  L F         ++RS+     
Sbjct  2482  DNGAK-------------NFRQRSPFIPFALQNLSGTPLLFKPIYAPLGDLTRSDLQQVE  2528

Query  2707  SETRWTPVEPNAVTSFSFGPQSKQRHNDTHKLNIHQVGVRVEGWSEVGPVSVDKVGVFFR  2766
                 W  V+PN   +F F  +SK RH  +H+LN+HQ+ V++ GW+ +GP+SVDKVG+FFR
Sbjct  2529  LIKNWYSVQPNETKTFDFSQKSKLRHVHSHQLNLHQIFVQIHGWTLIGPISVDKVGMFFR  2588

Query  2767  HARYEAVEFVSMPRARIVFSVTLEGSAHKLITVRSALRLINKLDRPILLRMEHDFRYLSN  2826
               + ++ +F++  ++RIVF ++L GSA KLI V+S+L +INKLDR + L+M     + S+
Sbjct  2589  TTKLDS-QFLT--KSRIVFDISLIGSAQKLIKVKSSLGVINKLDRNVFLKMTLKGTH-SD  2644

Query  2827  PLWPAVFSSIVPSSEVYSIPLNRVHSLLSVRPLPTEIDLEATQKELQMQRADEGTAFREV  2886
              L  +  S I P+ E+ S+PL  + + L V                      E  A+ + 
Sbjct  2645  GL--SSISVIKPNDEL-SVPLKFIDASLYV-----------------AHNTSESDAYEDT  2684

Query  2887  KFNSKEYWNKYESAAQRSTNSFQFCKDTLNWKEMDEGSELQQELRTCLSNRDKFRFVAAI  2946
              F+++E                      + WK   +  + +Q L    +N+        I
Sbjct  2685  GFSNEE----------------------ILWKACGK-DDTRQLLAGYDTNKSILYTFVNI  2721

Query  2947  RREGYPTKDAIGIPGHSITLWPPLRLNNLLPCDLLYKLLSGTQGRIASSESASVYEVDLE  3006
              RE Y  K+   +PGH ITL PPL++NN+L CDL++K+     GRI SSES ++Y V++ 
Sbjct  2722  SREIYHCKEQ-NLPGHKITLLPPLKINNMLCCDLMFKIHEHATGRINSSESVNIYNVNIC  2780

Query  3007  RELKITLTLDGYPGAGTLCIPVG-LGNVETTLRLSDMKQRVLNLRASITMIKGCGMQISI  3065
             + L +++TLD +  +G L IPV   G +E  L+L D+++R L++R SI  + G GM++ I
Sbjct  2781  QPLNLSITLDNFQLSGQLKIPVSHRGVIEPKLKLIDIQKRELHVRVSIQSVPGKGMELYI  2840

Query  3066  SAPYWLVNRTGLPLVFRQEGVPHESAGQFQENEQGRLVSPLMYSISDPDASPALTVRLGK  3125
             SAP W++N+TGLPL+++QEG  H +AGQF+E+E  R V+PLM+S SD + SPAL +RLGK
Sbjct  2841  SAPVWIINKTGLPLIYKQEGTSHTAAGQFEEHETARQVAPLMFSFSDQEGSPALVLRLGK  2900

Query  3126  RFGQNPPWCQPFQLHKDILNRQLKSGSSNETFVLGIEVRRGRGRYIKTSVVTFSPRFQLY  3185
              +G N  WC+ F  HKD+ +R L++ ++  ++ +GI VRRGRG Y  T+ VT SPRF L+
Sbjct  2901  AYGSNNMWCKSFSTHKDLADRDLRAENTKGSYAIGISVRRGRGLYACTTFVTLSPRFHLH  2960

Query  3186  NRSSYKLQFAQKYYATTLTDQLAKATFIEAVPGCHLPFHWPRLDKDQQLCIRLPDVENCL  3245
             NRS YKL+F Q        D+      I A   C+  FHWP  D++Q +C+R+P++E C 
Sbjct  2961  NRSGYKLEFMQLCDIVNY-DRPDPRKIISAPVDCNFAFHWPNWDQEQIICVRIPEIECCC  3019

Query  3246  WSGGIPIHETQSLYINIRNINGDMHFIRVEIVLQGATYFLLFGDAQALPPPIRIDNYSEV  3305
             WS GIPI + QSLYIN+RN  G+M F+R+EI+ + AT+ LLF DA+ LPPPIRIDN SEV
Sbjct  3020  WSKGIPIKDVQSLYINVRNEWGEMFFLRLEIISKDATFILLFTDARTLPPPIRIDNCSEV  3079

Query  3306  PLKFYQTDCKNQWQTVVRPHSSIAYALDEPMGAQSLYIEAPGGVSHVYSLRDLG-MSHNL  3364
              + F Q   K  W T VRP SS++Y +D+P+G Q L +EAPGG    + + +   +   L
Sbjct  3080  VINFSQLRSKPVWITPVRPQSSLSYVMDDPLGQQILLMEAPGGNMIEFPINNKNNIKKTL  3139

Query  3365  TYENFIYIAFSETFKNVSNIGNNSFDYDIESQQLVLTVVDGRVFLARRQPGDRSQLWRMN  3424
             TY NFIYIAF  TF+  SN   N+       +QLVL V   +V +  +  GDRSQLW MN
Sbjct  3140  TYTNFIYIAFQGTFER-SNEEENT------HRQLVLGVRGKKVVIVEKNSGDRSQLWLMN  3192

Query  3425  KEKQLEHEGSSPPTEPGRKSSSASPRYVLDLERAPQPQKFTSLVVRPANRQRKSTQTWYF  3484
                QLEHEGS+PP +    + + + R VLDLE+AP P +FT+LVVR  N+QR +TQTW F
Sbjct  3193  SNGQLEHEGSTPPIQT---NDANAVRLVLDLEKAPNPMEFTNLVVRTPNKQRVTTQTWRF  3249

Query  3485  TEEGRLMCEHANMCVQSRDGFFNLRPGSDAVLGMIVSPTPTYMYTESLVPVEQAIERQKL  3544
              E GRLMC HANMCVQSR G   L+P  +AV+G     T     +   +P+ Q I  QKL
Sbjct  3250  -ENGRLMC-HANMCVQSRFGESGLKPNYEAVVGR----TENRASSSKQIPIGQHIVAQKL  3303

Query  3545  RPGSGFLSVVVSMDGPIKTIQIKDIK-SLASASLSLDPTWKHVSHLLPHISETPNNNNDD  3603
             RPGSG L +   MDGPI TI+I DIK    S  L+ D  W H S          N    D
Sbjct  3304  RPGSGQLELSTKMDGPISTIEICDIKIKQNSVFLTPDLLWMHAS--------LNNRQITD  3355

Query  3604  SPSTSVVTKSLSELHVNLKLTKGLGLSLVSKRPCEELAFVTLEFITLEVIATPAVRSLDL  3663
                 S V + L    +N++L KG+G+S+++++PCEE+ F++L+ I  +++ +    SLDL
Sbjct  3356  KGKVSFVHEYL----INVELVKGIGISIIARKPCEEIMFISLDHINCDIVQSALENSLDL  3411

Query  3664  SVGDMQIDNQLFETPCPVMLFTNRNVEMVSLP-ATHLNIKLLPSPNKNAIIFEHFILSLR  3722
             ++  +QIDNQL +   P+ L T  + ++     A  L +K+LPSPNKNAIIF++  L L+
Sbjct  3412  NIAYIQIDNQLLDAVSPIALHTQTSNDLEETQNAVVLKLKMLPSPNKNAIIFKYLTLDLK  3471

Query  3723  PITIYLEERLMLRMACFIGLGQSQPDPAALPDECDYEAQRVATKILAANAKRFYFGDLQI  3782
             P T  LEE+L+L++A F+G G+      ++     Y+ +    K    + KR+YF +L I
Sbjct  3472  PSTASLEEKLILKVASFLGYGKINRQNLSV----QYQFENTDDKPFLQDMKRYYFENLSI  3527

Query  3783  VPSNIRLSVITASKLSPQLSEMKKRLGLTLIKFEDASIDFEKFKDKHHFETLEVYVRAIK  3842
               + +RLS  T+SKL  +L E KK LGLTLIKFEDA I+ +++ DK HFET++VY + +K
Sbjct  3528  GATQVRLSAFTSSKLPVELHETKKALGLTLIKFEDALIELDRYSDKLHFETMDVYRKELK  3587

Query  3843  SHYKQELKWQAAKILGSVDFLGNPTGFFGDLNEGMHGLFYEGSVTSLVKNVTHGLSNSTA  3902
              HY  ++KW AA ILGSVDFLGNP GF  DL+EG+ GL +EGSV SLVKNVTHG+SNSTA
Sbjct  3588  KHYINQVKWHAAAILGSVDFLGNPLGFANDLSEGVSGLIFEGSVKSLVKNVTHGISNSTA  3647

Query  3903  KLTESISDGLGRVVLDEQDTETRQKILEVSSGANSTGDHLKAGFMGLGFGLLGGVTSIVK  3962
             KLTE++SD LG+VVLD+ D ETRQ+ILE+ S  N++G HL AG  GLGFGLLGGVTSIV+
Sbjct  3648  KLTETLSDSLGKVVLDDHDNETRQRILELQS--NTSGGHLAAGLKGLGFGLLGGVTSIVR  3705

Query  3963  HTYAGAQTDGLHGFISGLGKGIVGTVTKPMIGVLDLASETANAVRERSKSSNRTLPERKR  4022
             HTY GA +DG+ GF+SGLGKG+VGTVTKP+IGVLDLASETA+AVRE S+ S+R  PERKR
Sbjct  3706  HTYDGATSDGVPGFLSGLGKGLVGTVTKPIIGVLDLASETASAVRETSRDSHRNAPERKR  3765

Query  4023  PPRCVTGAPGGLIPPFSLVQSKGQQHLFLINKRNFNEQFMAYEPCLLERRDSKLRLLVSS  4082
              PRCVTGAPGGL+P +S  QSKGQQ+L+LIN++NF+E+ ++YEP L   ++++LRLLVS+
Sbjct  3766  LPRCVTGAPGGLLPLYSNRQSKGQQYLYLINQKNFSEKIISYEPNLWSDKEARLRLLVST  3825

Query  4083  ENIWVFSRSEESTTTVLTHHLSELISCYPVSVNVA---PTGHKTKYQFYIELCLSLTSKS  4139
             E + +FS S+ + T +   H+SE++SC+PV  N      T  +     YIE+  +L    
Sbjct  3826  EYVRIFSLSDANPTIMFECHVSEILSCHPVVTNAGTTPTTSSRASASHYIEISTNLPK--  3883

Query  4140  LNYAGQEVVKRPRVRCQSEEMSQRAAHHINYAKSVYDEREHTL  4182
                     + RPR+RC+SEE ++ A+  INYAKSV+DEREH +
Sbjct  3884  --------ITRPRIRCRSEECAEAASRCINYAKSVFDEREHAV  3918


>VPS13_DROME unnamed protein product
Length=3321

 Score = 145 bits (366),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 97/349 (28%), Positives = 181/349 (52%), Gaps = 28/349 (8%)

Query  1    MLRELIAWVLNTYLGKYVENLNTAQLTVALLSGEVELENLPLRRDALRNLGLPLQALSGT  60
            +   ++A VLN  LG Y+ENL+  QL + +  G+V L+NL +R +AL  L LP+Q + G 
Sbjct  2    VFEAVVADVLNKVLGDYIENLDRNQLKIGIWGGDVVLQNLKIRENALDELDLPVQLIYGY  61

Query  61   VGKIKLQIPVRQFRTAPWCILIENVYVVVGPVNLDEWDAEAEEQADLDFKLSRLDGLEAK  120
            +GK+ L+IP +   + P  + IE++YV+V P N  +++AE E + ++D K + LD LEA 
Sbjct  62   LGKLVLKIPWKNLYSQPVIVNIEDLYVLVSPNNNVQYNAEKEAKYEMDLKKAALDALEAA  121

Query  121  WRASSEASLEGGYYASSYSGWLSYGTSLMTNIVENLELKIKNVHIRYEDSITIPDQRFAF  180
             +   E          + +G   +   L   IV NL+++I NVH+RYED+ T     F+F
Sbjct  122  RKKELEMD-----QPKADAG---FAEKLTAQIVNNLQVQITNVHLRYEDTTTT-GSPFSF  172

Query  181  GINIESLSARSCDENWTPGYTTAWINNSASFKLVELEAMSFYWDPLHNNEIFGDISSNEL  240
            GI++  L   + D +W   Y       S  FK+  L  +S Y +     +++ + + ++L
Sbjct  173  GISLHELELYTTDCDWEKCYMAQ--QASQVFKIANLSCLSAYLNC--GGQLYAN-NKSDL  227

Query  241  AE------AISKSKFTHQFIVSPVCAQAHLKRDRS----ETPLRTRSRPRLVCDLILNEV  290
            ++      A  ++K  + +++ P+   A LK + +    + P     +P++   L + ++
Sbjct  228  SQQFKTNIACKETKPNYNYVLGPISCNAKLKLNMNPELDDPPFE---KPKIDLTLEMEKL  284

Query  291  QLTLNDWQYSQMVGCVRGLDDIAKYRRFKLLRPLHSVHQG-PRAWWLYA  338
             + L + Q+  ++     ++       ++  RP +  ++G  R WW +A
Sbjct  285  NVGLTNTQFDNLMKLGDAMNRQQLGIPYRKYRPYNIPYKGHARDWWHFA  333


 Score = 115 bits (288),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 84/307 (27%), Positives = 142/307 (46%), Gaps = 29/307 (9%)

Query  3773  KRFYFGDLQIVPSNIRLSVITASK----LSPQLSEMKKRLGLTLIKFEDASIDFEKFKDK  3828
             ++ ++ +L + P  I +S   A      L   L  + + +G+TL    D       F+ +
Sbjct  2903  QKSFYDNLHLGPLKIHVSFSMAGSDTKALPGFLGSLVQGVGVTLTDVNDVVFRLAFFERE  2962

Query  3829  HHFETLEVYVRAIKSHYK-QELKWQAAKILGSVDFLGNPTGFFGDLNEGMHGLFYEG---  3884
             + F + +  +  I SHY  Q LK     +LG +D LGNP G    L +G+  LFYE    
Sbjct  2963  YQFFSQKQLINEITSHYTGQALKQLYVLVLG-LDVLGNPYGLVVGLKKGVEDLFYEPFQG  3021

Query  3885  --------------SVTSLVKNVTHGLSNSTAKLTESISDGLGRVVLDEQDTETRQKILE  3930
                            V SL  +   G + + +K+T ++  GL  +  DE   + R++   
Sbjct  3022  AIQGPGEFAEGLVLGVKSLFGHTVGGAAGAVSKITGAMGKGLAALTFDEDYQKKRRQ--G  3079

Query  3931  VSSGANSTGDHLKAGFMGLGFGLLGGVTSIVKHTYAGAQTDGLHGFISGLGKGIVGTVTK  3990
             + +   +  + L     GL  G + GVT +V     GA+ +G+ GF  GLGKG +G V +
Sbjct  3080  IQNKPKNFHEGLARSSKGLVMGFVDGVTGVVTKPVTGARDNGVEGFFKGLGKGAIGLVAR  3139

Query  3991  PMIGVLDLASETANAVRERSKSSNRTLPERKRPPRCVTGAPGGLIPPFSLVQSKGQQHLF  4050
             P  GV+D AS +  AV+  + +S     +R RPPR        ++ P+ L+++ G + + 
Sbjct  3140  PTAGVVDFASGSFEAVKRAADASEDV--KRMRPPRF--QHYDFVLRPYCLMEATGNKIMK  3195

Query  4051  LINKRNF  4057
               +K  F
Sbjct  3196  ETDKGKF  3202


 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 89/455 (20%), Positives = 181/455 (40%), Gaps = 79/455 (17%)

Query  1732  SPQPRERQDNLVLYTSLLIDPECPNFDSHYNSMRQSSSIDFNSLDLII---SVQSWFVLL  1788
             +P+     + L   +  + D   P F + YNS  Q    +F  L +++    +Q    ++
Sbjct  973   TPKQENSSNYLFTVSCTIADKSSPEFSTKYNSTEQLVVANFEVLQIVLHQECLQRIMEVV  1032

Query  1789  NFF------------------------------GLLSDDHDDVTSSREIP-------TTS  1811
             N F                               ++ +D +++ ++ ++        T  
Sbjct  1033  NNFQRNLDLVLSSTRPRDRMGSIGGGDGIKRTLNVILEDTEEIMTTDQMKRRKKTRRTHV  1092

Query  1812  VETVHKKGNSDLDISVRSLTLVFIRTDYEIAKANVSNAHFVISKYGQSKTVEGKLG--SI  1869
             VETV  +  ++LD     + LV       IA+ NV    FV S   +S   E  +G   I
Sbjct  1093  VETVKVRVIANLD----QVGLVLTGRKRPIAEMNVKK--FVSSLIIKSSYTEVNIGLKDI  1146

Query  1870  SLMDLTLHGAIYRERFLTSGYEALN----FFYRQDGPKLNSRSMNCDAKLKIQMSSVKYV  1925
              ++DL  +  I++      G +A N     + +++    NS  M    K+ + +  +K +
Sbjct  1147  QVLDLNPY-TIHKNILSIVGKDAFNCQIVIYNKEETQDYNSDDM----KITVDIGCMKII  1201

Query  1926  HTKRFVAEIQAFFKEFQQLQTPVLRKIKPS-----ESRHSLHQRPLQLGLEINAGSPIIL  1980
                 FVA +  F   F   Q  + +    +     +     ++   ++ L I   +PII+
Sbjct  1202  FLNWFVAGVMNFLNNFTAAQATISQAGAAAAESARQKAMDAYETATRMKLNIRIKAPIII  1261

Query  1981  LPLSSRSEKVIVADLGEFSLQNNFHLASERGIISIKVDDTGPDEILDVMQVHLVNTDLFA  2040
             +P+ S+    ++ DLG   L NN         + + V +     ++D +++ + +     
Sbjct  1262  VPIGSQDRNALLLDLGLLELTNN--------TVEVAVAEEERLAVIDEIKLQICD-----  1308

Query  2041  GIRIGKSDFVAGKLDICMDMNGYAILKQGSNLLNS-KCHLKLIVERNMDSWKSQNVPDIS  2099
              ++I K   + G      +++         N++N   C L   + RN+     ++VP+++
Sbjct  1309  -VKISKIVLLDGNESTVDEVDAEVGFLSKFNMMNPMSCTLS--ITRNLSYTWYRDVPELN  1365

Query  2100  VHGTLSRLEAVLDLQQYQLVRGFLSYNLGECIDDL  2134
             + G L  +E  L    Y LV   L+ NL E +++ 
Sbjct  1366  LSGRLKSIELTLFADDYALVMLVLNRNLNEGLEEF  1400


 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 65/279 (23%), Positives = 121/279 (43%), Gaps = 50/279 (18%)

Query  592  LFQMNYERKPLSHNTDYRLLIKSQSLDVVYNMDVIKWIVDFVMKPHQVIGTRKKIEAMKN  651
            L ++ +E  PL    D R+ + ++ L + Y+   I  +++    P  V  T  K E   +
Sbjct  569  LLEVFFETNPLDKLCDQRVKVVARPLQITYDAPTILALINAFQTPGDV--TLSKFEDAAS  626

Query  652  KTKMEIIKNWENILEGDLSDRKTWTLEIDIS-APQIIFAENFCVKGG---TLVVVDFGRL  707
             TK+   K         + D+K   L++DI   P I+   +  V      +L+VV  G++
Sbjct  627  -TKISNFKERSATGMQYMIDKKA-VLDVDILLMPNILVVPHKGVYDAGNVSLLVVSMGQV  684

Query  708  QLSNNQPESSKPEAPQEQFRKDSEEEDAFMTPCSTPPGSEASTSDSPTLCTALSDGFERN  767
             LS+ QP            R++S +                           L   F   
Sbjct  685  HLSS-QP------------RRESNK---------------------------LQHLFSAG  704

Query  768  IDSSLNEKSLHQKLYDSFKLNLTDLQVLVCKSKERWAFASSKGSSS-LHVLDRFNISLQM  826
             D     K++ +  YD F + + D+Q+LV ++ E W  A ++ +S+ +HVL   ++ +  
Sbjct  705  EDKDEILKTVMENAYDRFTVAVDDVQMLVVRAGEPWQNALAEANSTEMHVLRPVSLKVTA  764

Query  827  ERRVVYTLDPQFPSLTMSGSLPKLVVHVNEHKIAALIQM  865
               VV   DP+ P++ +   LP ++V+V+E +I   I++
Sbjct  765  ALCVVDN-DPRLPNIKVDIDLPAILVNVSEDRIFLAIKV  802


 Score = 46.6 bits (109),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 74/421 (18%), Positives = 165/421 (39%), Gaps = 76/421 (18%)

Query  2324  VPEEPMELVLNITDSELVFVETPDQWDTNAVILKSTTILSYRPIEVDKVMSINLNHLEVF  2383
             VP   M L+L+I + +++ VE  +  +T+ +I  +   L+YR I   ++++  ++ L+++
Sbjct  1622  VPNRKMNLILHIDEPDIILVENLEDLNTSCIIFNAQVHLNYRSINDKQIVNGQIDALKMY  1681

Query  2384  SCVLGFE--EETALSIIDPVTINMDLKKNVLDIQLAKRLSIRLSYNDVKMFSQMLQSLPR  2441
              C    E  E T   I+ P  I++   +     +    +S++LS                
Sbjct  1682  MCAFLPERREMTRHYILHPCVISL---QGSTPEEEGMHISLKLS----------------  1722

Query  2442  QTKNAKSKDHVTGDRSVDVQLISKLSALGFNSDDCVNALEICNNELDEAALWLTQHAEPT  2501
                     D +       ++L++K  A+   S   +    I     + + LW   H    
Sbjct  1723  --------DIIINVSPATIELLNK--AMLSVSSGTMTKCAIAEESRNYSNLWHQHHFHSR  1772

Query  2502  KHSHTIVHPLEIKSIAVQANCISICVIDDCKDADVPLLELSLSQLEFDQELSSSTELMRR  2561
              +  T V   E    A++A   S+   ++ +  +  ++E+    L  +  +   T+ +  
Sbjct  1773  TYWFTKV---EQGVDALEAEQRSVSTDNEKQKTEKCVIEIPSITLVIESGVGYYTKPLIS  1829

Query  2562  SNADLSA-----DKLCFKTGSLKGTFASDYYNRGLSGWEPLIE--------------PWK  2602
              +  ++A      +     GSL  T   +YYN+ L+ WEP+IE              PW+
Sbjct  1830  LDTRITAVFNNWSRSLTAHGSL--TLNMNYYNQALAEWEPIIELNEVIGRNGVREYTPWE  1887

Query  2603  CDATWSY-----SLGSGMQRNRLHLKVNSEDMVKLNVTSTSIELYRIVHDDWTQDYYSQP  2657
                          L    ++  +H+ ++S + +++ ++ T + L   + + ++Q      
Sbjct  1888  LKFEMGMEKVQSELEDDAEQQAMHMNIHSAETLEITLSKTCLGLLSELAEAFSQ------  1941

Query  2658  ASISNNKKSIQMSPNNYRRRNPFVPFAIRNETGVRLWFTVSRSESSMTSSETRWTPVEPN  2717
                        +  N   + +   P+ + N+TG  +   + +   ++       TPV  N
Sbjct  1942  ----------AIDQNGLTKPDIVAPYVLENDTGFDVNLNLRKGIFTLHEVHRGGTPVGAN  1991

Query  2718  A  2718
             +
Sbjct  1992  S  1992


 Score = 42.0 bits (97),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 53/291 (18%), Positives = 117/291 (40%), Gaps = 47/291 (16%)

Query  3061  MQISISAPYWLVNRTGLPLVFRQEGVPHESAGQFQENEQGRLVSPLMYSISDP---DASP  3117
             + +++ +P+W++N+TG+ L ++ E    E      E        P++++  D    D   
Sbjct  2349  LMLTLFSPFWMINKTGMMLTYKSETTSVEVLYHPPEYS-----GPILFTFRDKLFFDKKK  2403

Query  3118  ALTVRLGKRFGQNPPWCQPFQLHKDILNRQLKSGSSNETFVLGIEVRRGRGRYIKTSVVT  3177
             A ++R+      N  W +   L       ++   ++N+ + +G+     +    K   +T
Sbjct  2404  A-SIRI-----DNGQWSEKIPLDVAGSVGEVICFANNQKYPVGVHNHLTQNSLTKQ--IT  2455

Query  3178  FSPRFQLYNRSSYKLQFAQKYYATTLTDQLAKATFIEAVPGCHLPFH-----WPRLDKDQ  3232
             F P + + N+  + ++  ++                 A P  HL  +     WPR D   
Sbjct  2456  FIPFYIVCNKCHFDIELQEQSRP--------------ADPWLHLEPNEMEPLWPRNDTKN  2501

Query  3233  QLCIRLPDVENCLWSGGI-PIHETQSLYINIRNINGDMH-FIRVEIVLQGATYFLLFGDA  3290
              L +R+         G I P  +   +   +  +    +  I V++       ++ F D 
Sbjct  2502  NLVVRV--------DGKITPAFDFTEVICTLLKLEDSKYGGINVDVQTTEGGVYITFTDY  2553

Query  3291  QALPPPIRIDNYSEVPLKFYQTDCKNQWQTVVRPHSSIAYALDEPMGAQSL  3341
             +    P  + N++   + +++   KN  + ++   S+I YA D+P G + L
Sbjct  2554  KPADAPGLLINHTGKQIVYHEKGTKN--EHILNAKSTIMYAWDDPTGPKML  2602


>VP13C_DICDI unnamed protein product
Length=3848

 Score = 144 bits (362),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 124/470 (26%), Positives = 209/470 (44%), Gaps = 76/470 (16%)

Query  3626  GLGLSLVSKRPC-EELAFVTLEFITLEVIATPAVRSLDLSVGDMQIDNQLFETPCPVMLF  3684
              +G+S+++K P  EE+ +++++ + LEV  +   + +   V D+QID+Q + T  PV L 
Sbjct  3242  NIGISIINKIPTREEIVYLSIDGLKLEVKQSKLDQYIQFKVDDLQIDDQRYSTNFPVFLC  3301

Query  3685  TNRNV---------EMVSLPATHLNI-----------------KLLPS---------PNK  3709
              ++ +         +  S P +                     KL P             
Sbjct  3302  QSKKINHSINQQPNQQSSSPQSTNTTTTTTTNTTTTNNTTQQQKLKPFLQFSATRTLKYS  3361

Query  3710  NAIIFEHFILSLRPITIYLEERLMLRMACFIGLGQSQPDPAALPDECDYEAQRVATKILA  3769
             N + F +F + ++   I L+E  +L    FI +  +  +          + + + TK  A
Sbjct  3362  NIMFFRYFSILIQEFDINLDEASILNALSFININLNSLNEHFTLHPTITQEEILETK-NA  3420

Query  3770  ANAKR--FYFGDLQIVPSNIRLSVITASKLSPQLSEM---KKRLGLTLIKF---------  3815
             +N +    YF  L I P  + LS I+    SP+ ++     + L   LI F         
Sbjct  3421  SNIENHMVYFEMLHINPVKMNLSFISCK--SPKETQAILGARSLAELLIGFKSNSPFLNI  3478

Query  3816  EDASIDFEKFKDKHHFETLEVYVRAIKSHYKQELKWQAAKILGSVDFLGNPTGFFGDLNE  3875
             E A I F  F  +H F +    +  I  H+  ++  QA KI GS DF+GNP      L  
Sbjct  3479  ERAPIKFNGFIWEHPFLSTRQVIDEISLHFSYQMMSQAHKIFGSFDFIGNPIRLAESLGS  3538

Query  3876  GMHGLFYEGSV-----------------TSLVKNVTHGLSNSTAKLTESISDGLGRVVLD  3918
             G    F+E ++                 +SL+ N   G ++ST+K+T +IS GL ++ LD
Sbjct  3539  GFKDFFHEPALGLVKSPQDFAAGLSKGTSSLINNSVFGFADSTSKITGTISKGLVQLSLD  3598

Query  3919  EQDTETRQKILEVSSGANSTGDHLKAGFMGLGFGLLGGVTSIVKHTYAGA-QTDGLHGFI  3977
             +   + RQ+            + L+ GF   G G++ G+T I+   Y GA Q     GF 
Sbjct  3599  DSYIKERQE--SNKQKPKGVKEGLEFGFRDFGEGVIKGITGIIDEPYKGATQEKSWEGFF  3656

Query  3978  SGLGKGIVGTVTKPMIGVLDLASETANAVRERSKSSNRTLPE--RKRPPR  4025
              G+GKG++G   KP +GV DL S+T+  ++  S +  ++L +  R+R PR
Sbjct  3657  KGIGKGVLGVAVKPTVGVFDLVSKTSEGIK-NSTTVAKSLSQIKRRRIPR  3705


 Score = 136 bits (342),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 201/883 (23%), Positives = 370/883 (42%), Gaps = 191/883 (22%)

Query  1    MLRELIAWVLNTYLGKYVENLNTAQLTVALLSGEVELENLPLRRDALRNLGLPLQALSGT  60
            M+  + A VL  YLG YV++LN   + ++ LSGE  L++L +++  L++    +      
Sbjct  1    MVSHIAASVLTKYLGDYVDDLNKDNIKLSFLSGEAVLQDLKIKKTVLQSFLPNVIVKQAI  60

Query  61   VGKIKLQIPVRQFRTAPWCILIENVYVVV-GPVNLDEW----DAEAEEQADLDFK-LSRL  114
            + K+ L +P +  +  P  I IE +YV+    V  DE       + E+QA L  + + RL
Sbjct  61   IKKLSLHVPWKDLKGKPAIIKIEGIYVLAETSVEFDEQYYKKKFQDEKQAKLHIQEVLRL  120

Query  115  DGLEAKWRASSEASLEGGYYASSYSGWLSYGTSLMTNIVENLELKIKNVHIRYEDSITIP  174
            +  + K   +   S       S  S   ++G+ L+  +V+NL+L I +VHIR+EDS+   
Sbjct  121  NKQQLK---NPHQSTTTTTTTSDESN--TFGSKLLQTVVDNLQLYIDSVHIRFEDSVN--  173

Query  175  DQRFAFGINIESLSARSCDENWTPGYTTAWINNSASF--KLVELEAMSFYWDPLHNNEIF  232
             + F+FG+ + SL A S D+ W P +    I N ++   KL+ L  +S YW+       +
Sbjct  174  RRSFSFGVTLNSLVAESTDQTWNPTF----IKNESTIIHKLINLNQLSIYWNSNSPKLKY  229

Query  233  GDIS--SNELAEAISKS------------------------------KFTHQFIVSPVCA  260
             +I   S +L   I K                                   Q+I+ P+ A
Sbjct  230  TNIDDLSQKLKSMIKKEDSGKQQQQQQQQQGEEQDDEIEEDYFLSTESRKQQYIIDPISA  289

Query  261  QAHLKRDRSETPLRTRSRPRLVCDLILNEVQLTLNDWQYSQMVGCVRGLDDIAKYRRFKL  320
            +  +  ++S  P  +   P+   +   ++  ++L+D+QY  + G +       K   F+ 
Sbjct  290  KLKVVINKSIIP--SEVIPKYNLNFEFDKTDISLSDYQYKDITGILESFKLFEKSIEFRS  347

Query  321  LRPLHS-VHQGPRAWWLYAAQC-----HGFRRISADRRFK-IAKDNLEYIEIYSKIIKNP  373
             RP+++ + Q PR WW YA QC     H  R   +    K    D  +YIE++ K+ K  
Sbjct  348  ARPINTTIKQSPRKWWNYAIQCVLQKVHQKRYTQSWSYIKEFLSDKRDYIELFKKLKKKT  407

Query  374  -NEVLTTKLKEHKDAVEKERSYDELKLLREICML------------------------RM  408
             ++   T+L    D++E +  +D++   R +                            +
Sbjct  408  IHQTEQTRL----DSLEWKLPFDQILFFRNLSFKIIEKEEKLEKERLKLQQQQQQQQQNL  463

Query  409  PTPEGLSNETNQGRSMLVQWFPQWWGWYGSPAQTSSSQQQSSSLIALDATTPK-------  461
                  +  T    +    W   WW    + +   ++   +++    D+T  K       
Sbjct  464  NKISPTTTTTPSTSTGGGGWLSSWWKPIVNTSVPITAATTTTTATNTDSTITKLKDIKLS  523

Query  462  --DQHQLEDEL-LDALADSVESN-SILKRDAVFGK---------FDFTLRKGTLDICSGS  508
              D +++ D +  D   D + SN + L++   FGK          +F L +G L +    
Sbjct  524  KDDWNEIYDTIGYDENDDIINSNVASLQQPKQFGKDFSNIIKTVINFRLVQGGLKLKKKR  583

Query  509  ANKLMLQLQFENLILSVESRPRSASHFVGLSLGSVLLKDHITNNSEFPDLIKPQVKDESI  568
                +LQL   ++ LS++S+  S+  F G +L  + L D  T N++FP LI P +K  S 
Sbjct  584  RTIALLQLN--DISLSLKSKINSSFVFNG-NLKGLELIDQSTFNTQFPKLISPLLKRNS-  639

Query  569  THSRLHTQRANSRNSGLLNNTEPLFQMNYERKPLSH------------------------  604
              S + T+         + +  P+F +  E   LS                         
Sbjct  640  --SSIPTK---------IISQPPIFNITLESHSLSSTITSSTTTATTTQSTSTNSNNNNN  688

Query  605  -NTDYRLLIKSQSLDVVYNMDVIKWIVDFVMKPH-------QVIGTRKK-----IEAMKN  651
               +Y L I+S+ L +VY    I  + DF  K          V+   +K     IE++K 
Sbjct  689  IKVNYSLSIQSKPLTIVYYPKFISTVNDFFFKKEDDQDVQDMVLEDLEKKAQETIESIKA  748

Query  652  KTKMEIIKNWENILEGDLSDRKTWTLEIDISAPQIIFAENFCVKGGTLVVVDFGRLQLSN  711
            +T+ +++          +S++ T+++++D+ AP I+  E+   K   L+++D G+L + N
Sbjct  749  QTRDKLLL--------AISNKTTFSIDMDLEAPIILVPESITNKNTNLLILDLGKLLI-N  799

Query  712  NQPESSKPEAPQEQFRK---------------------DSEEE  733
            + P+  + +   +Q ++                     D +EE
Sbjct  800  HYPKQQQLQQQLQQLQQEQGQEQEQEQKQEQKQEQEQKDWKEE  842


 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 51/218 (23%), Positives = 85/218 (39%), Gaps = 59/218 (27%)

Query  1841  IAKANVSNAHFVISKYGQSKTVEGKLGSISLMDLTLHGAIY------RERFLTS------  1888
             + KA+ +  +    +Y     + GKLGS+ + D+T  G  Y      RER L +      
Sbjct  1278  LIKASFTGFNCTTDQYNYKTIMNGKLGSLKIYDMTTEGRNYRTILTTRERKLNNKTSPTT  1337

Query  1889  -----------------------------------------GYEALNFFYRQDGPKLNSR  1907
                                                      G E  +  Y Q      SR
Sbjct  1338  PSSSGVSTGTTFDIDIDNFDTVSSSSSSSLLSSSSLLISPPGGEQSSLVYFQ----FESR  1393

Query  1908  SMNCDAKLKIQMSSVKYVHTKRFVAEIQAFFKEFQQLQTPVLRKIKPSESRHSLHQRPLQ  1967
             + N    LKI +SS++++  KRF  E++ F      ++  +   I  + +   + Q    
Sbjct  1394  NDNNSQMLKINLSSIRFIFLKRFTEELRLFLNNVNMMREYLKSSIYSAAT--VISQNRST  1451

Query  1968  LGLEINAGSPIILLPLSSRSEKVIVADLGEFSLQNNFH  2005
             L  EI   +P I++PLSS S K+ + DLG+ +++N F 
Sbjct  1452  LFYEIEIQNPYIVIPLSSLSNKIFIVDLGKINIKNQFE  1489


 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 78/385 (20%), Positives = 141/385 (37%), Gaps = 99/385 (26%)

Query  2940  FRFVAAIRREGYPTKDAIGIPGHSITLWPPLRLNNLLPCDLLYKLLSGTQGRIASSESAS  2999
             F F+++I +    TK+ I      I++   + + N+L CDL Y+L  G   +I  S   S
Sbjct  2572  FVFLSSIEKNSLETKNTI-----EISINTAIMIENVLACDLQYRLYHGKNKKIIGSAFFS  2626

Query  3000  ----------VYEVDLERELKITLTLDGYPGAGTLCI---PVGLGNVETTLRLSDMKQRV  3046
                       V   D  +++ +   +  +  +  LC+    VGL  V   +++ D   + 
Sbjct  2627  GVIPMGKKLPVLVYDSLQDIYMEFQIYDFQWS-PLCLIDSMVGLA-VTDKVKIEDRLHQP  2684

Query  3047  LNLRASITMIKGCGMQISISAPYWLVNRTGLPLVFR-----------------QEGVPHE  3089
             L +     +       +++   YWL+N+TGLPL FR                 Q    HE
Sbjct  2685  LLISFDNRIQPNGSRFVTLYCEYWLINQTGLPLYFRHHIGAQTIDPAGQTPTKQIETIHE  2744

Query  3090  SAG-------QFQENEQGRLVSPLMYSISDPDASPALTVRLGKRFG---QNPPWCQPFQL  3139
             S          +   E      P M++ SD          +G +F     +  W  PF L
Sbjct  2745  STSMKPTDSRNWYTKEWNHPSQPFMFAYSDNSI-------VGGKFSLKIYDSNWSSPFSL  2797

Query  3140  H-----------------------KDILNRQLKSGSSNETFVLGIEVRRGRGRYIKTSVV  3176
                                     K+++    K       + L + +     ++ +T VV
Sbjct  2798  ISSQSSSNSNIEISEDRTDEEKEIKNVIGTITKRQPLKTNYNLSVSILPSNSKFWRTKVV  2857

Query  3177  TFSPRFQLYNRSSYKLQFAQKYYATTLTDQLAKATFIEAVPGCHLPFHWPRLDKDQQLCI  3236
             TFSP + + N + +++ + Q++   + T  +        +    LPF +P    ++ + I
Sbjct  2858  TFSPMYLMVNSTRFRILY-QQFDCDSNTQSI--------IQDQSLPFQFPSSRHEKLIRI  2908

Query  3237  RL-------------PDVENCLWSG  3248
              +              DV N  WSG
Sbjct  2909  GILDTSAISNNPYNANDVSNIKWSG  2933


 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 58/129 (45%), Gaps = 22/129 (17%)

Query  2539  LELSLSQLEF----DQELSSSTELMRRSNADLSADKLCFKTG-----SLKGTFASDYYNR  2589
             L +SL + EF    D ++SS  +L+      L ++   F        SL     + Y+N+
Sbjct  2058  LSISLEKGEFILNDDHKISSPIKLLSIGVDGLKSNIFSFPQKNQIALSLDANMKAGYFNK  2117

Query  2590  GLSGWEPLIEPWKCDATWSYSLGSGMQRNRLHLKVNSEDMVKLNVTS----TSIELYRIV  2645
              +  WEPLIE W    T + S+  G   N      NS+  + +N+T     TSI  Y+I 
Sbjct  2118  NIGIWEPLIENWGFSFTSNNSIEGGWMVN-----FNSKIPLYINITKIFIDTSISTYQI-  2171

Query  2646  HDDWTQDYY  2654
                W  DYY
Sbjct  2172  ---WADDYY  2177


 Score = 46.2 bits (108),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 33/107 (31%), Positives = 50/107 (47%), Gaps = 10/107 (9%)

Query  3252  IHETQSLYINIRNINGDMHFIRVEIVLQGATYFLLFGDAQALPPPIRIDNYSEVPLKFYQ  3311
             I E   ++IN+         IRV+      T  ++  +     PP RI+N +  PL   Q
Sbjct  3051  IFEDLRVFINVT--------IRVKSSKSLTTTMIILNEQNPELPPYRINNKTRFPLWIRQ  3102

Query  3312  TDCKNQWQTVVRPHSSIAYALDEPMGAQSLYIEAPGGVSHVYSLRDL  3358
                K +    V+P +SI YA D P+  + L IE P G++  Y L +L
Sbjct  3103  K--KTEIWDKVQPKTSIPYAWDHPILPKKLIIEFPTGLTKTYRLGNL  3147


 Score = 37.7 bits (86),  Expect = 0.30, Method: Compositional matrix adjust.
 Identities = 49/233 (21%), Positives = 85/233 (36%), Gaps = 73/233 (31%)

Query  1169  VEGSLGGLQVLDLTPEGIAHQRILSVGKDPL---TEPPHVEQDLLSSLT-----------  1214
             + G LG L++ D+T EG  ++ IL+  +  L   T P       +S+ T           
Sbjct  1299  MNGKLGSLKIYDMTTEGRNYRTILTTRERKLNNKTSPTTPSSSGVSTGTTFDIDIDNFDT  1358

Query  1215  --------------QEIYAMGTSKDEIVLVERQALSFRVTRDLNACVNIKIRMASVWYTH  1260
                             I   G  +  +V  + ++      R+ N    +KI ++S+ +  
Sbjct  1359  VSSSSSSSLLSSSSLLISPPGGEQSSLVYFQFES------RNDNNSQMLKINLSSIRFIF  1412

Query  1261  VARFIQELNWCATEFKHYLKNLAKSIREKATDMAMGLVQPRSDVITTPRSNEVYSPRHSL  1320
             + RF +EL           + L  SI   AT            VI+  RS   Y      
Sbjct  1413  LKRFTEELRLFLNNVNMMREYLKSSIYSAAT------------VISQNRSTLFY------  1454

Query  1321  RRKRLTSLSNQQNCIDVKLELDVVLDTPVLVLPRSSCSSQVFVAHLGKISVTN  1373
                                  ++ +  P +V+P SS S+++F+  LGKI++ N
Sbjct  1455  ---------------------EIEIQNPYIVIPLSSLSNKIFIVDLGKINIKN  1486



Lambda      K        H
   0.317    0.133    0.388 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 57319460198


Query= XP_037024187.1 protein transport protein Sec24C [Bradysia
coprophila]

Length=1260
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9PC99_DROME  unnamed protein product                                 1231    0.0   
Q9VQ94_DROME  unnamed protein product                                 1230    0.0   
C0H5J6_PLAF7  unnamed protein product                                 342     2e-100


>M9PC99_DROME unnamed protein product
Length=1231

 Score = 1231 bits (3186),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 568/788 (72%), Positives = 671/788 (85%), Gaps = 1/788 (0%)

Query  473   PGNFPQAQAQQQQRRLDPDQMPNPIQVMAENQRAMTGPFVTSQPGLVPPLVTTKSITQDQ  532
             PG     Q   Q RRLDPDQMPNPIQVM ENQR   GPFVT+QPGL+PPLVTTK +  DQ
Sbjct  407   PGAGNMYQQAPQARRLDPDQMPNPIQVMIENQRLSGGPFVTNQPGLLPPLVTTKFVVHDQ  466

Query  533   GNSGPRFIRSTMYNVPATADMMKQTAVPFALIISPYAKTLEGEIVPPIVNFGEVGPIRCI  592
             GNS PRF+RS++Y +P T D++K TA+P  L ISP AK  EGE+ PPIVNFGE+GPIRC 
Sbjct  467   GNSSPRFLRSSLYCIPNTGDLLKTTALPLTLNISPLAKVGEGEMEPPIVNFGEMGPIRCN  526

Query  593   RCKGYMSPNMQFIDAGRRFQCLLCKATTEVPQEYFQHLDHTGQRTDKYERPELVLGTYEF  652
             RCK YMSPNMQF+DAGRRFQCL+CK T+EV Q Y+QHLDHTGQR DK+ERPEL+LGTYEF
Sbjct  527   RCKAYMSPNMQFVDAGRRFQCLMCKVTSEVHQNYYQHLDHTGQRVDKHERPELLLGTYEF  586

Query  653   VATKDYCRNNKPPNPPAMIFVIDVSYNNIKSGLVHLLCSEMKRIIRNLPIDQGMDRSAMK  712
             +ATKDYCRNN PP  PA IF+IDVSYN +KSGLVHLLCS++K I+++LP+DQG D+S ++
Sbjct  587   LATKDYCRNNTPPEVPAFIFIIDVSYNTVKSGLVHLLCSQIKNILKHLPVDQGQDKSKVR  646

Query  713   VGFITYNNTVHFYNCKSNLAQPQMMVVGDVHEMFMPLLDGFLCDPEESGAVIDSLMEQIP  772
             VGFITYN+TVHFYN KS+LAQPQMMVVGDV EMFMPLLDGFLC PEES AVID+LME+IP
Sbjct  647   VGFITYNSTVHFYNIKSSLAQPQMMVVGDVQEMFMPLLDGFLCHPEESAAVIDALMEEIP  706

Query  773   AMFGETRETETILLPAIQAGLEALKASECAGKIIVLHSSLPIADAPGKLKNRDDRNVLGT  832
              MF +T+ETETIL PAIQAGLEALKAS  AGK++V +S+LPIA+APGKLKNRDDR +LGT
Sbjct  707   RMFADTKETETILYPAIQAGLEALKASNAAGKLLVFNSTLPIAEAPGKLKNRDDRKLLGT  766

Query  833   EKEKTVLTPQTNVYNNLGQECVQAGCAVDLFIFNNSYVDLATIGQICRLTGGEIYKYTYF  892
             +KEKTVLTPQT  YN LGQECVQ GC+VDLF+FNN+Y+DLATIGQ+ RLTGGE++KYTYF
Sbjct  767   DKEKTVLTPQTTAYNTLGQECVQQGCSVDLFVFNNAYIDLATIGQVSRLTGGEVFKYTYF  826

Query  893   QADMDGHRVVNDLIKNISRPIAFDSVMRVRTSTGVRPTDFYGHFFMSNTTDMEIGAIDCD  952
             QAD+DG R++ D+IKN+SRPIAFD+VMRVRTS G+RPT+FYGHFFMSNTTD+E+ +ID  
Sbjct  827   QADVDGKRLIQDIIKNVSRPIAFDAVMRVRTSAGIRPTEFYGHFFMSNTTDVELASIDAT  886

Query  953   KSIAIEVKHDDKLAPEDNVYIQVALLYTSCSGQRRLRILNLALKTCTQMADLFRCCDLDA  1012
             KSI+IE+KHDDKLAPE+NVY+QVALLYTSCSGQRRLRILNLAL+  T +AD+F+CCDLDA
Sbjct  887   KSISIEIKHDDKLAPEENVYLQVALLYTSCSGQRRLRILNLALRVTTTIADVFKCCDLDA  946

Query  1013  MVLFFAKQIIFKLVETPPKAVKDSLEARCAQILACYRKNCASPTSAGQLILPECMKLLPL  1072
             M+LFFAKQ  FKL+E  PK VKD+L  R AQILACYRK+C SPTSAGQLILPEC+KLLPL
Sbjct  947   MMLFFAKQACFKLMEHSPKQVKDNLIHRSAQILACYRKHCTSPTSAGQLILPECLKLLPL  1006

Query  1073  YASCLMKNDAISGGSDMTCDDRSYVMQFVSIMDLPMSVSYFYPRLIPIHDVDVNDTDVPS  1132
             YASCL+KNDAISGGSDMT DDRSYV+QF+  MDL  SVSY YPR IPIH+V   +TD+P+
Sbjct  1007  YASCLLKNDAISGGSDMTLDDRSYVIQFILSMDLNQSVSYLYPRFIPIHNVVPEETDLPT  1066

Query  1133  PIRTTIEKMCDDGAYILENGIHMFIWLGLSLAPEFTQSVFGAPSSQQIDTDRCGVPVFDN  1192
             P+R T EK  +DGAYILENG+H+F+WLG +L+P+F QSVFG    QQI  +R  + V + 
Sbjct  1067  PVRCTHEKTQEDGAYILENGVHLFVWLGQALSPDFVQSVFGVQGLQQIALERFNI-VPET  1125

Query  1193  PLSQRIRDIIDSIQAERPRTMRITLVRQRDKLEGVLRHFLIEDRGTHGAPSYVDYLCYLH  1252
             PL++RI  I++ I  ER R MRIT +RQ DKLE V RHFL+EDRGT G+ SYVD+LC++H
Sbjct  1126  PLAKRIHGILEQIMKERSRYMRITWLRQNDKLESVFRHFLVEDRGTDGSASYVDFLCHMH  1185

Query  1253  KEIRSLLS  1260
             KEI+ LLS
Sbjct  1186  KEIKDLLS  1193


>Q9VQ94_DROME unnamed protein product
Length=1193

 Score = 1230 bits (3183),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 568/788 (72%), Positives = 671/788 (85%), Gaps = 1/788 (0%)

Query  473   PGNFPQAQAQQQQRRLDPDQMPNPIQVMAENQRAMTGPFVTSQPGLVPPLVTTKSITQDQ  532
             PG     Q   Q RRLDPDQMPNPIQVM ENQR   GPFVT+QPGL+PPLVTTK +  DQ
Sbjct  407   PGAGNMYQQAPQARRLDPDQMPNPIQVMIENQRLSGGPFVTNQPGLLPPLVTTKFVVHDQ  466

Query  533   GNSGPRFIRSTMYNVPATADMMKQTAVPFALIISPYAKTLEGEIVPPIVNFGEVGPIRCI  592
             GNS PRF+RS++Y +P T D++K TA+P  L ISP AK  EGE+ PPIVNFGE+GPIRC 
Sbjct  467   GNSSPRFLRSSLYCIPNTGDLLKTTALPLTLNISPLAKVGEGEMEPPIVNFGEMGPIRCN  526

Query  593   RCKGYMSPNMQFIDAGRRFQCLLCKATTEVPQEYFQHLDHTGQRTDKYERPELVLGTYEF  652
             RCK YMSPNMQF+DAGRRFQCL+CK T+EV Q Y+QHLDHTGQR DK+ERPEL+LGTYEF
Sbjct  527   RCKAYMSPNMQFVDAGRRFQCLMCKVTSEVHQNYYQHLDHTGQRVDKHERPELLLGTYEF  586

Query  653   VATKDYCRNNKPPNPPAMIFVIDVSYNNIKSGLVHLLCSEMKRIIRNLPIDQGMDRSAMK  712
             +ATKDYCRNN PP  PA IF+IDVSYN +KSGLVHLLCS++K I+++LP+DQG D+S ++
Sbjct  587   LATKDYCRNNTPPEVPAFIFIIDVSYNTVKSGLVHLLCSQIKNILKHLPVDQGQDKSKVR  646

Query  713   VGFITYNNTVHFYNCKSNLAQPQMMVVGDVHEMFMPLLDGFLCDPEESGAVIDSLMEQIP  772
             VGFITYN+TVHFYN KS+LAQPQMMVVGDV EMFMPLLDGFLC PEES AVID+LME+IP
Sbjct  647   VGFITYNSTVHFYNIKSSLAQPQMMVVGDVQEMFMPLLDGFLCHPEESAAVIDALMEEIP  706

Query  773   AMFGETRETETILLPAIQAGLEALKASECAGKIIVLHSSLPIADAPGKLKNRDDRNVLGT  832
              MF +T+ETETIL PAIQAGLEALKAS  AGK++V +S+LPIA+APGKLKNRDDR +LGT
Sbjct  707   RMFADTKETETILYPAIQAGLEALKASNAAGKLLVFNSTLPIAEAPGKLKNRDDRKLLGT  766

Query  833   EKEKTVLTPQTNVYNNLGQECVQAGCAVDLFIFNNSYVDLATIGQICRLTGGEIYKYTYF  892
             +KEKTVLTPQT  YN LGQECVQ GC+VDLF+FNN+Y+DLATIGQ+ RLTGGE++KYTYF
Sbjct  767   DKEKTVLTPQTTAYNTLGQECVQQGCSVDLFVFNNAYIDLATIGQVSRLTGGEVFKYTYF  826

Query  893   QADMDGHRVVNDLIKNISRPIAFDSVMRVRTSTGVRPTDFYGHFFMSNTTDMEIGAIDCD  952
             QAD+DG R++ D+IKN+SRPIAFD+VMRVRTS G+RPT+FYGHFFMSNTTD+E+ +ID  
Sbjct  827   QADVDGKRLIQDIIKNVSRPIAFDAVMRVRTSAGIRPTEFYGHFFMSNTTDVELASIDAT  886

Query  953   KSIAIEVKHDDKLAPEDNVYIQVALLYTSCSGQRRLRILNLALKTCTQMADLFRCCDLDA  1012
             KSI+IE+KHDDKLAPE+NVY+QVALLYTSCSGQRRLRILNLAL+  T +AD+F+CCDLDA
Sbjct  887   KSISIEIKHDDKLAPEENVYLQVALLYTSCSGQRRLRILNLALRVTTTIADVFKCCDLDA  946

Query  1013  MVLFFAKQIIFKLVETPPKAVKDSLEARCAQILACYRKNCASPTSAGQLILPECMKLLPL  1072
             M+LFFAKQ  FKL+E  PK VKD+L  R AQILACYRK+C SPTSAGQLILPEC+KLLPL
Sbjct  947   MMLFFAKQACFKLMEHSPKQVKDNLIHRSAQILACYRKHCTSPTSAGQLILPECLKLLPL  1006

Query  1073  YASCLMKNDAISGGSDMTCDDRSYVMQFVSIMDLPMSVSYFYPRLIPIHDVDVNDTDVPS  1132
             YASCL+KNDAISGGSDMT DDRSYV+QF+  MDL  SVSY YPR IPIH+V   +TD+P+
Sbjct  1007  YASCLLKNDAISGGSDMTLDDRSYVIQFILSMDLNQSVSYLYPRFIPIHNVVPEETDLPT  1066

Query  1133  PIRTTIEKMCDDGAYILENGIHMFIWLGLSLAPEFTQSVFGAPSSQQIDTDRCGVPVFDN  1192
             P+R T EK  +DGAYILENG+H+F+WLG +L+P+F QSVFG    QQI  +R  + V + 
Sbjct  1067  PVRCTHEKTQEDGAYILENGVHLFVWLGQALSPDFVQSVFGVQGLQQIALERFNI-VPET  1125

Query  1193  PLSQRIRDIIDSIQAERPRTMRITLVRQRDKLEGVLRHFLIEDRGTHGAPSYVDYLCYLH  1252
             PL++RI  I++ I  ER R MRIT +RQ DKLE V RHFL+EDRGT G+ SYVD+LC++H
Sbjct  1126  PLAKRIHGILEQIMKERSRYMRITWLRQNDKLESVFRHFLVEDRGTDGSASYVDFLCHMH  1185

Query  1253  KEIRSLLS  1260
             KEI+ LLS
Sbjct  1186  KEIKDLLS  1193


>C0H5J6_PLAF7 unnamed protein product
Length=940

 Score = 342 bits (877),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 239/863 (28%), Positives = 421/863 (49%), Gaps = 80/863 (9%)

Query  443   MQQQPMQPGAYPGMQPQQRNFNSNQGMYNPPGNFPQAQAQQQQ--RRLDPDQMPNPIQVM  500
             + Q     G Y   Q   +  N  + MYN  G+   +   Q Q  R +    +P      
Sbjct  76    LHQGYQHSGVYGMNQGNYKTNNIGENMYNQDGHNNTSYINQGQPYRNVTSQFIPVSSNNT  135

Query  501   AENQRAMTGPFVTSQPGLVPPLVTTKSITQDQGNSGPRFIRSTMYNVPATADMMKQTAVP  560
              +    M G         V P++        Q N+   F++S++  +PA   + ++  VP
Sbjct  136   LKAGGNMLGYDNMGNINHVQPIINDTYQEFLQFNAFSHFVKSSVSYMPANTTLKQKAYVP  195

Query  561   FALIISPYAKTLEGEIVPPIVNFGEVGPIRCIRCKGYMSPNMQFIDAGRRFQCLLCKATT  620
                +I P A   +G      VNFG    +RC +C+ Y++P ++F   G+++ C +C    
Sbjct  196   LGFVIQPLAPIPDGYPELASVNFGNSTVVRCKKCRTYINPFVRFEAGGKKWNCNMCYNIN  255

Query  621   EVPQEYFQHLDHTGQRTDKYERPELVLGTYEFVATKDYCRNNKPPNPPAMIFVIDVSYNN  680
             + PQ YF  LD  G+R D ++RPEL  G+ EF+A  DY    +PP P   +F+IDV+  +
Sbjct  256   DTPQFYFVPLDEKGKRKDLFQRPELCTGSVEFIAPSDYMI--RPPQPSVYLFLIDVTVTS  313

Query  681   IKSGLVHLLCSEMKRII--RNLPID-------------------QGMDRSAMKVGFITYN  719
             + SGL+ ++CS +K ++   N   +                   +  D   + +G +T++
Sbjct  314   VNSGLLDVVCSTIKSLLPKNNDSTENNNQNDNNNNNNNNNSKNLKSFDSRTL-IGIMTFD  372

Query  720   NTVHFYNCKSNLAQPQMMVVGDVHEMFMPLLDGFLCDPEESGAVIDSLMEQIPAMFGETR  779
             +T+HFYN  SNL Q QMMVV D+ ++F+PL +  L +  E   VID L++ +P M+   +
Sbjct  373   STIHFYNLNSNLKQTQMMVVPDIQDIFIPLPEDILVNVHECQNVIDVLLDNLPGMWRNNK  432

Query  780   ETETILLPAIQAGLEALKASECAGKIIVLHSSLP-IADAPGKLKNRDDR-----------  827
              ++     A++A    LK  +  GK++   SS+P I D    + NRD++           
Sbjct  433   ISDCCAGNALKAAFMVLK--KVGGKLLFFLSSVPNIGDLTVSV-NRDNKDKSKYKNIYSS  489

Query  828   -----NVLGTE-KEKTVLTPQTNVYNNLGQECVQAGCAVDLF---IFNNSYVDLATIGQI  878
                  NV+ ++ +E  +L P  N+Y  L Q   Q   AVDLF   ++N   +DLA+I  +
Sbjct  490   SSSGNNVVDSKLREVELLNPCNNLYAELAQNITQYQIAVDLFACPLYN---LDLASIYPL  546

Query  879   CRLTGGEIYKYTYFQADMDGHRVVNDLIKNISRPIAFDSVMRVRTSTGVRPTDFYGHFFM  938
              + +GG +Y Y  F       ++  +L+  ++   A++SVMR+R S G + T++YG++  
Sbjct  547   IKNSGGSLYYYPQFNVHQYNDKLRQELLFALTTETAWESVMRIRISRGWKITNWYGNYQF  606

Query  939   SNTTDMEIGAIDCDKSIAIEVKHDDKLAPEDNVYIQVALLYTSCSGQRRLRILNLALKTC  998
                  + +      ++ +I V  ++ +  +  VY+Q ALLYT+ +G+RR+R+   AL   
Sbjct  607   RGADLLALPNCHSGQNFSIIVDLEENVVQDSIVYVQSALLYTNSNGERRIRLHTYALPIT  666

Query  999   TQMADLFRCCDLDAMVLFFAKQIIFKLVETPPKAVKDSLEARCAQILACYRKNCASPTSA  1058
               +  +    +   +V   A Q I    +      ++ ++  C+Q+L            +
Sbjct  667   QNIKTITDSINPQVVVSLLAHQSIDISKKGKIADGRNLIQNLCSQVL------------S  714

Query  1059  GQLILPECMKLLPLYASCLMKNDAISGGSDMTCDDRSYVMQFVSIMDLPMSV--SYFYPR  1116
              QL+  EC +LL LY   ++K+ A     D+  D R Y   +  + ++P+    + FYPR
Sbjct  715   SQLLQSECARLLSLYILGMLKSIAFRDSGDVPPDLRIY--HWYRLENIPVESVEANFYPR  772

Query  1117  LIPIHDVDV--------NDTDVPSPIRTTIEKMCDDGAYILENGIHMFIWLGLSLAPEFT  1168
             +  +H+++         N+   P  +  T E M  DG YI+E+G  + +W+G S+ P++ 
Sbjct  773   MFSLHNLEKHHGHLDENNNIVFPDALNLTCENMTQDGCYIVEDGETIVMWIGRSINPQWI  832

Query  1169  QSVFGAPSSQQIDTDRC--GVPVFDNPLSQRIRDIIDSIQAER-PRTMRITLVRQRDKLE  1225
              +VFG  +  Q++T+     +    NP   +I +II++++  R P  M++ +V+Q D LE
Sbjct  833   YAVFGVQTIDQLNTEYAENHLGSTGNPFGVQILNIINALRKIRTPCYMKLLVVKQGDPLE  892

Query  1226  GVLRHFLIEDRGTHGAPSYVDYL  1248
                  +LIEDR  H   S  ++L
Sbjct  893   YKFFSYLIEDRSQHMMLSLKEFL  915



Lambda      K        H
   0.317    0.133    0.388 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 57319460198


Query= XP_037024188.1 RNA-binding protein 5-B-like isoform X1 [Bradysia
coprophila]

Length=871
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VPY4_DROME  unnamed protein product                                 686     0.0  
Q8SZM4_DROME  unnamed protein product                                 685     0.0  
Q582H9_TRYB2  unnamed protein product                                 42.4    9e-04


>Q9VPY4_DROME unnamed protein product
Length=1004

 Score = 686 bits (1769),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/952 (47%), Positives = 558/952 (59%), Gaps = 150/952 (16%)

Query  3     RRSRSPDSRHRRRD-----------HRRRSRSR-SRDRS---RD---RRRRSRSRSRPRY  44
             RR  S D RHR RD           + +RSR   SRDRS   RD    R RSR  SRP  
Sbjct  115   RRHDSFDRRHRDRDGESDRELNDYEYEQRSRDLDSRDRSSTDRDWYHNRSRSREHSRPWN  174

Query  45    RRNSPDLYKDLIDQDYQNDRDRFRGDRDRRDRHHRRHQSTDEAY----------------  88
             R N+ D            DR R   +R+ R R HR +      +                
Sbjct  175   RNNNHD------------DRSR-SNERNTRHRDHRMYNGGGSNHNRDRDRDRDREQDRER  221

Query  89    ------LEEINSNDSFDSDQ--VNSEHYRNQVPS-NKIIILGLAQHITETDINNDLIHYG  139
                     E   +  +DSD+  +    YR+   + N III GL + +T  DI ++LI   
Sbjct  222   DRDRDRDRERRGSSDYDSDEGHMRRNKYRSTTEALNIIIIFGLTKEMTRADIMSELIKVN  281

Query  140   LQPVSIRLIRKRKTGASRGFAFVEFNTEEEARSWMEYKQGVLMVQDQYRSVMQYSVSREP  199
             ++P  IR+IRK+ T +SRG AFVEFNT EEA+ WM+  QGVL + D+ R  M+YS  R  
Sbjct  282   MEPACIRIIRKQGTDSSRGIAFVEFNTVEEAKQWMDITQGVLKLNDE-RVSMRYSHKR--  338

Query  200   LGKEKVATDWYCAKCGVFNFKRRENCFKCYASREESE----KGGEGSDEVSNILTKKIML  255
                     DW C KCGV NFK R  CF C  SRE+SE     G EG DEVS ILTKKIML
Sbjct  339   ------IQDWNCNKCGVCNFKFRFYCFVCKTSREDSETTFSSGSEGVDEVSTILTKKIML  392

Query  256   RNLDVLTNEEGVLTVMQEVVPSLVSKISKILICKDPLTCTSRGICYLSFENLVDSMSFHN  315
             RNLD LTNEE VLT +Q  +  L   +SK+LI +D LT  SRGICYL F+ LVDSM+ HN
Sbjct  393   RNLDALTNEEAVLTALQLHLKDLSKTVSKVLISRDSLTQASRGICYLHFDTLVDSMNVHN  452

Query  316   ALKAIEPALNIEDREVLVSYCVDSENKQI----NKSVASKPSHSDGPTVSSYSNT---HQ  368
             AL A++P L ++DR V ++YC+D E +Q      K +A K S  +   +S+ S +     
Sbjct  453   ALTALDPPLTLDDRVVAITYCIDLEEQQALPKNPKELAVKDSTVNSGNISAVSPSGLGGN  512

Query  369   YTLADVPRLAEYSASVYASNSAEHDHYYKYYTDYYIAQITNGHYNNLPTMGETANSGAAV  428
             YTLADVPRLAEYSAS+YASN AEH +Y +YYT+YY A I     NN  +    ANSGAAV
Sbjct  513   YTLADVPRLAEYSASLYASNPAEHAYYVQYYTEYYTADINK---NNRDSHLTEANSGAAV  569

Query  429   AMSAIQRKQKQQNKVSSSQAP----------------VTQPIQIPTGLDNKKYPAPDVFQ  472
             A+SAIQRKQK+ + + ++                     Q    P G D K YP PDV Q
Sbjct  570   ALSAIQRKQKKMSSIETTITAAATAAAQAAAQVKATLAAQVASAPKGNDGKIYPTPDVTQ  629

Query  473   YQYDESSGFYYDSSTGLYYDSSSQYYYNGESGAYLYWNAEKSTYTIAATTPSTPAEATKS  532
             YQYDE+SG+YYDS+TGLYY++ SQYYYN E+GAYLYW+  +STY +A  TP++   A + 
Sbjct  630   YQYDETSGYYYDSTTGLYYNAHSQYYYNNETGAYLYWDQRRSTYVLA--TPASTQAALQE  687

Query  533   TSGQSKNSDQNTSNQTTGVPTAVSDLMNDSTTKASEDRKKDPKQDKVKVAKKIVKDMEKW  592
                                  A ++   +  +K +++++   K DKVKVAKKIVKDMEKW
Sbjct  688   V-------------------LADAEQKGEEESKKAKEKEGGNKHDKVKVAKKIVKDMEKW  728

Query  593   AKQLNQKKDLNVVQAAPAPVRQEEEPIKVNRTGNGGYADVGFSILENKERSKISMDMGSR  652
             AKQLNQKKD   V A P P+   E     +R   GGYADVGFSILE KER K++      
Sbjct  729   AKQLNQKKDYTAV-ATPQPILANEVAT-TSRGNQGGYADVGFSILEKKERGKLN------  780

Query  653   GGAASIGTPPPPQIA---KLVSTYGSDSDNE-------QNEKPADVMS------EKDYID  696
                      P P +    KLV+ YG  SD+E       QN + + V+S      E DY+D
Sbjct  781   ------DYAPNPTVGPMNKLVNAYGGTSDSEEDNAASSQNTQSSAVVSGGGGAEESDYVD  834

Query  697   FAKLTCLLCKRAFSDAEILNKHLKMSNLHKENLQKYNLLHGKLDDINASGLSYRDRAKER  756
             F KLTCLLCKRAF   EIL KHLKMS LHKENL K   L+          L+YRDRAKER
Sbjct  835   FHKLTCLLCKRAFQSLEILQKHLKMSTLHKENLAK---LNQNTSSSIEEALAYRDRAKER  891

Query  757   RLKYGESDPPPVNRSRERFEKELEKQKSAIQVQASGNLASQPISSNNVGNRLLQKMGWSE  816
             RLKYGESDPPP NRSRERFE+E++  +S  Q Q++    + PISS+NVG+RLLQKMGWSE
Sbjct  892   RLKYGESDPPPPNRSRERFEQEIKTLQSR-QKQSTSATPAMPISSSNVGSRLLQKMGWSE  950

Query  817   GQGLGRTNQGRTNIIEAESRAPTAGLGTKTTNFGPGDDYKSYIKRMMKSRYE  868
             GQGLGR NQGRT IIEA+ R+   GLG K+    PG+DYKSYIK+MMK RYE
Sbjct  951   GQGLGRKNQGRTQIIEADGRSNYVGLGNKSGQMIPGNDYKSYIKKMMKQRYE  1002


>Q8SZM4_DROME unnamed protein product
Length=1004

 Score = 685 bits (1767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/952 (47%), Positives = 558/952 (59%), Gaps = 150/952 (16%)

Query  3     RRSRSPDSRHRRRD-----------HRRRSRSR-SRDRS---RD---RRRRSRSRSRPRY  44
             RR  S D RHR RD           + +RSR   SRDRS   RD    R RSR  SRP  
Sbjct  115   RRHDSFDRRHRDRDGESDRELNDYEYEQRSRDLDSRDRSSTDRDWYHNRSRSREHSRPWN  174

Query  45    RRNSPDLYKDLIDQDYQNDRDRFRGDRDRRDRHHRRHQSTDEAY----------------  88
             R N+ D            DR R   +R+ R R HR +      +                
Sbjct  175   RNNNHD------------DRSR-SNERNTRHRDHRMYNGGGSNHNRDRDRDRDREQDRER  221

Query  89    ------LEEINSNDSFDSDQ--VNSEHYRNQVPS-NKIIILGLAQHITETDINNDLIHYG  139
                     E   +  +DSD+  +    YR+   + N III GL + +T  DI ++LI   
Sbjct  222   DRDRDRDRERRGSSDYDSDEGHMRRNKYRSTTEALNIIIIFGLTKEMTRADIMSELIKVN  281

Query  140   LQPVSIRLIRKRKTGASRGFAFVEFNTEEEARSWMEYKQGVLMVQDQYRSVMQYSVSREP  199
             ++P  IR+IRK+ T +SRG AFVEFNT EEA+ WM+  QGVL + D+ R  M+YS  R  
Sbjct  282   MEPACIRIIRKQGTDSSRGIAFVEFNTVEEAKQWMDITQGVLKLNDE-RVSMRYSHKR--  338

Query  200   LGKEKVATDWYCAKCGVFNFKRRENCFKCYASREESE----KGGEGSDEVSNILTKKIML  255
                     DW C KCGV NFK R  CF C  SRE+SE     G EG DEVS ILTKKIML
Sbjct  339   ------IQDWNCYKCGVCNFKFRFYCFVCKTSREDSETTFSSGSEGVDEVSTILTKKIML  392

Query  256   RNLDVLTNEEGVLTVMQEVVPSLVSKISKILICKDPLTCTSRGICYLSFENLVDSMSFHN  315
             RNLD LTNEE VLT +Q  +  L   +SK+LI +D LT  SRGICYL F+ LVDSM+ HN
Sbjct  393   RNLDALTNEEAVLTALQLHLKDLSKTVSKVLISRDSLTQASRGICYLHFDTLVDSMNVHN  452

Query  316   ALKAIEPALNIEDREVLVSYCVDSENKQI----NKSVASKPSHSDGPTVSSYSNT---HQ  368
             AL A++P L ++DR V ++YC+D E +Q      K +A K S  +   +S+ S +     
Sbjct  453   ALTALDPPLTLDDRVVAITYCIDLEEQQALPKNPKELAVKDSTVNSGNISAVSPSGLGGN  512

Query  369   YTLADVPRLAEYSASVYASNSAEHDHYYKYYTDYYIAQITNGHYNNLPTMGETANSGAAV  428
             YTLADVPRLAEYSAS+YASN AEH +Y +YYT+YY A I     NN  +    ANSGAAV
Sbjct  513   YTLADVPRLAEYSASLYASNPAEHAYYVQYYTEYYTADINK---NNRDSHLTEANSGAAV  569

Query  429   AMSAIQRKQKQQNKVSSSQAP----------------VTQPIQIPTGLDNKKYPAPDVFQ  472
             A+SAIQRKQK+ + + ++                     Q    P G D K YP PDV Q
Sbjct  570   ALSAIQRKQKKMSSIETTITAAATAAAQAAAQVKATLAAQVASAPKGNDGKIYPTPDVTQ  629

Query  473   YQYDESSGFYYDSSTGLYYDSSSQYYYNGESGAYLYWNAEKSTYTIAATTPSTPAEATKS  532
             YQYDE+SG+YYDS+TGLYY++ SQYYYN E+GAYLYW+  +STY +A  TP++   A + 
Sbjct  630   YQYDETSGYYYDSTTGLYYNAHSQYYYNNETGAYLYWDQRRSTYVLA--TPASTQAALQE  687

Query  533   TSGQSKNSDQNTSNQTTGVPTAVSDLMNDSTTKASEDRKKDPKQDKVKVAKKIVKDMEKW  592
                                  A ++   +  +K +++++   K DKVKVAKKIVKDMEKW
Sbjct  688   V-------------------LADAEQKGEEESKKAKEKEGGNKHDKVKVAKKIVKDMEKW  728

Query  593   AKQLNQKKDLNVVQAAPAPVRQEEEPIKVNRTGNGGYADVGFSILENKERSKISMDMGSR  652
             AKQLNQKKD   V A P P+   E     +R   GGYADVGFSILE KER K++      
Sbjct  729   AKQLNQKKDYTAV-ATPQPILANEVAT-TSRGNQGGYADVGFSILEKKERGKLN------  780

Query  653   GGAASIGTPPPPQIA---KLVSTYGSDSDNE-------QNEKPADVMS------EKDYID  696
                      P P +    KLV+ YG  SD+E       QN + + V+S      E DY+D
Sbjct  781   ------DYAPNPTVGPMNKLVNAYGGTSDSEEDNAASSQNTQSSAVVSGGGGAEESDYVD  834

Query  697   FAKLTCLLCKRAFSDAEILNKHLKMSNLHKENLQKYNLLHGKLDDINASGLSYRDRAKER  756
             F KLTCLLCKRAF   E+L KHLKMS LHKENL K   L+          L+YRDRAKER
Sbjct  835   FHKLTCLLCKRAFQSLEVLQKHLKMSTLHKENLAK---LNQNTSSSIEEALAYRDRAKER  891

Query  757   RLKYGESDPPPVNRSRERFEKELEKQKSAIQVQASGNLASQPISSNNVGNRLLQKMGWSE  816
             RLKYGESDPPP NRSRERFE+E++  +S  Q Q++    + PISS+NVG+RLLQKMGWSE
Sbjct  892   RLKYGESDPPPPNRSRERFEQEIKTLQSR-QKQSTSATPAMPISSSNVGSRLLQKMGWSE  950

Query  817   GQGLGRTNQGRTNIIEAESRAPTAGLGTKTTNFGPGDDYKSYIKRMMKSRYE  868
             GQGLGR NQGRT IIEA+ R+   GLG K+    PG+DYKSYIK+MMK RYE
Sbjct  951   GQGLGRKNQGRTQIIEADGRSNYVGLGNKSGQMIPGNDYKSYIKKMMKQRYE  1002


>Q582H9_TRYB2 unnamed protein product
Length=271

 Score = 42.4 bits (98),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 26/44 (59%), Gaps = 0/44 (0%)

Query  800  SSNNVGNRLLQKMGWSEGQGLGRTNQGRTNIIEAESRAPTAGLG  843
            S NNVG  LL + GW+EG GLG+   G T  ++   +  T G+G
Sbjct  13   SENNVGRSLLLRGGWTEGSGLGKEKDGVTTHVKVRQKDGTMGIG  56



Lambda      K        H
   0.317    0.133    0.388 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 57319460198


Query= XP_037024189.1 RNA-binding protein 5-B-like isoform X2 [Bradysia
coprophila]

Length=870
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VPY4_DROME  unnamed protein product                                 686     0.0  
Q8SZM4_DROME  unnamed protein product                                 685     0.0  
Q582H9_TRYB2  unnamed protein product                                 42.4    9e-04


>Q9VPY4_DROME unnamed protein product
Length=1004

 Score = 686 bits (1770),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/952 (47%), Positives = 558/952 (59%), Gaps = 150/952 (16%)

Query  3     RRSRSPDSRHRRRD-----------HRRRSRSR-SRDRS---RD---RRRRSRSRSRPRY  44
             RR  S D RHR RD           + +RSR   SRDRS   RD    R RSR  SRP  
Sbjct  115   RRHDSFDRRHRDRDGESDRELNDYEYEQRSRDLDSRDRSSTDRDWYHNRSRSREHSRPWN  174

Query  45    RRNSPDLYKDLIDQDYQNDRDRFRGDRDRRDRHHRRHQSTDEAY----------------  88
             R N+ D            DR R   +R+ R R HR +      +                
Sbjct  175   RNNNHD------------DRSR-SNERNTRHRDHRMYNGGGSNHNRDRDRDRDREQDRER  221

Query  89    ------LEEINSNDSFDSDQ--VNSEHYRNQVPS-NKIIILGLAQHITETDINNDLIHYG  139
                     E   +  +DSD+  +    YR+   + N III GL + +T  DI ++LI   
Sbjct  222   DRDRDRDRERRGSSDYDSDEGHMRRNKYRSTTEALNIIIIFGLTKEMTRADIMSELIKVN  281

Query  140   LQPVSIRLIRKRKTGASRGFAFVEFNTEEEARSWMEYKQGVLMVQDQYRSVMQYSVSREP  199
             ++P  IR+IRK+ T +SRG AFVEFNT EEA+ WM+  QGVL + D+ R  M+YS  R  
Sbjct  282   MEPACIRIIRKQGTDSSRGIAFVEFNTVEEAKQWMDITQGVLKLNDE-RVSMRYSHKR--  338

Query  200   LGKEKVATDWYCAKCGVFNFKRRENCFKCYASREESE----KGGEGSDEVSNILTKKIML  255
                     DW C KCGV NFK R  CF C  SRE+SE     G EG DEVS ILTKKIML
Sbjct  339   ------IQDWNCNKCGVCNFKFRFYCFVCKTSREDSETTFSSGSEGVDEVSTILTKKIML  392

Query  256   RNLDVLTNEEGVLTVMQEVVPSLVSKISKILICKDPLTCTSRGICYLSFENLVDSMSFHN  315
             RNLD LTNEE VLT +Q  +  L   +SK+LI +D LT  SRGICYL F+ LVDSM+ HN
Sbjct  393   RNLDALTNEEAVLTALQLHLKDLSKTVSKVLISRDSLTQASRGICYLHFDTLVDSMNVHN  452

Query  316   ALKAIEPALNIEDREVLVSYCVDSENKQI----NKSVASKPSHSDGPTVSSYSNT---HQ  368
             AL A++P L ++DR V ++YC+D E +Q      K +A K S  +   +S+ S +     
Sbjct  453   ALTALDPPLTLDDRVVAITYCIDLEEQQALPKNPKELAVKDSTVNSGNISAVSPSGLGGN  512

Query  369   YTLADVPRLAEYSASVYASNSAEHDHYYKYYTDYYIAQITNGHYNNLPTMGETANSGAAV  428
             YTLADVPRLAEYSAS+YASN AEH +Y +YYT+YY A I     NN  +    ANSGAAV
Sbjct  513   YTLADVPRLAEYSASLYASNPAEHAYYVQYYTEYYTADINK---NNRDSHLTEANSGAAV  569

Query  429   AMSAIQRKQKQQNKVSSSQAP----------------VTQPIQIPTGLDNKKYPAPDVFQ  472
             A+SAIQRKQK+ + + ++                     Q    P G D K YP PDV Q
Sbjct  570   ALSAIQRKQKKMSSIETTITAAATAAAQAAAQVKATLAAQVASAPKGNDGKIYPTPDVTQ  629

Query  473   YQYDESSGFYYDSSTGLYYDSSSQYYYNGESGAYLYWNAEKSTYTIAATTPSTPAEATKS  532
             YQYDE+SG+YYDS+TGLYY++ SQYYYN E+GAYLYW+  +STY +A  TP++   A + 
Sbjct  630   YQYDETSGYYYDSTTGLYYNAHSQYYYNNETGAYLYWDQRRSTYVLA--TPASTQAALQE  687

Query  533   TSGQSKNSDQNTSNQTTGVPTAVSDLMNDSTTKASEDRKKDPKQDKVKVAKKIVKDMEKW  592
                                  A ++   +  +K +++++   K DKVKVAKKIVKDMEKW
Sbjct  688   V-------------------LADAEQKGEEESKKAKEKEGGNKHDKVKVAKKIVKDMEKW  728

Query  593   AKQLNQKKDLNVVQAAPAPVRQEEEPIKVNRTGNGGYADVGFSILENKERSKISMDMGSR  652
             AKQLNQKKD   V A P P+   E     +R   GGYADVGFSILE KER K++      
Sbjct  729   AKQLNQKKDYTAV-ATPQPILANEVAT-TSRGNQGGYADVGFSILEKKERGKLN------  780

Query  653   GGAASIGTPPPPQIA---KLVSTYGSDSDNE-------QNEKPADVMS------EKDYID  696
                      P P +    KLV+ YG  SD+E       QN + + V+S      E DY+D
Sbjct  781   ------DYAPNPTVGPMNKLVNAYGGTSDSEEDNAASSQNTQSSAVVSGGGGAEESDYVD  834

Query  697   FAKLTCLLCKRAFSDAEILNKHLKMSNLHKENLQKYNLLHGKLDDINASGLSYRDRAKER  756
             F KLTCLLCKRAF   EIL KHLKMS LHKENL K   L+          L+YRDRAKER
Sbjct  835   FHKLTCLLCKRAFQSLEILQKHLKMSTLHKENLAK---LNQNTSSSIEEALAYRDRAKER  891

Query  757   RLKYGESDPPPVNRSRERFEKELEKQKSAIQVQASGNLASQPISSNNVGNRLLQKMGWSE  816
             RLKYGESDPPP NRSRERFE+E++  +S  Q Q++    + PISS+NVG+RLLQKMGWSE
Sbjct  892   RLKYGESDPPPPNRSRERFEQEIKTLQSR-QKQSTSATPAMPISSSNVGSRLLQKMGWSE  950

Query  817   GQGLGRTNQGRTNIIEAESRAPTAGLGTKTTNFGPGDDYKSYIKRMMKSRYE  868
             GQGLGR NQGRT IIEA+ R+   GLG K+    PG+DYKSYIK+MMK RYE
Sbjct  951   GQGLGRKNQGRTQIIEADGRSNYVGLGNKSGQMIPGNDYKSYIKKMMKQRYE  1002


>Q8SZM4_DROME unnamed protein product
Length=1004

 Score = 685 bits (1767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/952 (47%), Positives = 558/952 (59%), Gaps = 150/952 (16%)

Query  3     RRSRSPDSRHRRRD-----------HRRRSRSR-SRDRS---RD---RRRRSRSRSRPRY  44
             RR  S D RHR RD           + +RSR   SRDRS   RD    R RSR  SRP  
Sbjct  115   RRHDSFDRRHRDRDGESDRELNDYEYEQRSRDLDSRDRSSTDRDWYHNRSRSREHSRPWN  174

Query  45    RRNSPDLYKDLIDQDYQNDRDRFRGDRDRRDRHHRRHQSTDEAY----------------  88
             R N+ D            DR R   +R+ R R HR +      +                
Sbjct  175   RNNNHD------------DRSR-SNERNTRHRDHRMYNGGGSNHNRDRDRDRDREQDRER  221

Query  89    ------LEEINSNDSFDSDQ--VNSEHYRNQVPS-NKIIILGLAQHITETDINNDLIHYG  139
                     E   +  +DSD+  +    YR+   + N III GL + +T  DI ++LI   
Sbjct  222   DRDRDRDRERRGSSDYDSDEGHMRRNKYRSTTEALNIIIIFGLTKEMTRADIMSELIKVN  281

Query  140   LQPVSIRLIRKRKTGASRGFAFVEFNTEEEARSWMEYKQGVLMVQDQYRSVMQYSVSREP  199
             ++P  IR+IRK+ T +SRG AFVEFNT EEA+ WM+  QGVL + D+ R  M+YS  R  
Sbjct  282   MEPACIRIIRKQGTDSSRGIAFVEFNTVEEAKQWMDITQGVLKLNDE-RVSMRYSHKR--  338

Query  200   LGKEKVATDWYCAKCGVFNFKRRENCFKCYASREESE----KGGEGSDEVSNILTKKIML  255
                     DW C KCGV NFK R  CF C  SRE+SE     G EG DEVS ILTKKIML
Sbjct  339   ------IQDWNCYKCGVCNFKFRFYCFVCKTSREDSETTFSSGSEGVDEVSTILTKKIML  392

Query  256   RNLDVLTNEEGVLTVMQEVVPSLVSKISKILICKDPLTCTSRGICYLSFENLVDSMSFHN  315
             RNLD LTNEE VLT +Q  +  L   +SK+LI +D LT  SRGICYL F+ LVDSM+ HN
Sbjct  393   RNLDALTNEEAVLTALQLHLKDLSKTVSKVLISRDSLTQASRGICYLHFDTLVDSMNVHN  452

Query  316   ALKAIEPALNIEDREVLVSYCVDSENKQI----NKSVASKPSHSDGPTVSSYSNT---HQ  368
             AL A++P L ++DR V ++YC+D E +Q      K +A K S  +   +S+ S +     
Sbjct  453   ALTALDPPLTLDDRVVAITYCIDLEEQQALPKNPKELAVKDSTVNSGNISAVSPSGLGGN  512

Query  369   YTLADVPRLAEYSASVYASNSAEHDHYYKYYTDYYIAQITNGHYNNLPTMGETANSGAAV  428
             YTLADVPRLAEYSAS+YASN AEH +Y +YYT+YY A I     NN  +    ANSGAAV
Sbjct  513   YTLADVPRLAEYSASLYASNPAEHAYYVQYYTEYYTADINK---NNRDSHLTEANSGAAV  569

Query  429   AMSAIQRKQKQQNKVSSSQAP----------------VTQPIQIPTGLDNKKYPAPDVFQ  472
             A+SAIQRKQK+ + + ++                     Q    P G D K YP PDV Q
Sbjct  570   ALSAIQRKQKKMSSIETTITAAATAAAQAAAQVKATLAAQVASAPKGNDGKIYPTPDVTQ  629

Query  473   YQYDESSGFYYDSSTGLYYDSSSQYYYNGESGAYLYWNAEKSTYTIAATTPSTPAEATKS  532
             YQYDE+SG+YYDS+TGLYY++ SQYYYN E+GAYLYW+  +STY +A  TP++   A + 
Sbjct  630   YQYDETSGYYYDSTTGLYYNAHSQYYYNNETGAYLYWDQRRSTYVLA--TPASTQAALQE  687

Query  533   TSGQSKNSDQNTSNQTTGVPTAVSDLMNDSTTKASEDRKKDPKQDKVKVAKKIVKDMEKW  592
                                  A ++   +  +K +++++   K DKVKVAKKIVKDMEKW
Sbjct  688   V-------------------LADAEQKGEEESKKAKEKEGGNKHDKVKVAKKIVKDMEKW  728

Query  593   AKQLNQKKDLNVVQAAPAPVRQEEEPIKVNRTGNGGYADVGFSILENKERSKISMDMGSR  652
             AKQLNQKKD   V A P P+   E     +R   GGYADVGFSILE KER K++      
Sbjct  729   AKQLNQKKDYTAV-ATPQPILANEVAT-TSRGNQGGYADVGFSILEKKERGKLN------  780

Query  653   GGAASIGTPPPPQIA---KLVSTYGSDSDNE-------QNEKPADVMS------EKDYID  696
                      P P +    KLV+ YG  SD+E       QN + + V+S      E DY+D
Sbjct  781   ------DYAPNPTVGPMNKLVNAYGGTSDSEEDNAASSQNTQSSAVVSGGGGAEESDYVD  834

Query  697   FAKLTCLLCKRAFSDAEILNKHLKMSNLHKENLQKYNLLHGKLDDINASGLSYRDRAKER  756
             F KLTCLLCKRAF   E+L KHLKMS LHKENL K   L+          L+YRDRAKER
Sbjct  835   FHKLTCLLCKRAFQSLEVLQKHLKMSTLHKENLAK---LNQNTSSSIEEALAYRDRAKER  891

Query  757   RLKYGESDPPPVNRSRERFEKELEKQKSAIQVQASGNLASQPISSNNVGNRLLQKMGWSE  816
             RLKYGESDPPP NRSRERFE+E++  +S  Q Q++    + PISS+NVG+RLLQKMGWSE
Sbjct  892   RLKYGESDPPPPNRSRERFEQEIKTLQSR-QKQSTSATPAMPISSSNVGSRLLQKMGWSE  950

Query  817   GQGLGRTNQGRTNIIEAESRAPTAGLGTKTTNFGPGDDYKSYIKRMMKSRYE  868
             GQGLGR NQGRT IIEA+ R+   GLG K+    PG+DYKSYIK+MMK RYE
Sbjct  951   GQGLGRKNQGRTQIIEADGRSNYVGLGNKSGQMIPGNDYKSYIKKMMKQRYE  1002


>Q582H9_TRYB2 unnamed protein product
Length=271

 Score = 42.4 bits (98),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 26/44 (59%), Gaps = 0/44 (0%)

Query  800  SSNNVGNRLLQKMGWSEGQGLGRTNQGRTNIIEAESRAPTAGLG  843
            S NNVG  LL + GW+EG GLG+   G T  ++   +  T G+G
Sbjct  13   SENNVGRSLLLRGGWTEGSGLGKEKDGVTTHVKVRQKDGTMGIG  56



Lambda      K        H
   0.317    0.133    0.388 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 57319460198


Query= XP_037024190.1 RNA-binding protein 5-like isoform X3 [Bradysia
coprophila]

Length=862
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VPY4_DROME  unnamed protein product                                 686     0.0  
Q8SZM4_DROME  unnamed protein product                                 685     0.0  
Q582H9_TRYB2  unnamed protein product                                 42.4    9e-04


>Q9VPY4_DROME unnamed protein product
Length=1004

 Score = 686 bits (1770),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/945 (48%), Positives = 558/945 (59%), Gaps = 144/945 (15%)

Query  3     RRSRSPDSRHRRRD-----------HRRRSRSR-SRDRS---RD---RRRRSRSRSRPRY  44
             RR  S D RHR RD           + +RSR   SRDRS   RD    R RSR  SRP  
Sbjct  115   RRHDSFDRRHRDRDGESDRELNDYEYEQRSRDLDSRDRSSTDRDWYHNRSRSREHSRPWN  174

Query  45    RRNSPDLYKDLIDQDYQNDRD-RDRHHRRHQSTDEAY----------------------L  81
             R N+ D      D+   N+R+ R R HR +      +                       
Sbjct  175   RNNNHD------DRSRSNERNTRHRDHRMYNGGGSNHNRDRDRDRDREQDRERDRDRDRD  228

Query  82    EEINSNDSFDSDQ--VNSEHYRNQVPS-NKIIILGLAQHITETDINNDLIHYGLQPVSIR  138
              E   +  +DSD+  +    YR+   + N III GL + +T  DI ++LI   ++P  IR
Sbjct  229   RERRGSSDYDSDEGHMRRNKYRSTTEALNIIIIFGLTKEMTRADIMSELIKVNMEPACIR  288

Query  139   LIRKRKTGASRGFAFVEFNTEEEARSWMEYKQGVLMVQDQYRSVMQYSVSREPLGKEKVA  198
             +IRK+ T +SRG AFVEFNT EEA+ WM+  QGVL + D+ R  M+YS  R         
Sbjct  289   IIRKQGTDSSRGIAFVEFNTVEEAKQWMDITQGVLKLNDE-RVSMRYSHKR--------I  339

Query  199   TDWYCAKCGVFNFKRRENCFKCYASREESE----KGGEGSDEVSNILTKKIMLRNLDVLT  254
              DW C KCGV NFK R  CF C  SRE+SE     G EG DEVS ILTKKIMLRNLD LT
Sbjct  340   QDWNCNKCGVCNFKFRFYCFVCKTSREDSETTFSSGSEGVDEVSTILTKKIMLRNLDALT  399

Query  255   NEEGVLTVMQEVVPSLVSKISKILICKDPLTCTSRGICYLSFENLVDSMSFHNALKAIEP  314
             NEE VLT +Q  +  L   +SK+LI +D LT  SRGICYL F+ LVDSM+ HNAL A++P
Sbjct  400   NEEAVLTALQLHLKDLSKTVSKVLISRDSLTQASRGICYLHFDTLVDSMNVHNALTALDP  459

Query  315   ALNIEDREVLVSYCVDSENKQI----NKSVASKPSHSDGPTVSSYSNT---HQYTLADVP  367
              L ++DR V ++YC+D E +Q      K +A K S  +   +S+ S +     YTLADVP
Sbjct  460   PLTLDDRVVAITYCIDLEEQQALPKNPKELAVKDSTVNSGNISAVSPSGLGGNYTLADVP  519

Query  368   RLAEYSASVYASNSAEHDHYYKYYTDYYIAQITNGHYNNLPTMGETANSGAAVAMSAIQR  427
             RLAEYSAS+YASN AEH +Y +YYT+YY A I     NN  +    ANSGAAVA+SAIQR
Sbjct  520   RLAEYSASLYASNPAEHAYYVQYYTEYYTADINK---NNRDSHLTEANSGAAVALSAIQR  576

Query  428   KQKQQNKVSSSQAP----------------VTQPIQIPTGLDNKKYPAPDVFQYQYDESS  471
             KQK+ + + ++                     Q    P G D K YP PDV QYQYDE+S
Sbjct  577   KQKKMSSIETTITAAATAAAQAAAQVKATLAAQVASAPKGNDGKIYPTPDVTQYQYDETS  636

Query  472   GFYYDSSTGLYYDSSSQYYYNGESGAYLYWNAEKSTYTIAATTPSTPAEATKSTSGQSKN  531
             G+YYDS+TGLYY++ SQYYYN E+GAYLYW+  +STY +A  TP++   A +        
Sbjct  637   GYYYDSTTGLYYNAHSQYYYNNETGAYLYWDQRRSTYVLA--TPASTQAALQEV------  688

Query  532   SDQNTSNQTTGVPTAVSDLMNDSTTKASEDRKKDPKQDKVKVAKKIVKDMEKWAKQLNQK  591
                           A ++   +  +K +++++   K DKVKVAKKIVKDMEKWAKQLNQK
Sbjct  689   -------------LADAEQKGEEESKKAKEKEGGNKHDKVKVAKKIVKDMEKWAKQLNQK  735

Query  592   KDLNVVQAAPAPVRQEEEPIKVNRTGNGGYADVGFSILENKERSKISMDMGSRGGAASIG  651
             KD   V A P P+   E     +R   GGYADVGFSILE KER K++             
Sbjct  736   KDYTAV-ATPQPILANEVAT-TSRGNQGGYADVGFSILEKKERGKLN------------D  781

Query  652   TPPPPQIA---KLVSTYGSDSDNE-------QNEKPADVMS------EKDYIDFAKLTCL  695
               P P +    KLV+ YG  SD+E       QN + + V+S      E DY+DF KLTCL
Sbjct  782   YAPNPTVGPMNKLVNAYGGTSDSEEDNAASSQNTQSSAVVSGGGGAEESDYVDFHKLTCL  841

Query  696   LCKRAFSDAEILNKHLKMSNLHKENLQKYNLLHGKLDDINASGLSYRDRAKERRLKYGES  755
             LCKRAF   EIL KHLKMS LHKENL K   L+          L+YRDRAKERRLKYGES
Sbjct  842   LCKRAFQSLEILQKHLKMSTLHKENLAK---LNQNTSSSIEEALAYRDRAKERRLKYGES  898

Query  756   DPPPVNRSRERFEKELEKQKSAIQVQASGNLASQPISSNNVGNRLLQKMGWSEGQGLGRT  815
             DPPP NRSRERFE+E++  +S  Q Q++    + PISS+NVG+RLLQKMGWSEGQGLGR 
Sbjct  899   DPPPPNRSRERFEQEIKTLQSR-QKQSTSATPAMPISSSNVGSRLLQKMGWSEGQGLGRK  957

Query  816   NQGRTNIIEAESRAPTAGLGTKTTNFGPGDDYKSYIKRMMKSRYE  860
             NQGRT IIEA+ R+   GLG K+    PG+DYKSYIK+MMK RYE
Sbjct  958   NQGRTQIIEADGRSNYVGLGNKSGQMIPGNDYKSYIKKMMKQRYE  1002


>Q8SZM4_DROME unnamed protein product
Length=1004

 Score = 685 bits (1768),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/945 (48%), Positives = 558/945 (59%), Gaps = 144/945 (15%)

Query  3     RRSRSPDSRHRRRD-----------HRRRSRSR-SRDRS---RD---RRRRSRSRSRPRY  44
             RR  S D RHR RD           + +RSR   SRDRS   RD    R RSR  SRP  
Sbjct  115   RRHDSFDRRHRDRDGESDRELNDYEYEQRSRDLDSRDRSSTDRDWYHNRSRSREHSRPWN  174

Query  45    RRNSPDLYKDLIDQDYQNDRD-RDRHHRRHQSTDEAY----------------------L  81
             R N+ D      D+   N+R+ R R HR +      +                       
Sbjct  175   RNNNHD------DRSRSNERNTRHRDHRMYNGGGSNHNRDRDRDRDREQDRERDRDRDRD  228

Query  82    EEINSNDSFDSDQ--VNSEHYRNQVPS-NKIIILGLAQHITETDINNDLIHYGLQPVSIR  138
              E   +  +DSD+  +    YR+   + N III GL + +T  DI ++LI   ++P  IR
Sbjct  229   RERRGSSDYDSDEGHMRRNKYRSTTEALNIIIIFGLTKEMTRADIMSELIKVNMEPACIR  288

Query  139   LIRKRKTGASRGFAFVEFNTEEEARSWMEYKQGVLMVQDQYRSVMQYSVSREPLGKEKVA  198
             +IRK+ T +SRG AFVEFNT EEA+ WM+  QGVL + D+ R  M+YS  R         
Sbjct  289   IIRKQGTDSSRGIAFVEFNTVEEAKQWMDITQGVLKLNDE-RVSMRYSHKR--------I  339

Query  199   TDWYCAKCGVFNFKRRENCFKCYASREESE----KGGEGSDEVSNILTKKIMLRNLDVLT  254
              DW C KCGV NFK R  CF C  SRE+SE     G EG DEVS ILTKKIMLRNLD LT
Sbjct  340   QDWNCYKCGVCNFKFRFYCFVCKTSREDSETTFSSGSEGVDEVSTILTKKIMLRNLDALT  399

Query  255   NEEGVLTVMQEVVPSLVSKISKILICKDPLTCTSRGICYLSFENLVDSMSFHNALKAIEP  314
             NEE VLT +Q  +  L   +SK+LI +D LT  SRGICYL F+ LVDSM+ HNAL A++P
Sbjct  400   NEEAVLTALQLHLKDLSKTVSKVLISRDSLTQASRGICYLHFDTLVDSMNVHNALTALDP  459

Query  315   ALNIEDREVLVSYCVDSENKQI----NKSVASKPSHSDGPTVSSYSNT---HQYTLADVP  367
              L ++DR V ++YC+D E +Q      K +A K S  +   +S+ S +     YTLADVP
Sbjct  460   PLTLDDRVVAITYCIDLEEQQALPKNPKELAVKDSTVNSGNISAVSPSGLGGNYTLADVP  519

Query  368   RLAEYSASVYASNSAEHDHYYKYYTDYYIAQITNGHYNNLPTMGETANSGAAVAMSAIQR  427
             RLAEYSAS+YASN AEH +Y +YYT+YY A I     NN  +    ANSGAAVA+SAIQR
Sbjct  520   RLAEYSASLYASNPAEHAYYVQYYTEYYTADINK---NNRDSHLTEANSGAAVALSAIQR  576

Query  428   KQKQQNKVSSSQAP----------------VTQPIQIPTGLDNKKYPAPDVFQYQYDESS  471
             KQK+ + + ++                     Q    P G D K YP PDV QYQYDE+S
Sbjct  577   KQKKMSSIETTITAAATAAAQAAAQVKATLAAQVASAPKGNDGKIYPTPDVTQYQYDETS  636

Query  472   GFYYDSSTGLYYDSSSQYYYNGESGAYLYWNAEKSTYTIAATTPSTPAEATKSTSGQSKN  531
             G+YYDS+TGLYY++ SQYYYN E+GAYLYW+  +STY +A  TP++   A +        
Sbjct  637   GYYYDSTTGLYYNAHSQYYYNNETGAYLYWDQRRSTYVLA--TPASTQAALQEV------  688

Query  532   SDQNTSNQTTGVPTAVSDLMNDSTTKASEDRKKDPKQDKVKVAKKIVKDMEKWAKQLNQK  591
                           A ++   +  +K +++++   K DKVKVAKKIVKDMEKWAKQLNQK
Sbjct  689   -------------LADAEQKGEEESKKAKEKEGGNKHDKVKVAKKIVKDMEKWAKQLNQK  735

Query  592   KDLNVVQAAPAPVRQEEEPIKVNRTGNGGYADVGFSILENKERSKISMDMGSRGGAASIG  651
             KD   V A P P+   E     +R   GGYADVGFSILE KER K++             
Sbjct  736   KDYTAV-ATPQPILANEVAT-TSRGNQGGYADVGFSILEKKERGKLN------------D  781

Query  652   TPPPPQIA---KLVSTYGSDSDNE-------QNEKPADVMS------EKDYIDFAKLTCL  695
               P P +    KLV+ YG  SD+E       QN + + V+S      E DY+DF KLTCL
Sbjct  782   YAPNPTVGPMNKLVNAYGGTSDSEEDNAASSQNTQSSAVVSGGGGAEESDYVDFHKLTCL  841

Query  696   LCKRAFSDAEILNKHLKMSNLHKENLQKYNLLHGKLDDINASGLSYRDRAKERRLKYGES  755
             LCKRAF   E+L KHLKMS LHKENL K   L+          L+YRDRAKERRLKYGES
Sbjct  842   LCKRAFQSLEVLQKHLKMSTLHKENLAK---LNQNTSSSIEEALAYRDRAKERRLKYGES  898

Query  756   DPPPVNRSRERFEKELEKQKSAIQVQASGNLASQPISSNNVGNRLLQKMGWSEGQGLGRT  815
             DPPP NRSRERFE+E++  +S  Q Q++    + PISS+NVG+RLLQKMGWSEGQGLGR 
Sbjct  899   DPPPPNRSRERFEQEIKTLQSR-QKQSTSATPAMPISSSNVGSRLLQKMGWSEGQGLGRK  957

Query  816   NQGRTNIIEAESRAPTAGLGTKTTNFGPGDDYKSYIKRMMKSRYE  860
             NQGRT IIEA+ R+   GLG K+    PG+DYKSYIK+MMK RYE
Sbjct  958   NQGRTQIIEADGRSNYVGLGNKSGQMIPGNDYKSYIKKMMKQRYE  1002


>Q582H9_TRYB2 unnamed protein product
Length=271

 Score = 42.4 bits (98),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 26/44 (59%), Gaps = 0/44 (0%)

Query  792  SSNNVGNRLLQKMGWSEGQGLGRTNQGRTNIIEAESRAPTAGLG  835
            S NNVG  LL + GW+EG GLG+   G T  ++   +  T G+G
Sbjct  13   SENNVGRSLLLRGGWTEGSGLGKEKDGVTTHVKVRQKDGTMGIG  56



Lambda      K        H
   0.317    0.133    0.388 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 57319460198


Query= XP_037024191.1 pancreatic triacylglycerol lipase-like isoform X1
[Bradysia coprophila]

Length=317
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7K3Z8_DROME  unnamed protein product                                 121     8e-32
Q0E8T1_DROME  unnamed protein product                                 119     5e-31
Q9VX69_DROME  unnamed protein product                                 112     6e-28


>Q7K3Z8_DROME unnamed protein product
Length=340

 Score = 121 bits (304),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 83/257 (32%), Positives = 126/257 (49%), Gaps = 17/257 (7%)

Query  66   TKLIIHGYIANRFHGSIEPVKNAYLGRGDVNVLLVDWEQLAHKLYD-ESRSYVRQIGSRI  124
            T L +HGY+ +    SI  +  AYL R D N++++DW +LA   Y  ++   ++Q+G  +
Sbjct  61   TVLYLHGYLEDPDVESIHVIAEAYLERKDTNLIVLDWGELADGNYMFDAFPNLKQLGPEL  120

Query  125  GNLLSHYIRNQNVSYSDIHVIGHSLGAHIAGNVGRYFNGH------LRRITGLDPAAPLF  178
              +L     +  +     H++GHS+G  +AG +GR           ++RI+ LDPA PLF
Sbjct  121  AKVLLKMF-DHGLDIEKFHIVGHSMGGQLAGLLGREITKRTKGVRKIKRISALDPAFPLF  179

Query  179  TNSSIDAIKQSDGQFVDIIHTCGYSLGEIWARGHIDFYPNSGKFHQPGCRKDDLLQLFS-  237
               +   +  +D +FVD+IHT  +  G   + G  DF+PN G   QPGC K +   L   
Sbjct  180  YPGT--HLSANDAEFVDVIHTDAWLYGAPTSTGTADFWPNGGYSLQPGCPKRNYKMLSDN  237

Query  238  --CSHFRAPLFYAESI--LFPYSFTAAKCTFREIMADSPNKCTNSNENVYMGDIVSMDSR  293
               SH R+  F+AES+   +P  F A     ++      NK   +   V MG        
Sbjct  238  DLSSHRRSWWFWAESVSDRYPIGFDAVPA--KKWSDFKQNKIVENCPPVVMGHHCPTTIH  295

Query  294  GLYYLTTNEMYPFGRGN  310
            G +YL TN   PF RG 
Sbjct  296  GDFYLQTNGHTPFARGK  312


>Q0E8T1_DROME unnamed protein product
Length=338

 Score = 119 bits (298),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 81/248 (33%), Positives = 124/248 (50%), Gaps = 7/248 (3%)

Query  65   PTKLIIHGYIANRFHGSIEPVKNAYLGRGDVNVLLVDWEQLAHK-LYDESRSYVRQIGSR  123
            P K++IHG+  +R       ++  +L + D N++ +D+ +LA++  Y E+    + +   
Sbjct  68   PLKVLIHGFNGHRDFSPNTQLRPLFLTQ-DYNLISLDYPKLAYEPCYTEAVHNAKYVARC  126

Query  124  IGNLLSHYIRNQNVSYSDIHVIGHSLGAHIAGNVGRYFNGH-LRRITGLDPAAPLF-TNS  181
               LL   + +  V   D+H+IG  LGAH+AG +G++   H L  IT LDPA P +    
Sbjct  127  TAQLLRVLLESGLVKIEDLHLIGLGLGAHVAGFIGQFLPEHKLEHITALDPAKPFYMVKD  186

Query  182  SIDAIKQSDGQFVDIIHTCGYSLGEIWARGHIDFYPNSGKFHQPGCRKDDLLQLFSCSHF  241
                +  +D +FVD++HT    LG + A GH+DFY N G   QP C   + ++   C H 
Sbjct  187  PALKLDPTDAKFVDVVHTDVTMLGLLDAVGHVDFYLNMG-VSQPNCGPINKMETHFCYHN  245

Query  242  RAPLFYAESILFPYSFTAAKCTFREIMADSPNKCTNSNENVYMGDIVSMDSRGLYYLTTN  301
            RA  +YAESI  P  F    C   +  A     C        MG  V   +RG Y+L TN
Sbjct  246  RAADYYAESISSPSGFYGFYCPNFKSFAKG--ICIPDKNIELMGFHVDPKARGRYFLDTN  303

Query  302  EMYPFGRG  309
               P+ +G
Sbjct  304  NGPPYAKG  311


>Q9VX69_DROME unnamed protein product
Length=411

 Score = 112 bits (280),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 81/235 (34%), Positives = 115/235 (49%), Gaps = 21/235 (9%)

Query  81   SIEPVKNAYLGRGDVNVLLVDWEQLAHKLYDESRSYVRQIGSRIGNLLSHYIRNQNVSYS  140
            +IE    AY  RGDVN + VD  +    LY  S     +IG  I   L   +    V   
Sbjct  149  TIEVFSKAYNCRGDVNFVAVDAARFVDTLYTWSAFNTEEIGENIALGLVKLL--DLVPVE  206

Query  141  DIHVIGHSLGAHIAGNVGRYF----NGHLRRITGLDPAAPLFTN-SSIDAIKQSDGQFVD  195
            +IH+IGHSLGAHI G+ GR+     N  + RITGLDPA P F    ++  + + D  FVD
Sbjct  207  NIHLIGHSLGAHIVGSAGRHLQHLTNQTIPRITGLDPAKPCFNEGEALSGLMRGDAHFVD  266

Query  196  IIHTCGYSLGEIWARGHIDFYPNSGKFHQPGCRKDDLLQLFSCSHFRAPLFYAESILFP-  254
            +IH+    LG+    G +DFYP        GC         +C+H R+  ++AE++ FP 
Sbjct  267  VIHSNPGVLGKRDPVGDVDFYPGGMSPLAAGCFS------VTCAHARSWEYFAETV-FPG  319

Query  255  --YSFTAAKCTFREIMADSPNKCTNSNENVYMGDIVSMDSRGLYYLTTNEMYPFG  307
               +F A +C     + D   +C    + V MG  V  + +G Y+L  +   PFG
Sbjct  320  NERNFMATRCNSISKLRDF--RC--PGDEVPMGYAVPQNIKGNYFLEVSASAPFG  370



Lambda      K        H
   0.317    0.133    0.388 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 57319460198


Query= XP_037024192.1 pancreatic triacylglycerol lipase-like isoform X2
[Bradysia coprophila]

Length=312
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7K3Z8_DROME  unnamed protein product                                 100     3e-24
Q0E8T1_DROME  unnamed protein product                                 89.4    4e-20
Q8SXG0_DROME  unnamed protein product                                 80.9    7e-17


>Q7K3Z8_DROME unnamed protein product
Length=340

 Score = 100 bits (250),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 78/257 (30%), Positives = 120/257 (47%), Gaps = 22/257 (9%)

Query  66   TKLIIHGYIANRFHGSIEPVKNAYLGRGDVNVLLVDWEQLAHKLYD-ESRSYVRQIGSRI  124
            T L +HGY+ +    SI  +  AYL R D N++++DW +LA   Y  ++   ++Q+G  +
Sbjct  61   TVLYLHGYLEDPDVESIHVIAEAYLERKDTNLIVLDWGELADGNYMFDAFPNLKQLGPEL  120

Query  125  GNLLSHYIRNQNVSYSDIHVIGHSLGK----------IERTSLV-TLEDISTVTLGAPLF  173
              +L     +  +     H++GHS+G            +RT  V  ++ IS +    PLF
Sbjct  121  AKVLLKMF-DHGLDIEKFHIVGHSMGGQLAGLLGREITKRTKGVRKIKRISALDPAFPLF  179

Query  174  TNSSIDAIKQSDGQFVDIIHTCGYSLGEIWARGHIDFYPNSGKFHQPGCRKDDLLQLFS-  232
               +   +  +D +FVD+IHT  +  G   + G  DF+PN G   QPGC K +   L   
Sbjct  180  YPGT--HLSANDAEFVDVIHTDAWLYGAPTSTGTADFWPNGGYSLQPGCPKRNYKMLSDN  237

Query  233  --CSHFRAPLFYAESI--LFPYSFTAAKCTFREIMADSPNKCTNSNENVYMGDIVSMDSR  288
               SH R+  F+AES+   +P  F A     ++      NK   +   V MG        
Sbjct  238  DLSSHRRSWWFWAESVSDRYPIGFDAVPA--KKWSDFKQNKIVENCPPVVMGHHCPTTIH  295

Query  289  GLYYLTTNEMYPFGRGN  305
            G +YL TN   PF RG 
Sbjct  296  GDFYLQTNGHTPFARGK  312


>Q0E8T1_DROME unnamed protein product
Length=338

 Score = 89.4 bits (220),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 71/248 (29%), Positives = 113/248 (46%), Gaps = 12/248 (5%)

Query  65   PTKLIIHGYIANRFHGSIEPVKNAYLGRGDVNVLLVDWEQLAHK-LYDESRSYVRQIGSR  123
            P K++IHG+  +R       ++  +L + D N++ +D+ +LA++  Y E+    + +   
Sbjct  68   PLKVLIHGFNGHRDFSPNTQLRPLFLTQ-DYNLISLDYPKLAYEPCYTEAVHNAKYVARC  126

Query  124  IGNLLSHYIRNQNVSYSDIHVIGHSLGKI------ERTSLVTLEDISTVTLGAPLF-TNS  176
               LL   + +  V   D+H+IG  LG        +      LE I+ +    P +    
Sbjct  127  TAQLLRVLLESGLVKIEDLHLIGLGLGAHVAGFIGQFLPEHKLEHITALDPAKPFYMVKD  186

Query  177  SIDAIKQSDGQFVDIIHTCGYSLGEIWARGHIDFYPNSGKFHQPGCRKDDLLQLFSCSHF  236
                +  +D +FVD++HT    LG + A GH+DFY N G   QP C   + ++   C H 
Sbjct  187  PALKLDPTDAKFVDVVHTDVTMLGLLDAVGHVDFYLNMG-VSQPNCGPINKMETHFCYHN  245

Query  237  RAPLFYAESILFPYSFTAAKCTFREIMADSPNKCTNSNENVYMGDIVSMDSRGLYYLTTN  296
            RA  +YAESI  P  F    C   +  A     C        MG  V   +RG Y+L TN
Sbjct  246  RAADYYAESISSPSGFYGFYCPNFKSFAKG--ICIPDKNIELMGFHVDPKARGRYFLDTN  303

Query  297  EMYPFGRG  304
               P+ +G
Sbjct  304  NGPPYAKG  311


>Q8SXG0_DROME unnamed protein product
Length=411

 Score = 80.9 bits (198),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 68/235 (29%), Positives = 105/235 (45%), Gaps = 26/235 (11%)

Query  81   SIEPVKNAYLGRGDVNVLLVDWEQLAHKLYDESRSYVRQIGSRIGNLLSHYIRNQNVSYS  140
            +IE    AY  RGDVN + VD  +    LY  S     +IG  I   L   +    V   
Sbjct  149  TIEVFSKAYNCRGDVNFVAVDAARFVDTLYTWSAFNTEEIGENIALGLVKLL--DLVPVE  206

Query  141  DIHVIGHSLGK---------IERTSLVTLEDISTVTLGAPLFTN-SSIDAIKQSDGQFVD  190
            +IH+IGHSLG          ++  +  T+  I+ +    P F    ++  + + D  FVD
Sbjct  207  NIHLIGHSLGAHIVGSAGRHLQHLTNQTIPRITGLDPAKPCFNEGEALSGLMRGDAHFVD  266

Query  191  IIHTCGYSLGEIWARGHIDFYPNSGKFHQPGCRKDDLLQLFSCSHFRAPLFYAESILFP-  249
            +IH+    LG+    G +DFYP        GC         +C+H R+  ++AE++ FP 
Sbjct  267  VIHSNPGVLGKRDPVGDVDFYPGGMSPLAAGCFS------VTCAHARSWEYFAETV-FPG  319

Query  250  --YSFTAAKCTFREIMADSPNKCTNSNENVYMGDIVSMDSRGLYYLTTNEMYPFG  302
               +F A +C     + D   +C    + V MG  V  + +G Y+L  +   PFG
Sbjct  320  NERNFMATRCNSISKLRDF--RC--PGDEVPMGYAVPQNIKGNYFLEVSASAPFG  370



Lambda      K        H
   0.317    0.133    0.388 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 57319460198


Query= XP_037024193.1 pancreatic triacylglycerol lipase-like isoform X3
[Bradysia coprophila]

Length=296
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7K3Z8_DROME  unnamed protein product                                 106     2e-26
Q9VX69_DROME  unnamed protein product                                 98.6    3e-23
Q8SXG0_DROME  unnamed protein product                                 98.6    3e-23


>Q7K3Z8_DROME unnamed protein product
Length=340

 Score = 106 bits (265),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 76/255 (30%), Positives = 117/255 (46%), Gaps = 34/255 (13%)

Query  66   TKLIIHGYIANRFHGSIEPVKNAYLGRGDVNVLLVDWEQLAHKLYD-ESRSYVRQIGSRI  124
            T L +HGY+ +    SI  +  AYL R D N++++DW +LA   Y  ++   ++Q+G  +
Sbjct  61   TVLYLHGYLEDPDVESIHVIAEAYLERKDTNLIVLDWGELADGNYMFDAFPNLKQLGPEL  120

Query  125  GNLLSHYIRNQNVSYSDIHVIGHSLGAHIAGNVGRYFNGH------LRRITGLDPAAPLF  178
              +L     +  +     H++GHS+G  +AG +GR           ++RI+ LDPA PLF
Sbjct  121  AKVLLKMF-DHGLDIEKFHIVGHSMGGQLAGLLGREITKRTKGVRKIKRISALDPAFPLF  179

Query  179  TNSSIDAIKQSDGQFVDIIHTCGYSLGEIWARGHIDFYPNSGKFHQPGCRK-------DD  231
               +   +  +D +FVD+IHT  +  G   + G  DF+PN G   QPGC K       D+
Sbjct  180  YPGT--HLSANDAEFVDVIHTDAWLYGAPTSTGTADFWPNGGYSLQPGCPKRNYKMLSDN  237

Query  232  LLQLFSSAKCTFREIMAD-----------------SPNKCTNSNENVYMGDIVSMDSRGL  274
             L     +   + E ++D                   NK   +   V MG        G 
Sbjct  238  DLSSHRRSWWFWAESVSDRYPIGFDAVPAKKWSDFKQNKIVENCPPVVMGHHCPTTIHGD  297

Query  275  YYLTTNEMYPFGRGN  289
            +YL TN   PF RG 
Sbjct  298  FYLQTNGHTPFARGK  312


>Q9VX69_DROME unnamed protein product
Length=411

 Score = 98.6 bits (244),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 76/224 (34%), Positives = 101/224 (45%), Gaps = 20/224 (9%)

Query  81   SIEPVKNAYLGRGDVNVLLVDWEQLAHKLYDESRSYVRQIGSRIGNLLSHYIRNQNVSYS  140
            +IE    AY  RGDVN + VD  +    LY  S     +IG  I   L   +    V   
Sbjct  149  TIEVFSKAYNCRGDVNFVAVDAARFVDTLYTWSAFNTEEIGENIALGLVKLL--DLVPVE  206

Query  141  DIHVIGHSLGAHIAGNVGRYF----NGHLRRITGLDPAAPLFTN-SSIDAIKQSDGQFVD  195
            +IH+IGHSLGAHI G+ GR+     N  + RITGLDPA P F    ++  + + D  FVD
Sbjct  207  NIHLIGHSLGAHIVGSAGRHLQHLTNQTIPRITGLDPAKPCFNEGEALSGLMRGDAHFVD  266

Query  196  IIHTCGYSLGEIWARGHIDFYPNSGKFHQPGCRKDDLLQLFSS---AKCTF----REIMA  248
            +IH+    LG+    G +DFYP        GC         S    A+  F    R  MA
Sbjct  267  VIHSNPGVLGKRDPVGDVDFYPGGMSPLAAGCFSVTCAHARSWEYFAETVFPGNERNFMA  326

Query  249  DSPNKCTN------SNENVYMGDIVSMDSRGLYYLTTNEMYPFG  286
               N  +         + V MG  V  + +G Y+L  +   PFG
Sbjct  327  TRCNSISKLRDFRCPGDEVPMGYAVPQNIKGNYFLEVSASAPFG  370


>Q8SXG0_DROME unnamed protein product
Length=411

 Score = 98.6 bits (244),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 76/224 (34%), Positives = 101/224 (45%), Gaps = 20/224 (9%)

Query  81   SIEPVKNAYLGRGDVNVLLVDWEQLAHKLYDESRSYVRQIGSRIGNLLSHYIRNQNVSYS  140
            +IE    AY  RGDVN + VD  +    LY  S     +IG  I   L   +    V   
Sbjct  149  TIEVFSKAYNCRGDVNFVAVDAARFVDTLYTWSAFNTEEIGENIALGLVKLL--DLVPVE  206

Query  141  DIHVIGHSLGAHIAGNVGRYF----NGHLRRITGLDPAAPLFTN-SSIDAIKQSDGQFVD  195
            +IH+IGHSLGAHI G+ GR+     N  + RITGLDPA P F    ++  + + D  FVD
Sbjct  207  NIHLIGHSLGAHIVGSAGRHLQHLTNQTIPRITGLDPAKPCFNEGEALSGLMRGDAHFVD  266

Query  196  IIHTCGYSLGEIWARGHIDFYPNSGKFHQPGCRKDDLLQLFSS---AKCTF----REIMA  248
            +IH+    LG+    G +DFYP        GC         S    A+  F    R  MA
Sbjct  267  VIHSNPGVLGKRDPVGDVDFYPGGMSPLAAGCFSVTCAHARSWEYFAETVFPGNERNFMA  326

Query  249  DSPNKCTN------SNENVYMGDIVSMDSRGLYYLTTNEMYPFG  286
               N  +         + V MG  V  + +G Y+L  +   PFG
Sbjct  327  TRCNSISKLRDFRCPGDEVPMGYAVPQNIKGNYFLEVSASAPFG  370



Lambda      K        H
   0.317    0.133    0.388 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 57319460198


Query= XP_037024194.1 pancreatic triacylglycerol lipase-like isoform X4
[Bradysia coprophila]

Length=228
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7K3Z8_DROME  unnamed protein product                                 47.4    3e-06
Q9VX69_DROME  unnamed protein product                                 40.4    7e-04
Q8SXG0_DROME  unnamed protein product                                 40.4    7e-04


>Q7K3Z8_DROME unnamed protein product
Length=340

 Score = 47.4 bits (111),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 47/86 (55%), Gaps = 2/86 (2%)

Query  66   TKLIIHGYIANRFHGSIEPVKNAYLGRGDVNVLLVDWEQLAHKLYD-ESRSYVRQIGSRI  124
            T L +HGY+ +    SI  +  AYL R D N++++DW +LA   Y  ++   ++Q+G  +
Sbjct  61   TVLYLHGYLEDPDVESIHVIAEAYLERKDTNLIVLDWGELADGNYMFDAFPNLKQLGPEL  120

Query  125  GNLLSHYIRNQNVSYSDIHVIGHSLG  150
              +L     +  +     H++GHS+G
Sbjct  121  AKVLLKMF-DHGLDIEKFHIVGHSMG  145


>Q9VX69_DROME unnamed protein product
Length=411

 Score = 40.4 bits (93),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 34/70 (49%), Gaps = 2/70 (3%)

Query  81   SIEPVKNAYLGRGDVNVLLVDWEQLAHKLYDESRSYVRQIGSRIGNLLSHYIRNQNVSYS  140
            +IE    AY  RGDVN + VD  +    LY  S     +IG  I   L   +    V   
Sbjct  149  TIEVFSKAYNCRGDVNFVAVDAARFVDTLYTWSAFNTEEIGENIALGLVKLL--DLVPVE  206

Query  141  DIHVIGHSLG  150
            +IH+IGHSLG
Sbjct  207  NIHLIGHSLG  216


>Q8SXG0_DROME unnamed protein product
Length=411

 Score = 40.4 bits (93),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 34/70 (49%), Gaps = 2/70 (3%)

Query  81   SIEPVKNAYLGRGDVNVLLVDWEQLAHKLYDESRSYVRQIGSRIGNLLSHYIRNQNVSYS  140
            +IE    AY  RGDVN + VD  +    LY  S     +IG  I   L   +    V   
Sbjct  149  TIEVFSKAYNCRGDVNFVAVDAARFVDTLYTWSAFNTEEIGENIALGLVKLL--DLVPVE  206

Query  141  DIHVIGHSLG  150
            +IH+IGHSLG
Sbjct  207  NIHLIGHSLG  216



Lambda      K        H
   0.317    0.133    0.388 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 57319460198


Query= XP_037024195.1 intraflagellar transport protein 172 homolog
[Bradysia coprophila]

Length=1739
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

OSM1_DROME  unnamed protein product                                   2310    0.0  
OSM1_CAEEL  unnamed protein product                                   1142    0.0  
Q38CC3_TRYB2  unnamed protein product                                 1039    0.0  


>OSM1_DROME unnamed protein product
Length=1754

 Score = 2310 bits (5985),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1084/1755 (62%), Positives = 1399/1755 (80%), Gaps = 20/1755 (1%)

Query  1     MHLKYLKTILDAQNQLSRIGGLTWAPNHQKLAVATADRSIILFDENGEKRDKFSTKPSGS  60
             M LKYL+T+L+ Q Q+ RI GL W+PN Q+LA+ATADR I+L+D+ GE+RDKFSTKP+  
Sbjct  1     MQLKYLRTLLEGQEQIQRIAGLAWSPNQQRLAIATADRHILLYDDAGERRDKFSTKPANP  60

Query  61    VEGKTSYVIRALVFSPDSTSLAVAQSDNIVYVYKLGTTWKEKKVICNKFPQPTAVTVMVW  120
               GK SYVIR L FSPDST LAV QSD+IVYVYKLG +W +KKVICNKFPQ +AVT ++W
Sbjct  61    ANGKNSYVIRGLAFSPDSTKLAVGQSDSIVYVYKLGESWNDKKVICNKFPQASAVTALIW  120

Query  121   LSVGPIIIGLEDGKVRALNCKTNRSQNLYAAEHTVVSLAANVRGTGFVSGHEDGSVIRFF  180
             L+ G II GLEDGKVRAL+ K+N+SQ+LY  +   +SLAAN +GTGF+SGH DG++IR+F
Sbjct  121   LTSGSIIAGLEDGKVRALHSKSNKSQSLYGGDSICISLAANTKGTGFLSGHNDGTIIRYF  180

Query  181   IVDETKFPSGRLFVHTSSPLALAWAQNDIVAAGCDRKVIFYNVQGQQSRVFDYSHDDNEK  240
             + DE   P GR+  H   P ALAW Q    A GCD++++FY+  G+Q R FD+S  + E+
Sbjct  181   MTDEATEPLGRVVQHPVPPFALAWPQGGFCAGGCDQRIVFYDSMGRQLRTFDHSRTEGER  240

Query  241   EFTSAECSPNGQSIAIGNYDQIRIYTWSPRQKTWTDVAKKEIKNLYSVSAMTWRSDGARL  300
             EFT A CSPNGQ++A G++D+IRI+ WSPRQ  W++ A KE+  LY++S++ WR DGARL
Sbjct  241   EFTVAACSPNGQAVAFGSFDRIRIFAWSPRQGAWSESATKEVACLYTLSSLLWRRDGARL  300

Query  301   VVGSICGAVLLFESVLKRTVWHDKFELTYVTHSQLLLKSLQESDSTVLVVESQLGLEIDD  360
              +GS+ GAVLLFESVL+RTVW DKFEL +V  SQLL++SL E  S  L +ESQLGLEIDD
Sbjct  301   ALGSVSGAVLLFESVLRRTVWQDKFELIFVAPSQLLVRSLTEP-SQALTIESQLGLEIDD  359

Query  361   VRFMGKDNYLVAHTEDSLILCDLTRNLTSELSWISSGHNEKFYFENPNVCFIFNAGELTL  420
             VR MG+DNYLVA TE+SLILCDLTRNL+SE+ W +SGH+E+FYFENP VC IFN GEL+L
Sbjct  360   VRIMGRDNYLVARTEESLILCDLTRNLSSEVPWTASGHHERFYFENPTVCLIFNVGELSL  419

Query  421   VEYGENSTLGSVRTEFVNPHVISVRINERGNTRDNKKLAYLMDMKTISVVDLISQSIIAQ  480
             VEYGENS LGSVRTEFVNPHVISVR+NERGN ++NKKLA+L+D KTI VVDLIS+    Q
Sbjct  420   VEYGENSILGSVRTEFVNPHVISVRLNERGNAKENKKLAFLLDAKTICVVDLISRMTSGQ  479

Query  481   INHESKIDWLELSETAHKILFRDKKMRLILFDIATSKKYNLMDKVSFVQWVPQSDVVVAQ  540
             I+HE+KIDWLELSETAHK+LFRDKK+RLIL D  T KK  L+  +SFVQWVPQSDVVVAQ
Sbjct  480   ISHETKIDWLELSETAHKLLFRDKKLRLILVDNYTGKKQTLLSNISFVQWVPQSDVVVAQ  539

Query  541   SDYNLAIWYNIDVPQHVTMVSIRGDVTHVVREEGTTEVKMKEGPTEHSYRLDQGLVEFGT  600
             S+ NLAIWYNID+P+HVTM S+RG+   V+RE G T V+ ++GP+EH+Y+LD+GLVEFGT
Sbjct  540   SNSNLAIWYNIDLPEHVTMQSVRGEAIEVLRENGRTVVRSQDGPSEHNYQLDEGLVEFGT  599

Query  601   AVNDNDFGKAIIFLESHDDKSAAKAMWHNLARIALYQQNMRVAQRCFVALGNASMAFYLG  660
             AVND+DFG+A+ FLES  DK AAKAMWHNLA IAL   N+RVAQRC+ ALGN S A+YL 
Sbjct  600   AVNDSDFGRAVHFLESLGDKPAAKAMWHNLALIALEDGNLRVAQRCYAALGNVSKAYYLA  659

Query  661   KTIKAAAEYGEEM-PLGVQGNEVRARMALVNCDLKSAERIYLDQGNIDAAISVYTRLRLW  719
               I+ A E+ E     G+   EVRA++AL+  DL++AERIYL+QG+I++A+ +Y +L +W
Sbjct  660   GMIQQADEFEESSGSPGILCPEVRAKLALLGSDLRTAERIYLEQGDIESALKMYQQLGMW  719

Query  720   DDAIKLAERRGYHGLNTLREQQMSFLLSTNQEELAGHALEESGDTDRAMTLYLKANKPVK  779
             D+A+ LAERRGY+ +  L++Q M +LLS+ Q+E AG  LEE GD  +AM+LY+KANKP +
Sbjct  720   DEAVALAERRGYNRIAELKQQHMDYLLSSEQQEKAGQVLEEQGDLQQAMSLYMKANKPAR  779

Query  780   AARLALKWPSLLQDNDLMNRVAKSLIAFELYELAGDLSNKLRKPEAAIEMYRRGGAYSRA  839
             AARLALK P +LQD  +M +V + L+  ELYELAGD++++L +PEAA+ +YR+GGAY+RA
Sbjct  780   AARLALKTPHILQDEQVMLQVTEGLVRSELYELAGDIAHRLSRPEAALALYRKGGAYARA  839

Query  840   IELARNVSPDEVTSLEEEWGDWLVSKRQMDASISHYIEAGSTIKALEAAVGAKQWRKAVQ  899
             +E+ R V+P EVT+LEEEWGDWLVS++Q+DASI+HYIEAG+T KALEAAVGAKQWRKAVQ
Sbjct  840   LEIGRVVAPQEVTALEEEWGDWLVSRKQLDASINHYIEAGATQKALEAAVGAKQWRKAVQ  899

Query  900   IAKVIDDPIEIRKYAVQLSDHLNLLGDKKGAEDILVRAELYKEAVEMLNQSGQWERAYVI  959
             IAKV+D+P  I++YAV L+ HL   GD  GAED+LVRA L+K+A+E+LN+ G+WERAY+I
Sbjct  900   IAKVLDEPELIQRYAVDLAKHLAFAGDLDGAEDMLVRANLHKDAIELLNRHGKWERAYLI  959

Query  960   AEQYLGSDIVRDMFIEMAAKLEQDGKYRDCERVFIAINEPDLAISMYERLEQYDPMIRLV  1019
              E++L ++ VR++F+++A  LE+ GK+RD E+V IA+NEPDLAI+MY+R E YD MIRLV
Sbjct  960   GEKHLKAEQVRELFVQLAGTLEEQGKFRDAEKVLIAVNEPDLAIAMYKRRELYDSMIRLV  1019

Query  1020  ERYHKDLLDSTHLHIAKQLEAKSKYKMAEGHYIAAGDWKAVVHMYCSIGKWEEAHRTALQ  1079
             ERYHKDLLDSTHLH+A+QLE++ K K AE H++A+GDWK+ VHMYCS G+WE+ +R A  
Sbjct  1020  ERYHKDLLDSTHLHLARQLESRGKLKNAEMHFVASGDWKSAVHMYCSSGRWEDGYRVAKL  1079

Query  1080  KGTEDAANQVAYIWSRSLPLEGAARLLTKMNLIRTALLYACDAKQFEFALDLCRVTGHSS  1139
             KGTE A+ QVAY+W++S+P EGA RLL+K+ L+ TA+ +ACD+ QFEFA++LC+  G  +
Sbjct  1080  KGTEGASQQVAYMWAKSMPTEGAVRLLSKLGLLDTAVGFACDSGQFEFAMELCKFAGKPT  1139

Query  1140  DDVHLRMAMDLEDEGKFFEAEAEFLLANKPKEAILMYSHSRDWRSALRVAEKYLPEAVNE  1199
             D+VHL++AM LEDEGKF  AEAEFL ANKP+EAILMY H+ DW++AL VAE +LP+AV E
Sbjct  1140  DEVHLKIAMSLEDEGKFEAAEAEFLKANKPREAILMYQHAGDWQAALNVAENHLPDAVGE  1199

Query  1200  ILISQAAESLESQNYQEYEALLIRAERPDIVLQQYKESEMWPEAIRIAREYVPAALPDIQ  1259
             +LI QA+ +LE+ NY++YEALL+RA RPD++++ YK+  ++ +A+RIA E+ P+AL D++
Sbjct  1200  VLIGQASAALETSNYKDYEALLLRAHRPDLIIEHYKQESLYEDALRIAEEHYPSALNDLR  1259

Query  1260  RLQA--RNSKTSAMISND----SRALLHHASEFIRSEEFKKAALCLLKINSINA-DPTTV  1312
             RLQA  +  +  A    D    SR+ L  A+EF + E+F+KAA CL++I+S NA D +T+
Sbjct  1260  RLQAQLQRGQAQAQAGEDAASISRSYLQKAAEFAKKEQFRKAAECLMQIDSSNAEDASTL  1319

Query  1313  EQALIRAAEICNQNLDGDDATEVAGELGPRLVELSQFGPAAQLYLAAEMPKEAVDVFIQS  1372
             E+AL+RAAEICNQ L+G DA E+A  LGPRL+ + Q GPAAQLYLAA+MPK+AVDVFI++
Sbjct  1320  ERALLRAAEICNQFLEGQDAQELAQSLGPRLLAIKQIGPAAQLYLAADMPKQAVDVFIKT  1379

Query  1373  ENWGKARRLAKEINP--QLLTYVETQQKSRLRMENNVEQLADIDIIGALDLLAEQGQWTR  1430
             E W KARRLAKEI+P  QLL YVE QQK+ L+ E N+EQLADIDI+ ALDLLAE G+W R
Sbjct  1380  EQWSKARRLAKEIDPDLQLLAYVEQQQKASLKHEGNIEQLADIDIVSALDLLAEHGEWQR  1439

Query  1431  CIEKAKQHSSVVMHKYLAQYATQLIRENECVEALSAYMKYGAPPLPQNFNIYNRIAVECI  1490
             C+EKAK  +  ++ KY+A YA QLIRE  C  AL  Y+ YGAPP+  +FNIY RIA++C+
Sbjct  1440  CLEKAKGLNPALLQKYVAVYAAQLIREGNCTTALGLYLSYGAPPIEAHFNIYTRIALDCL  1499

Query  1491  GLRE--TDGMNVWKDLRLFLFNLTQSIKMSDAVIDGLDRF----EELLLIAHYYVTRAAC  1544
              LRE  T+    W+ LR FLF L QS+K + A      +F    E+ LLIAHYY TRAAC
Sbjct  1500  ALREEQTERGTTWRQLRDFLFRLLQSLKATPA--QSQTKFAASMEQFLLIAHYYATRAAC  1557

Query  1545  REISSLKVLAVKISVALLRYTEIIPVDKGFYEAGMDLRSVGRESEAFVILNHYLDVSEAI  1604
             +E+ +L+ +A+++S+ALLR+T+++PVDKGFYEAGMDLR  GRE+EAFV+LNHYLDV EAI
Sbjct  1558  KEVQALQPVALRLSLALLRHTDLLPVDKGFYEAGMDLRQAGREAEAFVMLNHYLDVCEAI  1617

Query  1605  -DGSDVLVDHLNLTATDFPSSVPIPSELHLKDDLGLHEEVREWVLSVSMDQRVDQVLPID  1663
              +GS  LVDH +L +TDFPSSVP+P ++HLK+D  LHEEVREWVL+VSMDQ+VDQ LP D
Sbjct  1618  EEGSGQLVDHSDLASTDFPSSVPLPEDIHLKNDPSLHEEVREWVLAVSMDQQVDQQLPTD  1677

Query  1664  ERNLFESSLGMSDQPCVITGYPVVGKQPIIFQRSQRQANRDAWSKISVAAKMEPHSNIPD  1723
             +R L+ESSLG +D PC+++G+PV G+QP+ FQ S  Q NRD WSK SVA KM P S I D
Sbjct  1678  DRGLYESSLGPNDLPCMLSGFPVRGRQPVTFQGSSNQVNRDVWSKFSVALKMSPGSGIAD  1737

Query  1724  VIEFIEKWCGVANFV  1738
             +I F EKW G AN+V
Sbjct  1738  IISFTEKWQGAANYV  1752


>OSM1_CAEEL unnamed protein product
Length=1737

 Score = 1142 bits (2954),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 630/1753 (36%), Positives = 1031/1753 (59%), Gaps = 43/1753 (2%)

Query  1     MHLKYLKTILDAQNQLSRIGGLTWAPNHQKLAVATADRSIILFDENGEKRDKFSTKPSGS  60
             M LKYL TIL AQ+  ++I  ++ +PN  + A+A +DRS+ L DENG ++D+F+ KP  +
Sbjct  1     MKLKYLSTILPAQDGEAKISNISCSPNGSRAAIACSDRSVALLDENGVQKDRFTCKPIDA  60

Query  61    VEGKTSYVIRALVFSPDSTSLAVAQSDNIVYVYKLGTTWKEKKVICNKFPQPTAVTVMVW  120
               GK S+ +  + FSPDS+ +A+ QSDN++++YK+GT+W EKKVI NKF QP+AVT + W
Sbjct  61    KYGKKSFTVLCMTFSPDSSRIAIGQSDNVLFIYKVGTSWNEKKVIVNKFVQPSAVTCLSW  120

Query  121   LSVGPIIIGLEDGKVRALNCKTNRSQNLYAAEHTVVSLAANVRGTGFVSGHEDGSVIRFF  180
                  I++G  DGKVR    KTN+  +LY  + TVVS+  + + T FVS H+DGS+I + 
Sbjct  121   PFDDKILVGQLDGKVRIGLIKTNKCSSLYKTDETVVSIQTHPKRTSFVSAHQDGSIILYN  180

Query  181   IVDETKFPSGRLFVHTSSPLALAWAQNDIVAAGCDRKVIFYNVQGQQSRVFDYSHDDNEK  240
                 T+    ++      P  L +  + +V A  DR+V+ Y   G   + FDY +D +EK
Sbjct  181   FSSRTQ---SKICTLQVPPYNLVFTNHGLVVATSDRRVLSYTENGVVQQQFDY-NDQSEK  236

Query  241   EFTSAECSPNGQSIAIGNYDQIRIYTWSPRQKTWTDVAKKEIKNLYSVSAMTWRSDGARL  300
             EF+S  C P  Q++ + +YD++R+++WS R+  W + A  EI+N Y++ A+ W+ DG+ +
Sbjct  237   EFSSISCDPTAQNVVVASYDRLRLFSWSARRGAWDEGAPLEIQNAYTIGALGWKMDGSTI  296

Query  301   VVGSICGAVLLFESVLKRTVWHDKFELTYVTHSQLLLKSLQESDSTVLVVESQLGLEIDD  360
               G++CG V   +  L+R +   +FE TYV  S ++L+ +     T ++  S  GL ID+
Sbjct  297   YAGTVCGGVFSVDCCLRRGMLKSRFETTYVAPSHVILRDVTNDTRTNVI--SNKGLAIDE  354

Query  361   VRFMGKDNYLVAHTEDSLILCDLTRNLTSELSWISSGHNEKFYFENPNVCFIFNAGELTL  420
             ++ MGKD Y++ +T  S+I+ D      SEL W S GH EKFYF+  N C I NAGE+T+
Sbjct  355   LKIMGKDRYVIGYTSSSIIIADTESQRFSELEWQSGGH-EKFYFDFNNCCLIINAGEVTV  413

Query  421   VEYGENSTLGSVRTEFVNPHVISVRIN--ERGNTRDNKKLAYLMDMKTISVVDLISQSII  478
             VEYG + +LG VRTE  +PH++SV+++  +    +  KKLAYL+D  TIS+++LI+    
Sbjct  414   VEYGVDGSLGWVRTELTSPHLLSVQVSGPDVEEHKKVKKLAYLVDPTTISIINLINGQQE  473

Query  479   AQINHESKIDWLELSETAHKILFRDKKMRLILFDIATSKKYNLMDKVSFVQWVPQSDVVV  538
             + INH   +DW+EL+E A K+L+RDK+ ++ L DI++ ++  L+   ++VQWVP SDV+V
Sbjct  474   SFINHTGAVDWIELNERASKLLYRDKRSKVTLVDISSDQRSVLLSFCTYVQWVPMSDVIV  533

Query  539   AQSDYNLAIWYNIDVPQHVTMVSIRGDVTHVVREEGTTEVKMKEGPTEHSYRLDQGLVEF  598
             AQS  NL+IWYN D+P+ VT + I+G+V  V+R+   TEV ++E   + +Y LD   +EF
Sbjct  534   AQSGDNLSIWYNPDLPEQVTNMKIKGEVEAVLRDADRTEVIVQEPTAKVAYELDNTQIEF  593

Query  599   GTAVNDNDFGKAIIFLESHDDKSAAKAMWHNLARIALYQQNMRVAQRCFVALGNASMAFY  658
             G A+   DF +A+ FLES+   + A +MW  +A +AL   N+ VAQRC+ A+ + +    
Sbjct  594   GAALEKRDFDRAVAFLESNTSGTDAYSMWIRVAEMALEHGNLFVAQRCYAAINDVAKVRK  653

Query  659   LGKTIKAAAEYGEEMPLGVQGN---EVRARMALVNCDLKSAERIYLDQGNIDAAISVYTR  715
             L   ++ A E    + +G  G    +VRA +A++    K AERI+L+Q + ++AI +YT 
Sbjct  654   LHDILEIADE--ASISIGGDGTHFYKVRAMLAIMGRKFKEAERIFLEQNDTESAIGMYTS  711

Query  716   LRLWDDAIKLAERRGYHGLNTLREQQMSFLLSTNQEELAGHALEESGDTDRAMTLYLKAN  775
             L  WD+A++LA+   Y     L+   +  L  T Q+  A       GDT  A+ LY+K+N
Sbjct  712   LHKWDEALELAKVLNYPEYEQLKTSYLRALSDTGQDSKAAELKVSDGDTLSAIQLYIKSN  771

Query  776   KPVKAARLALKWPSLLQDNDLMNRVAKSLIAFELYELAGDLSNKLRKPEAAIEMYRRGGA  835
             KP+ A   A     L QD +++ ++A SL+  +LY+ AGD+  KL+  + A+E +++G A
Sbjct  772   KPLSALSAANNDSVLSQDENILRQIADSLVKSQLYDKAGDVYEKLKDFDKAVEYFKKGDA  831

Query  836   YSRAIELARNVSPDEVTSLEEEWGDWLVSKRQMDASISHYIEAGSTIKALEAAVGAKQWR  895
             Y +AI+LAR   P++V +LE+EWG  L    Q DA+++H++EA    KA+EAA+ AK+W 
Sbjct  832   YGKAIQLARFAFPEKVVTLEQEWGLHLEYIGQYDAAVNHFVEANDLKKAVEAAIRAKEWP  891

Query  896   KAVQIAKVIDDPIEIRKYAVQLSDHLNLLGDKKGAEDILVRAELYKEAVEMLNQSGQWER  955
             KA+ I + I D      Y  +++DH +  GD + AE + V A L+ +A+ M  ++ +W  
Sbjct  892   KALSIVENIQDQKVRTGYYGEIADHYSNKGDFERAERLFVEAGLFNDAIMMYGKNNKWID  951

Query  956   AYVIAEQYLGSDIVRDMFIEMAAKLEQDGKYRDCERVFIAINEPDLAISMYERLEQYDPM  1015
             A+ ++E++ G +     ++  A  L++ G++ + E+++I I  P  AI MY+R+ + D +
Sbjct  952   AFRLSEEFHGREATISSYLAKAEDLDEHGRFAEAEQLYITIGMPHKAIQMYDRVGRDDDV  1011

Query  1016  IRLVERYHKDLLDSTHLHIAKQLEAKSKYKMAEGHYIAAGDWKAVVHMYCSIGKWEEAHR  1075
             +RLVERYH + +  T    A Q E +   K AE  ++ AGD+++ V+MY     W +A+R
Sbjct  1012  LRLVERYHGEHMHETRKRFATQYEERGDLKAAEEQFLKAGDFRSAVNMYKDSEMWSDAYR  1071

Query  1076  TALQKGTEDAANQVAYIWSRSLPLEGAARLLTKMNLIRTALLYACDAKQFEFALDLCRVT  1135
              A  +G E+   QV ++W++S+  + A +LL K  ++   + +AC+   F+ A DL R+ 
Sbjct  1072  IAKTEGGENMEKQVLFMWAKSIGGDAAVKLLNKHGMLMEGIDFACETGAFDLAFDLARIG  1131

Query  1136  GHSS-DDVHLRMAMDLEDEGKFFEAEAEFLLANKPKEAILMYSHSRDWRSALRVAEKYLP  1194
                    VH+R+A  LE+EG+  +A   ++  NKP+ A+ M+    DW  A RVA+ +  
Sbjct  1132  AKDRMGTVHVRLATQLEEEGRLEDASKHYVEGNKPELAVEMFIRDNDWADAERVAKDHCE  1191

Query  1195  EAVNEILISQAAESLESQNYQEYEALLIRAERPDIVLQQYKESEMWPEAIRIAREYVPAA  1254
               + ++   QA  ++E  ++   E  L+RA +PDI+L+ + E+EMWP+A+RIA+ Y+P  
Sbjct  1192  SLLPDVYTGQARRAIEEGDHLRAETFLLRANKPDIILRYFIENEMWPDALRIAQNYLPHQ  1251

Query  1255  LPDIQRLQARNSKTSAMISNDSRALLHHASEFIRSEEFKKAALCLLKINSINAD-PTTVE  1313
                IQ    ++   +     DS   +  A E+ +  +++KA   LLKIN  + D    ++
Sbjct  1252  AALIQEEYEKSELRNGARGVDS--FVAQAKEWEQQGDWRKAVSALLKINRDSTDNDALIK  1309

Query  1314  QALIRAAEICNQNLDGDDATEVAGELGPRLVELSQFGPAAQLYLAAEMPKEAVDVFIQSE  1373
              +  +AA++  + L GD+  E  G     L E +    AA+L L     ++A++   +++
Sbjct  1310  HSTEKAADLVMKFLMGDE--EYIGAALGALDEANCNEKAAELLLLFGQSRQAINALCRAK  1367

Query  1374  NWGKARRLAKEINPQLLTYVETQQKSRLRMENNVEQLADIDIIGALDLLAEQGQWTRCIE  1433
              W KA+++A+E  P+++  +E   K  L+ E  + +L D+D+I A+D++ E  QW + ++
Sbjct  1368  QWAKAKQVAQEYLPEMVPEIEKIYKESLKSEGRLGELIDVDVITAIDMMIENDQWDKALD  1427

Query  1434  KAK-QHSSVVMHKYLAQYATQLIRENECVEALSAYMKYGAPPLPQNFNIYNRIAVECIGL  1492
              AK Q+   ++ KY+AQYA  L+  N+    L+   +YGA   P NF+IY  +  E +  
Sbjct  1428  TAKSQNYRPLLDKYVAQYAAILVHRNDLSRVLAVLERYGASANPANFSIYKLLMEETLAK  1487

Query  1493  RETDGMNVW--KDLRLFLFNLTQSIKMSDAVIDGLDRFEELLLIAHYYVTRAACREISS-  1549
                D   +   +++ L ++N  Q  K S    +  + F   L   H    R A  EI   
Sbjct  1488  PRFDYTEIARVRNVHLDVYNALQ--KESS---EHFEEFSRALWALHLIAMRTALEEIGDS  1542

Query  1550  ---LKVLAVKISVALLRYTEIIPVDKGFYEAGMDLRSVGRESEA--FVILNHYLDVSEAI  1604
                ++ L +K S++LLRYT+I+  D+ FYEAG   +  G E E+  F++LNHYLD+ +AI
Sbjct  1543  VPEVQKLCLKQSLSLLRYTDILVADRIFYEAGAAAKDYGSEYESLGFLLLNHYLDLVDAI  1602

Query  1605  -DGSDVLVDHLNLTATDFPSSVPIPSELHLKDDLGLHEEVREWVLSVSMDQRVDQVLPID  1663
              +G+  LVD+     +D P+ V +P+   L+     HEE++EWVL+ S+D    + L  D
Sbjct  1603  EEGNGELVDYSPFENSDIPTEVSLPTRQWLES--AKHEEMKEWVLASSVDDAHAKELVYD  1660

Query  1664  ERNLFESSLG---MSDQPCVITGYPVVGKQPIIFQRSQRQANRDAWSKISVAAKMEPHSN  1720
             +R +FE+SL     + +PC++TGYPV+     I       A +D  +K  V  K     N
Sbjct  1661  KRGVFEASLKDKRGTAEPCLVTGYPVIESTVRI---GSMVAEKDNLNKFLVVIKSNQTEN  1717

Query  1721  IPDVIEFIEKWCG  1733
             + +V  F+ KW G
Sbjct  1718  LLNVQNFVAKWAG  1730


>Q38CC3_TRYB2 unnamed protein product
Length=1747

 Score = 1039 bits (2687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 637/1795 (35%), Positives = 995/1795 (55%), Gaps = 113/1795 (6%)

Query  1     MHLKYLKTILDAQNQLSRIGGLTWAPNHQKLAVATADRSIILFDENGEKRDKFSTKPSGS  60
             M +K+ KT++  Q  ++R   + W+PN+++LAVA  +R + L+DE+GE+RDKF TK +  
Sbjct  1     MQVKHYKTLMACQQGIARTQAICWSPNNKRLAVADNNRVVNLYDEHGERRDKFPTKAADG  60

Query  61    VEGKTSYVIRALVFSPDSTSLAVAQSDNIVYVYKLGTTWKEKKVICNKFPQPTAVTVMVW  120
               GK ++VI  + FSPDS+ +A+ QSD IV +Y++G  W EKK IC+KFPQ + VT + W
Sbjct  61    KNGK-AFVIEGMAFSPDSSKIAIGQSDGIVAIYRVGIEWGEKKAICSKFPQNSPVTCLCW  119

Query  121   ----LSVGPIIIGLEDGKVRALNCKTNRSQNLYAAEHTVVSLAANVRGTGFVSGHEDGSV  176
                   V  ++ G  DGKV+    K N+SQ LYA EH VVS+A++  G   +SGH DG+V
Sbjct  120   PETSQGVELVVFGTLDGKVKVGILKANKSQALYAHEHAVVSIASSPDGNKVISGHLDGAV  179

Query  177   IRF-FIVDETKFPSG--RLFVHTSSPLALAWAQNDIVAAGCDRKVIFYNVQGQQSRVFDY  233
              ++ F  ++    SG  +LF H   P  L W +N I AAG +  V FY+  GQ+ + FDY
Sbjct  180   YQYTFESEDAGGGSGSKKLFNHGHPPYVLLWGEN-ICAAGQNSFVTFYDRSGQKVQSFDY  238

Query  234   SHDDNEKEFTSAECSPNGQSIAIGNYDQIRIYTWSPRQKTWTDVAKKEIKNLYSVSAMTW  293
               +D E EFT    +P+G +I + + +Q+R++ ++ R + W + A   + N  S SA++W
Sbjct  239   KAED-EGEFTVGSFNPSGHAIVLASREQLRLFDFNLRSRKWEEGAVIRVPNSCSFSAISW  297

Query  294   RSDGARLVVGSICGAVLLFESVLKRTVWHDKFELTYVTHSQLLLKSLQESDSTVLVVESQ  353
             + DG+R V GS+ GAV +F+  LKR      FE TYV+H+Q+++K L  +  T +V+ S 
Sbjct  298   KYDGSRFVTGSLAGAVDMFDVCLKRYRLRGAFEFTYVSHNQVIVKRL--ATGTRIVLRSS  355

Query  354   LGLEIDDVRFMGKDNYLVAHTEDSLILCDLTRNLTSELSWISSGHNEKFYFENPNVCFIF  413
             LG E+  V  + +D YLVAHT  +L++ DL     SE+ W  SG  EKF F+NP VC +F
Sbjct  356   LGYEVQCVN-VHQDRYLVAHTSTTLLVGDLISCKLSEVPWQLSGR-EKFVFDNPQVCMVF  413

Query  414   NAGELTLVEYGENSTLGSVRTEFVNPHVISVRINERGNTRDN------KKLAYLMDMKTI  467
              AGEL L+EYG+N  LG+ RTE  N H ISVR+++   T +       K +AYL+D +T 
Sbjct  414   AAGELCLIEYGKNEILGTCRTEERNAHRISVRVHDPSITSEGEGQQGRKFIAYLIDRQTA  473

Query  468   SVVDLISQSIIAQINHESKIDWLELSETAHKILFRDKKMRLILFDIATSKKYNLMDKVSF  527
              + DL S + +A+++H+ +IDWLEL+  A+K+LFRDK+ +L L+D+    +  L++  ++
Sbjct  474   QIDDLSSGTAVARLSHQCRIDWLELNYRANKLLFRDKQHQLFLYDLEEQNRTTLLNYCTY  533

Query  528   VQWVPQSDVVVAQSDYNLAIWYNIDVPQHVTMVSIRGDVTHVVREEGTTEVKMKEGPTEH  587
             VQWVP SDVVVAQ+   L +WY+I+ P  V +V I+G+V  + R  G TEV + EG    
Sbjct  534   VQWVPGSDVVVAQNRVELCVWYSINSPDRVAVVPIKGEVEGIERGNGKTEVIVDEGVNTV  593

Query  588   SYRLDQGLVEFGTAVNDNDFGKAIIFLESHDDKSAAKAMWHNLARIALYQQNMRVAQRCF  647
             +Y LD+ L+EFGTA+ D+D+ KA   L+        +AMW NLA +AL +  + +AQRC+
Sbjct  594   AYGLDEALIEFGTAMEDHDYIKACDLLDQIALTPETEAMWANLASLALQELKLPIAQRCY  653

Query  648   VALGNASMAFYLGKTIKAAAEYGEEMPLGVQGNE---VRARMALVNCDLKSAERIYLDQG  704
              ALG+ +    L +  + A            G +   VRA ++++N D K AE++YL+  
Sbjct  654   AALGDMAKVNSLNQINELAVSEARSSGGATDGYDHYAVRAELSMLNKDYKQAEQLYLENA  713

Query  705   NIDAAISVYTRLRLWDDAIKLAERRGYHGLNTLREQQMSFLLSTNQEELAGHALEESGDT  764
              I+ A++++  L  +D++I +AE RG+  L   R +  ++L+ T Q E AG   E  G  
Sbjct  714   KIEDAMAMWEELNRFDESISIAEARGWPDLANKRTRYYNWLVETGQFEKAGEQKEREGKH  773

Query  765   DRAMTLYLKANKPVKAARLALKWPSLLQDNDLMNRVAKSLIAFELYELAGDLSNKLRKPE  824
             + A+ LYL+   P +AA + +   ++  ++ L+  +A SL   +++E AGD   KL+  +
Sbjct  774   NDAINLYLRGGTPARAANV-ISANNMKPESQLLEAIAASLFKAQVFEKAGDFFEKLKMND  832

Query  825   AAIEMYRRGGAYSRAIELARNVSPDEVTSLEEEWGDWLVSKRQMDASISHYIEAGSTIKA  884
              AI+ Y++G  YSRA+E A+   PD V +LEEEWGD+LVS++ +D +I+HYIEA    KA
Sbjct  833   RAIQAYKKGHVYSRAVEFAKRAVPDRVVALEEEWGDYLVSQKHVDQAINHYIEAKKYDKA  892

Query  885   LEAAVGAKQWRKAVQIAKV----IDDPIEIRKYAVQLSDHLNLLGDKKGAEDILVRAELY  940
             ++AA+ ++QW KA  I +      D+   ++ +   ++ H   L     AE   ++A   
Sbjct  893   VKAAIDSRQWSKAAHILESQTVGSDNDETVKGFYKNIARHYEELHQYGEAEKFYIKANAI  952

Query  941   KEAVEMLNQSGQWERAYVIAEQYLGSDIVRDMFIEMAAKLEQDGKYRDCERVFIAINEPD  1000
              EAV+M +++G  +  Y +A+++L    +  +F++ A +LE  G Y   ER+++ +NEPD
Sbjct  953   NEAVDMYSRAGMADHMYRVAQRHLSQQQLVALFVDQAKRLETKGDYAGAERIYVKVNEPD  1012

Query  1001  LAISMYERLEQYDPMIRLVERYHKDLLDSTHLHIAKQLEAKSKYKMAEGHYIAAGDWKAV  1060
              AI MY++   Y  MIRLV+ Y  D L  THL +A Q E +S YKMAE HY+A  DW   
Sbjct  1013  QAIVMYKKARDYTNMIRLVQAYRPDFLSKTHLSLAAQFEKESNYKMAETHYVAGKDWGRA  1072

Query  1061  VHMYCSIGKWEEAHRTALQKGTEDAANQVAYIWSRSLPLEG--AARLLTKMNLIRTALLY  1118
             V+MY     WE+A R A   G  +AA QV  + SR++ +E     RLL K + I   +  
Sbjct  1073  VNMYRDHEMWEDAVRVAKVHGGANAAKQV--VLSRAMVVEAEDGVRLLMKFSFINPGIEA  1130

Query  1119  ACDAKQFEFALDLCRVTGHSS-DDVHLRMAMDLEDEGKFFEAEAEFLLANKPKEAILMYS  1177
             A +A++F+ AL   ++   +    V+L+ AM  ED+G F  AE  FL + KP+EAI MY 
Sbjct  1131  ALEAQKFDLALQWAQLAQPAKLPYVYLKYAMYYEDQGDFRMAEEAFLKSGKPREAIDMYL  1190

Query  1178  HSRDWRSALRVAEKYLPEAVNEILISQAAESLESQNYQEYEALLIRAERPDIVLQQYKES  1237
             H  ++ +A+RVAE Y   A+  IL +Q     +  NY+E E+  IRA  P+ +L+ Y E+
Sbjct  1191  HQHEFENAMRVAEGYDQTAIPSILQAQGRACFQKSNYREAESFFIRANAPEPLLKLYMEN  1250

Query  1238  EMWPEAIRIAREYVPAALPDIQRLQARNSKTSAMISNDSR---ALLHHASEFIRSEEFKK  1294
              M+ +A R+A+EY P  L +I       +K  A+ S+D +   A+L    E+  + E   
Sbjct  1251  RMYTDAQRVAKEYYPDMLGEI-------AKRIALQSSDPQKAGAVLEEHGEYQMAVETYL  1303

Query  1295  AALCLLKINSINADPTTVEQALIRAAEICNQNLDGDDATEVAGELGPRLVELSQFGPAAQ  1354
              A      N     P  +    +RA ++  Q  D +    V      +L E  ++  A +
Sbjct  1304  GATAEQVQN-----PNVLANLWVRAVKVA-QKHDRNMLKNVLRVATGKLKEAQRYVEAGK  1357

Query  1355  LYLAAEMPKEAVDVFIQSENWGKARRLAKEINPQLLTYVETQQKSRLRMENNVE------  1408
                  E  K A++++++ + +  A  LAK I+P+L  YV+     R  ++N++E      
Sbjct  1358  CLEDCEDYKGAINMYVEGKKFDLAEYLAKHISPELEDYVK-----RAIVQNSIEGGGMKD  1412

Query  1409  --QLADIDIIGALDLLAEQGQWTRCIEKAKQHSSVVMHKYLAQYATQL-IRENECVEALS  1465
                + +ID   A         W   +  AKQ     M KY+A    +    + E   AL 
Sbjct  1413  AKMVEEIDPEAAFKAYIANNDWENALRMAKQRPPEEM-KYVAGLKMKYHANKGELGAALG  1471

Query  1466  AYMKYGAPPLPQNFNIY-------NRIAVECIGLRETDGMNVWKDLRLFLF-----NLTQ  1513
                +   P  P +F  Y       +RI  + + LR         DL+L  F     ++ +
Sbjct  1472  VVEEL--PLDPGDFRFYETWLEMADRILAQ-LPLRPD------SDLKLERFHTCFSDVVE  1522

Query  1514  SIKMSDAVIDGLDRFEELLLIAHYYVTRAACREISSLKVLAVKISVALLRYTEIIPVDKG  1573
             S+  S    + + +      I H Y   A  RE+ SL   A+K+ + L R+   I  +K 
Sbjct  1523  SMSRSGQKQEDVAKANAFAHIIHIYYMSARMREL-SLDDYALKLMLGLPRWIPHIAPEKA  1581

Query  1574  FYEAGMDLRSVGRESEAFVILNHYLDVSEAIDGSDV---LVDHLNLTATDFPSSVPIPSE  1630
             FY+AGM  R+ G+++ AF+ LN +LD+SE I+   V    +D+ +   TDFP   P+P  
Sbjct  1582  FYDAGMAARNSGQDAIAFLYLNRFLDISEKIEDGAVDSSAIDNGDFDCTDFPKKYPMPKS  1641

Query  1631  LHLKDDLGLHEEVREWVLSVSMDQRVDQVLPI-----DERNLFESSL----GMSDQPCVI  1681
               ++      EEV  WVL++S+D  +D  LP       +  +FE SL    G++   C +
Sbjct  1642  SSVEKT--SEEEVNRWVLAISIDNSLDPHLPTVTDPQGQVEMFEGSLQSPAGVTYPECAV  1699

Query  1682  TGYPVVGKQPIIFQRSQRQANRDAWSKISVAAKMEPHSNIPDVIEFIEKWCGVAN  1736
             TGYP+VG   +  +  QR AN+D W++    AK  P             WCG A+
Sbjct  1700  TGYPIVGGGVVKCRNCQRPANQDDWTRYITLAKACP-------------WCGAAD  1741



Lambda      K        H
   0.317    0.133    0.388 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 57319460198


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jul 7, 2021  1:54 PM
  Number of letters in database: 17,197,330
  Number of sequences in database:  25,232



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= XP_037024196.1 Down syndrome cell adhesion molecule-like protein
Dscam2 isoform X1 [Bradysia coprophila]

Length=2031
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q0E9K5_DROME  unnamed protein product                                 3337    0.0  
Q0E9J0_DROME  unnamed protein product                                 3332    0.0  
Q0E9H6_DROME  unnamed protein product                                 3319    0.0  


>Q0E9K5_DROME unnamed protein product
Length=2032

 Score = 3337 bits (8652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1641/2051 (80%), Positives = 1802/2051 (88%), Gaps = 46/2051 (2%)

Query  3     QRTKWITKIIFIAV-LVDLGS---TANT-EADTKGPMFLKEPINRIDFSNSTGSVVECRA  57
             +R KW+  ++F AV L+  GS    AN  +AD KGP+FLKEP NRIDFSNSTG+ +EC+A
Sbjct  6     ERLKWL--MLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAEIECKA  63

Query  58    SGNPAPEIIWVRSDGTAVGDVPGLRQVLSNGNLVFPPFRAEDYRQEVHAQVYACLAKNQF  117
             SGNP PEIIW+RSDGTAVGDVPGLRQ+ S+G LVFPPFRAEDYRQEVHAQVYACLA+NQF
Sbjct  64    SGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQF  123

Query  118   GSIISRDVNVRAVVHQFYQSEVNNEYVIRGNSAVLRCSIPSFVGDYVTVLSWQDENGNLY  177
             GSIISRDV+VRAVV+QFY++E+  EYVIRGN+AVL+CSIPSFV D+V V SW D+ GN+ 
Sbjct  124   GSIISRDVHVRAVVNQFYEAEIMTEYVIRGNAAVLKCSIPSFVADFVRVESWIDDEGNVL  183

Query  178   GSLDDNSKDNFDGKYLVLPSGELHIKEVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI  237
                  +  DN+DGKYLVLPSGELHI+EVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI
Sbjct  184   -----SFSDNYDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI  238

Query  238   TEPVGSVAPKVNVADKGHISSARTGHTTDILCPAQGYPMPAFRWYKFIEGTTRKQAVVLN  297
             TEPVGSVAPKV+V D+        G    +LCPAQ YPMP +RWYKFIEGTTRKQAVVLN
Sbjct  239   TEPVGSVAPKVDVKDRITWLDKPMGQALSLLCPAQSYPMPVYRWYKFIEGTTRKQAVVLN  298

Query  298   DRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPSQVVDFG  357
             DRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPP+Q VDFG
Sbjct  299   DRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFG  358

Query  358   RPAVFTCHFSGNPIKTVSWLKDGKKIGHTDAILRIESVKKEHKGMYQCFIRNDQESAEAS  417
             RPAVFTC ++GNPIKTVSW+KDGK IGH++ +LRIESVKKE KGMYQCF+RNDQESAEAS
Sbjct  359   RPAVFTCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEAS  418

Query  418   AELKLGGRFDPPIIRQAFPEETLHPGPSVFLKCVAGGLPTPEISWELDGKKIANSERYQV  477
             AELKLGGRFDPP+IRQAF EET+ PGPSVFLKCVAGG PTPEISWELDGKKIAN++RYQV
Sbjct  419   AELKLGGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQV  478

Query  478   GQYVTVNGDVVSYLNITSIHANDGGLYKCIASSKVGVAEHSAKLNVYGLPYIRPMEKKAI  537
             GQYVTVNGDVVSYLNITS+HANDGGLYKCIA SKVGVAEHSAKLNVYGLPYIR MEKKAI
Sbjct  479   GQYVTVNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKAI  538

Query  538   VAGENLIVTCPVAGYPIESIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCV  597
             VAGE LIVTCPVAGYPI+SIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCV
Sbjct  539   VAGETLIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCV  598

Query  598   AKNSEGYSARGALEVQVMVRPLITPFDFGDEPTNTGEMAGVQCMIAKGDLPLDIFWTLNS  657
             AKN EGYSARG+LEVQVMV P I PF FGD+P NTGE AGVQCM+ KGD+P+ I WTLNS
Sbjct  599   AKNQEGYSARGSLEVQVMVPPSIAPFSFGDDPVNTGENAGVQCMVQKGDVPITIKWTLNS  658

Query  658   QPLVSGEDHIVITKLNSRTSSLSIESLTSHHRGTYQCIARNKAGFSYHSSELKVNVPPRW  717
             +P+++GE+ I I KL+ +TS L+I ++   HRG ++CIA NKAG S+ +SELKVNVPPRW
Sbjct  659   RPIINGEEGITILKLSPKTSVLNIAAVEQDHRGVFKCIAENKAGSSFTTSELKVNVPPRW  718

Query  718   ILEPTDKAFAQGSDAKVECKSDGFPKPQVTWKKAVGDTPGEYKDMKQSNNIRVDEGTLYI  777
             ILEPTDKAFAQGSDAKVECK+DGFPKPQVTWKKAVGDTPGEYKD+K+S+NIRV+EGTL++
Sbjct  719   ILEPTDKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHV  778

Query  778   DNIQKNNEGYYLCEAINGIGSGLSAVILISVQAPPEFVEKLRNQTARRSEPAVLQCEAKG  837
             DNIQK NEGYYLCEAINGIGSGLSAVI+ISVQAPPEF EKLRNQTARR EPAVLQCEAKG
Sbjct  779   DNIQKTNEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKG  838

Query  838   EKPIGILWNMNNMRLDPKTDNRYTIREEILSTGVMSSLSIKRTERTDSALFTCVATNAFG  897
             EKPIGILWNMNNMRLDPK DNRYTIREEILSTGVMSSLSIKRTER+DSALFTCVATNAFG
Sbjct  839   EKPIGILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAFG  898

Query  898   SDDASINMIIQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLKRYIIEFKTSRGSWEH  957
             SDDASINMI+QEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPL RYIIEFK SR SW  
Sbjct  899   SDDASINMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWS-  957

Query  958   DVDRVIVPGHTNEAQVQKLNPATTYNIRIVAENEIGVSDSSEVVPIITAEEAPSGKPQSI  1017
             ++DRVIVPGHT EAQVQKL+PATTYNIRIVAEN IG S SSE V IITAEEAPSGKPQ+I
Sbjct  958   EIDRVIVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNI  1017

Query  1018  KVEPLSQTSLRVLWKAPPRSDWNGEILGYYVGYKLTNNNGSYYFEDYKYMMEEGKEYSYE  1077
             KVEP++QT++RV WK PPR++WNGEILGYYVGYKL+N N SY FE   ++ EEGKE++ E
Sbjct  1018  KVEPVNQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLE  1077

Query  1078  LTNLKTYTQYSVVIQAYNKVGAGPLSEDEKQYTAEGTPDQPPSDITCTTLTSQTIRVSWV  1137
             L NL+ YTQYSVVIQA+NK+GAGPLSE+EKQ+TAEGTP QPPSD  CTTLTSQTIRV WV
Sbjct  1078  LQNLRVYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWV  1137

Query  1138  SPPLESANGVIKGYKVVYAPSELWYDDKNKDYKKTASSDTVLHGLKKYTNYTMQVLATTS  1197
             SPPLESANGVIK YKVVYAPS+ WYD+  + YKKTASSDTVLHGLKKYTNYTMQVLATT+
Sbjct  1138  SPPLESANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTA  1197

Query  1198  GGDGVRSPPIHCQTEQDVPEAPTAVKALVVGSEAILVSWLPPAQPNGLITQYTVYSKEEG  1257
             GGDGVRS PIHCQTE DVPEAPT VKALV+G+ AILVSW PPAQPNG+ITQYTVYSK EG
Sbjct  1198  GGDGVRSVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEG  1257

Query  1258  TESEVKSHKVPPYQMSYEASSLDKNKPFEFWVTANTNIGEGQASKSIVAMPSDKVPAKIA  1317
              E+E K+ KVP YQMS+EA+ L+KNKP+EFWVTA+T IGEGQ SKSIVAMPSD+VPAKIA
Sbjct  1258  AETETKTQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIA  1317

Query  1318  SFDDTFTAIFKEDFKLPCLAVGAPAPDITWKVKGVEFVPNDRVRQLPEGSLSIKDVIRQD  1377
             SFDDTFTA FKED K+PCLAVGAP P+ITWK+KGVEF  NDR+R LP+GSL IK V RQD
Sbjct  1318  SFDDTFTATFKEDAKMPCLAVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNRQD  1377

Query  1378  AGDYTCMAENSIAKDSITHKLIVLAPPQSPQVLLTATTTDSLTLKLKQHDGDTAPIHGYT  1437
             AGDY+C AENSIAKDSITHKLIVLAPPQSP V L+ATTTD+LT+KLK H+GDTAP+HGYT
Sbjct  1378  AGDYSCHAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGYT  1437

Query  1438  LHYKPEFGDWETVEVAVDAQKYTIENLFCGSRYQVYATGYNNIGAGEASDILNTRTKGSK  1497
             LHYKPEFG+WET EV+VD+QK+ IE L CGSRYQVYATG+NNIGAGEASDILNTRTKG K
Sbjct  1438  LHYKPEFGEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKGQK  1497

Query  1498  PMMPENSKFIDPSSNTVTLHLPTWKDGGCRMSHFVVEYKKKDHAEWTQISNNVKPGGNFV  1557
             P +PE  +FI+ SSN+V+LH   WKDGGC MSHFVVE KK+D  EW QISNNVKP  N+V
Sbjct  1498  PKLPEKPRFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKRDQIEWNQISNNVKPDNNYV  1557

Query  1558  VLDLDAASWYSVRITAHNSAGFTVAEYEFATLTVTGGTLAPPLNTAVLNGKTY----LPP  1613
             VLDL+ A+WY++RITAHNSAGFTVAEY+FATLTVTGGT+A PL+    +G  +    LP 
Sbjct  1558  VLDLEPATWYNLRITAHNSAGFTVAEYDFATLTVTGGTIA-PLDDGSGHGNVHTRIRLPA  1616

Query  1614  WMPQWFDLNFMVPLIATIIVVFVGVLVICVALSRRRMEDPRGGPKDVYYDVVYNQPMGPG  1673
             WMP+W DLNFMVPLIAT++VV VG+ V+CVALSRRR +D RGG KDVYYDVVYNQ MGPG
Sbjct  1617  WMPEWLDLNFMVPLIATVVVVAVGICVVCVALSRRRADDMRGGQKDVYYDVVYNQTMGPG  1676

Query  1674  ATMDKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRGTVISRSMRSNHSTWDPRR-  1732
             AT+DKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG      +RSNHSTWDPRR 
Sbjct  1677  ATLDKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG---RGGLRSNHSTWDPRRN  1733

Query  1733  -PLYEELKPPPVPRR-----HYHGSDECYHTHPHPHPAGMEDEICPYATFHLLGFREEMD  1786
               LYEELK PPVP       H HG+ EC++ HP     GMEDEICPYATFHLLGFREEMD
Sbjct  1734  PNLYEELKAPPVPMHGNHYGHAHGNAECHYRHP-----GMEDEICPYATFHLLGFREEMD  1788

Query  1787  PTKAMNFQTFPHQNGHTG--PGHA-TMGPGGPPGHIHSRSGSQSMPRQNRYARKNSQGGQ  1843
             PTKAMNFQTFPHQNGH G  PGHA TM P G PGH+HSRSGSQSMPR NRY RKNSQGGQ
Sbjct  1789  PTKAMNFQTFPHQNGHAGPVPGHAGTMLPPGHPGHVHSRSGSQSMPRANRYQRKNSQGGQ  1848

Query  1844  SSIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYGGPGPEYDDPANCAPEDDQYGSQY  1903
             SSIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLY GPGPEYDDPANCAPE+DQYGSQY
Sbjct  1849  SSIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYSGPGPEYDDPANCAPEEDQYGSQY  1908

Query  1904  GAPYG--YDHYGSRGSVGRRSVGSARNLPNGSPEPPPPPPRNHDTSNSSFNDSKESNEIS  1961
             G PYG  YDHYGSRGS+GRRS+GSARN  NGSPEPPPPPPRNHD SNSSFNDSKESNEIS
Sbjct  1909  GGPYGQPYDHYGSRGSMGRRSIGSARNPGNGSPEPPPPPPRNHDMSNSSFNDSKESNEIS  1968

Query  1962  EAECDRDH-PRGNYGENENSGDAKRSANTKDVRTTEEMRKLIDSRKSNEVAAKLQQQGGP  2020
             EAECDRDH PRGNYG        KRS   KD RTTEEMRKLI+  ++     +LQQ  G 
Sbjct  1969  EAECDRDHGPRGNYGA------VKRSPQPKDQRTTEEMRKLIERNETGPKQLQLQQANG-  2021

Query  2021  AGLTAYDTLAV  2031
             AG TAYDT+AV
Sbjct  2022  AGFTAYDTMAV  2032


>Q0E9J0_DROME unnamed protein product
Length=2035

 Score = 3332 bits (8640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1642/2051 (80%), Positives = 1797/2051 (88%), Gaps = 43/2051 (2%)

Query  3     QRTKWITKIIFIAV-LVDLGS---TANT-EADTKGPMFLKEPINRIDFSNSTGSVVECRA  57
             +R KW+  ++F AV L+  GS    AN  +AD KGP+FLKEP NRIDFSNSTG+ +EC+A
Sbjct  6     ERLKWL--MLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAEIECKA  63

Query  58    SGNPAPEIIWVRSDGTAVGDVPGLRQVLSNGNLVFPPFRAEDYRQEVHAQVYACLAKNQF  117
             SGNP PEIIW+RSDGTAVGDVPGLRQ+ S+G LVFPPFRAEDYRQEVHAQVYACLA+NQF
Sbjct  64    SGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQF  123

Query  118   GSIISRDVNVRAVVHQFYQSEVNNEYVIRGNSAVLRCSIPSFVGDYVTVLSWQDENGNLY  177
             GSIISRDV+VRAVV QFY+SEVNNEYVIRGN+AVL+CSIPSFV D+V V+SWQDE G LY
Sbjct  124   GSIISRDVHVRAVVQQFYESEVNNEYVIRGNAAVLKCSIPSFVADFVQVVSWQDEEGQLY  183

Query  178   GSLDDNSKDNFDGKYLVLPSGELHIKEVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI  237
             GSL D  +   DGKYLVLPSGELHI+EVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI
Sbjct  184   GSLGD--QQGTDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI  241

Query  238   TEPVGSVAPKVNVADKGHISSARTGHTTDILCPAQGYPMPAFRWYKFIEGTTRKQAVVLN  297
             TEPVG+ AP  +   K          +  +LC AQ +P+P  RWYKFIEGTTRKQAVVLN
Sbjct  242   TEPVGAKAPTFSGESKSFTFVKEISTSFALLCQAQAFPVPIIRWYKFIEGTTRKQAVVLN  301

Query  298   DRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPSQVVDFG  357
             DRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPP+Q VDFG
Sbjct  302   DRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFG  361

Query  358   RPAVFTCHFSGNPIKTVSWLKDGKKIGHTDAILRIESVKKEHKGMYQCFIRNDQESAEAS  417
             RPAVFTC ++GNPIKTVSW+KDGK IGH++ +LRIESVKKE KGMYQCF+RNDQESAEAS
Sbjct  362   RPAVFTCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEAS  421

Query  418   AELKLGGRFDPPIIRQAFPEETLHPGPSVFLKCVAGGLPTPEISWELDGKKIANSERYQV  477
             AELKLGGRFDPP+IRQAF EET+ PGPSVFLKCVAGG PTPEISWELDGKKIAN++RYQV
Sbjct  422   AELKLGGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQV  481

Query  478   GQYVTVNGDVVSYLNITSIHANDGGLYKCIASSKVGVAEHSAKLNVYGLPYIRPMEKKAI  537
             GQYVTVNGDVVSYLNITS+HANDGGLYKCIA SKVGVAEHSAKLNVYGLPYIR MEKKAI
Sbjct  482   GQYVTVNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKAI  541

Query  538   VAGENLIVTCPVAGYPIESIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCV  597
             VAGE LIVTCPVAGYPI+SIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCV
Sbjct  542   VAGETLIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCV  601

Query  598   AKNSEGYSARGALEVQVMVRPLITPFDFGDEPTNTGEMAGVQCMIAKGDLPLDIFWTLNS  657
             AKN EGYSARG+LEVQVMV P I  FDFG E  NTGEMAG  CM+ KGDLP++I WTLNS
Sbjct  602   AKNQEGYSARGSLEVQVMVPPQIQAFDFGSEAANTGEMAGGFCMVPKGDLPMEIRWTLNS  661

Query  658   QPLVSGEDHIVITKLNSRTSSLSIESLTSHHRGTYQCIARNKAGFSYHSSELKVNVPPRW  717
              P+++GE    +++LN RTSSLSI+SL + HRG Y+CIA NKAG + +S+EL VNVPPRW
Sbjct  662   APIITGEHGFSLSRLNPRTSSLSIDSLEARHRGLYRCIASNKAGSAEYSAELHVNVPPRW  721

Query  718   ILEPTDKAFAQGSDAKVECKSDGFPKPQVTWKKAVGDTPGEYKDMKQSNNIRVDEGTLYI  777
             ILEPTDKAFAQGSDAKVECK+DGFPKPQVTWKKAVGDTPGEYKD+K+S+NIRV+EGTL++
Sbjct  722   ILEPTDKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHV  781

Query  778   DNIQKNNEGYYLCEAINGIGSGLSAVILISVQAPPEFVEKLRNQTARRSEPAVLQCEAKG  837
             DNIQK NEGYYLCEAINGIGSGLSAVI+ISVQAPPEF EKLRNQTARR EPAVLQCEAKG
Sbjct  782   DNIQKTNEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKG  841

Query  838   EKPIGILWNMNNMRLDPKTDNRYTIREEILSTGVMSSLSIKRTERTDSALFTCVATNAFG  897
             EKPIGILWNMNNMRLDPK DNRYTIREEILSTGVMSSLSIKRTER+DSALFTCVATNAFG
Sbjct  842   EKPIGILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAFG  901

Query  898   SDDASINMIIQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLKRYIIEFKTSRGSWEH  957
             SDDASINMI+QEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPL RYIIEFK SR SW  
Sbjct  902   SDDASINMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWS-  960

Query  958   DVDRVIVPGHTNEAQVQKLNPATTYNIRIVAENEIGVSDSSEVVPIITAEEAPSGKPQSI  1017
             ++DRVIVPGHT EAQVQKL+PATTYNIRIVAEN IG S SSE V IITAEEAPSGKPQ+I
Sbjct  961   EIDRVIVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNI  1020

Query  1018  KVEPLSQTSLRVLWKAPPRSDWNGEILGYYVGYKLTNNNGSYYFEDYKYMMEEGKEYSYE  1077
             KVEP++QT++RV WK PPR++WNGEILGYYVGYKL+N N SY FE   ++ EEGKE++ E
Sbjct  1021  KVEPVNQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLE  1080

Query  1078  LTNLKTYTQYSVVIQAYNKVGAGPLSEDEKQYTAEGTPDQPPSDITCTTLTSQTIRVSWV  1137
             L NL+ YTQYSVVIQA+NK+GAGPLSE+EKQ+TAEGTP QPPSD  CTTLTSQTIRV WV
Sbjct  1081  LQNLRVYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWV  1140

Query  1138  SPPLESANGVIKGYKVVYAPSELWYDDKNKDYKKTASSDTVLHGLKKYTNYTMQVLATTS  1197
             SPPLESANGVIK YKVVYAPS+ WYD+  + YKKTASSDTVLHGLKKYTNYTMQVLATT+
Sbjct  1141  SPPLESANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTA  1200

Query  1198  GGDGVRSPPIHCQTEQDVPEAPTAVKALVVGSEAILVSWLPPAQPNGLITQYTVYSKEEG  1257
             GGDGVRS PIHCQTE DVPEAPT VKALV+G+ AILVSW PPAQPNG+ITQYTVYSK EG
Sbjct  1201  GGDGVRSVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEG  1260

Query  1258  TESEVKSHKVPPYQMSYEASSLDKNKPFEFWVTANTNIGEGQASKSIVAMPSDKVPAKIA  1317
              E+E K+ KVP YQMS+EA+ L+KNKP+EFWVTA+T IGEGQ SKSIVAMPSD+VPAKIA
Sbjct  1261  AETETKTQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIA  1320

Query  1318  SFDDTFTAIFKEDFKLPCLAVGAPAPDITWKVKGVEFVPNDRVRQLPEGSLSIKDVIRQD  1377
             SFDDTFTA FKED K+PCLAVGAP P+ITWK+KGVEF  NDR+R LP+GSL IK V RQD
Sbjct  1321  SFDDTFTATFKEDAKMPCLAVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNRQD  1380

Query  1378  AGDYTCMAENSIAKDSITHKLIVLAPPQSPQVLLTATTTDSLTLKLKQHDGDTAPIHGYT  1437
             AGDY+C AENSIAKDSITHKLIVLAPPQSP V L+ATTTD+LT+KLK H+GDTAP+HGYT
Sbjct  1381  AGDYSCHAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGYT  1440

Query  1438  LHYKPEFGDWETVEVAVDAQKYTIENLFCGSRYQVYATGYNNIGAGEASDILNTRTKGSK  1497
             LHYKPEFG+WET EV+VD+QK+ IE L CGSRYQVYATG+NNIGAGEASDILNTRTKG K
Sbjct  1441  LHYKPEFGEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKGQK  1500

Query  1498  PMMPENSKFIDPSSNTVTLHLPTWKDGGCRMSHFVVEYKKKDHAEWTQISNNVKPGGNFV  1557
             P +PE  +FI+ SSN+V+LH   WKDGGC MSHFVVE KK+D  EW QISNNVKP  N+V
Sbjct  1501  PKLPEKPRFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKRDQIEWNQISNNVKPDNNYV  1560

Query  1558  VLDLDAASWYSVRITAHNSAGFTVAEYEFATLTVTGGTLAPPLNTAVLNGKTY----LPP  1613
             VLDL+ A+WY++RITAHNSAGFTVAEY+FATLTVTGGT+A PL+    +G  +    LP 
Sbjct  1561  VLDLEPATWYNLRITAHNSAGFTVAEYDFATLTVTGGTIA-PLDDGSGHGNVHTRIRLPA  1619

Query  1614  WMPQWFDLNFMVPLIATIIVVFVGVLVICVALSRRRMEDPRGGPKDVYYDVVYNQPMGPG  1673
             WMP+W DLNFMVPLIAT++VV VG+ V+CVALSRRR +D RGG KDVYYDVVYNQ MGPG
Sbjct  1620  WMPEWLDLNFMVPLIATVVVVAVGICVVCVALSRRRADDMRGGQKDVYYDVVYNQTMGPG  1679

Query  1674  ATMDKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRGTVISRSMRSNHSTWDPRR-  1732
             AT+DKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG      +RSNHSTWDPRR 
Sbjct  1680  ATLDKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG---RGGLRSNHSTWDPRRN  1736

Query  1733  -PLYEELKPPPVPRR-----HYHGSDECYHTHPHPHPAGMEDEICPYATFHLLGFREEMD  1786
               LYEELK PPVP       H HG+ EC++ HP     GMEDEICPYATFHLLGFREEMD
Sbjct  1737  PNLYEELKAPPVPMHGNHYGHAHGNAECHYRHP-----GMEDEICPYATFHLLGFREEMD  1791

Query  1787  PTKAMNFQTFPHQNGHTG--PGHA-TMGPGGPPGHIHSRSGSQSMPRQNRYARKNSQGGQ  1843
             PTKAMNFQTFPHQNGH G  PGHA TM P G PGH+HSRSGSQSMPR NRY RKNSQGGQ
Sbjct  1792  PTKAMNFQTFPHQNGHAGPVPGHAGTMLPPGHPGHVHSRSGSQSMPRANRYQRKNSQGGQ  1851

Query  1844  SSIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYGGPGPEYDDPANCAPEDDQYGSQY  1903
             SSIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLY GPGPEYDDPANCAPE+DQYGSQY
Sbjct  1852  SSIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYSGPGPEYDDPANCAPEEDQYGSQY  1911

Query  1904  GAPYG--YDHYGSRGSVGRRSVGSARNLPNGSPEPPPPPPRNHDTSNSSFNDSKESNEIS  1961
             G PYG  YDHYGSRGS+GRRS+GSARN  NGSPEPPPPPPRNHD SNSSFNDSKESNEIS
Sbjct  1912  GGPYGQPYDHYGSRGSMGRRSIGSARNPGNGSPEPPPPPPRNHDMSNSSFNDSKESNEIS  1971

Query  1962  EAECDRDH-PRGNYGENENSGDAKRSANTKDVRTTEEMRKLIDSRKSNEVAAKLQQQGGP  2020
             EAECDRDH PRGNYG        KRS   KD RTTEEMRKLI+  ++     +LQQ  G 
Sbjct  1972  EAECDRDHGPRGNYGA------VKRSPQPKDQRTTEEMRKLIERNETGPKQLQLQQANG-  2024

Query  2021  AGLTAYDTLAV  2031
             AG TAYDT+AV
Sbjct  2025  AGFTAYDTMAV  2035


>Q0E9H6_DROME unnamed protein product
Length=2032

 Score = 3319 bits (8605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1633/2052 (80%), Positives = 1796/2052 (88%), Gaps = 48/2052 (2%)

Query  3     QRTKWITKIIFIAV-LVDLGS---TANT-EADTKGPMFLKEPINRIDFSNSTGSVVECRA  57
             +R KW+  ++F AV L+  GS    AN  +AD KGP+FLKEP NRIDFSNSTG+ +EC+A
Sbjct  6     ERLKWL--MLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAEIECKA  63

Query  58    SGNPAPEIIWVRSDGTAVGDVPGLRQVLSNGNLVFPPFRAEDYRQEVHAQVYACLAKNQF  117
             SGNP PEIIW+RSDGTAVGDVPGLRQ+ S+G LVFPPFRAEDYRQEVHAQVYACLA+NQF
Sbjct  64    SGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQF  123

Query  118   GSIISRDVNVRAVVHQFYQSEVNNEYVIRGNSAVLRCSIPSFVGDYVTVLSWQ-DENGNL  176
             GSIISRDV+VRAVV Q+Y+++VN E+VIRGNSAV++C IPSFV D+V V+SW  DE  N 
Sbjct  124   GSIISRDVHVRAVVAQYYEADVNKEHVIRGNSAVIKCLIPSFVADFVEVVSWHTDEEENY  183

Query  177   YGSLDDNSKDNFDGKYLVLPSGELHIKEVGPEDGYKSYQCRTKHRLTGETRLSATKGRLV  236
             +   +      +DGKYLVLPSGELHI+EVGPEDGYKSYQCRTKHRLTGETRLSATKGRLV
Sbjct  184   FPGAE------YDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLV  237

Query  237   ITEPVGSVAPKVNVADKGHISSARTGHTTDILCPAQGYPMPAFRWYKFIEGTTRKQAVVL  296
             ITEPVGSV PK+   D       R   +  +LCPAQ YP+P +RWYKFIEGTTRKQAVVL
Sbjct  238   ITEPVGSVGPKLTSGDDSRTVRIRQEDSVTLLCPAQAYPVPVYRWYKFIEGTTRKQAVVL  297

Query  297   NDRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPSQVVDF  356
             NDRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPP+Q VDF
Sbjct  298   NDRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDF  357

Query  357   GRPAVFTCHFSGNPIKTVSWLKDGKKIGHTDAILRIESVKKEHKGMYQCFIRNDQESAEA  416
             GRPAVFTC ++GNPIKTVSW+KDGK IGH++ +LRIESVKKE KGMYQCF+RNDQESAEA
Sbjct  358   GRPAVFTCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEA  417

Query  417   SAELKLGGRFDPPIIRQAFPEETLHPGPSVFLKCVAGGLPTPEISWELDGKKIANSERYQ  476
             SAELKLGGRFDPP+IRQAF EET+ PGPSVFLKCVAGG PTPEISWELDGKKIAN++RYQ
Sbjct  418   SAELKLGGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQ  477

Query  477   VGQYVTVNGDVVSYLNITSIHANDGGLYKCIASSKVGVAEHSAKLNVYGLPYIRPMEKKA  536
             VGQYVTVNGDVVSYLNITS+HANDGGLYKCIA SKVGVAEHSAKLNVYGLPYIR MEKKA
Sbjct  478   VGQYVTVNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKA  537

Query  537   IVAGENLIVTCPVAGYPIESIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTC  596
             IVAGE LIVTCPVAGYPI+SIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTC
Sbjct  538   IVAGETLIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTC  597

Query  597   VAKNSEGYSARGALEVQVMVRPLITPFDFGDEPTNTGEMAGVQCMIAKGDLPLDIFWTLN  656
             VAKN EGYSARG+LEVQVMV P I PF FGD+P NTGE AGVQCM+ KGD+P+ I WTLN
Sbjct  598   VAKNQEGYSARGSLEVQVMVPPSIAPFSFGDDPVNTGENAGVQCMVQKGDVPITIKWTLN  657

Query  657   SQPLVSGEDHIVITKLNSRTSSLSIESLTSHHRGTYQCIARNKAGFSYHSSELKVNVPPR  716
             S+P+++GE+ I I KL+ +TS L+I ++   HRG ++CIA NKAG S+ +SELKVNVPPR
Sbjct  658   SRPIINGEEGITILKLSPKTSVLNIAAVEQDHRGVFKCIAENKAGSSFTTSELKVNVPPR  717

Query  717   WILEPTDKAFAQGSDAKVECKSDGFPKPQVTWKKAVGDTPGEYKDMKQSNNIRVDEGTLY  776
             WILEPTDKAFAQGSDAKVECK+DGFPKPQVTWKKAVGDTPGEYKD+K+S+NIRV+EGTL+
Sbjct  718   WILEPTDKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLH  777

Query  777   IDNIQKNNEGYYLCEAINGIGSGLSAVILISVQAPPEFVEKLRNQTARRSEPAVLQCEAK  836
             +DNIQK NEGYYLCEAINGIGSGLSAVI+ISVQAPPEF EKLRNQTARR EPAVLQCEAK
Sbjct  778   VDNIQKTNEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAK  837

Query  837   GEKPIGILWNMNNMRLDPKTDNRYTIREEILSTGVMSSLSIKRTERTDSALFTCVATNAF  896
             GEKPIGILWNMNNMRLDPK DNRYTIREEILSTGVMSSLSIKRTER+DSALFTCVATNAF
Sbjct  838   GEKPIGILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAF  897

Query  897   GSDDASINMIIQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLKRYIIEFKTSRGSWE  956
             GSDDASINMI+QEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPL RYIIEFK SR SW 
Sbjct  898   GSDDASINMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWS  957

Query  957   HDVDRVIVPGHTNEAQVQKLNPATTYNIRIVAENEIGVSDSSEVVPIITAEEAPSGKPQS  1016
              ++DRVIVPGHT EAQVQKL+PATTYNIRIVAEN IG S SSE V IITAEEAPSGKPQ+
Sbjct  958   -EIDRVIVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQN  1016

Query  1017  IKVEPLSQTSLRVLWKAPPRSDWNGEILGYYVGYKLTNNNGSYYFEDYKYMMEEGKEYSY  1076
             IKVEP++QT++RV WK PPR++WNGEILGYYVGYKL+N N SY FE   ++ EEGKE++ 
Sbjct  1017  IKVEPVNQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNL  1076

Query  1077  ELTNLKTYTQYSVVIQAYNKVGAGPLSEDEKQYTAEGTPDQPPSDITCTTLTSQTIRVSW  1136
             EL NL+ YTQYSVVIQA+NK+GAGPLSE+EKQ+TAEGTP QPPSD  CTTLTSQTIRV W
Sbjct  1077  ELQNLRVYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGW  1136

Query  1137  VSPPLESANGVIKGYKVVYAPSELWYDDKNKDYKKTASSDTVLHGLKKYTNYTMQVLATT  1196
             VSPPLESANGVIK YKVVYAPS+ WYD+  + YKKTASSDTVLHGLKKYTNYTMQVLATT
Sbjct  1137  VSPPLESANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATT  1196

Query  1197  SGGDGVRSPPIHCQTEQDVPEAPTAVKALVVGSEAILVSWLPPAQPNGLITQYTVYSKEE  1256
             +GGDGVRS PIHCQTE DVPEAPT VKALV+G+ AILVSW PPAQPNG+ITQYTVYSK E
Sbjct  1197  AGGDGVRSVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAE  1256

Query  1257  GTESEVKSHKVPPYQMSYEASSLDKNKPFEFWVTANTNIGEGQASKSIVAMPSDKVPAKI  1316
             G E+E K+ KVP YQMS+EA+ L+KNKP+EFWVTA+T IGEGQ SKSIVAMPSD+VPAKI
Sbjct  1257  GAETETKTQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKI  1316

Query  1317  ASFDDTFTAIFKEDFKLPCLAVGAPAPDITWKVKGVEFVPNDRVRQLPEGSLSIKDVIRQ  1376
             ASFDDTFTA FKED K+PCLAVGAP P+ITWK+KGVEF  NDR+R LP+GSL IK V RQ
Sbjct  1317  ASFDDTFTATFKEDAKMPCLAVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNRQ  1376

Query  1377  DAGDYTCMAENSIAKDSITHKLIVLAPPQSPQVLLTATTTDSLTLKLKQHDGDTAPIHGY  1436
             DAGDY+C AENSIAKDSITHKLIVLAPPQSP V L+ATTTD+LT+KLK H+GDTAP+HGY
Sbjct  1377  DAGDYSCHAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGY  1436

Query  1437  TLHYKPEFGDWETVEVAVDAQKYTIENLFCGSRYQVYATGYNNIGAGEASDILNTRTKGS  1496
             TLHYKPEFG+WET EV+VD+QK+ IE L CGSRYQVYATG+NNIGAGEASDILNTRTKG 
Sbjct  1437  TLHYKPEFGEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKGQ  1496

Query  1497  KPMMPENSKFIDPSSNTVTLHLPTWKDGGCRMSHFVVEYKKKDHAEWTQISNNVKPGGNF  1556
             KP +PE  +FI+ SSN+V+LH   WKDGGC MSHFVVE KK+D  EW QISNNVKP  N+
Sbjct  1497  KPKLPEKPRFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKRDQIEWNQISNNVKPDNNY  1556

Query  1557  VVLDLDAASWYSVRITAHNSAGFTVAEYEFATLTVTGGTLAPPLNTAVLNGKTY----LP  1612
             VVLDL+ A+WY++RITAHNSAGFTVAEY+FATLTVTGGT+A PL+    +G  +    LP
Sbjct  1557  VVLDLEPATWYNLRITAHNSAGFTVAEYDFATLTVTGGTIA-PLDDGSGHGNVHTRIRLP  1615

Query  1613  PWMPQWFDLNFMVPLIATIIVVFVGVLVICVALSRRRMEDPRGGPKDVYYDVVYNQPMGP  1672
              WMP+W DLNFMVPLIAT++VV VG+ V+CVALSRRR +D RGG KDVYYDVVYNQ MGP
Sbjct  1616  AWMPEWLDLNFMVPLIATVVVVAVGICVVCVALSRRRADDMRGGQKDVYYDVVYNQTMGP  1675

Query  1673  GATMDKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRGTVISRSMRSNHSTWDPRR  1732
             GAT+DKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG      +RSNHSTWDPRR
Sbjct  1676  GATLDKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG---RGGLRSNHSTWDPRR  1732

Query  1733  --PLYEELKPPPVPRR-----HYHGSDECYHTHPHPHPAGMEDEICPYATFHLLGFREEM  1785
                LYEELK PPVP       H HG+ EC++ HP     GMEDEICPYATFHLLGFREEM
Sbjct  1733  NPNLYEELKAPPVPMHGNHYGHAHGNAECHYRHP-----GMEDEICPYATFHLLGFREEM  1787

Query  1786  DPTKAMNFQTFPHQNGHTG--PGHA-TMGPGGPPGHIHSRSGSQSMPRQNRYARKNSQGG  1842
             DPTKAMNFQTFPHQNGH G  PGHA TM P G PGH+HSRSGSQSMPR NRY RKNSQGG
Sbjct  1788  DPTKAMNFQTFPHQNGHAGPVPGHAGTMLPPGHPGHVHSRSGSQSMPRANRYQRKNSQGG  1847

Query  1843  QSSIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYGGPGPEYDDPANCAPEDDQYGSQ  1902
             QSSIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLY GPGPEYDDPANCAPE+DQYGSQ
Sbjct  1848  QSSIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYSGPGPEYDDPANCAPEEDQYGSQ  1907

Query  1903  YGAPYG--YDHYGSRGSVGRRSVGSARNLPNGSPEPPPPPPRNHDTSNSSFNDSKESNEI  1960
             YG PYG  YDHYGSRGS+GRRS+GSARN  NGSPEPPPPPPRNHD SNSSFNDSKESNEI
Sbjct  1908  YGGPYGQPYDHYGSRGSMGRRSIGSARNPGNGSPEPPPPPPRNHDMSNSSFNDSKESNEI  1967

Query  1961  SEAECDRDH-PRGNYGENENSGDAKRSANTKDVRTTEEMRKLIDSRKSNEVAAKLQQQGG  2019
             SEAECDRDH PRGNYG        KRS   KD RTTEEMRKLI+  ++     +LQQ  G
Sbjct  1968  SEAECDRDHGPRGNYGA------VKRSPQPKDQRTTEEMRKLIERNETGPKQLQLQQANG  2021

Query  2020  PAGLTAYDTLAV  2031
              AG TAYDT+AV
Sbjct  2022  -AGFTAYDTMAV  2032



Lambda      K        H
   0.314    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 27202772002


Query= XP_037024197.1 Down syndrome cell adhesion molecule-like protein
Dscam2 isoform X2 [Bradysia coprophila]

Length=2030
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A0A0B4K6R4_DROME  unnamed protein product                             3323    0.0  
Q0E9K4_DROME  unnamed protein product                                 3312    0.0  
Q0E9I2_DROME  unnamed protein product                                 3300    0.0  


>A0A0B4K6R4_DROME unnamed protein product
Length=2035

 Score = 3323 bits (8615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1636/2051 (80%), Positives = 1793/2051 (87%), Gaps = 44/2051 (2%)

Query  3     QRTKWITKIIFIAV-LVDLGS---TANT-EADTKGPMFLKEPINRIDFSNSTGSVVECRA  57
             +R KW+  ++F AV L+  GS    AN  +AD KGP+FLKEP NRIDFSNSTG+ +EC+A
Sbjct  6     ERLKWL--MLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAEIECKA  63

Query  58    SGNPAPEIIWVRSDGTAVGDVPGLRQVLSNGNLVFPPFRAEDYRQEVHAQVYACLAKNQF  117
             SGNP PEIIW+RSDGTAVGDVPGLRQ+ S+G LVFPPFRAEDYRQEVHAQVYACLA+NQF
Sbjct  64    SGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQF  123

Query  118   GSIISRDVNVRAVVHQFYQSEVNNEYVIRGNSAVLRCSIPSFVGDYVTVLSWQDENGNLY  177
             GSIISRDV+VRAVV QFY+SEVNNEYVIRGN+AVL+CSIPSFV D+V V+SWQDE G LY
Sbjct  124   GSIISRDVHVRAVVQQFYESEVNNEYVIRGNAAVLKCSIPSFVADFVQVVSWQDEEGQLY  183

Query  178   GSLDDNSKDNFDGKYLVLPSGELHIKEVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI  237
             GSL D  +   DGKYLVLPSGELHI+EVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI
Sbjct  184   GSLGD--QQGTDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI  241

Query  238   TEPVGSVAPKVN-VADKGHISSARTGHTTDILCPAQGYPMPAFRWYKFIEGTTRKQAVVL  296
             TEP+GSV PK+N + DK  +   +   +  + CP Q YP+P  RWYKFIEGTTRKQAVVL
Sbjct  242   TEPIGSVPPKINNINDKFQLMQVKLESSFAMQCPGQAYPVPVVRWYKFIEGTTRKQAVVL  301

Query  297   NDRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPSQVVDF  356
             NDRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPP+Q VDF
Sbjct  302   NDRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDF  361

Query  357   GRPAVFTCHFSGNPIKTVSWLKDGKKIGHTDAILRIESVKKEHKGMYQCFIRNDQESAEA  416
             GRPAVFTC ++GNPIKTVSW+KDGK IGH++ +LRIESVKKE KGMYQCF+RNDQESAEA
Sbjct  362   GRPAVFTCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEA  421

Query  417   SAELKLGGRFDPPIIRQAFPEETLHPGPSVFLKCVAGGLPTPEISWELDGKKIANSERYQ  476
             SAELKLGGRFDPP+IRQAF EET+ PGPSVFLKCVAGG PTPEISWELDGKKIAN++RYQ
Sbjct  422   SAELKLGGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQ  481

Query  477   VGQYVTVNGDVVSYLNITSIHANDGGLYKCIASSKVGVAEHSAKLNVYGLPYIRPMEKKA  536
             VGQYVTVNGDVVSYLNITS+HANDGGLYKCIA SKVGVAEHSAKLNVYGLPYIR MEKKA
Sbjct  482   VGQYVTVNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKA  541

Query  537   IVAGENLIVTCPVAGYPIESIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTC  596
             IVAGE LIVTCPVAGYPI+SIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTC
Sbjct  542   IVAGETLIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTC  601

Query  597   VAKNSEGYSARGALEVQVMVLPRITPFAFDGGPAETGQYQTLTCTVQAGDFPLNFTWLLN  656
             VAKN EGYSARG+LEVQVMVLPRI PFAF+ GPA+ GQY TL C+V  GD PLN  W L+
Sbjct  602   VAKNQEGYSARGSLEVQVMVLPRIIPFAFEEGPAQVGQYLTLHCSVPGGDLPLNIDWTLD  661

Query  657   GIELRDSFDISISNVGKRSTFLTIESIQAIHAGTYTCLVSNKAGLSQYSTELKVNVPPRW  716
             G  + +   I+ S VG+R + LTIE+++A HAG +TC   N AG  Q++T L V VPPRW
Sbjct  662   GQAISEDLGITTSRVGRRGSVLTIEAVEASHAGNFTCHARNLAGHQQFTTPLNVYVPPRW  721

Query  717   ILEPTDKAFAQGSDAKVECKSDGFPKPQVTWKKAVGDTPGEYKDMKQSNNIRVDEGTLYI  776
             ILEPTDKAFAQGSDAKVECK+DGFPKPQVTWKKAVGDTPGEYKD+K+S+NIRV+EGTL++
Sbjct  722   ILEPTDKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHV  781

Query  777   DNIQKNNEGYYLCEAINGIGSGLSAVILISVQAPPEFVEKLRNQTARRSEPAVLQCEAKG  836
             DNIQK NEGYYLCEAINGIGSGLSAVI+ISVQAPPEF EKLRNQTARR EPAVLQCEAKG
Sbjct  782   DNIQKTNEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKG  841

Query  837   EKPIGILWNMNNMRLDPKTDNRYTIREEILSTGVMSSLSIKRTERTDSALFTCVATNAFG  896
             EKPIGILWNMNNMRLDPK DNRYTIREEILSTGVMSSLSIKRTER+DSALFTCVATNAFG
Sbjct  842   EKPIGILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAFG  901

Query  897   SDDASINMIIQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLKRYIIEFKTSRGSWEH  956
             SDDASINMI+QEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPL RYIIEFK SR SW  
Sbjct  902   SDDASINMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWS-  960

Query  957   DVDRVIVPGHTNEAQVQKLNPATTYNIRIVAENEIGVSDSSEVVPIITAEEAPSGKPQSI  1016
             ++DRVIVPGHT EAQVQKL+PATTYNIRIVAEN IG S SSE V IITAEEAPSGKPQ+I
Sbjct  961   EIDRVIVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNI  1020

Query  1017  KVEPLSQTSLRVLWKAPPRSDWNGEILGYYVGYKLTNNNGSYYFEDYKYMMEEGKEYSYE  1076
             KVEP++QT++RV WK PPR++WNGEILGYYVGYKL+N N SY FE   ++ EEGKE++ E
Sbjct  1021  KVEPVNQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLE  1080

Query  1077  LTNLKTYTQYSVVIQAYNKVGAGPLSEDEKQYTAEGTPDQPPSDITCTTLTSQTIRVSWV  1136
             L NL+ YTQYSVVIQA+NK+GAGPLSE+EKQ+TAEGTP QPPSD  CTTLTSQTIRV WV
Sbjct  1081  LQNLRVYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWV  1140

Query  1137  SPPLESANGVIKGYKVVYAPSELWYDDKNKDYKKTASSDTVLHGLKKYTNYTMQVLATTS  1196
             SPPLESANGVIK YKVVYAPS+ WYD+  + YKKTASSDTVLHGLKKYTNYTMQVLATT+
Sbjct  1141  SPPLESANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTA  1200

Query  1197  GGDGVRSPPIHCQTEQDVPEAPTAVKALVVGSEAILVSWLPPAQPNGLITQYTVYSKEEG  1256
             GGDGVRS PIHCQTE DVPEAPT VKALV+G+ AILVSW PPAQPNG+ITQYTVYSK EG
Sbjct  1201  GGDGVRSVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEG  1260

Query  1257  TESEVKSHKVPPYQMSYEASSLDKNKPFEFWVTANTNIGEGQASKSIVAMPSDKVPAKIA  1316
              E+E K+ KVP YQMS+EA+ L+KNKP+EFWVTA+T IGEGQ SKSIVAMPSD+VPAKIA
Sbjct  1261  AETETKTQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIA  1320

Query  1317  SFDDTFTAIFKEDFKLPCLAVGAPAPDITWKVKGVEFVPNDRVRQLPEGSLSIKDVIRQD  1376
             SFDDTFTA FKED K+PCLAVGAP P+ITWK+KGVEF  NDR+R LP+GSL IK V RQD
Sbjct  1321  SFDDTFTATFKEDAKMPCLAVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNRQD  1380

Query  1377  AGDYTCMAENSIAKDSITHKLIVLAPPQSPQVLLTATTTDSLTLKLKQHDGDTAPIHGYT  1436
             AGDY+C AENSIAKDSITHKLIVLAPPQSP V L+ATTTD+LT+KLK H+GDTAP+HGYT
Sbjct  1381  AGDYSCHAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGYT  1440

Query  1437  LHYKPEFGDWETVEVAVDAQKYTIENLFCGSRYQVYATGYNNIGAGEASDILNTRTKGSK  1496
             LHYKPEFG+WET EV+VD+QK+ IE L CGSRYQVYATG+NNIGAGEASDILNTRTKG K
Sbjct  1441  LHYKPEFGEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKGQK  1500

Query  1497  PMMPENSKFIDPSSNTVTLHLPTWKDGGCRMSHFVVEYKKKDHAEWTQISNNVKPGGNFV  1556
             P +PE  +FI+ SSN+V+LH   WKDGGC MSHFVVE KK+D  EW QISNNVKP  N+V
Sbjct  1501  PKLPEKPRFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKRDQIEWNQISNNVKPDNNYV  1560

Query  1557  VLDLDAASWYSVRITAHNSAGFTVAEYEFATLTVTGGTLAPPLNTAVLNGKTY----LPP  1612
             VLDL+ A+WY++RITAHNSAGFTVAEY+FATLTVTGGT+A PL+    +G  +    LP 
Sbjct  1561  VLDLEPATWYNLRITAHNSAGFTVAEYDFATLTVTGGTIA-PLDDGSGHGNVHTRIRLPA  1619

Query  1613  WMPQWFDLNFMVPLIATIIVVFVGVLVICVALSRRRMEDPRGGPKDVYYDVVYNQPMGPG  1672
             WMP+W DLNFMVPLIAT++VV VG+ V+CVALSRRR +D RGG KDVYYDVVYNQ MGPG
Sbjct  1620  WMPEWLDLNFMVPLIATVVVVAVGICVVCVALSRRRADDMRGGQKDVYYDVVYNQTMGPG  1679

Query  1673  ATMDKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRGTVISRSMRSNHSTWDPRR-  1731
             AT+DKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG      +RSNHSTWDPRR 
Sbjct  1680  ATLDKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG---RGGLRSNHSTWDPRRN  1736

Query  1732  -PLYEELKPPPVPRR-----HYHGSDECYHTHPHPHPAGMEDEICPYATFHLLGFREEMD  1785
               LYEELK PPVP       H HG+ EC++ HP     GMEDEICPYATFHLLGFREEMD
Sbjct  1737  PNLYEELKAPPVPMHGNHYGHAHGNAECHYRHP-----GMEDEICPYATFHLLGFREEMD  1791

Query  1786  PTKAMNFQTFPHQNGHTG--PGHA-TMGPGGPPGHIHSRSGSQSMPRQNRYARKNSQGGQ  1842
             PTKAMNFQTFPHQNGH G  PGHA TM P G PGH+HSRSGSQSMPR NRY RKNSQGGQ
Sbjct  1792  PTKAMNFQTFPHQNGHAGPVPGHAGTMLPPGHPGHVHSRSGSQSMPRANRYQRKNSQGGQ  1851

Query  1843  SSIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYGGPGPEYDDPANCAPEDDQYGSQY  1902
             SSIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLY GPGPEYDDPANCAPE+DQYGSQY
Sbjct  1852  SSIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYSGPGPEYDDPANCAPEEDQYGSQY  1911

Query  1903  GAPYG--YDHYGSRGSVGRRSVGSARNLPNGSPEPPPPPPRNHDTSNSSFNDSKESNEIS  1960
             G PYG  YDHYGSRGS+GRRS+GSARN  NGSPEPPPPPPRNHD SNSSFNDSKESNEIS
Sbjct  1912  GGPYGQPYDHYGSRGSMGRRSIGSARNPGNGSPEPPPPPPRNHDMSNSSFNDSKESNEIS  1971

Query  1961  EAECDRDH-PRGNYGENENSGDAKRSANTKDVRTTEEMRKLIDSRKSNEVAAKLQQQGGP  2019
             EAECDRDH PRGNYG        KRS   KD RTTEEMRKLI+  ++     +LQQ  G 
Sbjct  1972  EAECDRDHGPRGNYGA------VKRSPQPKDQRTTEEMRKLIERNETGPKQLQLQQANG-  2024

Query  2020  AGLTAYDTLAV  2030
             AG TAYDT+AV
Sbjct  2025  AGFTAYDTMAV  2035


>Q0E9K4_DROME unnamed protein product
Length=2031

 Score = 3312 bits (8588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1631/2050 (80%), Positives = 1788/2050 (87%), Gaps = 46/2050 (2%)

Query  3     QRTKWITKIIFIAV-LVDLGS---TANT-EADTKGPMFLKEPINRIDFSNSTGSVVECRA  57
             +R KW+  ++F AV L+  GS    AN  +AD KGP+FLKEP NRIDFSNSTG+ +EC+A
Sbjct  6     ERLKWL--MLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAEIECKA  63

Query  58    SGNPAPEIIWVRSDGTAVGDVPGLRQVLSNGNLVFPPFRAEDYRQEVHAQVYACLAKNQF  117
             SGNP PEIIW+RSDGTAVGDVPGLRQ+ S+G LVFPPFRAEDYRQEVHAQVYACLA+NQF
Sbjct  64    SGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQF  123

Query  118   GSIISRDVNVRAVVHQFYQSEVNNEYVIRGNSAVLRCSIPSFVGDYVTVLSWQDENGNLY  177
             GSIISRDV+VRAVV+QFY++E+  EYVIRGN+AVL+CSIPSFV D+V V SW D+ GN+ 
Sbjct  124   GSIISRDVHVRAVVNQFYEAEIMTEYVIRGNAAVLKCSIPSFVADFVRVESWIDDEGNVL  183

Query  178   GSLDDNSKDNFDGKYLVLPSGELHIKEVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI  237
                  +  DN+DGKYLVLPSGELHI+EVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI
Sbjct  184   -----SFSDNYDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI  238

Query  238   TEPVGSVAPKVNVADKGHISSARTGHTTDILCPAQGYPMPAFRWYKFIEGTTRKQAVVLN  297
             TEPVGSV PKVN  DK          +  +LC AQ YP P+FRWYKFIEGTTRKQAVVLN
Sbjct  239   TEPVGSVRPKVNPQDKHQFIDVELASSYSLLCMAQSYPTPSFRWYKFIEGTTRKQAVVLN  298

Query  298   DRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPSQVVDFG  357
             DRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPP+Q VDFG
Sbjct  299   DRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFG  358

Query  358   RPAVFTCHFSGNPIKTVSWLKDGKKIGHTDAILRIESVKKEHKGMYQCFIRNDQESAEAS  417
             RPAVFTC ++GNPIKTVSW+KDGK IGH++ +LRIESVKKE KGMYQCF+RNDQESAEAS
Sbjct  359   RPAVFTCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEAS  418

Query  418   AELKLGGRFDPPIIRQAFPEETLHPGPSVFLKCVAGGLPTPEISWELDGKKIANSERYQV  477
             AELKLGGRFDPP+IRQAF EET+ PGPSVFLKCVAGG PTPEISWELDGKKIAN++RYQV
Sbjct  419   AELKLGGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQV  478

Query  478   GQYVTVNGDVVSYLNITSIHANDGGLYKCIASSKVGVAEHSAKLNVYGLPYIRPMEKKAI  537
             GQYVTVNGDVVSYLNITS+HANDGGLYKCIA SKVGVAEHSAKLNVYGLPYIR MEKKAI
Sbjct  479   GQYVTVNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKAI  538

Query  538   VAGENLIVTCPVAGYPIESIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCV  597
             VAGE LIVTCPVAGYPI+SIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCV
Sbjct  539   VAGETLIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCV  598

Query  598   AKNSEGYSARGALEVQVMVLPRITPFAFDGGPAETGQYQTLTCTVQAGDFPLNFTWLLNG  657
             AKN EGYSARG+LEVQVMVLPRI PFAF+ GPA+ GQY TL C+V  GD PLN  W L+G
Sbjct  599   AKNQEGYSARGSLEVQVMVLPRIIPFAFEEGPAQVGQYLTLHCSVPGGDLPLNIDWTLDG  658

Query  658   IELRDSFDISISNVGKRSTFLTIESIQAIHAGTYTCLVSNKAGLSQYSTELKVNVPPRWI  717
               + +   I+ S VG+R + LTIE+++A HAG +TC   N AG  Q++T L V VPPRWI
Sbjct  659   QAISEDLGITTSRVGRRGSVLTIEAVEASHAGNFTCHARNLAGHQQFTTPLNVYVPPRWI  718

Query  718   LEPTDKAFAQGSDAKVECKSDGFPKPQVTWKKAVGDTPGEYKDMKQSNNIRVDEGTLYID  777
             LEPTDKAFAQGSDAKVECK+DGFPKPQVTWKKAVGDTPGEYKD+K+S+NIRV+EGTL++D
Sbjct  719   LEPTDKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHVD  778

Query  778   NIQKNNEGYYLCEAINGIGSGLSAVILISVQAPPEFVEKLRNQTARRSEPAVLQCEAKGE  837
             NIQK NEGYYLCEAINGIGSGLSAVI+ISVQAPPEF EKLRNQTARR EPAVLQCEAKGE
Sbjct  779   NIQKTNEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKGE  838

Query  838   KPIGILWNMNNMRLDPKTDNRYTIREEILSTGVMSSLSIKRTERTDSALFTCVATNAFGS  897
             KPIGILWNMNNMRLDPK DNRYTIREEILSTGVMSSLSIKRTER+DSALFTCVATNAFGS
Sbjct  839   KPIGILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAFGS  898

Query  898   DDASINMIIQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLKRYIIEFKTSRGSWEHD  957
             DDASINMI+QEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPL RYIIEFK SR SW  +
Sbjct  899   DDASINMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWS-E  957

Query  958   VDRVIVPGHTNEAQVQKLNPATTYNIRIVAENEIGVSDSSEVVPIITAEEAPSGKPQSIK  1017
             +DRVIVPGHT EAQVQKL+PATTYNIRIVAEN IG S SSE V IITAEEAPSGKPQ+IK
Sbjct  958   IDRVIVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNIK  1017

Query  1018  VEPLSQTSLRVLWKAPPRSDWNGEILGYYVGYKLTNNNGSYYFEDYKYMMEEGKEYSYEL  1077
             VEP++QT++RV WK PPR++WNGEILGYYVGYKL+N N SY FE   ++ EEGKE++ EL
Sbjct  1018  VEPVNQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLEL  1077

Query  1078  TNLKTYTQYSVVIQAYNKVGAGPLSEDEKQYTAEGTPDQPPSDITCTTLTSQTIRVSWVS  1137
              NL+ YTQYSVVIQA+NK+GAGPLSE+EKQ+TAEGTP QPPSD  CTTLTSQTIRV WVS
Sbjct  1078  QNLRVYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWVS  1137

Query  1138  PPLESANGVIKGYKVVYAPSELWYDDKNKDYKKTASSDTVLHGLKKYTNYTMQVLATTSG  1197
             PPLESANGVIK YKVVYAPS+ WYD+  + YKKTASSDTVLHGLKKYTNYTMQVLATT+G
Sbjct  1138  PPLESANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTAG  1197

Query  1198  GDGVRSPPIHCQTEQDVPEAPTAVKALVVGSEAILVSWLPPAQPNGLITQYTVYSKEEGT  1257
             GDGVRS PIHCQTE DVPEAPT VKALV+G+ AILVSW PPAQPNG+ITQYTVYSK EG 
Sbjct  1198  GDGVRSVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEGA  1257

Query  1258  ESEVKSHKVPPYQMSYEASSLDKNKPFEFWVTANTNIGEGQASKSIVAMPSDKVPAKIAS  1317
             E+E K+ KVP YQMS+EA+ L+KNKP+EFWVTA+T IGEGQ SKSIVAMPSD+VPAKIAS
Sbjct  1258  ETETKTQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIAS  1317

Query  1318  FDDTFTAIFKEDFKLPCLAVGAPAPDITWKVKGVEFVPNDRVRQLPEGSLSIKDVIRQDA  1377
             FDDTFTA FKED K+PCLAVGAP P+ITWK+KGVEF  NDR+R LP+GSL IK V RQDA
Sbjct  1318  FDDTFTATFKEDAKMPCLAVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNRQDA  1377

Query  1378  GDYTCMAENSIAKDSITHKLIVLAPPQSPQVLLTATTTDSLTLKLKQHDGDTAPIHGYTL  1437
             GDY+C AENSIAKDSITHKLIVLAPPQSP V L+ATTTD+LT+KLK H+GDTAP+HGYTL
Sbjct  1378  GDYSCHAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGYTL  1437

Query  1438  HYKPEFGDWETVEVAVDAQKYTIENLFCGSRYQVYATGYNNIGAGEASDILNTRTKGSKP  1497
             HYKPEFG+WET EV+VD+QK+ IE L CGSRYQVYATG+NNIGAGEASDILNTRTKG KP
Sbjct  1438  HYKPEFGEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKGQKP  1497

Query  1498  MMPENSKFIDPSSNTVTLHLPTWKDGGCRMSHFVVEYKKKDHAEWTQISNNVKPGGNFVV  1557
              +PE  +FI+ SSN+V+LH   WKDGGC MSHFVVE KK+D  EW QISNNVKP  N+VV
Sbjct  1498  KLPEKPRFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKRDQIEWNQISNNVKPDNNYVV  1557

Query  1558  LDLDAASWYSVRITAHNSAGFTVAEYEFATLTVTGGTLAPPLNTAVLNGKTY----LPPW  1613
             LDL+ A+WY++RITAHNSAGFTVAEY+FATLTVTGGT+A PL+    +G  +    LP W
Sbjct  1558  LDLEPATWYNLRITAHNSAGFTVAEYDFATLTVTGGTIA-PLDDGSGHGNVHTRIRLPAW  1616

Query  1614  MPQWFDLNFMVPLIATIIVVFVGVLVICVALSRRRMEDPRGGPKDVYYDVVYNQPMGPGA  1673
             MP+W DLNFMVPLIAT++VV VG+ V+CVALSRRR +D RGG KDVYYDVVYNQ MGPGA
Sbjct  1617  MPEWLDLNFMVPLIATVVVVAVGICVVCVALSRRRADDMRGGQKDVYYDVVYNQTMGPGA  1676

Query  1674  TMDKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRGTVISRSMRSNHSTWDPRR--  1731
             T+DKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG      +RSNHSTWDPRR  
Sbjct  1677  TLDKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG---RGGLRSNHSTWDPRRNP  1733

Query  1732  PLYEELKPPPVPRR-----HYHGSDECYHTHPHPHPAGMEDEICPYATFHLLGFREEMDP  1786
              LYEELK PPVP       H HG+ EC++ HP     GMEDEICPYATFHLLGFREEMDP
Sbjct  1734  NLYEELKAPPVPMHGNHYGHAHGNAECHYRHP-----GMEDEICPYATFHLLGFREEMDP  1788

Query  1787  TKAMNFQTFPHQNGHTG--PGHA-TMGPGGPPGHIHSRSGSQSMPRQNRYARKNSQGGQS  1843
             TKAMNFQTFPHQNGH G  PGHA TM P G PGH+HSRSGSQSMPR NRY RKNSQGGQS
Sbjct  1789  TKAMNFQTFPHQNGHAGPVPGHAGTMLPPGHPGHVHSRSGSQSMPRANRYQRKNSQGGQS  1848

Query  1844  SIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYGGPGPEYDDPANCAPEDDQYGSQYG  1903
             SIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLY GPGPEYDDPANCAPE+DQYGSQYG
Sbjct  1849  SIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYSGPGPEYDDPANCAPEEDQYGSQYG  1908

Query  1904  APYG--YDHYGSRGSVGRRSVGSARNLPNGSPEPPPPPPRNHDTSNSSFNDSKESNEISE  1961
              PYG  YDHYGSRGS+GRRS+GSARN  NGSPEPPPPPPRNHD SNSSFNDSKESNEISE
Sbjct  1909  GPYGQPYDHYGSRGSMGRRSIGSARNPGNGSPEPPPPPPRNHDMSNSSFNDSKESNEISE  1968

Query  1962  AECDRDH-PRGNYGENENSGDAKRSANTKDVRTTEEMRKLIDSRKSNEVAAKLQQQGGPA  2020
             AECDRDH PRGNYG        KRS   KD RTTEEMRKLI+  ++     +LQQ  G A
Sbjct  1969  AECDRDHGPRGNYGA------VKRSPQPKDQRTTEEMRKLIERNETGPKQLQLQQANG-A  2021

Query  2021  GLTAYDTLAV  2030
             G TAYDT+AV
Sbjct  2022  GFTAYDTMAV  2031


>Q0E9I2_DROME unnamed protein product
Length=2031

 Score = 3300 bits (8556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1627/2051 (79%), Positives = 1785/2051 (87%), Gaps = 48/2051 (2%)

Query  3     QRTKWITKIIFIAV-LVDLGS---TANT-EADTKGPMFLKEPINRIDFSNSTGSVVECRA  57
             +R KW+  ++F AV L+  GS    AN  +AD KGP+FLKEP NRIDFSNSTG+ +EC+A
Sbjct  6     ERLKWL--MLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAEIECKA  63

Query  58    SGNPAPEIIWVRSDGTAVGDVPGLRQVLSNGNLVFPPFRAEDYRQEVHAQVYACLAKNQF  117
             SGNP PEIIW+RSDGTAVGDVPGLRQ+ S+G LVFPPFRAEDYRQEVHAQVYACLA+NQF
Sbjct  64    SGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQF  123

Query  118   GSIISRDVNVRAVVHQFYQSEVNNEYVIRGNSAVLRCSIPSFVGDYVTVLSWQ-DENGNL  176
             GSIISRDV+VRAVV Q Y+ +++  +VIRGNSA+L+C IPSFV D+V V+SW  DE  N 
Sbjct  124   GSIISRDVHVRAVVSQHYEEDIHKAFVIRGNSAILKCDIPSFVADFVNVISWHSDEKENF  183

Query  177   YGSLDDNSKDNFDGKYLVLPSGELHIKEVGPEDGYKSYQCRTKHRLTGETRLSATKGRLV  236
             Y   +      +DGKYLVLPSGELHI+EVGPEDGYKSYQCRTKHRLTGETRLSATKGRLV
Sbjct  184   YPGTE------YDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLV  237

Query  237   ITEPVGSVAPKVNVADKGHISSARTGHTTDILCPAQGYPMPAFRWYKFIEGTTRKQAVVL  296
             ITEPVGSVAPKV+V D+        G    +LCPAQ YPMP +RWYKFIEGTTRKQAVVL
Sbjct  238   ITEPVGSVAPKVDVKDRITWLDKPMGQALSLLCPAQSYPMPVYRWYKFIEGTTRKQAVVL  297

Query  297   NDRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPSQVVDF  356
             NDRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPP+Q VDF
Sbjct  298   NDRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDF  357

Query  357   GRPAVFTCHFSGNPIKTVSWLKDGKKIGHTDAILRIESVKKEHKGMYQCFIRNDQESAEA  416
             GRPAVFTC ++GNPIKTVSW+KDGK IGH++ +LRIESVKKE KGMYQCF+RNDQESAEA
Sbjct  358   GRPAVFTCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEA  417

Query  417   SAELKLGGRFDPPIIRQAFPEETLHPGPSVFLKCVAGGLPTPEISWELDGKKIANSERYQ  476
             SAELKLGGRFDPP+IRQAF EET+ PGPSVFLKCVAGG PTPEISWELDGKKIAN++RYQ
Sbjct  418   SAELKLGGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQ  477

Query  477   VGQYVTVNGDVVSYLNITSIHANDGGLYKCIASSKVGVAEHSAKLNVYGLPYIRPMEKKA  536
             VGQYVTVNGDVVSYLNITS+HANDGGLYKCIA SKVGVAEHSAKLNVYGLPYIR MEKKA
Sbjct  478   VGQYVTVNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKA  537

Query  537   IVAGENLIVTCPVAGYPIESIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTC  596
             IVAGE LIVTCPVAGYPI+SIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTC
Sbjct  538   IVAGETLIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTC  597

Query  597   VAKNSEGYSARGALEVQVMVLPRITPFAFDGGPAETGQYQTLTCTVQAGDFPLNFTWLLN  656
             VAKN EGYSARG+LEVQVMVLPRI PFAF+ GPA+ GQY TL C+V  GD PLN  W L+
Sbjct  598   VAKNQEGYSARGSLEVQVMVLPRIIPFAFEEGPAQVGQYLTLHCSVPGGDLPLNIDWTLD  657

Query  657   GIELRDSFDISISNVGKRSTFLTIESIQAIHAGTYTCLVSNKAGLSQYSTELKVNVPPRW  716
             G  + +   I+ S VG+R + LTIE+++A HAG +TC   N AG  Q++T L V VPPRW
Sbjct  658   GQAISEDLGITTSRVGRRGSVLTIEAVEASHAGNFTCHARNLAGHQQFTTPLNVYVPPRW  717

Query  717   ILEPTDKAFAQGSDAKVECKSDGFPKPQVTWKKAVGDTPGEYKDMKQSNNIRVDEGTLYI  776
             ILEPTDKAFAQGSDAKVECK+DGFPKPQVTWKKAVGDTPGEYKD+K+S+NIRV+EGTL++
Sbjct  718   ILEPTDKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHV  777

Query  777   DNIQKNNEGYYLCEAINGIGSGLSAVILISVQAPPEFVEKLRNQTARRSEPAVLQCEAKG  836
             DNIQK NEGYYLCEAINGIGSGLSAVI+ISVQAPPEF EKLRNQTARR EPAVLQCEAKG
Sbjct  778   DNIQKTNEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKG  837

Query  837   EKPIGILWNMNNMRLDPKTDNRYTIREEILSTGVMSSLSIKRTERTDSALFTCVATNAFG  896
             EKPIGILWNMNNMRLDPK DNRYTIREEILSTGVMSSLSIKRTER+DSALFTCVATNAFG
Sbjct  838   EKPIGILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAFG  897

Query  897   SDDASINMIIQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLKRYIIEFKTSRGSWEH  956
             SDDASINMI+QEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPL RYIIEFK SR SW  
Sbjct  898   SDDASINMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWS-  956

Query  957   DVDRVIVPGHTNEAQVQKLNPATTYNIRIVAENEIGVSDSSEVVPIITAEEAPSGKPQSI  1016
             ++DRVIVPGHT EAQVQKL+PATTYNIRIVAEN IG S SSE V IITAEEAPSGKPQ+I
Sbjct  957   EIDRVIVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNI  1016

Query  1017  KVEPLSQTSLRVLWKAPPRSDWNGEILGYYVGYKLTNNNGSYYFEDYKYMMEEGKEYSYE  1076
             KVEP++QT++RV WK PPR++WNGEILGYYVGYKL+N N SY FE   ++ EEGKE++ E
Sbjct  1017  KVEPVNQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLE  1076

Query  1077  LTNLKTYTQYSVVIQAYNKVGAGPLSEDEKQYTAEGTPDQPPSDITCTTLTSQTIRVSWV  1136
             L NL+ YTQYSVVIQA+NK+GAGPLSE+EKQ+TAEGTP QPPSD  CTTLTSQTIRV WV
Sbjct  1077  LQNLRVYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWV  1136

Query  1137  SPPLESANGVIKGYKVVYAPSELWYDDKNKDYKKTASSDTVLHGLKKYTNYTMQVLATTS  1196
             SPPLESANGVIK YKVVYAPS+ WYD+  + YKKTASSDTVLHGLKKYTNYTMQVLATT+
Sbjct  1137  SPPLESANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTA  1196

Query  1197  GGDGVRSPPIHCQTEQDVPEAPTAVKALVVGSEAILVSWLPPAQPNGLITQYTVYSKEEG  1256
             GGDGVRS PIHCQTE DVPEAPT VKALV+G+ AILVSW PPAQPNG+ITQYTVYSK EG
Sbjct  1197  GGDGVRSVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEG  1256

Query  1257  TESEVKSHKVPPYQMSYEASSLDKNKPFEFWVTANTNIGEGQASKSIVAMPSDKVPAKIA  1316
              E+E K+ KVP YQMS+EA+ L+KNKP+EFWVTA+T IGEGQ SKSIVAMPSD+VPAKIA
Sbjct  1257  AETETKTQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIA  1316

Query  1317  SFDDTFTAIFKEDFKLPCLAVGAPAPDITWKVKGVEFVPNDRVRQLPEGSLSIKDVIRQD  1376
             SFDDTFTA FKED K+PCLAVGAP P+ITWK+KGVEF  NDR+R LP+GSL IK V RQD
Sbjct  1317  SFDDTFTATFKEDAKMPCLAVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNRQD  1376

Query  1377  AGDYTCMAENSIAKDSITHKLIVLAPPQSPQVLLTATTTDSLTLKLKQHDGDTAPIHGYT  1436
             AGDY+C AENSIAKDSITHKLIVLAPPQSP V L+ATTTD+LT+KLK H+GDTAP+HGYT
Sbjct  1377  AGDYSCHAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGYT  1436

Query  1437  LHYKPEFGDWETVEVAVDAQKYTIENLFCGSRYQVYATGYNNIGAGEASDILNTRTKGSK  1496
             LHYKPEFG+WET EV+VD+QK+ IE L CGSRYQVYATG+NNIGAGEASDILNTRTKG K
Sbjct  1437  LHYKPEFGEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKGQK  1496

Query  1497  PMMPENSKFIDPSSNTVTLHLPTWKDGGCRMSHFVVEYKKKDHAEWTQISNNVKPGGNFV  1556
             P +PE  +FI+ SSN+V+LH   WKDGGC MSHFVVE KK+D  EW QISNNVKP  N+V
Sbjct  1497  PKLPEKPRFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKRDQIEWNQISNNVKPDNNYV  1556

Query  1557  VLDLDAASWYSVRITAHNSAGFTVAEYEFATLTVTGGTLAPPLNTAVLNGKTY----LPP  1612
             VLDL+ A+WY++RITAHNSAGFTVAEY+FATLTVTGGT+A PL+    +G  +    LP 
Sbjct  1557  VLDLEPATWYNLRITAHNSAGFTVAEYDFATLTVTGGTIA-PLDDGSGHGNVHTRIRLPA  1615

Query  1613  WMPQWFDLNFMVPLIATIIVVFVGVLVICVALSRRRMEDPRGGPKDVYYDVVYNQPMGPG  1672
             WMP+W DLNFMVPLIAT++VV VG+ V+CVALSRRR +D RGG KDVYYDVVYNQ MGPG
Sbjct  1616  WMPEWLDLNFMVPLIATVVVVAVGICVVCVALSRRRADDMRGGQKDVYYDVVYNQTMGPG  1675

Query  1673  ATMDKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRGTVISRSMRSNHSTWDPRR-  1731
             AT+DKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG      +RSNHSTWDPRR 
Sbjct  1676  ATLDKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG---RGGLRSNHSTWDPRRN  1732

Query  1732  -PLYEELKPPPVPRR-----HYHGSDECYHTHPHPHPAGMEDEICPYATFHLLGFREEMD  1785
               LYEELK PPVP       H HG+ EC++ HP     GMEDEICPYATFHLLGFREEMD
Sbjct  1733  PNLYEELKAPPVPMHGNHYGHAHGNAECHYRHP-----GMEDEICPYATFHLLGFREEMD  1787

Query  1786  PTKAMNFQTFPHQNGHTG--PGHA-TMGPGGPPGHIHSRSGSQSMPRQNRYARKNSQGGQ  1842
             PTKAMNFQTFPHQNGH G  PGHA TM P G PGH+HSRSGSQSMPR NRY RKNSQGGQ
Sbjct  1788  PTKAMNFQTFPHQNGHAGPVPGHAGTMLPPGHPGHVHSRSGSQSMPRANRYQRKNSQGGQ  1847

Query  1843  SSIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYGGPGPEYDDPANCAPEDDQYGSQY  1902
             SSIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLY GPGPEYDDPANCAPE+DQYGSQY
Sbjct  1848  SSIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYSGPGPEYDDPANCAPEEDQYGSQY  1907

Query  1903  GAPYG--YDHYGSRGSVGRRSVGSARNLPNGSPEPPPPPPRNHDTSNSSFNDSKESNEIS  1960
             G PYG  YDHYGSRGS+GRRS+GSARN  NGSPEPPPPPPRNHD SNSSFNDSKESNEIS
Sbjct  1908  GGPYGQPYDHYGSRGSMGRRSIGSARNPGNGSPEPPPPPPRNHDMSNSSFNDSKESNEIS  1967

Query  1961  EAECDRDH-PRGNYGENENSGDAKRSANTKDVRTTEEMRKLIDSRKSNEVAAKLQQQGGP  2019
             EAECDRDH PRGNYG        KRS   KD RTTEEMRKLI+  ++     +LQQ  G 
Sbjct  1968  EAECDRDHGPRGNYGA------VKRSPQPKDQRTTEEMRKLIERNETGPKQLQLQQANG-  2020

Query  2020  AGLTAYDTLAV  2030
             AG TAYDT+AV
Sbjct  2021  AGFTAYDTMAV  2031



Lambda      K        H
   0.314    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 27202772002


Query= XP_037024198.1 Down syndrome cell adhesion molecule-like protein
Dscam2 isoform X3 [Bradysia coprophila]

Length=2030
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q0E9H8_DROME  unnamed protein product                                 3339    0.0  
Q0E9L6_DROME  unnamed protein product                                 3336    0.0  
Q0E9J2_DROME  unnamed protein product                                 3328    0.0  


>Q0E9H8_DROME unnamed protein product
Length=2031

 Score = 3339 bits (8657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1641/2051 (80%), Positives = 1805/2051 (88%), Gaps = 48/2051 (2%)

Query  3     QRTKWITKIIFIAV-LVDLGS---TANT-EADTKGPMFLKEPINRIDFSNSTGSVVECRA  57
             +R KW+  ++F AV L+  GS    AN  +AD KGP+FLKEP NRIDFSNSTG+ +EC+A
Sbjct  6     ERLKWL--MLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAEIECKA  63

Query  58    SGNPAPEIIWVRSDGTAVGDVPGLRQVLSNGNLVFPPFRAEDYRQEVHAQVYACLAKNQF  117
             SGNP PEIIW+RSDGTAVGDVPGLRQ+ S+G LVFPPFRAEDYRQEVHAQVYACLA+NQF
Sbjct  64    SGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQF  123

Query  118   GSIISRDVNVRAVVHQFYQSEVNNEYVIRGNSAVLRCSIPSFVGDYVTVLSWQ-DENGNL  176
             GSIISRDV+VRAVV Q+Y+++VN E+VIRGNSAV++C IPSFV D+V V+SW  DE  N 
Sbjct  124   GSIISRDVHVRAVVAQYYEADVNKEHVIRGNSAVIKCLIPSFVADFVEVVSWHTDEEENY  183

Query  177   YGSLDDNSKDNFDGKYLVLPSGELHIKEVGPEDGYKSYQCRTKHRLTGETRLSATKGRLV  236
             +   +      +DGKYLVLPSGELHI+EVGPEDGYKSYQCRTKHRLTGETRLSATKGRLV
Sbjct  184   FPGAE------YDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLV  237

Query  237   ITEPVGSVAPKVNVADKGHISSARTGHTTDILCPAQGYPMPAFRWYKFIEGTTRKQAVVL  296
             ITEPVGSV PK+NV DK        G    +LCPAQ YP+PA RWYKFIEGTTRKQAVVL
Sbjct  238   ITEPVGSVKPKINVQDKLQTREISQGIGIALLCPAQSYPIPAHRWYKFIEGTTRKQAVVL  297

Query  297   NDRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPSQVVDF  356
             NDRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPP+Q VDF
Sbjct  298   NDRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDF  357

Query  357   GRPAVFTCHFSGNPIKTVSWLKDGKKIGHTDAILRIESVKKEHKGMYQCFIRNDQESAEA  416
             GRPAVFTC ++GNPIKTVSW+KDGK IGH++ +LRIESVKKE KGMYQCF+RNDQESAEA
Sbjct  358   GRPAVFTCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEA  417

Query  417   SAELKLGGRFDPPIIRQAFPEETLHPGPSVFLKCVAGGLPTPEISWELDGKKIANSERYQ  476
             SAELKLGGRFDPP+IRQAF EET+ PGPSVFLKCVAGG PTPEISWELDGKKIAN++RYQ
Sbjct  418   SAELKLGGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQ  477

Query  477   VGQYVTVNGDVVSYLNITSIHANDGGLYKCIASSKVGVAEHSAKLNVYGLPYIRPMEKKA  536
             VGQYVTVNGDVVSYLNITS+HANDGGLYKCIA SKVGVAEHSAKLNVYGLPYIR MEKKA
Sbjct  478   VGQYVTVNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKA  537

Query  537   IVAGENLIVTCPVAGYPIESIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTC  596
             IVAGE LIVTCPVAGYPI+SIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTC
Sbjct  538   IVAGETLIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTC  597

Query  597   VAKNSEGYSARGALEVQVMVLPQIVHFDFGDEEINSMDMVSASCTVNKGDLPVEIYWKRN  656
             VAKN EGYSARG+LEVQVMVLPQ+V FDFG+E IN +DMVSASCTVNKGDLPV+IYW +N
Sbjct  598   VAKNQEGYSARGSLEVQVMVLPQVVPFDFGEESINELDMVSASCTVNKGDLPVDIYWTKN  657

Query  657   GHKIFSNDGISISRTNKRMSVLSIESVRDRHSGEYTCVAENPAGVVEHTAVLSVNVPPRW  716
             G ++++NDG+ ++R ++R+SVLSIESVR RH+G Y+CVA N AG +  +A+L+VNVPPRW
Sbjct  658   GGRVYTNDGLIVTRNSQRLSVLSIESVRARHAGNYSCVATNNAGAITQSAMLAVNVPPRW  717

Query  717   ILEPTDKAFAQGSDAKVECKSDGFPKPQVTWKKAVGDTPGEYKDMKQSNNIRVDEGTLYI  776
             ILEPTDKAFAQGSDAKVECK+DGFPKPQVTWKKAVGDTPGEYKD+K+S+NIRV+EGTL++
Sbjct  718   ILEPTDKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHV  777

Query  777   DNIQKNNEGYYLCEAINGIGSGLSAVILISVQAPPEFVEKLRNQTARRSEPAVLQCEAKG  836
             DNIQK NEGYYLCEAINGIGSGLSAVI+ISVQAPPEF EKLRNQTARR EPAVLQCEAKG
Sbjct  778   DNIQKTNEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKG  837

Query  837   EKPIGILWNMNNMRLDPKTDNRYTIREEILSTGVMSSLSIKRTERTDSALFTCVATNAFG  896
             EKPIGILWNMNNMRLDPK DNRYTIREEILSTGVMSSLSIKRTER+DSALFTCVATNAFG
Sbjct  838   EKPIGILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAFG  897

Query  897   SDDASINMIIQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLKRYIIEFKTSRGSWEH  956
             SDDASINMI+QEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPL RYIIEFK SR SW  
Sbjct  898   SDDASINMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWS-  956

Query  957   DVDRVIVPGHTNEAQVQKLNPATTYNIRIVAENEIGVSDSSEVVPIITAEEAPSGKPQSI  1016
             ++DRVIVPGHT EAQVQKL+PATTYNIRIVAEN IG S SSE V IITAEEAPSGKPQ+I
Sbjct  957   EIDRVIVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNI  1016

Query  1017  KVEPLSQTSLRVLWKAPPRSDWNGEILGYYVGYKLTNNNGSYYFEDYKYMMEEGKEYSYE  1076
             KVEP++QT++RV WK PPR++WNGEILGYYVGYKL+N N SY FE   ++ EEGKE++ E
Sbjct  1017  KVEPVNQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLE  1076

Query  1077  LTNLKTYTQYSVVIQAYNKVGAGPLSEDEKQYTAEGTPDQPPSDITCTTLTSQTIRVSWV  1136
             L NL+ YTQYSVVIQA+NK+GAGPLSE+EKQ+TAEGTP QPPSD  CTTLTSQTIRV WV
Sbjct  1077  LQNLRVYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWV  1136

Query  1137  SPPLESANGVIKGYKVVYAPSELWYDDKNKDYKKTASSDTVLHGLKKYTNYTMQVLATTS  1196
             SPPLESANGVIK YKVVYAPS+ WYD+  + YKKTASSDTVLHGLKKYTNYTMQVLATT+
Sbjct  1137  SPPLESANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTA  1196

Query  1197  GGDGVRSPPIHCQTEQDVPEAPTAVKALVVGSEAILVSWLPPAQPNGLITQYTVYSKEEG  1256
             GGDGVRS PIHCQTE DVPEAPT VKALV+G+ AILVSW PPAQPNG+ITQYTVYSK EG
Sbjct  1197  GGDGVRSVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEG  1256

Query  1257  TESEVKSHKVPPYQMSYEASSLDKNKPFEFWVTANTNIGEGQASKSIVAMPSDKVPAKIA  1316
              E+E K+ KVP YQMS+EA+ L+KNKP+EFWVTA+T IGEGQ SKSIVAMPSD+VPAKIA
Sbjct  1257  AETETKTQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIA  1316

Query  1317  SFDDTFTAIFKEDFKLPCLAVGAPAPDITWKVKGVEFVPNDRVRQLPEGSLSIKDVIRQD  1376
             SFDDTFTA FKED K+PCLAVGAP P+ITWK+KGVEF  NDR+R LP+GSL IK V RQD
Sbjct  1317  SFDDTFTATFKEDAKMPCLAVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNRQD  1376

Query  1377  AGDYTCMAENSIAKDSITHKLIVLAPPQSPQVLLTATTTDSLTLKLKQHDGDTAPIHGYT  1436
             AGDY+C AENSIAKDSITHKLIVLAPPQSP V L+ATTTD+LT+KLK H+GDTAP+HGYT
Sbjct  1377  AGDYSCHAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGYT  1436

Query  1437  LHYKPEFGDWETVEVAVDAQKYTIENLFCGSRYQVYATGYNNIGAGEASDILNTRTKGSK  1496
             LHYKPEFG+WET EV+VD+QK+ IE L CGSRYQVYATG+NNIGAGEASDILNTRTKG K
Sbjct  1437  LHYKPEFGEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKGQK  1496

Query  1497  PMMPENSKFIDPSSNTVTLHLPTWKDGGCRMSHFVVEYKKKDHAEWTQISNNVKPGGNFV  1556
             P +PE  +FI+ SSN+V+LH   WKDGGC MSHFVVE KK+D  EW QISNNVKP  N+V
Sbjct  1497  PKLPEKPRFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKRDQIEWNQISNNVKPDNNYV  1556

Query  1557  VLDLDAASWYSVRITAHNSAGFTVAEYEFATLTVTGGTLAPPLNTAVLNGKTY----LPP  1612
             VLDL+ A+WY++RITAHNSAGFTVAEY+FATLTVTGGT+A PL+    +G  +    LP 
Sbjct  1557  VLDLEPATWYNLRITAHNSAGFTVAEYDFATLTVTGGTIA-PLDDGSGHGNVHTRIRLPA  1615

Query  1613  WMPQWFDLNFMVPLIATIIVVFVGVLVICVALSRRRMEDPRGGPKDVYYDVVYNQPMGPG  1672
             WMP+W DLNFMVPLIAT++VV VG+ V+CVALSRRR +D RGG KDVYYDVVYNQ MGPG
Sbjct  1616  WMPEWLDLNFMVPLIATVVVVAVGICVVCVALSRRRADDMRGGQKDVYYDVVYNQTMGPG  1675

Query  1673  ATMDKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRGTVISRSMRSNHSTWDPRR-  1731
             AT+DKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG      +RSNHSTWDPRR 
Sbjct  1676  ATLDKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG---RGGLRSNHSTWDPRRN  1732

Query  1732  -PLYEELKPPPVPRR-----HYHGSDECYHTHPHPHPAGMEDEICPYATFHLLGFREEMD  1785
               LYEELK PPVP       H HG+ EC++ HP     GMEDEICPYATFHLLGFREEMD
Sbjct  1733  PNLYEELKAPPVPMHGNHYGHAHGNAECHYRHP-----GMEDEICPYATFHLLGFREEMD  1787

Query  1786  PTKAMNFQTFPHQNGHTG--PGHA-TMGPGGPPGHIHSRSGSQSMPRQNRYARKNSQGGQ  1842
             PTKAMNFQTFPHQNGH G  PGHA TM P G PGH+HSRSGSQSMPR NRY RKNSQGGQ
Sbjct  1788  PTKAMNFQTFPHQNGHAGPVPGHAGTMLPPGHPGHVHSRSGSQSMPRANRYQRKNSQGGQ  1847

Query  1843  SSIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYGGPGPEYDDPANCAPEDDQYGSQY  1902
             SSIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLY GPGPEYDDPANCAPE+DQYGSQY
Sbjct  1848  SSIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYSGPGPEYDDPANCAPEEDQYGSQY  1907

Query  1903  GAPYG--YDHYGSRGSVGRRSVGSARNLPNGSPEPPPPPPRNHDTSNSSFNDSKESNEIS  1960
             G PYG  YDHYGSRGS+GRRS+GSARN  NGSPEPPPPPPRNHD SNSSFNDSKESNEIS
Sbjct  1908  GGPYGQPYDHYGSRGSMGRRSIGSARNPGNGSPEPPPPPPRNHDMSNSSFNDSKESNEIS  1967

Query  1961  EAECDRDH-PRGNYGENENSGDAKRSANTKDVRTTEEMRKLIDSRKSNEVAAKLQQQGGP  2019
             EAECDRDH PRGNYG        KRS   KD RTTEEMRKLI+  ++     +LQQ  G 
Sbjct  1968  EAECDRDHGPRGNYGA------VKRSPQPKDQRTTEEMRKLIERNETGPKQLQLQQANG-  2020

Query  2020  AGLTAYDTLAV  2030
             AG TAYDT+AV
Sbjct  2021  AGFTAYDTMAV  2031


>Q0E9L6_DROME unnamed protein product
Length=2034

 Score = 3336 bits (8651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1644/2053 (80%), Positives = 1807/2053 (88%), Gaps = 49/2053 (2%)

Query  3     QRTKWITKIIFIAV-LVDLGS---TANT-EADTKGPMFLKEPINRIDFSNSTGSVVECRA  57
             +R KW+  ++F AV L+  GS    AN  +AD KGP+FLKEP NRIDFSNSTG+ +EC+A
Sbjct  6     ERLKWL--MLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAEIECKA  63

Query  58    SGNPAPEIIWVRSDGTAVGDVPGLRQVLSNGNLVFPPFRAEDYRQEVHAQVYACLAKNQF  117
             SGNP PEIIW+RSDGTAVGDVPGLRQ+ S+G LVFPPFRAEDYRQEVHAQVYACLA+NQF
Sbjct  64    SGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQF  123

Query  118   GSIISRDVNVRAVVHQFYQSEVNNEYVIRGNSAVLRCSIPSFVGDYVTVLSWQDENG-NL  176
             GSIISRDV+VRAVVHQFYQ+ V +E+V+RGNSA L+C +PSFV D++ V  W DE G  +
Sbjct  124   GSIISRDVHVRAVVHQFYQTRVIDEFVLRGNSATLKCLVPSFVADFIDVEGWIDEEGVEI  183

Query  177   YGSLDDNSKDNFDGKYLVLPSGELHIKEVGPEDGYKSYQCRTKHRLTGETRLSATKGRLV  236
                L D   D+ DGKYLVLPSGELHI+EVGPEDGYKSYQCRTKHRLTGETRLSATKGRLV
Sbjct  184   LRPLPD---DSVDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLV  240

Query  237   ITEPVGSVAPKVNVADKGHISSARTGH--TTDILCPAQGYPMPAFRWYKFIEGTTRKQAV  294
             ITEPVGSVAPKV++ D+  I+ AR G   +  I+CPAQ YP+PAFRWYKFIEGTTRKQAV
Sbjct  241   ITEPVGSVAPKVDIKDE--INYARVGQDRSLAIVCPAQSYPVPAFRWYKFIEGTTRKQAV  298

Query  295   VLNDRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPSQVV  354
             VLNDRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPP+Q V
Sbjct  299   VLNDRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTV  358

Query  355   DFGRPAVFTCHFSGNPIKTVSWLKDGKKIGHTDAILRIESVKKEHKGMYQCFIRNDQESA  414
             DFGRPAVFTC ++GNPIKTVSW+KDGK IGH++ +LRIESVKKE KGMYQCF+RNDQESA
Sbjct  359   DFGRPAVFTCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESA  418

Query  415   EASAELKLGGRFDPPIIRQAFPEETLHPGPSVFLKCVAGGLPTPEISWELDGKKIANSER  474
             EASAELKLGGRFDPP+IRQAF EET+ PGPSVFLKCVAGG PTPEISWELDGKKIAN++R
Sbjct  419   EASAELKLGGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDR  478

Query  475   YQVGQYVTVNGDVVSYLNITSIHANDGGLYKCIASSKVGVAEHSAKLNVYGLPYIRPMEK  534
             YQVGQYVTVNGDVVSYLNITS+HANDGGLYKCIA SKVGVAEHSAKLNVYGLPYIR MEK
Sbjct  479   YQVGQYVTVNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEK  538

Query  535   KAIVAGENLIVTCPVAGYPIESIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATY  594
             KAIVAGE LIVTCPVAGYPI+SIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATY
Sbjct  539   KAIVAGETLIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATY  598

Query  595   TCVAKNSEGYSARGALEVQVMVLPQIVHFDFGDEEINSMDMVSASCTVNKGDLPVEIYWK  654
             TCVAKN EGYSARG+LEVQVMVLPQIV FDFG+E +N +DMVSASCTVNKGDLP+++ W 
Sbjct  599   TCVAKNQEGYSARGSLEVQVMVLPQIVPFDFGEETVNELDMVSASCTVNKGDLPIDVAWT  658

Query  655   RNGHKIFSNDGISISRTNKRMSVLSIESVRDRHSGEYTCVAENPAGVVEHTAVLSVNVPP  714
             +NG ++++NDGI +++T+ RMSVLSIES R RH+G Y+CVA N AG     AVL+VNVPP
Sbjct  659   KNGGRVYTNDGIVVTKTSTRMSVLSIESARARHAGNYSCVATNNAGETRQWAVLAVNVPP  718

Query  715   RWILEPTDKAFAQGSDAKVECKSDGFPKPQVTWKKAVGDTPGEYKDMKQSNNIRVDEGTL  774
             RWILEPTDKAFAQGSDAKVECK+DGFPKPQVTWKKAVGDTPGEYKD+K+S+NIRV+EGTL
Sbjct  719   RWILEPTDKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTL  778

Query  775   YIDNIQKNNEGYYLCEAINGIGSGLSAVILISVQAPPEFVEKLRNQTARRSEPAVLQCEA  834
             ++DNIQK NEGYYLCEAINGIGSGLSAVI+ISVQAPPEF EKLRNQTARR EPAVLQCEA
Sbjct  779   HVDNIQKTNEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEA  838

Query  835   KGEKPIGILWNMNNMRLDPKTDNRYTIREEILSTGVMSSLSIKRTERTDSALFTCVATNA  894
             KGEKPIGILWNMNNMRLDPK DNRYTIREEILSTGVMSSLSIKRTER+DSALFTCVATNA
Sbjct  839   KGEKPIGILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNA  898

Query  895   FGSDDASINMIIQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLKRYIIEFKTSRGSW  954
             FGSDDASINMI+QEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPL RYIIEFK SR SW
Sbjct  899   FGSDDASINMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASW  958

Query  955   EHDVDRVIVPGHTNEAQVQKLNPATTYNIRIVAENEIGVSDSSEVVPIITAEEAPSGKPQ  1014
               ++DRVIVPGHT EAQVQKL+PATTYNIRIVAEN IG S SSE V IITAEEAPSGKPQ
Sbjct  959   S-EIDRVIVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQ  1017

Query  1015  SIKVEPLSQTSLRVLWKAPPRSDWNGEILGYYVGYKLTNNNGSYYFEDYKYMMEEGKEYS  1074
             +IKVEP++QT++RV WK PPR++WNGEILGYYVGYKL+N N SY FE   ++ EEGKE++
Sbjct  1018  NIKVEPVNQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHN  1077

Query  1075  YELTNLKTYTQYSVVIQAYNKVGAGPLSEDEKQYTAEGTPDQPPSDITCTTLTSQTIRVS  1134
              EL NL+ YTQYSVVIQA+NK+GAGPLSE+EKQ+TAEGTP QPPSD  CTTLTSQTIRV 
Sbjct  1078  LELQNLRVYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVG  1137

Query  1135  WVSPPLESANGVIKGYKVVYAPSELWYDDKNKDYKKTASSDTVLHGLKKYTNYTMQVLAT  1194
             WVSPPLESANGVIK YKVVYAPS+ WYD+  + YKKTASSDTVLHGLKKYTNYTMQVLAT
Sbjct  1138  WVSPPLESANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLAT  1197

Query  1195  TSGGDGVRSPPIHCQTEQDVPEAPTAVKALVVGSEAILVSWLPPAQPNGLITQYTVYSKE  1254
             T+GGDGVRS PIHCQTE DVPEAPT VKALV+G+ AILVSW PPAQPNG+ITQYTVYSK 
Sbjct  1198  TAGGDGVRSVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKA  1257

Query  1255  EGTESEVKSHKVPPYQMSYEASSLDKNKPFEFWVTANTNIGEGQASKSIVAMPSDKVPAK  1314
             EG E+E K+ KVP YQMS+EA+ L+KNKP+EFWVTA+T IGEGQ SKSIVAMPSD+VPAK
Sbjct  1258  EGAETETKTQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAK  1317

Query  1315  IASFDDTFTAIFKEDFKLPCLAVGAPAPDITWKVKGVEFVPNDRVRQLPEGSLSIKDVIR  1374
             IASFDDTFTA FKED K+PCLAVGAP P+ITWK+KGVEF  NDR+R LP+GSL IK V R
Sbjct  1318  IASFDDTFTATFKEDAKMPCLAVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNR  1377

Query  1375  QDAGDYTCMAENSIAKDSITHKLIVLAPPQSPQVLLTATTTDSLTLKLKQHDGDTAPIHG  1434
             QDAGDY+C AENSIAKDSITHKLIVLAPPQSP V L+ATTTD+LT+KLK H+GDTAP+HG
Sbjct  1378  QDAGDYSCHAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHG  1437

Query  1435  YTLHYKPEFGDWETVEVAVDAQKYTIENLFCGSRYQVYATGYNNIGAGEASDILNTRTKG  1494
             YTLHYKPEFG+WET EV+VD+QK+ IE L CGSRYQVYATG+NNIGAGEASDILNTRTKG
Sbjct  1438  YTLHYKPEFGEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKG  1497

Query  1495  SKPMMPENSKFIDPSSNTVTLHLPTWKDGGCRMSHFVVEYKKKDHAEWTQISNNVKPGGN  1554
              KP +PE  +FI+ SSN+V+LH   WKDGGC MSHFVVE KK+D  EW QISNNVKP  N
Sbjct  1498  QKPKLPEKPRFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKRDQIEWNQISNNVKPDNN  1557

Query  1555  FVVLDLDAASWYSVRITAHNSAGFTVAEYEFATLTVTGGTLAPPLNTAVLNGKTY----L  1610
             +VVLDL+ A+WY++RITAHNSAGFTVAEY+FATLTVTGGT+A PL+    +G  +    L
Sbjct  1558  YVVLDLEPATWYNLRITAHNSAGFTVAEYDFATLTVTGGTIA-PLDDGSGHGNVHTRIRL  1616

Query  1611  PPWMPQWFDLNFMVPLIATIIVVFVGVLVICVALSRRRMEDPRGGPKDVYYDVVYNQPMG  1670
             P WMP+W DLNFMVPLIAT++VV VG+ V+CVALSRRR +D RGG KDVYYDVVYNQ MG
Sbjct  1617  PAWMPEWLDLNFMVPLIATVVVVAVGICVVCVALSRRRADDMRGGQKDVYYDVVYNQTMG  1676

Query  1671  PGATMDKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRGTVISRSMRSNHSTWDPR  1730
             PGAT+DKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG      +RSNHSTWDPR
Sbjct  1677  PGATLDKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG---RGGLRSNHSTWDPR  1733

Query  1731  R--PLYEELKPPPVPRR-----HYHGSDECYHTHPHPHPAGMEDEICPYATFHLLGFREE  1783
             R   LYEELK PPVP       H HG+ EC++ HP     GMEDEICPYATFHLLGFREE
Sbjct  1734  RNPNLYEELKAPPVPMHGNHYGHAHGNAECHYRHP-----GMEDEICPYATFHLLGFREE  1788

Query  1784  MDPTKAMNFQTFPHQNGHTG--PGHA-TMGPGGPPGHIHSRSGSQSMPRQNRYARKNSQG  1840
             MDPTKAMNFQTFPHQNGH G  PGHA TM P G PGH+HSRSGSQSMPR NRY RKNSQG
Sbjct  1789  MDPTKAMNFQTFPHQNGHAGPVPGHAGTMLPPGHPGHVHSRSGSQSMPRANRYQRKNSQG  1848

Query  1841  GQSSIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYGGPGPEYDDPANCAPEDDQYGS  1900
             GQSSIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLY GPGPEYDDPANCAPE+DQYGS
Sbjct  1849  GQSSIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYSGPGPEYDDPANCAPEEDQYGS  1908

Query  1901  QYGAPYG--YDHYGSRGSVGRRSVGSARNLPNGSPEPPPPPPRNHDTSNSSFNDSKESNE  1958
             QYG PYG  YDHYGSRGS+GRRS+GSARN  NGSPEPPPPPPRNHD SNSSFNDSKESNE
Sbjct  1909  QYGGPYGQPYDHYGSRGSMGRRSIGSARNPGNGSPEPPPPPPRNHDMSNSSFNDSKESNE  1968

Query  1959  ISEAECDRDH-PRGNYGENENSGDAKRSANTKDVRTTEEMRKLIDSRKSNEVAAKLQQQG  2017
             ISEAECDRDH PRGNYG        KRS   KD RTTEEMRKLI+  ++     +LQQ  
Sbjct  1969  ISEAECDRDHGPRGNYGA------VKRSPQPKDQRTTEEMRKLIERNETGPKQLQLQQAN  2022

Query  2018  GPAGLTAYDTLAV  2030
             G AG TAYDT+AV
Sbjct  2023  G-AGFTAYDTMAV  2034


>Q0E9J2_DROME unnamed protein product
Length=2031

 Score = 3328 bits (8630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1633/2050 (80%), Positives = 1802/2050 (88%), Gaps = 46/2050 (2%)

Query  3     QRTKWITKIIFIAV-LVDLGS---TANT-EADTKGPMFLKEPINRIDFSNSTGSVVECRA  57
             +R KW+  ++F AV L+  GS    AN  +AD KGP+FLKEP NRIDFSNSTG+ +EC+A
Sbjct  6     ERLKWL--MLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAEIECKA  63

Query  58    SGNPAPEIIWVRSDGTAVGDVPGLRQVLSNGNLVFPPFRAEDYRQEVHAQVYACLAKNQF  117
             SGNP PEIIW+RSDGTAVGDVPGLRQ+ S+G LVFPPFRAEDYRQEVHAQVYACLA+NQF
Sbjct  64    SGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQF  123

Query  118   GSIISRDVNVRAVVHQFYQSEVNNEYVIRGNSAVLRCSIPSFVGDYVTVLSWQDENGNLY  177
             GSIISRDV+VRAVV+Q+Y++EV +EYVIRGN+AVL+C+IPSFV D++ V +W   +G  Y
Sbjct  124   GSIISRDVHVRAVVNQYYEAEVVSEYVIRGNTAVLKCTIPSFVADFLRVEAWVASDGTEY  183

Query  178   GSLDDNSKDNFDGKYLVLPSGELHIKEVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI  237
                +D     FDGKYLVLPSGELHI+EVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI
Sbjct  184   APEED-----FDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI  238

Query  238   TEPVGSVAPKVNVADKGHISSARTGHTTDILCPAQGYPMPAFRWYKFIEGTTRKQAVVLN  297
             TEPV SV PK+N+ ++        G    + CP Q +P+P  RWYKFIEGTTRKQAVVLN
Sbjct  239   TEPVASVPPKLNLLERVRTMEVSVGTKYAMQCPGQAFPVPINRWYKFIEGTTRKQAVVLN  298

Query  298   DRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPSQVVDFG  357
             DRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPP+Q VDFG
Sbjct  299   DRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFG  358

Query  358   RPAVFTCHFSGNPIKTVSWLKDGKKIGHTDAILRIESVKKEHKGMYQCFIRNDQESAEAS  417
             RPAVFTC ++GNPIKTVSW+KDGK IGH++ +LRIESVKKE KGMYQCF+RNDQESAEAS
Sbjct  359   RPAVFTCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEAS  418

Query  418   AELKLGGRFDPPIIRQAFPEETLHPGPSVFLKCVAGGLPTPEISWELDGKKIANSERYQV  477
             AELKLGGRFDPP+IRQAF EET+ PGPSVFLKCVAGG PTPEISWELDGKKIAN++RYQV
Sbjct  419   AELKLGGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQV  478

Query  478   GQYVTVNGDVVSYLNITSIHANDGGLYKCIASSKVGVAEHSAKLNVYGLPYIRPMEKKAI  537
             GQYVTVNGDVVSYLNITS+HANDGGLYKCIA SKVGVAEHSAKLNVYGLPYIR MEKKAI
Sbjct  479   GQYVTVNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKAI  538

Query  538   VAGENLIVTCPVAGYPIESIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCV  597
             VAGE LIVTCPVAGYPI+SIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCV
Sbjct  539   VAGETLIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCV  598

Query  598   AKNSEGYSARGALEVQVMVLPQIVHFDFGDEEINSMDMVSASCTVNKGDLPVEIYWKRNG  657
             AKN EGYSARG+LEVQVMVLPQ+V FDFG+E IN +DMVSASCTVNKGDLPV+IYW +NG
Sbjct  599   AKNQEGYSARGSLEVQVMVLPQVVPFDFGEESINELDMVSASCTVNKGDLPVDIYWTKNG  658

Query  658   HKIFSNDGISISRTNKRMSVLSIESVRDRHSGEYTCVAENPAGVVEHTAVLSVNVPPRWI  717
              ++++NDG+ ++R ++R+SVLSIESVR RH+G Y+CVA N AG +  +A+L+VNVPPRWI
Sbjct  659   GRVYTNDGLIVTRNSQRLSVLSIESVRARHAGNYSCVATNNAGAITQSAMLAVNVPPRWI  718

Query  718   LEPTDKAFAQGSDAKVECKSDGFPKPQVTWKKAVGDTPGEYKDMKQSNNIRVDEGTLYID  777
             LEPTDKAFAQGSDAKVECK+DGFPKPQVTWKKAVGDTPGEYKD+K+S+NIRV+EGTL++D
Sbjct  719   LEPTDKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHVD  778

Query  778   NIQKNNEGYYLCEAINGIGSGLSAVILISVQAPPEFVEKLRNQTARRSEPAVLQCEAKGE  837
             NIQK NEGYYLCEAINGIGSGLSAVI+ISVQAPPEF EKLRNQTARR EPAVLQCEAKGE
Sbjct  779   NIQKTNEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKGE  838

Query  838   KPIGILWNMNNMRLDPKTDNRYTIREEILSTGVMSSLSIKRTERTDSALFTCVATNAFGS  897
             KPIGILWNMNNMRLDPK DNRYTIREEILSTGVMSSLSIKRTER+DSALFTCVATNAFGS
Sbjct  839   KPIGILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAFGS  898

Query  898   DDASINMIIQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLKRYIIEFKTSRGSWEHD  957
             DDASINMI+QEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPL RYIIEFK SR SW  +
Sbjct  899   DDASINMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWS-E  957

Query  958   VDRVIVPGHTNEAQVQKLNPATTYNIRIVAENEIGVSDSSEVVPIITAEEAPSGKPQSIK  1017
             +DRVIVPGHT EAQVQKL+PATTYNIRIVAEN IG S SSE V IITAEEAPSGKPQ+IK
Sbjct  958   IDRVIVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNIK  1017

Query  1018  VEPLSQTSLRVLWKAPPRSDWNGEILGYYVGYKLTNNNGSYYFEDYKYMMEEGKEYSYEL  1077
             VEP++QT++RV WK PPR++WNGEILGYYVGYKL+N N SY FE   ++ EEGKE++ EL
Sbjct  1018  VEPVNQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLEL  1077

Query  1078  TNLKTYTQYSVVIQAYNKVGAGPLSEDEKQYTAEGTPDQPPSDITCTTLTSQTIRVSWVS  1137
              NL+ YTQYSVVIQA+NK+GAGPLSE+EKQ+TAEGTP QPPSD  CTTLTSQTIRV WVS
Sbjct  1078  QNLRVYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWVS  1137

Query  1138  PPLESANGVIKGYKVVYAPSELWYDDKNKDYKKTASSDTVLHGLKKYTNYTMQVLATTSG  1197
             PPLESANGVIK YKVVYAPS+ WYD+  + YKKTASSDTVLHGLKKYTNYTMQVLATT+G
Sbjct  1138  PPLESANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTAG  1197

Query  1198  GDGVRSPPIHCQTEQDVPEAPTAVKALVVGSEAILVSWLPPAQPNGLITQYTVYSKEEGT  1257
             GDGVRS PIHCQTE DVPEAPT VKALV+G+ AILVSW PPAQPNG+ITQYTVYSK EG 
Sbjct  1198  GDGVRSVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEGA  1257

Query  1258  ESEVKSHKVPPYQMSYEASSLDKNKPFEFWVTANTNIGEGQASKSIVAMPSDKVPAKIAS  1317
             E+E K+ KVP YQMS+EA+ L+KNKP+EFWVTA+T IGEGQ SKSIVAMPSD+VPAKIAS
Sbjct  1258  ETETKTQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIAS  1317

Query  1318  FDDTFTAIFKEDFKLPCLAVGAPAPDITWKVKGVEFVPNDRVRQLPEGSLSIKDVIRQDA  1377
             FDDTFTA FKED K+PCLAVGAP P+ITWK+KGVEF  NDR+R LP+GSL IK V RQDA
Sbjct  1318  FDDTFTATFKEDAKMPCLAVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNRQDA  1377

Query  1378  GDYTCMAENSIAKDSITHKLIVLAPPQSPQVLLTATTTDSLTLKLKQHDGDTAPIHGYTL  1437
             GDY+C AENSIAKDSITHKLIVLAPPQSP V L+ATTTD+LT+KLK H+GDTAP+HGYTL
Sbjct  1378  GDYSCHAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGYTL  1437

Query  1438  HYKPEFGDWETVEVAVDAQKYTIENLFCGSRYQVYATGYNNIGAGEASDILNTRTKGSKP  1497
             HYKPEFG+WET EV+VD+QK+ IE L CGSRYQVYATG+NNIGAGEASDILNTRTKG KP
Sbjct  1438  HYKPEFGEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKGQKP  1497

Query  1498  MMPENSKFIDPSSNTVTLHLPTWKDGGCRMSHFVVEYKKKDHAEWTQISNNVKPGGNFVV  1557
              +PE  +FI+ SSN+V+LH   WKDGGC MSHFVVE KK+D  EW QISNNVKP  N+VV
Sbjct  1498  KLPEKPRFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKRDQIEWNQISNNVKPDNNYVV  1557

Query  1558  LDLDAASWYSVRITAHNSAGFTVAEYEFATLTVTGGTLAPPLNTAVLNGKTY----LPPW  1613
             LDL+ A+WY++RITAHNSAGFTVAEY+FATLTVTGGT+A PL+    +G  +    LP W
Sbjct  1558  LDLEPATWYNLRITAHNSAGFTVAEYDFATLTVTGGTIA-PLDDGSGHGNVHTRIRLPAW  1616

Query  1614  MPQWFDLNFMVPLIATIIVVFVGVLVICVALSRRRMEDPRGGPKDVYYDVVYNQPMGPGA  1673
             MP+W DLNFMVPLIAT++VV VG+ V+CVALSRRR +D RGG KDVYYDVVYNQ MGPGA
Sbjct  1617  MPEWLDLNFMVPLIATVVVVAVGICVVCVALSRRRADDMRGGQKDVYYDVVYNQTMGPGA  1676

Query  1674  TMDKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRGTVISRSMRSNHSTWDPRR--  1731
             T+DKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG      +RSNHSTWDPRR  
Sbjct  1677  TLDKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG---RGGLRSNHSTWDPRRNP  1733

Query  1732  PLYEELKPPPVPRR-----HYHGSDECYHTHPHPHPAGMEDEICPYATFHLLGFREEMDP  1786
              LYEELK PPVP       H HG+ EC++ HP     GMEDEICPYATFHLLGFREEMDP
Sbjct  1734  NLYEELKAPPVPMHGNHYGHAHGNAECHYRHP-----GMEDEICPYATFHLLGFREEMDP  1788

Query  1787  TKAMNFQTFPHQNGHTG--PGHA-TMGPGGPPGHIHSRSGSQSMPRQNRYARKNSQGGQS  1843
             TKAMNFQTFPHQNGH G  PGHA TM P G PGH+HSRSGSQSMPR NRY RKNSQGGQS
Sbjct  1789  TKAMNFQTFPHQNGHAGPVPGHAGTMLPPGHPGHVHSRSGSQSMPRANRYQRKNSQGGQS  1848

Query  1844  SIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYGGPGPEYDDPANCAPEDDQYGSQYG  1903
             SIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLY GPGPEYDDPANCAPE+DQYGSQYG
Sbjct  1849  SIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYSGPGPEYDDPANCAPEEDQYGSQYG  1908

Query  1904  APYG--YDHYGSRGSVGRRSVGSARNLPNGSPEPPPPPPRNHDTSNSSFNDSKESNEISE  1961
              PYG  YDHYGSRGS+GRRS+GSARN  NGSPEPPPPPPRNHD SNSSFNDSKESNEISE
Sbjct  1909  GPYGQPYDHYGSRGSMGRRSIGSARNPGNGSPEPPPPPPRNHDMSNSSFNDSKESNEISE  1968

Query  1962  AECDRDH-PRGNYGENENSGDAKRSANTKDVRTTEEMRKLIDSRKSNEVAAKLQQQGGPA  2020
             AECDRDH PRGNYG        KRS   KD RTTEEMRKLI+  ++     +LQQ  G A
Sbjct  1969  AECDRDHGPRGNYGA------VKRSPQPKDQRTTEEMRKLIERNETGPKQLQLQQANG-A  2021

Query  2021  GLTAYDTLAV  2030
             G TAYDT+AV
Sbjct  2022  GFTAYDTMAV  2031



Lambda      K        H
   0.314    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 27202772002


Query= XP_037024199.1 Down syndrome cell adhesion molecule-like protein
Dscam2 isoform X4 [Bradysia coprophila]

Length=2030
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q0E9L2_DROME  unnamed protein product                                 3338    0.0  
Q0E9J5_DROME  unnamed protein product                                 3305    0.0  
Q0E9J4_DROME  unnamed protein product                                 3298    0.0  


>Q0E9L2_DROME unnamed protein product
Length=2034

 Score = 3338 bits (8656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1640/2051 (80%), Positives = 1803/2051 (88%), Gaps = 45/2051 (2%)

Query  3     QRTKWITKIIFIAV-LVDLGS---TANT-EADTKGPMFLKEPINRIDFSNSTGSVVECRA  57
             +R KW+  ++F AV L+  GS    AN  +AD KGP+FLKEP NRIDFSNSTG+ +EC+A
Sbjct  6     ERLKWL--MLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAEIECKA  63

Query  58    SGNPAPEIIWVRSDGTAVGDVPGLRQVLSNGNLVFPPFRAEDYRQEVHAQVYACLAKNQF  117
             SGNP PEIIW+RSDGTAVGDVPGLRQ+ S+G LVFPPFRAEDYRQEVHAQVYACLA+NQF
Sbjct  64    SGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQF  123

Query  118   GSIISRDVNVRAVVHQFYQSEVNNEYVIRGNSAVLRCSIPSFVGDYVTVLSWQDENG-NL  176
             GSIISRDV+VRAVV QFY +E  NEYVI+GN+AV++C IPSFV D+V V +W DE G  L
Sbjct  124   GSIISRDVHVRAVVSQFYITEAENEYVIKGNAAVVKCKIPSFVADFVQVEAWVDEEGMEL  183

Query  177   YGSLDDNSKDNFDGKYLVLPSGELHIKEVGPEDGYKSYQCRTKHRLTGETRLSATKGRLV  236
             +    +N+ D +DGKYLVLPSGELHI+EVGPEDGYKSYQCRTKHRLTGETRLSATKGRLV
Sbjct  184   W---RNNATDAYDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLV  240

Query  237   ITEPVGSVAPKVNVADKGHISSARTGHTTDILCPAQGYPMPAFRWYKFIEGTTRKQAVVL  296
             ITEPVGSVAPKV++ DK   +   +  + ++ C AQG+PMPAFRWYKFIEGTTRKQAVVL
Sbjct  241   ITEPVGSVAPKVDMHDKMDFTIRSSNRSLNLFCKAQGFPMPAFRWYKFIEGTTRKQAVVL  300

Query  297   NDRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPSQVVDF  356
             NDRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPP+Q VDF
Sbjct  301   NDRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDF  360

Query  357   GRPAVFTCHFSGNPIKTVSWLKDGKKIGHTDAILRIESVKKEHKGMYQCFIRNDQESAEA  416
             GRPAVFTC ++GNPIKTVSW+KDGK IGH++ +LRIESVKKE KGMYQCF+RNDQESAEA
Sbjct  361   GRPAVFTCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEA  420

Query  417   SAELKLGGRFDPPIIRQAFPEETLHPGPSVFLKCVAGGLPTPEISWELDGKKIANSERYQ  476
             SAELKLGGRFDPP+IRQAF EET+ PGPSVFLKCVAGG PTPEISWELDGKKIAN++RYQ
Sbjct  421   SAELKLGGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQ  480

Query  477   VGQYVTVNGDVVSYLNITSIHANDGGLYKCIASSKVGVAEHSAKLNVYGLPYIRPMEKKA  536
             VGQYVTVNGDVVSYLNITS+HANDGGLYKCIA SKVGVAEHSAKLNVYGLPYIR MEKKA
Sbjct  481   VGQYVTVNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKA  540

Query  537   IVAGENLIVTCPVAGYPIESIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTC  596
             IVAGE LIVTCPVAGYPI+SIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTC
Sbjct  541   IVAGETLIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTC  600

Query  597   VAKNSEGYSARGALEVQVMVPPKIAPFSFGDEALSYGDTISITCTVSGGDLPVAVEWKLN  656
             VAKN EGYSARG+LEVQVM  PKI+PF+FG+E++SYG+ +++ CT+SGGDLPV + W LN
Sbjct  601   VAKNQEGYSARGSLEVQVMALPKISPFNFGEESMSYGEFVNVQCTISGGDLPVNITWTLN  660

Query  657   GSPLEAYLEIQTEKRGKRINNLVIDLVSAKHAGKYTCFAKNAAGVAEHSSELIVNVPPRW  716
               P E YLEI T KRGKRIN L I+ VSAKHAG Y+C A+N AGVA H++EL VNVPPRW
Sbjct  661   NKPFEDYLEILTTKRGKRINELTIEAVSAKHAGNYSCIAENKAGVANHTAELKVNVPPRW  720

Query  717   ILEPTDKAFAQGSDAKVECKSDGFPKPQVTWKKAVGDTPGEYKDMKQSNNIRVDEGTLYI  776
             ILEPTDKAFAQGSDAKVECK+DGFPKPQVTWKKAVGDTPGEYKD+K+S+NIRV+EGTL++
Sbjct  721   ILEPTDKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHV  780

Query  777   DNIQKNNEGYYLCEAINGIGSGLSAVILISVQAPPEFVEKLRNQTARRSEPAVLQCEAKG  836
             DNIQK NEGYYLCEAINGIGSGLSAVI+ISVQAPPEF EKLRNQTARR EPAVLQCEAKG
Sbjct  781   DNIQKTNEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKG  840

Query  837   EKPIGILWNMNNMRLDPKTDNRYTIREEILSTGVMSSLSIKRTERTDSALFTCVATNAFG  896
             EKPIGILWNMNNMRLDPK DNRYTIREEILSTGVMSSLSIKRTER+DSALFTCVATNAFG
Sbjct  841   EKPIGILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAFG  900

Query  897   SDDASINMIIQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLKRYIIEFKTSRGSWEH  956
             SDDASINMI+QEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPL RYIIEFK SR SW  
Sbjct  901   SDDASINMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWS-  959

Query  957   DVDRVIVPGHTNEAQVQKLNPATTYNIRIVAENEIGVSDSSEVVPIITAEEAPSGKPQSI  1016
             ++DRVIVPGHT EAQVQKL+PATTYNIRIVAEN IG S SSE V IITAEEAPSGKPQ+I
Sbjct  960   EIDRVIVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNI  1019

Query  1017  KVEPLSQTSLRVLWKAPPRSDWNGEILGYYVGYKLTNNNGSYYFEDYKYMMEEGKEYSYE  1076
             KVEP++QT++RV WK PPR++WNGEILGYYVGYKL+N N SY FE   ++ EEGKE++ E
Sbjct  1020  KVEPVNQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLE  1079

Query  1077  LTNLKTYTQYSVVIQAYNKVGAGPLSEDEKQYTAEGTPDQPPSDITCTTLTSQTIRVSWV  1136
             L NL+ YTQYSVVIQA+NK+GAGPLSE+EKQ+TAEGTP QPPSD  CTTLTSQTIRV WV
Sbjct  1080  LQNLRVYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWV  1139

Query  1137  SPPLESANGVIKGYKVVYAPSELWYDDKNKDYKKTASSDTVLHGLKKYTNYTMQVLATTS  1196
             SPPLESANGVIK YKVVYAPS+ WYD+  + YKKTASSDTVLHGLKKYTNYTMQVLATT+
Sbjct  1140  SPPLESANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTA  1199

Query  1197  GGDGVRSPPIHCQTEQDVPEAPTAVKALVVGSEAILVSWLPPAQPNGLITQYTVYSKEEG  1256
             GGDGVRS PIHCQTE DVPEAPT VKALV+G+ AILVSW PPAQPNG+ITQYTVYSK EG
Sbjct  1200  GGDGVRSVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEG  1259

Query  1257  TESEVKSHKVPPYQMSYEASSLDKNKPFEFWVTANTNIGEGQASKSIVAMPSDKVPAKIA  1316
              E+E K+ KVP YQMS+EA+ L+KNKP+EFWVTA+T IGEGQ SKSIVAMPSD+VPAKIA
Sbjct  1260  AETETKTQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIA  1319

Query  1317  SFDDTFTAIFKEDFKLPCLAVGAPAPDITWKVKGVEFVPNDRVRQLPEGSLSIKDVIRQD  1376
             SFDDTFTA FKED K+PCLAVGAP P+ITWK+KGVEF  NDR+R LP+GSL IK V RQD
Sbjct  1320  SFDDTFTATFKEDAKMPCLAVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNRQD  1379

Query  1377  AGDYTCMAENSIAKDSITHKLIVLAPPQSPQVLLTATTTDSLTLKLKQHDGDTAPIHGYT  1436
             AGDY+C AENSIAKDSITHKLIVLAPPQSP V L+ATTTD+LT+KLK H+GDTAP+HGYT
Sbjct  1380  AGDYSCHAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGYT  1439

Query  1437  LHYKPEFGDWETVEVAVDAQKYTIENLFCGSRYQVYATGYNNIGAGEASDILNTRTKGSK  1496
             LHYKPEFG+WET EV+VD+QK+ IE L CGSRYQVYATG+NNIGAGEASDILNTRTKG K
Sbjct  1440  LHYKPEFGEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKGQK  1499

Query  1497  PMMPENSKFIDPSSNTVTLHLPTWKDGGCRMSHFVVEYKKKDHAEWTQISNNVKPGGNFV  1556
             P +PE  +FI+ SSN+V+LH   WKDGGC MSHFVVE KK+D  EW QISNNVKP  N+V
Sbjct  1500  PKLPEKPRFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKRDQIEWNQISNNVKPDNNYV  1559

Query  1557  VLDLDAASWYSVRITAHNSAGFTVAEYEFATLTVTGGTLAPPLNTAVLNGKTY----LPP  1612
             VLDL+ A+WY++RITAHNSAGFTVAEY+FATLTVTGGT+A PL+    +G  +    LP 
Sbjct  1560  VLDLEPATWYNLRITAHNSAGFTVAEYDFATLTVTGGTIA-PLDDGSGHGNVHTRIRLPA  1618

Query  1613  WMPQWFDLNFMVPLIATIIVVFVGVLVICVALSRRRMEDPRGGPKDVYYDVVYNQPMGPG  1672
             WMP+W DLNFMVPLIAT++VV VG+ V+CVALSRRR +D RGG KDVYYDVVYNQ MGPG
Sbjct  1619  WMPEWLDLNFMVPLIATVVVVAVGICVVCVALSRRRADDMRGGQKDVYYDVVYNQTMGPG  1678

Query  1673  ATMDKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRGTVISRSMRSNHSTWDPRR-  1731
             AT+DKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG      +RSNHSTWDPRR 
Sbjct  1679  ATLDKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG---RGGLRSNHSTWDPRRN  1735

Query  1732  -PLYEELKPPPVPRR-----HYHGSDECYHTHPHPHPAGMEDEICPYATFHLLGFREEMD  1785
               LYEELK PPVP       H HG+ EC++ HP     GMEDEICPYATFHLLGFREEMD
Sbjct  1736  PNLYEELKAPPVPMHGNHYGHAHGNAECHYRHP-----GMEDEICPYATFHLLGFREEMD  1790

Query  1786  PTKAMNFQTFPHQNGHTG--PGHA-TMGPGGPPGHIHSRSGSQSMPRQNRYARKNSQGGQ  1842
             PTKAMNFQTFPHQNGH G  PGHA TM P G PGH+HSRSGSQSMPR NRY RKNSQGGQ
Sbjct  1791  PTKAMNFQTFPHQNGHAGPVPGHAGTMLPPGHPGHVHSRSGSQSMPRANRYQRKNSQGGQ  1850

Query  1843  SSIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYGGPGPEYDDPANCAPEDDQYGSQY  1902
             SSIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLY GPGPEYDDPANCAPE+DQYGSQY
Sbjct  1851  SSIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYSGPGPEYDDPANCAPEEDQYGSQY  1910

Query  1903  GAPYG--YDHYGSRGSVGRRSVGSARNLPNGSPEPPPPPPRNHDTSNSSFNDSKESNEIS  1960
             G PYG  YDHYGSRGS+GRRS+GSARN  NGSPEPPPPPPRNHD SNSSFNDSKESNEIS
Sbjct  1911  GGPYGQPYDHYGSRGSMGRRSIGSARNPGNGSPEPPPPPPRNHDMSNSSFNDSKESNEIS  1970

Query  1961  EAECDRDH-PRGNYGENENSGDAKRSANTKDVRTTEEMRKLIDSRKSNEVAAKLQQQGGP  2019
             EAECDRDH PRGNYG        KRS   KD RTTEEMRKLI+  ++     +LQQ  G 
Sbjct  1971  EAECDRDHGPRGNYGA------VKRSPQPKDQRTTEEMRKLIERNETGPKQLQLQQANG-  2023

Query  2020  AGLTAYDTLAV  2030
             AG TAYDT+AV
Sbjct  2024  AGFTAYDTMAV  2034


>Q0E9J5_DROME unnamed protein product
Length=2031

 Score = 3305 bits (8569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1629/2050 (79%), Positives = 1788/2050 (87%), Gaps = 46/2050 (2%)

Query  3     QRTKWITKIIFIAV-LVDLGS---TANT-EADTKGPMFLKEPINRIDFSNSTGSVVECRA  57
             +R KW+  ++F AV L+  GS    AN  +AD KGP+FLKEP NRIDFSNSTG+ +EC+A
Sbjct  6     ERLKWL--MLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAEIECKA  63

Query  58    SGNPAPEIIWVRSDGTAVGDVPGLRQVLSNGNLVFPPFRAEDYRQEVHAQVYACLAKNQF  117
             SGNP PEIIW+RSDGTAVGDVPGLRQ+ S+G LVFPPFRAEDYRQEVHAQVYACLA+NQF
Sbjct  64    SGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQF  123

Query  118   GSIISRDVNVRAVVHQFYQSEVNNEYVIRGNSAVLRCSIPSFVGDYVTVLSWQDENGNLY  177
             GSIISRDV+VRAVV+QFY +++  EYVIRGN+AVL+CSIPSFV D+V V SW DE G   
Sbjct  124   GSIISRDVHVRAVVNQFYGADILMEYVIRGNAAVLKCSIPSFVADFVRVESWIDEEGT--  181

Query  178   GSLDDNSKDNFDGKYLVLPSGELHIKEVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI  237
                +    +N+DGKYLVLPSGELHI+EVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI
Sbjct  182   ---ELRPSENYDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI  238

Query  238   TEPVGSVAPKVNVADKGHISSARTGHTTDILCPAQGYPMPAFRWYKFIEGTTRKQAVVLN  297
             TEPVGSVAPKV++ DK   +   +  + ++ C AQG+PMPAFRWYKFIEGTTRKQAVVLN
Sbjct  239   TEPVGSVAPKVDMHDKMDFTIRSSNRSLNLFCKAQGFPMPAFRWYKFIEGTTRKQAVVLN  298

Query  298   DRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPSQVVDFG  357
             DRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPP+Q VDFG
Sbjct  299   DRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFG  358

Query  358   RPAVFTCHFSGNPIKTVSWLKDGKKIGHTDAILRIESVKKEHKGMYQCFIRNDQESAEAS  417
             RPAVFTC ++GNPIKTVSW+KDGK IGH++ +LRIESVKKE KGMYQCF+RNDQESAEAS
Sbjct  359   RPAVFTCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEAS  418

Query  418   AELKLGGRFDPPIIRQAFPEETLHPGPSVFLKCVAGGLPTPEISWELDGKKIANSERYQV  477
             AELKLGGRFDPP+IRQAF EET+ PGPSVFLKCVAGG PTPEISWELDGKKIAN++RYQV
Sbjct  419   AELKLGGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQV  478

Query  478   GQYVTVNGDVVSYLNITSIHANDGGLYKCIASSKVGVAEHSAKLNVYGLPYIRPMEKKAI  537
             GQYVTVNGDVVSYLNITS+HANDGGLYKCIA SKVGVAEHSAKLNVYGLPYIR MEKKAI
Sbjct  479   GQYVTVNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKAI  538

Query  538   VAGENLIVTCPVAGYPIESIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCV  597
             VAGE LIVTCPVAGYPI+SIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCV
Sbjct  539   VAGETLIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCV  598

Query  598   AKNSEGYSARGALEVQVMVPPKIAPFSFGDEALSYGDTISITCTVSGGDLPVAVEWKLNG  657
             AKN EGYSARG+LEVQVM PPKIAPF FG  A S+ D++S+ C V+ GDLP+ +EW   G
Sbjct  599   AKNQEGYSARGSLEVQVMAPPKIAPFDFGQSASSFEDSVSVNCLVTSGDLPIDIEWLFGG  658

Query  658   SPLEAYLEIQTEKRGKRINNLVIDLVSAKHAGKYTCFAKNAAGVAEHSSELIVNVPPRWI  717
              P+     I   + GKR + L ID V A HAG YTC AKN A  +E+S+ LIVNVPPRWI
Sbjct  659   EPINFATGIAILRGGKRTSLLTIDSVHAGHAGNYTCKAKNQASSSEYSAALIVNVPPRWI  718

Query  718   LEPTDKAFAQGSDAKVECKSDGFPKPQVTWKKAVGDTPGEYKDMKQSNNIRVDEGTLYID  777
             LEPTDKAFAQGSDAKVECK+DGFPKPQVTWKKAVGDTPGEYKD+K+S+NIRV+EGTL++D
Sbjct  719   LEPTDKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHVD  778

Query  778   NIQKNNEGYYLCEAINGIGSGLSAVILISVQAPPEFVEKLRNQTARRSEPAVLQCEAKGE  837
             NIQK NEGYYLCEAINGIGSGLSAVI+ISVQAPPEF EKLRNQTARR EPAVLQCEAKGE
Sbjct  779   NIQKTNEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKGE  838

Query  838   KPIGILWNMNNMRLDPKTDNRYTIREEILSTGVMSSLSIKRTERTDSALFTCVATNAFGS  897
             KPIGILWNMNNMRLDPK DNRYTIREEILSTGVMSSLSIKRTER+DSALFTCVATNAFGS
Sbjct  839   KPIGILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAFGS  898

Query  898   DDASINMIIQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLKRYIIEFKTSRGSWEHD  957
             DDASINMI+QEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPL RYIIEFK SR SW  +
Sbjct  899   DDASINMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWS-E  957

Query  958   VDRVIVPGHTNEAQVQKLNPATTYNIRIVAENEIGVSDSSEVVPIITAEEAPSGKPQSIK  1017
             +DRVIVPGHT EAQVQKL+PATTYNIRIVAEN IG S SSE V IITAEEAPSGKPQ+IK
Sbjct  958   IDRVIVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNIK  1017

Query  1018  VEPLSQTSLRVLWKAPPRSDWNGEILGYYVGYKLTNNNGSYYFEDYKYMMEEGKEYSYEL  1077
             VEP++QT++RV WK PPR++WNGEILGYYVGYKL+N N SY FE   ++ EEGKE++ EL
Sbjct  1018  VEPVNQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLEL  1077

Query  1078  TNLKTYTQYSVVIQAYNKVGAGPLSEDEKQYTAEGTPDQPPSDITCTTLTSQTIRVSWVS  1137
              NL+ YTQYSVVIQA+NK+GAGPLSE+EKQ+TAEGTP QPPSD  CTTLTSQTIRV WVS
Sbjct  1078  QNLRVYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWVS  1137

Query  1138  PPLESANGVIKGYKVVYAPSELWYDDKNKDYKKTASSDTVLHGLKKYTNYTMQVLATTSG  1197
             PPLESANGVIK YKVVYAPS+ WYD+  + YKKTASSDTVLHGLKKYTNYTMQVLATT+G
Sbjct  1138  PPLESANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTAG  1197

Query  1198  GDGVRSPPIHCQTEQDVPEAPTAVKALVVGSEAILVSWLPPAQPNGLITQYTVYSKEEGT  1257
             GDGVRS PIHCQTE DVPEAPT VKALV+G+ AILVSW PPAQPNG+ITQYTVYSK EG 
Sbjct  1198  GDGVRSVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEGA  1257

Query  1258  ESEVKSHKVPPYQMSYEASSLDKNKPFEFWVTANTNIGEGQASKSIVAMPSDKVPAKIAS  1317
             E+E K+ KVP YQMS+EA+ L+KNKP+EFWVTA+T IGEGQ SKSIVAMPSD+VPAKIAS
Sbjct  1258  ETETKTQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIAS  1317

Query  1318  FDDTFTAIFKEDFKLPCLAVGAPAPDITWKVKGVEFVPNDRVRQLPEGSLSIKDVIRQDA  1377
             FDDTFTA FKED K+PCLAVGAP P+ITWK+KGVEF  NDR+R LP+GSL IK V RQDA
Sbjct  1318  FDDTFTATFKEDAKMPCLAVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNRQDA  1377

Query  1378  GDYTCMAENSIAKDSITHKLIVLAPPQSPQVLLTATTTDSLTLKLKQHDGDTAPIHGYTL  1437
             GDY+C AENSIAKDSITHKLIVLAPPQSP V L+ATTTD+LT+KLK H+GDTAP+HGYTL
Sbjct  1378  GDYSCHAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGYTL  1437

Query  1438  HYKPEFGDWETVEVAVDAQKYTIENLFCGSRYQVYATGYNNIGAGEASDILNTRTKGSKP  1497
             HYKPEFG+WET EV+VD+QK+ IE L CGSRYQVYATG+NNIGAGEASDILNTRTKG KP
Sbjct  1438  HYKPEFGEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKGQKP  1497

Query  1498  MMPENSKFIDPSSNTVTLHLPTWKDGGCRMSHFVVEYKKKDHAEWTQISNNVKPGGNFVV  1557
              +PE  +FI+ SSN+V+LH   WKDGGC MSHFVVE KK+D  EW QISNNVKP  N+VV
Sbjct  1498  KLPEKPRFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKRDQIEWNQISNNVKPDNNYVV  1557

Query  1558  LDLDAASWYSVRITAHNSAGFTVAEYEFATLTVTGGTLAPPLNTAVLNGKTY----LPPW  1613
             LDL+ A+WY++RITAHNSAGFTVAEY+FATLTVTGGT+A PL+    +G  +    LP W
Sbjct  1558  LDLEPATWYNLRITAHNSAGFTVAEYDFATLTVTGGTIA-PLDDGSGHGNVHTRIRLPAW  1616

Query  1614  MPQWFDLNFMVPLIATIIVVFVGVLVICVALSRRRMEDPRGGPKDVYYDVVYNQPMGPGA  1673
             MP+W DLNFMVPLIAT++VV VG+ V+CVALSRRR +D RGG KDVYYDVVYNQ MGPGA
Sbjct  1617  MPEWLDLNFMVPLIATVVVVAVGICVVCVALSRRRADDMRGGQKDVYYDVVYNQTMGPGA  1676

Query  1674  TMDKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRGTVISRSMRSNHSTWDPRR--  1731
             T+DKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG      +RSNHSTWDPRR  
Sbjct  1677  TLDKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG---RGGLRSNHSTWDPRRNP  1733

Query  1732  PLYEELKPPPVPRR-----HYHGSDECYHTHPHPHPAGMEDEICPYATFHLLGFREEMDP  1786
              LYEELK PPVP       H HG+ EC++ HP     GMEDEICPYATFHLLGFREEMDP
Sbjct  1734  NLYEELKAPPVPMHGNHYGHAHGNAECHYRHP-----GMEDEICPYATFHLLGFREEMDP  1788

Query  1787  TKAMNFQTFPHQNGHTG--PGHA-TMGPGGPPGHIHSRSGSQSMPRQNRYARKNSQGGQS  1843
             TKAMNFQTFPHQNGH G  PGHA TM P G PGH+HSRSGSQSMPR NRY RKNSQGGQS
Sbjct  1789  TKAMNFQTFPHQNGHAGPVPGHAGTMLPPGHPGHVHSRSGSQSMPRANRYQRKNSQGGQS  1848

Query  1844  SIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYGGPGPEYDDPANCAPEDDQYGSQYG  1903
             SIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLY GPGPEYDDPANCAPE+DQYGSQYG
Sbjct  1849  SIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYSGPGPEYDDPANCAPEEDQYGSQYG  1908

Query  1904  APYG--YDHYGSRGSVGRRSVGSARNLPNGSPEPPPPPPRNHDTSNSSFNDSKESNEISE  1961
              PYG  YDHYGSRGS+GRRS+GSARN  NGSPEPPPPPPRNHD SNSSFNDSKESNEISE
Sbjct  1909  GPYGQPYDHYGSRGSMGRRSIGSARNPGNGSPEPPPPPPRNHDMSNSSFNDSKESNEISE  1968

Query  1962  AECDRDH-PRGNYGENENSGDAKRSANTKDVRTTEEMRKLIDSRKSNEVAAKLQQQGGPA  2020
             AECDRDH PRGNYG        KRS   KD RTTEEMRKLI+  ++     +LQQ  G A
Sbjct  1969  AECDRDHGPRGNYGA------VKRSPQPKDQRTTEEMRKLIERNETGPKQLQLQQANG-A  2021

Query  2021  GLTAYDTLAV  2030
             G TAYDT+AV
Sbjct  2022  GFTAYDTMAV  2031


>Q0E9J4_DROME unnamed protein product
Length=2031

 Score = 3298 bits (8550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1623/2050 (79%), Positives = 1790/2050 (87%), Gaps = 46/2050 (2%)

Query  3     QRTKWITKIIFIAV-LVDLGS---TANT-EADTKGPMFLKEPINRIDFSNSTGSVVECRA  57
             +R KW+  ++F AV L+  GS    AN  +AD KGP+FLKEP NRIDFSNSTG+ +EC+A
Sbjct  6     ERLKWL--MLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAEIECKA  63

Query  58    SGNPAPEIIWVRSDGTAVGDVPGLRQVLSNGNLVFPPFRAEDYRQEVHAQVYACLAKNQF  117
             SGNP PEIIW+RSDGTAVGDVPGLRQ+ S+G LVFPPFRAEDYRQEVHAQVYACLA+NQF
Sbjct  64    SGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQF  123

Query  118   GSIISRDVNVRAVVHQFYQSEVNNEYVIRGNSAVLRCSIPSFVGDYVTVLSWQDENGNLY  177
             GSIISRDV+VRAVV+Q+Y++EV +EYVIRGN+AVL+C+IPSFV D++ V +W   +G  Y
Sbjct  124   GSIISRDVHVRAVVNQYYEAEVVSEYVIRGNTAVLKCTIPSFVADFLRVEAWVASDGTEY  183

Query  178   GSLDDNSKDNFDGKYLVLPSGELHIKEVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI  237
                +D     FDGKYLVLPSGELHI+EVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI
Sbjct  184   APEED-----FDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI  238

Query  238   TEPVGSVAPKVNVADKGHISSARTGHTTDILCPAQGYPMPAFRWYKFIEGTTRKQAVVLN  297
             TEPVGSV PK++V ++   + A +  T  + CPAQ YP+P+FRWYKFIEGTTRKQAVVLN
Sbjct  239   TEPVGSVGPKISVGERLRDAGAPSKSTLTLFCPAQSYPVPSFRWYKFIEGTTRKQAVVLN  298

Query  298   DRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPSQVVDFG  357
             DRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPP+Q VDFG
Sbjct  299   DRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFG  358

Query  358   RPAVFTCHFSGNPIKTVSWLKDGKKIGHTDAILRIESVKKEHKGMYQCFIRNDQESAEAS  417
             RPAVFTC ++GNPIKTVSW+KDGK IGH++ +LRIESVKKE KGMYQCF+RNDQESAEAS
Sbjct  359   RPAVFTCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEAS  418

Query  418   AELKLGGRFDPPIIRQAFPEETLHPGPSVFLKCVAGGLPTPEISWELDGKKIANSERYQV  477
             AELKLGGRFDPP+IRQAF EET+ PGPSVFLKCVAGG PTPEISWELDGKKIAN++RYQV
Sbjct  419   AELKLGGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQV  478

Query  478   GQYVTVNGDVVSYLNITSIHANDGGLYKCIASSKVGVAEHSAKLNVYGLPYIRPMEKKAI  537
             GQYVTVNGDVVSYLNITS+HANDGGLYKCIA SKVGVAEHSAKLNVYGLPYIR MEKKAI
Sbjct  479   GQYVTVNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKAI  538

Query  538   VAGENLIVTCPVAGYPIESIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCV  597
             VAGE LIVTCPVAGYPI+SIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCV
Sbjct  539   VAGETLIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCV  598

Query  598   AKNSEGYSARGALEVQVMVPPKIAPFSFGDEALSYGDTISITCTVSGGDLPVAVEWKLNG  657
             AKN EGYSARG+LEVQVM PPKI PFSFG+E  +  D++S+TC +S GDLP+ +EW  N 
Sbjct  599   AKNQEGYSARGSLEVQVMAPPKITPFSFGEEPANVEDSVSVTCLISTGDLPIDIEWFFNE  658

Query  658   SPLEAYLEIQTEKRGKRINNLVIDLVSAKHAGKYTCFAKNAAGVAEHSSELIVNVPPRWI  717
               + +Y  I   K GKR + L ID V A+HAG Y+C AKN A    ++++LIVNVPPRWI
Sbjct  659   YGISSYSGISVMKGGKRNSVLSIDSVQARHAGNYSCRAKNHAAAVNYTTDLIVNVPPRWI  718

Query  718   LEPTDKAFAQGSDAKVECKSDGFPKPQVTWKKAVGDTPGEYKDMKQSNNIRVDEGTLYID  777
             LEPTDKAFAQGSDAKVECK+DGFPKPQVTWKKAVGDTPGEYKD+K+S+NIRV+EGTL++D
Sbjct  719   LEPTDKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHVD  778

Query  778   NIQKNNEGYYLCEAINGIGSGLSAVILISVQAPPEFVEKLRNQTARRSEPAVLQCEAKGE  837
             NIQK NEGYYLCEAINGIGSGLSAVI+ISVQAPPEF EKLRNQTARR EPAVLQCEAKGE
Sbjct  779   NIQKTNEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKGE  838

Query  838   KPIGILWNMNNMRLDPKTDNRYTIREEILSTGVMSSLSIKRTERTDSALFTCVATNAFGS  897
             KPIGILWNMNNMRLDPK DNRYTIREEILSTGVMSSLSIKRTER+DSALFTCVATNAFGS
Sbjct  839   KPIGILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAFGS  898

Query  898   DDASINMIIQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLKRYIIEFKTSRGSWEHD  957
             DDASINMI+QEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPL RYIIEFK SR SW  +
Sbjct  899   DDASINMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWS-E  957

Query  958   VDRVIVPGHTNEAQVQKLNPATTYNIRIVAENEIGVSDSSEVVPIITAEEAPSGKPQSIK  1017
             +DRVIVPGHT EAQVQKL+PATTYNIRIVAEN IG S SSE V IITAEEAPSGKPQ+IK
Sbjct  958   IDRVIVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNIK  1017

Query  1018  VEPLSQTSLRVLWKAPPRSDWNGEILGYYVGYKLTNNNGSYYFEDYKYMMEEGKEYSYEL  1077
             VEP++QT++RV WK PPR++WNGEILGYYVGYKL+N N SY FE   ++ EEGKE++ EL
Sbjct  1018  VEPVNQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLEL  1077

Query  1078  TNLKTYTQYSVVIQAYNKVGAGPLSEDEKQYTAEGTPDQPPSDITCTTLTSQTIRVSWVS  1137
              NL+ YTQYSVVIQA+NK+GAGPLSE+EKQ+TAEGTP QPPSD  CTTLTSQTIRV WVS
Sbjct  1078  QNLRVYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWVS  1137

Query  1138  PPLESANGVIKGYKVVYAPSELWYDDKNKDYKKTASSDTVLHGLKKYTNYTMQVLATTSG  1197
             PPLESANGVIK YKVVYAPS+ WYD+  + YKKTASSDTVLHGLKKYTNYTMQVLATT+G
Sbjct  1138  PPLESANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTAG  1197

Query  1198  GDGVRSPPIHCQTEQDVPEAPTAVKALVVGSEAILVSWLPPAQPNGLITQYTVYSKEEGT  1257
             GDGVRS PIHCQTE DVPEAPT VKALV+G+ AILVSW PPAQPNG+ITQYTVYSK EG 
Sbjct  1198  GDGVRSVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEGA  1257

Query  1258  ESEVKSHKVPPYQMSYEASSLDKNKPFEFWVTANTNIGEGQASKSIVAMPSDKVPAKIAS  1317
             E+E K+ KVP YQMS+EA+ L+KNKP+EFWVTA+T IGEGQ SKSIVAMPSD+VPAKIAS
Sbjct  1258  ETETKTQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIAS  1317

Query  1318  FDDTFTAIFKEDFKLPCLAVGAPAPDITWKVKGVEFVPNDRVRQLPEGSLSIKDVIRQDA  1377
             FDDTFTA FKED K+PCLAVGAP P+ITWK+KGVEF  NDR+R LP+GSL IK V RQDA
Sbjct  1318  FDDTFTATFKEDAKMPCLAVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNRQDA  1377

Query  1378  GDYTCMAENSIAKDSITHKLIVLAPPQSPQVLLTATTTDSLTLKLKQHDGDTAPIHGYTL  1437
             GDY+C AENSIAKDSITHKLIVLAPPQSP V L+ATTTD+LT+KLK H+GDTAP+HGYTL
Sbjct  1378  GDYSCHAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGYTL  1437

Query  1438  HYKPEFGDWETVEVAVDAQKYTIENLFCGSRYQVYATGYNNIGAGEASDILNTRTKGSKP  1497
             HYKPEFG+WET EV+VD+QK+ IE L CGSRYQVYATG+NNIGAGEASDILNTRTKG KP
Sbjct  1438  HYKPEFGEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKGQKP  1497

Query  1498  MMPENSKFIDPSSNTVTLHLPTWKDGGCRMSHFVVEYKKKDHAEWTQISNNVKPGGNFVV  1557
              +PE  +FI+ SSN+V+LH   WKDGGC MSHFVVE KK+D  EW QISNNVKP  N+VV
Sbjct  1498  KLPEKPRFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKRDQIEWNQISNNVKPDNNYVV  1557

Query  1558  LDLDAASWYSVRITAHNSAGFTVAEYEFATLTVTGGTLAPPLNTAVLNGKTY----LPPW  1613
             LDL+ A+WY++RITAHNSAGFTVAEY+FATLTVTGGT+A PL+    +G  +    LP W
Sbjct  1558  LDLEPATWYNLRITAHNSAGFTVAEYDFATLTVTGGTIA-PLDDGSGHGNVHTRIRLPAW  1616

Query  1614  MPQWFDLNFMVPLIATIIVVFVGVLVICVALSRRRMEDPRGGPKDVYYDVVYNQPMGPGA  1673
             MP+W DLNFMVPLIAT++VV VG+ V+CVALSRRR +D RGG KDVYYDVVYNQ MGPGA
Sbjct  1617  MPEWLDLNFMVPLIATVVVVAVGICVVCVALSRRRADDMRGGQKDVYYDVVYNQTMGPGA  1676

Query  1674  TMDKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRGTVISRSMRSNHSTWDPRR--  1731
             T+DKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG      +RSNHSTWDPRR  
Sbjct  1677  TLDKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG---RGGLRSNHSTWDPRRNP  1733

Query  1732  PLYEELKPPPVPRR-----HYHGSDECYHTHPHPHPAGMEDEICPYATFHLLGFREEMDP  1786
              LYEELK PPVP       H HG+ EC++ HP     GMEDEICPYATFHLLGFREEMDP
Sbjct  1734  NLYEELKAPPVPMHGNHYGHAHGNAECHYRHP-----GMEDEICPYATFHLLGFREEMDP  1788

Query  1787  TKAMNFQTFPHQNGHTG--PGHA-TMGPGGPPGHIHSRSGSQSMPRQNRYARKNSQGGQS  1843
             TKAMNFQTFPHQNGH G  PGHA TM P G PGH+HSRSGSQSMPR NRY RKNSQGGQS
Sbjct  1789  TKAMNFQTFPHQNGHAGPVPGHAGTMLPPGHPGHVHSRSGSQSMPRANRYQRKNSQGGQS  1848

Query  1844  SIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYGGPGPEYDDPANCAPEDDQYGSQYG  1903
             SIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLY GPGPEYDDPANCAPE+DQYGSQYG
Sbjct  1849  SIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYSGPGPEYDDPANCAPEEDQYGSQYG  1908

Query  1904  APYG--YDHYGSRGSVGRRSVGSARNLPNGSPEPPPPPPRNHDTSNSSFNDSKESNEISE  1961
              PYG  YDHYGSRGS+GRRS+GSARN  NGSPEPPPPPPRNHD SNSSFNDSKESNEISE
Sbjct  1909  GPYGQPYDHYGSRGSMGRRSIGSARNPGNGSPEPPPPPPRNHDMSNSSFNDSKESNEISE  1968

Query  1962  AECDRDH-PRGNYGENENSGDAKRSANTKDVRTTEEMRKLIDSRKSNEVAAKLQQQGGPA  2020
             AECDRDH PRGNYG        KRS   KD RTTEEMRKLI+  ++     +LQQ  G A
Sbjct  1969  AECDRDHGPRGNYGA------VKRSPQPKDQRTTEEMRKLIERNETGPKQLQLQQANG-A  2021

Query  2021  GLTAYDTLAV  2030
             G TAYDT+AV
Sbjct  2022  GFTAYDTMAV  2031



Lambda      K        H
   0.314    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 27202772002


Query= XP_037024200.1 Down syndrome cell adhesion molecule-like protein
Dscam2 isoform X5 [Bradysia coprophila]

Length=2030
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q0E9L2_DROME  unnamed protein product                                 3346    0.0  
Q0E9J5_DROME  unnamed protein product                                 3312    0.0  
Q0E9J4_DROME  unnamed protein product                                 3304    0.0  


>Q0E9L2_DROME unnamed protein product
Length=2034

 Score = 3346 bits (8675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1644/2051 (80%), Positives = 1805/2051 (88%), Gaps = 45/2051 (2%)

Query  3     QRTKWITKIIFIAV-LVDLGS---TANT-EADTKGPMFLKEPINRIDFSNSTGSVVECRA  57
             +R KW+  ++F AV L+  GS    AN  +AD KGP+FLKEP NRIDFSNSTG+ +EC+A
Sbjct  6     ERLKWL--MLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAEIECKA  63

Query  58    SGNPAPEIIWVRSDGTAVGDVPGLRQVLSNGNLVFPPFRAEDYRQEVHAQVYACLAKNQF  117
             SGNP PEIIW+RSDGTAVGDVPGLRQ+ S+G LVFPPFRAEDYRQEVHAQVYACLA+NQF
Sbjct  64    SGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQF  123

Query  118   GSIISRDVNVRAVVHQFYQSEVNNEYVIRGNSAVLRCSIPSFVGDYVTVLSWQDENG-NL  176
             GSIISRDV+VRAVV QFY +E  NEYVI+GN+AV++C IPSFV D+V V +W DE G  L
Sbjct  124   GSIISRDVHVRAVVSQFYITEAENEYVIKGNAAVVKCKIPSFVADFVQVEAWVDEEGMEL  183

Query  177   YGSLDDNSKDNFDGKYLVLPSGELHIKEVGPEDGYKSYQCRTKHRLTGETRLSATKGRLV  236
             +    +N+ D +DGKYLVLPSGELHI+EVGPEDGYKSYQCRTKHRLTGETRLSATKGRLV
Sbjct  184   W---RNNATDAYDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLV  240

Query  237   ITEPVGSVAPKVNVADKGHISSARTGHTTDILCPAQGYPMPAFRWYKFIEGTTRKQAVVL  296
             ITEPVGSVAPKV++ DK   +   +  + ++ C AQG+PMPAFRWYKFIEGTTRKQAVVL
Sbjct  241   ITEPVGSVAPKVDMHDKMDFTIRSSNRSLNLFCKAQGFPMPAFRWYKFIEGTTRKQAVVL  300

Query  297   NDRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPSQVVDF  356
             NDRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPP+Q VDF
Sbjct  301   NDRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDF  360

Query  357   GRPAVFTCHFSGNPIKTVSWLKDGKKIGHTDAILRIESVKKEHKGMYQCFIRNDQESAEA  416
             GRPAVFTC ++GNPIKTVSW+KDGK IGH++ +LRIESVKKE KGMYQCF+RNDQESAEA
Sbjct  361   GRPAVFTCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEA  420

Query  417   SAELKLGGRFDPPIIRQAFPEETLHPGPSVFLKCVAGGLPTPEISWELDGKKIANSERYQ  476
             SAELKLGGRFDPP+IRQAF EET+ PGPSVFLKCVAGG PTPEISWELDGKKIAN++RYQ
Sbjct  421   SAELKLGGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQ  480

Query  477   VGQYVTVNGDVVSYLNITSIHANDGGLYKCIASSKVGVAEHSAKLNVYGLPYIRPMEKKA  536
             VGQYVTVNGDVVSYLNITS+HANDGGLYKCIA SKVGVAEHSAKLNVYGLPYIR MEKKA
Sbjct  481   VGQYVTVNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKA  540

Query  537   IVAGENLIVTCPVAGYPIESIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTC  596
             IVAGE LIVTCPVAGYPI+SIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTC
Sbjct  541   IVAGETLIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTC  600

Query  597   VAKNSEGYSARGALEVQVMVPPKIAPFTFGEDAMSYGDTISIQCTISGGDLPVDVEWRLN  656
             VAKN EGYSARG+LEVQVM  PKI+PF FGE++MSYG+ +++QCTISGGDLPV++ W LN
Sbjct  601   VAKNQEGYSARGSLEVQVMALPKISPFNFGEESMSYGEFVNVQCTISGGDLPVNITWTLN  660

Query  657   GSPLESYLEIQTAKSGKRINNLVIDLVSAKHAGNYTCLAKNAAGVAEHTSELVVNVPPRW  716
               P E YLEI T K GKRIN L I+ VSAKHAGNY+C+A+N AGVA HT+EL VNVPPRW
Sbjct  661   NKPFEDYLEILTTKRGKRINELTIEAVSAKHAGNYSCIAENKAGVANHTAELKVNVPPRW  720

Query  717   ILEPTDKAFAQGSDAKVECKSDGFPKPQVTWKKAVGDTPGEYKDMKQSNNIRVDEGTLYI  776
             ILEPTDKAFAQGSDAKVECK+DGFPKPQVTWKKAVGDTPGEYKD+K+S+NIRV+EGTL++
Sbjct  721   ILEPTDKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHV  780

Query  777   DNIQKNNEGYYLCEAINGIGSGLSAVILISVQAPPEFVEKLRNQTARRSEPAVLQCEAKG  836
             DNIQK NEGYYLCEAINGIGSGLSAVI+ISVQAPPEF EKLRNQTARR EPAVLQCEAKG
Sbjct  781   DNIQKTNEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKG  840

Query  837   EKPIGILWNMNNMRLDPKTDNRYTIREEILSTGVMSSLSIKRTERTDSALFTCVATNAFG  896
             EKPIGILWNMNNMRLDPK DNRYTIREEILSTGVMSSLSIKRTER+DSALFTCVATNAFG
Sbjct  841   EKPIGILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAFG  900

Query  897   SDDASINMIIQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLKRYIIEFKTSRGSWEH  956
             SDDASINMI+QEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPL RYIIEFK SR SW  
Sbjct  901   SDDASINMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWS-  959

Query  957   DVDRVIVPGHTNEAQVQKLNPATTYNIRIVAENEIGVSDSSEVVPIITAEEAPSGKPQSI  1016
             ++DRVIVPGHT EAQVQKL+PATTYNIRIVAEN IG S SSE V IITAEEAPSGKPQ+I
Sbjct  960   EIDRVIVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNI  1019

Query  1017  KVEPLSQTSLRVLWKAPPRSDWNGEILGYYVGYKLTNNNGSYYFEDYKYMMEEGKEYSYE  1076
             KVEP++QT++RV WK PPR++WNGEILGYYVGYKL+N N SY FE   ++ EEGKE++ E
Sbjct  1020  KVEPVNQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLE  1079

Query  1077  LTNLKTYTQYSVVIQAYNKVGAGPLSEDEKQYTAEGTPDQPPSDITCTTLTSQTIRVSWV  1136
             L NL+ YTQYSVVIQA+NK+GAGPLSE+EKQ+TAEGTP QPPSD  CTTLTSQTIRV WV
Sbjct  1080  LQNLRVYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWV  1139

Query  1137  SPPLESANGVIKGYKVVYAPSELWYDDKNKDYKKTASSDTVLHGLKKYTNYTMQVLATTS  1196
             SPPLESANGVIK YKVVYAPS+ WYD+  + YKKTASSDTVLHGLKKYTNYTMQVLATT+
Sbjct  1140  SPPLESANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTA  1199

Query  1197  GGDGVRSPPIHCQTEQDVPEAPTAVKALVVGSEAILVSWLPPAQPNGLITQYTVYSKEEG  1256
             GGDGVRS PIHCQTE DVPEAPT VKALV+G+ AILVSW PPAQPNG+ITQYTVYSK EG
Sbjct  1200  GGDGVRSVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEG  1259

Query  1257  TESEVKSHKVPPYQMSYEASSLDKNKPFEFWVTANTNIGEGQASKSIVAMPSDKVPAKIA  1316
              E+E K+ KVP YQMS+EA+ L+KNKP+EFWVTA+T IGEGQ SKSIVAMPSD+VPAKIA
Sbjct  1260  AETETKTQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIA  1319

Query  1317  SFDDTFTAIFKEDFKLPCLAVGAPAPDITWKVKGVEFVPNDRVRQLPEGSLSIKDVIRQD  1376
             SFDDTFTA FKED K+PCLAVGAP P+ITWK+KGVEF  NDR+R LP+GSL IK V RQD
Sbjct  1320  SFDDTFTATFKEDAKMPCLAVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNRQD  1379

Query  1377  AGDYTCMAENSIAKDSITHKLIVLAPPQSPQVLLTATTTDSLTLKLKQHDGDTAPIHGYT  1436
             AGDY+C AENSIAKDSITHKLIVLAPPQSP V L+ATTTD+LT+KLK H+GDTAP+HGYT
Sbjct  1380  AGDYSCHAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGYT  1439

Query  1437  LHYKPEFGDWETVEVAVDAQKYTIENLFCGSRYQVYATGYNNIGAGEASDILNTRTKGSK  1496
             LHYKPEFG+WET EV+VD+QK+ IE L CGSRYQVYATG+NNIGAGEASDILNTRTKG K
Sbjct  1440  LHYKPEFGEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKGQK  1499

Query  1497  PMMPENSKFIDPSSNTVTLHLPTWKDGGCRMSHFVVEYKKKDHAEWTQISNNVKPGGNFV  1556
             P +PE  +FI+ SSN+V+LH   WKDGGC MSHFVVE KK+D  EW QISNNVKP  N+V
Sbjct  1500  PKLPEKPRFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKRDQIEWNQISNNVKPDNNYV  1559

Query  1557  VLDLDAASWYSVRITAHNSAGFTVAEYEFATLTVTGGTLAPPLNTAVLNGKTY----LPP  1612
             VLDL+ A+WY++RITAHNSAGFTVAEY+FATLTVTGGT+A PL+    +G  +    LP 
Sbjct  1560  VLDLEPATWYNLRITAHNSAGFTVAEYDFATLTVTGGTIA-PLDDGSGHGNVHTRIRLPA  1618

Query  1613  WMPQWFDLNFMVPLIATIIVVFVGVLVICVALSRRRMEDPRGGPKDVYYDVVYNQPMGPG  1672
             WMP+W DLNFMVPLIAT++VV VG+ V+CVALSRRR +D RGG KDVYYDVVYNQ MGPG
Sbjct  1619  WMPEWLDLNFMVPLIATVVVVAVGICVVCVALSRRRADDMRGGQKDVYYDVVYNQTMGPG  1678

Query  1673  ATMDKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRGTVISRSMRSNHSTWDPRR-  1731
             AT+DKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG      +RSNHSTWDPRR 
Sbjct  1679  ATLDKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG---RGGLRSNHSTWDPRRN  1735

Query  1732  -PLYEELKPPPVPRR-----HYHGSDECYHTHPHPHPAGMEDEICPYATFHLLGFREEMD  1785
               LYEELK PPVP       H HG+ EC++ HP     GMEDEICPYATFHLLGFREEMD
Sbjct  1736  PNLYEELKAPPVPMHGNHYGHAHGNAECHYRHP-----GMEDEICPYATFHLLGFREEMD  1790

Query  1786  PTKAMNFQTFPHQNGHTG--PGHA-TMGPGGPPGHIHSRSGSQSMPRQNRYARKNSQGGQ  1842
             PTKAMNFQTFPHQNGH G  PGHA TM P G PGH+HSRSGSQSMPR NRY RKNSQGGQ
Sbjct  1791  PTKAMNFQTFPHQNGHAGPVPGHAGTMLPPGHPGHVHSRSGSQSMPRANRYQRKNSQGGQ  1850

Query  1843  SSIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYGGPGPEYDDPANCAPEDDQYGSQY  1902
             SSIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLY GPGPEYDDPANCAPE+DQYGSQY
Sbjct  1851  SSIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYSGPGPEYDDPANCAPEEDQYGSQY  1910

Query  1903  GAPYG--YDHYGSRGSVGRRSVGSARNLPNGSPEPPPPPPRNHDTSNSSFNDSKESNEIS  1960
             G PYG  YDHYGSRGS+GRRS+GSARN  NGSPEPPPPPPRNHD SNSSFNDSKESNEIS
Sbjct  1911  GGPYGQPYDHYGSRGSMGRRSIGSARNPGNGSPEPPPPPPRNHDMSNSSFNDSKESNEIS  1970

Query  1961  EAECDRDH-PRGNYGENENSGDAKRSANTKDVRTTEEMRKLIDSRKSNEVAAKLQQQGGP  2019
             EAECDRDH PRGNYG        KRS   KD RTTEEMRKLI+  ++     +LQQ  G 
Sbjct  1971  EAECDRDHGPRGNYGA------VKRSPQPKDQRTTEEMRKLIERNETGPKQLQLQQANG-  2023

Query  2020  AGLTAYDTLAV  2030
             AG TAYDT+AV
Sbjct  2024  AGFTAYDTMAV  2034


>Q0E9J5_DROME unnamed protein product
Length=2031

 Score = 3312 bits (8587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1628/2050 (79%), Positives = 1791/2050 (87%), Gaps = 46/2050 (2%)

Query  3     QRTKWITKIIFIAV-LVDLGS---TANT-EADTKGPMFLKEPINRIDFSNSTGSVVECRA  57
             +R KW+  ++F AV L+  GS    AN  +AD KGP+FLKEP NRIDFSNSTG+ +EC+A
Sbjct  6     ERLKWL--MLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAEIECKA  63

Query  58    SGNPAPEIIWVRSDGTAVGDVPGLRQVLSNGNLVFPPFRAEDYRQEVHAQVYACLAKNQF  117
             SGNP PEIIW+RSDGTAVGDVPGLRQ+ S+G LVFPPFRAEDYRQEVHAQVYACLA+NQF
Sbjct  64    SGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQF  123

Query  118   GSIISRDVNVRAVVHQFYQSEVNNEYVIRGNSAVLRCSIPSFVGDYVTVLSWQDENGNLY  177
             GSIISRDV+VRAVV+QFY +++  EYVIRGN+AVL+CSIPSFV D+V V SW DE G   
Sbjct  124   GSIISRDVHVRAVVNQFYGADILMEYVIRGNAAVLKCSIPSFVADFVRVESWIDEEGT--  181

Query  178   GSLDDNSKDNFDGKYLVLPSGELHIKEVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI  237
                +    +N+DGKYLVLPSGELHI+EVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI
Sbjct  182   ---ELRPSENYDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI  238

Query  238   TEPVGSVAPKVNVADKGHISSARTGHTTDILCPAQGYPMPAFRWYKFIEGTTRKQAVVLN  297
             TEPVGSVAPKV++ DK   +   +  + ++ C AQG+PMPAFRWYKFIEGTTRKQAVVLN
Sbjct  239   TEPVGSVAPKVDMHDKMDFTIRSSNRSLNLFCKAQGFPMPAFRWYKFIEGTTRKQAVVLN  298

Query  298   DRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPSQVVDFG  357
             DRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPP+Q VDFG
Sbjct  299   DRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFG  358

Query  358   RPAVFTCHFSGNPIKTVSWLKDGKKIGHTDAILRIESVKKEHKGMYQCFIRNDQESAEAS  417
             RPAVFTC ++GNPIKTVSW+KDGK IGH++ +LRIESVKKE KGMYQCF+RNDQESAEAS
Sbjct  359   RPAVFTCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEAS  418

Query  418   AELKLGGRFDPPIIRQAFPEETLHPGPSVFLKCVAGGLPTPEISWELDGKKIANSERYQV  477
             AELKLGGRFDPP+IRQAF EET+ PGPSVFLKCVAGG PTPEISWELDGKKIAN++RYQV
Sbjct  419   AELKLGGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQV  478

Query  478   GQYVTVNGDVVSYLNITSIHANDGGLYKCIASSKVGVAEHSAKLNVYGLPYIRPMEKKAI  537
             GQYVTVNGDVVSYLNITS+HANDGGLYKCIA SKVGVAEHSAKLNVYGLPYIR MEKKAI
Sbjct  479   GQYVTVNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKAI  538

Query  538   VAGENLIVTCPVAGYPIESIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCV  597
             VAGE LIVTCPVAGYPI+SIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCV
Sbjct  539   VAGETLIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCV  598

Query  598   AKNSEGYSARGALEVQVMVPPKIAPFTFGEDAMSYGDTISIQCTISGGDLPVDVEWRLNG  657
             AKN EGYSARG+LEVQVM PPKIAPF FG+ A S+ D++S+ C ++ GDLP+D+EW   G
Sbjct  599   AKNQEGYSARGSLEVQVMAPPKIAPFDFGQSASSFEDSVSVNCLVTSGDLPIDIEWLFGG  658

Query  658   SPLESYLEIQTAKSGKRINNLVIDLVSAKHAGNYTCLAKNAAGVAEHTSELVVNVPPRWI  717
              P+     I   + GKR + L ID V A HAGNYTC AKN A  +E+++ L+VNVPPRWI
Sbjct  659   EPINFATGIAILRGGKRTSLLTIDSVHAGHAGNYTCKAKNQASSSEYSAALIVNVPPRWI  718

Query  718   LEPTDKAFAQGSDAKVECKSDGFPKPQVTWKKAVGDTPGEYKDMKQSNNIRVDEGTLYID  777
             LEPTDKAFAQGSDAKVECK+DGFPKPQVTWKKAVGDTPGEYKD+K+S+NIRV+EGTL++D
Sbjct  719   LEPTDKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHVD  778

Query  778   NIQKNNEGYYLCEAINGIGSGLSAVILISVQAPPEFVEKLRNQTARRSEPAVLQCEAKGE  837
             NIQK NEGYYLCEAINGIGSGLSAVI+ISVQAPPEF EKLRNQTARR EPAVLQCEAKGE
Sbjct  779   NIQKTNEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKGE  838

Query  838   KPIGILWNMNNMRLDPKTDNRYTIREEILSTGVMSSLSIKRTERTDSALFTCVATNAFGS  897
             KPIGILWNMNNMRLDPK DNRYTIREEILSTGVMSSLSIKRTER+DSALFTCVATNAFGS
Sbjct  839   KPIGILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAFGS  898

Query  898   DDASINMIIQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLKRYIIEFKTSRGSWEHD  957
             DDASINMI+QEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPL RYIIEFK SR SW  +
Sbjct  899   DDASINMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWS-E  957

Query  958   VDRVIVPGHTNEAQVQKLNPATTYNIRIVAENEIGVSDSSEVVPIITAEEAPSGKPQSIK  1017
             +DRVIVPGHT EAQVQKL+PATTYNIRIVAEN IG S SSE V IITAEEAPSGKPQ+IK
Sbjct  958   IDRVIVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNIK  1017

Query  1018  VEPLSQTSLRVLWKAPPRSDWNGEILGYYVGYKLTNNNGSYYFEDYKYMMEEGKEYSYEL  1077
             VEP++QT++RV WK PPR++WNGEILGYYVGYKL+N N SY FE   ++ EEGKE++ EL
Sbjct  1018  VEPVNQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLEL  1077

Query  1078  TNLKTYTQYSVVIQAYNKVGAGPLSEDEKQYTAEGTPDQPPSDITCTTLTSQTIRVSWVS  1137
              NL+ YTQYSVVIQA+NK+GAGPLSE+EKQ+TAEGTP QPPSD  CTTLTSQTIRV WVS
Sbjct  1078  QNLRVYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWVS  1137

Query  1138  PPLESANGVIKGYKVVYAPSELWYDDKNKDYKKTASSDTVLHGLKKYTNYTMQVLATTSG  1197
             PPLESANGVIK YKVVYAPS+ WYD+  + YKKTASSDTVLHGLKKYTNYTMQVLATT+G
Sbjct  1138  PPLESANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTAG  1197

Query  1198  GDGVRSPPIHCQTEQDVPEAPTAVKALVVGSEAILVSWLPPAQPNGLITQYTVYSKEEGT  1257
             GDGVRS PIHCQTE DVPEAPT VKALV+G+ AILVSW PPAQPNG+ITQYTVYSK EG 
Sbjct  1198  GDGVRSVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEGA  1257

Query  1258  ESEVKSHKVPPYQMSYEASSLDKNKPFEFWVTANTNIGEGQASKSIVAMPSDKVPAKIAS  1317
             E+E K+ KVP YQMS+EA+ L+KNKP+EFWVTA+T IGEGQ SKSIVAMPSD+VPAKIAS
Sbjct  1258  ETETKTQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIAS  1317

Query  1318  FDDTFTAIFKEDFKLPCLAVGAPAPDITWKVKGVEFVPNDRVRQLPEGSLSIKDVIRQDA  1377
             FDDTFTA FKED K+PCLAVGAP P+ITWK+KGVEF  NDR+R LP+GSL IK V RQDA
Sbjct  1318  FDDTFTATFKEDAKMPCLAVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNRQDA  1377

Query  1378  GDYTCMAENSIAKDSITHKLIVLAPPQSPQVLLTATTTDSLTLKLKQHDGDTAPIHGYTL  1437
             GDY+C AENSIAKDSITHKLIVLAPPQSP V L+ATTTD+LT+KLK H+GDTAP+HGYTL
Sbjct  1378  GDYSCHAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGYTL  1437

Query  1438  HYKPEFGDWETVEVAVDAQKYTIENLFCGSRYQVYATGYNNIGAGEASDILNTRTKGSKP  1497
             HYKPEFG+WET EV+VD+QK+ IE L CGSRYQVYATG+NNIGAGEASDILNTRTKG KP
Sbjct  1438  HYKPEFGEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKGQKP  1497

Query  1498  MMPENSKFIDPSSNTVTLHLPTWKDGGCRMSHFVVEYKKKDHAEWTQISNNVKPGGNFVV  1557
              +PE  +FI+ SSN+V+LH   WKDGGC MSHFVVE KK+D  EW QISNNVKP  N+VV
Sbjct  1498  KLPEKPRFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKRDQIEWNQISNNVKPDNNYVV  1557

Query  1558  LDLDAASWYSVRITAHNSAGFTVAEYEFATLTVTGGTLAPPLNTAVLNGKTY----LPPW  1613
             LDL+ A+WY++RITAHNSAGFTVAEY+FATLTVTGGT+A PL+    +G  +    LP W
Sbjct  1558  LDLEPATWYNLRITAHNSAGFTVAEYDFATLTVTGGTIA-PLDDGSGHGNVHTRIRLPAW  1616

Query  1614  MPQWFDLNFMVPLIATIIVVFVGVLVICVALSRRRMEDPRGGPKDVYYDVVYNQPMGPGA  1673
             MP+W DLNFMVPLIAT++VV VG+ V+CVALSRRR +D RGG KDVYYDVVYNQ MGPGA
Sbjct  1617  MPEWLDLNFMVPLIATVVVVAVGICVVCVALSRRRADDMRGGQKDVYYDVVYNQTMGPGA  1676

Query  1674  TMDKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRGTVISRSMRSNHSTWDPRR--  1731
             T+DKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG      +RSNHSTWDPRR  
Sbjct  1677  TLDKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG---RGGLRSNHSTWDPRRNP  1733

Query  1732  PLYEELKPPPVPRR-----HYHGSDECYHTHPHPHPAGMEDEICPYATFHLLGFREEMDP  1786
              LYEELK PPVP       H HG+ EC++ HP     GMEDEICPYATFHLLGFREEMDP
Sbjct  1734  NLYEELKAPPVPMHGNHYGHAHGNAECHYRHP-----GMEDEICPYATFHLLGFREEMDP  1788

Query  1787  TKAMNFQTFPHQNGHTG--PGHA-TMGPGGPPGHIHSRSGSQSMPRQNRYARKNSQGGQS  1843
             TKAMNFQTFPHQNGH G  PGHA TM P G PGH+HSRSGSQSMPR NRY RKNSQGGQS
Sbjct  1789  TKAMNFQTFPHQNGHAGPVPGHAGTMLPPGHPGHVHSRSGSQSMPRANRYQRKNSQGGQS  1848

Query  1844  SIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYGGPGPEYDDPANCAPEDDQYGSQYG  1903
             SIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLY GPGPEYDDPANCAPE+DQYGSQYG
Sbjct  1849  SIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYSGPGPEYDDPANCAPEEDQYGSQYG  1908

Query  1904  APYG--YDHYGSRGSVGRRSVGSARNLPNGSPEPPPPPPRNHDTSNSSFNDSKESNEISE  1961
              PYG  YDHYGSRGS+GRRS+GSARN  NGSPEPPPPPPRNHD SNSSFNDSKESNEISE
Sbjct  1909  GPYGQPYDHYGSRGSMGRRSIGSARNPGNGSPEPPPPPPRNHDMSNSSFNDSKESNEISE  1968

Query  1962  AECDRDH-PRGNYGENENSGDAKRSANTKDVRTTEEMRKLIDSRKSNEVAAKLQQQGGPA  2020
             AECDRDH PRGNYG        KRS   KD RTTEEMRKLI+  ++     +LQQ  G A
Sbjct  1969  AECDRDHGPRGNYGA------VKRSPQPKDQRTTEEMRKLIERNETGPKQLQLQQANG-A  2021

Query  2021  GLTAYDTLAV  2030
             G TAYDT+AV
Sbjct  2022  GFTAYDTMAV  2031


>Q0E9J4_DROME unnamed protein product
Length=2031

 Score = 3304 bits (8568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1625/2050 (79%), Positives = 1791/2050 (87%), Gaps = 46/2050 (2%)

Query  3     QRTKWITKIIFIAV-LVDLGS---TANT-EADTKGPMFLKEPINRIDFSNSTGSVVECRA  57
             +R KW+  ++F AV L+  GS    AN  +AD KGP+FLKEP NRIDFSNSTG+ +EC+A
Sbjct  6     ERLKWL--MLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAEIECKA  63

Query  58    SGNPAPEIIWVRSDGTAVGDVPGLRQVLSNGNLVFPPFRAEDYRQEVHAQVYACLAKNQF  117
             SGNP PEIIW+RSDGTAVGDVPGLRQ+ S+G LVFPPFRAEDYRQEVHAQVYACLA+NQF
Sbjct  64    SGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQF  123

Query  118   GSIISRDVNVRAVVHQFYQSEVNNEYVIRGNSAVLRCSIPSFVGDYVTVLSWQDENGNLY  177
             GSIISRDV+VRAVV+Q+Y++EV +EYVIRGN+AVL+C+IPSFV D++ V +W   +G  Y
Sbjct  124   GSIISRDVHVRAVVNQYYEAEVVSEYVIRGNTAVLKCTIPSFVADFLRVEAWVASDGTEY  183

Query  178   GSLDDNSKDNFDGKYLVLPSGELHIKEVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI  237
                +D     FDGKYLVLPSGELHI+EVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI
Sbjct  184   APEED-----FDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI  238

Query  238   TEPVGSVAPKVNVADKGHISSARTGHTTDILCPAQGYPMPAFRWYKFIEGTTRKQAVVLN  297
             TEPVGSV PK++V ++   + A +  T  + CPAQ YP+P+FRWYKFIEGTTRKQAVVLN
Sbjct  239   TEPVGSVGPKISVGERLRDAGAPSKSTLTLFCPAQSYPVPSFRWYKFIEGTTRKQAVVLN  298

Query  298   DRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPSQVVDFG  357
             DRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPP+Q VDFG
Sbjct  299   DRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFG  358

Query  358   RPAVFTCHFSGNPIKTVSWLKDGKKIGHTDAILRIESVKKEHKGMYQCFIRNDQESAEAS  417
             RPAVFTC ++GNPIKTVSW+KDGK IGH++ +LRIESVKKE KGMYQCF+RNDQESAEAS
Sbjct  359   RPAVFTCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEAS  418

Query  418   AELKLGGRFDPPIIRQAFPEETLHPGPSVFLKCVAGGLPTPEISWELDGKKIANSERYQV  477
             AELKLGGRFDPP+IRQAF EET+ PGPSVFLKCVAGG PTPEISWELDGKKIAN++RYQV
Sbjct  419   AELKLGGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQV  478

Query  478   GQYVTVNGDVVSYLNITSIHANDGGLYKCIASSKVGVAEHSAKLNVYGLPYIRPMEKKAI  537
             GQYVTVNGDVVSYLNITS+HANDGGLYKCIA SKVGVAEHSAKLNVYGLPYIR MEKKAI
Sbjct  479   GQYVTVNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKAI  538

Query  538   VAGENLIVTCPVAGYPIESIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCV  597
             VAGE LIVTCPVAGYPI+SIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCV
Sbjct  539   VAGETLIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCV  598

Query  598   AKNSEGYSARGALEVQVMVPPKIAPFTFGEDAMSYGDTISIQCTISGGDLPVDVEWRLNG  657
             AKN EGYSARG+LEVQVM PPKI PF+FGE+  +  D++S+ C IS GDLP+D+EW  N 
Sbjct  599   AKNQEGYSARGSLEVQVMAPPKITPFSFGEEPANVEDSVSVTCLISTGDLPIDIEWFFNE  658

Query  658   SPLESYLEIQTAKSGKRINNLVIDLVSAKHAGNYTCLAKNAAGVAEHTSELVVNVPPRWI  717
               + SY  I   K GKR + L ID V A+HAGNY+C AKN A    +T++L+VNVPPRWI
Sbjct  659   YGISSYSGISVMKGGKRNSVLSIDSVQARHAGNYSCRAKNHAAAVNYTTDLIVNVPPRWI  718

Query  718   LEPTDKAFAQGSDAKVECKSDGFPKPQVTWKKAVGDTPGEYKDMKQSNNIRVDEGTLYID  777
             LEPTDKAFAQGSDAKVECK+DGFPKPQVTWKKAVGDTPGEYKD+K+S+NIRV+EGTL++D
Sbjct  719   LEPTDKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHVD  778

Query  778   NIQKNNEGYYLCEAINGIGSGLSAVILISVQAPPEFVEKLRNQTARRSEPAVLQCEAKGE  837
             NIQK NEGYYLCEAINGIGSGLSAVI+ISVQAPPEF EKLRNQTARR EPAVLQCEAKGE
Sbjct  779   NIQKTNEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKGE  838

Query  838   KPIGILWNMNNMRLDPKTDNRYTIREEILSTGVMSSLSIKRTERTDSALFTCVATNAFGS  897
             KPIGILWNMNNMRLDPK DNRYTIREEILSTGVMSSLSIKRTER+DSALFTCVATNAFGS
Sbjct  839   KPIGILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAFGS  898

Query  898   DDASINMIIQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLKRYIIEFKTSRGSWEHD  957
             DDASINMI+QEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPL RYIIEFK SR SW  +
Sbjct  899   DDASINMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWS-E  957

Query  958   VDRVIVPGHTNEAQVQKLNPATTYNIRIVAENEIGVSDSSEVVPIITAEEAPSGKPQSIK  1017
             +DRVIVPGHT EAQVQKL+PATTYNIRIVAEN IG S SSE V IITAEEAPSGKPQ+IK
Sbjct  958   IDRVIVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNIK  1017

Query  1018  VEPLSQTSLRVLWKAPPRSDWNGEILGYYVGYKLTNNNGSYYFEDYKYMMEEGKEYSYEL  1077
             VEP++QT++RV WK PPR++WNGEILGYYVGYKL+N N SY FE   ++ EEGKE++ EL
Sbjct  1018  VEPVNQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLEL  1077

Query  1078  TNLKTYTQYSVVIQAYNKVGAGPLSEDEKQYTAEGTPDQPPSDITCTTLTSQTIRVSWVS  1137
              NL+ YTQYSVVIQA+NK+GAGPLSE+EKQ+TAEGTP QPPSD  CTTLTSQTIRV WVS
Sbjct  1078  QNLRVYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWVS  1137

Query  1138  PPLESANGVIKGYKVVYAPSELWYDDKNKDYKKTASSDTVLHGLKKYTNYTMQVLATTSG  1197
             PPLESANGVIK YKVVYAPS+ WYD+  + YKKTASSDTVLHGLKKYTNYTMQVLATT+G
Sbjct  1138  PPLESANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTAG  1197

Query  1198  GDGVRSPPIHCQTEQDVPEAPTAVKALVVGSEAILVSWLPPAQPNGLITQYTVYSKEEGT  1257
             GDGVRS PIHCQTE DVPEAPT VKALV+G+ AILVSW PPAQPNG+ITQYTVYSK EG 
Sbjct  1198  GDGVRSVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEGA  1257

Query  1258  ESEVKSHKVPPYQMSYEASSLDKNKPFEFWVTANTNIGEGQASKSIVAMPSDKVPAKIAS  1317
             E+E K+ KVP YQMS+EA+ L+KNKP+EFWVTA+T IGEGQ SKSIVAMPSD+VPAKIAS
Sbjct  1258  ETETKTQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIAS  1317

Query  1318  FDDTFTAIFKEDFKLPCLAVGAPAPDITWKVKGVEFVPNDRVRQLPEGSLSIKDVIRQDA  1377
             FDDTFTA FKED K+PCLAVGAP P+ITWK+KGVEF  NDR+R LP+GSL IK V RQDA
Sbjct  1318  FDDTFTATFKEDAKMPCLAVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNRQDA  1377

Query  1378  GDYTCMAENSIAKDSITHKLIVLAPPQSPQVLLTATTTDSLTLKLKQHDGDTAPIHGYTL  1437
             GDY+C AENSIAKDSITHKLIVLAPPQSP V L+ATTTD+LT+KLK H+GDTAP+HGYTL
Sbjct  1378  GDYSCHAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGYTL  1437

Query  1438  HYKPEFGDWETVEVAVDAQKYTIENLFCGSRYQVYATGYNNIGAGEASDILNTRTKGSKP  1497
             HYKPEFG+WET EV+VD+QK+ IE L CGSRYQVYATG+NNIGAGEASDILNTRTKG KP
Sbjct  1438  HYKPEFGEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKGQKP  1497

Query  1498  MMPENSKFIDPSSNTVTLHLPTWKDGGCRMSHFVVEYKKKDHAEWTQISNNVKPGGNFVV  1557
              +PE  +FI+ SSN+V+LH   WKDGGC MSHFVVE KK+D  EW QISNNVKP  N+VV
Sbjct  1498  KLPEKPRFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKRDQIEWNQISNNVKPDNNYVV  1557

Query  1558  LDLDAASWYSVRITAHNSAGFTVAEYEFATLTVTGGTLAPPLNTAVLNGKTY----LPPW  1613
             LDL+ A+WY++RITAHNSAGFTVAEY+FATLTVTGGT+A PL+    +G  +    LP W
Sbjct  1558  LDLEPATWYNLRITAHNSAGFTVAEYDFATLTVTGGTIA-PLDDGSGHGNVHTRIRLPAW  1616

Query  1614  MPQWFDLNFMVPLIATIIVVFVGVLVICVALSRRRMEDPRGGPKDVYYDVVYNQPMGPGA  1673
             MP+W DLNFMVPLIAT++VV VG+ V+CVALSRRR +D RGG KDVYYDVVYNQ MGPGA
Sbjct  1617  MPEWLDLNFMVPLIATVVVVAVGICVVCVALSRRRADDMRGGQKDVYYDVVYNQTMGPGA  1676

Query  1674  TMDKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRGTVISRSMRSNHSTWDPRR--  1731
             T+DKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG      +RSNHSTWDPRR  
Sbjct  1677  TLDKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG---RGGLRSNHSTWDPRRNP  1733

Query  1732  PLYEELKPPPVPRR-----HYHGSDECYHTHPHPHPAGMEDEICPYATFHLLGFREEMDP  1786
              LYEELK PPVP       H HG+ EC++ HP     GMEDEICPYATFHLLGFREEMDP
Sbjct  1734  NLYEELKAPPVPMHGNHYGHAHGNAECHYRHP-----GMEDEICPYATFHLLGFREEMDP  1788

Query  1787  TKAMNFQTFPHQNGHTG--PGHA-TMGPGGPPGHIHSRSGSQSMPRQNRYARKNSQGGQS  1843
             TKAMNFQTFPHQNGH G  PGHA TM P G PGH+HSRSGSQSMPR NRY RKNSQGGQS
Sbjct  1789  TKAMNFQTFPHQNGHAGPVPGHAGTMLPPGHPGHVHSRSGSQSMPRANRYQRKNSQGGQS  1848

Query  1844  SIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYGGPGPEYDDPANCAPEDDQYGSQYG  1903
             SIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLY GPGPEYDDPANCAPE+DQYGSQYG
Sbjct  1849  SIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYSGPGPEYDDPANCAPEEDQYGSQYG  1908

Query  1904  APYG--YDHYGSRGSVGRRSVGSARNLPNGSPEPPPPPPRNHDTSNSSFNDSKESNEISE  1961
              PYG  YDHYGSRGS+GRRS+GSARN  NGSPEPPPPPPRNHD SNSSFNDSKESNEISE
Sbjct  1909  GPYGQPYDHYGSRGSMGRRSIGSARNPGNGSPEPPPPPPRNHDMSNSSFNDSKESNEISE  1968

Query  1962  AECDRDH-PRGNYGENENSGDAKRSANTKDVRTTEEMRKLIDSRKSNEVAAKLQQQGGPA  2020
             AECDRDH PRGNYG        KRS   KD RTTEEMRKLI+  ++     +LQQ  G A
Sbjct  1969  AECDRDHGPRGNYGA------VKRSPQPKDQRTTEEMRKLIERNETGPKQLQLQQANG-A  2021

Query  2021  GLTAYDTLAV  2030
             G TAYDT+AV
Sbjct  2022  GFTAYDTMAV  2031



Lambda      K        H
   0.314    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 27202772002


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jul 7, 2021  1:54 PM
  Number of letters in database: 17,197,330
  Number of sequences in database:  25,232



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= XP_037024201.1 Down syndrome cell adhesion molecule-like protein
Dscam2 isoform X6 [Bradysia coprophila]

Length=2030
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q0E9J4_DROME  unnamed protein product                                 3320    0.0  
Q0E9J5_DROME  unnamed protein product                                 3319    0.0  
Q0E9L3_DROME  unnamed protein product                                 3316    0.0  


>Q0E9J4_DROME unnamed protein product
Length=2031

 Score = 3320 bits (8607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1630/2050 (80%), Positives = 1798/2050 (88%), Gaps = 46/2050 (2%)

Query  3     QRTKWITKIIFIAV-LVDLGS---TANT-EADTKGPMFLKEPINRIDFSNSTGSVVECRA  57
             +R KW+  ++F AV L+  GS    AN  +AD KGP+FLKEP NRIDFSNSTG+ +EC+A
Sbjct  6     ERLKWL--MLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAEIECKA  63

Query  58    SGNPAPEIIWVRSDGTAVGDVPGLRQVLSNGNLVFPPFRAEDYRQEVHAQVYACLAKNQF  117
             SGNP PEIIW+RSDGTAVGDVPGLRQ+ S+G LVFPPFRAEDYRQEVHAQVYACLA+NQF
Sbjct  64    SGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQF  123

Query  118   GSIISRDVNVRAVVHQFYQSEVNNEYVIRGNSAVLRCSIPSFVGDYVTVLSWQDENGNLY  177
             GSIISRDV+VRAVV+Q+Y++EV +EYVIRGN+AVL+C+IPSFV D++ V +W   +G  Y
Sbjct  124   GSIISRDVHVRAVVNQYYEAEVVSEYVIRGNTAVLKCTIPSFVADFLRVEAWVASDGTEY  183

Query  178   GSLDDNSKDNFDGKYLVLPSGELHIKEVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI  237
                +D     FDGKYLVLPSGELHI+EVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI
Sbjct  184   APEED-----FDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI  238

Query  238   TEPVGSVAPKVNVADKGHISSARTGHTTDILCPAQGYPMPAFRWYKFIEGTTRKQAVVLN  297
             TEPVGSV PK++V ++   + A +  T  + CPAQ YP+P+FRWYKFIEGTTRKQAVVLN
Sbjct  239   TEPVGSVGPKISVGERLRDAGAPSKSTLTLFCPAQSYPVPSFRWYKFIEGTTRKQAVVLN  298

Query  298   DRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPSQVVDFG  357
             DRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPP+Q VDFG
Sbjct  299   DRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFG  358

Query  358   RPAVFTCHFSGNPIKTVSWLKDGKKIGHTDAILRIESVKKEHKGMYQCFIRNDQESAEAS  417
             RPAVFTC ++GNPIKTVSW+KDGK IGH++ +LRIESVKKE KGMYQCF+RNDQESAEAS
Sbjct  359   RPAVFTCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEAS  418

Query  418   AELKLGGRFDPPIIRQAFPEETLHPGPSVFLKCVAGGLPTPEISWELDGKKIANSERYQV  477
             AELKLGGRFDPP+IRQAF EET+ PGPSVFLKCVAGG PTPEISWELDGKKIAN++RYQV
Sbjct  419   AELKLGGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQV  478

Query  478   GQYVTVNGDVVSYLNITSIHANDGGLYKCIASSKVGVAEHSAKLNVYGLPYIRPMEKKAI  537
             GQYVTVNGDVVSYLNITS+HANDGGLYKCIA SKVGVAEHSAKLNVYGLPYIR MEKKAI
Sbjct  479   GQYVTVNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKAI  538

Query  538   VAGENLIVTCPVAGYPIESIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCV  597
             VAGE LIVTCPVAGYPI+SIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCV
Sbjct  539   VAGETLIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCV  598

Query  598   AKNSEGYSARGALEVQVMVPPKIAHFDFGDEPSNYGDTASVSCIVTSGDLPVDFKWLFNG  657
             AKN EGYSARG+LEVQVM PPKI  F FG+EP+N  D+ SV+C++++GDLP+D +W FN 
Sbjct  599   AKNQEGYSARGSLEVQVMAPPKITPFSFGEEPANVEDSVSVTCLISTGDLPIDIEWFFNE  658

Query  658   KPISEFAGISTAKMGKRNSVMNIDSVSGKHAGKYTCLASNTASIVNFTAVLIVNVPPRWI  717
               IS ++GIS  K GKRNSV++IDSV  +HAG Y+C A N A+ VN+T  LIVNVPPRWI
Sbjct  659   YGISSYSGISVMKGGKRNSVLSIDSVQARHAGNYSCRAKNHAAAVNYTTDLIVNVPPRWI  718

Query  718   LEPTDKAFAQGSDAKVECKSDGFPKPQVTWKKAVGDTPGEYKDMKQSNNIRVDEGTLYID  777
             LEPTDKAFAQGSDAKVECK+DGFPKPQVTWKKAVGDTPGEYKD+K+S+NIRV+EGTL++D
Sbjct  719   LEPTDKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHVD  778

Query  778   NIQKNNEGYYLCEAINGIGSGLSAVILISVQAPPEFVEKLRNQTARRSEPAVLQCEAKGE  837
             NIQK NEGYYLCEAINGIGSGLSAVI+ISVQAPPEF EKLRNQTARR EPAVLQCEAKGE
Sbjct  779   NIQKTNEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKGE  838

Query  838   KPIGILWNMNNMRLDPKTDNRYTIREEILSTGVMSSLSIKRTERTDSALFTCVATNAFGS  897
             KPIGILWNMNNMRLDPK DNRYTIREEILSTGVMSSLSIKRTER+DSALFTCVATNAFGS
Sbjct  839   KPIGILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAFGS  898

Query  898   DDASINMIIQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLKRYIIEFKTSRGSWEHD  957
             DDASINMI+QEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPL RYIIEFK SR SW  +
Sbjct  899   DDASINMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWS-E  957

Query  958   VDRVIVPGHTNEAQVQKLNPATTYNIRIVAENEIGVSDSSEVVPIITAEEAPSGKPQSIK  1017
             +DRVIVPGHT EAQVQKL+PATTYNIRIVAEN IG S SSE V IITAEEAPSGKPQ+IK
Sbjct  958   IDRVIVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNIK  1017

Query  1018  VEPLSQTSLRVLWKAPPRSDWNGEILGYYVGYKLTNNNGSYYFEDYKYMMEEGKEYSYEL  1077
             VEP++QT++RV WK PPR++WNGEILGYYVGYKL+N N SY FE   ++ EEGKE++ EL
Sbjct  1018  VEPVNQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLEL  1077

Query  1078  TNLKTYTQYSVVIQAYNKVGAGPLSEDEKQYTAEGTPDQPPSDITCTTLTSQTIRVSWVS  1137
              NL+ YTQYSVVIQA+NK+GAGPLSE+EKQ+TAEGTP QPPSD  CTTLTSQTIRV WVS
Sbjct  1078  QNLRVYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWVS  1137

Query  1138  PPLESANGVIKGYKVVYAPSELWYDDKNKDYKKTASSDTVLHGLKKYTNYTMQVLATTSG  1197
             PPLESANGVIK YKVVYAPS+ WYD+  + YKKTASSDTVLHGLKKYTNYTMQVLATT+G
Sbjct  1138  PPLESANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTAG  1197

Query  1198  GDGVRSPPIHCQTEQDVPEAPTAVKALVVGSEAILVSWLPPAQPNGLITQYTVYSKEEGT  1257
             GDGVRS PIHCQTE DVPEAPT VKALV+G+ AILVSW PPAQPNG+ITQYTVYSK EG 
Sbjct  1198  GDGVRSVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEGA  1257

Query  1258  ESEVKSHKVPPYQMSYEASSLDKNKPFEFWVTANTNIGEGQASKSIVAMPSDKVPAKIAS  1317
             E+E K+ KVP YQMS+EA+ L+KNKP+EFWVTA+T IGEGQ SKSIVAMPSD+VPAKIAS
Sbjct  1258  ETETKTQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIAS  1317

Query  1318  FDDTFTAIFKEDFKLPCLAVGAPAPDITWKVKGVEFVPNDRVRQLPEGSLSIKDVIRQDA  1377
             FDDTFTA FKED K+PCLAVGAP P+ITWK+KGVEF  NDR+R LP+GSL IK V RQDA
Sbjct  1318  FDDTFTATFKEDAKMPCLAVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNRQDA  1377

Query  1378  GDYTCMAENSIAKDSITHKLIVLAPPQSPQVLLTATTTDSLTLKLKQHDGDTAPIHGYTL  1437
             GDY+C AENSIAKDSITHKLIVLAPPQSP V L+ATTTD+LT+KLK H+GDTAP+HGYTL
Sbjct  1378  GDYSCHAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGYTL  1437

Query  1438  HYKPEFGDWETVEVAVDAQKYTIENLFCGSRYQVYATGYNNIGAGEASDILNTRTKGSKP  1497
             HYKPEFG+WET EV+VD+QK+ IE L CGSRYQVYATG+NNIGAGEASDILNTRTKG KP
Sbjct  1438  HYKPEFGEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKGQKP  1497

Query  1498  MMPENSKFIDPSSNTVTLHLPTWKDGGCRMSHFVVEYKKKDHAEWTQISNNVKPGGNFVV  1557
              +PE  +FI+ SSN+V+LH   WKDGGC MSHFVVE KK+D  EW QISNNVKP  N+VV
Sbjct  1498  KLPEKPRFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKRDQIEWNQISNNVKPDNNYVV  1557

Query  1558  LDLDAASWYSVRITAHNSAGFTVAEYEFATLTVTGGTLAPPLNTAVLNGKTY----LPPW  1613
             LDL+ A+WY++RITAHNSAGFTVAEY+FATLTVTGGT+A PL+    +G  +    LP W
Sbjct  1558  LDLEPATWYNLRITAHNSAGFTVAEYDFATLTVTGGTIA-PLDDGSGHGNVHTRIRLPAW  1616

Query  1614  MPQWFDLNFMVPLIATIIVVFVGVLVICVALSRRRMEDPRGGPKDVYYDVVYNQPMGPGA  1673
             MP+W DLNFMVPLIAT++VV VG+ V+CVALSRRR +D RGG KDVYYDVVYNQ MGPGA
Sbjct  1617  MPEWLDLNFMVPLIATVVVVAVGICVVCVALSRRRADDMRGGQKDVYYDVVYNQTMGPGA  1676

Query  1674  TMDKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRGTVISRSMRSNHSTWDPRR--  1731
             T+DKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG      +RSNHSTWDPRR  
Sbjct  1677  TLDKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG---RGGLRSNHSTWDPRRNP  1733

Query  1732  PLYEELKPPPVPRR-----HYHGSDECYHTHPHPHPAGMEDEICPYATFHLLGFREEMDP  1786
              LYEELK PPVP       H HG+ EC++ HP     GMEDEICPYATFHLLGFREEMDP
Sbjct  1734  NLYEELKAPPVPMHGNHYGHAHGNAECHYRHP-----GMEDEICPYATFHLLGFREEMDP  1788

Query  1787  TKAMNFQTFPHQNGHTG--PGHA-TMGPGGPPGHIHSRSGSQSMPRQNRYARKNSQGGQS  1843
             TKAMNFQTFPHQNGH G  PGHA TM P G PGH+HSRSGSQSMPR NRY RKNSQGGQS
Sbjct  1789  TKAMNFQTFPHQNGHAGPVPGHAGTMLPPGHPGHVHSRSGSQSMPRANRYQRKNSQGGQS  1848

Query  1844  SIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYGGPGPEYDDPANCAPEDDQYGSQYG  1903
             SIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLY GPGPEYDDPANCAPE+DQYGSQYG
Sbjct  1849  SIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYSGPGPEYDDPANCAPEEDQYGSQYG  1908

Query  1904  APYG--YDHYGSRGSVGRRSVGSARNLPNGSPEPPPPPPRNHDTSNSSFNDSKESNEISE  1961
              PYG  YDHYGSRGS+GRRS+GSARN  NGSPEPPPPPPRNHD SNSSFNDSKESNEISE
Sbjct  1909  GPYGQPYDHYGSRGSMGRRSIGSARNPGNGSPEPPPPPPRNHDMSNSSFNDSKESNEISE  1968

Query  1962  AECDRDH-PRGNYGENENSGDAKRSANTKDVRTTEEMRKLIDSRKSNEVAAKLQQQGGPA  2020
             AECDRDH PRGNYG        KRS   KD RTTEEMRKLI+  ++     +LQQ  G A
Sbjct  1969  AECDRDHGPRGNYGA------VKRSPQPKDQRTTEEMRKLIERNETGPKQLQLQQANG-A  2021

Query  2021  GLTAYDTLAV  2030
             G TAYDT+AV
Sbjct  2022  GFTAYDTMAV  2031


>Q0E9J5_DROME unnamed protein product
Length=2031

 Score = 3319 bits (8606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1634/2050 (80%), Positives = 1795/2050 (88%), Gaps = 46/2050 (2%)

Query  3     QRTKWITKIIFIAV-LVDLGS---TANT-EADTKGPMFLKEPINRIDFSNSTGSVVECRA  57
             +R KW+  ++F AV L+  GS    AN  +AD KGP+FLKEP NRIDFSNSTG+ +EC+A
Sbjct  6     ERLKWL--MLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAEIECKA  63

Query  58    SGNPAPEIIWVRSDGTAVGDVPGLRQVLSNGNLVFPPFRAEDYRQEVHAQVYACLAKNQF  117
             SGNP PEIIW+RSDGTAVGDVPGLRQ+ S+G LVFPPFRAEDYRQEVHAQVYACLA+NQF
Sbjct  64    SGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQF  123

Query  118   GSIISRDVNVRAVVHQFYQSEVNNEYVIRGNSAVLRCSIPSFVGDYVTVLSWQDENGNLY  177
             GSIISRDV+VRAVV+QFY +++  EYVIRGN+AVL+CSIPSFV D+V V SW DE G   
Sbjct  124   GSIISRDVHVRAVVNQFYGADILMEYVIRGNAAVLKCSIPSFVADFVRVESWIDEEGT--  181

Query  178   GSLDDNSKDNFDGKYLVLPSGELHIKEVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI  237
                +    +N+DGKYLVLPSGELHI+EVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI
Sbjct  182   ---ELRPSENYDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI  238

Query  238   TEPVGSVAPKVNVADKGHISSARTGHTTDILCPAQGYPMPAFRWYKFIEGTTRKQAVVLN  297
             TEPVGSVAPKV++ DK   +   +  + ++ C AQG+PMPAFRWYKFIEGTTRKQAVVLN
Sbjct  239   TEPVGSVAPKVDMHDKMDFTIRSSNRSLNLFCKAQGFPMPAFRWYKFIEGTTRKQAVVLN  298

Query  298   DRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPSQVVDFG  357
             DRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPP+Q VDFG
Sbjct  299   DRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFG  358

Query  358   RPAVFTCHFSGNPIKTVSWLKDGKKIGHTDAILRIESVKKEHKGMYQCFIRNDQESAEAS  417
             RPAVFTC ++GNPIKTVSW+KDGK IGH++ +LRIESVKKE KGMYQCF+RNDQESAEAS
Sbjct  359   RPAVFTCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEAS  418

Query  418   AELKLGGRFDPPIIRQAFPEETLHPGPSVFLKCVAGGLPTPEISWELDGKKIANSERYQV  477
             AELKLGGRFDPP+IRQAF EET+ PGPSVFLKCVAGG PTPEISWELDGKKIAN++RYQV
Sbjct  419   AELKLGGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQV  478

Query  478   GQYVTVNGDVVSYLNITSIHANDGGLYKCIASSKVGVAEHSAKLNVYGLPYIRPMEKKAI  537
             GQYVTVNGDVVSYLNITS+HANDGGLYKCIA SKVGVAEHSAKLNVYGLPYIR MEKKAI
Sbjct  479   GQYVTVNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKAI  538

Query  538   VAGENLIVTCPVAGYPIESIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCV  597
             VAGE LIVTCPVAGYPI+SIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCV
Sbjct  539   VAGETLIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCV  598

Query  598   AKNSEGYSARGALEVQVMVPPKIAHFDFGDEPSNYGDTASVSCIVTSGDLPVDFKWLFNG  657
             AKN EGYSARG+LEVQVM PPKIA FDFG   S++ D+ SV+C+VTSGDLP+D +WLF G
Sbjct  599   AKNQEGYSARGSLEVQVMAPPKIAPFDFGQSASSFEDSVSVNCLVTSGDLPIDIEWLFGG  658

Query  658   KPISEFAGISTAKMGKRNSVMNIDSVSGKHAGKYTCLASNTASIVNFTAVLIVNVPPRWI  717
             +PI+   GI+  + GKR S++ IDSV   HAG YTC A N AS   ++A LIVNVPPRWI
Sbjct  659   EPINFATGIAILRGGKRTSLLTIDSVHAGHAGNYTCKAKNQASSSEYSAALIVNVPPRWI  718

Query  718   LEPTDKAFAQGSDAKVECKSDGFPKPQVTWKKAVGDTPGEYKDMKQSNNIRVDEGTLYID  777
             LEPTDKAFAQGSDAKVECK+DGFPKPQVTWKKAVGDTPGEYKD+K+S+NIRV+EGTL++D
Sbjct  719   LEPTDKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHVD  778

Query  778   NIQKNNEGYYLCEAINGIGSGLSAVILISVQAPPEFVEKLRNQTARRSEPAVLQCEAKGE  837
             NIQK NEGYYLCEAINGIGSGLSAVI+ISVQAPPEF EKLRNQTARR EPAVLQCEAKGE
Sbjct  779   NIQKTNEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKGE  838

Query  838   KPIGILWNMNNMRLDPKTDNRYTIREEILSTGVMSSLSIKRTERTDSALFTCVATNAFGS  897
             KPIGILWNMNNMRLDPK DNRYTIREEILSTGVMSSLSIKRTER+DSALFTCVATNAFGS
Sbjct  839   KPIGILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAFGS  898

Query  898   DDASINMIIQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLKRYIIEFKTSRGSWEHD  957
             DDASINMI+QEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPL RYIIEFK SR SW  +
Sbjct  899   DDASINMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWS-E  957

Query  958   VDRVIVPGHTNEAQVQKLNPATTYNIRIVAENEIGVSDSSEVVPIITAEEAPSGKPQSIK  1017
             +DRVIVPGHT EAQVQKL+PATTYNIRIVAEN IG S SSE V IITAEEAPSGKPQ+IK
Sbjct  958   IDRVIVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNIK  1017

Query  1018  VEPLSQTSLRVLWKAPPRSDWNGEILGYYVGYKLTNNNGSYYFEDYKYMMEEGKEYSYEL  1077
             VEP++QT++RV WK PPR++WNGEILGYYVGYKL+N N SY FE   ++ EEGKE++ EL
Sbjct  1018  VEPVNQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLEL  1077

Query  1078  TNLKTYTQYSVVIQAYNKVGAGPLSEDEKQYTAEGTPDQPPSDITCTTLTSQTIRVSWVS  1137
              NL+ YTQYSVVIQA+NK+GAGPLSE+EKQ+TAEGTP QPPSD  CTTLTSQTIRV WVS
Sbjct  1078  QNLRVYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWVS  1137

Query  1138  PPLESANGVIKGYKVVYAPSELWYDDKNKDYKKTASSDTVLHGLKKYTNYTMQVLATTSG  1197
             PPLESANGVIK YKVVYAPS+ WYD+  + YKKTASSDTVLHGLKKYTNYTMQVLATT+G
Sbjct  1138  PPLESANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTAG  1197

Query  1198  GDGVRSPPIHCQTEQDVPEAPTAVKALVVGSEAILVSWLPPAQPNGLITQYTVYSKEEGT  1257
             GDGVRS PIHCQTE DVPEAPT VKALV+G+ AILVSW PPAQPNG+ITQYTVYSK EG 
Sbjct  1198  GDGVRSVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEGA  1257

Query  1258  ESEVKSHKVPPYQMSYEASSLDKNKPFEFWVTANTNIGEGQASKSIVAMPSDKVPAKIAS  1317
             E+E K+ KVP YQMS+EA+ L+KNKP+EFWVTA+T IGEGQ SKSIVAMPSD+VPAKIAS
Sbjct  1258  ETETKTQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIAS  1317

Query  1318  FDDTFTAIFKEDFKLPCLAVGAPAPDITWKVKGVEFVPNDRVRQLPEGSLSIKDVIRQDA  1377
             FDDTFTA FKED K+PCLAVGAP P+ITWK+KGVEF  NDR+R LP+GSL IK V RQDA
Sbjct  1318  FDDTFTATFKEDAKMPCLAVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNRQDA  1377

Query  1378  GDYTCMAENSIAKDSITHKLIVLAPPQSPQVLLTATTTDSLTLKLKQHDGDTAPIHGYTL  1437
             GDY+C AENSIAKDSITHKLIVLAPPQSP V L+ATTTD+LT+KLK H+GDTAP+HGYTL
Sbjct  1378  GDYSCHAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGYTL  1437

Query  1438  HYKPEFGDWETVEVAVDAQKYTIENLFCGSRYQVYATGYNNIGAGEASDILNTRTKGSKP  1497
             HYKPEFG+WET EV+VD+QK+ IE L CGSRYQVYATG+NNIGAGEASDILNTRTKG KP
Sbjct  1438  HYKPEFGEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKGQKP  1497

Query  1498  MMPENSKFIDPSSNTVTLHLPTWKDGGCRMSHFVVEYKKKDHAEWTQISNNVKPGGNFVV  1557
              +PE  +FI+ SSN+V+LH   WKDGGC MSHFVVE KK+D  EW QISNNVKP  N+VV
Sbjct  1498  KLPEKPRFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKRDQIEWNQISNNVKPDNNYVV  1557

Query  1558  LDLDAASWYSVRITAHNSAGFTVAEYEFATLTVTGGTLAPPLNTAVLNGKTY----LPPW  1613
             LDL+ A+WY++RITAHNSAGFTVAEY+FATLTVTGGT+A PL+    +G  +    LP W
Sbjct  1558  LDLEPATWYNLRITAHNSAGFTVAEYDFATLTVTGGTIA-PLDDGSGHGNVHTRIRLPAW  1616

Query  1614  MPQWFDLNFMVPLIATIIVVFVGVLVICVALSRRRMEDPRGGPKDVYYDVVYNQPMGPGA  1673
             MP+W DLNFMVPLIAT++VV VG+ V+CVALSRRR +D RGG KDVYYDVVYNQ MGPGA
Sbjct  1617  MPEWLDLNFMVPLIATVVVVAVGICVVCVALSRRRADDMRGGQKDVYYDVVYNQTMGPGA  1676

Query  1674  TMDKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRGTVISRSMRSNHSTWDPRR--  1731
             T+DKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG      +RSNHSTWDPRR  
Sbjct  1677  TLDKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG---RGGLRSNHSTWDPRRNP  1733

Query  1732  PLYEELKPPPVPRR-----HYHGSDECYHTHPHPHPAGMEDEICPYATFHLLGFREEMDP  1786
              LYEELK PPVP       H HG+ EC++ HP     GMEDEICPYATFHLLGFREEMDP
Sbjct  1734  NLYEELKAPPVPMHGNHYGHAHGNAECHYRHP-----GMEDEICPYATFHLLGFREEMDP  1788

Query  1787  TKAMNFQTFPHQNGHTG--PGHA-TMGPGGPPGHIHSRSGSQSMPRQNRYARKNSQGGQS  1843
             TKAMNFQTFPHQNGH G  PGHA TM P G PGH+HSRSGSQSMPR NRY RKNSQGGQS
Sbjct  1789  TKAMNFQTFPHQNGHAGPVPGHAGTMLPPGHPGHVHSRSGSQSMPRANRYQRKNSQGGQS  1848

Query  1844  SIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYGGPGPEYDDPANCAPEDDQYGSQYG  1903
             SIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLY GPGPEYDDPANCAPE+DQYGSQYG
Sbjct  1849  SIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYSGPGPEYDDPANCAPEEDQYGSQYG  1908

Query  1904  APYG--YDHYGSRGSVGRRSVGSARNLPNGSPEPPPPPPRNHDTSNSSFNDSKESNEISE  1961
              PYG  YDHYGSRGS+GRRS+GSARN  NGSPEPPPPPPRNHD SNSSFNDSKESNEISE
Sbjct  1909  GPYGQPYDHYGSRGSMGRRSIGSARNPGNGSPEPPPPPPRNHDMSNSSFNDSKESNEISE  1968

Query  1962  AECDRDH-PRGNYGENENSGDAKRSANTKDVRTTEEMRKLIDSRKSNEVAAKLQQQGGPA  2020
             AECDRDH PRGNYG        KRS   KD RTTEEMRKLI+  ++     +LQQ  G A
Sbjct  1969  AECDRDHGPRGNYGA------VKRSPQPKDQRTTEEMRKLIERNETGPKQLQLQQANG-A  2021

Query  2021  GLTAYDTLAV  2030
             G TAYDT+AV
Sbjct  2022  GFTAYDTMAV  2031


>Q0E9L3_DROME unnamed protein product
Length=2034

 Score = 3316 bits (8598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1632/2051 (80%), Positives = 1794/2051 (87%), Gaps = 45/2051 (2%)

Query  3     QRTKWITKIIFIAV-LVDLGS---TANT-EADTKGPMFLKEPINRIDFSNSTGSVVECRA  57
             +R KW+  ++F AV L+  GS    AN  +AD KGP+FLKEP NRIDFSNSTG+ +EC+A
Sbjct  6     ERLKWL--MLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAEIECKA  63

Query  58    SGNPAPEIIWVRSDGTAVGDVPGLRQVLSNGNLVFPPFRAEDYRQEVHAQVYACLAKNQF  117
             SGNP PEIIW+RSDGTAVGDVPGLRQ+ S+G LVFPPFRAEDYRQEVHAQVYACLA+NQF
Sbjct  64    SGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQF  123

Query  118   GSIISRDVNVRAVVHQFYQSEVNNEYVIRGNSAVLRCSIPSFVGDYVTVLSWQDENG-NL  176
             GSIISRDV+VRAVV QFY +E  NEYVI+GN+AV++C IPSFV D+V V +W DE G  L
Sbjct  124   GSIISRDVHVRAVVSQFYITEAENEYVIKGNAAVVKCKIPSFVADFVQVEAWVDEEGMEL  183

Query  177   YGSLDDNSKDNFDGKYLVLPSGELHIKEVGPEDGYKSYQCRTKHRLTGETRLSATKGRLV  236
             +    +N+ D +DGKYLVLPSGELHI+EVGPEDGYKSYQCRTKHRLTGETRLSATKGRLV
Sbjct  184   W---RNNATDAYDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLV  240

Query  237   ITEPVGSVAPKVNVADKGHISSARTGHTTDILCPAQGYPMPAFRWYKFIEGTTRKQAVVL  296
             ITEP+ S  PKV    K  + +     T  +LCPAQGYP+P FRWYKFIEGTTRKQAVVL
Sbjct  241   ITEPISSAVPKVVSLAKFDMKTYSGSSTMALLCPAQGYPVPVFRWYKFIEGTTRKQAVVL  300

Query  297   NDRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPSQVVDF  356
             NDRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPP+Q VDF
Sbjct  301   NDRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDF  360

Query  357   GRPAVFTCHFSGNPIKTVSWLKDGKKIGHTDAILRIESVKKEHKGMYQCFIRNDQESAEA  416
             GRPAVFTC ++GNPIKTVSW+KDGK IGH++ +LRIESVKKE KGMYQCF+RNDQESAEA
Sbjct  361   GRPAVFTCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEA  420

Query  417   SAELKLGGRFDPPIIRQAFPEETLHPGPSVFLKCVAGGLPTPEISWELDGKKIANSERYQ  476
             SAELKLGGRFDPP+IRQAF EET+ PGPSVFLKCVAGG PTPEISWELDGKKIAN++RYQ
Sbjct  421   SAELKLGGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQ  480

Query  477   VGQYVTVNGDVVSYLNITSIHANDGGLYKCIASSKVGVAEHSAKLNVYGLPYIRPMEKKA  536
             VGQYVTVNGDVVSYLNITS+HANDGGLYKCIA SKVGVAEHSAKLNVYGLPYIR MEKKA
Sbjct  481   VGQYVTVNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKA  540

Query  537   IVAGENLIVTCPVAGYPIESIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTC  596
             IVAGE LIVTCPVAGYPI+SIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTC
Sbjct  541   IVAGETLIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTC  600

Query  597   VAKNSEGYSARGALEVQVMVPPKIAHFDFGDEPSNYGDTASVSCIVTSGDLPVDFKWLFN  656
             VAKN EGYSARG+LEVQVMVPPKI  FDFGD P+N  D+ SV C++++GDLP+D +W FN
Sbjct  601   VAKNQEGYSARGSLEVQVMVPPKITPFDFGDAPTNVEDSVSVMCLISNGDLPIDIEWFFN  660

Query  657   GKPISEFAGISTAKMGKRNSVMNIDSVSGKHAGKYTCLASNTASIVNFTAVLIVNVPPRW  716
                IS ++GI+  K GKRNS+++IDSV  +HAGKY+C A N A+ VN+T  LIVNVPPRW
Sbjct  661   DYGISSYSGINVVKGGKRNSMLSIDSVQARHAGKYSCRAKNHAAAVNYTTELIVNVPPRW  720

Query  717   ILEPTDKAFAQGSDAKVECKSDGFPKPQVTWKKAVGDTPGEYKDMKQSNNIRVDEGTLYI  776
             ILEPTDKAFAQGSDAKVECK+DGFPKPQVTWKKAVGDTPGEYKD+K+S+NIRV+EGTL++
Sbjct  721   ILEPTDKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHV  780

Query  777   DNIQKNNEGYYLCEAINGIGSGLSAVILISVQAPPEFVEKLRNQTARRSEPAVLQCEAKG  836
             DNIQK NEGYYLCEAINGIGSGLSAVI+ISVQAPPEF EKLRNQTARR EPAVLQCEAKG
Sbjct  781   DNIQKTNEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKG  840

Query  837   EKPIGILWNMNNMRLDPKTDNRYTIREEILSTGVMSSLSIKRTERTDSALFTCVATNAFG  896
             EKPIGILWNMNNMRLDPK DNRYTIREEILSTGVMSSLSIKRTER+DSALFTCVATNAFG
Sbjct  841   EKPIGILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAFG  900

Query  897   SDDASINMIIQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLKRYIIEFKTSRGSWEH  956
             SDDASINMI+QEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPL RYIIEFK SR SW  
Sbjct  901   SDDASINMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWS-  959

Query  957   DVDRVIVPGHTNEAQVQKLNPATTYNIRIVAENEIGVSDSSEVVPIITAEEAPSGKPQSI  1016
             ++DRVIVPGHT EAQVQKL+PATTYNIRIVAEN IG S SSE V IITAEEAPSGKPQ+I
Sbjct  960   EIDRVIVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNI  1019

Query  1017  KVEPLSQTSLRVLWKAPPRSDWNGEILGYYVGYKLTNNNGSYYFEDYKYMMEEGKEYSYE  1076
             KVEP++QT++RV WK PPR++WNGEILGYYVGYKL+N N SY FE   ++ EEGKE++ E
Sbjct  1020  KVEPVNQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLE  1079

Query  1077  LTNLKTYTQYSVVIQAYNKVGAGPLSEDEKQYTAEGTPDQPPSDITCTTLTSQTIRVSWV  1136
             L NL+ YTQYSVVIQA+NK+GAGPLSE+EKQ+TAEGTP QPPSD  CTTLTSQTIRV WV
Sbjct  1080  LQNLRVYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWV  1139

Query  1137  SPPLESANGVIKGYKVVYAPSELWYDDKNKDYKKTASSDTVLHGLKKYTNYTMQVLATTS  1196
             SPPLESANGVIK YKVVYAPS+ WYD+  + YKKTASSDTVLHGLKKYTNYTMQVLATT+
Sbjct  1140  SPPLESANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTA  1199

Query  1197  GGDGVRSPPIHCQTEQDVPEAPTAVKALVVGSEAILVSWLPPAQPNGLITQYTVYSKEEG  1256
             GGDGVRS PIHCQTE DVPEAPT VKALV+G+ AILVSW PPAQPNG+ITQYTVYSK EG
Sbjct  1200  GGDGVRSVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEG  1259

Query  1257  TESEVKSHKVPPYQMSYEASSLDKNKPFEFWVTANTNIGEGQASKSIVAMPSDKVPAKIA  1316
              E+E K+ KVP YQMS+EA+ L+KNKP+EFWVTA+T IGEGQ SKSIVAMPSD+VPAKIA
Sbjct  1260  AETETKTQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIA  1319

Query  1317  SFDDTFTAIFKEDFKLPCLAVGAPAPDITWKVKGVEFVPNDRVRQLPEGSLSIKDVIRQD  1376
             SFDDTFTA FKED K+PCLAVGAP P+ITWK+KGVEF  NDR+R LP+GSL IK V RQD
Sbjct  1320  SFDDTFTATFKEDAKMPCLAVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNRQD  1379

Query  1377  AGDYTCMAENSIAKDSITHKLIVLAPPQSPQVLLTATTTDSLTLKLKQHDGDTAPIHGYT  1436
             AGDY+C AENSIAKDSITHKLIVLAPPQSP V L+ATTTD+LT+KLK H+GDTAP+HGYT
Sbjct  1380  AGDYSCHAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGYT  1439

Query  1437  LHYKPEFGDWETVEVAVDAQKYTIENLFCGSRYQVYATGYNNIGAGEASDILNTRTKGSK  1496
             LHYKPEFG+WET EV+VD+QK+ IE L CGSRYQVYATG+NNIGAGEASDILNTRTKG K
Sbjct  1440  LHYKPEFGEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKGQK  1499

Query  1497  PMMPENSKFIDPSSNTVTLHLPTWKDGGCRMSHFVVEYKKKDHAEWTQISNNVKPGGNFV  1556
             P +PE  +FI+ SSN+V+LH   WKDGGC MSHFVVE KK+D  EW QISNNVKP  N+V
Sbjct  1500  PKLPEKPRFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKRDQIEWNQISNNVKPDNNYV  1559

Query  1557  VLDLDAASWYSVRITAHNSAGFTVAEYEFATLTVTGGTLAPPLNTAVLNGKTY----LPP  1612
             VLDL+ A+WY++RITAHNSAGFTVAEY+FATLTVTGGT+A PL+    +G  +    LP 
Sbjct  1560  VLDLEPATWYNLRITAHNSAGFTVAEYDFATLTVTGGTIA-PLDDGSGHGNVHTRIRLPA  1618

Query  1613  WMPQWFDLNFMVPLIATIIVVFVGVLVICVALSRRRMEDPRGGPKDVYYDVVYNQPMGPG  1672
             WMP+W DLNFMVPLIAT++VV VG+ V+CVALSRRR +D RGG KDVYYDVVYNQ MGPG
Sbjct  1619  WMPEWLDLNFMVPLIATVVVVAVGICVVCVALSRRRADDMRGGQKDVYYDVVYNQTMGPG  1678

Query  1673  ATMDKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRGTVISRSMRSNHSTWDPRR-  1731
             AT+DKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG      +RSNHSTWDPRR 
Sbjct  1679  ATLDKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG---RGGLRSNHSTWDPRRN  1735

Query  1732  -PLYEELKPPPVPRR-----HYHGSDECYHTHPHPHPAGMEDEICPYATFHLLGFREEMD  1785
               LYEELK PPVP       H HG+ EC++ HP     GMEDEICPYATFHLLGFREEMD
Sbjct  1736  PNLYEELKAPPVPMHGNHYGHAHGNAECHYRHP-----GMEDEICPYATFHLLGFREEMD  1790

Query  1786  PTKAMNFQTFPHQNGHTG--PGHA-TMGPGGPPGHIHSRSGSQSMPRQNRYARKNSQGGQ  1842
             PTKAMNFQTFPHQNGH G  PGHA TM P G PGH+HSRSGSQSMPR NRY RKNSQGGQ
Sbjct  1791  PTKAMNFQTFPHQNGHAGPVPGHAGTMLPPGHPGHVHSRSGSQSMPRANRYQRKNSQGGQ  1850

Query  1843  SSIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYGGPGPEYDDPANCAPEDDQYGSQY  1902
             SSIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLY GPGPEYDDPANCAPE+DQYGSQY
Sbjct  1851  SSIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYSGPGPEYDDPANCAPEEDQYGSQY  1910

Query  1903  GAPYG--YDHYGSRGSVGRRSVGSARNLPNGSPEPPPPPPRNHDTSNSSFNDSKESNEIS  1960
             G PYG  YDHYGSRGS+GRRS+GSARN  NGSPEPPPPPPRNHD SNSSFNDSKESNEIS
Sbjct  1911  GGPYGQPYDHYGSRGSMGRRSIGSARNPGNGSPEPPPPPPRNHDMSNSSFNDSKESNEIS  1970

Query  1961  EAECDRDH-PRGNYGENENSGDAKRSANTKDVRTTEEMRKLIDSRKSNEVAAKLQQQGGP  2019
             EAECDRDH PRGNYG        KRS   KD RTTEEMRKLI+  ++     +LQQ  G 
Sbjct  1971  EAECDRDHGPRGNYGA------VKRSPQPKDQRTTEEMRKLIERNETGPKQLQLQQANG-  2023

Query  2020  AGLTAYDTLAV  2030
             AG TAYDT+AV
Sbjct  2024  AGFTAYDTMAV  2034



Lambda      K        H
   0.314    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 27188552048


Query= XP_037024202.1 Down syndrome cell adhesion molecule-like protein
Dscam2 isoform X7 [Bradysia coprophila]

Length=2030
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q0E9K5_DROME  unnamed protein product                                 3307    0.0  
Q0E9J0_DROME  unnamed protein product                                 3296    0.0  
Q0E9L2_DROME  unnamed protein product                                 3293    0.0  


>Q0E9K5_DROME unnamed protein product
Length=2032

 Score = 3307 bits (8575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1633/2051 (80%), Positives = 1790/2051 (87%), Gaps = 47/2051 (2%)

Query  3     QRTKWITKIIFIAV-LVDLGS---TANT-EADTKGPMFLKEPINRIDFSNSTGSVVECRA  57
             +R KW+  ++F AV L+  GS    AN  +AD KGP+FLKEP NRIDFSNSTG+ +EC+A
Sbjct  6     ERLKWL--MLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAEIECKA  63

Query  58    SGNPAPEIIWVRSDGTAVGDVPGLRQVLSNGNLVFPPFRAEDYRQEVHAQVYACLAKNQF  117
             SGNP PEIIW+RSDGTAVGDVPGLRQ+ S+G LVFPPFRAEDYRQEVHAQVYACLA+NQF
Sbjct  64    SGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQF  123

Query  118   GSIISRDVNVRAVVHQFYQSEVNNEYVIRGNSAVLRCSIPSFVGDYVTVLSWQDENGNLY  177
             GSIISRDV+VRAVV+QFY++E+  EYVIRGN+AVL+CSIPSFV D+V V SW D+ GN+ 
Sbjct  124   GSIISRDVHVRAVVNQFYEAEIMTEYVIRGNAAVLKCSIPSFVADFVRVESWIDDEGNVL  183

Query  178   GSLDDNSKDNFDGKYLVLPSGELHIKEVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI  237
                  +  DN+DGKYLVLPSGELHI+EVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI
Sbjct  184   -----SFSDNYDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI  238

Query  238   TEPVGSVAPKVNVADKGHISSARTGHTTDILCPAQGYPMPAFRWYKFIEGTTRKQAVVLN  297
             TEPVGSVAPKV+V D+        G    +LCPAQ YPMP +RWYKFIEGTTRKQAVVLN
Sbjct  239   TEPVGSVAPKVDVKDRITWLDKPMGQALSLLCPAQSYPMPVYRWYKFIEGTTRKQAVVLN  298

Query  298   DRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPSQVVDFG  357
             DRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPP+Q VDFG
Sbjct  299   DRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFG  358

Query  358   RPAVFTCHFSGNPIKTVSWLKDGKKIGHTDAILRIESVKKEHKGMYQCFIRNDQESAEAS  417
             RPAVFTC ++GNPIKTVSW+KDGK IGH++ +LRIESVKKE KGMYQCF+RNDQESAEAS
Sbjct  359   RPAVFTCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEAS  418

Query  418   AELKLGGRFDPPIIRQAFPEETLHPGPSVFLKCVAGGLPTPEISWELDGKKIANSERYQV  477
             AELKLGGRFDPP+IRQAF EET+ PGPSVFLKCVAGG PTPEISWELDGKKIAN++RYQV
Sbjct  419   AELKLGGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQV  478

Query  478   GQYVTVNGDVVSYLNITSIHANDGGLYKCIASSKVGVAEHSAKLNVYGLPYIRPMEKKAI  537
             GQYVTVNGDVVSYLNITS+HANDGGLYKCIA SKVGVAEHSAKLNVYGLPYIR MEKKAI
Sbjct  479   GQYVTVNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKAI  538

Query  538   VAGENLIVTCPVAGYPIESIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCV  597
             VAGE LIVTCPVAGYPI+SIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCV
Sbjct  539   VAGETLIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCV  598

Query  598   AKNSEGYSARGALEVQVMVPPTILPFTFGDEVVNAGDIVAVQCMVLKGDLPISIFWMHNN  657
             AKN EGYSARG+LEVQVMVPP+I PF+FGD+ VN G+   VQCMV KGD+PI+I W  N+
Sbjct  599   AKNQEGYSARGSLEVQVMVPPSIAPFSFGDDPVNTGENAGVQCMVQKGDVPITIKWTLNS  658

Query  658   ASIKELPD-VNIIKTSSRISTLNIESVNANHRGTFHCIASNSAGRSDQAAELNVNVPPRW  716
               I    + + I+K S + S LNI +V  +HRG F CIA N AG S   +EL VNVPPRW
Sbjct  659   RPIINGEEGITILKLSPKTSVLNIAAVEQDHRGVFKCIAENKAGSSFTTSELKVNVPPRW  718

Query  717   ILEPTDKAFAQGSDAKVECKSDGFPKPQVTWKKAVGDTPGEYKDMKQSNNIRVDEGTLYI  776
             ILEPTDKAFAQGSDAKVECK+DGFPKPQVTWKKAVGDTPGEYKD+K+S+NIRV+EGTL++
Sbjct  719   ILEPTDKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHV  778

Query  777   DNIQKNNEGYYLCEAINGIGSGLSAVILISVQAPPEFVEKLRNQTARRSEPAVLQCEAKG  836
             DNIQK NEGYYLCEAINGIGSGLSAVI+ISVQAPPEF EKLRNQTARR EPAVLQCEAKG
Sbjct  779   DNIQKTNEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKG  838

Query  837   EKPIGILWNMNNMRLDPKTDNRYTIREEILSTGVMSSLSIKRTERTDSALFTCVATNAFG  896
             EKPIGILWNMNNMRLDPK DNRYTIREEILSTGVMSSLSIKRTER+DSALFTCVATNAFG
Sbjct  839   EKPIGILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAFG  898

Query  897   SDDASINMIIQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLKRYIIEFKTSRGSWEH  956
             SDDASINMI+QEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPL RYIIEFK SR SW  
Sbjct  899   SDDASINMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWS-  957

Query  957   DVDRVIVPGHTNEAQVQKLNPATTYNIRIVAENEIGVSDSSEVVPIITAEEAPSGKPQSI  1016
             ++DRVIVPGHT EAQVQKL+PATTYNIRIVAEN IG S SSE V IITAEEAPSGKPQ+I
Sbjct  958   EIDRVIVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNI  1017

Query  1017  KVEPLSQTSLRVLWKAPPRSDWNGEILGYYVGYKLTNNNGSYYFEDYKYMMEEGKEYSYE  1076
             KVEP++QT++RV WK PPR++WNGEILGYYVGYKL+N N SY FE   ++ EEGKE++ E
Sbjct  1018  KVEPVNQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLE  1077

Query  1077  LTNLKTYTQYSVVIQAYNKVGAGPLSEDEKQYTAEGTPDQPPSDITCTTLTSQTIRVSWV  1136
             L NL+ YTQYSVVIQA+NK+GAGPLSE+EKQ+TAEGTP QPPSD  CTTLTSQTIRV WV
Sbjct  1078  LQNLRVYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWV  1137

Query  1137  SPPLESANGVIKGYKVVYAPSELWYDDKNKDYKKTASSDTVLHGLKKYTNYTMQVLATTS  1196
             SPPLESANGVIK YKVVYAPS+ WYD+  + YKKTASSDTVLHGLKKYTNYTMQVLATT+
Sbjct  1138  SPPLESANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTA  1197

Query  1197  GGDGVRSPPIHCQTEQDVPEAPTAVKALVVGSEAILVSWLPPAQPNGLITQYTVYSKEEG  1256
             GGDGVRS PIHCQTE DVPEAPT VKALV+G+ AILVSW PPAQPNG+ITQYTVYSK EG
Sbjct  1198  GGDGVRSVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEG  1257

Query  1257  TESEVKSHKVPPYQMSYEASSLDKNKPFEFWVTANTNIGEGQASKSIVAMPSDKVPAKIA  1316
              E+E K+ KVP YQMS+EA+ L+KNKP+EFWVTA+T IGEGQ SKSIVAMPSD+VPAKIA
Sbjct  1258  AETETKTQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIA  1317

Query  1317  SFDDTFTAIFKEDFKLPCLAVGAPAPDITWKVKGVEFVPNDRVRQLPEGSLSIKDVIRQD  1376
             SFDDTFTA FKED K+PCLAVGAP P+ITWK+KGVEF  NDR+R LP+GSL IK V RQD
Sbjct  1318  SFDDTFTATFKEDAKMPCLAVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNRQD  1377

Query  1377  AGDYTCMAENSIAKDSITHKLIVLAPPQSPQVLLTATTTDSLTLKLKQHDGDTAPIHGYT  1436
             AGDY+C AENSIAKDSITHKLIVLAPPQSP V L+ATTTD+LT+KLK H+GDTAP+HGYT
Sbjct  1378  AGDYSCHAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGYT  1437

Query  1437  LHYKPEFGDWETVEVAVDAQKYTIENLFCGSRYQVYATGYNNIGAGEASDILNTRTKGSK  1496
             LHYKPEFG+WET EV+VD+QK+ IE L CGSRYQVYATG+NNIGAGEASDILNTRTKG K
Sbjct  1438  LHYKPEFGEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKGQK  1497

Query  1497  PMMPENSKFIDPSSNTVTLHLPTWKDGGCRMSHFVVEYKKKDHAEWTQISNNVKPGGNFV  1556
             P +PE  +FI+ SSN+V+LH   WKDGGC MSHFVVE KK+D  EW QISNNVKP  N+V
Sbjct  1498  PKLPEKPRFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKRDQIEWNQISNNVKPDNNYV  1557

Query  1557  VLDLDAASWYSVRITAHNSAGFTVAEYEFATLTVTGGTLAPPLNTAVLNGKTY----LPP  1612
             VLDL+ A+WY++RITAHNSAGFTVAEY+FATLTVTGGT+A PL+    +G  +    LP 
Sbjct  1558  VLDLEPATWYNLRITAHNSAGFTVAEYDFATLTVTGGTIA-PLDDGSGHGNVHTRIRLPA  1616

Query  1613  WMPQWFDLNFMVPLIATIIVVFVGVLVICVALSRRRMEDPRGGPKDVYYDVVYNQPMGPG  1672
             WMP+W DLNFMVPLIAT++VV VG+ V+CVALSRRR +D RGG KDVYYDVVYNQ MGPG
Sbjct  1617  WMPEWLDLNFMVPLIATVVVVAVGICVVCVALSRRRADDMRGGQKDVYYDVVYNQTMGPG  1676

Query  1673  ATMDKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRGTVISRSMRSNHSTWDPRR-  1731
             AT+DKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG      +RSNHSTWDPRR 
Sbjct  1677  ATLDKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG---RGGLRSNHSTWDPRRN  1733

Query  1732  -PLYEELKPPPVPRR-----HYHGSDECYHTHPHPHPAGMEDEICPYATFHLLGFREEMD  1785
               LYEELK PPVP       H HG+ EC++ HP     GMEDEICPYATFHLLGFREEMD
Sbjct  1734  PNLYEELKAPPVPMHGNHYGHAHGNAECHYRHP-----GMEDEICPYATFHLLGFREEMD  1788

Query  1786  PTKAMNFQTFPHQNGHTG--PGHA-TMGPGGPPGHIHSRSGSQSMPRQNRYARKNSQGGQ  1842
             PTKAMNFQTFPHQNGH G  PGHA TM P G PGH+HSRSGSQSMPR NRY RKNSQGGQ
Sbjct  1789  PTKAMNFQTFPHQNGHAGPVPGHAGTMLPPGHPGHVHSRSGSQSMPRANRYQRKNSQGGQ  1848

Query  1843  SSIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYGGPGPEYDDPANCAPEDDQYGSQY  1902
             SSIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLY GPGPEYDDPANCAPE+DQYGSQY
Sbjct  1849  SSIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYSGPGPEYDDPANCAPEEDQYGSQY  1908

Query  1903  GAPYG--YDHYGSRGSVGRRSVGSARNLPNGSPEPPPPPPRNHDTSNSSFNDSKESNEIS  1960
             G PYG  YDHYGSRGS+GRRS+GSARN  NGSPEPPPPPPRNHD SNSSFNDSKESNEIS
Sbjct  1909  GGPYGQPYDHYGSRGSMGRRSIGSARNPGNGSPEPPPPPPRNHDMSNSSFNDSKESNEIS  1968

Query  1961  EAECDRDH-PRGNYGENENSGDAKRSANTKDVRTTEEMRKLIDSRKSNEVAAKLQQQGGP  2019
             EAECDRDH PRGNYG        KRS   KD RTTEEMRKLI+  ++     +LQQ  G 
Sbjct  1969  EAECDRDHGPRGNYGA------VKRSPQPKDQRTTEEMRKLIERNETGPKQLQLQQANG-  2021

Query  2020  AGLTAYDTLAV  2030
             AG TAYDT+AV
Sbjct  2022  AGFTAYDTMAV  2032


>Q0E9J0_DROME unnamed protein product
Length=2035

 Score = 3296 bits (8547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1628/2051 (79%), Positives = 1785/2051 (87%), Gaps = 44/2051 (2%)

Query  3     QRTKWITKIIFIAV-LVDLGS---TANT-EADTKGPMFLKEPINRIDFSNSTGSVVECRA  57
             +R KW+  ++F AV L+  GS    AN  +AD KGP+FLKEP NRIDFSNSTG+ +EC+A
Sbjct  6     ERLKWL--MLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAEIECKA  63

Query  58    SGNPAPEIIWVRSDGTAVGDVPGLRQVLSNGNLVFPPFRAEDYRQEVHAQVYACLAKNQF  117
             SGNP PEIIW+RSDGTAVGDVPGLRQ+ S+G LVFPPFRAEDYRQEVHAQVYACLA+NQF
Sbjct  64    SGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQF  123

Query  118   GSIISRDVNVRAVVHQFYQSEVNNEYVIRGNSAVLRCSIPSFVGDYVTVLSWQDENGNLY  177
             GSIISRDV+VRAVV QFY+SEVNNEYVIRGN+AVL+CSIPSFV D+V V+SWQDE G LY
Sbjct  124   GSIISRDVHVRAVVQQFYESEVNNEYVIRGNAAVLKCSIPSFVADFVQVVSWQDEEGQLY  183

Query  178   GSLDDNSKDNFDGKYLVLPSGELHIKEVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI  237
             GSL D  +   DGKYLVLPSGELHI+EVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI
Sbjct  184   GSLGD--QQGTDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI  241

Query  238   TEPVGSVAPKVNVADKGHISSARTGHTTDILCPAQGYPMPAFRWYKFIEGTTRKQAVVLN  297
             TEPVG+ AP  +   K          +  +LC AQ +P+P  RWYKFIEGTTRKQAVVLN
Sbjct  242   TEPVGAKAPTFSGESKSFTFVKEISTSFALLCQAQAFPVPIIRWYKFIEGTTRKQAVVLN  301

Query  298   DRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPSQVVDFG  357
             DRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPP+Q VDFG
Sbjct  302   DRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFG  361

Query  358   RPAVFTCHFSGNPIKTVSWLKDGKKIGHTDAILRIESVKKEHKGMYQCFIRNDQESAEAS  417
             RPAVFTC ++GNPIKTVSW+KDGK IGH++ +LRIESVKKE KGMYQCF+RNDQESAEAS
Sbjct  362   RPAVFTCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEAS  421

Query  418   AELKLGGRFDPPIIRQAFPEETLHPGPSVFLKCVAGGLPTPEISWELDGKKIANSERYQV  477
             AELKLGGRFDPP+IRQAF EET+ PGPSVFLKCVAGG PTPEISWELDGKKIAN++RYQV
Sbjct  422   AELKLGGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQV  481

Query  478   GQYVTVNGDVVSYLNITSIHANDGGLYKCIASSKVGVAEHSAKLNVYGLPYIRPMEKKAI  537
             GQYVTVNGDVVSYLNITS+HANDGGLYKCIA SKVGVAEHSAKLNVYGLPYIR MEKKAI
Sbjct  482   GQYVTVNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKAI  541

Query  538   VAGENLIVTCPVAGYPIESIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCV  597
             VAGE LIVTCPVAGYPI+SIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCV
Sbjct  542   VAGETLIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCV  601

Query  598   AKNSEGYSARGALEVQVMVPPTILPFTFGDEVVNAGDIVAVQCMVLKGDLPISIFWMHNN  657
             AKN EGYSARG+LEVQVMVPP I  F FG E  N G++    CMV KGDLP+ I W  N+
Sbjct  602   AKNQEGYSARGSLEVQVMVPPQIQAFDFGSEAANTGEMAGGFCMVPKGDLPMEIRWTLNS  661

Query  658   ASI-KELPDVNIIKTSSRISTLNIESVNANHRGTFHCIASNSAGRSDQAAELNVNVPPRW  716
             A I       ++ + + R S+L+I+S+ A HRG + CIASN AG ++ +AEL+VNVPPRW
Sbjct  662   APIITGEHGFSLSRLNPRTSSLSIDSLEARHRGLYRCIASNKAGSAEYSAELHVNVPPRW  721

Query  717   ILEPTDKAFAQGSDAKVECKSDGFPKPQVTWKKAVGDTPGEYKDMKQSNNIRVDEGTLYI  776
             ILEPTDKAFAQGSDAKVECK+DGFPKPQVTWKKAVGDTPGEYKD+K+S+NIRV+EGTL++
Sbjct  722   ILEPTDKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHV  781

Query  777   DNIQKNNEGYYLCEAINGIGSGLSAVILISVQAPPEFVEKLRNQTARRSEPAVLQCEAKG  836
             DNIQK NEGYYLCEAINGIGSGLSAVI+ISVQAPPEF EKLRNQTARR EPAVLQCEAKG
Sbjct  782   DNIQKTNEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKG  841

Query  837   EKPIGILWNMNNMRLDPKTDNRYTIREEILSTGVMSSLSIKRTERTDSALFTCVATNAFG  896
             EKPIGILWNMNNMRLDPK DNRYTIREEILSTGVMSSLSIKRTER+DSALFTCVATNAFG
Sbjct  842   EKPIGILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAFG  901

Query  897   SDDASINMIIQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLKRYIIEFKTSRGSWEH  956
             SDDASINMI+QEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPL RYIIEFK SR SW  
Sbjct  902   SDDASINMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWS-  960

Query  957   DVDRVIVPGHTNEAQVQKLNPATTYNIRIVAENEIGVSDSSEVVPIITAEEAPSGKPQSI  1016
             ++DRVIVPGHT EAQVQKL+PATTYNIRIVAEN IG S SSE V IITAEEAPSGKPQ+I
Sbjct  961   EIDRVIVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNI  1020

Query  1017  KVEPLSQTSLRVLWKAPPRSDWNGEILGYYVGYKLTNNNGSYYFEDYKYMMEEGKEYSYE  1076
             KVEP++QT++RV WK PPR++WNGEILGYYVGYKL+N N SY FE   ++ EEGKE++ E
Sbjct  1021  KVEPVNQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLE  1080

Query  1077  LTNLKTYTQYSVVIQAYNKVGAGPLSEDEKQYTAEGTPDQPPSDITCTTLTSQTIRVSWV  1136
             L NL+ YTQYSVVIQA+NK+GAGPLSE+EKQ+TAEGTP QPPSD  CTTLTSQTIRV WV
Sbjct  1081  LQNLRVYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWV  1140

Query  1137  SPPLESANGVIKGYKVVYAPSELWYDDKNKDYKKTASSDTVLHGLKKYTNYTMQVLATTS  1196
             SPPLESANGVIK YKVVYAPS+ WYD+  + YKKTASSDTVLHGLKKYTNYTMQVLATT+
Sbjct  1141  SPPLESANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTA  1200

Query  1197  GGDGVRSPPIHCQTEQDVPEAPTAVKALVVGSEAILVSWLPPAQPNGLITQYTVYSKEEG  1256
             GGDGVRS PIHCQTE DVPEAPT VKALV+G+ AILVSW PPAQPNG+ITQYTVYSK EG
Sbjct  1201  GGDGVRSVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEG  1260

Query  1257  TESEVKSHKVPPYQMSYEASSLDKNKPFEFWVTANTNIGEGQASKSIVAMPSDKVPAKIA  1316
              E+E K+ KVP YQMS+EA+ L+KNKP+EFWVTA+T IGEGQ SKSIVAMPSD+VPAKIA
Sbjct  1261  AETETKTQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIA  1320

Query  1317  SFDDTFTAIFKEDFKLPCLAVGAPAPDITWKVKGVEFVPNDRVRQLPEGSLSIKDVIRQD  1376
             SFDDTFTA FKED K+PCLAVGAP P+ITWK+KGVEF  NDR+R LP+GSL IK V RQD
Sbjct  1321  SFDDTFTATFKEDAKMPCLAVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNRQD  1380

Query  1377  AGDYTCMAENSIAKDSITHKLIVLAPPQSPQVLLTATTTDSLTLKLKQHDGDTAPIHGYT  1436
             AGDY+C AENSIAKDSITHKLIVLAPPQSP V L+ATTTD+LT+KLK H+GDTAP+HGYT
Sbjct  1381  AGDYSCHAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGYT  1440

Query  1437  LHYKPEFGDWETVEVAVDAQKYTIENLFCGSRYQVYATGYNNIGAGEASDILNTRTKGSK  1496
             LHYKPEFG+WET EV+VD+QK+ IE L CGSRYQVYATG+NNIGAGEASDILNTRTKG K
Sbjct  1441  LHYKPEFGEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKGQK  1500

Query  1497  PMMPENSKFIDPSSNTVTLHLPTWKDGGCRMSHFVVEYKKKDHAEWTQISNNVKPGGNFV  1556
             P +PE  +FI+ SSN+V+LH   WKDGGC MSHFVVE KK+D  EW QISNNVKP  N+V
Sbjct  1501  PKLPEKPRFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKRDQIEWNQISNNVKPDNNYV  1560

Query  1557  VLDLDAASWYSVRITAHNSAGFTVAEYEFATLTVTGGTLAPPLNTAVLNGKTY----LPP  1612
             VLDL+ A+WY++RITAHNSAGFTVAEY+FATLTVTGGT+A PL+    +G  +    LP 
Sbjct  1561  VLDLEPATWYNLRITAHNSAGFTVAEYDFATLTVTGGTIA-PLDDGSGHGNVHTRIRLPA  1619

Query  1613  WMPQWFDLNFMVPLIATIIVVFVGVLVICVALSRRRMEDPRGGPKDVYYDVVYNQPMGPG  1672
             WMP+W DLNFMVPLIAT++VV VG+ V+CVALSRRR +D RGG KDVYYDVVYNQ MGPG
Sbjct  1620  WMPEWLDLNFMVPLIATVVVVAVGICVVCVALSRRRADDMRGGQKDVYYDVVYNQTMGPG  1679

Query  1673  ATMDKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRGTVISRSMRSNHSTWDPRR-  1731
             AT+DKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG      +RSNHSTWDPRR 
Sbjct  1680  ATLDKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG---RGGLRSNHSTWDPRRN  1736

Query  1732  -PLYEELKPPPVPRR-----HYHGSDECYHTHPHPHPAGMEDEICPYATFHLLGFREEMD  1785
               LYEELK PPVP       H HG+ EC++ HP     GMEDEICPYATFHLLGFREEMD
Sbjct  1737  PNLYEELKAPPVPMHGNHYGHAHGNAECHYRHP-----GMEDEICPYATFHLLGFREEMD  1791

Query  1786  PTKAMNFQTFPHQNGHTG--PGHA-TMGPGGPPGHIHSRSGSQSMPRQNRYARKNSQGGQ  1842
             PTKAMNFQTFPHQNGH G  PGHA TM P G PGH+HSRSGSQSMPR NRY RKNSQGGQ
Sbjct  1792  PTKAMNFQTFPHQNGHAGPVPGHAGTMLPPGHPGHVHSRSGSQSMPRANRYQRKNSQGGQ  1851

Query  1843  SSIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYGGPGPEYDDPANCAPEDDQYGSQY  1902
             SSIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLY GPGPEYDDPANCAPE+DQYGSQY
Sbjct  1852  SSIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYSGPGPEYDDPANCAPEEDQYGSQY  1911

Query  1903  GAPYG--YDHYGSRGSVGRRSVGSARNLPNGSPEPPPPPPRNHDTSNSSFNDSKESNEIS  1960
             G PYG  YDHYGSRGS+GRRS+GSARN  NGSPEPPPPPPRNHD SNSSFNDSKESNEIS
Sbjct  1912  GGPYGQPYDHYGSRGSMGRRSIGSARNPGNGSPEPPPPPPRNHDMSNSSFNDSKESNEIS  1971

Query  1961  EAECDRDH-PRGNYGENENSGDAKRSANTKDVRTTEEMRKLIDSRKSNEVAAKLQQQGGP  2019
             EAECDRDH PRGNYG        KRS   KD RTTEEMRKLI+  ++     +LQQ  G 
Sbjct  1972  EAECDRDHGPRGNYGA------VKRSPQPKDQRTTEEMRKLIERNETGPKQLQLQQANG-  2024

Query  2020  AGLTAYDTLAV  2030
             AG TAYDT+AV
Sbjct  2025  AGFTAYDTMAV  2035


>Q0E9L2_DROME unnamed protein product
Length=2034

 Score = 3293 bits (8539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1622/2051 (79%), Positives = 1786/2051 (87%), Gaps = 45/2051 (2%)

Query  3     QRTKWITKIIFIAV-LVDLGS---TANT-EADTKGPMFLKEPINRIDFSNSTGSVVECRA  57
             +R KW+  ++F AV L+  GS    AN  +AD KGP+FLKEP NRIDFSNSTG+ +EC+A
Sbjct  6     ERLKWL--MLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAEIECKA  63

Query  58    SGNPAPEIIWVRSDGTAVGDVPGLRQVLSNGNLVFPPFRAEDYRQEVHAQVYACLAKNQF  117
             SGNP PEIIW+RSDGTAVGDVPGLRQ+ S+G LVFPPFRAEDYRQEVHAQVYACLA+NQF
Sbjct  64    SGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQF  123

Query  118   GSIISRDVNVRAVVHQFYQSEVNNEYVIRGNSAVLRCSIPSFVGDYVTVLSWQDENG-NL  176
             GSIISRDV+VRAVV QFY +E  NEYVI+GN+AV++C IPSFV D+V V +W DE G  L
Sbjct  124   GSIISRDVHVRAVVSQFYITEAENEYVIKGNAAVVKCKIPSFVADFVQVEAWVDEEGMEL  183

Query  177   YGSLDDNSKDNFDGKYLVLPSGELHIKEVGPEDGYKSYQCRTKHRLTGETRLSATKGRLV  236
             +    +N+ D +DGKYLVLPSGELHI+EVGPEDGYKSYQCRTKHRLTGETRLSATKGRLV
Sbjct  184   W---RNNATDAYDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLV  240

Query  237   ITEPVGSVAPKVNVADKGHISSARTGHTTDILCPAQGYPMPAFRWYKFIEGTTRKQAVVL  296
             ITEPVGSVAPKV++ DK   +   +  + ++ C AQG+PMPAFRWYKFIEGTTRKQAVVL
Sbjct  241   ITEPVGSVAPKVDMHDKMDFTIRSSNRSLNLFCKAQGFPMPAFRWYKFIEGTTRKQAVVL  300

Query  297   NDRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPSQVVDF  356
             NDRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPP+Q VDF
Sbjct  301   NDRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDF  360

Query  357   GRPAVFTCHFSGNPIKTVSWLKDGKKIGHTDAILRIESVKKEHKGMYQCFIRNDQESAEA  416
             GRPAVFTC ++GNPIKTVSW+KDGK IGH++ +LRIESVKKE KGMYQCF+RNDQESAEA
Sbjct  361   GRPAVFTCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEA  420

Query  417   SAELKLGGRFDPPIIRQAFPEETLHPGPSVFLKCVAGGLPTPEISWELDGKKIANSERYQ  476
             SAELKLGGRFDPP+IRQAF EET+ PGPSVFLKCVAGG PTPEISWELDGKKIAN++RYQ
Sbjct  421   SAELKLGGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQ  480

Query  477   VGQYVTVNGDVVSYLNITSIHANDGGLYKCIASSKVGVAEHSAKLNVYGLPYIRPMEKKA  536
             VGQYVTVNGDVVSYLNITS+HANDGGLYKCIA SKVGVAEHSAKLNVYGLPYIR MEKKA
Sbjct  481   VGQYVTVNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKA  540

Query  537   IVAGENLIVTCPVAGYPIESIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTC  596
             IVAGE LIVTCPVAGYPI+SIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTC
Sbjct  541   IVAGETLIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTC  600

Query  597   VAKNSEGYSARGALEVQVMVPPTILPFTFGDEVVNAGDIVAVQCMVLKGDLPISIFWMHN  656
             VAKN EGYSARG+LEVQVM  P I PF FG+E ++ G+ V VQC +  GDLP++I W  N
Sbjct  601   VAKNQEGYSARGSLEVQVMALPKISPFNFGEESMSYGEFVNVQCTISGGDLPVNITWTLN  660

Query  657   NASIKELPDVNIIKTSSRISTLNIESVNANHRGTFHCIASNSAGRSDQAAELNVNVPPRW  716
             N   ++  ++   K   RI+ L IE+V+A H G + CIA N AG ++  AEL VNVPPRW
Sbjct  661   NKPFEDYLEILTTKRGKRINELTIEAVSAKHAGNYSCIAENKAGVANHTAELKVNVPPRW  720

Query  717   ILEPTDKAFAQGSDAKVECKSDGFPKPQVTWKKAVGDTPGEYKDMKQSNNIRVDEGTLYI  776
             ILEPTDKAFAQGSDAKVECK+DGFPKPQVTWKKAVGDTPGEYKD+K+S+NIRV+EGTL++
Sbjct  721   ILEPTDKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHV  780

Query  777   DNIQKNNEGYYLCEAINGIGSGLSAVILISVQAPPEFVEKLRNQTARRSEPAVLQCEAKG  836
             DNIQK NEGYYLCEAINGIGSGLSAVI+ISVQAPPEF EKLRNQTARR EPAVLQCEAKG
Sbjct  781   DNIQKTNEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKG  840

Query  837   EKPIGILWNMNNMRLDPKTDNRYTIREEILSTGVMSSLSIKRTERTDSALFTCVATNAFG  896
             EKPIGILWNMNNMRLDPK DNRYTIREEILSTGVMSSLSIKRTER+DSALFTCVATNAFG
Sbjct  841   EKPIGILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAFG  900

Query  897   SDDASINMIIQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLKRYIIEFKTSRGSWEH  956
             SDDASINMI+QEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPL RYIIEFK SR SW  
Sbjct  901   SDDASINMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWS-  959

Query  957   DVDRVIVPGHTNEAQVQKLNPATTYNIRIVAENEIGVSDSSEVVPIITAEEAPSGKPQSI  1016
             ++DRVIVPGHT EAQVQKL+PATTYNIRIVAEN IG S SSE V IITAEEAPSGKPQ+I
Sbjct  960   EIDRVIVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNI  1019

Query  1017  KVEPLSQTSLRVLWKAPPRSDWNGEILGYYVGYKLTNNNGSYYFEDYKYMMEEGKEYSYE  1076
             KVEP++QT++RV WK PPR++WNGEILGYYVGYKL+N N SY FE   ++ EEGKE++ E
Sbjct  1020  KVEPVNQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLE  1079

Query  1077  LTNLKTYTQYSVVIQAYNKVGAGPLSEDEKQYTAEGTPDQPPSDITCTTLTSQTIRVSWV  1136
             L NL+ YTQYSVVIQA+NK+GAGPLSE+EKQ+TAEGTP QPPSD  CTTLTSQTIRV WV
Sbjct  1080  LQNLRVYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWV  1139

Query  1137  SPPLESANGVIKGYKVVYAPSELWYDDKNKDYKKTASSDTVLHGLKKYTNYTMQVLATTS  1196
             SPPLESANGVIK YKVVYAPS+ WYD+  + YKKTASSDTVLHGLKKYTNYTMQVLATT+
Sbjct  1140  SPPLESANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTA  1199

Query  1197  GGDGVRSPPIHCQTEQDVPEAPTAVKALVVGSEAILVSWLPPAQPNGLITQYTVYSKEEG  1256
             GGDGVRS PIHCQTE DVPEAPT VKALV+G+ AILVSW PPAQPNG+ITQYTVYSK EG
Sbjct  1200  GGDGVRSVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEG  1259

Query  1257  TESEVKSHKVPPYQMSYEASSLDKNKPFEFWVTANTNIGEGQASKSIVAMPSDKVPAKIA  1316
              E+E K+ KVP YQMS+EA+ L+KNKP+EFWVTA+T IGEGQ SKSIVAMPSD+VPAKIA
Sbjct  1260  AETETKTQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIA  1319

Query  1317  SFDDTFTAIFKEDFKLPCLAVGAPAPDITWKVKGVEFVPNDRVRQLPEGSLSIKDVIRQD  1376
             SFDDTFTA FKED K+PCLAVGAP P+ITWK+KGVEF  NDR+R LP+GSL IK V RQD
Sbjct  1320  SFDDTFTATFKEDAKMPCLAVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNRQD  1379

Query  1377  AGDYTCMAENSIAKDSITHKLIVLAPPQSPQVLLTATTTDSLTLKLKQHDGDTAPIHGYT  1436
             AGDY+C AENSIAKDSITHKLIVLAPPQSP V L+ATTTD+LT+KLK H+GDTAP+HGYT
Sbjct  1380  AGDYSCHAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGYT  1439

Query  1437  LHYKPEFGDWETVEVAVDAQKYTIENLFCGSRYQVYATGYNNIGAGEASDILNTRTKGSK  1496
             LHYKPEFG+WET EV+VD+QK+ IE L CGSRYQVYATG+NNIGAGEASDILNTRTKG K
Sbjct  1440  LHYKPEFGEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKGQK  1499

Query  1497  PMMPENSKFIDPSSNTVTLHLPTWKDGGCRMSHFVVEYKKKDHAEWTQISNNVKPGGNFV  1556
             P +PE  +FI+ SSN+V+LH   WKDGGC MSHFVVE KK+D  EW QISNNVKP  N+V
Sbjct  1500  PKLPEKPRFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKRDQIEWNQISNNVKPDNNYV  1559

Query  1557  VLDLDAASWYSVRITAHNSAGFTVAEYEFATLTVTGGTLAPPLNTAVLNGKTY----LPP  1612
             VLDL+ A+WY++RITAHNSAGFTVAEY+FATLTVTGGT+A PL+    +G  +    LP 
Sbjct  1560  VLDLEPATWYNLRITAHNSAGFTVAEYDFATLTVTGGTIA-PLDDGSGHGNVHTRIRLPA  1618

Query  1613  WMPQWFDLNFMVPLIATIIVVFVGVLVICVALSRRRMEDPRGGPKDVYYDVVYNQPMGPG  1672
             WMP+W DLNFMVPLIAT++VV VG+ V+CVALSRRR +D RGG KDVYYDVVYNQ MGPG
Sbjct  1619  WMPEWLDLNFMVPLIATVVVVAVGICVVCVALSRRRADDMRGGQKDVYYDVVYNQTMGPG  1678

Query  1673  ATMDKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRGTVISRSMRSNHSTWDPRR-  1731
             AT+DKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG      +RSNHSTWDPRR 
Sbjct  1679  ATLDKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG---RGGLRSNHSTWDPRRN  1735

Query  1732  -PLYEELKPPPVPRR-----HYHGSDECYHTHPHPHPAGMEDEICPYATFHLLGFREEMD  1785
               LYEELK PPVP       H HG+ EC++ HP     GMEDEICPYATFHLLGFREEMD
Sbjct  1736  PNLYEELKAPPVPMHGNHYGHAHGNAECHYRHP-----GMEDEICPYATFHLLGFREEMD  1790

Query  1786  PTKAMNFQTFPHQNGHTG--PGHA-TMGPGGPPGHIHSRSGSQSMPRQNRYARKNSQGGQ  1842
             PTKAMNFQTFPHQNGH G  PGHA TM P G PGH+HSRSGSQSMPR NRY RKNSQGGQ
Sbjct  1791  PTKAMNFQTFPHQNGHAGPVPGHAGTMLPPGHPGHVHSRSGSQSMPRANRYQRKNSQGGQ  1850

Query  1843  SSIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYGGPGPEYDDPANCAPEDDQYGSQY  1902
             SSIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLY GPGPEYDDPANCAPE+DQYGSQY
Sbjct  1851  SSIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYSGPGPEYDDPANCAPEEDQYGSQY  1910

Query  1903  GAPYG--YDHYGSRGSVGRRSVGSARNLPNGSPEPPPPPPRNHDTSNSSFNDSKESNEIS  1960
             G PYG  YDHYGSRGS+GRRS+GSARN  NGSPEPPPPPPRNHD SNSSFNDSKESNEIS
Sbjct  1911  GGPYGQPYDHYGSRGSMGRRSIGSARNPGNGSPEPPPPPPRNHDMSNSSFNDSKESNEIS  1970

Query  1961  EAECDRDH-PRGNYGENENSGDAKRSANTKDVRTTEEMRKLIDSRKSNEVAAKLQQQGGP  2019
             EAECDRDH PRGNYG        KRS   KD RTTEEMRKLI+  ++     +LQQ  G 
Sbjct  1971  EAECDRDHGPRGNYGA------VKRSPQPKDQRTTEEMRKLIERNETGPKQLQLQQANG-  2023

Query  2020  AGLTAYDTLAV  2030
             AG TAYDT+AV
Sbjct  2024  AGFTAYDTMAV  2034



Lambda      K        H
   0.314    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 27188552048


Query= XP_037024203.1 Down syndrome cell adhesion molecule-like protein
Dscam2 isoform X8 [Bradysia coprophila]

Length=2030
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q0E9J4_DROME  unnamed protein product                                 3319    0.0  
Q0E9J5_DROME  unnamed protein product                                 3317    0.0  
Q0E9L3_DROME  unnamed protein product                                 3314    0.0  


>Q0E9J4_DROME unnamed protein product
Length=2031

 Score = 3319 bits (8606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1631/2050 (80%), Positives = 1796/2050 (88%), Gaps = 46/2050 (2%)

Query  3     QRTKWITKIIFIAV-LVDLGS---TANT-EADTKGPMFLKEPINRIDFSNSTGSVVECRA  57
             +R KW+  ++F AV L+  GS    AN  +AD KGP+FLKEP NRIDFSNSTG+ +EC+A
Sbjct  6     ERLKWL--MLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAEIECKA  63

Query  58    SGNPAPEIIWVRSDGTAVGDVPGLRQVLSNGNLVFPPFRAEDYRQEVHAQVYACLAKNQF  117
             SGNP PEIIW+RSDGTAVGDVPGLRQ+ S+G LVFPPFRAEDYRQEVHAQVYACLA+NQF
Sbjct  64    SGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQF  123

Query  118   GSIISRDVNVRAVVHQFYQSEVNNEYVIRGNSAVLRCSIPSFVGDYVTVLSWQDENGNLY  177
             GSIISRDV+VRAVV+Q+Y++EV +EYVIRGN+AVL+C+IPSFV D++ V +W   +G  Y
Sbjct  124   GSIISRDVHVRAVVNQYYEAEVVSEYVIRGNTAVLKCTIPSFVADFLRVEAWVASDGTEY  183

Query  178   GSLDDNSKDNFDGKYLVLPSGELHIKEVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI  237
                +D     FDGKYLVLPSGELHI+EVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI
Sbjct  184   APEED-----FDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI  238

Query  238   TEPVGSVAPKVNVADKGHISSARTGHTTDILCPAQGYPMPAFRWYKFIEGTTRKQAVVLN  297
             TEPVGSV PK++V ++   + A +  T  + CPAQ YP+P+FRWYKFIEGTTRKQAVVLN
Sbjct  239   TEPVGSVGPKISVGERLRDAGAPSKSTLTLFCPAQSYPVPSFRWYKFIEGTTRKQAVVLN  298

Query  298   DRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPSQVVDFG  357
             DRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPP+Q VDFG
Sbjct  299   DRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFG  358

Query  358   RPAVFTCHFSGNPIKTVSWLKDGKKIGHTDAILRIESVKKEHKGMYQCFIRNDQESAEAS  417
             RPAVFTC ++GNPIKTVSW+KDGK IGH++ +LRIESVKKE KGMYQCF+RNDQESAEAS
Sbjct  359   RPAVFTCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEAS  418

Query  418   AELKLGGRFDPPIIRQAFPEETLHPGPSVFLKCVAGGLPTPEISWELDGKKIANSERYQV  477
             AELKLGGRFDPP+IRQAF EET+ PGPSVFLKCVAGG PTPEISWELDGKKIAN++RYQV
Sbjct  419   AELKLGGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQV  478

Query  478   GQYVTVNGDVVSYLNITSIHANDGGLYKCIASSKVGVAEHSAKLNVYGLPYIRPMEKKAI  537
             GQYVTVNGDVVSYLNITS+HANDGGLYKCIA SKVGVAEHSAKLNVYGLPYIR MEKKAI
Sbjct  479   GQYVTVNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKAI  538

Query  538   VAGENLIVTCPVAGYPIESIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCV  597
             VAGE LIVTCPVAGYPI+SIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCV
Sbjct  539   VAGETLIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCV  598

Query  598   AKNSEGYSARGALEVQVMVPPNIAHFDFGDEPSNYGDTASVSCIVTSGDSPITFKWLFNN  657
             AKN EGYSARG+LEVQVM PP I  F FG+EP+N  D+ SV+C++++GD PI  +W FN 
Sbjct  599   AKNQEGYSARGSLEVQVMAPPKITPFSFGEEPANVEDSVSVTCLISTGDLPIDIEWFFNE  658

Query  658   KPISEVSGISTVKLGKRNSAMTIDSVNGRHAGNFTCQAANSAATVNYTAVLIVNVPPRWI  717
               IS  SGIS +K GKRNS ++IDSV  RHAGN++C+A N AA VNYT  LIVNVPPRWI
Sbjct  659   YGISSYSGISVMKGGKRNSVLSIDSVQARHAGNYSCRAKNHAAAVNYTTDLIVNVPPRWI  718

Query  718   LEPTDKAFAQGSDAKVECKSDGFPKPQVTWKKAVGDTPGEYKDMKQSNNIRVDEGTLYID  777
             LEPTDKAFAQGSDAKVECK+DGFPKPQVTWKKAVGDTPGEYKD+K+S+NIRV+EGTL++D
Sbjct  719   LEPTDKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHVD  778

Query  778   NIQKNNEGYYLCEAINGIGSGLSAVILISVQAPPEFVEKLRNQTARRSEPAVLQCEAKGE  837
             NIQK NEGYYLCEAINGIGSGLSAVI+ISVQAPPEF EKLRNQTARR EPAVLQCEAKGE
Sbjct  779   NIQKTNEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKGE  838

Query  838   KPIGILWNMNNMRLDPKTDNRYTIREEILSTGVMSSLSIKRTERTDSALFTCVATNAFGS  897
             KPIGILWNMNNMRLDPK DNRYTIREEILSTGVMSSLSIKRTER+DSALFTCVATNAFGS
Sbjct  839   KPIGILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAFGS  898

Query  898   DDASINMIIQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLKRYIIEFKTSRGSWEHD  957
             DDASINMI+QEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPL RYIIEFK SR SW  +
Sbjct  899   DDASINMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWS-E  957

Query  958   VDRVIVPGHTNEAQVQKLNPATTYNIRIVAENEIGVSDSSEVVPIITAEEAPSGKPQSIK  1017
             +DRVIVPGHT EAQVQKL+PATTYNIRIVAEN IG S SSE V IITAEEAPSGKPQ+IK
Sbjct  958   IDRVIVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNIK  1017

Query  1018  VEPLSQTSLRVLWKAPPRSDWNGEILGYYVGYKLTNNNGSYYFEDYKYMMEEGKEYSYEL  1077
             VEP++QT++RV WK PPR++WNGEILGYYVGYKL+N N SY FE   ++ EEGKE++ EL
Sbjct  1018  VEPVNQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLEL  1077

Query  1078  TNLKTYTQYSVVIQAYNKVGAGPLSEDEKQYTAEGTPDQPPSDITCTTLTSQTIRVSWVS  1137
              NL+ YTQYSVVIQA+NK+GAGPLSE+EKQ+TAEGTP QPPSD  CTTLTSQTIRV WVS
Sbjct  1078  QNLRVYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWVS  1137

Query  1138  PPLESANGVIKGYKVVYAPSELWYDDKNKDYKKTASSDTVLHGLKKYTNYTMQVLATTSG  1197
             PPLESANGVIK YKVVYAPS+ WYD+  + YKKTASSDTVLHGLKKYTNYTMQVLATT+G
Sbjct  1138  PPLESANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTAG  1197

Query  1198  GDGVRSPPIHCQTEQDVPEAPTAVKALVVGSEAILVSWLPPAQPNGLITQYTVYSKEEGT  1257
             GDGVRS PIHCQTE DVPEAPT VKALV+G+ AILVSW PPAQPNG+ITQYTVYSK EG 
Sbjct  1198  GDGVRSVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEGA  1257

Query  1258  ESEVKSHKVPPYQMSYEASSLDKNKPFEFWVTANTNIGEGQASKSIVAMPSDKVPAKIAS  1317
             E+E K+ KVP YQMS+EA+ L+KNKP+EFWVTA+T IGEGQ SKSIVAMPSD+VPAKIAS
Sbjct  1258  ETETKTQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIAS  1317

Query  1318  FDDTFTAIFKEDFKLPCLAVGAPAPDITWKVKGVEFVPNDRVRQLPEGSLSIKDVIRQDA  1377
             FDDTFTA FKED K+PCLAVGAP P+ITWK+KGVEF  NDR+R LP+GSL IK V RQDA
Sbjct  1318  FDDTFTATFKEDAKMPCLAVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNRQDA  1377

Query  1378  GDYTCMAENSIAKDSITHKLIVLAPPQSPQVLLTATTTDSLTLKLKQHDGDTAPIHGYTL  1437
             GDY+C AENSIAKDSITHKLIVLAPPQSP V L+ATTTD+LT+KLK H+GDTAP+HGYTL
Sbjct  1378  GDYSCHAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGYTL  1437

Query  1438  HYKPEFGDWETVEVAVDAQKYTIENLFCGSRYQVYATGYNNIGAGEASDILNTRTKGSKP  1497
             HYKPEFG+WET EV+VD+QK+ IE L CGSRYQVYATG+NNIGAGEASDILNTRTKG KP
Sbjct  1438  HYKPEFGEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKGQKP  1497

Query  1498  MMPENSKFIDPSSNTVTLHLPTWKDGGCRMSHFVVEYKKKDHAEWTQISNNVKPGGNFVV  1557
              +PE  +FI+ SSN+V+LH   WKDGGC MSHFVVE KK+D  EW QISNNVKP  N+VV
Sbjct  1498  KLPEKPRFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKRDQIEWNQISNNVKPDNNYVV  1557

Query  1558  LDLDAASWYSVRITAHNSAGFTVAEYEFATLTVTGGTLAPPLNTAVLNGKTY----LPPW  1613
             LDL+ A+WY++RITAHNSAGFTVAEY+FATLTVTGGT+A PL+    +G  +    LP W
Sbjct  1558  LDLEPATWYNLRITAHNSAGFTVAEYDFATLTVTGGTIA-PLDDGSGHGNVHTRIRLPAW  1616

Query  1614  MPQWFDLNFMVPLIATIIVVFVGVLVICVALSRRRMEDPRGGPKDVYYDVVYNQPMGPGA  1673
             MP+W DLNFMVPLIAT++VV VG+ V+CVALSRRR +D RGG KDVYYDVVYNQ MGPGA
Sbjct  1617  MPEWLDLNFMVPLIATVVVVAVGICVVCVALSRRRADDMRGGQKDVYYDVVYNQTMGPGA  1676

Query  1674  TMDKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRGTVISRSMRSNHSTWDPRR--  1731
             T+DKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG      +RSNHSTWDPRR  
Sbjct  1677  TLDKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG---RGGLRSNHSTWDPRRNP  1733

Query  1732  PLYEELKPPPVPRR-----HYHGSDECYHTHPHPHPAGMEDEICPYATFHLLGFREEMDP  1786
              LYEELK PPVP       H HG+ EC++ HP     GMEDEICPYATFHLLGFREEMDP
Sbjct  1734  NLYEELKAPPVPMHGNHYGHAHGNAECHYRHP-----GMEDEICPYATFHLLGFREEMDP  1788

Query  1787  TKAMNFQTFPHQNGHTG--PGHA-TMGPGGPPGHIHSRSGSQSMPRQNRYARKNSQGGQS  1843
             TKAMNFQTFPHQNGH G  PGHA TM P G PGH+HSRSGSQSMPR NRY RKNSQGGQS
Sbjct  1789  TKAMNFQTFPHQNGHAGPVPGHAGTMLPPGHPGHVHSRSGSQSMPRANRYQRKNSQGGQS  1848

Query  1844  SIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYGGPGPEYDDPANCAPEDDQYGSQYG  1903
             SIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLY GPGPEYDDPANCAPE+DQYGSQYG
Sbjct  1849  SIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYSGPGPEYDDPANCAPEEDQYGSQYG  1908

Query  1904  APYG--YDHYGSRGSVGRRSVGSARNLPNGSPEPPPPPPRNHDTSNSSFNDSKESNEISE  1961
              PYG  YDHYGSRGS+GRRS+GSARN  NGSPEPPPPPPRNHD SNSSFNDSKESNEISE
Sbjct  1909  GPYGQPYDHYGSRGSMGRRSIGSARNPGNGSPEPPPPPPRNHDMSNSSFNDSKESNEISE  1968

Query  1962  AECDRDH-PRGNYGENENSGDAKRSANTKDVRTTEEMRKLIDSRKSNEVAAKLQQQGGPA  2020
             AECDRDH PRGNYG        KRS   KD RTTEEMRKLI+  ++     +LQQ  G A
Sbjct  1969  AECDRDHGPRGNYGA------VKRSPQPKDQRTTEEMRKLIERNETGPKQLQLQQANG-A  2021

Query  2021  GLTAYDTLAV  2030
             G TAYDT+AV
Sbjct  2022  GFTAYDTMAV  2031


>Q0E9J5_DROME unnamed protein product
Length=2031

 Score = 3317 bits (8601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1632/2050 (80%), Positives = 1797/2050 (88%), Gaps = 46/2050 (2%)

Query  3     QRTKWITKIIFIAV-LVDLGS---TANT-EADTKGPMFLKEPINRIDFSNSTGSVVECRA  57
             +R KW+  ++F AV L+  GS    AN  +AD KGP+FLKEP NRIDFSNSTG+ +EC+A
Sbjct  6     ERLKWL--MLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAEIECKA  63

Query  58    SGNPAPEIIWVRSDGTAVGDVPGLRQVLSNGNLVFPPFRAEDYRQEVHAQVYACLAKNQF  117
             SGNP PEIIW+RSDGTAVGDVPGLRQ+ S+G LVFPPFRAEDYRQEVHAQVYACLA+NQF
Sbjct  64    SGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQF  123

Query  118   GSIISRDVNVRAVVHQFYQSEVNNEYVIRGNSAVLRCSIPSFVGDYVTVLSWQDENGNLY  177
             GSIISRDV+VRAVV+QFY +++  EYVIRGN+AVL+CSIPSFV D+V V SW DE G   
Sbjct  124   GSIISRDVHVRAVVNQFYGADILMEYVIRGNAAVLKCSIPSFVADFVRVESWIDEEGT--  181

Query  178   GSLDDNSKDNFDGKYLVLPSGELHIKEVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI  237
                +    +N+DGKYLVLPSGELHI+EVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI
Sbjct  182   ---ELRPSENYDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI  238

Query  238   TEPVGSVAPKVNVADKGHISSARTGHTTDILCPAQGYPMPAFRWYKFIEGTTRKQAVVLN  297
             TEPVGSVAPKV++ DK   +   +  + ++ C AQG+PMPAFRWYKFIEGTTRKQAVVLN
Sbjct  239   TEPVGSVAPKVDMHDKMDFTIRSSNRSLNLFCKAQGFPMPAFRWYKFIEGTTRKQAVVLN  298

Query  298   DRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPSQVVDFG  357
             DRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPP+Q VDFG
Sbjct  299   DRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFG  358

Query  358   RPAVFTCHFSGNPIKTVSWLKDGKKIGHTDAILRIESVKKEHKGMYQCFIRNDQESAEAS  417
             RPAVFTC ++GNPIKTVSW+KDGK IGH++ +LRIESVKKE KGMYQCF+RNDQESAEAS
Sbjct  359   RPAVFTCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEAS  418

Query  418   AELKLGGRFDPPIIRQAFPEETLHPGPSVFLKCVAGGLPTPEISWELDGKKIANSERYQV  477
             AELKLGGRFDPP+IRQAF EET+ PGPSVFLKCVAGG PTPEISWELDGKKIAN++RYQV
Sbjct  419   AELKLGGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQV  478

Query  478   GQYVTVNGDVVSYLNITSIHANDGGLYKCIASSKVGVAEHSAKLNVYGLPYIRPMEKKAI  537
             GQYVTVNGDVVSYLNITS+HANDGGLYKCIA SKVGVAEHSAKLNVYGLPYIR MEKKAI
Sbjct  479   GQYVTVNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKAI  538

Query  538   VAGENLIVTCPVAGYPIESIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCV  597
             VAGE LIVTCPVAGYPI+SIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCV
Sbjct  539   VAGETLIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCV  598

Query  598   AKNSEGYSARGALEVQVMVPPNIAHFDFGDEPSNYGDTASVSCIVTSGDSPITFKWLFNN  657
             AKN EGYSARG+LEVQVM PP IA FDFG   S++ D+ SV+C+VTSGD PI  +WLF  
Sbjct  599   AKNQEGYSARGSLEVQVMAPPKIAPFDFGQSASSFEDSVSVNCLVTSGDLPIDIEWLFGG  658

Query  658   KPISEVSGISTVKLGKRNSAMTIDSVNGRHAGNFTCQAANSAATVNYTAVLIVNVPPRWI  717
             +PI+  +GI+ ++ GKR S +TIDSV+  HAGN+TC+A N A++  Y+A LIVNVPPRWI
Sbjct  659   EPINFATGIAILRGGKRTSLLTIDSVHAGHAGNYTCKAKNQASSSEYSAALIVNVPPRWI  718

Query  718   LEPTDKAFAQGSDAKVECKSDGFPKPQVTWKKAVGDTPGEYKDMKQSNNIRVDEGTLYID  777
             LEPTDKAFAQGSDAKVECK+DGFPKPQVTWKKAVGDTPGEYKD+K+S+NIRV+EGTL++D
Sbjct  719   LEPTDKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHVD  778

Query  778   NIQKNNEGYYLCEAINGIGSGLSAVILISVQAPPEFVEKLRNQTARRSEPAVLQCEAKGE  837
             NIQK NEGYYLCEAINGIGSGLSAVI+ISVQAPPEF EKLRNQTARR EPAVLQCEAKGE
Sbjct  779   NIQKTNEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKGE  838

Query  838   KPIGILWNMNNMRLDPKTDNRYTIREEILSTGVMSSLSIKRTERTDSALFTCVATNAFGS  897
             KPIGILWNMNNMRLDPK DNRYTIREEILSTGVMSSLSIKRTER+DSALFTCVATNAFGS
Sbjct  839   KPIGILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAFGS  898

Query  898   DDASINMIIQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLKRYIIEFKTSRGSWEHD  957
             DDASINMI+QEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPL RYIIEFK SR SW  +
Sbjct  899   DDASINMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWS-E  957

Query  958   VDRVIVPGHTNEAQVQKLNPATTYNIRIVAENEIGVSDSSEVVPIITAEEAPSGKPQSIK  1017
             +DRVIVPGHT EAQVQKL+PATTYNIRIVAEN IG S SSE V IITAEEAPSGKPQ+IK
Sbjct  958   IDRVIVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNIK  1017

Query  1018  VEPLSQTSLRVLWKAPPRSDWNGEILGYYVGYKLTNNNGSYYFEDYKYMMEEGKEYSYEL  1077
             VEP++QT++RV WK PPR++WNGEILGYYVGYKL+N N SY FE   ++ EEGKE++ EL
Sbjct  1018  VEPVNQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLEL  1077

Query  1078  TNLKTYTQYSVVIQAYNKVGAGPLSEDEKQYTAEGTPDQPPSDITCTTLTSQTIRVSWVS  1137
              NL+ YTQYSVVIQA+NK+GAGPLSE+EKQ+TAEGTP QPPSD  CTTLTSQTIRV WVS
Sbjct  1078  QNLRVYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWVS  1137

Query  1138  PPLESANGVIKGYKVVYAPSELWYDDKNKDYKKTASSDTVLHGLKKYTNYTMQVLATTSG  1197
             PPLESANGVIK YKVVYAPS+ WYD+  + YKKTASSDTVLHGLKKYTNYTMQVLATT+G
Sbjct  1138  PPLESANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTAG  1197

Query  1198  GDGVRSPPIHCQTEQDVPEAPTAVKALVVGSEAILVSWLPPAQPNGLITQYTVYSKEEGT  1257
             GDGVRS PIHCQTE DVPEAPT VKALV+G+ AILVSW PPAQPNG+ITQYTVYSK EG 
Sbjct  1198  GDGVRSVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEGA  1257

Query  1258  ESEVKSHKVPPYQMSYEASSLDKNKPFEFWVTANTNIGEGQASKSIVAMPSDKVPAKIAS  1317
             E+E K+ KVP YQMS+EA+ L+KNKP+EFWVTA+T IGEGQ SKSIVAMPSD+VPAKIAS
Sbjct  1258  ETETKTQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIAS  1317

Query  1318  FDDTFTAIFKEDFKLPCLAVGAPAPDITWKVKGVEFVPNDRVRQLPEGSLSIKDVIRQDA  1377
             FDDTFTA FKED K+PCLAVGAP P+ITWK+KGVEF  NDR+R LP+GSL IK V RQDA
Sbjct  1318  FDDTFTATFKEDAKMPCLAVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNRQDA  1377

Query  1378  GDYTCMAENSIAKDSITHKLIVLAPPQSPQVLLTATTTDSLTLKLKQHDGDTAPIHGYTL  1437
             GDY+C AENSIAKDSITHKLIVLAPPQSP V L+ATTTD+LT+KLK H+GDTAP+HGYTL
Sbjct  1378  GDYSCHAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGYTL  1437

Query  1438  HYKPEFGDWETVEVAVDAQKYTIENLFCGSRYQVYATGYNNIGAGEASDILNTRTKGSKP  1497
             HYKPEFG+WET EV+VD+QK+ IE L CGSRYQVYATG+NNIGAGEASDILNTRTKG KP
Sbjct  1438  HYKPEFGEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKGQKP  1497

Query  1498  MMPENSKFIDPSSNTVTLHLPTWKDGGCRMSHFVVEYKKKDHAEWTQISNNVKPGGNFVV  1557
              +PE  +FI+ SSN+V+LH   WKDGGC MSHFVVE KK+D  EW QISNNVKP  N+VV
Sbjct  1498  KLPEKPRFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKRDQIEWNQISNNVKPDNNYVV  1557

Query  1558  LDLDAASWYSVRITAHNSAGFTVAEYEFATLTVTGGTLAPPLNTAVLNGKTY----LPPW  1613
             LDL+ A+WY++RITAHNSAGFTVAEY+FATLTVTGGT+A PL+    +G  +    LP W
Sbjct  1558  LDLEPATWYNLRITAHNSAGFTVAEYDFATLTVTGGTIA-PLDDGSGHGNVHTRIRLPAW  1616

Query  1614  MPQWFDLNFMVPLIATIIVVFVGVLVICVALSRRRMEDPRGGPKDVYYDVVYNQPMGPGA  1673
             MP+W DLNFMVPLIAT++VV VG+ V+CVALSRRR +D RGG KDVYYDVVYNQ MGPGA
Sbjct  1617  MPEWLDLNFMVPLIATVVVVAVGICVVCVALSRRRADDMRGGQKDVYYDVVYNQTMGPGA  1676

Query  1674  TMDKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRGTVISRSMRSNHSTWDPRR--  1731
             T+DKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG      +RSNHSTWDPRR  
Sbjct  1677  TLDKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG---RGGLRSNHSTWDPRRNP  1733

Query  1732  PLYEELKPPPVPRR-----HYHGSDECYHTHPHPHPAGMEDEICPYATFHLLGFREEMDP  1786
              LYEELK PPVP       H HG+ EC++ HP     GMEDEICPYATFHLLGFREEMDP
Sbjct  1734  NLYEELKAPPVPMHGNHYGHAHGNAECHYRHP-----GMEDEICPYATFHLLGFREEMDP  1788

Query  1787  TKAMNFQTFPHQNGHTG--PGHA-TMGPGGPPGHIHSRSGSQSMPRQNRYARKNSQGGQS  1843
             TKAMNFQTFPHQNGH G  PGHA TM P G PGH+HSRSGSQSMPR NRY RKNSQGGQS
Sbjct  1789  TKAMNFQTFPHQNGHAGPVPGHAGTMLPPGHPGHVHSRSGSQSMPRANRYQRKNSQGGQS  1848

Query  1844  SIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYGGPGPEYDDPANCAPEDDQYGSQYG  1903
             SIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLY GPGPEYDDPANCAPE+DQYGSQYG
Sbjct  1849  SIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYSGPGPEYDDPANCAPEEDQYGSQYG  1908

Query  1904  APYG--YDHYGSRGSVGRRSVGSARNLPNGSPEPPPPPPRNHDTSNSSFNDSKESNEISE  1961
              PYG  YDHYGSRGS+GRRS+GSARN  NGSPEPPPPPPRNHD SNSSFNDSKESNEISE
Sbjct  1909  GPYGQPYDHYGSRGSMGRRSIGSARNPGNGSPEPPPPPPRNHDMSNSSFNDSKESNEISE  1968

Query  1962  AECDRDH-PRGNYGENENSGDAKRSANTKDVRTTEEMRKLIDSRKSNEVAAKLQQQGGPA  2020
             AECDRDH PRGNYG        KRS   KD RTTEEMRKLI+  ++     +LQQ  G A
Sbjct  1969  AECDRDHGPRGNYGA------VKRSPQPKDQRTTEEMRKLIERNETGPKQLQLQQANG-A  2021

Query  2021  GLTAYDTLAV  2030
             G TAYDT+AV
Sbjct  2022  GFTAYDTMAV  2031


>Q0E9L3_DROME unnamed protein product
Length=2034

 Score = 3314 bits (8593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1633/2051 (80%), Positives = 1791/2051 (87%), Gaps = 45/2051 (2%)

Query  3     QRTKWITKIIFIAV-LVDLGS---TANT-EADTKGPMFLKEPINRIDFSNSTGSVVECRA  57
             +R KW+  ++F AV L+  GS    AN  +AD KGP+FLKEP NRIDFSNSTG+ +EC+A
Sbjct  6     ERLKWL--MLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAEIECKA  63

Query  58    SGNPAPEIIWVRSDGTAVGDVPGLRQVLSNGNLVFPPFRAEDYRQEVHAQVYACLAKNQF  117
             SGNP PEIIW+RSDGTAVGDVPGLRQ+ S+G LVFPPFRAEDYRQEVHAQVYACLA+NQF
Sbjct  64    SGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQF  123

Query  118   GSIISRDVNVRAVVHQFYQSEVNNEYVIRGNSAVLRCSIPSFVGDYVTVLSWQDENG-NL  176
             GSIISRDV+VRAVV QFY +E  NEYVI+GN+AV++C IPSFV D+V V +W DE G  L
Sbjct  124   GSIISRDVHVRAVVSQFYITEAENEYVIKGNAAVVKCKIPSFVADFVQVEAWVDEEGMEL  183

Query  177   YGSLDDNSKDNFDGKYLVLPSGELHIKEVGPEDGYKSYQCRTKHRLTGETRLSATKGRLV  236
             +    +N+ D +DGKYLVLPSGELHI+EVGPEDGYKSYQCRTKHRLTGETRLSATKGRLV
Sbjct  184   W---RNNATDAYDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLV  240

Query  237   ITEPVGSVAPKVNVADKGHISSARTGHTTDILCPAQGYPMPAFRWYKFIEGTTRKQAVVL  296
             ITEP+ S  PKV    K  + +     T  +LCPAQGYP+P FRWYKFIEGTTRKQAVVL
Sbjct  241   ITEPISSAVPKVVSLAKFDMKTYSGSSTMALLCPAQGYPVPVFRWYKFIEGTTRKQAVVL  300

Query  297   NDRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPSQVVDF  356
             NDRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPP+Q VDF
Sbjct  301   NDRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDF  360

Query  357   GRPAVFTCHFSGNPIKTVSWLKDGKKIGHTDAILRIESVKKEHKGMYQCFIRNDQESAEA  416
             GRPAVFTC ++GNPIKTVSW+KDGK IGH++ +LRIESVKKE KGMYQCF+RNDQESAEA
Sbjct  361   GRPAVFTCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEA  420

Query  417   SAELKLGGRFDPPIIRQAFPEETLHPGPSVFLKCVAGGLPTPEISWELDGKKIANSERYQ  476
             SAELKLGGRFDPP+IRQAF EET+ PGPSVFLKCVAGG PTPEISWELDGKKIAN++RYQ
Sbjct  421   SAELKLGGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQ  480

Query  477   VGQYVTVNGDVVSYLNITSIHANDGGLYKCIASSKVGVAEHSAKLNVYGLPYIRPMEKKA  536
             VGQYVTVNGDVVSYLNITS+HANDGGLYKCIA SKVGVAEHSAKLNVYGLPYIR MEKKA
Sbjct  481   VGQYVTVNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKA  540

Query  537   IVAGENLIVTCPVAGYPIESIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTC  596
             IVAGE LIVTCPVAGYPI+SIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTC
Sbjct  541   IVAGETLIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTC  600

Query  597   VAKNSEGYSARGALEVQVMVPPNIAHFDFGDEPSNYGDTASVSCIVTSGDSPITFKWLFN  656
             VAKN EGYSARG+LEVQVMVPP I  FDFGD P+N  D+ SV C++++GD PI  +W FN
Sbjct  601   VAKNQEGYSARGSLEVQVMVPPKITPFDFGDAPTNVEDSVSVMCLISNGDLPIDIEWFFN  660

Query  657   NKPISEVSGISTVKLGKRNSAMTIDSVNGRHAGNFTCQAANSAATVNYTAVLIVNVPPRW  716
             +  IS  SGI+ VK GKRNS ++IDSV  RHAG ++C+A N AA VNYT  LIVNVPPRW
Sbjct  661   DYGISSYSGINVVKGGKRNSMLSIDSVQARHAGKYSCRAKNHAAAVNYTTELIVNVPPRW  720

Query  717   ILEPTDKAFAQGSDAKVECKSDGFPKPQVTWKKAVGDTPGEYKDMKQSNNIRVDEGTLYI  776
             ILEPTDKAFAQGSDAKVECK+DGFPKPQVTWKKAVGDTPGEYKD+K+S+NIRV+EGTL++
Sbjct  721   ILEPTDKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHV  780

Query  777   DNIQKNNEGYYLCEAINGIGSGLSAVILISVQAPPEFVEKLRNQTARRSEPAVLQCEAKG  836
             DNIQK NEGYYLCEAINGIGSGLSAVI+ISVQAPPEF EKLRNQTARR EPAVLQCEAKG
Sbjct  781   DNIQKTNEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKG  840

Query  837   EKPIGILWNMNNMRLDPKTDNRYTIREEILSTGVMSSLSIKRTERTDSALFTCVATNAFG  896
             EKPIGILWNMNNMRLDPK DNRYTIREEILSTGVMSSLSIKRTER+DSALFTCVATNAFG
Sbjct  841   EKPIGILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAFG  900

Query  897   SDDASINMIIQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLKRYIIEFKTSRGSWEH  956
             SDDASINMI+QEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPL RYIIEFK SR SW  
Sbjct  901   SDDASINMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWS-  959

Query  957   DVDRVIVPGHTNEAQVQKLNPATTYNIRIVAENEIGVSDSSEVVPIITAEEAPSGKPQSI  1016
             ++DRVIVPGHT EAQVQKL+PATTYNIRIVAEN IG S SSE V IITAEEAPSGKPQ+I
Sbjct  960   EIDRVIVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNI  1019

Query  1017  KVEPLSQTSLRVLWKAPPRSDWNGEILGYYVGYKLTNNNGSYYFEDYKYMMEEGKEYSYE  1076
             KVEP++QT++RV WK PPR++WNGEILGYYVGYKL+N N SY FE   ++ EEGKE++ E
Sbjct  1020  KVEPVNQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLE  1079

Query  1077  LTNLKTYTQYSVVIQAYNKVGAGPLSEDEKQYTAEGTPDQPPSDITCTTLTSQTIRVSWV  1136
             L NL+ YTQYSVVIQA+NK+GAGPLSE+EKQ+TAEGTP QPPSD  CTTLTSQTIRV WV
Sbjct  1080  LQNLRVYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWV  1139

Query  1137  SPPLESANGVIKGYKVVYAPSELWYDDKNKDYKKTASSDTVLHGLKKYTNYTMQVLATTS  1196
             SPPLESANGVIK YKVVYAPS+ WYD+  + YKKTASSDTVLHGLKKYTNYTMQVLATT+
Sbjct  1140  SPPLESANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTA  1199

Query  1197  GGDGVRSPPIHCQTEQDVPEAPTAVKALVVGSEAILVSWLPPAQPNGLITQYTVYSKEEG  1256
             GGDGVRS PIHCQTE DVPEAPT VKALV+G+ AILVSW PPAQPNG+ITQYTVYSK EG
Sbjct  1200  GGDGVRSVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEG  1259

Query  1257  TESEVKSHKVPPYQMSYEASSLDKNKPFEFWVTANTNIGEGQASKSIVAMPSDKVPAKIA  1316
              E+E K+ KVP YQMS+EA+ L+KNKP+EFWVTA+T IGEGQ SKSIVAMPSD+VPAKIA
Sbjct  1260  AETETKTQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIA  1319

Query  1317  SFDDTFTAIFKEDFKLPCLAVGAPAPDITWKVKGVEFVPNDRVRQLPEGSLSIKDVIRQD  1376
             SFDDTFTA FKED K+PCLAVGAP P+ITWK+KGVEF  NDR+R LP+GSL IK V RQD
Sbjct  1320  SFDDTFTATFKEDAKMPCLAVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNRQD  1379

Query  1377  AGDYTCMAENSIAKDSITHKLIVLAPPQSPQVLLTATTTDSLTLKLKQHDGDTAPIHGYT  1436
             AGDY+C AENSIAKDSITHKLIVLAPPQSP V L+ATTTD+LT+KLK H+GDTAP+HGYT
Sbjct  1380  AGDYSCHAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGYT  1439

Query  1437  LHYKPEFGDWETVEVAVDAQKYTIENLFCGSRYQVYATGYNNIGAGEASDILNTRTKGSK  1496
             LHYKPEFG+WET EV+VD+QK+ IE L CGSRYQVYATG+NNIGAGEASDILNTRTKG K
Sbjct  1440  LHYKPEFGEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKGQK  1499

Query  1497  PMMPENSKFIDPSSNTVTLHLPTWKDGGCRMSHFVVEYKKKDHAEWTQISNNVKPGGNFV  1556
             P +PE  +FI+ SSN+V+LH   WKDGGC MSHFVVE KK+D  EW QISNNVKP  N+V
Sbjct  1500  PKLPEKPRFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKRDQIEWNQISNNVKPDNNYV  1559

Query  1557  VLDLDAASWYSVRITAHNSAGFTVAEYEFATLTVTGGTLAPPLNTAVLNGKTY----LPP  1612
             VLDL+ A+WY++RITAHNSAGFTVAEY+FATLTVTGGT+A PL+    +G  +    LP 
Sbjct  1560  VLDLEPATWYNLRITAHNSAGFTVAEYDFATLTVTGGTIA-PLDDGSGHGNVHTRIRLPA  1618

Query  1613  WMPQWFDLNFMVPLIATIIVVFVGVLVICVALSRRRMEDPRGGPKDVYYDVVYNQPMGPG  1672
             WMP+W DLNFMVPLIAT++VV VG+ V+CVALSRRR +D RGG KDVYYDVVYNQ MGPG
Sbjct  1619  WMPEWLDLNFMVPLIATVVVVAVGICVVCVALSRRRADDMRGGQKDVYYDVVYNQTMGPG  1678

Query  1673  ATMDKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRGTVISRSMRSNHSTWDPRR-  1731
             AT+DKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG      +RSNHSTWDPRR 
Sbjct  1679  ATLDKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG---RGGLRSNHSTWDPRRN  1735

Query  1732  -PLYEELKPPPVPRR-----HYHGSDECYHTHPHPHPAGMEDEICPYATFHLLGFREEMD  1785
               LYEELK PPVP       H HG+ EC++ HP     GMEDEICPYATFHLLGFREEMD
Sbjct  1736  PNLYEELKAPPVPMHGNHYGHAHGNAECHYRHP-----GMEDEICPYATFHLLGFREEMD  1790

Query  1786  PTKAMNFQTFPHQNGHTG--PGHA-TMGPGGPPGHIHSRSGSQSMPRQNRYARKNSQGGQ  1842
             PTKAMNFQTFPHQNGH G  PGHA TM P G PGH+HSRSGSQSMPR NRY RKNSQGGQ
Sbjct  1791  PTKAMNFQTFPHQNGHAGPVPGHAGTMLPPGHPGHVHSRSGSQSMPRANRYQRKNSQGGQ  1850

Query  1843  SSIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYGGPGPEYDDPANCAPEDDQYGSQY  1902
             SSIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLY GPGPEYDDPANCAPE+DQYGSQY
Sbjct  1851  SSIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYSGPGPEYDDPANCAPEEDQYGSQY  1910

Query  1903  GAPYG--YDHYGSRGSVGRRSVGSARNLPNGSPEPPPPPPRNHDTSNSSFNDSKESNEIS  1960
             G PYG  YDHYGSRGS+GRRS+GSARN  NGSPEPPPPPPRNHD SNSSFNDSKESNEIS
Sbjct  1911  GGPYGQPYDHYGSRGSMGRRSIGSARNPGNGSPEPPPPPPRNHDMSNSSFNDSKESNEIS  1970

Query  1961  EAECDRDH-PRGNYGENENSGDAKRSANTKDVRTTEEMRKLIDSRKSNEVAAKLQQQGGP  2019
             EAECDRDH PRGNYG        KRS   KD RTTEEMRKLI+  ++     +LQQ  G 
Sbjct  1971  EAECDRDHGPRGNYGA------VKRSPQPKDQRTTEEMRKLIERNETGPKQLQLQQANG-  2023

Query  2020  AGLTAYDTLAV  2030
             AG TAYDT+AV
Sbjct  2024  AGFTAYDTMAV  2034



Lambda      K        H
   0.314    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 27188552048


Query= XP_037024204.1 Down syndrome cell adhesion molecule-like protein
Dscam2 isoform X9 [Bradysia coprophila]

Length=2028
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q0E9J0_DROME  unnamed protein product                                 3336    0.0  
Q0E9K9_DROME  unnamed protein product                                 3329    0.0  
A0A0B4K828_DROME  unnamed protein product                             3325    0.0  


>Q0E9J0_DROME unnamed protein product
Length=2035

 Score = 3336 bits (8649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1637/2049 (80%), Positives = 1800/2049 (88%), Gaps = 42/2049 (2%)

Query  3     QRTKWITKIIFIAV-LVDLGS---TANT-EADTKGPMFLKEPINRIDFSNSTGSVVECRA  57
             +R KW+  ++F AV L+  GS    AN  +AD KGP+FLKEP NRIDFSNSTG+ +EC+A
Sbjct  6     ERLKWL--MLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAEIECKA  63

Query  58    SGNPAPEIIWVRSDGTAVGDVPGLRQVLSNGNLVFPPFRAEDYRQEVHAQVYACLAKNQF  117
             SGNP PEIIW+RSDGTAVGDVPGLRQ+ S+G LVFPPFRAEDYRQEVHAQVYACLA+NQF
Sbjct  64    SGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQF  123

Query  118   GSIISRDVNVRAVVIQSYEAEADNEYVIRGNSAVMTCEIPSYVSEFVAVDLWTDSDGGTF  177
             GSIISRDV+VRAVV Q YE+E +NEYVIRGN+AV+ C IPS+V++FV V  W D +G  +
Sbjct  124   GSIISRDVHVRAVVQQFYESEVNNEYVIRGNAAVLKCSIPSFVADFVQVVSWQDEEGQLY  183

Query  178   YP-GNEQQTDGKYLVLPSGELHIKEVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITE  236
                G++Q TDGKYLVLPSGELHI+EVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITE
Sbjct  184   GSLGDQQGTDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITE  243

Query  237   PVGSKAPTFSSDYSSFTFKRRVTESFGMLCQAQAYPVPLIRWYKFIEGTTRKQAVVLNDR  296
             PVG+KAPTFS +  SFTF + ++ SF +LCQAQA+PVP+IRWYKFIEGTTRKQAVVLNDR
Sbjct  244   PVGAKAPTFSGESKSFTFVKEISTSFALLCQAQAFPVPIIRWYKFIEGTTRKQAVVLNDR  303

Query  297   VKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPSQVVDFGRP  356
             VKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPP+Q VDFGRP
Sbjct  304   VKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFGRP  363

Query  357   AVFTCHFSGNPIKTVSWLKDGKKIGHTDAILRIESVKKEHKGMYQCFIRNDQESAEASAE  416
             AVFTC ++GNPIKTVSW+KDGK IGH++ +LRIESVKKE KGMYQCF+RNDQESAEASAE
Sbjct  364   AVFTCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEASAE  423

Query  417   LKLGGRFDPPIIRQAFPEETLHPGPSVFLKCVAGGLPTPEISWELDGKKIANSERYQVGQ  476
             LKLGGRFDPP+IRQAF EET+ PGPSVFLKCVAGG PTPEISWELDGKKIAN++RYQVGQ
Sbjct  424   LKLGGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQVGQ  483

Query  477   YVTVNGDVVSYLNITSIHANDGGLYKCIASSKVGVAEHSAKLNVYGLPYIRPMEKKAIVA  536
             YVTVNGDVVSYLNITS+HANDGGLYKCIA SKVGVAEHSAKLNVYGLPYIR MEKKAIVA
Sbjct  484   YVTVNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKAIVA  543

Query  537   GENLIVTCPVAGYPIESIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAK  596
             GE LIVTCPVAGYPI+SIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAK
Sbjct  544   GETLIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAK  603

Query  597   NSEGYSARGALEVQVMVAPMILPFSFGDEAANPGDSTAVNCMITKGDLPLNIKWTLNGQP  656
             N EGYSARG+LEVQVMV P I  F FG EAAN G+     CM+ KGDLP+ I+WTLN  P
Sbjct  604   NQEGYSARGSLEVQVMVPPQIQAFDFGSEAANTGEMAGGFCMVPKGDLPMEIRWTLNSAP  663

Query  657   VVNGENGLQVVKMSSRLSSLSIESLGDRHRGTFRCIASNDAGETNYSSELNINVPPRWIL  716
             ++ GE+G  + +++ R SSLSI+SL  RHRG +RCIASN AG   YS+EL++NVPPRWIL
Sbjct  664   IITGEHGFSLSRLNPRTSSLSIDSLEARHRGLYRCIASNKAGSAEYSAELHVNVPPRWIL  723

Query  717   EPTDKAFAQGSDAKVECKSDGFPKPQVTWKKAVGDTPGEYKDMKQSNNIRVDEGTLYIDN  776
             EPTDKAFAQGSDAKVECK+DGFPKPQVTWKKAVGDTPGEYKD+K+S+NIRV+EGTL++DN
Sbjct  724   EPTDKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHVDN  783

Query  777   IQKNNEGYYLCEAINGIGSGLSAVILISVQAPPEFVEKLRNQTARRSEPAVLQCEAKGEK  836
             IQK NEGYYLCEAINGIGSGLSAVI+ISVQAPPEF EKLRNQTARR EPAVLQCEAKGEK
Sbjct  784   IQKTNEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKGEK  843

Query  837   PIGILWNMNNMRLDPKTDNRYTIREEILSTGVMSSLSIKRTERTDSALFTCVATNAFGSD  896
             PIGILWNMNNMRLDPK DNRYTIREEILSTGVMSSLSIKRTER+DSALFTCVATNAFGSD
Sbjct  844   PIGILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAFGSD  903

Query  897   DASINMIIQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLKRYIIEFKTSRGSWEHDV  956
             DASINMI+QEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPL RYIIEFK SR SW  ++
Sbjct  904   DASINMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWS-EI  962

Query  957   DRVIVPGHTNEAQVQKLNPATTYNIRIVAENEIGVSDSSEVVPIITAEEAPSGKPQSIKV  1016
             DRVIVPGHT EAQVQKL+PATTYNIRIVAEN IG S SSE V IITAEEAPSGKPQ+IKV
Sbjct  963   DRVIVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNIKV  1022

Query  1017  EPLSQTSLRVLWKAPPRSDWNGEILGYYVGYKLTNNNGSYYFEDYKYMMEEGKEYSYELT  1076
             EP++QT++RV WK PPR++WNGEILGYYVGYKL+N N SY FE   ++ EEGKE++ EL 
Sbjct  1023  EPVNQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLELQ  1082

Query  1077  NLKTYTQYSVVIQAYNKVGAGPLSEDEKQYTAEGTPDQPPSDITCTTLTSQTIRVSWVSP  1136
             NL+ YTQYSVVIQA+NK+GAGPLSE+EKQ+TAEGTP QPPSD  CTTLTSQTIRV WVSP
Sbjct  1083  NLRVYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWVSP  1142

Query  1137  PLESANGVIKGYKVVYAPSELWYDDKNKDYKKTASSDTVLHGLKKYTNYTMQVLATTSGG  1196
             PLESANGVIK YKVVYAPS+ WYD+  + YKKTASSDTVLHGLKKYTNYTMQVLATT+GG
Sbjct  1143  PLESANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTAGG  1202

Query  1197  DGVRSPPIHCQTEQDVPEAPTAVKALVVGSEAILVSWLPPAQPNGLITQYTVYSKEEGTE  1256
             DGVRS PIHCQTE DVPEAPT VKALV+G+ AILVSW PPAQPNG+ITQYTVYSK EG E
Sbjct  1203  DGVRSVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEGAE  1262

Query  1257  SEVKSHKVPPYQMSYEASSLDKNKPFEFWVTANTNIGEGQASKSIVAMPSDKVPAKIASF  1316
             +E K+ KVP YQMS+EA+ L+KNKP+EFWVTA+T IGEGQ SKSIVAMPSD+VPAKIASF
Sbjct  1263  TETKTQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIASF  1322

Query  1317  DDTFTAIFKEDFKLPCLAVGAPAPDITWKVKGVEFVPNDRVRQLPEGSLSIKDVIRQDAG  1376
             DDTFTA FKED K+PCLAVGAP P+ITWK+KGVEF  NDR+R LP+GSL IK V RQDAG
Sbjct  1323  DDTFTATFKEDAKMPCLAVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNRQDAG  1382

Query  1377  DYTCMAENSIAKDSITHKLIVLAPPQSPQVLLTATTTDSLTLKLKQHDGDTAPIHGYTLH  1436
             DY+C AENSIAKDSITHKLIVLAPPQSP V L+ATTTD+LT+KLK H+GDTAP+HGYTLH
Sbjct  1383  DYSCHAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGYTLH  1442

Query  1437  YKPEFGDWETVEVAVDAQKYTIENLFCGSRYQVYATGYNNIGAGEASDILNTRTKGSKPM  1496
             YKPEFG+WET EV+VD+QK+ IE L CGSRYQVYATG+NNIGAGEASDILNTRTKG KP 
Sbjct  1443  YKPEFGEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKGQKPK  1502

Query  1497  MPENSKFIDPSSNTVTLHLPTWKDGGCRMSHFVVEYKKKDHAEWTQISNNVKPGGNFVVL  1556
             +PE  +FI+ SSN+V+LH   WKDGGC MSHFVVE KK+D  EW QISNNVKP  N+VVL
Sbjct  1503  LPEKPRFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKRDQIEWNQISNNVKPDNNYVVL  1562

Query  1557  DLDAASWYSVRITAHNSAGFTVAEYEFATLTVTGGTLAPPLNTAVLNGKTY----LPPWM  1612
             DL+ A+WY++RITAHNSAGFTVAEY+FATLTVTGGT+A PL+    +G  +    LP WM
Sbjct  1563  DLEPATWYNLRITAHNSAGFTVAEYDFATLTVTGGTIA-PLDDGSGHGNVHTRIRLPAWM  1621

Query  1613  PQWFDLNFMVPLIATIIVVFVGVLVICVALSRRRMEDPRGGPKDVYYDVVYNQPMGPGAT  1672
             P+W DLNFMVPLIAT++VV VG+ V+CVALSRRR +D RGG KDVYYDVVYNQ MGPGAT
Sbjct  1622  PEWLDLNFMVPLIATVVVVAVGICVVCVALSRRRADDMRGGQKDVYYDVVYNQTMGPGAT  1681

Query  1673  MDKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRGTVISRSMRSNHSTWDPRR--P  1730
             +DKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG      +RSNHSTWDPRR   
Sbjct  1682  LDKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG---RGGLRSNHSTWDPRRNPN  1738

Query  1731  LYEELKPPPVPRR-----HYHGSDECYHTHPHPHPAGMEDEICPYATFHLLGFREEMDPT  1785
             LYEELK PPVP       H HG+ EC++ HP     GMEDEICPYATFHLLGFREEMDPT
Sbjct  1739  LYEELKAPPVPMHGNHYGHAHGNAECHYRHP-----GMEDEICPYATFHLLGFREEMDPT  1793

Query  1786  KAMNFQTFPHQNGHTG--PGHA-TMGPGGPPGHIHSRSGSQSMPRQNRYARKNSQGGQSS  1842
             KAMNFQTFPHQNGH G  PGHA TM P G PGH+HSRSGSQSMPR NRY RKNSQGGQSS
Sbjct  1794  KAMNFQTFPHQNGHAGPVPGHAGTMLPPGHPGHVHSRSGSQSMPRANRYQRKNSQGGQSS  1853

Query  1843  IYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYGGPGPEYDDPANCAPEDDQYGSQYGA  1902
             IYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLY GPGPEYDDPANCAPE+DQYGSQYG 
Sbjct  1854  IYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYSGPGPEYDDPANCAPEEDQYGSQYGG  1913

Query  1903  PYG--YDHYGSRGSVGRRSVGSARNLPNGSPEPPPPPPRNHDTSNSSFNDSKESNEISEA  1960
             PYG  YDHYGSRGS+GRRS+GSARN  NGSPEPPPPPPRNHD SNSSFNDSKESNEISEA
Sbjct  1914  PYGQPYDHYGSRGSMGRRSIGSARNPGNGSPEPPPPPPRNHDMSNSSFNDSKESNEISEA  1973

Query  1961  ECDRDH-PRGNYGENENSGDAKRSANTKDVRTTEEMRKLIDSRKSNEVAAKLQQQGGPAG  2019
             ECDRDH PRGNYG        KRS   KD RTTEEMRKLI+  ++     +LQQ  G AG
Sbjct  1974  ECDRDHGPRGNYGA------VKRSPQPKDQRTTEEMRKLIERNETGPKQLQLQQANG-AG  2026

Query  2020  LTAYDTLAV  2028
              TAYDT+AV
Sbjct  2027  FTAYDTMAV  2035


>Q0E9K9_DROME unnamed protein product
Length=2032

 Score = 3329 bits (8631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1633/2048 (80%), Positives = 1795/2048 (88%), Gaps = 43/2048 (2%)

Query  3     QRTKWITKIIFIAV-LVDLGS---TANT-EADTKGPMFLKEPINRIDFSNSTGSVVECRA  57
             +R KW+  ++F AV L+  GS    AN  +AD KGP+FLKEP NRIDFSNSTG+ +EC+A
Sbjct  6     ERLKWL--MLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAEIECKA  63

Query  58    SGNPAPEIIWVRSDGTAVGDVPGLRQVLSNGNLVFPPFRAEDYRQEVHAQVYACLAKNQF  117
             SGNP PEIIW+RSDGTAVGDVPGLRQ+ S+G LVFPPFRAEDYRQEVHAQVYACLA+NQF
Sbjct  64    SGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQF  123

Query  118   GSIISRDVNVRAVVIQSYEAEADNEYVIRGNSAVMTCEIPSYVSEFVAVDLWTDSDGGTF  177
             GSIISRDV+VRAVV Q YEAE   EYVIRGN+AV+ C IPS+V++FV V+ W D +G   
Sbjct  124   GSIISRDVHVRAVVNQFYEAEIMTEYVIRGNAAVLKCSIPSFVADFVRVESWIDDEGNVL  183

Query  178   YPGNEQQTDGKYLVLPSGELHIKEVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEP  237
                     DGKYLVLPSGELHI+EVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEP
Sbjct  184   --SFSDNYDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEP  241

Query  238   VGSKAPTFSSDYSSFTFKRRVTESFGMLCQAQAYPVPLIRWYKFIEGTTRKQAVVLNDRV  297
             +G++APTFS+D +SF++ R V +SF +LCQAQAYPVP++RWYKFIEGTTRKQAVVLNDRV
Sbjct  242   IGARAPTFSTDSNSFSYTRSVGQSFALLCQAQAYPVPIMRWYKFIEGTTRKQAVVLNDRV  301

Query  298   KQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPSQVVDFGRPA  357
             KQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPP+Q VDFGRPA
Sbjct  302   KQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFGRPA  361

Query  358   VFTCHFSGNPIKTVSWLKDGKKIGHTDAILRIESVKKEHKGMYQCFIRNDQESAEASAEL  417
             VFTC ++GNPIKTVSW+KDGK IGH++ +LRIESVKKE KGMYQCF+RNDQESAEASAEL
Sbjct  362   VFTCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEASAEL  421

Query  418   KLGGRFDPPIIRQAFPEETLHPGPSVFLKCVAGGLPTPEISWELDGKKIANSERYQVGQY  477
             KLGGRFDPP+IRQAF EET+ PGPSVFLKCVAGG PTPEISWELDGKKIAN++RYQVGQY
Sbjct  422   KLGGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQVGQY  481

Query  478   VTVNGDVVSYLNITSIHANDGGLYKCIASSKVGVAEHSAKLNVYGLPYIRPMEKKAIVAG  537
             VTVNGDVVSYLNITS+HANDGGLYKCIA SKVGVAEHSAKLNVYGLPYIR MEKKAIVAG
Sbjct  482   VTVNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKAIVAG  541

Query  538   ENLIVTCPVAGYPIESIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKN  597
             E LIVTCPVAGYPI+SIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKN
Sbjct  542   ETLIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKN  601

Query  598   SEGYSARGALEVQVMVAPMILPFSFGDEAANPGDSTAVNCMITKGDLPLNIKWTLNGQPV  657
              EGYSARG+LEVQVMV P I  F FG EAAN G+     CM+ KGDLP+ I+WTLN  P+
Sbjct  602   QEGYSARGSLEVQVMVPPQIQAFDFGSEAANTGEMAGGFCMVPKGDLPMEIRWTLNSAPI  661

Query  658   VNGENGLQVVKMSSRLSSLSIESLGDRHRGTFRCIASNDAGETNYSSELNINVPPRWILE  717
             + GE+G  + +++ R SSLSI+SL  RHRG +RCIASN AG   YS+EL++NVPPRWILE
Sbjct  662   ITGEHGFSLSRLNPRTSSLSIDSLEARHRGLYRCIASNKAGSAEYSAELHVNVPPRWILE  721

Query  718   PTDKAFAQGSDAKVECKSDGFPKPQVTWKKAVGDTPGEYKDMKQSNNIRVDEGTLYIDNI  777
             PTDKAFAQGSDAKVECK+DGFPKPQVTWKKAVGDTPGEYKD+K+S+NIRV+EGTL++DNI
Sbjct  722   PTDKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHVDNI  781

Query  778   QKNNEGYYLCEAINGIGSGLSAVILISVQAPPEFVEKLRNQTARRSEPAVLQCEAKGEKP  837
             QK NEGYYLCEAINGIGSGLSAVI+ISVQAPPEF EKLRNQTARR EPAVLQCEAKGEKP
Sbjct  782   QKTNEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKGEKP  841

Query  838   IGILWNMNNMRLDPKTDNRYTIREEILSTGVMSSLSIKRTERTDSALFTCVATNAFGSDD  897
             IGILWNMNNMRLDPK DNRYTIREEILSTGVMSSLSIKRTER+DSALFTCVATNAFGSDD
Sbjct  842   IGILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAFGSDD  901

Query  898   ASINMIIQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLKRYIIEFKTSRGSWEHDVD  957
             ASINMI+QEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPL RYIIEFK SR SW  ++D
Sbjct  902   ASINMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWS-EID  960

Query  958   RVIVPGHTNEAQVQKLNPATTYNIRIVAENEIGVSDSSEVVPIITAEEAPSGKPQSIKVE  1017
             RVIVPGHT EAQVQKL+PATTYNIRIVAEN IG S SSE V IITAEEAPSGKPQ+IKVE
Sbjct  961   RVIVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNIKVE  1020

Query  1018  PLSQTSLRVLWKAPPRSDWNGEILGYYVGYKLTNNNGSYYFEDYKYMMEEGKEYSYELTN  1077
             P++QT++RV WK PPR++WNGEILGYYVGYKL+N N SY FE   ++ EEGKE++ EL N
Sbjct  1021  PVNQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLELQN  1080

Query  1078  LKTYTQYSVVIQAYNKVGAGPLSEDEKQYTAEGTPDQPPSDITCTTLTSQTIRVSWVSPP  1137
             L+ YTQYSVVIQA+NK+GAGPLSE+EKQ+TAEGTP QPPSD  CTTLTSQTIRV WVSPP
Sbjct  1081  LRVYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWVSPP  1140

Query  1138  LESANGVIKGYKVVYAPSELWYDDKNKDYKKTASSDTVLHGLKKYTNYTMQVLATTSGGD  1197
             LESANGVIK YKVVYAPS+ WYD+  + YKKTASSDTVLHGLKKYTNYTMQVLATT+GGD
Sbjct  1141  LESANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTAGGD  1200

Query  1198  GVRSPPIHCQTEQDVPEAPTAVKALVVGSEAILVSWLPPAQPNGLITQYTVYSKEEGTES  1257
             GVRS PIHCQTE DVPEAPT VKALV+G+ AILVSW PPAQPNG+ITQYTVYSK EG E+
Sbjct  1201  GVRSVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEGAET  1260

Query  1258  EVKSHKVPPYQMSYEASSLDKNKPFEFWVTANTNIGEGQASKSIVAMPSDKVPAKIASFD  1317
             E K+ KVP YQMS+EA+ L+KNKP+EFWVTA+T IGEGQ SKSIVAMPSD+VPAKIASFD
Sbjct  1261  ETKTQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIASFD  1320

Query  1318  DTFTAIFKEDFKLPCLAVGAPAPDITWKVKGVEFVPNDRVRQLPEGSLSIKDVIRQDAGD  1377
             DTFTA FKED K+PCLAVGAP P+ITWK+KGVEF  NDR+R LP+GSL IK V RQDAGD
Sbjct  1321  DTFTATFKEDAKMPCLAVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNRQDAGD  1380

Query  1378  YTCMAENSIAKDSITHKLIVLAPPQSPQVLLTATTTDSLTLKLKQHDGDTAPIHGYTLHY  1437
             Y+C AENSIAKDSITHKLIVLAPPQSP V L+ATTTD+LT+KLK H+GDTAP+HGYTLHY
Sbjct  1381  YSCHAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGYTLHY  1440

Query  1438  KPEFGDWETVEVAVDAQKYTIENLFCGSRYQVYATGYNNIGAGEASDILNTRTKGSKPMM  1497
             KPEFG+WET EV+VD+QK+ IE L CGSRYQVYATG+NNIGAGEASDILNTRTKG KP +
Sbjct  1441  KPEFGEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKGQKPKL  1500

Query  1498  PENSKFIDPSSNTVTLHLPTWKDGGCRMSHFVVEYKKKDHAEWTQISNNVKPGGNFVVLD  1557
             PE  +FI+ SSN+V+LH   WKDGGC MSHFVVE KK+D  EW QISNNVKP  N+VVLD
Sbjct  1501  PEKPRFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKRDQIEWNQISNNVKPDNNYVVLD  1560

Query  1558  LDAASWYSVRITAHNSAGFTVAEYEFATLTVTGGTLAPPLNTAVLNGKTY----LPPWMP  1613
             L+ A+WY++RITAHNSAGFTVAEY+FATLTVTGGT+A PL+    +G  +    LP WMP
Sbjct  1561  LEPATWYNLRITAHNSAGFTVAEYDFATLTVTGGTIA-PLDDGSGHGNVHTRIRLPAWMP  1619

Query  1614  QWFDLNFMVPLIATIIVVFVGVLVICVALSRRRMEDPRGGPKDVYYDVVYNQPMGPGATM  1673
             +W DLNFMVPLIAT++VV VG+ V+CVALSRRR +D RGG KDVYYDVVYNQ MGPGAT+
Sbjct  1620  EWLDLNFMVPLIATVVVVAVGICVVCVALSRRRADDMRGGQKDVYYDVVYNQTMGPGATL  1679

Query  1674  DKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRGTVISRSMRSNHSTWDPRR--PL  1731
             DKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG      +RSNHSTWDPRR   L
Sbjct  1680  DKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG---RGGLRSNHSTWDPRRNPNL  1736

Query  1732  YEELKPPPVPRR-----HYHGSDECYHTHPHPHPAGMEDEICPYATFHLLGFREEMDPTK  1786
             YEELK PPVP       H HG+ EC++ HP     GMEDEICPYATFHLLGFREEMDPTK
Sbjct  1737  YEELKAPPVPMHGNHYGHAHGNAECHYRHP-----GMEDEICPYATFHLLGFREEMDPTK  1791

Query  1787  AMNFQTFPHQNGHTG--PGHA-TMGPGGPPGHIHSRSGSQSMPRQNRYARKNSQGGQSSI  1843
             AMNFQTFPHQNGH G  PGHA TM P G PGH+HSRSGSQSMPR NRY RKNSQGGQSSI
Sbjct  1792  AMNFQTFPHQNGHAGPVPGHAGTMLPPGHPGHVHSRSGSQSMPRANRYQRKNSQGGQSSI  1851

Query  1844  YTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYGGPGPEYDDPANCAPEDDQYGSQYGAP  1903
             YTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLY GPGPEYDDPANCAPE+DQYGSQYG P
Sbjct  1852  YTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYSGPGPEYDDPANCAPEEDQYGSQYGGP  1911

Query  1904  YG--YDHYGSRGSVGRRSVGSARNLPNGSPEPPPPPPRNHDTSNSSFNDSKESNEISEAE  1961
             YG  YDHYGSRGS+GRRS+GSARN  NGSPEPPPPPPRNHD SNSSFNDSKESNEISEAE
Sbjct  1912  YGQPYDHYGSRGSMGRRSIGSARNPGNGSPEPPPPPPRNHDMSNSSFNDSKESNEISEAE  1971

Query  1962  CDRDH-PRGNYGENENSGDAKRSANTKDVRTTEEMRKLIDSRKSNEVAAKLQQQGGPAGL  2020
             CDRDH PRGNYG        KRS   KD RTTEEMRKLI+  ++     +LQQ  G AG 
Sbjct  1972  CDRDHGPRGNYGA------VKRSPQPKDQRTTEEMRKLIERNETGPKQLQLQQANG-AGF  2024

Query  2021  TAYDTLAV  2028
             TAYDT+AV
Sbjct  2025  TAYDTMAV  2032


>A0A0B4K828_DROME unnamed protein product
Length=2032

 Score = 3325 bits (8620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1634/2048 (80%), Positives = 1796/2048 (88%), Gaps = 43/2048 (2%)

Query  3     QRTKWITKIIFIAV-LVDLGS---TANT-EADTKGPMFLKEPINRIDFSNSTGSVVECRA  57
             +R KW+  ++F AV L+  GS    AN  +AD KGP+FLKEP NRIDFSNSTG+ +EC+A
Sbjct  6     ERLKWL--MLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAEIECKA  63

Query  58    SGNPAPEIIWVRSDGTAVGDVPGLRQVLSNGNLVFPPFRAEDYRQEVHAQVYACLAKNQF  117
             SGNP PEIIW+RSDGTAVGDVPGLRQ+ S+G LVFPPFRAEDYRQEVHAQVYACLA+NQF
Sbjct  64    SGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQF  123

Query  118   GSIISRDVNVRAVVIQSYEAEADNEYVIRGNSAVMTCEIPSYVSEFVAVDLWTDSDGGTF  177
             GSIISRDV+VRAVV Q Y+ + +  YVIRGN+AV+ CEIPS+V++FV+V  W       F
Sbjct  124   GSIISRDVHVRAVVAQYYDTDVNKAYVIRGNAAVLKCEIPSFVADFVSVVSWHTDQNEDF  183

Query  178   YPGNEQQTDGKYLVLPSGELHIKEVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEP  237
              PG+E   DGKYLVLPSGELHI+EVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEP
Sbjct  184   LPGSEY--DGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEP  241

Query  238   VGSKAPTFSSDYSSFTFKRRVTESFGMLCQAQAYPVPLIRWYKFIEGTTRKQAVVLNDRV  297
             V +K PTF+SD  S+TF R   +SF +LCQAQAYPVPLIRWYKFIEGTTRKQAVVLNDRV
Sbjct  242   VSAKGPTFASDMKSYTFVRHFGQSFALLCQAQAYPVPLIRWYKFIEGTTRKQAVVLNDRV  301

Query  298   KQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPSQVVDFGRPA  357
             KQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPP+Q VDFGRPA
Sbjct  302   KQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFGRPA  361

Query  358   VFTCHFSGNPIKTVSWLKDGKKIGHTDAILRIESVKKEHKGMYQCFIRNDQESAEASAEL  417
             VFTC ++GNPIKTVSW+KDGK IGH++ +LRIESVKKE KGMYQCF+RNDQESAEASAEL
Sbjct  362   VFTCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEASAEL  421

Query  418   KLGGRFDPPIIRQAFPEETLHPGPSVFLKCVAGGLPTPEISWELDGKKIANSERYQVGQY  477
             KLGGRFDPP+IRQAF EET+ PGPSVFLKCVAGG PTPEISWELDGKKIAN++RYQVGQY
Sbjct  422   KLGGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQVGQY  481

Query  478   VTVNGDVVSYLNITSIHANDGGLYKCIASSKVGVAEHSAKLNVYGLPYIRPMEKKAIVAG  537
             VTVNGDVVSYLNITS+HANDGGLYKCIA SKVGVAEHSAKLNVYGLPYIR MEKKAIVAG
Sbjct  482   VTVNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKAIVAG  541

Query  538   ENLIVTCPVAGYPIESIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKN  597
             E LIVTCPVAGYPI+SIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKN
Sbjct  542   ETLIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKN  601

Query  598   SEGYSARGALEVQVMVAPMILPFSFGDEAANPGDSTAVNCMITKGDLPLNIKWTLNGQPV  657
              EGYSARG+LEVQVMVAP I PFSFGDE  N G+  +VNC++ KGDLPL+I WTLN   +
Sbjct  602   QEGYSARGSLEVQVMVAPQISPFSFGDEPLNRGEVASVNCVVPKGDLPLDIYWTLNSALI  661

Query  658   VNGENGLQVVKMSSRLSSLSIESLGDRHRGTFRCIASNDAGETNYSSELNINVPPRWILE  717
             VNGE G  +V+++ R SSL+++SL   HRG+++CIA+N AG   Y S L++NVPPRWILE
Sbjct  662   VNGEMGFTLVRLNKRTSSLNVDSLEAVHRGSYKCIANNSAGYAEYVSTLDVNVPPRWILE  721

Query  718   PTDKAFAQGSDAKVECKSDGFPKPQVTWKKAVGDTPGEYKDMKQSNNIRVDEGTLYIDNI  777
             PTDKAFAQGSDAKVECK+DGFPKPQVTWKKAVGDTPGEYKD+K+S+NIRV+EGTL++DNI
Sbjct  722   PTDKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHVDNI  781

Query  778   QKNNEGYYLCEAINGIGSGLSAVILISVQAPPEFVEKLRNQTARRSEPAVLQCEAKGEKP  837
             QK NEGYYLCEAINGIGSGLSAVI+ISVQAPPEF EKLRNQTARR EPAVLQCEAKGEKP
Sbjct  782   QKTNEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKGEKP  841

Query  838   IGILWNMNNMRLDPKTDNRYTIREEILSTGVMSSLSIKRTERTDSALFTCVATNAFGSDD  897
             IGILWNMNNMRLDPK DNRYTIREEILSTGVMSSLSIKRTER+DSALFTCVATNAFGSDD
Sbjct  842   IGILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAFGSDD  901

Query  898   ASINMIIQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLKRYIIEFKTSRGSWEHDVD  957
             ASINMI+QEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPL RYIIEFK SR SW  ++D
Sbjct  902   ASINMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWS-EID  960

Query  958   RVIVPGHTNEAQVQKLNPATTYNIRIVAENEIGVSDSSEVVPIITAEEAPSGKPQSIKVE  1017
             RVIVPGHT EAQVQKL+PATTYNIRIVAEN IG S SSE V IITAEEAPSGKPQ+IKVE
Sbjct  961   RVIVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNIKVE  1020

Query  1018  PLSQTSLRVLWKAPPRSDWNGEILGYYVGYKLTNNNGSYYFEDYKYMMEEGKEYSYELTN  1077
             P++QT++RV WK PPR++WNGEILGYYVGYKL+N N SY FE   ++ EEGKE++ EL N
Sbjct  1021  PVNQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLELQN  1080

Query  1078  LKTYTQYSVVIQAYNKVGAGPLSEDEKQYTAEGTPDQPPSDITCTTLTSQTIRVSWVSPP  1137
             L+ YTQYSVVIQA+NK+GAGPLSE+EKQ+TAEGTP QPPSD  CTTLTSQTIRV WVSPP
Sbjct  1081  LRVYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWVSPP  1140

Query  1138  LESANGVIKGYKVVYAPSELWYDDKNKDYKKTASSDTVLHGLKKYTNYTMQVLATTSGGD  1197
             LESANGVIK YKVVYAPS+ WYD+  + YKKTASSDTVLHGLKKYTNYTMQVLATT+GGD
Sbjct  1141  LESANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTAGGD  1200

Query  1198  GVRSPPIHCQTEQDVPEAPTAVKALVVGSEAILVSWLPPAQPNGLITQYTVYSKEEGTES  1257
             GVRS PIHCQTE DVPEAPT VKALV+G+ AILVSW PPAQPNG+ITQYTVYSK EG E+
Sbjct  1201  GVRSVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEGAET  1260

Query  1258  EVKSHKVPPYQMSYEASSLDKNKPFEFWVTANTNIGEGQASKSIVAMPSDKVPAKIASFD  1317
             E K+ KVP YQMS+EA+ L+KNKP+EFWVTA+T IGEGQ SKSIVAMPSD+VPAKIASFD
Sbjct  1261  ETKTQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIASFD  1320

Query  1318  DTFTAIFKEDFKLPCLAVGAPAPDITWKVKGVEFVPNDRVRQLPEGSLSIKDVIRQDAGD  1377
             DTFTA FKED K+PCLAVGAP P+ITWK+KGVEF  NDR+R LP+GSL IK V RQDAGD
Sbjct  1321  DTFTATFKEDAKMPCLAVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNRQDAGD  1380

Query  1378  YTCMAENSIAKDSITHKLIVLAPPQSPQVLLTATTTDSLTLKLKQHDGDTAPIHGYTLHY  1437
             Y+C AENSIAKDSITHKLIVLAPPQSP V L+ATTTD+LT+KLK H+GDTAP+HGYTLHY
Sbjct  1381  YSCHAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGYTLHY  1440

Query  1438  KPEFGDWETVEVAVDAQKYTIENLFCGSRYQVYATGYNNIGAGEASDILNTRTKGSKPMM  1497
             KPEFG+WET EV+VD+QK+ IE L CGSRYQVYATG+NNIGAGEASDILNTRTKG KP +
Sbjct  1441  KPEFGEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKGQKPKL  1500

Query  1498  PENSKFIDPSSNTVTLHLPTWKDGGCRMSHFVVEYKKKDHAEWTQISNNVKPGGNFVVLD  1557
             PE  +FI+ SSN+V+LH   WKDGGC MSHFVVE KK+D  EW QISNNVKP  N+VVLD
Sbjct  1501  PEKPRFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKRDQIEWNQISNNVKPDNNYVVLD  1560

Query  1558  LDAASWYSVRITAHNSAGFTVAEYEFATLTVTGGTLAPPLNTAVLNGKTY----LPPWMP  1613
             L+ A+WY++RITAHNSAGFTVAEY+FATLTVTGGT+A PL+    +G  +    LP WMP
Sbjct  1561  LEPATWYNLRITAHNSAGFTVAEYDFATLTVTGGTIA-PLDDGSGHGNVHTRIRLPAWMP  1619

Query  1614  QWFDLNFMVPLIATIIVVFVGVLVICVALSRRRMEDPRGGPKDVYYDVVYNQPMGPGATM  1673
             +W DLNFMVPLIAT++VV VG+ V+CVALSRRR +D RGG KDVYYDVVYNQ MGPGAT+
Sbjct  1620  EWLDLNFMVPLIATVVVVAVGICVVCVALSRRRADDMRGGQKDVYYDVVYNQTMGPGATL  1679

Query  1674  DKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRGTVISRSMRSNHSTWDPRR--PL  1731
             DKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG      +RSNHSTWDPRR   L
Sbjct  1680  DKRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG---RGGLRSNHSTWDPRRNPNL  1736

Query  1732  YEELKPPPVPRR-----HYHGSDECYHTHPHPHPAGMEDEICPYATFHLLGFREEMDPTK  1786
             YEELK PPVP       H HG+ EC++ HP     GMEDEICPYATFHLLGFREEMDPTK
Sbjct  1737  YEELKAPPVPMHGNHYGHAHGNAECHYRHP-----GMEDEICPYATFHLLGFREEMDPTK  1791

Query  1787  AMNFQTFPHQNGHTG--PGHA-TMGPGGPPGHIHSRSGSQSMPRQNRYARKNSQGGQSSI  1843
             AMNFQTFPHQNGH G  PGHA TM P G PGH+HSRSGSQSMPR NRY RKNSQGGQSSI
Sbjct  1792  AMNFQTFPHQNGHAGPVPGHAGTMLPPGHPGHVHSRSGSQSMPRANRYQRKNSQGGQSSI  1851

Query  1844  YTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYGGPGPEYDDPANCAPEDDQYGSQYGAP  1903
             YTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLY GPGPEYDDPANCAPE+DQYGSQYG P
Sbjct  1852  YTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYSGPGPEYDDPANCAPEEDQYGSQYGGP  1911

Query  1904  YG--YDHYGSRGSVGRRSVGSARNLPNGSPEPPPPPPRNHDTSNSSFNDSKESNEISEAE  1961
             YG  YDHYGSRGS+GRRS+GSARN  NGSPEPPPPPPRNHD SNSSFNDSKESNEISEAE
Sbjct  1912  YGQPYDHYGSRGSMGRRSIGSARNPGNGSPEPPPPPPRNHDMSNSSFNDSKESNEISEAE  1971

Query  1962  CDRDH-PRGNYGENENSGDAKRSANTKDVRTTEEMRKLIDSRKSNEVAAKLQQQGGPAGL  2020
             CDRDH PRGNYG        KRS   KD RTTEEMRKLI+  ++     +LQQ  G AG 
Sbjct  1972  CDRDHGPRGNYGA------VKRSPQPKDQRTTEEMRKLIERNETGPKQLQLQQANG-AGF  2024

Query  2021  TAYDTLAV  2028
             TAYDT+AV
Sbjct  2025  TAYDTMAV  2032



Lambda      K        H
   0.314    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 27188552048


Query= XP_037024205.1 Down syndrome cell adhesion molecule-like protein
Dscam2 isoform X10 [Bradysia coprophila]

Length=2026
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q0E9H6_DROME  unnamed protein product                                 3350    0.0  
Q0E9I6_DROME  unnamed protein product                                 3335    0.0  
A0A0B4K828_DROME  unnamed protein product                             3335    0.0  


>Q0E9H6_DROME unnamed protein product
Length=2032

 Score = 3350 bits (8686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1639/2046 (80%), Positives = 1805/2046 (88%), Gaps = 41/2046 (2%)

Query  3     QRTKWITKIIFIAV-LVDLGS---TANT-EADTKGPMFLKEPINRIDFSNSTGSVVECRA  57
             +R KW+  ++F AV L+  GS    AN  +AD KGP+FLKEP NRIDFSNSTG+ +EC+A
Sbjct  6     ERLKWL--MLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAEIECKA  63

Query  58    SGNPAPEIIWVRSDGTAVGDVPGLRQVLSNGNLVFPPFRAEDYRQEVHAQVYACLAKNQF  117
             SGNP PEIIW+RSDGTAVGDVPGLRQ+ S+G LVFPPFRAEDYRQEVHAQVYACLA+NQF
Sbjct  64    SGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQF  123

Query  118   GSIISRDVNVRAVVAQHYDTDVNKAYVIRGNAGILKCEIPSYIIDFVHVVSWHTDKEESF  177
             GSIISRDV+VRAVVAQ+Y+ DVNK +VIRGN+ ++KC IPS++ DFV VVSWHTD+EE++
Sbjct  124   GSIISRDVHVRAVVAQYYEADVNKEHVIRGNSAVIKCLIPSFVADFVEVVSWHTDEEENY  183

Query  178   FPGTEYDGKYLVLPSGELHIKEVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVN  237
             FPG EYDGKYLVLPSGELHI+EVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPV 
Sbjct  184   FPGAEYDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVG  243

Query  238   SVAPKLTSGDKSRTLDSRRTHSITLLCPAQSSPLPNFRWYKFIEGTTRKQAVVLNDRVKQ  297
             SV PKLTSGD SRT+  R+  S+TLLCPAQ+ P+P +RWYKFIEGTTRKQAVVLNDRVKQ
Sbjct  244   SVGPKLTSGDDSRTVRIRQEDSVTLLCPAQAYPVPVYRWYKFIEGTTRKQAVVLNDRVKQ  303

Query  298   VSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPSQVVDFGRPAVF  357
             VSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPP+Q VDFGRPAVF
Sbjct  304   VSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFGRPAVF  363

Query  358   TCHFSGNPIKTVSWLKDGKKIGHTDAILRIESVKKEHKGMYQCFIRNDQESAEASAELKL  417
             TC ++GNPIKTVSW+KDGK IGH++ +LRIESVKKE KGMYQCF+RNDQESAEASAELKL
Sbjct  364   TCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEASAELKL  423

Query  418   GGRFDPPIIRQAFPEETLHPGPSVFLKCVAGGLPTPEISWELDGKKIANSERYQVGQYVT  477
             GGRFDPP+IRQAF EET+ PGPSVFLKCVAGG PTPEISWELDGKKIAN++RYQVGQYVT
Sbjct  424   GGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQVGQYVT  483

Query  478   VNGDVVSYLNITSIHANDGGLYKCIASSKVGVAEHSAKLNVYGLPYIRPMEKKAIVAGEN  537
             VNGDVVSYLNITS+HANDGGLYKCIA SKVGVAEHSAKLNVYGLPYIR MEKKAIVAGE 
Sbjct  484   VNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKAIVAGET  543

Query  538   LIVTCPVAGYPIESIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKNSE  597
             LIVTCPVAGYPI+SIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKN E
Sbjct  544   LIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKNQE  603

Query  598   GYSARGALEVQVMVAPMILPFSFGDEAANPGDSTAVNCMITKGDLPLNIKWTLNGQPVVN  657
             GYSARG+LEVQVMV P I PFSFGD+  N G++  V CM+ KGD+P+ IKWTLN +P++N
Sbjct  604   GYSARGSLEVQVMVPPSIAPFSFGDDPVNTGENAGVQCMVQKGDVPITIKWTLNSRPIIN  663

Query  658   GENGLQVVKMSSRLSSLSIESLGDRHRGTFRCIASNDAGETNYSSELNINVPPRWILEPT  717
             GE G+ ++K+S + S L+I ++   HRG F+CIA N AG +  +SEL +NVPPRWILEPT
Sbjct  664   GEEGITILKLSPKTSVLNIAAVEQDHRGVFKCIAENKAGSSFTTSELKVNVPPRWILEPT  723

Query  718   DKAFAQGSDAKVECKSDGFPKPQVTWKKAVGDTPGEYKDMKQSNNIRVDEGTLYIDNIQK  777
             DKAFAQGSDAKVECK+DGFPKPQVTWKKAVGDTPGEYKD+K+S+NIRV+EGTL++DNIQK
Sbjct  724   DKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHVDNIQK  783

Query  778   NNEGYYLCEAINGIGSGLSAVILISVQAPPEFVEKLRNQTARRSEPAVLQCEAKGEKPIG  837
              NEGYYLCEAINGIGSGLSAVI+ISVQAPPEF EKLRNQTARR EPAVLQCEAKGEKPIG
Sbjct  784   TNEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKGEKPIG  843

Query  838   ILWNMNNMRLDPKTDNRYTIREEILSTGVMSSLSIKRTERTDSALFTCVATNAFGSDDAS  897
             ILWNMNNMRLDPK DNRYTIREEILSTGVMSSLSIKRTER+DSALFTCVATNAFGSDDAS
Sbjct  844   ILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAFGSDDAS  903

Query  898   INMIIQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLKRYIIEFKTSRGSWEHDVDRV  957
             INMI+QEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPL RYIIEFK SR SW  ++DRV
Sbjct  904   INMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWS-EIDRV  962

Query  958   IVPGHTNEAQVQKLNPATTYNIRIVAENEIGVSDSSEVVPIITAEEAPSGKPQSIKVEPL  1017
             IVPGHT EAQVQKL+PATTYNIRIVAEN IG S SSE V IITAEEAPSGKPQ+IKVEP+
Sbjct  963   IVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNIKVEPV  1022

Query  1018  SQTSLRVLWKAPPRSDWNGEILGYYVGYKLTNNNGSYYFEDYKYMMEEGKEYSYELTNLK  1077
             +QT++RV WK PPR++WNGEILGYYVGYKL+N N SY FE   ++ EEGKE++ EL NL+
Sbjct  1023  NQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLELQNLR  1082

Query  1078  TYTQYSVVIQAYNKVGAGPLSEDEKQYTAEGTPDQPPSDITCTTLTSQTIRVSWVSPPLE  1137
              YTQYSVVIQA+NK+GAGPLSE+EKQ+TAEGTP QPPSD  CTTLTSQTIRV WVSPPLE
Sbjct  1083  VYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWVSPPLE  1142

Query  1138  SANGVIKGYKVVYAPSELWYDDKNKDYKKTASSDTVLHGLKKYTNYTMQVLATTSGGDGV  1197
             SANGVIK YKVVYAPS+ WYD+  + YKKTASSDTVLHGLKKYTNYTMQVLATT+GGDGV
Sbjct  1143  SANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTAGGDGV  1202

Query  1198  RSPPIHCQTEQDVPEAPTAVKALVVGSEAILVSWLPPAQPNGLITQYTVYSKEEGTESEV  1257
             RS PIHCQTE DVPEAPT VKALV+G+ AILVSW PPAQPNG+ITQYTVYSK EG E+E 
Sbjct  1203  RSVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEGAETET  1262

Query  1258  KSHKVPPYQMSYEASSLDKNKPFEFWVTANTNIGEGQASKSIVAMPSDKVPAKIASFDDT  1317
             K+ KVP YQMS+EA+ L+KNKP+EFWVTA+T IGEGQ SKSIVAMPSD+VPAKIASFDDT
Sbjct  1263  KTQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIASFDDT  1322

Query  1318  FTAIFKEDFKLPCLAVGAPAPDITWKVKGVEFVPNDRVRQLPEGSLSIKDVIRQDAGDYT  1377
             FTA FKED K+PCLAVGAP P+ITWK+KGVEF  NDR+R LP+GSL IK V RQDAGDY+
Sbjct  1323  FTATFKEDAKMPCLAVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNRQDAGDYS  1382

Query  1378  CMAENSIAKDSITHKLIVLAPPQSPQVLLTATTTDSLTLKLKQHDGDTAPIHGYTLHYKP  1437
             C AENSIAKDSITHKLIVLAPPQSP V L+ATTTD+LT+KLK H+GDTAP+HGYTLHYKP
Sbjct  1383  CHAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGYTLHYKP  1442

Query  1438  EFGDWETVEVAVDAQKYTIENLFCGSRYQVYATGYNNIGAGEASDILNTRTKGSKPMMPE  1497
             EFG+WET EV+VD+QK+ IE L CGSRYQVYATG+NNIGAGEASDILNTRTKG KP +PE
Sbjct  1443  EFGEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKGQKPKLPE  1502

Query  1498  NSKFIDPSSNTVTLHLPTWKDGGCRMSHFVVEYKKKDHAEWTQISNNVKPGGNFVVLDLD  1557
               +FI+ SSN+V+LH   WKDGGC MSHFVVE KK+D  EW QISNNVKP  N+VVLDL+
Sbjct  1503  KPRFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKRDQIEWNQISNNVKPDNNYVVLDLE  1562

Query  1558  AASWYSVRITAHNSAGFTVAEYEFATLTVTGGTLAPPLNTAVLNGKTY----LPPWMPQW  1613
              A+WY++RITAHNSAGFTVAEY+FATLTVTGGT+A PL+    +G  +    LP WMP+W
Sbjct  1563  PATWYNLRITAHNSAGFTVAEYDFATLTVTGGTIA-PLDDGSGHGNVHTRIRLPAWMPEW  1621

Query  1614  FDLNFMVPLIATIIVVFVGVLVICVALSRRRMEDPRGGPKDVYYDVVYNQPMGPGATMDK  1673
              DLNFMVPLIAT++VV VG+ V+CVALSRRR +D RGG KDVYYDVVYNQ MGPGAT+DK
Sbjct  1622  LDLNFMVPLIATVVVVAVGICVVCVALSRRRADDMRGGQKDVYYDVVYNQTMGPGATLDK  1681

Query  1674  RRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRGTVISRSMRSNHSTWDPRR--PLYE  1731
             RRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG      +RSNHSTWDPRR   LYE
Sbjct  1682  RRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG---RGGLRSNHSTWDPRRNPNLYE  1738

Query  1732  ELKPPPVPRR-----HYHGSDECYHTHPHPHPAGMEDEICPYATFHLLGFREEMDPTKAM  1786
             ELK PPVP       H HG+ EC++ HP     GMEDEICPYATFHLLGFREEMDPTKAM
Sbjct  1739  ELKAPPVPMHGNHYGHAHGNAECHYRHP-----GMEDEICPYATFHLLGFREEMDPTKAM  1793

Query  1787  NFQTFPHQNGHTG--PGHA-TMGPGGPPGHIHSRSGSQSMPRQNRYARKNSQGGQSSIYT  1843
             NFQTFPHQNGH G  PGHA TM P G PGH+HSRSGSQSMPR NRY RKNSQGGQSSIYT
Sbjct  1794  NFQTFPHQNGHAGPVPGHAGTMLPPGHPGHVHSRSGSQSMPRANRYQRKNSQGGQSSIYT  1853

Query  1844  PAPEYDDPANCAEEDQYRRYTRVNSQGGSLYGGPGPEYDDPANCAPEDDQYGSQYGAPYG  1903
             PAPEYDDPANCAEEDQYRRYTRVNSQGGSLY GPGPEYDDPANCAPE+DQYGSQYG PYG
Sbjct  1854  PAPEYDDPANCAEEDQYRRYTRVNSQGGSLYSGPGPEYDDPANCAPEEDQYGSQYGGPYG  1913

Query  1904  --YDHYGSRGSVGRRSVGSARNLPNGSPEPPPPPPRNHDTSNSSFNDSKESNEISEAECD  1961
               YDHYGSRGS+GRRS+GSARN  NGSPEPPPPPPRNHD SNSSFNDSKESNEISEAECD
Sbjct  1914  QPYDHYGSRGSMGRRSIGSARNPGNGSPEPPPPPPRNHDMSNSSFNDSKESNEISEAECD  1973

Query  1962  RDH-PRGNYGENENSGDAKRSANTKDVRTTEEMRKLIDSRKSNEVAAKLQQQGGPAGLTA  2020
             RDH PRGNYG        KRS   KD RTTEEMRKLI+  ++     +LQQ  G AG TA
Sbjct  1974  RDHGPRGNYGA------VKRSPQPKDQRTTEEMRKLIERNETGPKQLQLQQANG-AGFTA  2026

Query  2021  YDTLAV  2026
             YDT+AV
Sbjct  2027  YDTMAV  2032


>Q0E9I6_DROME unnamed protein product
Length=2032

 Score = 3335 bits (8648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1640/2046 (80%), Positives = 1798/2046 (88%), Gaps = 41/2046 (2%)

Query  3     QRTKWITKIIFIAV-LVDLGS---TANT-EADTKGPMFLKEPINRIDFSNSTGSVVECRA  57
             +R KW+  ++F AV L+  GS    AN  +AD KGP+FLKEP NRIDFSNSTG+ +EC+A
Sbjct  6     ERLKWL--MLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAEIECKA  63

Query  58    SGNPAPEIIWVRSDGTAVGDVPGLRQVLSNGNLVFPPFRAEDYRQEVHAQVYACLAKNQF  117
             SGNP PEIIW+RSDGTAVGDVPGLRQ+ S+G LVFPPFRAEDYRQEVHAQVYACLA+NQF
Sbjct  64    SGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQF  123

Query  118   GSIISRDVNVRAVVAQHYDTDVNKAYVIRGNAGILKCEIPSYIIDFVHVVSWHTDKEESF  177
             GSIISRDV+VRAVVAQ+YDTDVNKAYVIRGNA +LKCEIPS++ DFV VVSWHTD+ E F
Sbjct  124   GSIISRDVHVRAVVAQYYDTDVNKAYVIRGNAAVLKCEIPSFVADFVSVVSWHTDQNEDF  183

Query  178   FPGTEYDGKYLVLPSGELHIKEVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVN  237
              PG+EYDGKYLVLPSGELHI+EVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPV 
Sbjct  184   LPGSEYDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVG  243

Query  238   SVAPKLTSGDKSRTLDSRRTHSITLLCPAQSSPLPNFRWYKFIEGTTRKQAVVLNDRVKQ  297
             SVAPK+   D+           + L CPAQS P+P +RWYKFIEGTTRKQAVVLNDRVKQ
Sbjct  244   SVAPKVNKNDEFSHDRIAIGGMVALRCPAQSFPVPVYRWYKFIEGTTRKQAVVLNDRVKQ  303

Query  298   VSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPSQVVDFGRPAVF  357
             VSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPP+Q VDFGRPAVF
Sbjct  304   VSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFGRPAVF  363

Query  358   TCHFSGNPIKTVSWLKDGKKIGHTDAILRIESVKKEHKGMYQCFIRNDQESAEASAELKL  417
             TC ++GNPIKTVSW+KDGK IGH++ +LRIESVKKE KGMYQCF+RNDQESAEASAELKL
Sbjct  364   TCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEASAELKL  423

Query  418   GGRFDPPIIRQAFPEETLHPGPSVFLKCVAGGLPTPEISWELDGKKIANSERYQVGQYVT  477
             GGRFDPP+IRQAF EET+ PGPSVFLKCVAGG PTPEISWELDGKKIAN++RYQVGQYVT
Sbjct  424   GGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQVGQYVT  483

Query  478   VNGDVVSYLNITSIHANDGGLYKCIASSKVGVAEHSAKLNVYGLPYIRPMEKKAIVAGEN  537
             VNGDVVSYLNITS+HANDGGLYKCIA SKVGVAEHSAKLNVYGLPYIR MEKKAIVAGE 
Sbjct  484   VNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKAIVAGET  543

Query  538   LIVTCPVAGYPIESIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKNSE  597
             LIVTCPVAGYPI+SIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKN E
Sbjct  544   LIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKNQE  603

Query  598   GYSARGALEVQVMVAPMILPFSFGDEAANPGDSTAVNCMITKGDLPLNIKWTLNGQPVVN  657
             GYSARG+LEVQVMVAP I PFSFGDE  N G+  +VNC++ KGDLPL+I WTLN   +VN
Sbjct  604   GYSARGSLEVQVMVAPQISPFSFGDEPLNRGEVASVNCVVPKGDLPLDIYWTLNSALIVN  663

Query  658   GENGLQVVKMSSRLSSLSIESLGDRHRGTFRCIASNDAGETNYSSELNINVPPRWILEPT  717
             GE G  +V+++ R SSL+++SL   HRG+++CIA+N AG   Y S L++NVPPRWILEPT
Sbjct  664   GEMGFTLVRLNKRTSSLNVDSLEAVHRGSYKCIANNSAGYAEYVSTLDVNVPPRWILEPT  723

Query  718   DKAFAQGSDAKVECKSDGFPKPQVTWKKAVGDTPGEYKDMKQSNNIRVDEGTLYIDNIQK  777
             DKAFAQGSDAKVECK+DGFPKPQVTWKKAVGDTPGEYKD+K+S+NIRV+EGTL++DNIQK
Sbjct  724   DKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHVDNIQK  783

Query  778   NNEGYYLCEAINGIGSGLSAVILISVQAPPEFVEKLRNQTARRSEPAVLQCEAKGEKPIG  837
              NEGYYLCEAINGIGSGLSAVI+ISVQAPPEF EKLRNQTARR EPAVLQCEAKGEKPIG
Sbjct  784   TNEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKGEKPIG  843

Query  838   ILWNMNNMRLDPKTDNRYTIREEILSTGVMSSLSIKRTERTDSALFTCVATNAFGSDDAS  897
             ILWNMNNMRLDPK DNRYTIREEILSTGVMSSLSIKRTER+DSALFTCVATNAFGSDDAS
Sbjct  844   ILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAFGSDDAS  903

Query  898   INMIIQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLKRYIIEFKTSRGSWEHDVDRV  957
             INMI+QEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPL RYIIEFK SR SW  ++DRV
Sbjct  904   INMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWS-EIDRV  962

Query  958   IVPGHTNEAQVQKLNPATTYNIRIVAENEIGVSDSSEVVPIITAEEAPSGKPQSIKVEPL  1017
             IVPGHT EAQVQKL+PATTYNIRIVAEN IG S SSE V IITAEEAPSGKPQ+IKVEP+
Sbjct  963   IVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNIKVEPV  1022

Query  1018  SQTSLRVLWKAPPRSDWNGEILGYYVGYKLTNNNGSYYFEDYKYMMEEGKEYSYELTNLK  1077
             +QT++RV WK PPR++WNGEILGYYVGYKL+N N SY FE   ++ EEGKE++ EL NL+
Sbjct  1023  NQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLELQNLR  1082

Query  1078  TYTQYSVVIQAYNKVGAGPLSEDEKQYTAEGTPDQPPSDITCTTLTSQTIRVSWVSPPLE  1137
              YTQYSVVIQA+NK+GAGPLSE+EKQ+TAEGTP QPPSD  CTTLTSQTIRV WVSPPLE
Sbjct  1083  VYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWVSPPLE  1142

Query  1138  SANGVIKGYKVVYAPSELWYDDKNKDYKKTASSDTVLHGLKKYTNYTMQVLATTSGGDGV  1197
             SANGVIK YKVVYAPS+ WYD+  + YKKTASSDTVLHGLKKYTNYTMQVLATT+GGDGV
Sbjct  1143  SANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTAGGDGV  1202

Query  1198  RSPPIHCQTEQDVPEAPTAVKALVVGSEAILVSWLPPAQPNGLITQYTVYSKEEGTESEV  1257
             RS PIHCQTE DVPEAPT VKALV+G+ AILVSW PPAQPNG+ITQYTVYSK EG E+E 
Sbjct  1203  RSVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEGAETET  1262

Query  1258  KSHKVPPYQMSYEASSLDKNKPFEFWVTANTNIGEGQASKSIVAMPSDKVPAKIASFDDT  1317
             K+ KVP YQMS+EA+ L+KNKP+EFWVTA+T IGEGQ SKSIVAMPSD+VPAKIASFDDT
Sbjct  1263  KTQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIASFDDT  1322

Query  1318  FTAIFKEDFKLPCLAVGAPAPDITWKVKGVEFVPNDRVRQLPEGSLSIKDVIRQDAGDYT  1377
             FTA FKED K+PCLAVGAP P+ITWK+KGVEF  NDR+R LP+GSL IK V RQDAGDY+
Sbjct  1323  FTATFKEDAKMPCLAVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNRQDAGDYS  1382

Query  1378  CMAENSIAKDSITHKLIVLAPPQSPQVLLTATTTDSLTLKLKQHDGDTAPIHGYTLHYKP  1437
             C AENSIAKDSITHKLIVLAPPQSP V L+ATTTD+LT+KLK H+GDTAP+HGYTLHYKP
Sbjct  1383  CHAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGYTLHYKP  1442

Query  1438  EFGDWETVEVAVDAQKYTIENLFCGSRYQVYATGYNNIGAGEASDILNTRTKGSKPMMPE  1497
             EFG+WET EV+VD+QK+ IE L CGSRYQVYATG+NNIGAGEASDILNTRTKG KP +PE
Sbjct  1443  EFGEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKGQKPKLPE  1502

Query  1498  NSKFIDPSSNTVTLHLPTWKDGGCRMSHFVVEYKKKDHAEWTQISNNVKPGGNFVVLDLD  1557
               +FI+ SSN+V+LH   WKDGGC MSHFVVE KK+D  EW QISNNVKP  N+VVLDL+
Sbjct  1503  KPRFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKRDQIEWNQISNNVKPDNNYVVLDLE  1562

Query  1558  AASWYSVRITAHNSAGFTVAEYEFATLTVTGGTLAPPLNTAVLNGKTY----LPPWMPQW  1613
              A+WY++RITAHNSAGFTVAEY+FATLTVTGGT+A PL+    +G  +    LP WMP+W
Sbjct  1563  PATWYNLRITAHNSAGFTVAEYDFATLTVTGGTIA-PLDDGSGHGNVHTRIRLPAWMPEW  1621

Query  1614  FDLNFMVPLIATIIVVFVGVLVICVALSRRRMEDPRGGPKDVYYDVVYNQPMGPGATMDK  1673
              DLNFMVPLIAT++VV VG+ V+CVALSRRR +D RGG KDVYYDVVYNQ MGPGAT+DK
Sbjct  1622  LDLNFMVPLIATVVVVAVGICVVCVALSRRRADDMRGGQKDVYYDVVYNQTMGPGATLDK  1681

Query  1674  RRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRGTVISRSMRSNHSTWDPRR--PLYE  1731
             RRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG      +RSNHSTWDPRR   LYE
Sbjct  1682  RRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG---RGGLRSNHSTWDPRRNPNLYE  1738

Query  1732  ELKPPPVPRR-----HYHGSDECYHTHPHPHPAGMEDEICPYATFHLLGFREEMDPTKAM  1786
             ELK PPVP       H HG+ EC++ HP     GMEDEICPYATFHLLGFREEMDPTKAM
Sbjct  1739  ELKAPPVPMHGNHYGHAHGNAECHYRHP-----GMEDEICPYATFHLLGFREEMDPTKAM  1793

Query  1787  NFQTFPHQNGHTG--PGHA-TMGPGGPPGHIHSRSGSQSMPRQNRYARKNSQGGQSSIYT  1843
             NFQTFPHQNGH G  PGHA TM P G PGH+HSRSGSQSMPR NRY RKNSQGGQSSIYT
Sbjct  1794  NFQTFPHQNGHAGPVPGHAGTMLPPGHPGHVHSRSGSQSMPRANRYQRKNSQGGQSSIYT  1853

Query  1844  PAPEYDDPANCAEEDQYRRYTRVNSQGGSLYGGPGPEYDDPANCAPEDDQYGSQYGAPYG  1903
             PAPEYDDPANCAEEDQYRRYTRVNSQGGSLY GPGPEYDDPANCAPE+DQYGSQYG PYG
Sbjct  1854  PAPEYDDPANCAEEDQYRRYTRVNSQGGSLYSGPGPEYDDPANCAPEEDQYGSQYGGPYG  1913

Query  1904  --YDHYGSRGSVGRRSVGSARNLPNGSPEPPPPPPRNHDTSNSSFNDSKESNEISEAECD  1961
               YDHYGSRGS+GRRS+GSARN  NGSPEPPPPPPRNHD SNSSFNDSKESNEISEAECD
Sbjct  1914  QPYDHYGSRGSMGRRSIGSARNPGNGSPEPPPPPPRNHDMSNSSFNDSKESNEISEAECD  1973

Query  1962  RDH-PRGNYGENENSGDAKRSANTKDVRTTEEMRKLIDSRKSNEVAAKLQQQGGPAGLTA  2020
             RDH PRGNYG        KRS   KD RTTEEMRKLI+  ++     +LQQ  G AG TA
Sbjct  1974  RDHGPRGNYGA------VKRSPQPKDQRTTEEMRKLIERNETGPKQLQLQQANG-AGFTA  2026

Query  2021  YDTLAV  2026
             YDT+AV
Sbjct  2027  YDTMAV  2032


>A0A0B4K828_DROME unnamed protein product
Length=2032

 Score = 3335 bits (8647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1639/2046 (80%), Positives = 1796/2046 (88%), Gaps = 41/2046 (2%)

Query  3     QRTKWITKIIFIAV-LVDLGS---TANT-EADTKGPMFLKEPINRIDFSNSTGSVVECRA  57
             +R KW+  ++F AV L+  GS    AN  +AD KGP+FLKEP NRIDFSNSTG+ +EC+A
Sbjct  6     ERLKWL--MLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAEIECKA  63

Query  58    SGNPAPEIIWVRSDGTAVGDVPGLRQVLSNGNLVFPPFRAEDYRQEVHAQVYACLAKNQF  117
             SGNP PEIIW+RSDGTAVGDVPGLRQ+ S+G LVFPPFRAEDYRQEVHAQVYACLA+NQF
Sbjct  64    SGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQF  123

Query  118   GSIISRDVNVRAVVAQHYDTDVNKAYVIRGNAGILKCEIPSYIIDFVHVVSWHTDKEESF  177
             GSIISRDV+VRAVVAQ+YDTDVNKAYVIRGNA +LKCEIPS++ DFV VVSWHTD+ E F
Sbjct  124   GSIISRDVHVRAVVAQYYDTDVNKAYVIRGNAAVLKCEIPSFVADFVSVVSWHTDQNEDF  183

Query  178   FPGTEYDGKYLVLPSGELHIKEVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVN  237
              PG+EYDGKYLVLPSGELHI+EVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPV+
Sbjct  184   LPGSEYDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVS  243

Query  238   SVAPKLTSGDKSRTLDSRRTHSITLLCPAQSSPLPNFRWYKFIEGTTRKQAVVLNDRVKQ  297
             +  P   S  KS T       S  LLC AQ+ P+P  RWYKFIEGTTRKQAVVLNDRVKQ
Sbjct  244   AKGPTFASDMKSYTFVRHFGQSFALLCQAQAYPVPLIRWYKFIEGTTRKQAVVLNDRVKQ  303

Query  298   VSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPSQVVDFGRPAVF  357
             VSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPP+Q VDFGRPAVF
Sbjct  304   VSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFGRPAVF  363

Query  358   TCHFSGNPIKTVSWLKDGKKIGHTDAILRIESVKKEHKGMYQCFIRNDQESAEASAELKL  417
             TC ++GNPIKTVSW+KDGK IGH++ +LRIESVKKE KGMYQCF+RNDQESAEASAELKL
Sbjct  364   TCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEASAELKL  423

Query  418   GGRFDPPIIRQAFPEETLHPGPSVFLKCVAGGLPTPEISWELDGKKIANSERYQVGQYVT  477
             GGRFDPP+IRQAF EET+ PGPSVFLKCVAGG PTPEISWELDGKKIAN++RYQVGQYVT
Sbjct  424   GGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQVGQYVT  483

Query  478   VNGDVVSYLNITSIHANDGGLYKCIASSKVGVAEHSAKLNVYGLPYIRPMEKKAIVAGEN  537
             VNGDVVSYLNITS+HANDGGLYKCIA SKVGVAEHSAKLNVYGLPYIR MEKKAIVAGE 
Sbjct  484   VNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKAIVAGET  543

Query  538   LIVTCPVAGYPIESIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKNSE  597
             LIVTCPVAGYPI+SIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKN E
Sbjct  544   LIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKNQE  603

Query  598   GYSARGALEVQVMVAPMILPFSFGDEAANPGDSTAVNCMITKGDLPLNIKWTLNGQPVVN  657
             GYSARG+LEVQVMVAP I PFSFGDE  N G+  +VNC++ KGDLPL+I WTLN   +VN
Sbjct  604   GYSARGSLEVQVMVAPQISPFSFGDEPLNRGEVASVNCVVPKGDLPLDIYWTLNSALIVN  663

Query  658   GENGLQVVKMSSRLSSLSIESLGDRHRGTFRCIASNDAGETNYSSELNINVPPRWILEPT  717
             GE G  +V+++ R SSL+++SL   HRG+++CIA+N AG   Y S L++NVPPRWILEPT
Sbjct  664   GEMGFTLVRLNKRTSSLNVDSLEAVHRGSYKCIANNSAGYAEYVSTLDVNVPPRWILEPT  723

Query  718   DKAFAQGSDAKVECKSDGFPKPQVTWKKAVGDTPGEYKDMKQSNNIRVDEGTLYIDNIQK  777
             DKAFAQGSDAKVECK+DGFPKPQVTWKKAVGDTPGEYKD+K+S+NIRV+EGTL++DNIQK
Sbjct  724   DKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHVDNIQK  783

Query  778   NNEGYYLCEAINGIGSGLSAVILISVQAPPEFVEKLRNQTARRSEPAVLQCEAKGEKPIG  837
              NEGYYLCEAINGIGSGLSAVI+ISVQAPPEF EKLRNQTARR EPAVLQCEAKGEKPIG
Sbjct  784   TNEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKGEKPIG  843

Query  838   ILWNMNNMRLDPKTDNRYTIREEILSTGVMSSLSIKRTERTDSALFTCVATNAFGSDDAS  897
             ILWNMNNMRLDPK DNRYTIREEILSTGVMSSLSIKRTER+DSALFTCVATNAFGSDDAS
Sbjct  844   ILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAFGSDDAS  903

Query  898   INMIIQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLKRYIIEFKTSRGSWEHDVDRV  957
             INMI+QEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPL RYIIEFK SR SW  ++DRV
Sbjct  904   INMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWS-EIDRV  962

Query  958   IVPGHTNEAQVQKLNPATTYNIRIVAENEIGVSDSSEVVPIITAEEAPSGKPQSIKVEPL  1017
             IVPGHT EAQVQKL+PATTYNIRIVAEN IG S SSE V IITAEEAPSGKPQ+IKVEP+
Sbjct  963   IVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNIKVEPV  1022

Query  1018  SQTSLRVLWKAPPRSDWNGEILGYYVGYKLTNNNGSYYFEDYKYMMEEGKEYSYELTNLK  1077
             +QT++RV WK PPR++WNGEILGYYVGYKL+N N SY FE   ++ EEGKE++ EL NL+
Sbjct  1023  NQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLELQNLR  1082

Query  1078  TYTQYSVVIQAYNKVGAGPLSEDEKQYTAEGTPDQPPSDITCTTLTSQTIRVSWVSPPLE  1137
              YTQYSVVIQA+NK+GAGPLSE+EKQ+TAEGTP QPPSD  CTTLTSQTIRV WVSPPLE
Sbjct  1083  VYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWVSPPLE  1142

Query  1138  SANGVIKGYKVVYAPSELWYDDKNKDYKKTASSDTVLHGLKKYTNYTMQVLATTSGGDGV  1197
             SANGVIK YKVVYAPS+ WYD+  + YKKTASSDTVLHGLKKYTNYTMQVLATT+GGDGV
Sbjct  1143  SANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTAGGDGV  1202

Query  1198  RSPPIHCQTEQDVPEAPTAVKALVVGSEAILVSWLPPAQPNGLITQYTVYSKEEGTESEV  1257
             RS PIHCQTE DVPEAPT VKALV+G+ AILVSW PPAQPNG+ITQYTVYSK EG E+E 
Sbjct  1203  RSVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEGAETET  1262

Query  1258  KSHKVPPYQMSYEASSLDKNKPFEFWVTANTNIGEGQASKSIVAMPSDKVPAKIASFDDT  1317
             K+ KVP YQMS+EA+ L+KNKP+EFWVTA+T IGEGQ SKSIVAMPSD+VPAKIASFDDT
Sbjct  1263  KTQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIASFDDT  1322

Query  1318  FTAIFKEDFKLPCLAVGAPAPDITWKVKGVEFVPNDRVRQLPEGSLSIKDVIRQDAGDYT  1377
             FTA FKED K+PCLAVGAP P+ITWK+KGVEF  NDR+R LP+GSL IK V RQDAGDY+
Sbjct  1323  FTATFKEDAKMPCLAVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNRQDAGDYS  1382

Query  1378  CMAENSIAKDSITHKLIVLAPPQSPQVLLTATTTDSLTLKLKQHDGDTAPIHGYTLHYKP  1437
             C AENSIAKDSITHKLIVLAPPQSP V L+ATTTD+LT+KLK H+GDTAP+HGYTLHYKP
Sbjct  1383  CHAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGYTLHYKP  1442

Query  1438  EFGDWETVEVAVDAQKYTIENLFCGSRYQVYATGYNNIGAGEASDILNTRTKGSKPMMPE  1497
             EFG+WET EV+VD+QK+ IE L CGSRYQVYATG+NNIGAGEASDILNTRTKG KP +PE
Sbjct  1443  EFGEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKGQKPKLPE  1502

Query  1498  NSKFIDPSSNTVTLHLPTWKDGGCRMSHFVVEYKKKDHAEWTQISNNVKPGGNFVVLDLD  1557
               +FI+ SSN+V+LH   WKDGGC MSHFVVE KK+D  EW QISNNVKP  N+VVLDL+
Sbjct  1503  KPRFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKRDQIEWNQISNNVKPDNNYVVLDLE  1562

Query  1558  AASWYSVRITAHNSAGFTVAEYEFATLTVTGGTLAPPLNTAVLNGKTY----LPPWMPQW  1613
              A+WY++RITAHNSAGFTVAEY+FATLTVTGGT+A PL+    +G  +    LP WMP+W
Sbjct  1563  PATWYNLRITAHNSAGFTVAEYDFATLTVTGGTIA-PLDDGSGHGNVHTRIRLPAWMPEW  1621

Query  1614  FDLNFMVPLIATIIVVFVGVLVICVALSRRRMEDPRGGPKDVYYDVVYNQPMGPGATMDK  1673
              DLNFMVPLIAT++VV VG+ V+CVALSRRR +D RGG KDVYYDVVYNQ MGPGAT+DK
Sbjct  1622  LDLNFMVPLIATVVVVAVGICVVCVALSRRRADDMRGGQKDVYYDVVYNQTMGPGATLDK  1681

Query  1674  RRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRGTVISRSMRSNHSTWDPRR--PLYE  1731
             RRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG      +RSNHSTWDPRR   LYE
Sbjct  1682  RRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG---RGGLRSNHSTWDPRRNPNLYE  1738

Query  1732  ELKPPPVPRR-----HYHGSDECYHTHPHPHPAGMEDEICPYATFHLLGFREEMDPTKAM  1786
             ELK PPVP       H HG+ EC++ HP     GMEDEICPYATFHLLGFREEMDPTKAM
Sbjct  1739  ELKAPPVPMHGNHYGHAHGNAECHYRHP-----GMEDEICPYATFHLLGFREEMDPTKAM  1793

Query  1787  NFQTFPHQNGHTG--PGHA-TMGPGGPPGHIHSRSGSQSMPRQNRYARKNSQGGQSSIYT  1843
             NFQTFPHQNGH G  PGHA TM P G PGH+HSRSGSQSMPR NRY RKNSQGGQSSIYT
Sbjct  1794  NFQTFPHQNGHAGPVPGHAGTMLPPGHPGHVHSRSGSQSMPRANRYQRKNSQGGQSSIYT  1853

Query  1844  PAPEYDDPANCAEEDQYRRYTRVNSQGGSLYGGPGPEYDDPANCAPEDDQYGSQYGAPYG  1903
             PAPEYDDPANCAEEDQYRRYTRVNSQGGSLY GPGPEYDDPANCAPE+DQYGSQYG PYG
Sbjct  1854  PAPEYDDPANCAEEDQYRRYTRVNSQGGSLYSGPGPEYDDPANCAPEEDQYGSQYGGPYG  1913

Query  1904  --YDHYGSRGSVGRRSVGSARNLPNGSPEPPPPPPRNHDTSNSSFNDSKESNEISEAECD  1961
               YDHYGSRGS+GRRS+GSARN  NGSPEPPPPPPRNHD SNSSFNDSKESNEISEAECD
Sbjct  1914  QPYDHYGSRGSMGRRSIGSARNPGNGSPEPPPPPPRNHDMSNSSFNDSKESNEISEAECD  1973

Query  1962  RDH-PRGNYGENENSGDAKRSANTKDVRTTEEMRKLIDSRKSNEVAAKLQQQGGPAGLTA  2020
             RDH PRGNYG        KRS   KD RTTEEMRKLI+  ++     +LQQ  G AG TA
Sbjct  1974  RDHGPRGNYGA------VKRSPQPKDQRTTEEMRKLIERNETGPKQLQLQQANG-AGFTA  2026

Query  2021  YDTLAV  2026
             YDT+AV
Sbjct  2027  YDTMAV  2032



Lambda      K        H
   0.314    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 27188552048


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jul 7, 2021  1:54 PM
  Number of letters in database: 17,197,330
  Number of sequences in database:  25,232



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= XP_037024206.1 Down syndrome cell adhesion molecule-like protein
Dscam2 isoform X11 [Bradysia coprophila]

Length=2026
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q0E9I6_DROME  unnamed protein product                                 3346    0.0  
Q0E9H6_DROME  unnamed protein product                                 3341    0.0  
A0A0B4K828_DROME  unnamed protein product                             3333    0.0  


>Q0E9I6_DROME unnamed protein product
Length=2032

 Score = 3346 bits (8675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1643/2046 (80%), Positives = 1802/2046 (88%), Gaps = 41/2046 (2%)

Query  3     QRTKWITKIIFIAV-LVDLGS---TANT-EADTKGPMFLKEPINRIDFSNSTGSVVECRA  57
             +R KW+  ++F AV L+  GS    AN  +AD KGP+FLKEP NRIDFSNSTG+ +EC+A
Sbjct  6     ERLKWL--MLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAEIECKA  63

Query  58    SGNPAPEIIWVRSDGTAVGDVPGLRQVLSNGNLVFPPFRAEDYRQEVHAQVYACLAKNQF  117
             SGNP PEIIW+RSDGTAVGDVPGLRQ+ S+G LVFPPFRAEDYRQEVHAQVYACLA+NQF
Sbjct  64    SGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQF  123

Query  118   GSIISRDVNVRAVVAQHYDTDVNKAYVIRGNAGILKCEIPSYIIDFVHVVSWHTDKEESF  177
             GSIISRDV+VRAVVAQ+YDTDVNKAYVIRGNA +LKCEIPS++ DFV VVSWHTD+ E F
Sbjct  124   GSIISRDVHVRAVVAQYYDTDVNKAYVIRGNAAVLKCEIPSFVADFVSVVSWHTDQNEDF  183

Query  178   FPGTEYDGKYLVLPSGELHIKEVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVG  237
              PG+EYDGKYLVLPSGELHI+EVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVG
Sbjct  184   LPGSEYDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVG  243

Query  238   SVSPKFNAADELNIVRSKMTQDICLLCPAQSYPTPISRWYKFIEGTTRKQAVVLNDRVKQ  297
             SV+PK N  DE +  R  +   + L CPAQS+P P+ RWYKFIEGTTRKQAVVLNDRVKQ
Sbjct  244   SVAPKVNKNDEFSHDRIAIGGMVALRCPAQSFPVPVYRWYKFIEGTTRKQAVVLNDRVKQ  303

Query  298   VSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPSQVVDFGRPAVF  357
             VSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPP+Q VDFGRPAVF
Sbjct  304   VSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFGRPAVF  363

Query  358   TCHFSGNPIKTVSWLKDGKKIGHTDAILRIESVKKEHKGMYQCFIRNDQESAEASAELKL  417
             TC ++GNPIKTVSW+KDGK IGH++ +LRIESVKKE KGMYQCF+RNDQESAEASAELKL
Sbjct  364   TCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEASAELKL  423

Query  418   GGRFDPPIIRQAFPEETLHPGPSVFLKCVAGGLPTPEISWELDGKKIANSERYQVGQYVT  477
             GGRFDPP+IRQAF EET+ PGPSVFLKCVAGG PTPEISWELDGKKIAN++RYQVGQYVT
Sbjct  424   GGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQVGQYVT  483

Query  478   VNGDVVSYLNITSIHANDGGLYKCIASSKVGVAEHSAKLNVYGLPYIRPMEKKAIVAGEN  537
             VNGDVVSYLNITS+HANDGGLYKCIA SKVGVAEHSAKLNVYGLPYIR MEKKAIVAGE 
Sbjct  484   VNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKAIVAGET  543

Query  538   LIVTCPVAGYPIESIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKNSE  597
             LIVTCPVAGYPI+SIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKN E
Sbjct  544   LIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKNQE  603

Query  598   GYSARGALEVQVMVAPMILPFSFGDEAANPGDSTAVNCMITKGDLPLNIKWTLNGQPVVN  657
             GYSARG+LEVQVMVAP I PFSFGDE  N G+  +VNC++ KGDLPL+I WTLN   +VN
Sbjct  604   GYSARGSLEVQVMVAPQISPFSFGDEPLNRGEVASVNCVVPKGDLPLDIYWTLNSALIVN  663

Query  658   GENGLQVVKMSSRLSSLSIESLGDRHRGTFRCIASNDAGETNYSSELNINVPPRWILEPT  717
             GE G  +V+++ R SSL+++SL   HRG+++CIA+N AG   Y S L++NVPPRWILEPT
Sbjct  664   GEMGFTLVRLNKRTSSLNVDSLEAVHRGSYKCIANNSAGYAEYVSTLDVNVPPRWILEPT  723

Query  718   DKAFAQGSDAKVECKSDGFPKPQVTWKKAVGDTPGEYKDMKQSNNIRVDEGTLYIDNIQK  777
             DKAFAQGSDAKVECK+DGFPKPQVTWKKAVGDTPGEYKD+K+S+NIRV+EGTL++DNIQK
Sbjct  724   DKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHVDNIQK  783

Query  778   NNEGYYLCEAINGIGSGLSAVILISVQAPPEFVEKLRNQTARRSEPAVLQCEAKGEKPIG  837
              NEGYYLCEAINGIGSGLSAVI+ISVQAPPEF EKLRNQTARR EPAVLQCEAKGEKPIG
Sbjct  784   TNEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKGEKPIG  843

Query  838   ILWNMNNMRLDPKTDNRYTIREEILSTGVMSSLSIKRTERTDSALFTCVATNAFGSDDAS  897
             ILWNMNNMRLDPK DNRYTIREEILSTGVMSSLSIKRTER+DSALFTCVATNAFGSDDAS
Sbjct  844   ILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAFGSDDAS  903

Query  898   INMIIQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLKRYIIEFKTSRGSWEHDVDRV  957
             INMI+QEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPL RYIIEFK SR SW  ++DRV
Sbjct  904   INMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWS-EIDRV  962

Query  958   IVPGHTNEAQVQKLNPATTYNIRIVAENEIGVSDSSEVVPIITAEEAPSGKPQSIKVEPL  1017
             IVPGHT EAQVQKL+PATTYNIRIVAEN IG S SSE V IITAEEAPSGKPQ+IKVEP+
Sbjct  963   IVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNIKVEPV  1022

Query  1018  SQTSLRVLWKAPPRSDWNGEILGYYVGYKLTNNNGSYYFEDYKYMMEEGKEYSYELTNLK  1077
             +QT++RV WK PPR++WNGEILGYYVGYKL+N N SY FE   ++ EEGKE++ EL NL+
Sbjct  1023  NQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLELQNLR  1082

Query  1078  TYTQYSVVIQAYNKVGAGPLSEDEKQYTAEGTPDQPPSDITCTTLTSQTIRVSWVSPPLE  1137
              YTQYSVVIQA+NK+GAGPLSE+EKQ+TAEGTP QPPSD  CTTLTSQTIRV WVSPPLE
Sbjct  1083  VYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWVSPPLE  1142

Query  1138  SANGVIKGYKVVYAPSELWYDDKNKDYKKTASSDTVLHGLKKYTNYTMQVLATTSGGDGV  1197
             SANGVIK YKVVYAPS+ WYD+  + YKKTASSDTVLHGLKKYTNYTMQVLATT+GGDGV
Sbjct  1143  SANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTAGGDGV  1202

Query  1198  RSPPIHCQTEQDVPEAPTAVKALVVGSEAILVSWLPPAQPNGLITQYTVYSKEEGTESEV  1257
             RS PIHCQTE DVPEAPT VKALV+G+ AILVSW PPAQPNG+ITQYTVYSK EG E+E 
Sbjct  1203  RSVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEGAETET  1262

Query  1258  KSHKVPPYQMSYEASSLDKNKPFEFWVTANTNIGEGQASKSIVAMPSDKVPAKIASFDDT  1317
             K+ KVP YQMS+EA+ L+KNKP+EFWVTA+T IGEGQ SKSIVAMPSD+VPAKIASFDDT
Sbjct  1263  KTQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIASFDDT  1322

Query  1318  FTAIFKEDFKLPCLAVGAPAPDITWKVKGVEFVPNDRVRQLPEGSLSIKDVIRQDAGDYT  1377
             FTA FKED K+PCLAVGAP P+ITWK+KGVEF  NDR+R LP+GSL IK V RQDAGDY+
Sbjct  1323  FTATFKEDAKMPCLAVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNRQDAGDYS  1382

Query  1378  CMAENSIAKDSITHKLIVLAPPQSPQVLLTATTTDSLTLKLKQHDGDTAPIHGYTLHYKP  1437
             C AENSIAKDSITHKLIVLAPPQSP V L+ATTTD+LT+KLK H+GDTAP+HGYTLHYKP
Sbjct  1383  CHAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGYTLHYKP  1442

Query  1438  EFGDWETVEVAVDAQKYTIENLFCGSRYQVYATGYNNIGAGEASDILNTRTKGSKPMMPE  1497
             EFG+WET EV+VD+QK+ IE L CGSRYQVYATG+NNIGAGEASDILNTRTKG KP +PE
Sbjct  1443  EFGEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKGQKPKLPE  1502

Query  1498  NSKFIDPSSNTVTLHLPTWKDGGCRMSHFVVEYKKKDHAEWTQISNNVKPGGNFVVLDLD  1557
               +FI+ SSN+V+LH   WKDGGC MSHFVVE KK+D  EW QISNNVKP  N+VVLDL+
Sbjct  1503  KPRFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKRDQIEWNQISNNVKPDNNYVVLDLE  1562

Query  1558  AASWYSVRITAHNSAGFTVAEYEFATLTVTGGTLAPPLNTAVLNGKTY----LPPWMPQW  1613
              A+WY++RITAHNSAGFTVAEY+FATLTVTGGT+A PL+    +G  +    LP WMP+W
Sbjct  1563  PATWYNLRITAHNSAGFTVAEYDFATLTVTGGTIA-PLDDGSGHGNVHTRIRLPAWMPEW  1621

Query  1614  FDLNFMVPLIATIIVVFVGVLVICVALSRRRMEDPRGGPKDVYYDVVYNQPMGPGATMDK  1673
              DLNFMVPLIAT++VV VG+ V+CVALSRRR +D RGG KDVYYDVVYNQ MGPGAT+DK
Sbjct  1622  LDLNFMVPLIATVVVVAVGICVVCVALSRRRADDMRGGQKDVYYDVVYNQTMGPGATLDK  1681

Query  1674  RRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRGTVISRSMRSNHSTWDPRR--PLYE  1731
             RRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG      +RSNHSTWDPRR   LYE
Sbjct  1682  RRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG---RGGLRSNHSTWDPRRNPNLYE  1738

Query  1732  ELKPPPVPRR-----HYHGSDECYHTHPHPHPAGMEDEICPYATFHLLGFREEMDPTKAM  1786
             ELK PPVP       H HG+ EC++ HP     GMEDEICPYATFHLLGFREEMDPTKAM
Sbjct  1739  ELKAPPVPMHGNHYGHAHGNAECHYRHP-----GMEDEICPYATFHLLGFREEMDPTKAM  1793

Query  1787  NFQTFPHQNGHTG--PGHA-TMGPGGPPGHIHSRSGSQSMPRQNRYARKNSQGGQSSIYT  1843
             NFQTFPHQNGH G  PGHA TM P G PGH+HSRSGSQSMPR NRY RKNSQGGQSSIYT
Sbjct  1794  NFQTFPHQNGHAGPVPGHAGTMLPPGHPGHVHSRSGSQSMPRANRYQRKNSQGGQSSIYT  1853

Query  1844  PAPEYDDPANCAEEDQYRRYTRVNSQGGSLYGGPGPEYDDPANCAPEDDQYGSQYGAPYG  1903
             PAPEYDDPANCAEEDQYRRYTRVNSQGGSLY GPGPEYDDPANCAPE+DQYGSQYG PYG
Sbjct  1854  PAPEYDDPANCAEEDQYRRYTRVNSQGGSLYSGPGPEYDDPANCAPEEDQYGSQYGGPYG  1913

Query  1904  --YDHYGSRGSVGRRSVGSARNLPNGSPEPPPPPPRNHDTSNSSFNDSKESNEISEAECD  1961
               YDHYGSRGS+GRRS+GSARN  NGSPEPPPPPPRNHD SNSSFNDSKESNEISEAECD
Sbjct  1914  QPYDHYGSRGSMGRRSIGSARNPGNGSPEPPPPPPRNHDMSNSSFNDSKESNEISEAECD  1973

Query  1962  RDH-PRGNYGENENSGDAKRSANTKDVRTTEEMRKLIDSRKSNEVAAKLQQQGGPAGLTA  2020
             RDH PRGNYG        KRS   KD RTTEEMRKLI+  ++     +LQQ  G AG TA
Sbjct  1974  RDHGPRGNYGA------VKRSPQPKDQRTTEEMRKLIERNETGPKQLQLQQANG-AGFTA  2026

Query  2021  YDTLAV  2026
             YDT+AV
Sbjct  2027  YDTMAV  2032


>Q0E9H6_DROME unnamed protein product
Length=2032

 Score = 3341 bits (8664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1633/2046 (80%), Positives = 1799/2046 (88%), Gaps = 41/2046 (2%)

Query  3     QRTKWITKIIFIAV-LVDLGS---TANT-EADTKGPMFLKEPINRIDFSNSTGSVVECRA  57
             +R KW+  ++F AV L+  GS    AN  +AD KGP+FLKEP NRIDFSNSTG+ +EC+A
Sbjct  6     ERLKWL--MLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAEIECKA  63

Query  58    SGNPAPEIIWVRSDGTAVGDVPGLRQVLSNGNLVFPPFRAEDYRQEVHAQVYACLAKNQF  117
             SGNP PEIIW+RSDGTAVGDVPGLRQ+ S+G LVFPPFRAEDYRQEVHAQVYACLA+NQF
Sbjct  64    SGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQF  123

Query  118   GSIISRDVNVRAVVAQHYDTDVNKAYVIRGNAGILKCEIPSYIIDFVHVVSWHTDKEESF  177
             GSIISRDV+VRAVVAQ+Y+ DVNK +VIRGN+ ++KC IPS++ DFV VVSWHTD+EE++
Sbjct  124   GSIISRDVHVRAVVAQYYEADVNKEHVIRGNSAVIKCLIPSFVADFVEVVSWHTDEEENY  183

Query  178   FPGTEYDGKYLVLPSGELHIKEVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVG  237
             FPG EYDGKYLVLPSGELHI+EVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVG
Sbjct  184   FPGAEYDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVG  243

Query  238   SVSPKFNAADELNIVRSKMTQDICLLCPAQSYPTPISRWYKFIEGTTRKQAVVLNDRVKQ  297
             SV PK  + D+   VR +    + LLCPAQ+YP P+ RWYKFIEGTTRKQAVVLNDRVKQ
Sbjct  244   SVGPKLTSGDDSRTVRIRQEDSVTLLCPAQAYPVPVYRWYKFIEGTTRKQAVVLNDRVKQ  303

Query  298   VSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPSQVVDFGRPAVF  357
             VSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPP+Q VDFGRPAVF
Sbjct  304   VSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFGRPAVF  363

Query  358   TCHFSGNPIKTVSWLKDGKKIGHTDAILRIESVKKEHKGMYQCFIRNDQESAEASAELKL  417
             TC ++GNPIKTVSW+KDGK IGH++ +LRIESVKKE KGMYQCF+RNDQESAEASAELKL
Sbjct  364   TCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEASAELKL  423

Query  418   GGRFDPPIIRQAFPEETLHPGPSVFLKCVAGGLPTPEISWELDGKKIANSERYQVGQYVT  477
             GGRFDPP+IRQAF EET+ PGPSVFLKCVAGG PTPEISWELDGKKIAN++RYQVGQYVT
Sbjct  424   GGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQVGQYVT  483

Query  478   VNGDVVSYLNITSIHANDGGLYKCIASSKVGVAEHSAKLNVYGLPYIRPMEKKAIVAGEN  537
             VNGDVVSYLNITS+HANDGGLYKCIA SKVGVAEHSAKLNVYGLPYIR MEKKAIVAGE 
Sbjct  484   VNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKAIVAGET  543

Query  538   LIVTCPVAGYPIESIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKNSE  597
             LIVTCPVAGYPI+SIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKN E
Sbjct  544   LIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKNQE  603

Query  598   GYSARGALEVQVMVAPMILPFSFGDEAANPGDSTAVNCMITKGDLPLNIKWTLNGQPVVN  657
             GYSARG+LEVQVMV P I PFSFGD+  N G++  V CM+ KGD+P+ IKWTLN +P++N
Sbjct  604   GYSARGSLEVQVMVPPSIAPFSFGDDPVNTGENAGVQCMVQKGDVPITIKWTLNSRPIIN  663

Query  658   GENGLQVVKMSSRLSSLSIESLGDRHRGTFRCIASNDAGETNYSSELNINVPPRWILEPT  717
             GE G+ ++K+S + S L+I ++   HRG F+CIA N AG +  +SEL +NVPPRWILEPT
Sbjct  664   GEEGITILKLSPKTSVLNIAAVEQDHRGVFKCIAENKAGSSFTTSELKVNVPPRWILEPT  723

Query  718   DKAFAQGSDAKVECKSDGFPKPQVTWKKAVGDTPGEYKDMKQSNNIRVDEGTLYIDNIQK  777
             DKAFAQGSDAKVECK+DGFPKPQVTWKKAVGDTPGEYKD+K+S+NIRV+EGTL++DNIQK
Sbjct  724   DKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHVDNIQK  783

Query  778   NNEGYYLCEAINGIGSGLSAVILISVQAPPEFVEKLRNQTARRSEPAVLQCEAKGEKPIG  837
              NEGYYLCEAINGIGSGLSAVI+ISVQAPPEF EKLRNQTARR EPAVLQCEAKGEKPIG
Sbjct  784   TNEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKGEKPIG  843

Query  838   ILWNMNNMRLDPKTDNRYTIREEILSTGVMSSLSIKRTERTDSALFTCVATNAFGSDDAS  897
             ILWNMNNMRLDPK DNRYTIREEILSTGVMSSLSIKRTER+DSALFTCVATNAFGSDDAS
Sbjct  844   ILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAFGSDDAS  903

Query  898   INMIIQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLKRYIIEFKTSRGSWEHDVDRV  957
             INMI+QEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPL RYIIEFK SR SW  ++DRV
Sbjct  904   INMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWS-EIDRV  962

Query  958   IVPGHTNEAQVQKLNPATTYNIRIVAENEIGVSDSSEVVPIITAEEAPSGKPQSIKVEPL  1017
             IVPGHT EAQVQKL+PATTYNIRIVAEN IG S SSE V IITAEEAPSGKPQ+IKVEP+
Sbjct  963   IVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNIKVEPV  1022

Query  1018  SQTSLRVLWKAPPRSDWNGEILGYYVGYKLTNNNGSYYFEDYKYMMEEGKEYSYELTNLK  1077
             +QT++RV WK PPR++WNGEILGYYVGYKL+N N SY FE   ++ EEGKE++ EL NL+
Sbjct  1023  NQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLELQNLR  1082

Query  1078  TYTQYSVVIQAYNKVGAGPLSEDEKQYTAEGTPDQPPSDITCTTLTSQTIRVSWVSPPLE  1137
              YTQYSVVIQA+NK+GAGPLSE+EKQ+TAEGTP QPPSD  CTTLTSQTIRV WVSPPLE
Sbjct  1083  VYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWVSPPLE  1142

Query  1138  SANGVIKGYKVVYAPSELWYDDKNKDYKKTASSDTVLHGLKKYTNYTMQVLATTSGGDGV  1197
             SANGVIK YKVVYAPS+ WYD+  + YKKTASSDTVLHGLKKYTNYTMQVLATT+GGDGV
Sbjct  1143  SANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTAGGDGV  1202

Query  1198  RSPPIHCQTEQDVPEAPTAVKALVVGSEAILVSWLPPAQPNGLITQYTVYSKEEGTESEV  1257
             RS PIHCQTE DVPEAPT VKALV+G+ AILVSW PPAQPNG+ITQYTVYSK EG E+E 
Sbjct  1203  RSVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEGAETET  1262

Query  1258  KSHKVPPYQMSYEASSLDKNKPFEFWVTANTNIGEGQASKSIVAMPSDKVPAKIASFDDT  1317
             K+ KVP YQMS+EA+ L+KNKP+EFWVTA+T IGEGQ SKSIVAMPSD+VPAKIASFDDT
Sbjct  1263  KTQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIASFDDT  1322

Query  1318  FTAIFKEDFKLPCLAVGAPAPDITWKVKGVEFVPNDRVRQLPEGSLSIKDVIRQDAGDYT  1377
             FTA FKED K+PCLAVGAP P+ITWK+KGVEF  NDR+R LP+GSL IK V RQDAGDY+
Sbjct  1323  FTATFKEDAKMPCLAVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNRQDAGDYS  1382

Query  1378  CMAENSIAKDSITHKLIVLAPPQSPQVLLTATTTDSLTLKLKQHDGDTAPIHGYTLHYKP  1437
             C AENSIAKDSITHKLIVLAPPQSP V L+ATTTD+LT+KLK H+GDTAP+HGYTLHYKP
Sbjct  1383  CHAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGYTLHYKP  1442

Query  1438  EFGDWETVEVAVDAQKYTIENLFCGSRYQVYATGYNNIGAGEASDILNTRTKGSKPMMPE  1497
             EFG+WET EV+VD+QK+ IE L CGSRYQVYATG+NNIGAGEASDILNTRTKG KP +PE
Sbjct  1443  EFGEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKGQKPKLPE  1502

Query  1498  NSKFIDPSSNTVTLHLPTWKDGGCRMSHFVVEYKKKDHAEWTQISNNVKPGGNFVVLDLD  1557
               +FI+ SSN+V+LH   WKDGGC MSHFVVE KK+D  EW QISNNVKP  N+VVLDL+
Sbjct  1503  KPRFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKRDQIEWNQISNNVKPDNNYVVLDLE  1562

Query  1558  AASWYSVRITAHNSAGFTVAEYEFATLTVTGGTLAPPLNTAVLNGKTY----LPPWMPQW  1613
              A+WY++RITAHNSAGFTVAEY+FATLTVTGGT+A PL+    +G  +    LP WMP+W
Sbjct  1563  PATWYNLRITAHNSAGFTVAEYDFATLTVTGGTIA-PLDDGSGHGNVHTRIRLPAWMPEW  1621

Query  1614  FDLNFMVPLIATIIVVFVGVLVICVALSRRRMEDPRGGPKDVYYDVVYNQPMGPGATMDK  1673
              DLNFMVPLIAT++VV VG+ V+CVALSRRR +D RGG KDVYYDVVYNQ MGPGAT+DK
Sbjct  1622  LDLNFMVPLIATVVVVAVGICVVCVALSRRRADDMRGGQKDVYYDVVYNQTMGPGATLDK  1681

Query  1674  RRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRGTVISRSMRSNHSTWDPRR--PLYE  1731
             RRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG      +RSNHSTWDPRR   LYE
Sbjct  1682  RRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG---RGGLRSNHSTWDPRRNPNLYE  1738

Query  1732  ELKPPPVPRR-----HYHGSDECYHTHPHPHPAGMEDEICPYATFHLLGFREEMDPTKAM  1786
             ELK PPVP       H HG+ EC++ HP     GMEDEICPYATFHLLGFREEMDPTKAM
Sbjct  1739  ELKAPPVPMHGNHYGHAHGNAECHYRHP-----GMEDEICPYATFHLLGFREEMDPTKAM  1793

Query  1787  NFQTFPHQNGHTG--PGHA-TMGPGGPPGHIHSRSGSQSMPRQNRYARKNSQGGQSSIYT  1843
             NFQTFPHQNGH G  PGHA TM P G PGH+HSRSGSQSMPR NRY RKNSQGGQSSIYT
Sbjct  1794  NFQTFPHQNGHAGPVPGHAGTMLPPGHPGHVHSRSGSQSMPRANRYQRKNSQGGQSSIYT  1853

Query  1844  PAPEYDDPANCAEEDQYRRYTRVNSQGGSLYGGPGPEYDDPANCAPEDDQYGSQYGAPYG  1903
             PAPEYDDPANCAEEDQYRRYTRVNSQGGSLY GPGPEYDDPANCAPE+DQYGSQYG PYG
Sbjct  1854  PAPEYDDPANCAEEDQYRRYTRVNSQGGSLYSGPGPEYDDPANCAPEEDQYGSQYGGPYG  1913

Query  1904  --YDHYGSRGSVGRRSVGSARNLPNGSPEPPPPPPRNHDTSNSSFNDSKESNEISEAECD  1961
               YDHYGSRGS+GRRS+GSARN  NGSPEPPPPPPRNHD SNSSFNDSKESNEISEAECD
Sbjct  1914  QPYDHYGSRGSMGRRSIGSARNPGNGSPEPPPPPPRNHDMSNSSFNDSKESNEISEAECD  1973

Query  1962  RDH-PRGNYGENENSGDAKRSANTKDVRTTEEMRKLIDSRKSNEVAAKLQQQGGPAGLTA  2020
             RDH PRGNYG        KRS   KD RTTEEMRKLI+  ++     +LQQ  G AG TA
Sbjct  1974  RDHGPRGNYGA------VKRSPQPKDQRTTEEMRKLIERNETGPKQLQLQQANG-AGFTA  2026

Query  2021  YDTLAV  2026
             YDT+AV
Sbjct  2027  YDTMAV  2032


>A0A0B4K828_DROME unnamed protein product
Length=2032

 Score = 3333 bits (8642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1637/2046 (80%), Positives = 1795/2046 (88%), Gaps = 41/2046 (2%)

Query  3     QRTKWITKIIFIAV-LVDLGS---TANT-EADTKGPMFLKEPINRIDFSNSTGSVVECRA  57
             +R KW+  ++F AV L+  GS    AN  +AD KGP+FLKEP NRIDFSNSTG+ +EC+A
Sbjct  6     ERLKWL--MLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAEIECKA  63

Query  58    SGNPAPEIIWVRSDGTAVGDVPGLRQVLSNGNLVFPPFRAEDYRQEVHAQVYACLAKNQF  117
             SGNP PEIIW+RSDGTAVGDVPGLRQ+ S+G LVFPPFRAEDYRQEVHAQVYACLA+NQF
Sbjct  64    SGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQF  123

Query  118   GSIISRDVNVRAVVAQHYDTDVNKAYVIRGNAGILKCEIPSYIIDFVHVVSWHTDKEESF  177
             GSIISRDV+VRAVVAQ+YDTDVNKAYVIRGNA +LKCEIPS++ DFV VVSWHTD+ E F
Sbjct  124   GSIISRDVHVRAVVAQYYDTDVNKAYVIRGNAAVLKCEIPSFVADFVSVVSWHTDQNEDF  183

Query  178   FPGTEYDGKYLVLPSGELHIKEVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVG  237
              PG+EYDGKYLVLPSGELHI+EVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPV 
Sbjct  184   LPGSEYDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVS  243

Query  238   SVSPKFNAADELNIVRSKMTQDICLLCPAQSYPTPISRWYKFIEGTTRKQAVVLNDRVKQ  297
             +  P F +  +         Q   LLC AQ+YP P+ RWYKFIEGTTRKQAVVLNDRVKQ
Sbjct  244   AKGPTFASDMKSYTFVRHFGQSFALLCQAQAYPVPLIRWYKFIEGTTRKQAVVLNDRVKQ  303

Query  298   VSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPSQVVDFGRPAVF  357
             VSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPP+Q VDFGRPAVF
Sbjct  304   VSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFGRPAVF  363

Query  358   TCHFSGNPIKTVSWLKDGKKIGHTDAILRIESVKKEHKGMYQCFIRNDQESAEASAELKL  417
             TC ++GNPIKTVSW+KDGK IGH++ +LRIESVKKE KGMYQCF+RNDQESAEASAELKL
Sbjct  364   TCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEASAELKL  423

Query  418   GGRFDPPIIRQAFPEETLHPGPSVFLKCVAGGLPTPEISWELDGKKIANSERYQVGQYVT  477
             GGRFDPP+IRQAF EET+ PGPSVFLKCVAGG PTPEISWELDGKKIAN++RYQVGQYVT
Sbjct  424   GGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQVGQYVT  483

Query  478   VNGDVVSYLNITSIHANDGGLYKCIASSKVGVAEHSAKLNVYGLPYIRPMEKKAIVAGEN  537
             VNGDVVSYLNITS+HANDGGLYKCIA SKVGVAEHSAKLNVYGLPYIR MEKKAIVAGE 
Sbjct  484   VNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKAIVAGET  543

Query  538   LIVTCPVAGYPIESIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKNSE  597
             LIVTCPVAGYPI+SIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKN E
Sbjct  544   LIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKNQE  603

Query  598   GYSARGALEVQVMVAPMILPFSFGDEAANPGDSTAVNCMITKGDLPLNIKWTLNGQPVVN  657
             GYSARG+LEVQVMVAP I PFSFGDE  N G+  +VNC++ KGDLPL+I WTLN   +VN
Sbjct  604   GYSARGSLEVQVMVAPQISPFSFGDEPLNRGEVASVNCVVPKGDLPLDIYWTLNSALIVN  663

Query  658   GENGLQVVKMSSRLSSLSIESLGDRHRGTFRCIASNDAGETNYSSELNINVPPRWILEPT  717
             GE G  +V+++ R SSL+++SL   HRG+++CIA+N AG   Y S L++NVPPRWILEPT
Sbjct  664   GEMGFTLVRLNKRTSSLNVDSLEAVHRGSYKCIANNSAGYAEYVSTLDVNVPPRWILEPT  723

Query  718   DKAFAQGSDAKVECKSDGFPKPQVTWKKAVGDTPGEYKDMKQSNNIRVDEGTLYIDNIQK  777
             DKAFAQGSDAKVECK+DGFPKPQVTWKKAVGDTPGEYKD+K+S+NIRV+EGTL++DNIQK
Sbjct  724   DKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHVDNIQK  783

Query  778   NNEGYYLCEAINGIGSGLSAVILISVQAPPEFVEKLRNQTARRSEPAVLQCEAKGEKPIG  837
              NEGYYLCEAINGIGSGLSAVI+ISVQAPPEF EKLRNQTARR EPAVLQCEAKGEKPIG
Sbjct  784   TNEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKGEKPIG  843

Query  838   ILWNMNNMRLDPKTDNRYTIREEILSTGVMSSLSIKRTERTDSALFTCVATNAFGSDDAS  897
             ILWNMNNMRLDPK DNRYTIREEILSTGVMSSLSIKRTER+DSALFTCVATNAFGSDDAS
Sbjct  844   ILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAFGSDDAS  903

Query  898   INMIIQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLKRYIIEFKTSRGSWEHDVDRV  957
             INMI+QEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPL RYIIEFK SR SW  ++DRV
Sbjct  904   INMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWS-EIDRV  962

Query  958   IVPGHTNEAQVQKLNPATTYNIRIVAENEIGVSDSSEVVPIITAEEAPSGKPQSIKVEPL  1017
             IVPGHT EAQVQKL+PATTYNIRIVAEN IG S SSE V IITAEEAPSGKPQ+IKVEP+
Sbjct  963   IVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNIKVEPV  1022

Query  1018  SQTSLRVLWKAPPRSDWNGEILGYYVGYKLTNNNGSYYFEDYKYMMEEGKEYSYELTNLK  1077
             +QT++RV WK PPR++WNGEILGYYVGYKL+N N SY FE   ++ EEGKE++ EL NL+
Sbjct  1023  NQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLELQNLR  1082

Query  1078  TYTQYSVVIQAYNKVGAGPLSEDEKQYTAEGTPDQPPSDITCTTLTSQTIRVSWVSPPLE  1137
              YTQYSVVIQA+NK+GAGPLSE+EKQ+TAEGTP QPPSD  CTTLTSQTIRV WVSPPLE
Sbjct  1083  VYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWVSPPLE  1142

Query  1138  SANGVIKGYKVVYAPSELWYDDKNKDYKKTASSDTVLHGLKKYTNYTMQVLATTSGGDGV  1197
             SANGVIK YKVVYAPS+ WYD+  + YKKTASSDTVLHGLKKYTNYTMQVLATT+GGDGV
Sbjct  1143  SANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTAGGDGV  1202

Query  1198  RSPPIHCQTEQDVPEAPTAVKALVVGSEAILVSWLPPAQPNGLITQYTVYSKEEGTESEV  1257
             RS PIHCQTE DVPEAPT VKALV+G+ AILVSW PPAQPNG+ITQYTVYSK EG E+E 
Sbjct  1203  RSVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEGAETET  1262

Query  1258  KSHKVPPYQMSYEASSLDKNKPFEFWVTANTNIGEGQASKSIVAMPSDKVPAKIASFDDT  1317
             K+ KVP YQMS+EA+ L+KNKP+EFWVTA+T IGEGQ SKSIVAMPSD+VPAKIASFDDT
Sbjct  1263  KTQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIASFDDT  1322

Query  1318  FTAIFKEDFKLPCLAVGAPAPDITWKVKGVEFVPNDRVRQLPEGSLSIKDVIRQDAGDYT  1377
             FTA FKED K+PCLAVGAP P+ITWK+KGVEF  NDR+R LP+GSL IK V RQDAGDY+
Sbjct  1323  FTATFKEDAKMPCLAVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNRQDAGDYS  1382

Query  1378  CMAENSIAKDSITHKLIVLAPPQSPQVLLTATTTDSLTLKLKQHDGDTAPIHGYTLHYKP  1437
             C AENSIAKDSITHKLIVLAPPQSP V L+ATTTD+LT+KLK H+GDTAP+HGYTLHYKP
Sbjct  1383  CHAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGYTLHYKP  1442

Query  1438  EFGDWETVEVAVDAQKYTIENLFCGSRYQVYATGYNNIGAGEASDILNTRTKGSKPMMPE  1497
             EFG+WET EV+VD+QK+ IE L CGSRYQVYATG+NNIGAGEASDILNTRTKG KP +PE
Sbjct  1443  EFGEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKGQKPKLPE  1502

Query  1498  NSKFIDPSSNTVTLHLPTWKDGGCRMSHFVVEYKKKDHAEWTQISNNVKPGGNFVVLDLD  1557
               +FI+ SSN+V+LH   WKDGGC MSHFVVE KK+D  EW QISNNVKP  N+VVLDL+
Sbjct  1503  KPRFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKRDQIEWNQISNNVKPDNNYVVLDLE  1562

Query  1558  AASWYSVRITAHNSAGFTVAEYEFATLTVTGGTLAPPLNTAVLNGKTY----LPPWMPQW  1613
              A+WY++RITAHNSAGFTVAEY+FATLTVTGGT+A PL+    +G  +    LP WMP+W
Sbjct  1563  PATWYNLRITAHNSAGFTVAEYDFATLTVTGGTIA-PLDDGSGHGNVHTRIRLPAWMPEW  1621

Query  1614  FDLNFMVPLIATIIVVFVGVLVICVALSRRRMEDPRGGPKDVYYDVVYNQPMGPGATMDK  1673
              DLNFMVPLIAT++VV VG+ V+CVALSRRR +D RGG KDVYYDVVYNQ MGPGAT+DK
Sbjct  1622  LDLNFMVPLIATVVVVAVGICVVCVALSRRRADDMRGGQKDVYYDVVYNQTMGPGATLDK  1681

Query  1674  RRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRGTVISRSMRSNHSTWDPRR--PLYE  1731
             RRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG      +RSNHSTWDPRR   LYE
Sbjct  1682  RRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG---RGGLRSNHSTWDPRRNPNLYE  1738

Query  1732  ELKPPPVPRR-----HYHGSDECYHTHPHPHPAGMEDEICPYATFHLLGFREEMDPTKAM  1786
             ELK PPVP       H HG+ EC++ HP     GMEDEICPYATFHLLGFREEMDPTKAM
Sbjct  1739  ELKAPPVPMHGNHYGHAHGNAECHYRHP-----GMEDEICPYATFHLLGFREEMDPTKAM  1793

Query  1787  NFQTFPHQNGHTG--PGHA-TMGPGGPPGHIHSRSGSQSMPRQNRYARKNSQGGQSSIYT  1843
             NFQTFPHQNGH G  PGHA TM P G PGH+HSRSGSQSMPR NRY RKNSQGGQSSIYT
Sbjct  1794  NFQTFPHQNGHAGPVPGHAGTMLPPGHPGHVHSRSGSQSMPRANRYQRKNSQGGQSSIYT  1853

Query  1844  PAPEYDDPANCAEEDQYRRYTRVNSQGGSLYGGPGPEYDDPANCAPEDDQYGSQYGAPYG  1903
             PAPEYDDPANCAEEDQYRRYTRVNSQGGSLY GPGPEYDDPANCAPE+DQYGSQYG PYG
Sbjct  1854  PAPEYDDPANCAEEDQYRRYTRVNSQGGSLYSGPGPEYDDPANCAPEEDQYGSQYGGPYG  1913

Query  1904  --YDHYGSRGSVGRRSVGSARNLPNGSPEPPPPPPRNHDTSNSSFNDSKESNEISEAECD  1961
               YDHYGSRGS+GRRS+GSARN  NGSPEPPPPPPRNHD SNSSFNDSKESNEISEAECD
Sbjct  1914  QPYDHYGSRGSMGRRSIGSARNPGNGSPEPPPPPPRNHDMSNSSFNDSKESNEISEAECD  1973

Query  1962  RDH-PRGNYGENENSGDAKRSANTKDVRTTEEMRKLIDSRKSNEVAAKLQQQGGPAGLTA  2020
             RDH PRGNYG        KRS   KD RTTEEMRKLI+  ++     +LQQ  G AG TA
Sbjct  1974  RDHGPRGNYGA------VKRSPQPKDQRTTEEMRKLIERNETGPKQLQLQQANG-AGFTA  2026

Query  2021  YDTLAV  2026
             YDT+AV
Sbjct  2027  YDTMAV  2032



Lambda      K        H
   0.314    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 27131672232


Query= XP_037024207.1 Down syndrome cell adhesion molecule-like protein
Dscam2 isoform X12 [Bradysia coprophila]

Length=2026
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q0E9I6_DROME  unnamed protein product                                 3344    0.0  
Q0E9H6_DROME  unnamed protein product                                 3341    0.0  
A0A0B4K828_DROME  unnamed protein product                             3332    0.0  


>Q0E9I6_DROME unnamed protein product
Length=2032

 Score = 3344 bits (8670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1644/2046 (80%), Positives = 1802/2046 (88%), Gaps = 41/2046 (2%)

Query  3     QRTKWITKIIFIAV-LVDLGS---TANT-EADTKGPMFLKEPINRIDFSNSTGSVVECRA  57
             +R KW+  ++F AV L+  GS    AN  +AD KGP+FLKEP NRIDFSNSTG+ +EC+A
Sbjct  6     ERLKWL--MLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAEIECKA  63

Query  58    SGNPAPEIIWVRSDGTAVGDVPGLRQVLSNGNLVFPPFRAEDYRQEVHAQVYACLAKNQF  117
             SGNP PEIIW+RSDGTAVGDVPGLRQ+ S+G LVFPPFRAEDYRQEVHAQVYACLA+NQF
Sbjct  64    SGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQF  123

Query  118   GSIISRDVNVRAVVAQHYDTDVNKAYVIRGNAGILKCEIPSYIIDFVHVVSWHTDKEESF  177
             GSIISRDV+VRAVVAQ+YDTDVNKAYVIRGNA +LKCEIPS++ DFV VVSWHTD+ E F
Sbjct  124   GSIISRDVHVRAVVAQYYDTDVNKAYVIRGNAAVLKCEIPSFVADFVSVVSWHTDQNEDF  183

Query  178   FPGTEYDGKYLVLPSGELHIKEVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVG  237
              PG+EYDGKYLVLPSGELHI+EVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVG
Sbjct  184   LPGSEYDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVG  243

Query  238   SVAPKVNLGDKSRILSIRHGHVFDLLCPAQSYPMASFRWYKFIEGTTRKQAVVLNDRVKQ  297
             SVAPKVN  D+     I  G +  L CPAQS+P+  +RWYKFIEGTTRKQAVVLNDRVKQ
Sbjct  244   SVAPKVNKNDEFSHDRIAIGGMVALRCPAQSFPVPVYRWYKFIEGTTRKQAVVLNDRVKQ  303

Query  298   VSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPSQVVDFGRPAVF  357
             VSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPP+Q VDFGRPAVF
Sbjct  304   VSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFGRPAVF  363

Query  358   TCHFSGNPIKTVSWLKDGKKIGHTDAILRIESVKKEHKGMYQCFIRNDQESAEASAELKL  417
             TC ++GNPIKTVSW+KDGK IGH++ +LRIESVKKE KGMYQCF+RNDQESAEASAELKL
Sbjct  364   TCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEASAELKL  423

Query  418   GGRFDPPIIRQAFPEETLHPGPSVFLKCVAGGLPTPEISWELDGKKIANSERYQVGQYVT  477
             GGRFDPP+IRQAF EET+ PGPSVFLKCVAGG PTPEISWELDGKKIAN++RYQVGQYVT
Sbjct  424   GGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQVGQYVT  483

Query  478   VNGDVVSYLNITSIHANDGGLYKCIASSKVGVAEHSAKLNVYGLPYIRPMEKKAIVAGEN  537
             VNGDVVSYLNITS+HANDGGLYKCIA SKVGVAEHSAKLNVYGLPYIR MEKKAIVAGE 
Sbjct  484   VNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKAIVAGET  543

Query  538   LIVTCPVAGYPIESIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKNSE  597
             LIVTCPVAGYPI+SIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKN E
Sbjct  544   LIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKNQE  603

Query  598   GYSARGALEVQVMVAPMILPFSFGDEAANPGDSTAVNCMITKGDLPLNIKWTLNGQPVVN  657
             GYSARG+LEVQVMVAP I PFSFGDE  N G+  +VNC++ KGDLPL+I WTLN   +VN
Sbjct  604   GYSARGSLEVQVMVAPQISPFSFGDEPLNRGEVASVNCVVPKGDLPLDIYWTLNSALIVN  663

Query  658   GENGLQVVKMSSRLSSLSIESLGDRHRGTFRCIASNDAGETNYSSELNINVPPRWILEPT  717
             GE G  +V+++ R SSL+++SL   HRG+++CIA+N AG   Y S L++NVPPRWILEPT
Sbjct  664   GEMGFTLVRLNKRTSSLNVDSLEAVHRGSYKCIANNSAGYAEYVSTLDVNVPPRWILEPT  723

Query  718   DKAFAQGSDAKVECKSDGFPKPQVTWKKAVGDTPGEYKDMKQSNNIRVDEGTLYIDNIQK  777
             DKAFAQGSDAKVECK+DGFPKPQVTWKKAVGDTPGEYKD+K+S+NIRV+EGTL++DNIQK
Sbjct  724   DKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHVDNIQK  783

Query  778   NNEGYYLCEAINGIGSGLSAVILISVQAPPEFVEKLRNQTARRSEPAVLQCEAKGEKPIG  837
              NEGYYLCEAINGIGSGLSAVI+ISVQAPPEF EKLRNQTARR EPAVLQCEAKGEKPIG
Sbjct  784   TNEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKGEKPIG  843

Query  838   ILWNMNNMRLDPKTDNRYTIREEILSTGVMSSLSIKRTERTDSALFTCVATNAFGSDDAS  897
             ILWNMNNMRLDPK DNRYTIREEILSTGVMSSLSIKRTER+DSALFTCVATNAFGSDDAS
Sbjct  844   ILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAFGSDDAS  903

Query  898   INMIIQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLKRYIIEFKTSRGSWEHDVDRV  957
             INMI+QEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPL RYIIEFK SR SW  ++DRV
Sbjct  904   INMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWS-EIDRV  962

Query  958   IVPGHTNEAQVQKLNPATTYNIRIVAENEIGVSDSSEVVPIITAEEAPSGKPQSIKVEPL  1017
             IVPGHT EAQVQKL+PATTYNIRIVAEN IG S SSE V IITAEEAPSGKPQ+IKVEP+
Sbjct  963   IVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNIKVEPV  1022

Query  1018  SQTSLRVLWKAPPRSDWNGEILGYYVGYKLTNNNGSYYFEDYKYMMEEGKEYSYELTNLK  1077
             +QT++RV WK PPR++WNGEILGYYVGYKL+N N SY FE   ++ EEGKE++ EL NL+
Sbjct  1023  NQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLELQNLR  1082

Query  1078  TYTQYSVVIQAYNKVGAGPLSEDEKQYTAEGTPDQPPSDITCTTLTSQTIRVSWVSPPLE  1137
              YTQYSVVIQA+NK+GAGPLSE+EKQ+TAEGTP QPPSD  CTTLTSQTIRV WVSPPLE
Sbjct  1083  VYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWVSPPLE  1142

Query  1138  SANGVIKGYKVVYAPSELWYDDKNKDYKKTASSDTVLHGLKKYTNYTMQVLATTSGGDGV  1197
             SANGVIK YKVVYAPS+ WYD+  + YKKTASSDTVLHGLKKYTNYTMQVLATT+GGDGV
Sbjct  1143  SANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTAGGDGV  1202

Query  1198  RSPPIHCQTEQDVPEAPTAVKALVVGSEAILVSWLPPAQPNGLITQYTVYSKEEGTESEV  1257
             RS PIHCQTE DVPEAPT VKALV+G+ AILVSW PPAQPNG+ITQYTVYSK EG E+E 
Sbjct  1203  RSVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEGAETET  1262

Query  1258  KSHKVPPYQMSYEASSLDKNKPFEFWVTANTNIGEGQASKSIVAMPSDKVPAKIASFDDT  1317
             K+ KVP YQMS+EA+ L+KNKP+EFWVTA+T IGEGQ SKSIVAMPSD+VPAKIASFDDT
Sbjct  1263  KTQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIASFDDT  1322

Query  1318  FTAIFKEDFKLPCLAVGAPAPDITWKVKGVEFVPNDRVRQLPEGSLSIKDVIRQDAGDYT  1377
             FTA FKED K+PCLAVGAP P+ITWK+KGVEF  NDR+R LP+GSL IK V RQDAGDY+
Sbjct  1323  FTATFKEDAKMPCLAVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNRQDAGDYS  1382

Query  1378  CMAENSIAKDSITHKLIVLAPPQSPQVLLTATTTDSLTLKLKQHDGDTAPIHGYTLHYKP  1437
             C AENSIAKDSITHKLIVLAPPQSP V L+ATTTD+LT+KLK H+GDTAP+HGYTLHYKP
Sbjct  1383  CHAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGYTLHYKP  1442

Query  1438  EFGDWETVEVAVDAQKYTIENLFCGSRYQVYATGYNNIGAGEASDILNTRTKGSKPMMPE  1497
             EFG+WET EV+VD+QK+ IE L CGSRYQVYATG+NNIGAGEASDILNTRTKG KP +PE
Sbjct  1443  EFGEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKGQKPKLPE  1502

Query  1498  NSKFIDPSSNTVTLHLPTWKDGGCRMSHFVVEYKKKDHAEWTQISNNVKPGGNFVVLDLD  1557
               +FI+ SSN+V+LH   WKDGGC MSHFVVE KK+D  EW QISNNVKP  N+VVLDL+
Sbjct  1503  KPRFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKRDQIEWNQISNNVKPDNNYVVLDLE  1562

Query  1558  AASWYSVRITAHNSAGFTVAEYEFATLTVTGGTLAPPLNTAVLNGKTY----LPPWMPQW  1613
              A+WY++RITAHNSAGFTVAEY+FATLTVTGGT+A PL+    +G  +    LP WMP+W
Sbjct  1563  PATWYNLRITAHNSAGFTVAEYDFATLTVTGGTIA-PLDDGSGHGNVHTRIRLPAWMPEW  1621

Query  1614  FDLNFMVPLIATIIVVFVGVLVICVALSRRRMEDPRGGPKDVYYDVVYNQPMGPGATMDK  1673
              DLNFMVPLIAT++VV VG+ V+CVALSRRR +D RGG KDVYYDVVYNQ MGPGAT+DK
Sbjct  1622  LDLNFMVPLIATVVVVAVGICVVCVALSRRRADDMRGGQKDVYYDVVYNQTMGPGATLDK  1681

Query  1674  RRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRGTVISRSMRSNHSTWDPRR--PLYE  1731
             RRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG      +RSNHSTWDPRR   LYE
Sbjct  1682  RRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG---RGGLRSNHSTWDPRRNPNLYE  1738

Query  1732  ELKPPPVPRR-----HYHGSDECYHTHPHPHPAGMEDEICPYATFHLLGFREEMDPTKAM  1786
             ELK PPVP       H HG+ EC++ HP     GMEDEICPYATFHLLGFREEMDPTKAM
Sbjct  1739  ELKAPPVPMHGNHYGHAHGNAECHYRHP-----GMEDEICPYATFHLLGFREEMDPTKAM  1793

Query  1787  NFQTFPHQNGHTG--PGHA-TMGPGGPPGHIHSRSGSQSMPRQNRYARKNSQGGQSSIYT  1843
             NFQTFPHQNGH G  PGHA TM P G PGH+HSRSGSQSMPR NRY RKNSQGGQSSIYT
Sbjct  1794  NFQTFPHQNGHAGPVPGHAGTMLPPGHPGHVHSRSGSQSMPRANRYQRKNSQGGQSSIYT  1853

Query  1844  PAPEYDDPANCAEEDQYRRYTRVNSQGGSLYGGPGPEYDDPANCAPEDDQYGSQYGAPYG  1903
             PAPEYDDPANCAEEDQYRRYTRVNSQGGSLY GPGPEYDDPANCAPE+DQYGSQYG PYG
Sbjct  1854  PAPEYDDPANCAEEDQYRRYTRVNSQGGSLYSGPGPEYDDPANCAPEEDQYGSQYGGPYG  1913

Query  1904  --YDHYGSRGSVGRRSVGSARNLPNGSPEPPPPPPRNHDTSNSSFNDSKESNEISEAECD  1961
               YDHYGSRGS+GRRS+GSARN  NGSPEPPPPPPRNHD SNSSFNDSKESNEISEAECD
Sbjct  1914  QPYDHYGSRGSMGRRSIGSARNPGNGSPEPPPPPPRNHDMSNSSFNDSKESNEISEAECD  1973

Query  1962  RDH-PRGNYGENENSGDAKRSANTKDVRTTEEMRKLIDSRKSNEVAAKLQQQGGPAGLTA  2020
             RDH PRGNYG        KRS   KD RTTEEMRKLI+  ++     +LQQ  G AG TA
Sbjct  1974  RDHGPRGNYGA------VKRSPQPKDQRTTEEMRKLIERNETGPKQLQLQQANG-AGFTA  2026

Query  2021  YDTLAV  2026
             YDT+AV
Sbjct  2027  YDTMAV  2032


>Q0E9H6_DROME unnamed protein product
Length=2032

 Score = 3341 bits (8662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1635/2046 (80%), Positives = 1800/2046 (88%), Gaps = 41/2046 (2%)

Query  3     QRTKWITKIIFIAV-LVDLGS---TANT-EADTKGPMFLKEPINRIDFSNSTGSVVECRA  57
             +R KW+  ++F AV L+  GS    AN  +AD KGP+FLKEP NRIDFSNSTG+ +EC+A
Sbjct  6     ERLKWL--MLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAEIECKA  63

Query  58    SGNPAPEIIWVRSDGTAVGDVPGLRQVLSNGNLVFPPFRAEDYRQEVHAQVYACLAKNQF  117
             SGNP PEIIW+RSDGTAVGDVPGLRQ+ S+G LVFPPFRAEDYRQEVHAQVYACLA+NQF
Sbjct  64    SGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQF  123

Query  118   GSIISRDVNVRAVVAQHYDTDVNKAYVIRGNAGILKCEIPSYIIDFVHVVSWHTDKEESF  177
             GSIISRDV+VRAVVAQ+Y+ DVNK +VIRGN+ ++KC IPS++ DFV VVSWHTD+EE++
Sbjct  124   GSIISRDVHVRAVVAQYYEADVNKEHVIRGNSAVIKCLIPSFVADFVEVVSWHTDEEENY  183

Query  178   FPGTEYDGKYLVLPSGELHIKEVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVG  237
             FPG EYDGKYLVLPSGELHI+EVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVG
Sbjct  184   FPGAEYDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVG  243

Query  238   SVAPKVNLGDKSRILSIRHGHVFDLLCPAQSYPMASFRWYKFIEGTTRKQAVVLNDRVKQ  297
             SV PK+  GD SR + IR      LLCPAQ+YP+  +RWYKFIEGTTRKQAVVLNDRVKQ
Sbjct  244   SVGPKLTSGDDSRTVRIRQEDSVTLLCPAQAYPVPVYRWYKFIEGTTRKQAVVLNDRVKQ  303

Query  298   VSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPSQVVDFGRPAVF  357
             VSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPP+Q VDFGRPAVF
Sbjct  304   VSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFGRPAVF  363

Query  358   TCHFSGNPIKTVSWLKDGKKIGHTDAILRIESVKKEHKGMYQCFIRNDQESAEASAELKL  417
             TC ++GNPIKTVSW+KDGK IGH++ +LRIESVKKE KGMYQCF+RNDQESAEASAELKL
Sbjct  364   TCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEASAELKL  423

Query  418   GGRFDPPIIRQAFPEETLHPGPSVFLKCVAGGLPTPEISWELDGKKIANSERYQVGQYVT  477
             GGRFDPP+IRQAF EET+ PGPSVFLKCVAGG PTPEISWELDGKKIAN++RYQVGQYVT
Sbjct  424   GGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQVGQYVT  483

Query  478   VNGDVVSYLNITSIHANDGGLYKCIASSKVGVAEHSAKLNVYGLPYIRPMEKKAIVAGEN  537
             VNGDVVSYLNITS+HANDGGLYKCIA SKVGVAEHSAKLNVYGLPYIR MEKKAIVAGE 
Sbjct  484   VNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKAIVAGET  543

Query  538   LIVTCPVAGYPIESIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKNSE  597
             LIVTCPVAGYPI+SIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKN E
Sbjct  544   LIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKNQE  603

Query  598   GYSARGALEVQVMVAPMILPFSFGDEAANPGDSTAVNCMITKGDLPLNIKWTLNGQPVVN  657
             GYSARG+LEVQVMV P I PFSFGD+  N G++  V CM+ KGD+P+ IKWTLN +P++N
Sbjct  604   GYSARGSLEVQVMVPPSIAPFSFGDDPVNTGENAGVQCMVQKGDVPITIKWTLNSRPIIN  663

Query  658   GENGLQVVKMSSRLSSLSIESLGDRHRGTFRCIASNDAGETNYSSELNINVPPRWILEPT  717
             GE G+ ++K+S + S L+I ++   HRG F+CIA N AG +  +SEL +NVPPRWILEPT
Sbjct  664   GEEGITILKLSPKTSVLNIAAVEQDHRGVFKCIAENKAGSSFTTSELKVNVPPRWILEPT  723

Query  718   DKAFAQGSDAKVECKSDGFPKPQVTWKKAVGDTPGEYKDMKQSNNIRVDEGTLYIDNIQK  777
             DKAFAQGSDAKVECK+DGFPKPQVTWKKAVGDTPGEYKD+K+S+NIRV+EGTL++DNIQK
Sbjct  724   DKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHVDNIQK  783

Query  778   NNEGYYLCEAINGIGSGLSAVILISVQAPPEFVEKLRNQTARRSEPAVLQCEAKGEKPIG  837
              NEGYYLCEAINGIGSGLSAVI+ISVQAPPEF EKLRNQTARR EPAVLQCEAKGEKPIG
Sbjct  784   TNEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKGEKPIG  843

Query  838   ILWNMNNMRLDPKTDNRYTIREEILSTGVMSSLSIKRTERTDSALFTCVATNAFGSDDAS  897
             ILWNMNNMRLDPK DNRYTIREEILSTGVMSSLSIKRTER+DSALFTCVATNAFGSDDAS
Sbjct  844   ILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAFGSDDAS  903

Query  898   INMIIQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLKRYIIEFKTSRGSWEHDVDRV  957
             INMI+QEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPL RYIIEFK SR SW  ++DRV
Sbjct  904   INMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWS-EIDRV  962

Query  958   IVPGHTNEAQVQKLNPATTYNIRIVAENEIGVSDSSEVVPIITAEEAPSGKPQSIKVEPL  1017
             IVPGHT EAQVQKL+PATTYNIRIVAEN IG S SSE V IITAEEAPSGKPQ+IKVEP+
Sbjct  963   IVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNIKVEPV  1022

Query  1018  SQTSLRVLWKAPPRSDWNGEILGYYVGYKLTNNNGSYYFEDYKYMMEEGKEYSYELTNLK  1077
             +QT++RV WK PPR++WNGEILGYYVGYKL+N N SY FE   ++ EEGKE++ EL NL+
Sbjct  1023  NQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLELQNLR  1082

Query  1078  TYTQYSVVIQAYNKVGAGPLSEDEKQYTAEGTPDQPPSDITCTTLTSQTIRVSWVSPPLE  1137
              YTQYSVVIQA+NK+GAGPLSE+EKQ+TAEGTP QPPSD  CTTLTSQTIRV WVSPPLE
Sbjct  1083  VYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWVSPPLE  1142

Query  1138  SANGVIKGYKVVYAPSELWYDDKNKDYKKTASSDTVLHGLKKYTNYTMQVLATTSGGDGV  1197
             SANGVIK YKVVYAPS+ WYD+  + YKKTASSDTVLHGLKKYTNYTMQVLATT+GGDGV
Sbjct  1143  SANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTAGGDGV  1202

Query  1198  RSPPIHCQTEQDVPEAPTAVKALVVGSEAILVSWLPPAQPNGLITQYTVYSKEEGTESEV  1257
             RS PIHCQTE DVPEAPT VKALV+G+ AILVSW PPAQPNG+ITQYTVYSK EG E+E 
Sbjct  1203  RSVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEGAETET  1262

Query  1258  KSHKVPPYQMSYEASSLDKNKPFEFWVTANTNIGEGQASKSIVAMPSDKVPAKIASFDDT  1317
             K+ KVP YQMS+EA+ L+KNKP+EFWVTA+T IGEGQ SKSIVAMPSD+VPAKIASFDDT
Sbjct  1263  KTQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIASFDDT  1322

Query  1318  FTAIFKEDFKLPCLAVGAPAPDITWKVKGVEFVPNDRVRQLPEGSLSIKDVIRQDAGDYT  1377
             FTA FKED K+PCLAVGAP P+ITWK+KGVEF  NDR+R LP+GSL IK V RQDAGDY+
Sbjct  1323  FTATFKEDAKMPCLAVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNRQDAGDYS  1382

Query  1378  CMAENSIAKDSITHKLIVLAPPQSPQVLLTATTTDSLTLKLKQHDGDTAPIHGYTLHYKP  1437
             C AENSIAKDSITHKLIVLAPPQSP V L+ATTTD+LT+KLK H+GDTAP+HGYTLHYKP
Sbjct  1383  CHAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGYTLHYKP  1442

Query  1438  EFGDWETVEVAVDAQKYTIENLFCGSRYQVYATGYNNIGAGEASDILNTRTKGSKPMMPE  1497
             EFG+WET EV+VD+QK+ IE L CGSRYQVYATG+NNIGAGEASDILNTRTKG KP +PE
Sbjct  1443  EFGEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKGQKPKLPE  1502

Query  1498  NSKFIDPSSNTVTLHLPTWKDGGCRMSHFVVEYKKKDHAEWTQISNNVKPGGNFVVLDLD  1557
               +FI+ SSN+V+LH   WKDGGC MSHFVVE KK+D  EW QISNNVKP  N+VVLDL+
Sbjct  1503  KPRFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKRDQIEWNQISNNVKPDNNYVVLDLE  1562

Query  1558  AASWYSVRITAHNSAGFTVAEYEFATLTVTGGTLAPPLNTAVLNGKTY----LPPWMPQW  1613
              A+WY++RITAHNSAGFTVAEY+FATLTVTGGT+A PL+    +G  +    LP WMP+W
Sbjct  1563  PATWYNLRITAHNSAGFTVAEYDFATLTVTGGTIA-PLDDGSGHGNVHTRIRLPAWMPEW  1621

Query  1614  FDLNFMVPLIATIIVVFVGVLVICVALSRRRMEDPRGGPKDVYYDVVYNQPMGPGATMDK  1673
              DLNFMVPLIAT++VV VG+ V+CVALSRRR +D RGG KDVYYDVVYNQ MGPGAT+DK
Sbjct  1622  LDLNFMVPLIATVVVVAVGICVVCVALSRRRADDMRGGQKDVYYDVVYNQTMGPGATLDK  1681

Query  1674  RRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRGTVISRSMRSNHSTWDPRR--PLYE  1731
             RRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG      +RSNHSTWDPRR   LYE
Sbjct  1682  RRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG---RGGLRSNHSTWDPRRNPNLYE  1738

Query  1732  ELKPPPVPRR-----HYHGSDECYHTHPHPHPAGMEDEICPYATFHLLGFREEMDPTKAM  1786
             ELK PPVP       H HG+ EC++ HP     GMEDEICPYATFHLLGFREEMDPTKAM
Sbjct  1739  ELKAPPVPMHGNHYGHAHGNAECHYRHP-----GMEDEICPYATFHLLGFREEMDPTKAM  1793

Query  1787  NFQTFPHQNGHTG--PGHA-TMGPGGPPGHIHSRSGSQSMPRQNRYARKNSQGGQSSIYT  1843
             NFQTFPHQNGH G  PGHA TM P G PGH+HSRSGSQSMPR NRY RKNSQGGQSSIYT
Sbjct  1794  NFQTFPHQNGHAGPVPGHAGTMLPPGHPGHVHSRSGSQSMPRANRYQRKNSQGGQSSIYT  1853

Query  1844  PAPEYDDPANCAEEDQYRRYTRVNSQGGSLYGGPGPEYDDPANCAPEDDQYGSQYGAPYG  1903
             PAPEYDDPANCAEEDQYRRYTRVNSQGGSLY GPGPEYDDPANCAPE+DQYGSQYG PYG
Sbjct  1854  PAPEYDDPANCAEEDQYRRYTRVNSQGGSLYSGPGPEYDDPANCAPEEDQYGSQYGGPYG  1913

Query  1904  --YDHYGSRGSVGRRSVGSARNLPNGSPEPPPPPPRNHDTSNSSFNDSKESNEISEAECD  1961
               YDHYGSRGS+GRRS+GSARN  NGSPEPPPPPPRNHD SNSSFNDSKESNEISEAECD
Sbjct  1914  QPYDHYGSRGSMGRRSIGSARNPGNGSPEPPPPPPRNHDMSNSSFNDSKESNEISEAECD  1973

Query  1962  RDH-PRGNYGENENSGDAKRSANTKDVRTTEEMRKLIDSRKSNEVAAKLQQQGGPAGLTA  2020
             RDH PRGNYG        KRS   KD RTTEEMRKLI+  ++     +LQQ  G AG TA
Sbjct  1974  RDHGPRGNYGA------VKRSPQPKDQRTTEEMRKLIERNETGPKQLQLQQANG-AGFTA  2026

Query  2021  YDTLAV  2026
             YDT+AV
Sbjct  2027  YDTMAV  2032


>A0A0B4K828_DROME unnamed protein product
Length=2032

 Score = 3332 bits (8640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1638/2046 (80%), Positives = 1794/2046 (88%), Gaps = 41/2046 (2%)

Query  3     QRTKWITKIIFIAV-LVDLGS---TANT-EADTKGPMFLKEPINRIDFSNSTGSVVECRA  57
             +R KW+  ++F AV L+  GS    AN  +AD KGP+FLKEP NRIDFSNSTG+ +EC+A
Sbjct  6     ERLKWL--MLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAEIECKA  63

Query  58    SGNPAPEIIWVRSDGTAVGDVPGLRQVLSNGNLVFPPFRAEDYRQEVHAQVYACLAKNQF  117
             SGNP PEIIW+RSDGTAVGDVPGLRQ+ S+G LVFPPFRAEDYRQEVHAQVYACLA+NQF
Sbjct  64    SGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQF  123

Query  118   GSIISRDVNVRAVVAQHYDTDVNKAYVIRGNAGILKCEIPSYIIDFVHVVSWHTDKEESF  177
             GSIISRDV+VRAVVAQ+YDTDVNKAYVIRGNA +LKCEIPS++ DFV VVSWHTD+ E F
Sbjct  124   GSIISRDVHVRAVVAQYYDTDVNKAYVIRGNAAVLKCEIPSFVADFVSVVSWHTDQNEDF  183

Query  178   FPGTEYDGKYLVLPSGELHIKEVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVG  237
              PG+EYDGKYLVLPSGELHI+EVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPV 
Sbjct  184   LPGSEYDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVS  243

Query  238   SVAPKVNLGDKSRILSIRHGHVFDLLCPAQSYPMASFRWYKFIEGTTRKQAVVLNDRVKQ  297
             +  P      KS       G  F LLC AQ+YP+   RWYKFIEGTTRKQAVVLNDRVKQ
Sbjct  244   AKGPTFASDMKSYTFVRHFGQSFALLCQAQAYPVPLIRWYKFIEGTTRKQAVVLNDRVKQ  303

Query  298   VSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPSQVVDFGRPAVF  357
             VSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPP+Q VDFGRPAVF
Sbjct  304   VSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFGRPAVF  363

Query  358   TCHFSGNPIKTVSWLKDGKKIGHTDAILRIESVKKEHKGMYQCFIRNDQESAEASAELKL  417
             TC ++GNPIKTVSW+KDGK IGH++ +LRIESVKKE KGMYQCF+RNDQESAEASAELKL
Sbjct  364   TCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEASAELKL  423

Query  418   GGRFDPPIIRQAFPEETLHPGPSVFLKCVAGGLPTPEISWELDGKKIANSERYQVGQYVT  477
             GGRFDPP+IRQAF EET+ PGPSVFLKCVAGG PTPEISWELDGKKIAN++RYQVGQYVT
Sbjct  424   GGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQVGQYVT  483

Query  478   VNGDVVSYLNITSIHANDGGLYKCIASSKVGVAEHSAKLNVYGLPYIRPMEKKAIVAGEN  537
             VNGDVVSYLNITS+HANDGGLYKCIA SKVGVAEHSAKLNVYGLPYIR MEKKAIVAGE 
Sbjct  484   VNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKAIVAGET  543

Query  538   LIVTCPVAGYPIESIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKNSE  597
             LIVTCPVAGYPI+SIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKN E
Sbjct  544   LIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKNQE  603

Query  598   GYSARGALEVQVMVAPMILPFSFGDEAANPGDSTAVNCMITKGDLPLNIKWTLNGQPVVN  657
             GYSARG+LEVQVMVAP I PFSFGDE  N G+  +VNC++ KGDLPL+I WTLN   +VN
Sbjct  604   GYSARGSLEVQVMVAPQISPFSFGDEPLNRGEVASVNCVVPKGDLPLDIYWTLNSALIVN  663

Query  658   GENGLQVVKMSSRLSSLSIESLGDRHRGTFRCIASNDAGETNYSSELNINVPPRWILEPT  717
             GE G  +V+++ R SSL+++SL   HRG+++CIA+N AG   Y S L++NVPPRWILEPT
Sbjct  664   GEMGFTLVRLNKRTSSLNVDSLEAVHRGSYKCIANNSAGYAEYVSTLDVNVPPRWILEPT  723

Query  718   DKAFAQGSDAKVECKSDGFPKPQVTWKKAVGDTPGEYKDMKQSNNIRVDEGTLYIDNIQK  777
             DKAFAQGSDAKVECK+DGFPKPQVTWKKAVGDTPGEYKD+K+S+NIRV+EGTL++DNIQK
Sbjct  724   DKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHVDNIQK  783

Query  778   NNEGYYLCEAINGIGSGLSAVILISVQAPPEFVEKLRNQTARRSEPAVLQCEAKGEKPIG  837
              NEGYYLCEAINGIGSGLSAVI+ISVQAPPEF EKLRNQTARR EPAVLQCEAKGEKPIG
Sbjct  784   TNEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKGEKPIG  843

Query  838   ILWNMNNMRLDPKTDNRYTIREEILSTGVMSSLSIKRTERTDSALFTCVATNAFGSDDAS  897
             ILWNMNNMRLDPK DNRYTIREEILSTGVMSSLSIKRTER+DSALFTCVATNAFGSDDAS
Sbjct  844   ILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAFGSDDAS  903

Query  898   INMIIQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLKRYIIEFKTSRGSWEHDVDRV  957
             INMI+QEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPL RYIIEFK SR SW  ++DRV
Sbjct  904   INMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWS-EIDRV  962

Query  958   IVPGHTNEAQVQKLNPATTYNIRIVAENEIGVSDSSEVVPIITAEEAPSGKPQSIKVEPL  1017
             IVPGHT EAQVQKL+PATTYNIRIVAEN IG S SSE V IITAEEAPSGKPQ+IKVEP+
Sbjct  963   IVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNIKVEPV  1022

Query  1018  SQTSLRVLWKAPPRSDWNGEILGYYVGYKLTNNNGSYYFEDYKYMMEEGKEYSYELTNLK  1077
             +QT++RV WK PPR++WNGEILGYYVGYKL+N N SY FE   ++ EEGKE++ EL NL+
Sbjct  1023  NQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLELQNLR  1082

Query  1078  TYTQYSVVIQAYNKVGAGPLSEDEKQYTAEGTPDQPPSDITCTTLTSQTIRVSWVSPPLE  1137
              YTQYSVVIQA+NK+GAGPLSE+EKQ+TAEGTP QPPSD  CTTLTSQTIRV WVSPPLE
Sbjct  1083  VYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWVSPPLE  1142

Query  1138  SANGVIKGYKVVYAPSELWYDDKNKDYKKTASSDTVLHGLKKYTNYTMQVLATTSGGDGV  1197
             SANGVIK YKVVYAPS+ WYD+  + YKKTASSDTVLHGLKKYTNYTMQVLATT+GGDGV
Sbjct  1143  SANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTAGGDGV  1202

Query  1198  RSPPIHCQTEQDVPEAPTAVKALVVGSEAILVSWLPPAQPNGLITQYTVYSKEEGTESEV  1257
             RS PIHCQTE DVPEAPT VKALV+G+ AILVSW PPAQPNG+ITQYTVYSK EG E+E 
Sbjct  1203  RSVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEGAETET  1262

Query  1258  KSHKVPPYQMSYEASSLDKNKPFEFWVTANTNIGEGQASKSIVAMPSDKVPAKIASFDDT  1317
             K+ KVP YQMS+EA+ L+KNKP+EFWVTA+T IGEGQ SKSIVAMPSD+VPAKIASFDDT
Sbjct  1263  KTQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIASFDDT  1322

Query  1318  FTAIFKEDFKLPCLAVGAPAPDITWKVKGVEFVPNDRVRQLPEGSLSIKDVIRQDAGDYT  1377
             FTA FKED K+PCLAVGAP P+ITWK+KGVEF  NDR+R LP+GSL IK V RQDAGDY+
Sbjct  1323  FTATFKEDAKMPCLAVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNRQDAGDYS  1382

Query  1378  CMAENSIAKDSITHKLIVLAPPQSPQVLLTATTTDSLTLKLKQHDGDTAPIHGYTLHYKP  1437
             C AENSIAKDSITHKLIVLAPPQSP V L+ATTTD+LT+KLK H+GDTAP+HGYTLHYKP
Sbjct  1383  CHAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGYTLHYKP  1442

Query  1438  EFGDWETVEVAVDAQKYTIENLFCGSRYQVYATGYNNIGAGEASDILNTRTKGSKPMMPE  1497
             EFG+WET EV+VD+QK+ IE L CGSRYQVYATG+NNIGAGEASDILNTRTKG KP +PE
Sbjct  1443  EFGEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKGQKPKLPE  1502

Query  1498  NSKFIDPSSNTVTLHLPTWKDGGCRMSHFVVEYKKKDHAEWTQISNNVKPGGNFVVLDLD  1557
               +FI+ SSN+V+LH   WKDGGC MSHFVVE KK+D  EW QISNNVKP  N+VVLDL+
Sbjct  1503  KPRFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKRDQIEWNQISNNVKPDNNYVVLDLE  1562

Query  1558  AASWYSVRITAHNSAGFTVAEYEFATLTVTGGTLAPPLNTAVLNGKTY----LPPWMPQW  1613
              A+WY++RITAHNSAGFTVAEY+FATLTVTGGT+A PL+    +G  +    LP WMP+W
Sbjct  1563  PATWYNLRITAHNSAGFTVAEYDFATLTVTGGTIA-PLDDGSGHGNVHTRIRLPAWMPEW  1621

Query  1614  FDLNFMVPLIATIIVVFVGVLVICVALSRRRMEDPRGGPKDVYYDVVYNQPMGPGATMDK  1673
              DLNFMVPLIAT++VV VG+ V+CVALSRRR +D RGG KDVYYDVVYNQ MGPGAT+DK
Sbjct  1622  LDLNFMVPLIATVVVVAVGICVVCVALSRRRADDMRGGQKDVYYDVVYNQTMGPGATLDK  1681

Query  1674  RRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRGTVISRSMRSNHSTWDPRR--PLYE  1731
             RRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG      +RSNHSTWDPRR   LYE
Sbjct  1682  RRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG---RGGLRSNHSTWDPRRNPNLYE  1738

Query  1732  ELKPPPVPRR-----HYHGSDECYHTHPHPHPAGMEDEICPYATFHLLGFREEMDPTKAM  1786
             ELK PPVP       H HG+ EC++ HP     GMEDEICPYATFHLLGFREEMDPTKAM
Sbjct  1739  ELKAPPVPMHGNHYGHAHGNAECHYRHP-----GMEDEICPYATFHLLGFREEMDPTKAM  1793

Query  1787  NFQTFPHQNGHTG--PGHA-TMGPGGPPGHIHSRSGSQSMPRQNRYARKNSQGGQSSIYT  1843
             NFQTFPHQNGH G  PGHA TM P G PGH+HSRSGSQSMPR NRY RKNSQGGQSSIYT
Sbjct  1794  NFQTFPHQNGHAGPVPGHAGTMLPPGHPGHVHSRSGSQSMPRANRYQRKNSQGGQSSIYT  1853

Query  1844  PAPEYDDPANCAEEDQYRRYTRVNSQGGSLYGGPGPEYDDPANCAPEDDQYGSQYGAPYG  1903
             PAPEYDDPANCAEEDQYRRYTRVNSQGGSLY GPGPEYDDPANCAPE+DQYGSQYG PYG
Sbjct  1854  PAPEYDDPANCAEEDQYRRYTRVNSQGGSLYSGPGPEYDDPANCAPEEDQYGSQYGGPYG  1913

Query  1904  --YDHYGSRGSVGRRSVGSARNLPNGSPEPPPPPPRNHDTSNSSFNDSKESNEISEAECD  1961
               YDHYGSRGS+GRRS+GSARN  NGSPEPPPPPPRNHD SNSSFNDSKESNEISEAECD
Sbjct  1914  QPYDHYGSRGSMGRRSIGSARNPGNGSPEPPPPPPRNHDMSNSSFNDSKESNEISEAECD  1973

Query  1962  RDH-PRGNYGENENSGDAKRSANTKDVRTTEEMRKLIDSRKSNEVAAKLQQQGGPAGLTA  2020
             RDH PRGNYG        KRS   KD RTTEEMRKLI+  ++     +LQQ  G AG TA
Sbjct  1974  RDHGPRGNYGA------VKRSPQPKDQRTTEEMRKLIERNETGPKQLQLQQANG-AGFTA  2026

Query  2021  YDTLAV  2026
             YDT+AV
Sbjct  2027  YDTMAV  2032



Lambda      K        H
   0.314    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 27131672232


Query= XP_037024208.1 Down syndrome cell adhesion molecule-like protein
Dscam2 isoform X13 [Bradysia coprophila]

Length=2026
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q0E9K5_DROME  unnamed protein product                                 3323    0.0  
Q0E9J4_DROME  unnamed protein product                                 3313    0.0  
Q0E9K9_DROME  unnamed protein product                                 3310    0.0  


>Q0E9K5_DROME unnamed protein product
Length=2032

 Score = 3323 bits (8617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1633/2047 (80%), Positives = 1798/2047 (88%), Gaps = 43/2047 (2%)

Query  3     QRTKWITKIIFIAV-LVDLGS---TANT-EADTKGPMFLKEPINRIDFSNSTGSVVECRA  57
             +R KW+  ++F AV L+  GS    AN  +AD KGP+FLKEP NRIDFSNSTG+ +EC+A
Sbjct  6     ERLKWL--MLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAEIECKA  63

Query  58    SGNPAPEIIWVRSDGTAVGDVPGLRQVLSNGNLVFPPFRAEDYRQEVHAQVYACLAKNQF  117
             SGNP PEIIW+RSDGTAVGDVPGLRQ+ S+G LVFPPFRAEDYRQEVHAQVYACLA+NQF
Sbjct  64    SGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQF  123

Query  118   GSIISRDVNVRAVVNQYYEAEVVSEYVIKGNTAVLKCNIPSF-ADFVKVEAWVASDGTEF  176
             GSIISRDV+VRAVVNQ+YEAE+++EYVI+GN AVLKC+IPSF ADFV+VE+W+  +G   
Sbjct  124   GSIISRDVHVRAVVNQFYEAEIMTEYVIRGNAAVLKCSIPSFVADFVRVESWIDDEGNVL  183

Query  177   LPSDSDFDGKYLVLPSGELHIKEVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPV  236
               SD ++DGKYLVLPSGELHI+EVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPV
Sbjct  184   SFSD-NYDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPV  242

Query  237   GSVAPKVNLGDKSRILSIRHGHVFDLLCPAQSYPMASFRWYKFIEGTTRKQAVVLNDRVK  296
             GSVAPKV++ D+   L    G    LLCPAQSYPM  +RWYKFIEGTTRKQAVVLNDRVK
Sbjct  243   GSVAPKVDVKDRITWLDKPMGQALSLLCPAQSYPMPVYRWYKFIEGTTRKQAVVLNDRVK  302

Query  297   QVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPSQVVDFGRPAV  356
             QVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPP+Q VDFGRPAV
Sbjct  303   QVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFGRPAV  362

Query  357   FTCHFSGNPIKTVSWLKDGKKIGHTDAILRIESVKKEHKGMYQCFIRNDQESAEASAELK  416
             FTC ++GNPIKTVSW+KDGK IGH++ +LRIESVKKE KGMYQCF+RNDQESAEASAELK
Sbjct  363   FTCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEASAELK  422

Query  417   LGGRFDPPIIRQAFPEETLHPGPSVFLKCVAGGLPTPEISWELDGKKIANSERYQVGQYV  476
             LGGRFDPP+IRQAF EET+ PGPSVFLKCVAGG PTPEISWELDGKKIAN++RYQVGQYV
Sbjct  423   LGGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQVGQYV  482

Query  477   TVNGDVVSYLNITSIHANDGGLYKCIASSKVGVAEHSAKLNVYGLPYIRPMEKKAIVAGE  536
             TVNGDVVSYLNITS+HANDGGLYKCIA SKVGVAEHSAKLNVYGLPYIR MEKKAIVAGE
Sbjct  483   TVNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKAIVAGE  542

Query  537   NLIVTCPVAGYPIESIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKNS  596
              LIVTCPVAGYPI+SIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKN 
Sbjct  543   TLIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKNQ  602

Query  597   EGYSARGALEVQVMVAPMILPFSFGDEAANPGDSTAVNCMITKGDLPLNIKWTLNGQPVV  656
             EGYSARG+LEVQVMV P I PFSFGD+  N G++  V CM+ KGD+P+ IKWTLN +P++
Sbjct  603   EGYSARGSLEVQVMVPPSIAPFSFGDDPVNTGENAGVQCMVQKGDVPITIKWTLNSRPII  662

Query  657   NGENGLQVVKMSSRLSSLSIESLGDRHRGTFRCIASNDAGETNYSSELNINVPPRWILEP  716
             NGE G+ ++K+S + S L+I ++   HRG F+CIA N AG +  +SEL +NVPPRWILEP
Sbjct  663   NGEEGITILKLSPKTSVLNIAAVEQDHRGVFKCIAENKAGSSFTTSELKVNVPPRWILEP  722

Query  717   TDKAFAQGSDAKVECKSDGFPKPQVTWKKAVGDTPGEYKDMKQSNNIRVDEGTLYIDNIQ  776
             TDKAFAQGSDAKVECK+DGFPKPQVTWKKAVGDTPGEYKD+K+S+NIRV+EGTL++DNIQ
Sbjct  723   TDKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHVDNIQ  782

Query  777   KNNEGYYLCEAINGIGSGLSAVILISVQAPPEFVEKLRNQTARRSEPAVLQCEAKGEKPI  836
             K NEGYYLCEAINGIGSGLSAVI+ISVQAPPEF EKLRNQTARR EPAVLQCEAKGEKPI
Sbjct  783   KTNEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKGEKPI  842

Query  837   GILWNMNNMRLDPKTDNRYTIREEILSTGVMSSLSIKRTERTDSALFTCVATNAFGSDDA  896
             GILWNMNNMRLDPK DNRYTIREEILSTGVMSSLSIKRTER+DSALFTCVATNAFGSDDA
Sbjct  843   GILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAFGSDDA  902

Query  897   SINMIIQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLKRYIIEFKTSRGSWEHDVDR  956
             SINMI+QEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPL RYIIEFK SR SW  ++DR
Sbjct  903   SINMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWS-EIDR  961

Query  957   VIVPGHTNEAQVQKLNPATTYNIRIVAENEIGVSDSSEVVPIITAEEAPSGKPQSIKVEP  1016
             VIVPGHT EAQVQKL+PATTYNIRIVAEN IG S SSE V IITAEEAPSGKPQ+IKVEP
Sbjct  962   VIVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNIKVEP  1021

Query  1017  LSQTSLRVLWKAPPRSDWNGEILGYYVGYKLTNNNGSYYFEDYKYMMEEGKEYSYELTNL  1076
             ++QT++RV WK PPR++WNGEILGYYVGYKL+N N SY FE   ++ EEGKE++ EL NL
Sbjct  1022  VNQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLELQNL  1081

Query  1077  KTYTQYSVVIQAYNKVGAGPLSEDEKQYTAEGTPDQPPSDITCTTLTSQTIRVSWVSPPL  1136
             + YTQYSVVIQA+NK+GAGPLSE+EKQ+TAEGTP QPPSD  CTTLTSQTIRV WVSPPL
Sbjct  1082  RVYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWVSPPL  1141

Query  1137  ESANGVIKGYKVVYAPSELWYDDKNKDYKKTASSDTVLHGLKKYTNYTMQVLATTSGGDG  1196
             ESANGVIK YKVVYAPS+ WYD+  + YKKTASSDTVLHGLKKYTNYTMQVLATT+GGDG
Sbjct  1142  ESANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTAGGDG  1201

Query  1197  VRSPPIHCQTEQDVPEAPTAVKALVVGSEAILVSWLPPAQPNGLITQYTVYSKEEGTESE  1256
             VRS PIHCQTE DVPEAPT VKALV+G+ AILVSW PPAQPNG+ITQYTVYSK EG E+E
Sbjct  1202  VRSVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEGAETE  1261

Query  1257  VKSHKVPPYQMSYEASSLDKNKPFEFWVTANTNIGEGQASKSIVAMPSDKVPAKIASFDD  1316
              K+ KVP YQMS+EA+ L+KNKP+EFWVTA+T IGEGQ SKSIVAMPSD+VPAKIASFDD
Sbjct  1262  TKTQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIASFDD  1321

Query  1317  TFTAIFKEDFKLPCLAVGAPAPDITWKVKGVEFVPNDRVRQLPEGSLSIKDVIRQDAGDY  1376
             TFTA FKED K+PCLAVGAP P+ITWK+KGVEF  NDR+R LP+GSL IK V RQDAGDY
Sbjct  1322  TFTATFKEDAKMPCLAVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNRQDAGDY  1381

Query  1377  TCMAENSIAKDSITHKLIVLAPPQSPQVLLTATTTDSLTLKLKQHDGDTAPIHGYTLHYK  1436
             +C AENSIAKDSITHKLIVLAPPQSP V L+ATTTD+LT+KLK H+GDTAP+HGYTLHYK
Sbjct  1382  SCHAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGYTLHYK  1441

Query  1437  PEFGDWETVEVAVDAQKYTIENLFCGSRYQVYATGYNNIGAGEASDILNTRTKGSKPMMP  1496
             PEFG+WET EV+VD+QK+ IE L CGSRYQVYATG+NNIGAGEASDILNTRTKG KP +P
Sbjct  1442  PEFGEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKGQKPKLP  1501

Query  1497  ENSKFIDPSSNTVTLHLPTWKDGGCRMSHFVVEYKKKDHAEWTQISNNVKPGGNFVVLDL  1556
             E  +FI+ SSN+V+LH   WKDGGC MSHFVVE KK+D  EW QISNNVKP  N+VVLDL
Sbjct  1502  EKPRFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKRDQIEWNQISNNVKPDNNYVVLDL  1561

Query  1557  DAASWYSVRITAHNSAGFTVAEYEFATLTVTGGTLAPPLNTAVLNGKTY----LPPWMPQ  1612
             + A+WY++RITAHNSAGFTVAEY+FATLTVTGGT+A PL+    +G  +    LP WMP+
Sbjct  1562  EPATWYNLRITAHNSAGFTVAEYDFATLTVTGGTIA-PLDDGSGHGNVHTRIRLPAWMPE  1620

Query  1613  WFDLNFMVPLIATIIVVFVGVLVICVALSRRRMEDPRGGPKDVYYDVVYNQPMGPGATMD  1672
             W DLNFMVPLIAT++VV VG+ V+CVALSRRR +D RGG KDVYYDVVYNQ MGPGAT+D
Sbjct  1621  WLDLNFMVPLIATVVVVAVGICVVCVALSRRRADDMRGGQKDVYYDVVYNQTMGPGATLD  1680

Query  1673  KRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRGTVISRSMRSNHSTWDPRR--PLY  1730
             KRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG      +RSNHSTWDPRR   LY
Sbjct  1681  KRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG---RGGLRSNHSTWDPRRNPNLY  1737

Query  1731  EELKPPPVPRR-----HYHGSDECYHTHPHPHPAGMEDEICPYATFHLLGFREEMDPTKA  1785
             EELK PPVP       H HG+ EC++ HP     GMEDEICPYATFHLLGFREEMDPTKA
Sbjct  1738  EELKAPPVPMHGNHYGHAHGNAECHYRHP-----GMEDEICPYATFHLLGFREEMDPTKA  1792

Query  1786  MNFQTFPHQNGHTG--PGHA-TMGPGGPPGHIHSRSGSQSMPRQNRYARKNSQGGQSSIY  1842
             MNFQTFPHQNGH G  PGHA TM P G PGH+HSRSGSQSMPR NRY RKNSQGGQSSIY
Sbjct  1793  MNFQTFPHQNGHAGPVPGHAGTMLPPGHPGHVHSRSGSQSMPRANRYQRKNSQGGQSSIY  1852

Query  1843  TPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYGGPGPEYDDPANCAPEDDQYGSQYGAPY  1902
             TPAPEYDDPANCAEEDQYRRYTRVNSQGGSLY GPGPEYDDPANCAPE+DQYGSQYG PY
Sbjct  1853  TPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYSGPGPEYDDPANCAPEEDQYGSQYGGPY  1912

Query  1903  G--YDHYGSRGSVGRRSVGSARNLPNGSPEPPPPPPRNHDTSNSSFNDSKESNEISEAEC  1960
             G  YDHYGSRGS+GRRS+GSARN  NGSPEPPPPPPRNHD SNSSFNDSKESNEISEAEC
Sbjct  1913  GQPYDHYGSRGSMGRRSIGSARNPGNGSPEPPPPPPRNHDMSNSSFNDSKESNEISEAEC  1972

Query  1961  DRDH-PRGNYGENENSGDAKRSANTKDVRTTEEMRKLIDSRKSNEVAAKLQQQGGPAGLT  2019
             DRDH PRGNYG        KRS   KD RTTEEMRKLI+  ++     +LQQ  G AG T
Sbjct  1973  DRDHGPRGNYGA------VKRSPQPKDQRTTEEMRKLIERNETGPKQLQLQQANG-AGFT  2025

Query  2020  AYDTLAV  2026
             AYDT+AV
Sbjct  2026  AYDTMAV  2032


>Q0E9J4_DROME unnamed protein product
Length=2031

 Score = 3313 bits (8589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1636/2047 (80%), Positives = 1795/2047 (88%), Gaps = 44/2047 (2%)

Query  3     QRTKWITKIIFIAV-LVDLGS---TANT-EADTKGPMFLKEPINRIDFSNSTGSVVECRA  57
             +R KW+  ++F AV L+  GS    AN  +AD KGP+FLKEP NRIDFSNSTG+ +EC+A
Sbjct  6     ERLKWL--MLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAEIECKA  63

Query  58    SGNPAPEIIWVRSDGTAVGDVPGLRQVLSNGNLVFPPFRAEDYRQEVHAQVYACLAKNQF  117
             SGNP PEIIW+RSDGTAVGDVPGLRQ+ S+G LVFPPFRAEDYRQEVHAQVYACLA+NQF
Sbjct  64    SGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQF  123

Query  118   GSIISRDVNVRAVVNQYYEAEVVSEYVIKGNTAVLKCNIPSF-ADFVKVEAWVASDGTEF  176
             GSIISRDV+VRAVVNQYYEAEVVSEYVI+GNTAVLKC IPSF ADF++VEAWVASDGTE+
Sbjct  124   GSIISRDVHVRAVVNQYYEAEVVSEYVIRGNTAVLKCTIPSFVADFLRVEAWVASDGTEY  183

Query  177   LPSDSDFDGKYLVLPSGELHIKEVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPV  236
              P + DFDGKYLVLPSGELHI+EVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPV
Sbjct  184   APEE-DFDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPV  242

Query  237   GSVAPKVNLGDKSRILSIRHGHVFDLLCPAQSYPMASFRWYKFIEGTTRKQAVVLNDRVK  296
             GSV PK+++G++ R           L CPAQSYP+ SFRWYKFIEGTTRKQAVVLNDRVK
Sbjct  243   GSVGPKISVGERLRDAGAPSKSTLTLFCPAQSYPVPSFRWYKFIEGTTRKQAVVLNDRVK  302

Query  297   QVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPSQVVDFGRPAV  356
             QVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPP+Q VDFGRPAV
Sbjct  303   QVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFGRPAV  362

Query  357   FTCHFSGNPIKTVSWLKDGKKIGHTDAILRIESVKKEHKGMYQCFIRNDQESAEASAELK  416
             FTC ++GNPIKTVSW+KDGK IGH++ +LRIESVKKE KGMYQCF+RNDQESAEASAELK
Sbjct  363   FTCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEASAELK  422

Query  417   LGGRFDPPIIRQAFPEETLHPGPSVFLKCVAGGLPTPEISWELDGKKIANSERYQVGQYV  476
             LGGRFDPP+IRQAF EET+ PGPSVFLKCVAGG PTPEISWELDGKKIAN++RYQVGQYV
Sbjct  423   LGGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQVGQYV  482

Query  477   TVNGDVVSYLNITSIHANDGGLYKCIASSKVGVAEHSAKLNVYGLPYIRPMEKKAIVAGE  536
             TVNGDVVSYLNITS+HANDGGLYKCIA SKVGVAEHSAKLNVYGLPYIR MEKKAIVAGE
Sbjct  483   TVNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKAIVAGE  542

Query  537   NLIVTCPVAGYPIESIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKNS  596
              LIVTCPVAGYPI+SIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKN 
Sbjct  543   TLIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKNQ  602

Query  597   EGYSARGALEVQVMVAPMILPFSFGDEAANPGDSTAVNCMITKGDLPLNIKWTLNGQPVV  656
             EGYSARG+LEVQVM  P I PFSFG+E AN  DS +V C+I+ GDLP++I+W  N +  +
Sbjct  603   EGYSARGSLEVQVMAPPKITPFSFGEEPANVEDSVSVTCLISTGDLPIDIEWFFN-EYGI  661

Query  657   NGENGLQVVKMSSRLSSLSIESLGDRHRGTFRCIASNDAGETNYSSELNINVPPRWILEP  716
             +  +G+ V+K   R S LSI+S+  RH G + C A N A   NY+++L +NVPPRWILEP
Sbjct  662   SSYSGISVMKGGKRNSVLSIDSVQARHAGNYSCRAKNHAAAVNYTTDLIVNVPPRWILEP  721

Query  717   TDKAFAQGSDAKVECKSDGFPKPQVTWKKAVGDTPGEYKDMKQSNNIRVDEGTLYIDNIQ  776
             TDKAFAQGSDAKVECK+DGFPKPQVTWKKAVGDTPGEYKD+K+S+NIRV+EGTL++DNIQ
Sbjct  722   TDKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHVDNIQ  781

Query  777   KNNEGYYLCEAINGIGSGLSAVILISVQAPPEFVEKLRNQTARRSEPAVLQCEAKGEKPI  836
             K NEGYYLCEAINGIGSGLSAVI+ISVQAPPEF EKLRNQTARR EPAVLQCEAKGEKPI
Sbjct  782   KTNEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKGEKPI  841

Query  837   GILWNMNNMRLDPKTDNRYTIREEILSTGVMSSLSIKRTERTDSALFTCVATNAFGSDDA  896
             GILWNMNNMRLDPK DNRYTIREEILSTGVMSSLSIKRTER+DSALFTCVATNAFGSDDA
Sbjct  842   GILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAFGSDDA  901

Query  897   SINMIIQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLKRYIIEFKTSRGSWEHDVDR  956
             SINMI+QEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPL RYIIEFK SR SW  ++DR
Sbjct  902   SINMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWS-EIDR  960

Query  957   VIVPGHTNEAQVQKLNPATTYNIRIVAENEIGVSDSSEVVPIITAEEAPSGKPQSIKVEP  1016
             VIVPGHT EAQVQKL+PATTYNIRIVAEN IG S SSE V IITAEEAPSGKPQ+IKVEP
Sbjct  961   VIVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNIKVEP  1020

Query  1017  LSQTSLRVLWKAPPRSDWNGEILGYYVGYKLTNNNGSYYFEDYKYMMEEGKEYSYELTNL  1076
             ++QT++RV WK PPR++WNGEILGYYVGYKL+N N SY FE   ++ EEGKE++ EL NL
Sbjct  1021  VNQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLELQNL  1080

Query  1077  KTYTQYSVVIQAYNKVGAGPLSEDEKQYTAEGTPDQPPSDITCTTLTSQTIRVSWVSPPL  1136
             + YTQYSVVIQA+NK+GAGPLSE+EKQ+TAEGTP QPPSD  CTTLTSQTIRV WVSPPL
Sbjct  1081  RVYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWVSPPL  1140

Query  1137  ESANGVIKGYKVVYAPSELWYDDKNKDYKKTASSDTVLHGLKKYTNYTMQVLATTSGGDG  1196
             ESANGVIK YKVVYAPS+ WYD+  + YKKTASSDTVLHGLKKYTNYTMQVLATT+GGDG
Sbjct  1141  ESANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTAGGDG  1200

Query  1197  VRSPPIHCQTEQDVPEAPTAVKALVVGSEAILVSWLPPAQPNGLITQYTVYSKEEGTESE  1256
             VRS PIHCQTE DVPEAPT VKALV+G+ AILVSW PPAQPNG+ITQYTVYSK EG E+E
Sbjct  1201  VRSVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEGAETE  1260

Query  1257  VKSHKVPPYQMSYEASSLDKNKPFEFWVTANTNIGEGQASKSIVAMPSDKVPAKIASFDD  1316
              K+ KVP YQMS+EA+ L+KNKP+EFWVTA+T IGEGQ SKSIVAMPSD+VPAKIASFDD
Sbjct  1261  TKTQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIASFDD  1320

Query  1317  TFTAIFKEDFKLPCLAVGAPAPDITWKVKGVEFVPNDRVRQLPEGSLSIKDVIRQDAGDY  1376
             TFTA FKED K+PCLAVGAP P+ITWK+KGVEF  NDR+R LP+GSL IK V RQDAGDY
Sbjct  1321  TFTATFKEDAKMPCLAVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNRQDAGDY  1380

Query  1377  TCMAENSIAKDSITHKLIVLAPPQSPQVLLTATTTDSLTLKLKQHDGDTAPIHGYTLHYK  1436
             +C AENSIAKDSITHKLIVLAPPQSP V L+ATTTD+LT+KLK H+GDTAP+HGYTLHYK
Sbjct  1381  SCHAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGYTLHYK  1440

Query  1437  PEFGDWETVEVAVDAQKYTIENLFCGSRYQVYATGYNNIGAGEASDILNTRTKGSKPMMP  1496
             PEFG+WET EV+VD+QK+ IE L CGSRYQVYATG+NNIGAGEASDILNTRTKG KP +P
Sbjct  1441  PEFGEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKGQKPKLP  1500

Query  1497  ENSKFIDPSSNTVTLHLPTWKDGGCRMSHFVVEYKKKDHAEWTQISNNVKPGGNFVVLDL  1556
             E  +FI+ SSN+V+LH   WKDGGC MSHFVVE KK+D  EW QISNNVKP  N+VVLDL
Sbjct  1501  EKPRFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKRDQIEWNQISNNVKPDNNYVVLDL  1560

Query  1557  DAASWYSVRITAHNSAGFTVAEYEFATLTVTGGTLAPPLNTAVLNGKTY----LPPWMPQ  1612
             + A+WY++RITAHNSAGFTVAEY+FATLTVTGGT+A PL+    +G  +    LP WMP+
Sbjct  1561  EPATWYNLRITAHNSAGFTVAEYDFATLTVTGGTIA-PLDDGSGHGNVHTRIRLPAWMPE  1619

Query  1613  WFDLNFMVPLIATIIVVFVGVLVICVALSRRRMEDPRGGPKDVYYDVVYNQPMGPGATMD  1672
             W DLNFMVPLIAT++VV VG+ V+CVALSRRR +D RGG KDVYYDVVYNQ MGPGAT+D
Sbjct  1620  WLDLNFMVPLIATVVVVAVGICVVCVALSRRRADDMRGGQKDVYYDVVYNQTMGPGATLD  1679

Query  1673  KRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRGTVISRSMRSNHSTWDPRR--PLY  1730
             KRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG      +RSNHSTWDPRR   LY
Sbjct  1680  KRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG---RGGLRSNHSTWDPRRNPNLY  1736

Query  1731  EELKPPPVPRR-----HYHGSDECYHTHPHPHPAGMEDEICPYATFHLLGFREEMDPTKA  1785
             EELK PPVP       H HG+ EC++ HP     GMEDEICPYATFHLLGFREEMDPTKA
Sbjct  1737  EELKAPPVPMHGNHYGHAHGNAECHYRHP-----GMEDEICPYATFHLLGFREEMDPTKA  1791

Query  1786  MNFQTFPHQNGHTG--PGHA-TMGPGGPPGHIHSRSGSQSMPRQNRYARKNSQGGQSSIY  1842
             MNFQTFPHQNGH G  PGHA TM P G PGH+HSRSGSQSMPR NRY RKNSQGGQSSIY
Sbjct  1792  MNFQTFPHQNGHAGPVPGHAGTMLPPGHPGHVHSRSGSQSMPRANRYQRKNSQGGQSSIY  1851

Query  1843  TPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYGGPGPEYDDPANCAPEDDQYGSQYGAPY  1902
             TPAPEYDDPANCAEEDQYRRYTRVNSQGGSLY GPGPEYDDPANCAPE+DQYGSQYG PY
Sbjct  1852  TPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYSGPGPEYDDPANCAPEEDQYGSQYGGPY  1911

Query  1903  G--YDHYGSRGSVGRRSVGSARNLPNGSPEPPPPPPRNHDTSNSSFNDSKESNEISEAEC  1960
             G  YDHYGSRGS+GRRS+GSARN  NGSPEPPPPPPRNHD SNSSFNDSKESNEISEAEC
Sbjct  1912  GQPYDHYGSRGSMGRRSIGSARNPGNGSPEPPPPPPRNHDMSNSSFNDSKESNEISEAEC  1971

Query  1961  DRDH-PRGNYGENENSGDAKRSANTKDVRTTEEMRKLIDSRKSNEVAAKLQQQGGPAGLT  2019
             DRDH PRGNYG        KRS   KD RTTEEMRKLI+  ++     +LQQ  G AG T
Sbjct  1972  DRDHGPRGNYGA------VKRSPQPKDQRTTEEMRKLIERNETGPKQLQLQQANG-AGFT  2024

Query  2020  AYDTLAV  2026
             AYDT+AV
Sbjct  2025  AYDTMAV  2031


>Q0E9K9_DROME unnamed protein product
Length=2032

 Score = 3310 bits (8583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1629/2047 (80%), Positives = 1791/2047 (87%), Gaps = 43/2047 (2%)

Query  3     QRTKWITKIIFIAV-LVDLGS---TANT-EADTKGPMFLKEPINRIDFSNSTGSVVECRA  57
             +R KW+  ++F AV L+  GS    AN  +AD KGP+FLKEP NRIDFSNSTG+ +EC+A
Sbjct  6     ERLKWL--MLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAEIECKA  63

Query  58    SGNPAPEIIWVRSDGTAVGDVPGLRQVLSNGNLVFPPFRAEDYRQEVHAQVYACLAKNQF  117
             SGNP PEIIW+RSDGTAVGDVPGLRQ+ S+G LVFPPFRAEDYRQEVHAQVYACLA+NQF
Sbjct  64    SGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQF  123

Query  118   GSIISRDVNVRAVVNQYYEAEVVSEYVIKGNTAVLKCNIPSF-ADFVKVEAWVASDGTEF  176
             GSIISRDV+VRAVVNQ+YEAE+++EYVI+GN AVLKC+IPSF ADFV+VE+W+  +G   
Sbjct  124   GSIISRDVHVRAVVNQFYEAEIMTEYVIRGNAAVLKCSIPSFVADFVRVESWIDDEGNVL  183

Query  177   LPSDSDFDGKYLVLPSGELHIKEVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPV  236
               SD ++DGKYLVLPSGELHI+EVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEP+
Sbjct  184   SFSD-NYDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPI  242

Query  237   GSVAPKVNLGDKSRILSIRHGHVFDLLCPAQSYPMASFRWYKFIEGTTRKQAVVLNDRVK  296
             G+ AP  +    S   +   G  F LLC AQ+YP+   RWYKFIEGTTRKQAVVLNDRVK
Sbjct  243   GARAPTFSTDSNSFSYTRSVGQSFALLCQAQAYPVPIMRWYKFIEGTTRKQAVVLNDRVK  302

Query  297   QVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPSQVVDFGRPAV  356
             QVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPP+Q VDFGRPAV
Sbjct  303   QVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFGRPAV  362

Query  357   FTCHFSGNPIKTVSWLKDGKKIGHTDAILRIESVKKEHKGMYQCFIRNDQESAEASAELK  416
             FTC ++GNPIKTVSW+KDGK IGH++ +LRIESVKKE KGMYQCF+RNDQESAEASAELK
Sbjct  363   FTCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEASAELK  422

Query  417   LGGRFDPPIIRQAFPEETLHPGPSVFLKCVAGGLPTPEISWELDGKKIANSERYQVGQYV  476
             LGGRFDPP+IRQAF EET+ PGPSVFLKCVAGG PTPEISWELDGKKIAN++RYQVGQYV
Sbjct  423   LGGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQVGQYV  482

Query  477   TVNGDVVSYLNITSIHANDGGLYKCIASSKVGVAEHSAKLNVYGLPYIRPMEKKAIVAGE  536
             TVNGDVVSYLNITS+HANDGGLYKCIA SKVGVAEHSAKLNVYGLPYIR MEKKAIVAGE
Sbjct  483   TVNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKAIVAGE  542

Query  537   NLIVTCPVAGYPIESIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKNS  596
              LIVTCPVAGYPI+SIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKN 
Sbjct  543   TLIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKNQ  602

Query  597   EGYSARGALEVQVMVAPMILPFSFGDEAANPGDSTAVNCMITKGDLPLNIKWTLNGQPVV  656
             EGYSARG+LEVQVMV P I  F FG EAAN G+     CM+ KGDLP+ I+WTLN  P++
Sbjct  603   EGYSARGSLEVQVMVPPQIQAFDFGSEAANTGEMAGGFCMVPKGDLPMEIRWTLNSAPII  662

Query  657   NGENGLQVVKMSSRLSSLSIESLGDRHRGTFRCIASNDAGETNYSSELNINVPPRWILEP  716
              GE+G  + +++ R SSLSI+SL  RHRG +RCIASN AG   YS+EL++NVPPRWILEP
Sbjct  663   TGEHGFSLSRLNPRTSSLSIDSLEARHRGLYRCIASNKAGSAEYSAELHVNVPPRWILEP  722

Query  717   TDKAFAQGSDAKVECKSDGFPKPQVTWKKAVGDTPGEYKDMKQSNNIRVDEGTLYIDNIQ  776
             TDKAFAQGSDAKVECK+DGFPKPQVTWKKAVGDTPGEYKD+K+S+NIRV+EGTL++DNIQ
Sbjct  723   TDKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHVDNIQ  782

Query  777   KNNEGYYLCEAINGIGSGLSAVILISVQAPPEFVEKLRNQTARRSEPAVLQCEAKGEKPI  836
             K NEGYYLCEAINGIGSGLSAVI+ISVQAPPEF EKLRNQTARR EPAVLQCEAKGEKPI
Sbjct  783   KTNEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKGEKPI  842

Query  837   GILWNMNNMRLDPKTDNRYTIREEILSTGVMSSLSIKRTERTDSALFTCVATNAFGSDDA  896
             GILWNMNNMRLDPK DNRYTIREEILSTGVMSSLSIKRTER+DSALFTCVATNAFGSDDA
Sbjct  843   GILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAFGSDDA  902

Query  897   SINMIIQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLKRYIIEFKTSRGSWEHDVDR  956
             SINMI+QEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPL RYIIEFK SR SW  ++DR
Sbjct  903   SINMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWS-EIDR  961

Query  957   VIVPGHTNEAQVQKLNPATTYNIRIVAENEIGVSDSSEVVPIITAEEAPSGKPQSIKVEP  1016
             VIVPGHT EAQVQKL+PATTYNIRIVAEN IG S SSE V IITAEEAPSGKPQ+IKVEP
Sbjct  962   VIVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNIKVEP  1021

Query  1017  LSQTSLRVLWKAPPRSDWNGEILGYYVGYKLTNNNGSYYFEDYKYMMEEGKEYSYELTNL  1076
             ++QT++RV WK PPR++WNGEILGYYVGYKL+N N SY FE   ++ EEGKE++ EL NL
Sbjct  1022  VNQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLELQNL  1081

Query  1077  KTYTQYSVVIQAYNKVGAGPLSEDEKQYTAEGTPDQPPSDITCTTLTSQTIRVSWVSPPL  1136
             + YTQYSVVIQA+NK+GAGPLSE+EKQ+TAEGTP QPPSD  CTTLTSQTIRV WVSPPL
Sbjct  1082  RVYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWVSPPL  1141

Query  1137  ESANGVIKGYKVVYAPSELWYDDKNKDYKKTASSDTVLHGLKKYTNYTMQVLATTSGGDG  1196
             ESANGVIK YKVVYAPS+ WYD+  + YKKTASSDTVLHGLKKYTNYTMQVLATT+GGDG
Sbjct  1142  ESANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTAGGDG  1201

Query  1197  VRSPPIHCQTEQDVPEAPTAVKALVVGSEAILVSWLPPAQPNGLITQYTVYSKEEGTESE  1256
             VRS PIHCQTE DVPEAPT VKALV+G+ AILVSW PPAQPNG+ITQYTVYSK EG E+E
Sbjct  1202  VRSVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEGAETE  1261

Query  1257  VKSHKVPPYQMSYEASSLDKNKPFEFWVTANTNIGEGQASKSIVAMPSDKVPAKIASFDD  1316
              K+ KVP YQMS+EA+ L+KNKP+EFWVTA+T IGEGQ SKSIVAMPSD+VPAKIASFDD
Sbjct  1262  TKTQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIASFDD  1321

Query  1317  TFTAIFKEDFKLPCLAVGAPAPDITWKVKGVEFVPNDRVRQLPEGSLSIKDVIRQDAGDY  1376
             TFTA FKED K+PCLAVGAP P+ITWK+KGVEF  NDR+R LP+GSL IK V RQDAGDY
Sbjct  1322  TFTATFKEDAKMPCLAVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNRQDAGDY  1381

Query  1377  TCMAENSIAKDSITHKLIVLAPPQSPQVLLTATTTDSLTLKLKQHDGDTAPIHGYTLHYK  1436
             +C AENSIAKDSITHKLIVLAPPQSP V L+ATTTD+LT+KLK H+GDTAP+HGYTLHYK
Sbjct  1382  SCHAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGYTLHYK  1441

Query  1437  PEFGDWETVEVAVDAQKYTIENLFCGSRYQVYATGYNNIGAGEASDILNTRTKGSKPMMP  1496
             PEFG+WET EV+VD+QK+ IE L CGSRYQVYATG+NNIGAGEASDILNTRTKG KP +P
Sbjct  1442  PEFGEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKGQKPKLP  1501

Query  1497  ENSKFIDPSSNTVTLHLPTWKDGGCRMSHFVVEYKKKDHAEWTQISNNVKPGGNFVVLDL  1556
             E  +FI+ SSN+V+LH   WKDGGC MSHFVVE KK+D  EW QISNNVKP  N+VVLDL
Sbjct  1502  EKPRFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKRDQIEWNQISNNVKPDNNYVVLDL  1561

Query  1557  DAASWYSVRITAHNSAGFTVAEYEFATLTVTGGTLAPPLNTAVLNGKTY----LPPWMPQ  1612
             + A+WY++RITAHNSAGFTVAEY+FATLTVTGGT+A PL+    +G  +    LP WMP+
Sbjct  1562  EPATWYNLRITAHNSAGFTVAEYDFATLTVTGGTIA-PLDDGSGHGNVHTRIRLPAWMPE  1620

Query  1613  WFDLNFMVPLIATIIVVFVGVLVICVALSRRRMEDPRGGPKDVYYDVVYNQPMGPGATMD  1672
             W DLNFMVPLIAT++VV VG+ V+CVALSRRR +D RGG KDVYYDVVYNQ MGPGAT+D
Sbjct  1621  WLDLNFMVPLIATVVVVAVGICVVCVALSRRRADDMRGGQKDVYYDVVYNQTMGPGATLD  1680

Query  1673  KRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRGTVISRSMRSNHSTWDPRR--PLY  1730
             KRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG      +RSNHSTWDPRR   LY
Sbjct  1681  KRRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG---RGGLRSNHSTWDPRRNPNLY  1737

Query  1731  EELKPPPVPRR-----HYHGSDECYHTHPHPHPAGMEDEICPYATFHLLGFREEMDPTKA  1785
             EELK PPVP       H HG+ EC++ HP     GMEDEICPYATFHLLGFREEMDPTKA
Sbjct  1738  EELKAPPVPMHGNHYGHAHGNAECHYRHP-----GMEDEICPYATFHLLGFREEMDPTKA  1792

Query  1786  MNFQTFPHQNGHTG--PGHA-TMGPGGPPGHIHSRSGSQSMPRQNRYARKNSQGGQSSIY  1842
             MNFQTFPHQNGH G  PGHA TM P G PGH+HSRSGSQSMPR NRY RKNSQGGQSSIY
Sbjct  1793  MNFQTFPHQNGHAGPVPGHAGTMLPPGHPGHVHSRSGSQSMPRANRYQRKNSQGGQSSIY  1852

Query  1843  TPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYGGPGPEYDDPANCAPEDDQYGSQYGAPY  1902
             TPAPEYDDPANCAEEDQYRRYTRVNSQGGSLY GPGPEYDDPANCAPE+DQYGSQYG PY
Sbjct  1853  TPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYSGPGPEYDDPANCAPEEDQYGSQYGGPY  1912

Query  1903  G--YDHYGSRGSVGRRSVGSARNLPNGSPEPPPPPPRNHDTSNSSFNDSKESNEISEAEC  1960
             G  YDHYGSRGS+GRRS+GSARN  NGSPEPPPPPPRNHD SNSSFNDSKESNEISEAEC
Sbjct  1913  GQPYDHYGSRGSMGRRSIGSARNPGNGSPEPPPPPPRNHDMSNSSFNDSKESNEISEAEC  1972

Query  1961  DRDH-PRGNYGENENSGDAKRSANTKDVRTTEEMRKLIDSRKSNEVAAKLQQQGGPAGLT  2019
             DRDH PRGNYG        KRS   KD RTTEEMRKLI+  ++     +LQQ  G AG T
Sbjct  1973  DRDHGPRGNYGA------VKRSPQPKDQRTTEEMRKLIERNETGPKQLQLQQANG-AGFT  2025

Query  2020  AYDTLAV  2026
             AYDT+AV
Sbjct  2026  AYDTMAV  2032



Lambda      K        H
   0.314    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 27131672232


Query= XP_037024209.1 Down syndrome cell adhesion molecule-like protein
Dscam2 isoform X14 [Bradysia coprophila]

Length=2025
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q0E9J5_DROME  unnamed protein product                                 3348    0.0  
Q0E9J4_DROME  unnamed protein product                                 3335    0.0  
Q0E9J9_DROME  unnamed protein product                                 3331    0.0  


>Q0E9J5_DROME unnamed protein product
Length=2031

 Score = 3348 bits (8682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1642/2045 (80%), Positives = 1799/2045 (88%), Gaps = 41/2045 (2%)

Query  3     QRTKWITKIIFIAV-LVDLGS---TANT-EADTKGPMFLKEPINRIDFSNSTGSVVECRA  57
             +R KW+  ++F AV L+  GS    AN  +AD KGP+FLKEP NRIDFSNSTG+ +EC+A
Sbjct  6     ERLKWL--MLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAEIECKA  63

Query  58    SGNPAPEIIWVRSDGTAVGDVPGLRQVLSNGNLVFPPFRAEDYRQEVHAQVYACLAKNQF  117
             SGNP PEIIW+RSDGTAVGDVPGLRQ+ S+G LVFPPFRAEDYRQEVHAQVYACLA+NQF
Sbjct  64    SGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQF  123

Query  118   GSIISRDVNVRAVVNQFYEAEIMTEYVIRGNTAILKCSIPSFMGDYVRVESWIDETNTVL  177
             GSIISRDV+VRAVVNQFY A+I+ EYVIRGN A+LKCSIPSF+ D+VRVESWIDE  T L
Sbjct  124   GSIISRDVHVRAVVNQFYGADILMEYVIRGNAAVLKCSIPSFVADFVRVESWIDEEGTEL  183

Query  178   ATSDNYDGKYLVLPSGELHIKEVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVG  237
               S+NYDGKYLVLPSGELHI+EVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVG
Sbjct  184   RPSENYDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVG  243

Query  238   SVAPKVNVADKGHISSARTGHTTDILCPAQGYPMPAFRWYKFIEGTTRKQAVVLNDRVKQ  297
             SVAPKV++ DK   +   +  + ++ C AQG+PMPAFRWYKFIEGTTRKQAVVLNDRVKQ
Sbjct  244   SVAPKVDMHDKMDFTIRSSNRSLNLFCKAQGFPMPAFRWYKFIEGTTRKQAVVLNDRVKQ  303

Query  298   VSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPSQVVDFGRPAVF  357
             VSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPP+Q VDFGRPAVF
Sbjct  304   VSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFGRPAVF  363

Query  358   TCHFSGNPIKTVSWLKDGKKIGHTDAILRIESVKKEHKGMYQCFIRNDQESAEASAELKL  417
             TC ++GNPIKTVSW+KDGK IGH++ +LRIESVKKE KGMYQCF+RNDQESAEASAELKL
Sbjct  364   TCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEASAELKL  423

Query  418   GGRFDPPIIRQAFPEETLHPGPSVFLKCVAGGLPTPEISWELDGKKIANSERYQVGQYVT  477
             GGRFDPP+IRQAF EET+ PGPSVFLKCVAGG PTPEISWELDGKKIAN++RYQVGQYVT
Sbjct  424   GGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQVGQYVT  483

Query  478   VNGDVVSYLNITSIHANDGGLYKCIASSKVGVAEHSAKLNVYGLPYIRPMEKKAIVAGEN  537
             VNGDVVSYLNITS+HANDGGLYKCIA SKVGVAEHSAKLNVYGLPYIR MEKKAIVAGE 
Sbjct  484   VNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKAIVAGET  543

Query  538   LIVTCPVAGYPIESIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKNSE  597
             LIVTCPVAGYPI+SIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKN E
Sbjct  544   LIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKNQE  603

Query  598   GYSARGALEVQVMVPPKIAHFDFGDEPSNYGDTASVSCIVTSGDLPVDFKWLFNGKPISE  657
             GYSARG+LEVQVM PPKIA FDFG   S++ D+ SV+C+VTSGDLP+D +WLF G+PI+ 
Sbjct  604   GYSARGSLEVQVMAPPKIAPFDFGQSASSFEDSVSVNCLVTSGDLPIDIEWLFGGEPINF  663

Query  658   FAGISTAKMGKRNSVMNIDSVSGKHAGKYTCLASNTASIVNFTAVLIVNVPPRWILEPTD  717
               GI+  + GKR S++ IDSV   HAG YTC A N AS   ++A LIVNVPPRWILEPTD
Sbjct  664   ATGIAILRGGKRTSLLTIDSVHAGHAGNYTCKAKNQASSSEYSAALIVNVPPRWILEPTD  723

Query  718   KAFAQGSDAKVECKSDGFPKPQVTWKKAVGDTPGEYKDMKQSNNIRVDEGTLYIDNIQKN  777
             KAFAQGSDAKVECK+DGFPKPQVTWKKAVGDTPGEYKD+K+S+NIRV+EGTL++DNIQK 
Sbjct  724   KAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHVDNIQKT  783

Query  778   NEGYYLCEAINGIGSGLSAVILISVQAPPEFVEKLRNQTARRSEPAVLQCEAKGEKPIGI  837
             NEGYYLCEAINGIGSGLSAVI+ISVQAPPEF EKLRNQTARR EPAVLQCEAKGEKPIGI
Sbjct  784   NEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKGEKPIGI  843

Query  838   LWNMNNMRLDPKTDNRYTIREEILSTGVMSSLSIKRTERTDSALFTCVATNAFGSDDASI  897
             LWNMNNMRLDPK DNRYTIREEILSTGVMSSLSIKRTER+DSALFTCVATNAFGSDDASI
Sbjct  844   LWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAFGSDDASI  903

Query  898   NMIIQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLKRYIIEFKTSRGSWEHDVDRVI  957
             NMI+QEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPL RYIIEFK SR SW  ++DRVI
Sbjct  904   NMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWS-EIDRVI  962

Query  958   VPGHTNEAQVQKLNPATTYNIRIVAENEIGVSDSSEVVPIITAEEAPSGKPQSIKVEPLS  1017
             VPGHT EAQVQKL+PATTYNIRIVAEN IG S SSE V IITAEEAPSGKPQ+IKVEP++
Sbjct  963   VPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNIKVEPVN  1022

Query  1018  QTSLRVLWKAPPRSDWNGEILGYYVGYKLTNNNGSYYFEDYKYMMEEGKEYSYELTNLKT  1077
             QT++RV WK PPR++WNGEILGYYVGYKL+N N SY FE   ++ EEGKE++ EL NL+ 
Sbjct  1023  QTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLELQNLRV  1082

Query  1078  YTQYSVVIQAYNKVGAGPLSEDEKQYTAEGTPDQPPSDITCTTLTSQTIRVSWVSPPLES  1137
             YTQYSVVIQA+NK+GAGPLSE+EKQ+TAEGTP QPPSD  CTTLTSQTIRV WVSPPLES
Sbjct  1083  YTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWVSPPLES  1142

Query  1138  ANGVIKGYKVVYAPSELWYDDKNKDYKKTASSDTVLHGLKKYTNYTMQVLATTSGGDGVR  1197
             ANGVIK YKVVYAPS+ WYD+  + YKKTASSDTVLHGLKKYTNYTMQVLATT+GGDGVR
Sbjct  1143  ANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTAGGDGVR  1202

Query  1198  SPPIHCQTEQDVPEAPTAVKALVVGSEAILVSWLPPAQPNGLITQYTVYSKEEGTESEVK  1257
             S PIHCQTE DVPEAPT VKALV+G+ AILVSW PPAQPNG+ITQYTVYSK EG E+E K
Sbjct  1203  SVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEGAETETK  1262

Query  1258  SHKVPPYQMSYEASSLDKNKPFEFWVTANTNIGEGQASKSIVAMPSDKVPAKIASFDDTF  1317
             + KVP YQMS+EA+ L+KNKP+EFWVTA+T IGEGQ SKSIVAMPSD+VPAKIASFDDTF
Sbjct  1263  TQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIASFDDTF  1322

Query  1318  TAIFKEDFKLPCLAVGAPAPDITWKVKGVEFVPNDRVRQLPEGSLSIKDVIRQDAGDYTC  1377
             TA FKED K+PCLAVGAP P+ITWK+KGVEF  NDR+R LP+GSL IK V RQDAGDY+C
Sbjct  1323  TATFKEDAKMPCLAVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNRQDAGDYSC  1382

Query  1378  MAENSIAKDSITHKLIVLAPPQSPQVLLTATTTDSLTLKLKQHDGDTAPIHGYTLHYKPE  1437
              AENSIAKDSITHKLIVLAPPQSP V L+ATTTD+LT+KLK H+GDTAP+HGYTLHYKPE
Sbjct  1383  HAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGYTLHYKPE  1442

Query  1438  FGDWETVEVAVDAQKYTIENLFCGSRYQVYATGYNNIGAGEASDILNTRTKGSKPMMPEN  1497
             FG+WET EV+VD+QK+ IE L CGSRYQVYATG+NNIGAGEASDILNTRTKG KP +PE 
Sbjct  1443  FGEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKGQKPKLPEK  1502

Query  1498  SKFIDPSSNTVTLHLPTWKDGGCRMSHFVVEYKKKDHAEWTQISNNVKPGGNFVVLDLDA  1557
              +FI+ SSN+V+LH   WKDGGC MSHFVVE KK+D  EW QISNNVKP  N+VVLDL+ 
Sbjct  1503  PRFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKRDQIEWNQISNNVKPDNNYVVLDLEP  1562

Query  1558  ASWYSVRITAHNSAGFTVAEYEFATLTVTGGTLAPPLNTAVLNGKTY----LPPWMPQWF  1613
             A+WY++RITAHNSAGFTVAEY+FATLTVTGGT+A PL+    +G  +    LP WMP+W 
Sbjct  1563  ATWYNLRITAHNSAGFTVAEYDFATLTVTGGTIA-PLDDGSGHGNVHTRIRLPAWMPEWL  1621

Query  1614  DLNFMVPLIATIIVVFVGVLVICVALSRRRMEDPRGGPKDVYYDVVYNQPMGPGATMDKR  1673
             DLNFMVPLIAT++VV VG+ V+CVALSRRR +D RGG KDVYYDVVYNQ MGPGAT+DKR
Sbjct  1622  DLNFMVPLIATVVVVAVGICVVCVALSRRRADDMRGGQKDVYYDVVYNQTMGPGATLDKR  1681

Query  1674  RPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRGTVISRSMRSNHSTWDPRR--PLYEE  1731
             RPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG      +RSNHSTWDPRR   LYEE
Sbjct  1682  RPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG---RGGLRSNHSTWDPRRNPNLYEE  1738

Query  1732  LKPPPVPRR-----HYHGSDECYHTHPHPHPAGMEDEICPYATFHLLGFREEMDPTKAMN  1786
             LK PPVP       H HG+ EC++ HP     GMEDEICPYATFHLLGFREEMDPTKAMN
Sbjct  1739  LKAPPVPMHGNHYGHAHGNAECHYRHP-----GMEDEICPYATFHLLGFREEMDPTKAMN  1793

Query  1787  FQTFPHQNGHTG--PGHA-TMGPGGPPGHIHSRSGSQSMPRQNRYARKNSQGGQSSIYTP  1843
             FQTFPHQNGH G  PGHA TM P G PGH+HSRSGSQSMPR NRY RKNSQGGQSSIYTP
Sbjct  1794  FQTFPHQNGHAGPVPGHAGTMLPPGHPGHVHSRSGSQSMPRANRYQRKNSQGGQSSIYTP  1853

Query  1844  APEYDDPANCAEEDQYRRYTRVNSQGGSLYGGPGPEYDDPANCAPEDDQYGSQYGAPYG-  1902
             APEYDDPANCAEEDQYRRYTRVNSQGGSLY GPGPEYDDPANCAPE+DQYGSQYG PYG 
Sbjct  1854  APEYDDPANCAEEDQYRRYTRVNSQGGSLYSGPGPEYDDPANCAPEEDQYGSQYGGPYGQ  1913

Query  1903  -YDHYGSRGSVGRRSVGSARNLPNGSPEPPPPPPRNHDTSNSSFNDSKESNEISEAECDR  1961
              YDHYGSRGS+GRRS+GSARN  NGSPEPPPPPPRNHD SNSSFNDSKESNEISEAECDR
Sbjct  1914  PYDHYGSRGSMGRRSIGSARNPGNGSPEPPPPPPRNHDMSNSSFNDSKESNEISEAECDR  1973

Query  1962  DH-PRGNYGENENSGDAKRSANTKDVRTTEEMRKLIDSRKSNEVAAKLQQQGGPAGLTAY  2020
             DH PRGNYG        KRS   KD RTTEEMRKLI+  ++     +LQQ  G AG TAY
Sbjct  1974  DHGPRGNYGA------VKRSPQPKDQRTTEEMRKLIERNETGPKQLQLQQANG-AGFTAY  2026

Query  2021  DTLAV  2025
             DT+AV
Sbjct  2027  DTMAV  2031


>Q0E9J4_DROME unnamed protein product
Length=2031

 Score = 3335 bits (8648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1632/2045 (80%), Positives = 1801/2045 (88%), Gaps = 41/2045 (2%)

Query  3     QRTKWITKIIFIAV-LVDLGS---TANT-EADTKGPMFLKEPINRIDFSNSTGSVVECRA  57
             +R KW+  ++F AV L+  GS    AN  +AD KGP+FLKEP NRIDFSNSTG+ +EC+A
Sbjct  6     ERLKWL--MLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAEIECKA  63

Query  58    SGNPAPEIIWVRSDGTAVGDVPGLRQVLSNGNLVFPPFRAEDYRQEVHAQVYACLAKNQF  117
             SGNP PEIIW+RSDGTAVGDVPGLRQ+ S+G LVFPPFRAEDYRQEVHAQVYACLA+NQF
Sbjct  64    SGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQF  123

Query  118   GSIISRDVNVRAVVNQFYEAEIMTEYVIRGNTAILKCSIPSFMGDYVRVESWIDETNTVL  177
             GSIISRDV+VRAVVNQ+YEAE+++EYVIRGNTA+LKC+IPSF+ D++RVE+W+    T  
Sbjct  124   GSIISRDVHVRAVVNQYYEAEVVSEYVIRGNTAVLKCTIPSFVADFLRVEAWVASDGTEY  183

Query  178   ATSDNYDGKYLVLPSGELHIKEVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVG  237
             A  +++DGKYLVLPSGELHI+EVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVG
Sbjct  184   APEEDFDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVG  243

Query  238   SVAPKVNVADKGHISSARTGHTTDILCPAQGYPMPAFRWYKFIEGTTRKQAVVLNDRVKQ  297
             SV PK++V ++   + A +  T  + CPAQ YP+P+FRWYKFIEGTTRKQAVVLNDRVKQ
Sbjct  244   SVGPKISVGERLRDAGAPSKSTLTLFCPAQSYPVPSFRWYKFIEGTTRKQAVVLNDRVKQ  303

Query  298   VSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPSQVVDFGRPAVF  357
             VSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPP+Q VDFGRPAVF
Sbjct  304   VSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFGRPAVF  363

Query  358   TCHFSGNPIKTVSWLKDGKKIGHTDAILRIESVKKEHKGMYQCFIRNDQESAEASAELKL  417
             TC ++GNPIKTVSW+KDGK IGH++ +LRIESVKKE KGMYQCF+RNDQESAEASAELKL
Sbjct  364   TCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEASAELKL  423

Query  418   GGRFDPPIIRQAFPEETLHPGPSVFLKCVAGGLPTPEISWELDGKKIANSERYQVGQYVT  477
             GGRFDPP+IRQAF EET+ PGPSVFLKCVAGG PTPEISWELDGKKIAN++RYQVGQYVT
Sbjct  424   GGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQVGQYVT  483

Query  478   VNGDVVSYLNITSIHANDGGLYKCIASSKVGVAEHSAKLNVYGLPYIRPMEKKAIVAGEN  537
             VNGDVVSYLNITS+HANDGGLYKCIA SKVGVAEHSAKLNVYGLPYIR MEKKAIVAGE 
Sbjct  484   VNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKAIVAGET  543

Query  538   LIVTCPVAGYPIESIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKNSE  597
             LIVTCPVAGYPI+SIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKN E
Sbjct  544   LIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKNQE  603

Query  598   GYSARGALEVQVMVPPKIAHFDFGDEPSNYGDTASVSCIVTSGDLPVDFKWLFNGKPISE  657
             GYSARG+LEVQVM PPKI  F FG+EP+N  D+ SV+C++++GDLP+D +W FN   IS 
Sbjct  604   GYSARGSLEVQVMAPPKITPFSFGEEPANVEDSVSVTCLISTGDLPIDIEWFFNEYGISS  663

Query  658   FAGISTAKMGKRNSVMNIDSVSGKHAGKYTCLASNTASIVNFTAVLIVNVPPRWILEPTD  717
             ++GIS  K GKRNSV++IDSV  +HAG Y+C A N A+ VN+T  LIVNVPPRWILEPTD
Sbjct  664   YSGISVMKGGKRNSVLSIDSVQARHAGNYSCRAKNHAAAVNYTTDLIVNVPPRWILEPTD  723

Query  718   KAFAQGSDAKVECKSDGFPKPQVTWKKAVGDTPGEYKDMKQSNNIRVDEGTLYIDNIQKN  777
             KAFAQGSDAKVECK+DGFPKPQVTWKKAVGDTPGEYKD+K+S+NIRV+EGTL++DNIQK 
Sbjct  724   KAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHVDNIQKT  783

Query  778   NEGYYLCEAINGIGSGLSAVILISVQAPPEFVEKLRNQTARRSEPAVLQCEAKGEKPIGI  837
             NEGYYLCEAINGIGSGLSAVI+ISVQAPPEF EKLRNQTARR EPAVLQCEAKGEKPIGI
Sbjct  784   NEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKGEKPIGI  843

Query  838   LWNMNNMRLDPKTDNRYTIREEILSTGVMSSLSIKRTERTDSALFTCVATNAFGSDDASI  897
             LWNMNNMRLDPK DNRYTIREEILSTGVMSSLSIKRTER+DSALFTCVATNAFGSDDASI
Sbjct  844   LWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAFGSDDASI  903

Query  898   NMIIQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLKRYIIEFKTSRGSWEHDVDRVI  957
             NMI+QEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPL RYIIEFK SR SW  ++DRVI
Sbjct  904   NMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWS-EIDRVI  962

Query  958   VPGHTNEAQVQKLNPATTYNIRIVAENEIGVSDSSEVVPIITAEEAPSGKPQSIKVEPLS  1017
             VPGHT EAQVQKL+PATTYNIRIVAEN IG S SSE V IITAEEAPSGKPQ+IKVEP++
Sbjct  963   VPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNIKVEPVN  1022

Query  1018  QTSLRVLWKAPPRSDWNGEILGYYVGYKLTNNNGSYYFEDYKYMMEEGKEYSYELTNLKT  1077
             QT++RV WK PPR++WNGEILGYYVGYKL+N N SY FE   ++ EEGKE++ EL NL+ 
Sbjct  1023  QTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLELQNLRV  1082

Query  1078  YTQYSVVIQAYNKVGAGPLSEDEKQYTAEGTPDQPPSDITCTTLTSQTIRVSWVSPPLES  1137
             YTQYSVVIQA+NK+GAGPLSE+EKQ+TAEGTP QPPSD  CTTLTSQTIRV WVSPPLES
Sbjct  1083  YTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWVSPPLES  1142

Query  1138  ANGVIKGYKVVYAPSELWYDDKNKDYKKTASSDTVLHGLKKYTNYTMQVLATTSGGDGVR  1197
             ANGVIK YKVVYAPS+ WYD+  + YKKTASSDTVLHGLKKYTNYTMQVLATT+GGDGVR
Sbjct  1143  ANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTAGGDGVR  1202

Query  1198  SPPIHCQTEQDVPEAPTAVKALVVGSEAILVSWLPPAQPNGLITQYTVYSKEEGTESEVK  1257
             S PIHCQTE DVPEAPT VKALV+G+ AILVSW PPAQPNG+ITQYTVYSK EG E+E K
Sbjct  1203  SVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEGAETETK  1262

Query  1258  SHKVPPYQMSYEASSLDKNKPFEFWVTANTNIGEGQASKSIVAMPSDKVPAKIASFDDTF  1317
             + KVP YQMS+EA+ L+KNKP+EFWVTA+T IGEGQ SKSIVAMPSD+VPAKIASFDDTF
Sbjct  1263  TQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIASFDDTF  1322

Query  1318  TAIFKEDFKLPCLAVGAPAPDITWKVKGVEFVPNDRVRQLPEGSLSIKDVIRQDAGDYTC  1377
             TA FKED K+PCLAVGAP P+ITWK+KGVEF  NDR+R LP+GSL IK V RQDAGDY+C
Sbjct  1323  TATFKEDAKMPCLAVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNRQDAGDYSC  1382

Query  1378  MAENSIAKDSITHKLIVLAPPQSPQVLLTATTTDSLTLKLKQHDGDTAPIHGYTLHYKPE  1437
              AENSIAKDSITHKLIVLAPPQSP V L+ATTTD+LT+KLK H+GDTAP+HGYTLHYKPE
Sbjct  1383  HAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGYTLHYKPE  1442

Query  1438  FGDWETVEVAVDAQKYTIENLFCGSRYQVYATGYNNIGAGEASDILNTRTKGSKPMMPEN  1497
             FG+WET EV+VD+QK+ IE L CGSRYQVYATG+NNIGAGEASDILNTRTKG KP +PE 
Sbjct  1443  FGEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKGQKPKLPEK  1502

Query  1498  SKFIDPSSNTVTLHLPTWKDGGCRMSHFVVEYKKKDHAEWTQISNNVKPGGNFVVLDLDA  1557
              +FI+ SSN+V+LH   WKDGGC MSHFVVE KK+D  EW QISNNVKP  N+VVLDL+ 
Sbjct  1503  PRFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKRDQIEWNQISNNVKPDNNYVVLDLEP  1562

Query  1558  ASWYSVRITAHNSAGFTVAEYEFATLTVTGGTLAPPLNTAVLNGKTY----LPPWMPQWF  1613
             A+WY++RITAHNSAGFTVAEY+FATLTVTGGT+A PL+    +G  +    LP WMP+W 
Sbjct  1563  ATWYNLRITAHNSAGFTVAEYDFATLTVTGGTIA-PLDDGSGHGNVHTRIRLPAWMPEWL  1621

Query  1614  DLNFMVPLIATIIVVFVGVLVICVALSRRRMEDPRGGPKDVYYDVVYNQPMGPGATMDKR  1673
             DLNFMVPLIAT++VV VG+ V+CVALSRRR +D RGG KDVYYDVVYNQ MGPGAT+DKR
Sbjct  1622  DLNFMVPLIATVVVVAVGICVVCVALSRRRADDMRGGQKDVYYDVVYNQTMGPGATLDKR  1681

Query  1674  RPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRGTVISRSMRSNHSTWDPRR--PLYEE  1731
             RPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG      +RSNHSTWDPRR   LYEE
Sbjct  1682  RPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG---RGGLRSNHSTWDPRRNPNLYEE  1738

Query  1732  LKPPPVPRR-----HYHGSDECYHTHPHPHPAGMEDEICPYATFHLLGFREEMDPTKAMN  1786
             LK PPVP       H HG+ EC++ HP     GMEDEICPYATFHLLGFREEMDPTKAMN
Sbjct  1739  LKAPPVPMHGNHYGHAHGNAECHYRHP-----GMEDEICPYATFHLLGFREEMDPTKAMN  1793

Query  1787  FQTFPHQNGHTG--PGHA-TMGPGGPPGHIHSRSGSQSMPRQNRYARKNSQGGQSSIYTP  1843
             FQTFPHQNGH G  PGHA TM P G PGH+HSRSGSQSMPR NRY RKNSQGGQSSIYTP
Sbjct  1794  FQTFPHQNGHAGPVPGHAGTMLPPGHPGHVHSRSGSQSMPRANRYQRKNSQGGQSSIYTP  1853

Query  1844  APEYDDPANCAEEDQYRRYTRVNSQGGSLYGGPGPEYDDPANCAPEDDQYGSQYGAPYG-  1902
             APEYDDPANCAEEDQYRRYTRVNSQGGSLY GPGPEYDDPANCAPE+DQYGSQYG PYG 
Sbjct  1854  APEYDDPANCAEEDQYRRYTRVNSQGGSLYSGPGPEYDDPANCAPEEDQYGSQYGGPYGQ  1913

Query  1903  -YDHYGSRGSVGRRSVGSARNLPNGSPEPPPPPPRNHDTSNSSFNDSKESNEISEAECDR  1961
              YDHYGSRGS+GRRS+GSARN  NGSPEPPPPPPRNHD SNSSFNDSKESNEISEAECDR
Sbjct  1914  PYDHYGSRGSMGRRSIGSARNPGNGSPEPPPPPPRNHDMSNSSFNDSKESNEISEAECDR  1973

Query  1962  DH-PRGNYGENENSGDAKRSANTKDVRTTEEMRKLIDSRKSNEVAAKLQQQGGPAGLTAY  2020
             DH PRGNYG        KRS   KD RTTEEMRKLI+  ++     +LQQ  G AG TAY
Sbjct  1974  DHGPRGNYGA------VKRSPQPKDQRTTEEMRKLIERNETGPKQLQLQQANG-AGFTAY  2026

Query  2021  DTLAV  2025
             DT+AV
Sbjct  2027  DTMAV  2031


>Q0E9J9_DROME unnamed protein product
Length=2032

 Score = 3331 bits (8636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1641/2046 (80%), Positives = 1795/2046 (88%), Gaps = 42/2046 (2%)

Query  3     QRTKWITKIIFIAV-LVDLGS---TANT-EADTKGPMFLKEPINRIDFSNSTGSVVECRA  57
             +R KW+  ++F AV L+  GS    AN  +AD KGP+FLKEP NRIDFSNSTG+ +EC+A
Sbjct  6     ERLKWL--MLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAEIECKA  63

Query  58    SGNPAPEIIWVRSDGTAVGDVPGLRQVLSNGNLVFPPFRAEDYRQEVHAQVYACLAKNQF  117
             SGNP PEIIW+RSDGTAVGDVPGLRQ+ S+G LVFPPFRAEDYRQEVHAQVYACLA+NQF
Sbjct  64    SGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQF  123

Query  118   GSIISRDVNVRAVVNQFYEAEIMTEYVIRGNTAILKCSIPSFMGDYVRVESWIDETNTVL  177
             GSIISRDV+VRAVVNQFY A+I+ EYVIRGN A+LKCSIPSF+ D+VRVESWIDE  T L
Sbjct  124   GSIISRDVHVRAVVNQFYGADILMEYVIRGNAAVLKCSIPSFVADFVRVESWIDEEGTEL  183

Query  178   ATSDNYDGKYLVLPSGELHIKEVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVG  237
               S+NYDGKYLVLPSGELHI+EVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVG
Sbjct  184   RPSENYDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVG  243

Query  238   SVAPKVNVADKGHISSARTGHTTDILCPAQGYPMPAFRWYKFIEGTTRKQAVVLNDRVKQ  297
             + AP  ++  K        G    +LC AQ +P+P  RWYKFIEGTTRKQAVVLNDRVKQ
Sbjct  244   AKAPTFSLEYKLIEVQKSKGTAFALLCQAQAFPVPIIRWYKFIEGTTRKQAVVLNDRVKQ  303

Query  298   VSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPSQVVDFGRPAVF  357
             VSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPP+Q VDFGRPAVF
Sbjct  304   VSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFGRPAVF  363

Query  358   TCHFSGNPIKTVSWLKDGKKIGHTDAILRIESVKKEHKGMYQCFIRNDQESAEASAELKL  417
             TC ++GNPIKTVSW+KDGK IGH++ +LRIESVKKE KGMYQCF+RNDQESAEASAELKL
Sbjct  364   TCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEASAELKL  423

Query  418   GGRFDPPIIRQAFPEETLHPGPSVFLKCVAGGLPTPEISWELDGKKIANSERYQVGQYVT  477
             GGRFDPP+IRQAF EET+ PGPSVFLKCVAGG PTPEISWELDGKKIAN++RYQVGQYVT
Sbjct  424   GGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQVGQYVT  483

Query  478   VNGDVVSYLNITSIHANDGGLYKCIASSKVGVAEHSAKLNVYGLPYIRPMEKKAIVAGEN  537
             VNGDVVSYLNITS+HANDGGLYKCIA SKVGVAEHSAKLNVYGLPYIR MEKKAIVAGE 
Sbjct  484   VNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKAIVAGET  543

Query  538   LIVTCPVAGYPIESIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKNSE  597
             LIVTCPVAGYPI+SIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKN E
Sbjct  544   LIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKNQE  603

Query  598   GYSARGALEVQVMVPPKIAHFDFGDEPSNYGDTASVSCIVTSGDLPVDFKWLFNGKPISE  657
             GYSARG+LEVQVMV PKIA FDFGDEPSN+G++ASV C+VTSGD PV F WLFNG+ I+E
Sbjct  604   GYSARGSLEVQVMVAPKIAPFDFGDEPSNFGESASVQCLVTSGDFPVSFAWLFNGREINE  663

Query  658   -FAGISTAKMGKRNSVMNIDSVSGKHAGKYTCLASNTASIVNFTAVLIVNVPPRWILEPT  716
                 +S  K+GK+ S ++ID V   HAG YTC+A N A+ VNFTA L+VNVPPRWILEPT
Sbjct  664   NVYDVSMVKLGKKISALSIDIVRDHHAGNYTCVAVNRATSVNFTAELVVNVPPRWILEPT  723

Query  717   DKAFAQGSDAKVECKSDGFPKPQVTWKKAVGDTPGEYKDMKQSNNIRVDEGTLYIDNIQK  776
             DKAFAQGSDAKVECK+DGFPKPQVTWKKAVGDTPGEYKD+K+S+NIRV+EGTL++DNIQK
Sbjct  724   DKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHVDNIQK  783

Query  777   NNEGYYLCEAINGIGSGLSAVILISVQAPPEFVEKLRNQTARRSEPAVLQCEAKGEKPIG  836
              NEGYYLCEAINGIGSGLSAVI+ISVQAPPEF EKLRNQTARR EPAVLQCEAKGEKPIG
Sbjct  784   TNEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKGEKPIG  843

Query  837   ILWNMNNMRLDPKTDNRYTIREEILSTGVMSSLSIKRTERTDSALFTCVATNAFGSDDAS  896
             ILWNMNNMRLDPK DNRYTIREEILSTGVMSSLSIKRTER+DSALFTCVATNAFGSDDAS
Sbjct  844   ILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAFGSDDAS  903

Query  897   INMIIQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLKRYIIEFKTSRGSWEHDVDRV  956
             INMI+QEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPL RYIIEFK SR SW  ++DRV
Sbjct  904   INMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWS-EIDRV  962

Query  957   IVPGHTNEAQVQKLNPATTYNIRIVAENEIGVSDSSEVVPIITAEEAPSGKPQSIKVEPL  1016
             IVPGHT EAQVQKL+PATTYNIRIVAEN IG S SSE V IITAEEAPSGKPQ+IKVEP+
Sbjct  963   IVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNIKVEPV  1022

Query  1017  SQTSLRVLWKAPPRSDWNGEILGYYVGYKLTNNNGSYYFEDYKYMMEEGKEYSYELTNLK  1076
             +QT++RV WK PPR++WNGEILGYYVGYKL+N N SY FE   ++ EEGKE++ EL NL+
Sbjct  1023  NQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLELQNLR  1082

Query  1077  TYTQYSVVIQAYNKVGAGPLSEDEKQYTAEGTPDQPPSDITCTTLTSQTIRVSWVSPPLE  1136
              YTQYSVVIQA+NK+GAGPLSE+EKQ+TAEGTP QPPSD  CTTLTSQTIRV WVSPPLE
Sbjct  1083  VYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWVSPPLE  1142

Query  1137  SANGVIKGYKVVYAPSELWYDDKNKDYKKTASSDTVLHGLKKYTNYTMQVLATTSGGDGV  1196
             SANGVIK YKVVYAPS+ WYD+  + YKKTASSDTVLHGLKKYTNYTMQVLATT+GGDGV
Sbjct  1143  SANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTAGGDGV  1202

Query  1197  RSPPIHCQTEQDVPEAPTAVKALVVGSEAILVSWLPPAQPNGLITQYTVYSKEEGTESEV  1256
             RS PIHCQTE DVPEAPT VKALV+G+ AILVSW PPAQPNG+ITQYTVYSK EG E+E 
Sbjct  1203  RSVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEGAETET  1262

Query  1257  KSHKVPPYQMSYEASSLDKNKPFEFWVTANTNIGEGQASKSIVAMPSDKVPAKIASFDDT  1316
             K+ KVP YQMS+EA+ L+KNKP+EFWVTA+T IGEGQ SKSIVAMPSD+VPAKIASFDDT
Sbjct  1263  KTQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIASFDDT  1322

Query  1317  FTAIFKEDFKLPCLAVGAPAPDITWKVKGVEFVPNDRVRQLPEGSLSIKDVIRQDAGDYT  1376
             FTA FKED K+PCLAVGAP P+ITWK+KGVEF  NDR+R LP+GSL IK V RQDAGDY+
Sbjct  1323  FTATFKEDAKMPCLAVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNRQDAGDYS  1382

Query  1377  CMAENSIAKDSITHKLIVLAPPQSPQVLLTATTTDSLTLKLKQHDGDTAPIHGYTLHYKP  1436
             C AENSIAKDSITHKLIVLAPPQSP V L+ATTTD+LT+KLK H+GDTAP+HGYTLHYKP
Sbjct  1383  CHAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGYTLHYKP  1442

Query  1437  EFGDWETVEVAVDAQKYTIENLFCGSRYQVYATGYNNIGAGEASDILNTRTKGSKPMMPE  1496
             EFG+WET EV+VD+QK+ IE L CGSRYQVYATG+NNIGAGEASDILNTRTKG KP +PE
Sbjct  1443  EFGEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKGQKPKLPE  1502

Query  1497  NSKFIDPSSNTVTLHLPTWKDGGCRMSHFVVEYKKKDHAEWTQISNNVKPGGNFVVLDLD  1556
               +FI+ SSN+V+LH   WKDGGC MSHFVVE KK+D  EW QISNNVKP  N+VVLDL+
Sbjct  1503  KPRFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKRDQIEWNQISNNVKPDNNYVVLDLE  1562

Query  1557  AASWYSVRITAHNSAGFTVAEYEFATLTVTGGTLAPPLNTAVLNGKTY----LPPWMPQW  1612
              A+WY++RITAHNSAGFTVAEY+FATLTVTGGT+A PL+    +G  +    LP WMP+W
Sbjct  1563  PATWYNLRITAHNSAGFTVAEYDFATLTVTGGTIA-PLDDGSGHGNVHTRIRLPAWMPEW  1621

Query  1613  FDLNFMVPLIATIIVVFVGVLVICVALSRRRMEDPRGGPKDVYYDVVYNQPMGPGATMDK  1672
              DLNFMVPLIAT++VV VG+ V+CVALSRRR +D RGG KDVYYDVVYNQ MGPGAT+DK
Sbjct  1622  LDLNFMVPLIATVVVVAVGICVVCVALSRRRADDMRGGQKDVYYDVVYNQTMGPGATLDK  1681

Query  1673  RRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRGTVISRSMRSNHSTWDPRR--PLYE  1730
             RRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG      +RSNHSTWDPRR   LYE
Sbjct  1682  RRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG---RGGLRSNHSTWDPRRNPNLYE  1738

Query  1731  ELKPPPVPRR-----HYHGSDECYHTHPHPHPAGMEDEICPYATFHLLGFREEMDPTKAM  1785
             ELK PPVP       H HG+ EC++ HP     GMEDEICPYATFHLLGFREEMDPTKAM
Sbjct  1739  ELKAPPVPMHGNHYGHAHGNAECHYRHP-----GMEDEICPYATFHLLGFREEMDPTKAM  1793

Query  1786  NFQTFPHQNGHTG--PGHA-TMGPGGPPGHIHSRSGSQSMPRQNRYARKNSQGGQSSIYT  1842
             NFQTFPHQNGH G  PGHA TM P G PGH+HSRSGSQSMPR NRY RKNSQGGQSSIYT
Sbjct  1794  NFQTFPHQNGHAGPVPGHAGTMLPPGHPGHVHSRSGSQSMPRANRYQRKNSQGGQSSIYT  1853

Query  1843  PAPEYDDPANCAEEDQYRRYTRVNSQGGSLYGGPGPEYDDPANCAPEDDQYGSQYGAPYG  1902
             PAPEYDDPANCAEEDQYRRYTRVNSQGGSLY GPGPEYDDPANCAPE+DQYGSQYG PYG
Sbjct  1854  PAPEYDDPANCAEEDQYRRYTRVNSQGGSLYSGPGPEYDDPANCAPEEDQYGSQYGGPYG  1913

Query  1903  --YDHYGSRGSVGRRSVGSARNLPNGSPEPPPPPPRNHDTSNSSFNDSKESNEISEAECD  1960
               YDHYGSRGS+GRRS+GSARN  NGSPEPPPPPPRNHD SNSSFNDSKESNEISEAECD
Sbjct  1914  QPYDHYGSRGSMGRRSIGSARNPGNGSPEPPPPPPRNHDMSNSSFNDSKESNEISEAECD  1973

Query  1961  RDH-PRGNYGENENSGDAKRSANTKDVRTTEEMRKLIDSRKSNEVAAKLQQQGGPAGLTA  2019
             RDH PRGNYG        KRS   KD RTTEEMRKLI+  ++     +LQQ  G AG TA
Sbjct  1974  RDHGPRGNYGA------VKRSPQPKDQRTTEEMRKLIERNETGPKQLQLQQANG-AGFTA  2026

Query  2020  YDTLAV  2025
             YDT+AV
Sbjct  2027  YDTMAV  2032



Lambda      K        H
   0.314    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 27131672232


Query= XP_037024210.1 Down syndrome cell adhesion molecule-like protein
Dscam2 isoform X15 [Bradysia coprophila]

Length=2025
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q0E9I2_DROME  unnamed protein product                                 3333    0.0  
Q0E9H5_DROME  unnamed protein product                                 3320    0.0  
Q0E9I4_DROME  unnamed protein product                                 3316    0.0  


>Q0E9I2_DROME unnamed protein product
Length=2031

 Score = 3333 bits (8643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1633/2045 (80%), Positives = 1799/2045 (88%), Gaps = 41/2045 (2%)

Query  3     QRTKWITKIIFIAV-LVDLGS---TANT-EADTKGPMFLKEPINRIDFSNSTGSVVECRA  57
             +R KW+  ++F AV L+  GS    AN  +AD KGP+FLKEP NRIDFSNSTG+ +EC+A
Sbjct  6     ERLKWL--MLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAEIECKA  63

Query  58    SGNPAPEIIWVRSDGTAVGDVPGLRQVLSNGNLVFPPFRAEDYRQEVHAQVYACLAKNQF  117
             SGNP PEIIW+RSDGTAVGDVPGLRQ+ S+G LVFPPFRAEDYRQEVHAQVYACLA+NQF
Sbjct  64    SGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQF  123

Query  118   GSIISRDVNVRAVVAQHYDTDVNKAYVIRGNAGILKCEIPSYIIDFVHVVSWHTDKEESF  177
             GSIISRDV+VRAVV+QHY+ D++KA+VIRGN+ ILKC+IPS++ DFV+V+SWH+D++E+F
Sbjct  124   GSIISRDVHVRAVVSQHYEEDIHKAFVIRGNSAILKCDIPSFVADFVNVISWHSDEKENF  183

Query  178   FPGTEYDGKYLVLPSGELHIKEVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVN  237
             +PGTEYDGKYLVLPSGELHI+EVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPV 
Sbjct  184   YPGTEYDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVG  243

Query  238   SVAPKLTSGDKSRTLDSRRTHSITLLCPAQSSPLPNFRWYKFIEGTTRKQAVVLNDRVKQ  297
             SVAPK+   D+   LD     +++LLCPAQS P+P +RWYKFIEGTTRKQAVVLNDRVKQ
Sbjct  244   SVAPKVDVKDRITWLDKPMGQALSLLCPAQSYPMPVYRWYKFIEGTTRKQAVVLNDRVKQ  303

Query  298   VSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPSQVVDFGRPAVF  357
             VSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPP+Q VDFGRPAVF
Sbjct  304   VSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFGRPAVF  363

Query  358   TCHFSGNPIKTVSWLKDGKKIGHTDAILRIESVKKEHKGMYQCFIRNDQESAEASAELKL  417
             TC ++GNPIKTVSW+KDGK IGH++ +LRIESVKKE KGMYQCF+RNDQESAEASAELKL
Sbjct  364   TCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEASAELKL  423

Query  418   GGRFDPPIIRQAFPEETLHPGPSVFLKCVAGGLPTPEISWELDGKKIANSERYQVGQYVT  477
             GGRFDPP+IRQAF EET+ PGPSVFLKCVAGG PTPEISWELDGKKIAN++RYQVGQYVT
Sbjct  424   GGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQVGQYVT  483

Query  478   VNGDVVSYLNITSIHANDGGLYKCIASSKVGVAEHSAKLNVYGLPYIRPMEKKAIVAGEN  537
             VNGDVVSYLNITS+HANDGGLYKCIA SKVGVAEHSAKLNVYGLPYIR MEKKAIVAGE 
Sbjct  484   VNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKAIVAGET  543

Query  538   LIVTCPVAGYPIESIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKNSE  597
             LIVTCPVAGYPI+SIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKN E
Sbjct  544   LIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKNQE  603

Query  598   GYSARGALEVQVMVLPRITPFAFDGGPAETGQYQTLTCTVQAGDFPLNFTWLLNGIELRD  657
             GYSARG+LEVQVMVLPRI PFAF+ GPA+ GQY TL C+V  GD PLN  W L+G  + +
Sbjct  604   GYSARGSLEVQVMVLPRIIPFAFEEGPAQVGQYLTLHCSVPGGDLPLNIDWTLDGQAISE  663

Query  658   SFDISISNVGKRSTFLTIESIQAIHAGTYTCLVSNKAGLSQYSTELKVNVPPRWILEPTD  717
                I+ S VG+R + LTIE+++A HAG +TC   N AG  Q++T L V VPPRWILEPTD
Sbjct  664   DLGITTSRVGRRGSVLTIEAVEASHAGNFTCHARNLAGHQQFTTPLNVYVPPRWILEPTD  723

Query  718   KAFAQGSDAKVECKSDGFPKPQVTWKKAVGDTPGEYKDMKQSNNIRVDEGTLYIDNIQKN  777
             KAFAQGSDAKVECK+DGFPKPQVTWKKAVGDTPGEYKD+K+S+NIRV+EGTL++DNIQK 
Sbjct  724   KAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHVDNIQKT  783

Query  778   NEGYYLCEAINGIGSGLSAVILISVQAPPEFVEKLRNQTARRSEPAVLQCEAKGEKPIGI  837
             NEGYYLCEAINGIGSGLSAVI+ISVQAPPEF EKLRNQTARR EPAVLQCEAKGEKPIGI
Sbjct  784   NEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKGEKPIGI  843

Query  838   LWNMNNMRLDPKTDNRYTIREEILSTGVMSSLSIKRTERTDSALFTCVATNAFGSDDASI  897
             LWNMNNMRLDPK DNRYTIREEILSTGVMSSLSIKRTER+DSALFTCVATNAFGSDDASI
Sbjct  844   LWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAFGSDDASI  903

Query  898   NMIIQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLKRYIIEFKTSRGSWEHDVDRVI  957
             NMI+QEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPL RYIIEFK SR SW  ++DRVI
Sbjct  904   NMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWS-EIDRVI  962

Query  958   VPGHTNEAQVQKLNPATTYNIRIVAENEIGVSDSSEVVPIITAEEAPSGKPQSIKVEPLS  1017
             VPGHT EAQVQKL+PATTYNIRIVAEN IG S SSE V IITAEEAPSGKPQ+IKVEP++
Sbjct  963   VPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNIKVEPVN  1022

Query  1018  QTSLRVLWKAPPRSDWNGEILGYYVGYKLTNNNGSYYFEDYKYMMEEGKEYSYELTNLKT  1077
             QT++RV WK PPR++WNGEILGYYVGYKL+N N SY FE   ++ EEGKE++ EL NL+ 
Sbjct  1023  QTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLELQNLRV  1082

Query  1078  YTQYSVVIQAYNKVGAGPLSEDEKQYTAEGTPDQPPSDITCTTLTSQTIRVSWVSPPLES  1137
             YTQYSVVIQA+NK+GAGPLSE+EKQ+TAEGTP QPPSD  CTTLTSQTIRV WVSPPLES
Sbjct  1083  YTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWVSPPLES  1142

Query  1138  ANGVIKGYKVVYAPSELWYDDKNKDYKKTASSDTVLHGLKKYTNYTMQVLATTSGGDGVR  1197
             ANGVIK YKVVYAPS+ WYD+  + YKKTASSDTVLHGLKKYTNYTMQVLATT+GGDGVR
Sbjct  1143  ANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTAGGDGVR  1202

Query  1198  SPPIHCQTEQDVPEAPTAVKALVVGSEAILVSWLPPAQPNGLITQYTVYSKEEGTESEVK  1257
             S PIHCQTE DVPEAPT VKALV+G+ AILVSW PPAQPNG+ITQYTVYSK EG E+E K
Sbjct  1203  SVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEGAETETK  1262

Query  1258  SHKVPPYQMSYEASSLDKNKPFEFWVTANTNIGEGQASKSIVAMPSDKVPAKIASFDDTF  1317
             + KVP YQMS+EA+ L+KNKP+EFWVTA+T IGEGQ SKSIVAMPSD+VPAKIASFDDTF
Sbjct  1263  TQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIASFDDTF  1322

Query  1318  TAIFKEDFKLPCLAVGAPAPDITWKVKGVEFVPNDRVRQLPEGSLSIKDVIRQDAGDYTC  1377
             TA FKED K+PCLAVGAP P+ITWK+KGVEF  NDR+R LP+GSL IK V RQDAGDY+C
Sbjct  1323  TATFKEDAKMPCLAVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNRQDAGDYSC  1382

Query  1378  MAENSIAKDSITHKLIVLAPPQSPQVLLTATTTDSLTLKLKQHDGDTAPIHGYTLHYKPE  1437
              AENSIAKDSITHKLIVLAPPQSP V L+ATTTD+LT+KLK H+GDTAP+HGYTLHYKPE
Sbjct  1383  HAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGYTLHYKPE  1442

Query  1438  FGDWETVEVAVDAQKYTIENLFCGSRYQVYATGYNNIGAGEASDILNTRTKGSKPMMPEN  1497
             FG+WET EV+VD+QK+ IE L CGSRYQVYATG+NNIGAGEASDILNTRTKG KP +PE 
Sbjct  1443  FGEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKGQKPKLPEK  1502

Query  1498  SKFIDPSSNTVTLHLPTWKDGGCRMSHFVVEYKKKDHAEWTQISNNVKPGGNFVVLDLDA  1557
              +FI+ SSN+V+LH   WKDGGC MSHFVVE KK+D  EW QISNNVKP  N+VVLDL+ 
Sbjct  1503  PRFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKRDQIEWNQISNNVKPDNNYVVLDLEP  1562

Query  1558  ASWYSVRITAHNSAGFTVAEYEFATLTVTGGTLAPPLNTAVLNGKTY----LPPWMPQWF  1613
             A+WY++RITAHNSAGFTVAEY+FATLTVTGGT+A PL+    +G  +    LP WMP+W 
Sbjct  1563  ATWYNLRITAHNSAGFTVAEYDFATLTVTGGTIA-PLDDGSGHGNVHTRIRLPAWMPEWL  1621

Query  1614  DLNFMVPLIATIIVVFVGVLVICVALSRRRMEDPRGGPKDVYYDVVYNQPMGPGATMDKR  1673
             DLNFMVPLIAT++VV VG+ V+CVALSRRR +D RGG KDVYYDVVYNQ MGPGAT+DKR
Sbjct  1622  DLNFMVPLIATVVVVAVGICVVCVALSRRRADDMRGGQKDVYYDVVYNQTMGPGATLDKR  1681

Query  1674  RPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRGTVISRSMRSNHSTWDPRR--PLYEE  1731
             RPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG      +RSNHSTWDPRR   LYEE
Sbjct  1682  RPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG---RGGLRSNHSTWDPRRNPNLYEE  1738

Query  1732  LKPPPVPRR-----HYHGSDECYHTHPHPHPAGMEDEICPYATFHLLGFREEMDPTKAMN  1786
             LK PPVP       H HG+ EC++ HP     GMEDEICPYATFHLLGFREEMDPTKAMN
Sbjct  1739  LKAPPVPMHGNHYGHAHGNAECHYRHP-----GMEDEICPYATFHLLGFREEMDPTKAMN  1793

Query  1787  FQTFPHQNGHTG--PGHA-TMGPGGPPGHIHSRSGSQSMPRQNRYARKNSQGGQSSIYTP  1843
             FQTFPHQNGH G  PGHA TM P G PGH+HSRSGSQSMPR NRY RKNSQGGQSSIYTP
Sbjct  1794  FQTFPHQNGHAGPVPGHAGTMLPPGHPGHVHSRSGSQSMPRANRYQRKNSQGGQSSIYTP  1853

Query  1844  APEYDDPANCAEEDQYRRYTRVNSQGGSLYGGPGPEYDDPANCAPEDDQYGSQYGAPYG-  1902
             APEYDDPANCAEEDQYRRYTRVNSQGGSLY GPGPEYDDPANCAPE+DQYGSQYG PYG 
Sbjct  1854  APEYDDPANCAEEDQYRRYTRVNSQGGSLYSGPGPEYDDPANCAPEEDQYGSQYGGPYGQ  1913

Query  1903  -YDHYGSRGSVGRRSVGSARNLPNGSPEPPPPPPRNHDTSNSSFNDSKESNEISEAECDR  1961
              YDHYGSRGS+GRRS+GSARN  NGSPEPPPPPPRNHD SNSSFNDSKESNEISEAECDR
Sbjct  1914  PYDHYGSRGSMGRRSIGSARNPGNGSPEPPPPPPRNHDMSNSSFNDSKESNEISEAECDR  1973

Query  1962  DH-PRGNYGENENSGDAKRSANTKDVRTTEEMRKLIDSRKSNEVAAKLQQQGGPAGLTAY  2020
             DH PRGNYG        KRS   KD RTTEEMRKLI+  ++     +LQQ  G AG TAY
Sbjct  1974  DHGPRGNYGA------VKRSPQPKDQRTTEEMRKLIERNETGPKQLQLQQANG-AGFTAY  2026

Query  2021  DTLAV  2025
             DT+AV
Sbjct  2027  DTMAV  2031


>Q0E9H5_DROME unnamed protein product
Length=2031

 Score = 3320 bits (8608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1628/2045 (80%), Positives = 1788/2045 (87%), Gaps = 41/2045 (2%)

Query  3     QRTKWITKIIFIAV-LVDLGS---TANT-EADTKGPMFLKEPINRIDFSNSTGSVVECRA  57
             +R KW+  ++F AV L+  GS    AN  +AD KGP+FLKEP NRIDFSNSTG+ +EC+A
Sbjct  6     ERLKWL--MLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAEIECKA  63

Query  58    SGNPAPEIIWVRSDGTAVGDVPGLRQVLSNGNLVFPPFRAEDYRQEVHAQVYACLAKNQF  117
             SGNP PEIIW+RSDGTAVGDVPGLRQ+ S+G LVFPPFRAEDYRQEVHAQVYACLA+NQF
Sbjct  64    SGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQF  123

Query  118   GSIISRDVNVRAVVAQHYDTDVNKAYVIRGNAGILKCEIPSYIIDFVHVVSWHTDKEESF  177
             GSIISRDV+VRAVVAQ+Y+ DVNK +VIRGN+ ++KC IPS++ DFV VVSWHTD+EE++
Sbjct  124   GSIISRDVHVRAVVAQYYEADVNKEHVIRGNSAVIKCLIPSFVADFVEVVSWHTDEEENY  183

Query  178   FPGTEYDGKYLVLPSGELHIKEVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVN  237
             FPG EYDGKYLVLPSGELHI+EVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEP+ 
Sbjct  184   FPGAEYDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPIA  243

Query  238   SVAPKLTSGDKSRTLDSRRTHSITLLCPAQSSPLPNFRWYKFIEGTTRKQAVVLNDRVKQ  297
             SV P+L SG+  + L    + + TLLCPAQS P+P FRWYKFIEGTTRKQAVVLNDRVKQ
Sbjct  244   SVGPRLLSGNDIKVLQFSASQASTLLCPAQSYPVPVFRWYKFIEGTTRKQAVVLNDRVKQ  303

Query  298   VSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPSQVVDFGRPAVF  357
             VSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPP+Q VDFGRPAVF
Sbjct  304   VSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFGRPAVF  363

Query  358   TCHFSGNPIKTVSWLKDGKKIGHTDAILRIESVKKEHKGMYQCFIRNDQESAEASAELKL  417
             TC ++GNPIKTVSW+KDGK IGH++ +LRIESVKKE KGMYQCF+RNDQESAEASAELKL
Sbjct  364   TCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEASAELKL  423

Query  418   GGRFDPPIIRQAFPEETLHPGPSVFLKCVAGGLPTPEISWELDGKKIANSERYQVGQYVT  477
             GGRFDPP+IRQAF EET+ PGPSVFLKCVAGG PTPEISWELDGKKIAN++RYQVGQYVT
Sbjct  424   GGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQVGQYVT  483

Query  478   VNGDVVSYLNITSIHANDGGLYKCIASSKVGVAEHSAKLNVYGLPYIRPMEKKAIVAGEN  537
             VNGDVVSYLNITS+HANDGGLYKCIA SKVGVAEHSAKLNVYGLPYIR MEKKAIVAGE 
Sbjct  484   VNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKAIVAGET  543

Query  538   LIVTCPVAGYPIESIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKNSE  597
             LIVTCPVAGYPI+SIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKN E
Sbjct  544   LIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKNQE  603

Query  598   GYSARGALEVQVMVLPRITPFAFDGGPAETGQYQTLTCTVQAGDFPLNFTWLLNGIELRD  657
             GYSARG+LEVQVMV P+I  F F   P   G+  ++ CT+  GD P+N TWLLN   +  
Sbjct  604   GYSARGSLEVQVMVAPKIASFDFGEEPLNYGEPASVQCTILGGDLPMNVTWLLNNATIDS  663

Query  658   SFDISISNVGKRSTFLTIESIQAIHAGTYTCLVSNKAGLSQYSTELKVNVPPRWILEPTD  717
               DIS S +GKR   L+IES+ A HAG Y+C   NKAG++ +S  L VNVPPRWILEPTD
Sbjct  664   FHDISFSRIGKRINVLSIESVSAHHAGFYSCHAQNKAGITAHSARLIVNVPPRWILEPTD  723

Query  718   KAFAQGSDAKVECKSDGFPKPQVTWKKAVGDTPGEYKDMKQSNNIRVDEGTLYIDNIQKN  777
             KAFAQGSDAKVECK+DGFPKPQVTWKKAVGDTPGEYKD+K+S+NIRV+EGTL++DNIQK 
Sbjct  724   KAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHVDNIQKT  783

Query  778   NEGYYLCEAINGIGSGLSAVILISVQAPPEFVEKLRNQTARRSEPAVLQCEAKGEKPIGI  837
             NEGYYLCEAINGIGSGLSAVI+ISVQAPPEF EKLRNQTARR EPAVLQCEAKGEKPIGI
Sbjct  784   NEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKGEKPIGI  843

Query  838   LWNMNNMRLDPKTDNRYTIREEILSTGVMSSLSIKRTERTDSALFTCVATNAFGSDDASI  897
             LWNMNNMRLDPK DNRYTIREEILSTGVMSSLSIKRTER+DSALFTCVATNAFGSDDASI
Sbjct  844   LWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAFGSDDASI  903

Query  898   NMIIQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLKRYIIEFKTSRGSWEHDVDRVI  957
             NMI+QEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPL RYIIEFK SR SW  ++DRVI
Sbjct  904   NMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWS-EIDRVI  962

Query  958   VPGHTNEAQVQKLNPATTYNIRIVAENEIGVSDSSEVVPIITAEEAPSGKPQSIKVEPLS  1017
             VPGHT EAQVQKL+PATTYNIRIVAEN IG S SSE V IITAEEAPSGKPQ+IKVEP++
Sbjct  963   VPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNIKVEPVN  1022

Query  1018  QTSLRVLWKAPPRSDWNGEILGYYVGYKLTNNNGSYYFEDYKYMMEEGKEYSYELTNLKT  1077
             QT++RV WK PPR++WNGEILGYYVGYKL+N N SY FE   ++ EEGKE++ EL NL+ 
Sbjct  1023  QTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLELQNLRV  1082

Query  1078  YTQYSVVIQAYNKVGAGPLSEDEKQYTAEGTPDQPPSDITCTTLTSQTIRVSWVSPPLES  1137
             YTQYSVVIQA+NK+GAGPLSE+EKQ+TAEGTP QPPSD  CTTLTSQTIRV WVSPPLES
Sbjct  1083  YTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWVSPPLES  1142

Query  1138  ANGVIKGYKVVYAPSELWYDDKNKDYKKTASSDTVLHGLKKYTNYTMQVLATTSGGDGVR  1197
             ANGVIK YKVVYAPS+ WYD+  + YKKTASSDTVLHGLKKYTNYTMQVLATT+GGDGVR
Sbjct  1143  ANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTAGGDGVR  1202

Query  1198  SPPIHCQTEQDVPEAPTAVKALVVGSEAILVSWLPPAQPNGLITQYTVYSKEEGTESEVK  1257
             S PIHCQTE DVPEAPT VKALV+G+ AILVSW PPAQPNG+ITQYTVYSK EG E+E K
Sbjct  1203  SVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEGAETETK  1262

Query  1258  SHKVPPYQMSYEASSLDKNKPFEFWVTANTNIGEGQASKSIVAMPSDKVPAKIASFDDTF  1317
             + KVP YQMS+EA+ L+KNKP+EFWVTA+T IGEGQ SKSIVAMPSD+VPAKIASFDDTF
Sbjct  1263  TQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIASFDDTF  1322

Query  1318  TAIFKEDFKLPCLAVGAPAPDITWKVKGVEFVPNDRVRQLPEGSLSIKDVIRQDAGDYTC  1377
             TA FKED K+PCLAVGAP P+ITWK+KGVEF  NDR+R LP+GSL IK V RQDAGDY+C
Sbjct  1323  TATFKEDAKMPCLAVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNRQDAGDYSC  1382

Query  1378  MAENSIAKDSITHKLIVLAPPQSPQVLLTATTTDSLTLKLKQHDGDTAPIHGYTLHYKPE  1437
              AENSIAKDSITHKLIVLAPPQSP V L+ATTTD+LT+KLK H+GDTAP+HGYTLHYKPE
Sbjct  1383  HAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGYTLHYKPE  1442

Query  1438  FGDWETVEVAVDAQKYTIENLFCGSRYQVYATGYNNIGAGEASDILNTRTKGSKPMMPEN  1497
             FG+WET EV+VD+QK+ IE L CGSRYQVYATG+NNIGAGEASDILNTRTKG KP +PE 
Sbjct  1443  FGEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKGQKPKLPEK  1502

Query  1498  SKFIDPSSNTVTLHLPTWKDGGCRMSHFVVEYKKKDHAEWTQISNNVKPGGNFVVLDLDA  1557
              +FI+ SSN+V+LH   WKDGGC MSHFVVE KK+D  EW QISNNVKP  N+VVLDL+ 
Sbjct  1503  PRFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKRDQIEWNQISNNVKPDNNYVVLDLEP  1562

Query  1558  ASWYSVRITAHNSAGFTVAEYEFATLTVTGGTLAPPLNTAVLNGKTY----LPPWMPQWF  1613
             A+WY++RITAHNSAGFTVAEY+FATLTVTGGT+A PL+    +G  +    LP WMP+W 
Sbjct  1563  ATWYNLRITAHNSAGFTVAEYDFATLTVTGGTIA-PLDDGSGHGNVHTRIRLPAWMPEWL  1621

Query  1614  DLNFMVPLIATIIVVFVGVLVICVALSRRRMEDPRGGPKDVYYDVVYNQPMGPGATMDKR  1673
             DLNFMVPLIAT++VV VG+ V+CVALSRRR +D RGG KDVYYDVVYNQ MGPGAT+DKR
Sbjct  1622  DLNFMVPLIATVVVVAVGICVVCVALSRRRADDMRGGQKDVYYDVVYNQTMGPGATLDKR  1681

Query  1674  RPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRGTVISRSMRSNHSTWDPRR--PLYEE  1731
             RPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG      +RSNHSTWDPRR   LYEE
Sbjct  1682  RPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG---RGGLRSNHSTWDPRRNPNLYEE  1738

Query  1732  LKPPPVPRR-----HYHGSDECYHTHPHPHPAGMEDEICPYATFHLLGFREEMDPTKAMN  1786
             LK PPVP       H HG+ EC++ HP     GMEDEICPYATFHLLGFREEMDPTKAMN
Sbjct  1739  LKAPPVPMHGNHYGHAHGNAECHYRHP-----GMEDEICPYATFHLLGFREEMDPTKAMN  1793

Query  1787  FQTFPHQNGHTG--PGHA-TMGPGGPPGHIHSRSGSQSMPRQNRYARKNSQGGQSSIYTP  1843
             FQTFPHQNGH G  PGHA TM P G PGH+HSRSGSQSMPR NRY RKNSQGGQSSIYTP
Sbjct  1794  FQTFPHQNGHAGPVPGHAGTMLPPGHPGHVHSRSGSQSMPRANRYQRKNSQGGQSSIYTP  1853

Query  1844  APEYDDPANCAEEDQYRRYTRVNSQGGSLYGGPGPEYDDPANCAPEDDQYGSQYGAPYG-  1902
             APEYDDPANCAEEDQYRRYTRVNSQGGSLY GPGPEYDDPANCAPE+DQYGSQYG PYG 
Sbjct  1854  APEYDDPANCAEEDQYRRYTRVNSQGGSLYSGPGPEYDDPANCAPEEDQYGSQYGGPYGQ  1913

Query  1903  -YDHYGSRGSVGRRSVGSARNLPNGSPEPPPPPPRNHDTSNSSFNDSKESNEISEAECDR  1961
              YDHYGSRGS+GRRS+GSARN  NGSPEPPPPPPRNHD SNSSFNDSKESNEISEAECDR
Sbjct  1914  PYDHYGSRGSMGRRSIGSARNPGNGSPEPPPPPPRNHDMSNSSFNDSKESNEISEAECDR  1973

Query  1962  DH-PRGNYGENENSGDAKRSANTKDVRTTEEMRKLIDSRKSNEVAAKLQQQGGPAGLTAY  2020
             DH PRGNYG        KRS   KD RTTEEMRKLI+  ++     +LQQ  G AG TAY
Sbjct  1974  DHGPRGNYGA------VKRSPQPKDQRTTEEMRKLIERNETGPKQLQLQQANG-AGFTAY  2026

Query  2021  DTLAV  2025
             DT+AV
Sbjct  2027  DTMAV  2031


>Q0E9I4_DROME unnamed protein product
Length=2031

 Score = 3316 bits (8598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1626/2045 (80%), Positives = 1792/2045 (88%), Gaps = 41/2045 (2%)

Query  3     QRTKWITKIIFIAV-LVDLGS---TANT-EADTKGPMFLKEPINRIDFSNSTGSVVECRA  57
             +R KW+  ++F AV L+  GS    AN  +AD KGP+FLKEP NRIDFSNSTG+ +EC+A
Sbjct  6     ERLKWL--MLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAEIECKA  63

Query  58    SGNPAPEIIWVRSDGTAVGDVPGLRQVLSNGNLVFPPFRAEDYRQEVHAQVYACLAKNQF  117
             SGNP PEIIW+RSDGTAVGDVPGLRQ+ S+G LVFPPFRAEDYRQEVHAQVYACLA+NQF
Sbjct  64    SGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQF  123

Query  118   GSIISRDVNVRAVVAQHYDTDVNKAYVIRGNAGILKCEIPSYIIDFVHVVSWHTDKEESF  177
             GSIISRDV+VRAVV+QHY+ D++KA+VIRGN+ ILKC+IPS++ DFV+V+SWH+D++E+F
Sbjct  124   GSIISRDVHVRAVVSQHYEEDIHKAFVIRGNSAILKCDIPSFVADFVNVISWHSDEKENF  183

Query  178   FPGTEYDGKYLVLPSGELHIKEVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVN  237
             +PGTEYDGKYLVLPSGELHI+EVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEP+ 
Sbjct  184   YPGTEYDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPIG  243

Query  238   SVAPKLTSGDKSRTLDSRRTHSITLLCPAQSSPLPNFRWYKFIEGTTRKQAVVLNDRVKQ  297
             S AP + +G            +  +LC AQ+ P+P FRWYKFIEGTTRKQAVVLNDRVKQ
Sbjct  244   SKAPSVPTGVMVFQQQVPLLSTFAMLCQAQAFPVPVFRWYKFIEGTTRKQAVVLNDRVKQ  303

Query  298   VSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPSQVVDFGRPAVF  357
             VSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPP+Q VDFGRPAVF
Sbjct  304   VSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFGRPAVF  363

Query  358   TCHFSGNPIKTVSWLKDGKKIGHTDAILRIESVKKEHKGMYQCFIRNDQESAEASAELKL  417
             TC ++GNPIKTVSW+KDGK IGH++ +LRIESVKKE KGMYQCF+RNDQESAEASAELKL
Sbjct  364   TCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEASAELKL  423

Query  418   GGRFDPPIIRQAFPEETLHPGPSVFLKCVAGGLPTPEISWELDGKKIANSERYQVGQYVT  477
             GGRFDPP+IRQAF EET+ PGPSVFLKCVAGG PTPEISWELDGKKIAN++RYQVGQYVT
Sbjct  424   GGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQVGQYVT  483

Query  478   VNGDVVSYLNITSIHANDGGLYKCIASSKVGVAEHSAKLNVYGLPYIRPMEKKAIVAGEN  537
             VNGDVVSYLNITS+HANDGGLYKCIA SKVGVAEHSAKLNVYGLPYIR MEKKAIVAGE 
Sbjct  484   VNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKAIVAGET  543

Query  538   LIVTCPVAGYPIESIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKNSE  597
             LIVTCPVAGYPI+SIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKN E
Sbjct  544   LIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKNQE  603

Query  598   GYSARGALEVQVMVLPRITPFAFDGGPAETGQYQTLTCTVQAGDFPLNFTWLLNGIELRD  657
             GYSARG+LEVQVMVLPRI PFAF+ GPA+ GQY TL C+V  GD PLN  W L+G  + +
Sbjct  604   GYSARGSLEVQVMVLPRIIPFAFEEGPAQVGQYLTLHCSVPGGDLPLNIDWTLDGQAISE  663

Query  658   SFDISISNVGKRSTFLTIESIQAIHAGTYTCLVSNKAGLSQYSTELKVNVPPRWILEPTD  717
                I+ S VG+R + LTIE+++A HAG +TC   N AG  Q++T L V VPPRWILEPTD
Sbjct  664   DLGITTSRVGRRGSVLTIEAVEASHAGNFTCHARNLAGHQQFTTPLNVYVPPRWILEPTD  723

Query  718   KAFAQGSDAKVECKSDGFPKPQVTWKKAVGDTPGEYKDMKQSNNIRVDEGTLYIDNIQKN  777
             KAFAQGSDAKVECK+DGFPKPQVTWKKAVGDTPGEYKD+K+S+NIRV+EGTL++DNIQK 
Sbjct  724   KAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHVDNIQKT  783

Query  778   NEGYYLCEAINGIGSGLSAVILISVQAPPEFVEKLRNQTARRSEPAVLQCEAKGEKPIGI  837
             NEGYYLCEAINGIGSGLSAVI+ISVQAPPEF EKLRNQTARR EPAVLQCEAKGEKPIGI
Sbjct  784   NEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKGEKPIGI  843

Query  838   LWNMNNMRLDPKTDNRYTIREEILSTGVMSSLSIKRTERTDSALFTCVATNAFGSDDASI  897
             LWNMNNMRLDPK DNRYTIREEILSTGVMSSLSIKRTER+DSALFTCVATNAFGSDDASI
Sbjct  844   LWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAFGSDDASI  903

Query  898   NMIIQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLKRYIIEFKTSRGSWEHDVDRVI  957
             NMI+QEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPL RYIIEFK SR SW  ++DRVI
Sbjct  904   NMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWS-EIDRVI  962

Query  958   VPGHTNEAQVQKLNPATTYNIRIVAENEIGVSDSSEVVPIITAEEAPSGKPQSIKVEPLS  1017
             VPGHT EAQVQKL+PATTYNIRIVAEN IG S SSE V IITAEEAPSGKPQ+IKVEP++
Sbjct  963   VPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNIKVEPVN  1022

Query  1018  QTSLRVLWKAPPRSDWNGEILGYYVGYKLTNNNGSYYFEDYKYMMEEGKEYSYELTNLKT  1077
             QT++RV WK PPR++WNGEILGYYVGYKL+N N SY FE   ++ EEGKE++ EL NL+ 
Sbjct  1023  QTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLELQNLRV  1082

Query  1078  YTQYSVVIQAYNKVGAGPLSEDEKQYTAEGTPDQPPSDITCTTLTSQTIRVSWVSPPLES  1137
             YTQYSVVIQA+NK+GAGPLSE+EKQ+TAEGTP QPPSD  CTTLTSQTIRV WVSPPLES
Sbjct  1083  YTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWVSPPLES  1142

Query  1138  ANGVIKGYKVVYAPSELWYDDKNKDYKKTASSDTVLHGLKKYTNYTMQVLATTSGGDGVR  1197
             ANGVIK YKVVYAPS+ WYD+  + YKKTASSDTVLHGLKKYTNYTMQVLATT+GGDGVR
Sbjct  1143  ANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTAGGDGVR  1202

Query  1198  SPPIHCQTEQDVPEAPTAVKALVVGSEAILVSWLPPAQPNGLITQYTVYSKEEGTESEVK  1257
             S PIHCQTE DVPEAPT VKALV+G+ AILVSW PPAQPNG+ITQYTVYSK EG E+E K
Sbjct  1203  SVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEGAETETK  1262

Query  1258  SHKVPPYQMSYEASSLDKNKPFEFWVTANTNIGEGQASKSIVAMPSDKVPAKIASFDDTF  1317
             + KVP YQMS+EA+ L+KNKP+EFWVTA+T IGEGQ SKSIVAMPSD+VPAKIASFDDTF
Sbjct  1263  TQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIASFDDTF  1322

Query  1318  TAIFKEDFKLPCLAVGAPAPDITWKVKGVEFVPNDRVRQLPEGSLSIKDVIRQDAGDYTC  1377
             TA FKED K+PCLAVGAP P+ITWK+KGVEF  NDR+R LP+GSL IK V RQDAGDY+C
Sbjct  1323  TATFKEDAKMPCLAVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNRQDAGDYSC  1382

Query  1378  MAENSIAKDSITHKLIVLAPPQSPQVLLTATTTDSLTLKLKQHDGDTAPIHGYTLHYKPE  1437
              AENSIAKDSITHKLIVLAPPQSP V L+ATTTD+LT+KLK H+GDTAP+HGYTLHYKPE
Sbjct  1383  HAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGYTLHYKPE  1442

Query  1438  FGDWETVEVAVDAQKYTIENLFCGSRYQVYATGYNNIGAGEASDILNTRTKGSKPMMPEN  1497
             FG+WET EV+VD+QK+ IE L CGSRYQVYATG+NNIGAGEASDILNTRTKG KP +PE 
Sbjct  1443  FGEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKGQKPKLPEK  1502

Query  1498  SKFIDPSSNTVTLHLPTWKDGGCRMSHFVVEYKKKDHAEWTQISNNVKPGGNFVVLDLDA  1557
              +FI+ SSN+V+LH   WKDGGC MSHFVVE KK+D  EW QISNNVKP  N+VVLDL+ 
Sbjct  1503  PRFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKRDQIEWNQISNNVKPDNNYVVLDLEP  1562

Query  1558  ASWYSVRITAHNSAGFTVAEYEFATLTVTGGTLAPPLNTAVLNGKTY----LPPWMPQWF  1613
             A+WY++RITAHNSAGFTVAEY+FATLTVTGGT+A PL+    +G  +    LP WMP+W 
Sbjct  1563  ATWYNLRITAHNSAGFTVAEYDFATLTVTGGTIA-PLDDGSGHGNVHTRIRLPAWMPEWL  1621

Query  1614  DLNFMVPLIATIIVVFVGVLVICVALSRRRMEDPRGGPKDVYYDVVYNQPMGPGATMDKR  1673
             DLNFMVPLIAT++VV VG+ V+CVALSRRR +D RGG KDVYYDVVYNQ MGPGAT+DKR
Sbjct  1622  DLNFMVPLIATVVVVAVGICVVCVALSRRRADDMRGGQKDVYYDVVYNQTMGPGATLDKR  1681

Query  1674  RPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRGTVISRSMRSNHSTWDPRR--PLYEE  1731
             RPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG      +RSNHSTWDPRR   LYEE
Sbjct  1682  RPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG---RGGLRSNHSTWDPRRNPNLYEE  1738

Query  1732  LKPPPVPRR-----HYHGSDECYHTHPHPHPAGMEDEICPYATFHLLGFREEMDPTKAMN  1786
             LK PPVP       H HG+ EC++ HP     GMEDEICPYATFHLLGFREEMDPTKAMN
Sbjct  1739  LKAPPVPMHGNHYGHAHGNAECHYRHP-----GMEDEICPYATFHLLGFREEMDPTKAMN  1793

Query  1787  FQTFPHQNGHTG--PGHA-TMGPGGPPGHIHSRSGSQSMPRQNRYARKNSQGGQSSIYTP  1843
             FQTFPHQNGH G  PGHA TM P G PGH+HSRSGSQSMPR NRY RKNSQGGQSSIYTP
Sbjct  1794  FQTFPHQNGHAGPVPGHAGTMLPPGHPGHVHSRSGSQSMPRANRYQRKNSQGGQSSIYTP  1853

Query  1844  APEYDDPANCAEEDQYRRYTRVNSQGGSLYGGPGPEYDDPANCAPEDDQYGSQYGAPYG-  1902
             APEYDDPANCAEEDQYRRYTRVNSQGGSLY GPGPEYDDPANCAPE+DQYGSQYG PYG 
Sbjct  1854  APEYDDPANCAEEDQYRRYTRVNSQGGSLYSGPGPEYDDPANCAPEEDQYGSQYGGPYGQ  1913

Query  1903  -YDHYGSRGSVGRRSVGSARNLPNGSPEPPPPPPRNHDTSNSSFNDSKESNEISEAECDR  1961
              YDHYGSRGS+GRRS+GSARN  NGSPEPPPPPPRNHD SNSSFNDSKESNEISEAECDR
Sbjct  1914  PYDHYGSRGSMGRRSIGSARNPGNGSPEPPPPPPRNHDMSNSSFNDSKESNEISEAECDR  1973

Query  1962  DH-PRGNYGENENSGDAKRSANTKDVRTTEEMRKLIDSRKSNEVAAKLQQQGGPAGLTAY  2020
             DH PRGNYG        KRS   KD RTTEEMRKLI+  ++     +LQQ  G AG TAY
Sbjct  1974  DHGPRGNYGA------VKRSPQPKDQRTTEEMRKLIERNETGPKQLQLQQANG-AGFTAY  2026

Query  2021  DTLAV  2025
             DT+AV
Sbjct  2027  DTMAV  2031



Lambda      K        H
   0.314    0.133    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 27131672232


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jul 7, 2021  1:54 PM
  Number of letters in database: 17,197,330
  Number of sequences in database:  25,232



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= XP_037024211.1 uncharacterized protein LOC119066072 isoform X1
[Bradysia coprophila]

Length=555


***** No hits found *****



Lambda      K        H
   0.314    0.126    0.359 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6469106478


Query= XP_037024212.1 Down syndrome cell adhesion molecule-like protein
Dscam2 isoform X16 [Bradysia coprophila]

Length=2025
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q0E9J5_DROME  unnamed protein product                                 3342    0.0  
Q0E9J4_DROME  unnamed protein product                                 3341    0.0  
Q0E9J9_DROME  unnamed protein product                                 3339    0.0  


>Q0E9J5_DROME unnamed protein product
Length=2031

 Score = 3342 bits (8666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1640/2045 (80%), Positives = 1798/2045 (88%), Gaps = 41/2045 (2%)

Query  3     QRTKWITKIIFIAV-LVDLGS---TANT-EADTKGPMFLKEPINRIDFSNSTGSVVECRA  57
             +R KW+  ++F AV L+  GS    AN  +AD KGP+FLKEP NRIDFSNSTG+ +EC+A
Sbjct  6     ERLKWL--MLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAEIECKA  63

Query  58    SGNPAPEIIWVRSDGTAVGDVPGLRQVLSNGNLVFPPFRAEDYRQEVHAQVYACLAKNQF  117
             SGNP PEIIW+RSDGTAVGDVPGLRQ+ S+G LVFPPFRAEDYRQEVHAQVYACLA+NQF
Sbjct  64    SGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQF  123

Query  118   GSIISRDVNVRAVVNQFYEAEIMTEYVIRGNTAILKCSIPSFMGDYVRVESWIDETNTVL  177
             GSIISRDV+VRAVVNQFY A+I+ EYVIRGN A+LKCSIPSF+ D+VRVESWIDE  T L
Sbjct  124   GSIISRDVHVRAVVNQFYGADILMEYVIRGNAAVLKCSIPSFVADFVRVESWIDEEGTEL  183

Query  178   ATSDNYDGKYLVLPSGELHIKEVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVG  237
               S+NYDGKYLVLPSGELHI+EVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVG
Sbjct  184   RPSENYDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVG  243

Query  238   SVAPKVGIDDEIKNARTAINNTISLACPAQSYPVPVFRWYKFIEGTTRKQAVVLNDRVKQ  297
             SVAPKV + D++     + N +++L C AQ +P+P FRWYKFIEGTTRKQAVVLNDRVKQ
Sbjct  244   SVAPKVDMHDKMDFTIRSSNRSLNLFCKAQGFPMPAFRWYKFIEGTTRKQAVVLNDRVKQ  303

Query  298   VSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPSQVVDFGRPAVF  357
             VSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPP+Q VDFGRPAVF
Sbjct  304   VSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFGRPAVF  363

Query  358   TCHFSGNPIKTVSWLKDGKKIGHTDAILRIESVKKEHKGMYQCFIRNDQESAEASAELKL  417
             TC ++GNPIKTVSW+KDGK IGH++ +LRIESVKKE KGMYQCF+RNDQESAEASAELKL
Sbjct  364   TCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEASAELKL  423

Query  418   GGRFDPPIIRQAFPEETLHPGPSVFLKCVAGGLPTPEISWELDGKKIANSERYQVGQYVT  477
             GGRFDPP+IRQAF EET+ PGPSVFLKCVAGG PTPEISWELDGKKIAN++RYQVGQYVT
Sbjct  424   GGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQVGQYVT  483

Query  478   VNGDVVSYLNITSIHANDGGLYKCIASSKVGVAEHSAKLNVYGLPYIRPMEKKAIVAGEN  537
             VNGDVVSYLNITS+HANDGGLYKCIA SKVGVAEHSAKLNVYGLPYIR MEKKAIVAGE 
Sbjct  484   VNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKAIVAGET  543

Query  538   LIVTCPVAGYPIESIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKNSE  597
             LIVTCPVAGYPI+SIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKN E
Sbjct  544   LIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKNQE  603

Query  598   GYSARGALEVQVMVPPKIAHFDFGDEPSNYGDTASVSCIVTSGDLPVDFKWLFNGKPISE  657
             GYSARG+LEVQVM PPKIA FDFG   S++ D+ SV+C+VTSGDLP+D +WLF G+PI+ 
Sbjct  604   GYSARGSLEVQVMAPPKIAPFDFGQSASSFEDSVSVNCLVTSGDLPIDIEWLFGGEPINF  663

Query  658   FAGISTAKMGKRNSVMNIDSVSGKHAGKYTCLASNTASIVNFTAVLIVNVPPRWILEPTD  717
               GI+  + GKR S++ IDSV   HAG YTC A N AS   ++A LIVNVPPRWILEPTD
Sbjct  664   ATGIAILRGGKRTSLLTIDSVHAGHAGNYTCKAKNQASSSEYSAALIVNVPPRWILEPTD  723

Query  718   KAFAQGSDAKVECKSDGFPKPQVTWKKAVGDTPGEYKDMKQSNNIRVDEGTLYIDNIQKN  777
             KAFAQGSDAKVECK+DGFPKPQVTWKKAVGDTPGEYKD+K+S+NIRV+EGTL++DNIQK 
Sbjct  724   KAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHVDNIQKT  783

Query  778   NEGYYLCEAINGIGSGLSAVILISVQAPPEFVEKLRNQTARRSEPAVLQCEAKGEKPIGI  837
             NEGYYLCEAINGIGSGLSAVI+ISVQAPPEF EKLRNQTARR EPAVLQCEAKGEKPIGI
Sbjct  784   NEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKGEKPIGI  843

Query  838   LWNMNNMRLDPKTDNRYTIREEILSTGVMSSLSIKRTERTDSALFTCVATNAFGSDDASI  897
             LWNMNNMRLDPK DNRYTIREEILSTGVMSSLSIKRTER+DSALFTCVATNAFGSDDASI
Sbjct  844   LWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAFGSDDASI  903

Query  898   NMIIQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLKRYIIEFKTSRGSWEHDVDRVI  957
             NMI+QEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPL RYIIEFK SR SW  ++DRVI
Sbjct  904   NMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWS-EIDRVI  962

Query  958   VPGHTNEAQVQKLNPATTYNIRIVAENEIGVSDSSEVVPIITAEEAPSGKPQSIKVEPLS  1017
             VPGHT EAQVQKL+PATTYNIRIVAEN IG S SSE V IITAEEAPSGKPQ+IKVEP++
Sbjct  963   VPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNIKVEPVN  1022

Query  1018  QTSLRVLWKAPPRSDWNGEILGYYVGYKLTNNNGSYYFEDYKYMMEEGKEYSYELTNLKT  1077
             QT++RV WK PPR++WNGEILGYYVGYKL+N N SY FE   ++ EEGKE++ EL NL+ 
Sbjct  1023  QTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLELQNLRV  1082

Query  1078  YTQYSVVIQAYNKVGAGPLSEDEKQYTAEGTPDQPPSDITCTTLTSQTIRVSWVSPPLES  1137
             YTQYSVVIQA+NK+GAGPLSE+EKQ+TAEGTP QPPSD  CTTLTSQTIRV WVSPPLES
Sbjct  1083  YTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWVSPPLES  1142

Query  1138  ANGVIKGYKVVYAPSELWYDDKNKDYKKTASSDTVLHGLKKYTNYTMQVLATTSGGDGVR  1197
             ANGVIK YKVVYAPS+ WYD+  + YKKTASSDTVLHGLKKYTNYTMQVLATT+GGDGVR
Sbjct  1143  ANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTAGGDGVR  1202

Query  1198  SPPIHCQTEQDVPEAPTAVKALVVGSEAILVSWLPPAQPNGLITQYTVYSKEEGTESEVK  1257
             S PIHCQTE DVPEAPT VKALV+G+ AILVSW PPAQPNG+ITQYTVYSK EG E+E K
Sbjct  1203  SVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEGAETETK  1262

Query  1258  SHKVPPYQMSYEASSLDKNKPFEFWVTANTNIGEGQASKSIVAMPSDKVPAKIASFDDTF  1317
             + KVP YQMS+EA+ L+KNKP+EFWVTA+T IGEGQ SKSIVAMPSD+VPAKIASFDDTF
Sbjct  1263  TQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIASFDDTF  1322

Query  1318  TAIFKEDFKLPCLAVGAPAPDITWKVKGVEFVPNDRVRQLPEGSLSIKDVIRQDAGDYTC  1377
             TA FKED K+PCLAVGAP P+ITWK+KGVEF  NDR+R LP+GSL IK V RQDAGDY+C
Sbjct  1323  TATFKEDAKMPCLAVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNRQDAGDYSC  1382

Query  1378  MAENSIAKDSITHKLIVLAPPQSPQVLLTATTTDSLTLKLKQHDGDTAPIHGYTLHYKPE  1437
              AENSIAKDSITHKLIVLAPPQSP V L+ATTTD+LT+KLK H+GDTAP+HGYTLHYKPE
Sbjct  1383  HAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGYTLHYKPE  1442

Query  1438  FGDWETVEVAVDAQKYTIENLFCGSRYQVYATGYNNIGAGEASDILNTRTKGSKPMMPEN  1497
             FG+WET EV+VD+QK+ IE L CGSRYQVYATG+NNIGAGEASDILNTRTKG KP +PE 
Sbjct  1443  FGEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKGQKPKLPEK  1502

Query  1498  SKFIDPSSNTVTLHLPTWKDGGCRMSHFVVEYKKKDHAEWTQISNNVKPGGNFVVLDLDA  1557
              +FI+ SSN+V+LH   WKDGGC MSHFVVE KK+D  EW QISNNVKP  N+VVLDL+ 
Sbjct  1503  PRFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKRDQIEWNQISNNVKPDNNYVVLDLEP  1562

Query  1558  ASWYSVRITAHNSAGFTVAEYEFATLTVTGGTLAPPLNTAVLNGKTY----LPPWMPQWF  1613
             A+WY++RITAHNSAGFTVAEY+FATLTVTGGT+A PL+    +G  +    LP WMP+W 
Sbjct  1563  ATWYNLRITAHNSAGFTVAEYDFATLTVTGGTIA-PLDDGSGHGNVHTRIRLPAWMPEWL  1621

Query  1614  DLNFMVPLIATIIVVFVGVLVICVALSRRRMEDPRGGPKDVYYDVVYNQPMGPGATMDKR  1673
             DLNFMVPLIAT++VV VG+ V+CVALSRRR +D RGG KDVYYDVVYNQ MGPGAT+DKR
Sbjct  1622  DLNFMVPLIATVVVVAVGICVVCVALSRRRADDMRGGQKDVYYDVVYNQTMGPGATLDKR  1681

Query  1674  RPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRGTVISRSMRSNHSTWDPRR--PLYEE  1731
             RPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG      +RSNHSTWDPRR   LYEE
Sbjct  1682  RPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG---RGGLRSNHSTWDPRRNPNLYEE  1738

Query  1732  LKPPPVPRR-----HYHGSDECYHTHPHPHPAGMEDEICPYATFHLLGFREEMDPTKAMN  1786
             LK PPVP       H HG+ EC++ HP     GMEDEICPYATFHLLGFREEMDPTKAMN
Sbjct  1739  LKAPPVPMHGNHYGHAHGNAECHYRHP-----GMEDEICPYATFHLLGFREEMDPTKAMN  1793

Query  1787  FQTFPHQNGHTG--PGHA-TMGPGGPPGHIHSRSGSQSMPRQNRYARKNSQGGQSSIYTP  1843
             FQTFPHQNGH G  PGHA TM P G PGH+HSRSGSQSMPR NRY RKNSQGGQSSIYTP
Sbjct  1794  FQTFPHQNGHAGPVPGHAGTMLPPGHPGHVHSRSGSQSMPRANRYQRKNSQGGQSSIYTP  1853

Query  1844  APEYDDPANCAEEDQYRRYTRVNSQGGSLYGGPGPEYDDPANCAPEDDQYGSQYGAPYG-  1902
             APEYDDPANCAEEDQYRRYTRVNSQGGSLY GPGPEYDDPANCAPE+DQYGSQYG PYG 
Sbjct  1854  APEYDDPANCAEEDQYRRYTRVNSQGGSLYSGPGPEYDDPANCAPEEDQYGSQYGGPYGQ  1913

Query  1903  -YDHYGSRGSVGRRSVGSARNLPNGSPEPPPPPPRNHDTSNSSFNDSKESNEISEAECDR  1961
              YDHYGSRGS+GRRS+GSARN  NGSPEPPPPPPRNHD SNSSFNDSKESNEISEAECDR
Sbjct  1914  PYDHYGSRGSMGRRSIGSARNPGNGSPEPPPPPPRNHDMSNSSFNDSKESNEISEAECDR  1973

Query  1962  DH-PRGNYGENENSGDAKRSANTKDVRTTEEMRKLIDSRKSNEVAAKLQQQGGPAGLTAY  2020
             DH PRGNYG        KRS   KD RTTEEMRKLI+  ++     +LQQ  G AG TAY
Sbjct  1974  DHGPRGNYGA------VKRSPQPKDQRTTEEMRKLIERNETGPKQLQLQQANG-AGFTAY  2026

Query  2021  DTLAV  2025
             DT+AV
Sbjct  2027  DTMAV  2031


>Q0E9J4_DROME unnamed protein product
Length=2031

 Score = 3341 bits (8664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1634/2045 (80%), Positives = 1803/2045 (88%), Gaps = 41/2045 (2%)

Query  3     QRTKWITKIIFIAV-LVDLGS---TANT-EADTKGPMFLKEPINRIDFSNSTGSVVECRA  57
             +R KW+  ++F AV L+  GS    AN  +AD KGP+FLKEP NRIDFSNSTG+ +EC+A
Sbjct  6     ERLKWL--MLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAEIECKA  63

Query  58    SGNPAPEIIWVRSDGTAVGDVPGLRQVLSNGNLVFPPFRAEDYRQEVHAQVYACLAKNQF  117
             SGNP PEIIW+RSDGTAVGDVPGLRQ+ S+G LVFPPFRAEDYRQEVHAQVYACLA+NQF
Sbjct  64    SGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQF  123

Query  118   GSIISRDVNVRAVVNQFYEAEIMTEYVIRGNTAILKCSIPSFMGDYVRVESWIDETNTVL  177
             GSIISRDV+VRAVVNQ+YEAE+++EYVIRGNTA+LKC+IPSF+ D++RVE+W+    T  
Sbjct  124   GSIISRDVHVRAVVNQYYEAEVVSEYVIRGNTAVLKCTIPSFVADFLRVEAWVASDGTEY  183

Query  178   ATSDNYDGKYLVLPSGELHIKEVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVG  237
             A  +++DGKYLVLPSGELHI+EVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVG
Sbjct  184   APEEDFDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVG  243

Query  238   SVAPKVGIDDEIKNARTAINNTISLACPAQSYPVPVFRWYKFIEGTTRKQAVVLNDRVKQ  297
             SV PK+ + + +++A     +T++L CPAQSYPVP FRWYKFIEGTTRKQAVVLNDRVKQ
Sbjct  244   SVGPKISVGERLRDAGAPSKSTLTLFCPAQSYPVPSFRWYKFIEGTTRKQAVVLNDRVKQ  303

Query  298   VSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPSQVVDFGRPAVF  357
             VSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPP+Q VDFGRPAVF
Sbjct  304   VSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFGRPAVF  363

Query  358   TCHFSGNPIKTVSWLKDGKKIGHTDAILRIESVKKEHKGMYQCFIRNDQESAEASAELKL  417
             TC ++GNPIKTVSW+KDGK IGH++ +LRIESVKKE KGMYQCF+RNDQESAEASAELKL
Sbjct  364   TCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEASAELKL  423

Query  418   GGRFDPPIIRQAFPEETLHPGPSVFLKCVAGGLPTPEISWELDGKKIANSERYQVGQYVT  477
             GGRFDPP+IRQAF EET+ PGPSVFLKCVAGG PTPEISWELDGKKIAN++RYQVGQYVT
Sbjct  424   GGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQVGQYVT  483

Query  478   VNGDVVSYLNITSIHANDGGLYKCIASSKVGVAEHSAKLNVYGLPYIRPMEKKAIVAGEN  537
             VNGDVVSYLNITS+HANDGGLYKCIA SKVGVAEHSAKLNVYGLPYIR MEKKAIVAGE 
Sbjct  484   VNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKAIVAGET  543

Query  538   LIVTCPVAGYPIESIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKNSE  597
             LIVTCPVAGYPI+SIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKN E
Sbjct  544   LIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKNQE  603

Query  598   GYSARGALEVQVMVPPKIAHFDFGDEPSNYGDTASVSCIVTSGDLPVDFKWLFNGKPISE  657
             GYSARG+LEVQVM PPKI  F FG+EP+N  D+ SV+C++++GDLP+D +W FN   IS 
Sbjct  604   GYSARGSLEVQVMAPPKITPFSFGEEPANVEDSVSVTCLISTGDLPIDIEWFFNEYGISS  663

Query  658   FAGISTAKMGKRNSVMNIDSVSGKHAGKYTCLASNTASIVNFTAVLIVNVPPRWILEPTD  717
             ++GIS  K GKRNSV++IDSV  +HAG Y+C A N A+ VN+T  LIVNVPPRWILEPTD
Sbjct  664   YSGISVMKGGKRNSVLSIDSVQARHAGNYSCRAKNHAAAVNYTTDLIVNVPPRWILEPTD  723

Query  718   KAFAQGSDAKVECKSDGFPKPQVTWKKAVGDTPGEYKDMKQSNNIRVDEGTLYIDNIQKN  777
             KAFAQGSDAKVECK+DGFPKPQVTWKKAVGDTPGEYKD+K+S+NIRV+EGTL++DNIQK 
Sbjct  724   KAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHVDNIQKT  783

Query  778   NEGYYLCEAINGIGSGLSAVILISVQAPPEFVEKLRNQTARRSEPAVLQCEAKGEKPIGI  837
             NEGYYLCEAINGIGSGLSAVI+ISVQAPPEF EKLRNQTARR EPAVLQCEAKGEKPIGI
Sbjct  784   NEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKGEKPIGI  843

Query  838   LWNMNNMRLDPKTDNRYTIREEILSTGVMSSLSIKRTERTDSALFTCVATNAFGSDDASI  897
             LWNMNNMRLDPK DNRYTIREEILSTGVMSSLSIKRTER+DSALFTCVATNAFGSDDASI
Sbjct  844   LWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAFGSDDASI  903

Query  898   NMIIQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLKRYIIEFKTSRGSWEHDVDRVI  957
             NMI+QEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPL RYIIEFK SR SW  ++DRVI
Sbjct  904   NMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWS-EIDRVI  962

Query  958   VPGHTNEAQVQKLNPATTYNIRIVAENEIGVSDSSEVVPIITAEEAPSGKPQSIKVEPLS  1017
             VPGHT EAQVQKL+PATTYNIRIVAEN IG S SSE V IITAEEAPSGKPQ+IKVEP++
Sbjct  963   VPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNIKVEPVN  1022

Query  1018  QTSLRVLWKAPPRSDWNGEILGYYVGYKLTNNNGSYYFEDYKYMMEEGKEYSYELTNLKT  1077
             QT++RV WK PPR++WNGEILGYYVGYKL+N N SY FE   ++ EEGKE++ EL NL+ 
Sbjct  1023  QTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLELQNLRV  1082

Query  1078  YTQYSVVIQAYNKVGAGPLSEDEKQYTAEGTPDQPPSDITCTTLTSQTIRVSWVSPPLES  1137
             YTQYSVVIQA+NK+GAGPLSE+EKQ+TAEGTP QPPSD  CTTLTSQTIRV WVSPPLES
Sbjct  1083  YTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWVSPPLES  1142

Query  1138  ANGVIKGYKVVYAPSELWYDDKNKDYKKTASSDTVLHGLKKYTNYTMQVLATTSGGDGVR  1197
             ANGVIK YKVVYAPS+ WYD+  + YKKTASSDTVLHGLKKYTNYTMQVLATT+GGDGVR
Sbjct  1143  ANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTAGGDGVR  1202

Query  1198  SPPIHCQTEQDVPEAPTAVKALVVGSEAILVSWLPPAQPNGLITQYTVYSKEEGTESEVK  1257
             S PIHCQTE DVPEAPT VKALV+G+ AILVSW PPAQPNG+ITQYTVYSK EG E+E K
Sbjct  1203  SVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEGAETETK  1262

Query  1258  SHKVPPYQMSYEASSLDKNKPFEFWVTANTNIGEGQASKSIVAMPSDKVPAKIASFDDTF  1317
             + KVP YQMS+EA+ L+KNKP+EFWVTA+T IGEGQ SKSIVAMPSD+VPAKIASFDDTF
Sbjct  1263  TQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIASFDDTF  1322

Query  1318  TAIFKEDFKLPCLAVGAPAPDITWKVKGVEFVPNDRVRQLPEGSLSIKDVIRQDAGDYTC  1377
             TA FKED K+PCLAVGAP P+ITWK+KGVEF  NDR+R LP+GSL IK V RQDAGDY+C
Sbjct  1323  TATFKEDAKMPCLAVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNRQDAGDYSC  1382

Query  1378  MAENSIAKDSITHKLIVLAPPQSPQVLLTATTTDSLTLKLKQHDGDTAPIHGYTLHYKPE  1437
              AENSIAKDSITHKLIVLAPPQSP V L+ATTTD+LT+KLK H+GDTAP+HGYTLHYKPE
Sbjct  1383  HAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGYTLHYKPE  1442

Query  1438  FGDWETVEVAVDAQKYTIENLFCGSRYQVYATGYNNIGAGEASDILNTRTKGSKPMMPEN  1497
             FG+WET EV+VD+QK+ IE L CGSRYQVYATG+NNIGAGEASDILNTRTKG KP +PE 
Sbjct  1443  FGEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKGQKPKLPEK  1502

Query  1498  SKFIDPSSNTVTLHLPTWKDGGCRMSHFVVEYKKKDHAEWTQISNNVKPGGNFVVLDLDA  1557
              +FI+ SSN+V+LH   WKDGGC MSHFVVE KK+D  EW QISNNVKP  N+VVLDL+ 
Sbjct  1503  PRFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKRDQIEWNQISNNVKPDNNYVVLDLEP  1562

Query  1558  ASWYSVRITAHNSAGFTVAEYEFATLTVTGGTLAPPLNTAVLNGKTY----LPPWMPQWF  1613
             A+WY++RITAHNSAGFTVAEY+FATLTVTGGT+A PL+    +G  +    LP WMP+W 
Sbjct  1563  ATWYNLRITAHNSAGFTVAEYDFATLTVTGGTIA-PLDDGSGHGNVHTRIRLPAWMPEWL  1621

Query  1614  DLNFMVPLIATIIVVFVGVLVICVALSRRRMEDPRGGPKDVYYDVVYNQPMGPGATMDKR  1673
             DLNFMVPLIAT++VV VG+ V+CVALSRRR +D RGG KDVYYDVVYNQ MGPGAT+DKR
Sbjct  1622  DLNFMVPLIATVVVVAVGICVVCVALSRRRADDMRGGQKDVYYDVVYNQTMGPGATLDKR  1681

Query  1674  RPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRGTVISRSMRSNHSTWDPRR--PLYEE  1731
             RPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG      +RSNHSTWDPRR   LYEE
Sbjct  1682  RPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG---RGGLRSNHSTWDPRRNPNLYEE  1738

Query  1732  LKPPPVPRR-----HYHGSDECYHTHPHPHPAGMEDEICPYATFHLLGFREEMDPTKAMN  1786
             LK PPVP       H HG+ EC++ HP     GMEDEICPYATFHLLGFREEMDPTKAMN
Sbjct  1739  LKAPPVPMHGNHYGHAHGNAECHYRHP-----GMEDEICPYATFHLLGFREEMDPTKAMN  1793

Query  1787  FQTFPHQNGHTG--PGHA-TMGPGGPPGHIHSRSGSQSMPRQNRYARKNSQGGQSSIYTP  1843
             FQTFPHQNGH G  PGHA TM P G PGH+HSRSGSQSMPR NRY RKNSQGGQSSIYTP
Sbjct  1794  FQTFPHQNGHAGPVPGHAGTMLPPGHPGHVHSRSGSQSMPRANRYQRKNSQGGQSSIYTP  1853

Query  1844  APEYDDPANCAEEDQYRRYTRVNSQGGSLYGGPGPEYDDPANCAPEDDQYGSQYGAPYG-  1902
             APEYDDPANCAEEDQYRRYTRVNSQGGSLY GPGPEYDDPANCAPE+DQYGSQYG PYG 
Sbjct  1854  APEYDDPANCAEEDQYRRYTRVNSQGGSLYSGPGPEYDDPANCAPEEDQYGSQYGGPYGQ  1913

Query  1903  -YDHYGSRGSVGRRSVGSARNLPNGSPEPPPPPPRNHDTSNSSFNDSKESNEISEAECDR  1961
              YDHYGSRGS+GRRS+GSARN  NGSPEPPPPPPRNHD SNSSFNDSKESNEISEAECDR
Sbjct  1914  PYDHYGSRGSMGRRSIGSARNPGNGSPEPPPPPPRNHDMSNSSFNDSKESNEISEAECDR  1973

Query  1962  DH-PRGNYGENENSGDAKRSANTKDVRTTEEMRKLIDSRKSNEVAAKLQQQGGPAGLTAY  2020
             DH PRGNYG        KRS   KD RTTEEMRKLI+  ++     +LQQ  G AG TAY
Sbjct  1974  DHGPRGNYGA------VKRSPQPKDQRTTEEMRKLIERNETGPKQLQLQQANG-AGFTAY  2026

Query  2021  DTLAV  2025
             DT+AV
Sbjct  2027  DTMAV  2031


>Q0E9J9_DROME unnamed protein product
Length=2032

 Score = 3339 bits (8658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1640/2046 (80%), Positives = 1799/2046 (88%), Gaps = 42/2046 (2%)

Query  3     QRTKWITKIIFIAV-LVDLGS---TANT-EADTKGPMFLKEPINRIDFSNSTGSVVECRA  57
             +R KW+  ++F AV L+  GS    AN  +AD KGP+FLKEP NRIDFSNSTG+ +EC+A
Sbjct  6     ERLKWL--MLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAEIECKA  63

Query  58    SGNPAPEIIWVRSDGTAVGDVPGLRQVLSNGNLVFPPFRAEDYRQEVHAQVYACLAKNQF  117
             SGNP PEIIW+RSDGTAVGDVPGLRQ+ S+G LVFPPFRAEDYRQEVHAQVYACLA+NQF
Sbjct  64    SGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQF  123

Query  118   GSIISRDVNVRAVVNQFYEAEIMTEYVIRGNTAILKCSIPSFMGDYVRVESWIDETNTVL  177
             GSIISRDV+VRAVVNQFY A+I+ EYVIRGN A+LKCSIPSF+ D+VRVESWIDE  T L
Sbjct  124   GSIISRDVHVRAVVNQFYGADILMEYVIRGNAAVLKCSIPSFVADFVRVESWIDEEGTEL  183

Query  178   ATSDNYDGKYLVLPSGELHIKEVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVG  237
               S+NYDGKYLVLPSGELHI+EVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVG
Sbjct  184   RPSENYDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVG  243

Query  238   SVAPKVGIDDEIKNARTAINNTISLACPAQSYPVPVFRWYKFIEGTTRKQAVVLNDRVKQ  297
             + AP   ++ ++   + +     +L C AQ++PVP+ RWYKFIEGTTRKQAVVLNDRVKQ
Sbjct  244   AKAPTFSLEYKLIEVQKSKGTAFALLCQAQAFPVPIIRWYKFIEGTTRKQAVVLNDRVKQ  303

Query  298   VSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPSQVVDFGRPAVF  357
             VSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPP+Q VDFGRPAVF
Sbjct  304   VSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFGRPAVF  363

Query  358   TCHFSGNPIKTVSWLKDGKKIGHTDAILRIESVKKEHKGMYQCFIRNDQESAEASAELKL  417
             TC ++GNPIKTVSW+KDGK IGH++ +LRIESVKKE KGMYQCF+RNDQESAEASAELKL
Sbjct  364   TCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEASAELKL  423

Query  418   GGRFDPPIIRQAFPEETLHPGPSVFLKCVAGGLPTPEISWELDGKKIANSERYQVGQYVT  477
             GGRFDPP+IRQAF EET+ PGPSVFLKCVAGG PTPEISWELDGKKIAN++RYQVGQYVT
Sbjct  424   GGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQVGQYVT  483

Query  478   VNGDVVSYLNITSIHANDGGLYKCIASSKVGVAEHSAKLNVYGLPYIRPMEKKAIVAGEN  537
             VNGDVVSYLNITS+HANDGGLYKCIA SKVGVAEHSAKLNVYGLPYIR MEKKAIVAGE 
Sbjct  484   VNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKAIVAGET  543

Query  538   LIVTCPVAGYPIESIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKNSE  597
             LIVTCPVAGYPI+SIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKN E
Sbjct  544   LIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKNQE  603

Query  598   GYSARGALEVQVMVPPKIAHFDFGDEPSNYGDTASVSCIVTSGDLPVDFKWLFNGKPISE  657
             GYSARG+LEVQVMV PKIA FDFGDEPSN+G++ASV C+VTSGD PV F WLFNG+ I+E
Sbjct  604   GYSARGSLEVQVMVAPKIAPFDFGDEPSNFGESASVQCLVTSGDFPVSFAWLFNGREINE  663

Query  658   -FAGISTAKMGKRNSVMNIDSVSGKHAGKYTCLASNTASIVNFTAVLIVNVPPRWILEPT  716
                 +S  K+GK+ S ++ID V   HAG YTC+A N A+ VNFTA L+VNVPPRWILEPT
Sbjct  664   NVYDVSMVKLGKKISALSIDIVRDHHAGNYTCVAVNRATSVNFTAELVVNVPPRWILEPT  723

Query  717   DKAFAQGSDAKVECKSDGFPKPQVTWKKAVGDTPGEYKDMKQSNNIRVDEGTLYIDNIQK  776
             DKAFAQGSDAKVECK+DGFPKPQVTWKKAVGDTPGEYKD+K+S+NIRV+EGTL++DNIQK
Sbjct  724   DKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHVDNIQK  783

Query  777   NNEGYYLCEAINGIGSGLSAVILISVQAPPEFVEKLRNQTARRSEPAVLQCEAKGEKPIG  836
              NEGYYLCEAINGIGSGLSAVI+ISVQAPPEF EKLRNQTARR EPAVLQCEAKGEKPIG
Sbjct  784   TNEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKGEKPIG  843

Query  837   ILWNMNNMRLDPKTDNRYTIREEILSTGVMSSLSIKRTERTDSALFTCVATNAFGSDDAS  896
             ILWNMNNMRLDPK DNRYTIREEILSTGVMSSLSIKRTER+DSALFTCVATNAFGSDDAS
Sbjct  844   ILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAFGSDDAS  903

Query  897   INMIIQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLKRYIIEFKTSRGSWEHDVDRV  956
             INMI+QEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPL RYIIEFK SR SW  ++DRV
Sbjct  904   INMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWS-EIDRV  962

Query  957   IVPGHTNEAQVQKLNPATTYNIRIVAENEIGVSDSSEVVPIITAEEAPSGKPQSIKVEPL  1016
             IVPGHT EAQVQKL+PATTYNIRIVAEN IG S SSE V IITAEEAPSGKPQ+IKVEP+
Sbjct  963   IVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNIKVEPV  1022

Query  1017  SQTSLRVLWKAPPRSDWNGEILGYYVGYKLTNNNGSYYFEDYKYMMEEGKEYSYELTNLK  1076
             +QT++RV WK PPR++WNGEILGYYVGYKL+N N SY FE   ++ EEGKE++ EL NL+
Sbjct  1023  NQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLELQNLR  1082

Query  1077  TYTQYSVVIQAYNKVGAGPLSEDEKQYTAEGTPDQPPSDITCTTLTSQTIRVSWVSPPLE  1136
              YTQYSVVIQA+NK+GAGPLSE+EKQ+TAEGTP QPPSD  CTTLTSQTIRV WVSPPLE
Sbjct  1083  VYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWVSPPLE  1142

Query  1137  SANGVIKGYKVVYAPSELWYDDKNKDYKKTASSDTVLHGLKKYTNYTMQVLATTSGGDGV  1196
             SANGVIK YKVVYAPS+ WYD+  + YKKTASSDTVLHGLKKYTNYTMQVLATT+GGDGV
Sbjct  1143  SANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTAGGDGV  1202

Query  1197  RSPPIHCQTEQDVPEAPTAVKALVVGSEAILVSWLPPAQPNGLITQYTVYSKEEGTESEV  1256
             RS PIHCQTE DVPEAPT VKALV+G+ AILVSW PPAQPNG+ITQYTVYSK EG E+E 
Sbjct  1203  RSVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEGAETET  1262

Query  1257  KSHKVPPYQMSYEASSLDKNKPFEFWVTANTNIGEGQASKSIVAMPSDKVPAKIASFDDT  1316
             K+ KVP YQMS+EA+ L+KNKP+EFWVTA+T IGEGQ SKSIVAMPSD+VPAKIASFDDT
Sbjct  1263  KTQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIASFDDT  1322

Query  1317  FTAIFKEDFKLPCLAVGAPAPDITWKVKGVEFVPNDRVRQLPEGSLSIKDVIRQDAGDYT  1376
             FTA FKED K+PCLAVGAP P+ITWK+KGVEF  NDR+R LP+GSL IK V RQDAGDY+
Sbjct  1323  FTATFKEDAKMPCLAVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNRQDAGDYS  1382

Query  1377  CMAENSIAKDSITHKLIVLAPPQSPQVLLTATTTDSLTLKLKQHDGDTAPIHGYTLHYKP  1436
             C AENSIAKDSITHKLIVLAPPQSP V L+ATTTD+LT+KLK H+GDTAP+HGYTLHYKP
Sbjct  1383  CHAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGYTLHYKP  1442

Query  1437  EFGDWETVEVAVDAQKYTIENLFCGSRYQVYATGYNNIGAGEASDILNTRTKGSKPMMPE  1496
             EFG+WET EV+VD+QK+ IE L CGSRYQVYATG+NNIGAGEASDILNTRTKG KP +PE
Sbjct  1443  EFGEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKGQKPKLPE  1502

Query  1497  NSKFIDPSSNTVTLHLPTWKDGGCRMSHFVVEYKKKDHAEWTQISNNVKPGGNFVVLDLD  1556
               +FI+ SSN+V+LH   WKDGGC MSHFVVE KK+D  EW QISNNVKP  N+VVLDL+
Sbjct  1503  KPRFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKRDQIEWNQISNNVKPDNNYVVLDLE  1562

Query  1557  AASWYSVRITAHNSAGFTVAEYEFATLTVTGGTLAPPLNTAVLNGKTY----LPPWMPQW  1612
              A+WY++RITAHNSAGFTVAEY+FATLTVTGGT+A PL+    +G  +    LP WMP+W
Sbjct  1563  PATWYNLRITAHNSAGFTVAEYDFATLTVTGGTIA-PLDDGSGHGNVHTRIRLPAWMPEW  1621

Query  1613  FDLNFMVPLIATIIVVFVGVLVICVALSRRRMEDPRGGPKDVYYDVVYNQPMGPGATMDK  1672
              DLNFMVPLIAT++VV VG+ V+CVALSRRR +D RGG KDVYYDVVYNQ MGPGAT+DK
Sbjct  1622  LDLNFMVPLIATVVVVAVGICVVCVALSRRRADDMRGGQKDVYYDVVYNQTMGPGATLDK  1681

Query  1673  RRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRGTVISRSMRSNHSTWDPRR--PLYE  1730
             RRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG      +RSNHSTWDPRR   LYE
Sbjct  1682  RRPDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRG---RGGLRSNHSTWDPRRNPNLYE  1738

Query  1731  ELKPPPVPRR-----HYHGSDECYHTHPHPHPAGMEDEICPYATFHLLGFREEMDPTKAM  1785
             ELK PPVP       H HG+ EC++ HP     GMEDEICPYATFHLLGFREEMDPTKAM
Sbjct  1739  ELKAPPVPMHGNHYGHAHGNAECHYRHP-----GMEDEICPYATFHLLGFREEMDPTKAM  1793

Query  1786  NFQTFPHQNGHTG--PGHA-TMGPGGPPGHIHSRSGSQSMPRQNRYARKNSQGGQSSIYT  1842
             NFQTFPHQNGH G  PGHA TM P G PGH+HSRSGSQSMPR NRY RKNSQGGQSSIYT
Sbjct  1794  NFQTFPHQNGHAGPVPGHAGTMLPPGHPGHVHSRSGSQSMPRANRYQRKNSQGGQSSIYT  1853

Query  1843  PAPEYDDPANCAEEDQYRRYTRVNSQGGSLYGGPGPEYDDPANCAPEDDQYGSQYGAPYG  1902
             PAPEYDDPANCAEEDQYRRYTRVNSQGGSLY GPGPEYDDPANCAPE+DQYGSQYG PYG
Sbjct  1854  PAPEYDDPANCAEEDQYRRYTRVNSQGGSLYSGPGPEYDDPANCAPEEDQYGSQYGGPYG  1913

Query  1903  --YDHYGSRGSVGRRSVGSARNLPNGSPEPPPPPPRNHDTSNSSFNDSKESNEISEAECD  1960
               YDHYGSRGS+GRRS+GSARN  NGSPEPPPPPPRNHD SNSSFNDSKESNEISEAECD
Sbjct  1914  QPYDHYGSRGSMGRRSIGSARNPGNGSPEPPPPPPRNHDMSNSSFNDSKESNEISEAECD  1973

Query  1961  RDH-PRGNYGENENSGDAKRSANTKDVRTTEEMRKLIDSRKSNEVAAKLQQQGGPAGLTA  2019
             RDH PRGNYG        KRS   KD RTTEEMRKLI+  ++     +LQQ  G AG TA
Sbjct  1974  RDHGPRGNYGA------VKRSPQPKDQRTTEEMRKLIERNETGPKQLQLQQANG-AGFTA  2026

Query  2020  YDTLAV  2025
             YDT+AV
Sbjct  2027  YDTMAV  2032



Lambda      K        H
   0.314    0.126    0.359 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6469106478


Query= XP_037024213.1 Down syndrome cell adhesion molecule-like protein
Dscam2 isoform X17 [Bradysia coprophila]

Length=2025
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q0E9H5_DROME  unnamed protein product                                 3333    0.0  
Q0E9L2_DROME  unnamed protein product                                 3320    0.0  
Q0E9I6_DROME  unnamed protein product                                 3313    0.0  


>Q0E9H5_DROME unnamed protein product
Length=2031

 Score = 3333 bits (8643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1631/2045 (80%), Positives = 1802/2045 (88%), Gaps = 41/2045 (2%)

Query  3     QRTKWITKIIFIAV-LVDLGS---TANT-EADTKGPMFLKEPINRIDFSNSTGSVVECRA  57
             +R KW+  ++F AV L+  GS    AN  +AD KGP+FLKEP NRIDFSNSTG+ +EC+A
Sbjct  6     ERLKWL--MLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAEIECKA  63

Query  58    SGNPAPEIIWVRSDGTAVGDVPGLRQVLSNGNLVFPPFRAEDYRQEVHAQVYACLAKNQF  117
             SGNP PEIIW+RSDGTAVGDVPGLRQ+ S+G LVFPPFRAEDYRQEVHAQVYACLA+NQF
Sbjct  64    SGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQF  123

Query  118   GSIISRDVNVRAVVAQHYDTDVNKAYVIRGNAGILKCEIPSYIIDFVHVVSWHTDKEESF  177
             GSIISRDV+VRAVVAQ+Y+ DVNK +VIRGN+ ++KC IPS++ DFV VVSWHTD+EE++
Sbjct  124   GSIISRDVHVRAVVAQYYEADVNKEHVIRGNSAVIKCLIPSFVADFVEVVSWHTDEEENY  183

Query  178   FPGTEYDGKYLVLPSGELHIKEVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVG  237
             FPG EYDGKYLVLPSGELHI+EVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEP+ 
Sbjct  184   FPGAEYDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPIA  243

Query  238   SVSPKFNAADELNIVRSKMTQDICLLCPAQSYPTPISRWYKFIEGTTRKQAVVLNDRVKQ  297
             SV P+  + +++ +++   +Q   LLCPAQSYP P+ RWYKFIEGTTRKQAVVLNDRVKQ
Sbjct  244   SVGPRLLSGNDIKVLQFSASQASTLLCPAQSYPVPVFRWYKFIEGTTRKQAVVLNDRVKQ  303

Query  298   VSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPSQVVDFGRPAVF  357
             VSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPP+Q VDFGRPAVF
Sbjct  304   VSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFGRPAVF  363

Query  358   TCHFSGNPIKTVSWLKDGKKIGHTDAILRIESVKKEHKGMYQCFIRNDQESAEASAELKL  417
             TC ++GNPIKTVSW+KDGK IGH++ +LRIESVKKE KGMYQCF+RNDQESAEASAELKL
Sbjct  364   TCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEASAELKL  423

Query  418   GGRFDPPIIRQAFPEETLHPGPSVFLKCVAGGLPTPEISWELDGKKIANSERYQVGQYVT  477
             GGRFDPP+IRQAF EET+ PGPSVFLKCVAGG PTPEISWELDGKKIAN++RYQVGQYVT
Sbjct  424   GGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQVGQYVT  483

Query  478   VNGDVVSYLNITSIHANDGGLYKCIASSKVGVAEHSAKLNVYGLPYIRP